data_2WFZ
# 
_entry.id   2WFZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WFZ         
WWPDB D_1290039457 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 2VQ6 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH 2-PAM' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 2J3Q unspecified 'TORPEDO ACETYLCHOLINESTERASE COMPLEXED WITH FLUOROPHORE THIOFLAVIN T' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 2J4F unspecified 'TORPEDO ACETYLCHOLINESTERASE - HG HEAVY-ATOM DERIVATIVE' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJC unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 150K
;
PDB 2VJB unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET D AT 100K
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 2VJD unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET C AT 150K
;
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 2VT6 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 9400000 GY' 
PDB 2W9I unspecified 'ACHE IN COMPLEX WITH METHYLENE BLUE' 
PDB 2VT7 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 800000 GY' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2W6C unspecified 'ACHE IN COMPLEX WITH A BIS-(-)-NOR- MEPTAZINOL DERIVATIVE' 
PDB 2VJA unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 100K
;
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 2V96 unspecified 
'STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AT 100K' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2VA9 unspecified 
;STRUCTURE OF NATIVE TCACHE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE DURING THE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 2V98 unspecified 
;STRUCTURE OF THE COMPLEX OF TCACHE WITH 1 -(2-NITROPHENYL)-2,2,2-TRIFLUOROETHYL- ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE, DURING HTE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN-II' 
PDB 2V97 unspecified 
;STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE
;
PDB 2WG2 unspecified 'NON-AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN (ALTERNATIVE REFINEMENT)' 
PDB 2WG1 unspecified 'TERNARY COMPLEX OF THE AGED CONJUGATE OF TORPEDO CALIFORNICA ACEYLCHOLINESTERASE WITH SOMAN AND 2-PAM' 
PDB 2WG0 unspecified 'AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN (OBTAINED BY IN CRYSTALLO AGING)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WFZ 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-15 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sanson, B.'       1  
'Nachon, F.'       2  
'Colletier, J.P.'  3  
'Froment, M.T.'    4  
'Toker, L.'        5  
'Greenblatt, H.M.' 6  
'Sussman, J.L.'    7  
'Ashani, Y.'       8  
'Masson, P.'       9  
'Silman, I.'       10 
'Weik, M.'         11 
# 
_citation.id                        primary 
_citation.title                     
;Crystallographic Snapshots of Nonaged and Aged Conjugates of Soman with Acetylcholinesterase, and of a Ternary Complex of the Aged Conjugate with Pralidoxime.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            52 
_citation.page_first                7593 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19642642 
_citation.pdbx_database_id_DOI      10.1021/JM900433T 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sanson, B.'       1  ? 
primary 'Nachon, F.'       2  ? 
primary 'Colletier, J.P.'  3  ? 
primary 'Froment, M.T.'    4  ? 
primary 'Toker, L.'        5  ? 
primary 'Greenblatt, H.M.' 6  ? 
primary 'Sussman, J.L.'    7  ? 
primary 'Ashani, Y.'       8  ? 
primary 'Masson, P.'       9  ? 
primary 'Silman, I.'       10 ? 
primary 'Weik, M.'         11 ? 
# 
_cell.entry_id           2WFZ 
_cell.length_a           111.410 
_cell.length_b           111.410 
_cell.length_c           137.380 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WFZ 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                                                      60736.516 1   3.1.1.7 
? 'RESIDUES 22-558' ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ?       
? ?                 ? 
3 branched    man 'alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose'                     367.349   1   ?       
? ?                 ? 
4 non-polymer syn '(1R)-1,2,2-TRIMETHYLPROPYL (S)-METHYLPHOSPHINATE'                                        164.182   1   ?       
? ?                 ? 
5 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL                                                  122.143   2   ?       
? ?                 ? 
6 non-polymer syn 'TETRAETHYLENE GLYCOL'                                                                    194.226   5   ?       
? ?                 ? 
7 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                   106.120   1   ?       
? ?                 ? 
8 non-polymer syn 'CHLORIDE ION'                                                                            35.453    1   ?       
? ?                 ? 
9 water       nat water                                                                                     18.015    660 ?       
? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2WFZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                    ? 'C4 H7 N O4'     133.103 
CL  non-polymer                   . 'CHLORIDE ION'                                     ? 'Cl -1'          35.453  
CYS 'L-peptide linking'           y CYSTEINE                                           ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                               
'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5'      164.156 
GD8 non-polymer                   . '(1R)-1,2,2-TRIMETHYLPROPYL (S)-METHYLPHOSPHINATE' ? 'C7 H17 O2 P'    164.182 
GLN 'L-peptide linking'           y GLUTAMINE                                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                              ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                         ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose           
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PEG non-polymer                   . 'DI(HYDROXYETHYL)ETHER'                            ? 'C4 H10 O3'      106.120 
PG4 non-polymer                   . 'TETRAETHYLENE GLYCOL'                             ? 'C8 H18 O5'      194.226 
PHE 'L-peptide linking'           y PHENYLALANINE                                      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                         ? 'C11 H12 N2 O2'  204.225 
TRS non-polymer                   . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL           'TRIS BUFFER' 'C4 H12 N O3 1'  122.143 
TYR 'L-peptide linking'           y TYROSINE                                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2WFZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;ACHE WAS CRYSTALLIZED IN 34% PEG200, 150 MM MES, PH 6, 4 DEG. C. THE CRYSTAL WAS SOAKED FOR 6 MIN IN 1.3 MM SOMAN AT PH 8, 4 DEG C., THEN FLASH-COOLED IN LN2.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2006-11-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.93927 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.93927 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WFZ 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.20 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   71726 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.60 
_reflns.B_iso_Wilson_estimate        28.4 
_reflns.pdbx_redundancy              7.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   98.8 
_reflns_shell.Rmerge_I_obs           0.60 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.10 
_reflns_shell.pdbx_redundancy        7.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WFZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     68190 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.79 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    99.31 
_refine.ls_R_factor_obs                          0.16761 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16619 
_refine.ls_R_factor_R_free                       0.19563 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  3535 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.B_iso_mean                               31.369 
_refine.aniso_B[1][1]                            2.06 
_refine.aniso_B[2][2]                            2.06 
_refine.aniso_B[3][3]                            -3.09 
_refine.aniso_B[1][2]                            1.03 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. THE MODEL WAS ALSO ALTERNATIVELY REFINED USING LOOSER RESTRAINTS ON THE GEOMETRY OF BOTH THE LENGTH OF THE CALPHA-O2 BOND AND THE GEOMETRY OF THE CALPHA OF THE SOMAN ADDUCT (PDB ENTRY 2WG2). THIS IS DESCRIBED IN THE SUPPLMENTARY INFORMATION OF THE PUBLICATION.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1EA5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.110 
_refine.pdbx_overall_ESU_R_Free                  0.107 
_refine.overall_SU_ML                            0.074 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.665 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4244 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         151 
_refine_hist.number_atoms_solvent             660 
_refine_hist.number_atoms_total               5055 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        45.79 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 4695 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.266  1.979  ? 6389 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.946  5.000  ? 583  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.943 24.167 ? 228  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.427 15.000 ? 761  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.402 15.000 ? 27   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.090  0.200  ? 672  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 3606 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.632  1.500  ? 2736 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.183  2.000  ? 4453 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.804  3.000  ? 1959 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.935  4.500  ? 1909 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.950 
_refine_ls_shell.d_res_low                        2.001 
_refine_ls_shell.number_reflns_R_work             4893 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.percent_reflns_obs               98.79 
_refine_ls_shell.R_factor_R_free                  0.276 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             266 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2WFZ 
_struct.title                     'NON-AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WFZ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SOMAN, AGING, SYNAPSE, MEMBRANE, HYDROLASE, CELL MEMBRANE, DISULFIDE BOND, SERINE ESTERASE, NEUROTRANSMITTER CLEAVAGE, CONFORMATIONAL FLEXIBILITY, NEUROTRANSMITTER DEGRADATION, ALPHA/BETA HYDROLASE, ALTERNATIVE SPLICING, ORGANOPHOSPHATE, SYNAPSE MEMBRANE, ALZHEIMER DISEASE, GPI-ANCHOR, LIPOPROTEIN, GLYCOPROTEIN, CELL JUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 7 ? 
M N N 8 ? 
N N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  AA4 GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  AA5 VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  AA6 ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  AA7 GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  AA8 SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  AA9 SER A 212 ? ASP A 217 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P10 AB1 SER A 237 ? LEU A 252 ? SER A 237 LEU A 252 1 ? 16 
HELX_P HELX_P11 AB2 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 AB3 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 AB4 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 AB5 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 AB7 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 AB9 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 AC2 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P23 AC5 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 AC7 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.072 ? ?               
disulf2 disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf3 disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.052 ? ?               
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  C NAG 1   1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale2 covale none ? A SER 200 OG  ? ? ? 1_555 D GD8 .   P  ? ? A SER 200 A GD8 605 1_555 ? ? ? ? ? ? ? 1.632 ? ?               
covale3 covale one  ? A ASN 416 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 416 B NAG 1   1_555 ? ? ? ? ? ? ? 1.436 ? N-Glycosylation 
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
covale5 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 2   1_555 ? ? ? ? ? ? ? 1.332 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.46 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA1 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AA2 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AA2 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AA2 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AA2 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AA2 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AA2 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AA2 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AA2 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AA2 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AA2 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AA2 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
AA1 2  3  N LYS A 14  ? N LYS A 14  O TRP A 58  ? O TRP A 58  
AA2 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AA2 2  3  N SER A 28  ? N SER A 28  O VAL A 101 ? O VAL A 101 
AA2 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AA2 4  5  O VAL A 144 ? O VAL A 144 N MET A 112 ? N MET A 112 
AA2 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
AA2 6  7  N GLY A 198 ? N GLY A 198 O GLN A 225 ? O GLN A 225 
AA2 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AA2 8  9  N VAL A 323 ? N VAL A 323 O PHE A 423 ? O PHE A 423 
AA2 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AA2 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
# 
_database_PDB_matrix.entry_id          2WFZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WFZ 
_atom_sites.fract_transf_matrix[1][1]   0.008976 
_atom_sites.fract_transf_matrix[1][2]   0.005182 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010364 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007279 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? -13.186 87.659 34.598 1.00 43.85 ? 4    SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? -12.789 87.786 36.029 1.00 43.20 ? 4    SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? -11.659 86.810 36.402 1.00 42.03 ? 4    SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? -11.767 85.591 36.192 1.00 41.74 ? 4    SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? -13.999 87.565 36.929 1.00 43.69 ? 4    SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? -13.621 87.599 38.298 1.00 46.23 ? 4    SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? -10.591 87.371 36.962 1.00 40.34 ? 5    GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? -9.449  86.623 37.460 1.00 39.25 ? 5    GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? -9.809  85.616 38.562 1.00 37.95 ? 5    GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? -9.136  84.599 38.712 1.00 37.45 ? 5    GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? -8.401  87.598 37.986 1.00 40.00 ? 5    GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? -7.007  87.038 38.023 1.00 42.23 ? 5    GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? -5.984  88.041 38.506 1.00 45.39 ? 5    GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? -6.334  89.224 38.710 1.00 47.81 ? 5    GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? -4.821  87.647 38.671 1.00 45.71 ? 5    GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? -10.871 85.900 39.313 1.00 35.87 ? 6    LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? -11.281 85.049 40.427 1.00 34.48 ? 6    LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? -12.267 83.964 40.027 1.00 33.90 ? 6    LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? -12.617 83.129 40.854 1.00 33.55 ? 6    LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? -11.835 85.891 41.600 1.00 33.60 ? 6    LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? -10.836 86.880 42.229 1.00 33.43 ? 6    LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? -11.506 87.739 43.315 1.00 33.79 ? 6    LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? -9.603  86.161 42.800 1.00 33.35 ? 6    LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? -12.709 83.970 38.767 1.00 33.42 ? 7    LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? -13.613 82.936 38.265 1.00 32.91 ? 7    LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? -12.859 81.965 37.361 1.00 32.43 ? 7    LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? -12.211 82.372 36.390 1.00 32.07 ? 7    LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? -14.828 83.545 37.540 1.00 33.43 ? 7    LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? -15.841 82.552 36.947 1.00 35.59 ? 7    LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? -16.564 81.745 38.034 1.00 37.01 ? 7    LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? -16.865 83.280 36.049 1.00 39.33 ? 7    LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? -12.921 80.679 37.708 1.00 31.86 ? 8    VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? -12.259 79.634 36.928 1.00 31.03 ? 8    VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? -13.272 78.548 36.650 1.00 30.83 ? 8    VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? -13.958 78.098 37.560 1.00 30.79 ? 8    VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? -11.025 79.029 37.660 1.00 31.06 ? 8    VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? -10.482 77.787 36.916 1.00 30.39 ? 8    VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? -9.928  80.060 37.790 1.00 30.77 ? 8    VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? -13.378 78.148 35.384 1.00 31.06 ? 9    ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9   ? -14.148 76.964 35.030 1.00 31.74 ? 9    ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9   ? -13.275 75.718 34.995 1.00 30.74 ? 9    ASN A C   1 
ATOM   42   O  O   . ASN A 1 9   ? -12.221 75.705 34.354 1.00 30.66 ? 9    ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9   ? -14.877 77.134 33.688 1.00 32.76 ? 9    ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9   ? -16.016 76.118 33.515 1.00 37.02 ? 9    ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9   ? -16.550 75.566 34.503 1.00 40.25 ? 9    ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9   ? -16.395 75.863 32.263 1.00 40.44 ? 9    ASN A ND2 1 
ATOM   47   N  N   . THR A 1 10  ? -13.731 74.671 35.680 1.00 29.88 ? 10   THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? -13.004 73.413 35.762 1.00 29.20 ? 10   THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? -13.892 72.326 35.198 1.00 29.38 ? 10   THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? -15.084 72.550 34.973 1.00 29.40 ? 10   THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? -12.640 73.036 37.250 1.00 28.60 ? 10   THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? -13.788 72.502 37.914 1.00 28.01 ? 10   THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? -12.141 74.248 38.046 1.00 28.28 ? 10   THR A CG2 1 
ATOM   54   N  N   . LYS A 1 11  ? -13.331 71.127 35.022 1.00 29.34 ? 11   LYS A N   1 
ATOM   55   C  CA  . LYS A 1 11  ? -14.114 69.963 34.639 1.00 29.13 ? 11   LYS A CA  1 
ATOM   56   C  C   . LYS A 1 11  ? -15.161 69.573 35.682 1.00 30.12 ? 11   LYS A C   1 
ATOM   57   O  O   . LYS A 1 11  ? -16.063 68.781 35.386 1.00 30.22 ? 11   LYS A O   1 
ATOM   58   C  CB  . LYS A 1 11  ? -13.188 68.777 34.356 1.00 29.30 ? 11   LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 11  ? -12.266 69.028 33.158 1.00 27.41 ? 11   LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 11  ? -11.065 68.113 33.162 1.00 26.89 ? 11   LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 11  ? -10.189 68.329 31.918 1.00 26.72 ? 11   LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 11  ? -8.976  67.478 31.967 1.00 26.42 ? 11   LYS A NZ  1 
ATOM   63   N  N   . SER A 1 12  ? -15.043 70.096 36.905 1.00 29.97 ? 12   SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? -16.009 69.746 37.953 1.00 31.06 ? 12   SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? -17.092 70.825 38.115 1.00 30.84 ? 12   SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? -18.063 70.640 38.850 1.00 30.71 ? 12   SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? -15.308 69.522 39.304 1.00 31.09 ? 12   SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? -14.409 68.437 39.244 1.00 33.54 ? 12   SER A OG  1 
ATOM   69   N  N   . GLY A 1 13  ? -16.898 71.954 37.439 1.00 31.15 ? 13   GLY A N   1 
ATOM   70   C  CA  . GLY A 1 13  ? -17.773 73.112 37.602 1.00 30.71 ? 13   GLY A CA  1 
ATOM   71   C  C   . GLY A 1 13  ? -16.988 74.380 37.849 1.00 30.79 ? 13   GLY A C   1 
ATOM   72   O  O   . GLY A 1 13  ? -15.751 74.371 37.931 1.00 30.02 ? 13   GLY A O   1 
ATOM   73   N  N   . LYS A 1 14  ? -17.712 75.486 37.954 1.00 30.77 ? 14   LYS A N   1 
ATOM   74   C  CA  . LYS A 1 14  ? -17.083 76.792 38.122 1.00 31.26 ? 14   LYS A CA  1 
ATOM   75   C  C   . LYS A 1 14  ? -16.738 77.015 39.591 1.00 30.68 ? 14   LYS A C   1 
ATOM   76   O  O   . LYS A 1 14  ? -17.479 76.581 40.471 1.00 30.36 ? 14   LYS A O   1 
ATOM   77   C  CB  . LYS A 1 14  ? -18.022 77.908 37.631 1.00 31.95 ? 14   LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 14  ? -18.611 77.677 36.231 1.00 35.14 ? 14   LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 14  ? -19.374 78.913 35.731 1.00 39.78 ? 14   LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 14  ? -19.810 78.731 34.275 1.00 43.99 ? 14   LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 14  ? -20.296 80.011 33.683 1.00 47.60 ? 14   LYS A NZ  1 
ATOM   82   N  N   . VAL A 1 15  ? -15.620 77.695 39.839 1.00 30.87 ? 15   VAL A N   1 
ATOM   83   C  CA  . VAL A 1 15  ? -15.235 78.104 41.194 1.00 31.16 ? 15   VAL A CA  1 
ATOM   84   C  C   . VAL A 1 15  ? -14.905 79.593 41.233 1.00 31.33 ? 15   VAL A C   1 
ATOM   85   O  O   . VAL A 1 15  ? -14.286 80.112 40.306 1.00 31.61 ? 15   VAL A O   1 
ATOM   86   C  CB  . VAL A 1 15  ? -13.991 77.303 41.740 1.00 31.09 ? 15   VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 15  ? -14.250 75.784 41.699 1.00 30.86 ? 15   VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 15  ? -12.744 77.634 40.962 1.00 31.37 ? 15   VAL A CG2 1 
ATOM   89   N  N   . MET A 1 16  ? -15.313 80.261 42.311 1.00 31.28 ? 16   MET A N   1 
ATOM   90   C  CA  A MET A 1 16  ? -14.971 81.664 42.537 0.50 31.35 ? 16   MET A CA  1 
ATOM   91   C  CA  B MET A 1 16  ? -14.945 81.655 42.524 0.50 31.71 ? 16   MET A CA  1 
ATOM   92   C  C   . MET A 1 16  ? -14.027 81.794 43.726 1.00 31.34 ? 16   MET A C   1 
ATOM   93   O  O   . MET A 1 16  ? -14.376 81.389 44.846 1.00 31.50 ? 16   MET A O   1 
ATOM   94   C  CB  A MET A 1 16  ? -16.241 82.490 42.782 0.50 31.06 ? 16   MET A CB  1 
ATOM   95   C  CB  B MET A 1 16  ? -16.187 82.532 42.699 0.50 31.78 ? 16   MET A CB  1 
ATOM   96   C  CG  A MET A 1 16  ? -15.994 83.979 42.954 0.50 31.27 ? 16   MET A CG  1 
ATOM   97   C  CG  B MET A 1 16  ? -15.863 83.989 42.946 0.50 33.53 ? 16   MET A CG  1 
ATOM   98   S  SD  A MET A 1 16  ? -15.524 84.790 41.422 0.50 32.50 ? 16   MET A SD  1 
ATOM   99   S  SD  B MET A 1 16  ? -17.325 85.013 42.816 0.50 39.26 ? 16   MET A SD  1 
ATOM   100  C  CE  A MET A 1 16  ? -17.062 84.730 40.507 0.50 32.33 ? 16   MET A CE  1 
ATOM   101  C  CE  B MET A 1 16  ? -17.325 85.354 41.054 0.50 37.85 ? 16   MET A CE  1 
ATOM   102  N  N   . GLY A 1 17  ? -12.856 82.366 43.481 1.00 31.30 ? 17   GLY A N   1 
ATOM   103  C  CA  . GLY A 1 17  ? -11.873 82.552 44.518 1.00 32.05 ? 17   GLY A CA  1 
ATOM   104  C  C   . GLY A 1 17  ? -11.947 83.918 45.158 1.00 32.91 ? 17   GLY A C   1 
ATOM   105  O  O   . GLY A 1 17  ? -12.964 84.594 45.090 1.00 32.66 ? 17   GLY A O   1 
ATOM   106  N  N   . THR A 1 18  ? -10.848 84.321 45.772 1.00 33.56 ? 18   THR A N   1 
ATOM   107  C  CA  . THR A 1 18  ? -10.804 85.547 46.543 1.00 34.75 ? 18   THR A CA  1 
ATOM   108  C  C   . THR A 1 18  ? -9.441  86.191 46.369 1.00 35.16 ? 18   THR A C   1 
ATOM   109  O  O   . THR A 1 18  ? -8.442  85.492 46.215 1.00 35.21 ? 18   THR A O   1 
ATOM   110  C  CB  . THR A 1 18  ? -11.169 85.270 48.043 1.00 35.26 ? 18   THR A CB  1 
ATOM   111  O  OG1 . THR A 1 18  ? -11.341 86.505 48.739 1.00 36.28 ? 18   THR A OG1 1 
ATOM   112  C  CG2 . THR A 1 18  ? -10.102 84.426 48.749 1.00 35.15 ? 18   THR A CG2 1 
ATOM   113  N  N   . ARG A 1 19  ? -9.400  87.520 46.349 1.00 35.72 ? 19   ARG A N   1 
ATOM   114  C  CA  . ARG A 1 19  ? -8.136  88.241 46.246 1.00 36.74 ? 19   ARG A CA  1 
ATOM   115  C  C   . ARG A 1 19  ? -7.574  88.380 47.655 1.00 36.75 ? 19   ARG A C   1 
ATOM   116  O  O   . ARG A 1 19  ? -8.252  88.883 48.546 1.00 37.33 ? 19   ARG A O   1 
ATOM   117  C  CB  . ARG A 1 19  ? -8.351  89.619 45.606 1.00 37.11 ? 19   ARG A CB  1 
ATOM   118  C  CG  . ARG A 1 19  ? -7.070  90.361 45.224 1.00 40.43 ? 19   ARG A CG  1 
ATOM   119  C  CD  . ARG A 1 19  ? -7.327  91.332 44.051 1.00 45.46 ? 19   ARG A CD  1 
ATOM   120  N  NE  . ARG A 1 19  ? -6.123  92.077 43.646 1.00 49.69 ? 19   ARG A NE  1 
ATOM   121  C  CZ  . ARG A 1 19  ? -5.224  91.657 42.747 1.00 52.49 ? 19   ARG A CZ  1 
ATOM   122  N  NH1 . ARG A 1 19  ? -5.366  90.478 42.141 1.00 53.45 ? 19   ARG A NH1 1 
ATOM   123  N  NH2 . ARG A 1 19  ? -4.163  92.412 42.462 1.00 52.20 ? 19   ARG A NH2 1 
ATOM   124  N  N   . VAL A 1 20  ? -6.351  87.907 47.865 1.00 36.68 ? 20   VAL A N   1 
ATOM   125  C  CA  . VAL A 1 20  ? -5.748  87.970 49.190 1.00 36.36 ? 20   VAL A CA  1 
ATOM   126  C  C   . VAL A 1 20  ? -4.500  88.838 49.173 1.00 35.64 ? 20   VAL A C   1 
ATOM   127  O  O   . VAL A 1 20  ? -3.697  88.745 48.251 1.00 35.55 ? 20   VAL A O   1 
ATOM   128  C  CB  . VAL A 1 20  ? -5.467  86.553 49.810 1.00 36.40 ? 20   VAL A CB  1 
ATOM   129  C  CG1 . VAL A 1 20  ? -6.756  85.772 49.925 1.00 36.64 ? 20   VAL A CG1 1 
ATOM   130  C  CG2 . VAL A 1 20  ? -4.462  85.778 49.000 1.00 37.28 ? 20   VAL A CG2 1 
ATOM   131  N  N   . PRO A 1 21  ? -4.359  89.719 50.182 1.00 35.55 ? 21   PRO A N   1 
ATOM   132  C  CA  . PRO A 1 21  ? -3.162  90.542 50.272 1.00 35.45 ? 21   PRO A CA  1 
ATOM   133  C  C   . PRO A 1 21  ? -1.970  89.679 50.642 1.00 35.15 ? 21   PRO A C   1 
ATOM   134  O  O   . PRO A 1 21  ? -2.116  88.701 51.386 1.00 35.15 ? 21   PRO A O   1 
ATOM   135  C  CB  . PRO A 1 21  ? -3.489  91.533 51.396 1.00 35.20 ? 21   PRO A CB  1 
ATOM   136  C  CG  . PRO A 1 21  ? -4.519  90.838 52.232 1.00 36.46 ? 21   PRO A CG  1 
ATOM   137  C  CD  . PRO A 1 21  ? -5.318  90.003 51.267 1.00 35.88 ? 21   PRO A CD  1 
ATOM   138  N  N   . VAL A 1 22  ? -0.817  90.029 50.094 1.00 34.75 ? 22   VAL A N   1 
ATOM   139  C  CA  . VAL A 1 22  ? 0.428   89.356 50.388 1.00 34.69 ? 22   VAL A CA  1 
ATOM   140  C  C   . VAL A 1 22  ? 1.608   90.299 50.146 1.00 35.45 ? 22   VAL A C   1 
ATOM   141  O  O   . VAL A 1 22  ? 1.853   90.724 49.011 1.00 34.93 ? 22   VAL A O   1 
ATOM   142  C  CB  . VAL A 1 22  ? 0.602   88.023 49.555 1.00 34.45 ? 22   VAL A CB  1 
ATOM   143  C  CG1 . VAL A 1 22  ? 0.482   88.278 48.057 1.00 32.87 ? 22   VAL A CG1 1 
ATOM   144  C  CG2 . VAL A 1 22  ? 1.925   87.354 49.885 1.00 32.20 ? 22   VAL A CG2 1 
ATOM   145  N  N   . LEU A 1 23  ? 2.334   90.620 51.219 1.00 36.76 ? 23   LEU A N   1 
ATOM   146  C  CA  . LEU A 1 23  ? 3.583   91.404 51.135 1.00 37.56 ? 23   LEU A CA  1 
ATOM   147  C  C   . LEU A 1 23  ? 3.499   92.691 50.281 1.00 38.35 ? 23   LEU A C   1 
ATOM   148  O  O   . LEU A 1 23  ? 4.347   92.933 49.393 1.00 38.56 ? 23   LEU A O   1 
ATOM   149  C  CB  . LEU A 1 23  ? 4.723   90.514 50.632 1.00 37.62 ? 23   LEU A CB  1 
ATOM   150  C  CG  . LEU A 1 23  ? 5.046   89.286 51.487 1.00 38.35 ? 23   LEU A CG  1 
ATOM   151  C  CD1 . LEU A 1 23  ? 6.010   88.386 50.728 1.00 37.09 ? 23   LEU A CD1 1 
ATOM   152  C  CD2 . LEU A 1 23  ? 5.632   89.722 52.851 1.00 38.92 ? 23   LEU A CD2 1 
ATOM   153  N  N   . SER A 1 24  ? 2.482   93.503 50.559 1.00 38.72 ? 24   SER A N   1 
ATOM   154  C  CA  . SER A 1 24  ? 2.238   94.764 49.831 1.00 39.86 ? 24   SER A CA  1 
ATOM   155  C  C   . SER A 1 24  ? 1.667   94.580 48.416 1.00 39.76 ? 24   SER A C   1 
ATOM   156  O  O   . SER A 1 24  ? 1.532   95.556 47.665 1.00 39.83 ? 24   SER A O   1 
ATOM   157  C  CB  . SER A 1 24  ? 3.494   95.644 49.792 1.00 40.22 ? 24   SER A CB  1 
ATOM   158  O  OG  . SER A 1 24  ? 3.829   96.074 51.104 1.00 42.41 ? 24   SER A OG  1 
ATOM   159  N  N   . SER A 1 25  ? 1.326   93.337 48.069 1.00 39.00 ? 25   SER A N   1 
ATOM   160  C  CA  . SER A 1 25  ? 0.684   93.022 46.802 1.00 38.01 ? 25   SER A CA  1 
ATOM   161  C  C   . SER A 1 25  ? -0.530  92.117 47.058 1.00 37.80 ? 25   SER A C   1 
ATOM   162  O  O   . SER A 1 25  ? -1.064  92.093 48.173 1.00 37.27 ? 25   SER A O   1 
ATOM   163  C  CB  . SER A 1 25  ? 1.699   92.395 45.843 1.00 38.27 ? 25   SER A CB  1 
ATOM   164  O  OG  . SER A 1 25  ? 1.176   92.293 44.529 1.00 38.16 ? 25   SER A OG  1 
ATOM   165  N  N   . HIS A 1 26  ? -1.001  91.421 46.023 1.00 37.35 ? 26   HIS A N   1 
ATOM   166  C  CA  . HIS A 1 26  ? -2.177  90.560 46.133 1.00 36.88 ? 26   HIS A CA  1 
ATOM   167  C  C   . HIS A 1 26  ? -2.015  89.363 45.198 1.00 36.15 ? 26   HIS A C   1 
ATOM   168  O  O   . HIS A 1 26  ? -1.265  89.436 44.220 1.00 36.24 ? 26   HIS A O   1 
ATOM   169  C  CB  . HIS A 1 26  ? -3.462  91.306 45.749 1.00 37.47 ? 26   HIS A CB  1 
ATOM   170  C  CG  . HIS A 1 26  ? -3.846  92.414 46.686 1.00 40.77 ? 26   HIS A CG  1 
ATOM   171  N  ND1 . HIS A 1 26  ? -3.312  93.684 46.597 1.00 42.81 ? 26   HIS A ND1 1 
ATOM   172  C  CD2 . HIS A 1 26  ? -4.737  92.453 47.708 1.00 42.46 ? 26   HIS A CD2 1 
ATOM   173  C  CE1 . HIS A 1 26  ? -3.844  94.452 47.534 1.00 43.98 ? 26   HIS A CE1 1 
ATOM   174  N  NE2 . HIS A 1 26  ? -4.710  93.730 48.222 1.00 44.17 ? 26   HIS A NE2 1 
ATOM   175  N  N   . ILE A 1 27  ? -2.714  88.268 45.506 1.00 34.57 ? 27   ILE A N   1 
ATOM   176  C  CA  . ILE A 1 27  ? -2.817  87.123 44.605 1.00 33.60 ? 27   ILE A CA  1 
ATOM   177  C  C   . ILE A 1 27  ? -4.201  86.518 44.741 1.00 32.12 ? 27   ILE A C   1 
ATOM   178  O  O   . ILE A 1 27  ? -4.998  86.973 45.569 1.00 32.19 ? 27   ILE A O   1 
ATOM   179  C  CB  . ILE A 1 27  ? -1.734  86.017 44.842 1.00 33.99 ? 27   ILE A CB  1 
ATOM   180  C  CG1 . ILE A 1 27  ? -1.854  85.379 46.224 1.00 34.91 ? 27   ILE A CG1 1 
ATOM   181  C  CG2 . ILE A 1 27  ? -0.329  86.550 44.596 1.00 35.73 ? 27   ILE A CG2 1 
ATOM   182  C  CD1 . ILE A 1 27  ? -0.905  84.173 46.378 1.00 38.29 ? 27   ILE A CD1 1 
ATOM   183  N  N   . SER A 1 28  ? -4.492  85.509 43.926 1.00 30.06 ? 28   SER A N   1 
ATOM   184  C  CA  . SER A 1 28  ? -5.785  84.859 43.988 1.00 29.56 ? 28   SER A CA  1 
ATOM   185  C  C   . SER A 1 28  ? -5.661  83.587 44.820 1.00 28.94 ? 28   SER A C   1 
ATOM   186  O  O   . SER A 1 28  ? -4.648  82.879 44.748 1.00 28.44 ? 28   SER A O   1 
ATOM   187  C  CB  . SER A 1 28  ? -6.324  84.531 42.585 1.00 29.37 ? 28   SER A CB  1 
ATOM   188  O  OG  . SER A 1 28  ? -6.211  85.642 41.683 1.00 30.55 ? 28   SER A OG  1 
ATOM   189  N  N   . ALA A 1 29  ? -6.700  83.305 45.596 1.00 28.25 ? 29   ALA A N   1 
ATOM   190  C  CA  . ALA A 1 29  ? -6.770  82.093 46.399 1.00 27.88 ? 29   ALA A CA  1 
ATOM   191  C  C   . ALA A 1 29  ? -8.088  81.430 46.109 1.00 27.63 ? 29   ALA A C   1 
ATOM   192  O  O   . ALA A 1 29  ? -9.127  82.091 46.068 1.00 27.86 ? 29   ALA A O   1 
ATOM   193  C  CB  . ALA A 1 29  ? -6.670  82.424 47.898 1.00 27.67 ? 29   ALA A CB  1 
ATOM   194  N  N   . PHE A 1 30  ? -8.041  80.124 45.874 1.00 27.15 ? 30   PHE A N   1 
ATOM   195  C  CA  . PHE A 1 30  ? -9.241  79.328 45.717 1.00 26.52 ? 30   PHE A CA  1 
ATOM   196  C  C   . PHE A 1 30  ? -9.184  78.300 46.839 1.00 26.61 ? 30   PHE A C   1 
ATOM   197  O  O   . PHE A 1 30  ? -8.394  77.347 46.781 1.00 26.68 ? 30   PHE A O   1 
ATOM   198  C  CB  . PHE A 1 30  ? -9.277  78.677 44.326 1.00 26.80 ? 30   PHE A CB  1 
ATOM   199  C  CG  . PHE A 1 30  ? -9.209  79.675 43.189 1.00 26.46 ? 30   PHE A CG  1 
ATOM   200  C  CD1 . PHE A 1 30  ? -7.981  80.181 42.770 1.00 24.36 ? 30   PHE A CD1 1 
ATOM   201  C  CD2 . PHE A 1 30  ? -10.378 80.128 42.569 1.00 25.84 ? 30   PHE A CD2 1 
ATOM   202  C  CE1 . PHE A 1 30  ? -7.899  81.121 41.727 1.00 25.36 ? 30   PHE A CE1 1 
ATOM   203  C  CE2 . PHE A 1 30  ? -10.323 81.065 41.528 1.00 24.90 ? 30   PHE A CE2 1 
ATOM   204  C  CZ  . PHE A 1 30  ? -9.077  81.576 41.107 1.00 24.92 ? 30   PHE A CZ  1 
ATOM   205  N  N   . LEU A 1 31  ? -10.024 78.504 47.853 1.00 26.15 ? 31   LEU A N   1 
ATOM   206  C  CA  . LEU A 1 31  ? -9.941  77.758 49.107 1.00 26.10 ? 31   LEU A CA  1 
ATOM   207  C  C   . LEU A 1 31  ? -11.110 76.832 49.235 1.00 25.87 ? 31   LEU A C   1 
ATOM   208  O  O   . LEU A 1 31  ? -12.224 77.193 48.872 1.00 26.49 ? 31   LEU A O   1 
ATOM   209  C  CB  . LEU A 1 31  ? -9.901  78.733 50.303 1.00 26.05 ? 31   LEU A CB  1 
ATOM   210  C  CG  . LEU A 1 31  ? -8.841  79.830 50.226 1.00 26.52 ? 31   LEU A CG  1 
ATOM   211  C  CD1 . LEU A 1 31  ? -8.962  80.793 51.431 1.00 27.02 ? 31   LEU A CD1 1 
ATOM   212  C  CD2 . LEU A 1 31  ? -7.416  79.232 50.101 1.00 24.82 ? 31   LEU A CD2 1 
ATOM   213  N  N   . GLY A 1 32  ? -10.871 75.623 49.742 1.00 25.00 ? 32   GLY A N   1 
ATOM   214  C  CA  . GLY A 1 32  ? -11.965 74.684 49.970 1.00 24.51 ? 32   GLY A CA  1 
ATOM   215  C  C   . GLY A 1 32  ? -12.690 74.143 48.738 1.00 24.45 ? 32   GLY A C   1 
ATOM   216  O  O   . GLY A 1 32  ? -13.909 73.981 48.763 1.00 24.23 ? 32   GLY A O   1 
ATOM   217  N  N   . ILE A 1 33  ? -11.945 73.832 47.676 1.00 24.88 ? 33   ILE A N   1 
ATOM   218  C  CA  . ILE A 1 33  ? -12.513 73.147 46.498 1.00 24.47 ? 33   ILE A CA  1 
ATOM   219  C  C   . ILE A 1 33  ? -12.631 71.646 46.777 1.00 24.45 ? 33   ILE A C   1 
ATOM   220  O  O   . ILE A 1 33  ? -11.649 71.014 47.141 1.00 25.09 ? 33   ILE A O   1 
ATOM   221  C  CB  . ILE A 1 33  ? -11.629 73.348 45.242 1.00 24.23 ? 33   ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1 33  ? -11.464 74.835 44.928 1.00 23.82 ? 33   ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1 33  ? -12.220 72.594 44.024 1.00 23.62 ? 33   ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1 33  ? -10.363 75.133 43.928 1.00 25.15 ? 33   ILE A CD1 1 
ATOM   225  N  N   . PRO A 1 34  ? -13.824 71.064 46.573 1.00 24.85 ? 34   PRO A N   1 
ATOM   226  C  CA  . PRO A 1 34  ? -14.019 69.636 46.847 1.00 25.03 ? 34   PRO A CA  1 
ATOM   227  C  C   . PRO A 1 34  ? -13.387 68.767 45.753 1.00 25.27 ? 34   PRO A C   1 
ATOM   228  O  O   . PRO A 1 34  ? -13.472 69.106 44.568 1.00 25.09 ? 34   PRO A O   1 
ATOM   229  C  CB  . PRO A 1 34  ? -15.547 69.487 46.833 1.00 25.47 ? 34   PRO A CB  1 
ATOM   230  C  CG  . PRO A 1 34  ? -16.021 70.596 45.905 1.00 25.33 ? 34   PRO A CG  1 
ATOM   231  C  CD  . PRO A 1 34  ? -15.068 71.735 46.125 1.00 24.78 ? 34   PRO A CD  1 
ATOM   232  N  N   . PHE A 1 35  ? -12.733 67.671 46.136 1.00 24.79 ? 35   PHE A N   1 
ATOM   233  C  CA  . PHE A 1 35  ? -12.133 66.794 45.125 1.00 24.85 ? 35   PHE A CA  1 
ATOM   234  C  C   . PHE A 1 35  ? -12.671 65.379 45.212 1.00 25.21 ? 35   PHE A C   1 
ATOM   235  O  O   . PHE A 1 35  ? -12.402 64.562 44.341 1.00 25.37 ? 35   PHE A O   1 
ATOM   236  C  CB  . PHE A 1 35  ? -10.588 66.848 45.144 1.00 24.86 ? 35   PHE A CB  1 
ATOM   237  C  CG  . PHE A 1 35  ? -9.967  66.340 46.437 1.00 24.46 ? 35   PHE A CG  1 
ATOM   238  C  CD1 . PHE A 1 35  ? -9.830  64.980 46.670 1.00 23.40 ? 35   PHE A CD1 1 
ATOM   239  C  CD2 . PHE A 1 35  ? -9.522  67.232 47.411 1.00 22.97 ? 35   PHE A CD2 1 
ATOM   240  C  CE1 . PHE A 1 35  ? -9.252  64.501 47.879 1.00 23.36 ? 35   PHE A CE1 1 
ATOM   241  C  CE2 . PHE A 1 35  ? -8.944  66.771 48.617 1.00 22.86 ? 35   PHE A CE2 1 
ATOM   242  C  CZ  . PHE A 1 35  ? -8.823  65.403 48.849 1.00 21.68 ? 35   PHE A CZ  1 
ATOM   243  N  N   . ALA A 1 36  ? -13.440 65.094 46.259 1.00 25.36 ? 36   ALA A N   1 
ATOM   244  C  CA  . ALA A 1 36  ? -14.074 63.795 46.428 1.00 25.46 ? 36   ALA A CA  1 
ATOM   245  C  C   . ALA A 1 36  ? -15.447 64.025 46.995 1.00 25.96 ? 36   ALA A C   1 
ATOM   246  O  O   . ALA A 1 36  ? -15.726 65.105 47.532 1.00 27.15 ? 36   ALA A O   1 
ATOM   247  C  CB  . ALA A 1 36  ? -13.259 62.879 47.376 1.00 24.99 ? 36   ALA A CB  1 
ATOM   248  N  N   . GLU A 1 37  ? -16.300 63.013 46.888 1.00 26.07 ? 37   GLU A N   1 
ATOM   249  C  CA  . GLU A 1 37  ? -17.548 62.983 47.624 1.00 27.02 ? 37   GLU A CA  1 
ATOM   250  C  C   . GLU A 1 37  ? -17.240 62.890 49.130 1.00 27.16 ? 37   GLU A C   1 
ATOM   251  O  O   . GLU A 1 37  ? -16.273 62.231 49.508 1.00 26.63 ? 37   GLU A O   1 
ATOM   252  C  CB  . GLU A 1 37  ? -18.370 61.765 47.188 1.00 26.80 ? 37   GLU A CB  1 
ATOM   253  C  CG  . GLU A 1 37  ? -18.976 61.927 45.786 1.00 29.80 ? 37   GLU A CG  1 
ATOM   254  C  CD  . GLU A 1 37  ? -20.001 63.042 45.736 1.00 31.68 ? 37   GLU A CD  1 
ATOM   255  O  OE1 . GLU A 1 37  ? -21.017 62.943 46.452 1.00 36.93 ? 37   GLU A OE1 1 
ATOM   256  O  OE2 . GLU A 1 37  ? -19.792 64.022 45.004 1.00 32.31 ? 37   GLU A OE2 1 
ATOM   257  N  N   . PRO A 1 38  ? -18.058 63.550 49.981 1.00 27.23 ? 38   PRO A N   1 
ATOM   258  C  CA  . PRO A 1 38  ? -17.938 63.418 51.445 1.00 26.96 ? 38   PRO A CA  1 
ATOM   259  C  C   . PRO A 1 38  ? -17.908 61.958 51.895 1.00 26.80 ? 38   PRO A C   1 
ATOM   260  O  O   . PRO A 1 38  ? -18.862 61.222 51.652 1.00 26.82 ? 38   PRO A O   1 
ATOM   261  C  CB  . PRO A 1 38  ? -19.204 64.119 51.959 1.00 26.88 ? 38   PRO A CB  1 
ATOM   262  C  CG  . PRO A 1 38  ? -19.450 65.189 50.915 1.00 27.27 ? 38   PRO A CG  1 
ATOM   263  C  CD  . PRO A 1 38  ? -19.150 64.480 49.611 1.00 26.83 ? 38   PRO A CD  1 
ATOM   264  N  N   . PRO A 1 39  ? -16.805 61.527 52.539 1.00 26.86 ? 39   PRO A N   1 
ATOM   265  C  CA  . PRO A 1 39  ? -16.675 60.121 52.917 1.00 27.19 ? 39   PRO A CA  1 
ATOM   266  C  C   . PRO A 1 39  ? -17.398 59.821 54.242 1.00 28.17 ? 39   PRO A C   1 
ATOM   267  O  O   . PRO A 1 39  ? -16.791 59.363 55.221 1.00 28.63 ? 39   PRO A O   1 
ATOM   268  C  CB  . PRO A 1 39  ? -15.163 59.937 53.031 1.00 26.65 ? 39   PRO A CB  1 
ATOM   269  C  CG  . PRO A 1 39  ? -14.668 61.276 53.454 1.00 26.62 ? 39   PRO A CG  1 
ATOM   270  C  CD  . PRO A 1 39  ? -15.586 62.297 52.845 1.00 26.06 ? 39   PRO A CD  1 
ATOM   271  N  N   . VAL A 1 40  ? -18.702 60.059 54.237 1.00 28.45 ? 40   VAL A N   1 
ATOM   272  C  CA  . VAL A 1 40  ? -19.518 60.005 55.435 1.00 28.91 ? 40   VAL A CA  1 
ATOM   273  C  C   . VAL A 1 40  ? -20.517 58.849 55.400 1.00 29.79 ? 40   VAL A C   1 
ATOM   274  O  O   . VAL A 1 40  ? -20.847 58.327 54.327 1.00 30.21 ? 40   VAL A O   1 
ATOM   275  C  CB  . VAL A 1 40  ? -20.239 61.354 55.666 1.00 28.77 ? 40   VAL A CB  1 
ATOM   276  C  CG1 . VAL A 1 40  ? -19.222 62.483 55.698 1.00 27.05 ? 40   VAL A CG1 1 
ATOM   277  C  CG2 . VAL A 1 40  ? -21.296 61.622 54.584 1.00 29.72 ? 40   VAL A CG2 1 
ATOM   278  N  N   . GLY A 1 41  ? -20.975 58.440 56.579 1.00 30.03 ? 41   GLY A N   1 
ATOM   279  C  CA  . GLY A 1 41  ? -21.974 57.384 56.706 1.00 29.98 ? 41   GLY A CA  1 
ATOM   280  C  C   . GLY A 1 41  ? -21.397 56.046 56.326 1.00 30.41 ? 41   GLY A C   1 
ATOM   281  O  O   . GLY A 1 41  ? -20.381 55.611 56.895 1.00 30.30 ? 41   GLY A O   1 
ATOM   282  N  N   . ASN A 1 42  ? -22.023 55.382 55.356 1.00 30.43 ? 42   ASN A N   1 
ATOM   283  C  CA  A ASN A 1 42  ? -21.537 54.096 54.866 0.60 30.82 ? 42   ASN A CA  1 
ATOM   284  C  CA  B ASN A 1 42  ? -21.517 54.089 54.903 0.40 30.32 ? 42   ASN A CA  1 
ATOM   285  C  C   . ASN A 1 42  ? -20.259 54.209 54.037 1.00 30.04 ? 42   ASN A C   1 
ATOM   286  O  O   . ASN A 1 42  ? -19.648 53.205 53.693 1.00 30.51 ? 42   ASN A O   1 
ATOM   287  C  CB  A ASN A 1 42  ? -22.625 53.385 54.064 0.60 31.72 ? 42   ASN A CB  1 
ATOM   288  C  CB  B ASN A 1 42  ? -22.609 53.242 54.230 0.40 30.66 ? 42   ASN A CB  1 
ATOM   289  C  CG  A ASN A 1 42  ? -23.649 52.703 54.947 0.60 34.25 ? 42   ASN A CG  1 
ATOM   290  C  CG  B ASN A 1 42  ? -23.228 53.917 53.019 0.40 31.34 ? 42   ASN A CG  1 
ATOM   291  O  OD1 A ASN A 1 42  ? -24.001 53.200 56.020 0.60 38.08 ? 42   ASN A OD1 1 
ATOM   292  O  OD1 B ASN A 1 42  ? -22.789 54.982 52.589 0.40 31.55 ? 42   ASN A OD1 1 
ATOM   293  N  ND2 A ASN A 1 42  ? -24.145 51.557 54.492 0.60 37.17 ? 42   ASN A ND2 1 
ATOM   294  N  ND2 B ASN A 1 42  ? -24.261 53.291 52.461 0.40 32.07 ? 42   ASN A ND2 1 
ATOM   295  N  N   . MET A 1 43  ? -19.870 55.440 53.721 1.00 29.00 ? 43   MET A N   1 
ATOM   296  C  CA  A MET A 1 43  ? -18.625 55.682 53.012 0.60 28.90 ? 43   MET A CA  1 
ATOM   297  C  CA  B MET A 1 43  ? -18.626 55.703 53.008 0.40 28.85 ? 43   MET A CA  1 
ATOM   298  C  C   . MET A 1 43  ? -17.427 55.812 53.966 1.00 28.24 ? 43   MET A C   1 
ATOM   299  O  O   . MET A 1 43  ? -16.274 55.866 53.523 1.00 28.37 ? 43   MET A O   1 
ATOM   300  C  CB  A MET A 1 43  ? -18.741 56.910 52.110 0.60 29.21 ? 43   MET A CB  1 
ATOM   301  C  CB  B MET A 1 43  ? -18.745 56.969 52.151 0.40 29.12 ? 43   MET A CB  1 
ATOM   302  C  CG  A MET A 1 43  ? -19.730 56.724 50.959 0.60 31.04 ? 43   MET A CG  1 
ATOM   303  C  CG  B MET A 1 43  ? -19.829 56.897 51.076 0.40 30.64 ? 43   MET A CG  1 
ATOM   304  S  SD  A MET A 1 43  ? -19.748 58.117 49.821 0.60 33.86 ? 43   MET A SD  1 
ATOM   305  S  SD  B MET A 1 43  ? -19.564 55.545 49.915 0.40 33.48 ? 43   MET A SD  1 
ATOM   306  C  CE  A MET A 1 43  ? -18.106 58.064 49.153 0.60 32.21 ? 43   MET A CE  1 
ATOM   307  C  CE  B MET A 1 43  ? -18.006 56.024 49.173 0.40 31.79 ? 43   MET A CE  1 
ATOM   308  N  N   . ARG A 1 44  ? -17.687 55.845 55.273 1.00 26.75 ? 44   ARG A N   1 
ATOM   309  C  CA  . ARG A 1 44  ? -16.568 55.834 56.247 1.00 25.47 ? 44   ARG A CA  1 
ATOM   310  C  C   . ARG A 1 44  ? -15.717 54.583 56.066 1.00 24.72 ? 44   ARG A C   1 
ATOM   311  O  O   . ARG A 1 44  ? -16.251 53.477 55.994 1.00 24.58 ? 44   ARG A O   1 
ATOM   312  C  CB  . ARG A 1 44  ? -17.059 55.941 57.700 1.00 25.30 ? 44   ARG A CB  1 
ATOM   313  C  CG  . ARG A 1 44  ? -15.914 56.041 58.739 1.00 24.56 ? 44   ARG A CG  1 
ATOM   314  C  CD  . ARG A 1 44  ? -16.407 55.958 60.193 1.00 22.55 ? 44   ARG A CD  1 
ATOM   315  N  NE  . ARG A 1 44  ? -17.100 57.164 60.643 1.00 22.97 ? 44   ARG A NE  1 
ATOM   316  C  CZ  . ARG A 1 44  ? -17.820 57.223 61.765 1.00 23.02 ? 44   ARG A CZ  1 
ATOM   317  N  NH1 . ARG A 1 44  ? -17.927 56.147 62.544 1.00 23.28 ? 44   ARG A NH1 1 
ATOM   318  N  NH2 . ARG A 1 44  ? -18.417 58.354 62.121 1.00 21.73 ? 44   ARG A NH2 1 
ATOM   319  N  N   . PHE A 1 45  ? -14.397 54.777 55.996 1.00 23.70 ? 45   PHE A N   1 
ATOM   320  C  CA  . PHE A 1 45  ? -13.383 53.719 55.782 1.00 23.54 ? 45   PHE A CA  1 
ATOM   321  C  C   . PHE A 1 45  ? -13.204 53.275 54.325 1.00 23.56 ? 45   PHE A C   1 
ATOM   322  O  O   . PHE A 1 45  ? -12.211 52.596 54.011 1.00 22.61 ? 45   PHE A O   1 
ATOM   323  C  CB  . PHE A 1 45  ? -13.570 52.474 56.675 1.00 23.81 ? 45   PHE A CB  1 
ATOM   324  C  CG  . PHE A 1 45  ? -13.794 52.775 58.134 1.00 24.16 ? 45   PHE A CG  1 
ATOM   325  C  CD1 . PHE A 1 45  ? -12.880 53.539 58.859 1.00 24.81 ? 45   PHE A CD1 1 
ATOM   326  C  CD2 . PHE A 1 45  ? -14.911 52.258 58.787 1.00 24.19 ? 45   PHE A CD2 1 
ATOM   327  C  CE1 . PHE A 1 45  ? -13.091 53.799 60.235 1.00 25.27 ? 45   PHE A CE1 1 
ATOM   328  C  CE2 . PHE A 1 45  ? -15.138 52.516 60.156 1.00 25.32 ? 45   PHE A CE2 1 
ATOM   329  C  CZ  . PHE A 1 45  ? -14.237 53.278 60.874 1.00 25.95 ? 45   PHE A CZ  1 
ATOM   330  N  N   . ARG A 1 46  ? -14.142 53.672 53.459 1.00 24.20 ? 46   ARG A N   1 
ATOM   331  C  CA  A ARG A 1 46  ? -14.093 53.270 52.051 0.50 24.91 ? 46   ARG A CA  1 
ATOM   332  C  CA  B ARG A 1 46  ? -14.149 53.313 52.027 0.50 24.71 ? 46   ARG A CA  1 
ATOM   333  C  C   . ARG A 1 46  ? -13.171 54.169 51.223 1.00 24.84 ? 46   ARG A C   1 
ATOM   334  O  O   . ARG A 1 46  ? -12.889 55.323 51.598 1.00 24.29 ? 46   ARG A O   1 
ATOM   335  C  CB  A ARG A 1 46  ? -15.503 53.239 51.445 0.50 25.32 ? 46   ARG A CB  1 
ATOM   336  C  CB  B ARG A 1 46  ? -15.545 53.545 51.425 0.50 24.83 ? 46   ARG A CB  1 
ATOM   337  C  CG  A ARG A 1 46  ? -16.204 51.884 51.581 0.50 27.42 ? 46   ARG A CG  1 
ATOM   338  C  CG  B ARG A 1 46  ? -16.640 52.603 51.892 0.50 26.23 ? 46   ARG A CG  1 
ATOM   339  C  CD  A ARG A 1 46  ? -17.509 51.855 50.791 0.50 30.76 ? 46   ARG A CD  1 
ATOM   340  C  CD  B ARG A 1 46  ? -17.837 52.628 50.937 0.50 29.42 ? 46   ARG A CD  1 
ATOM   341  N  NE  A ARG A 1 46  ? -17.294 52.124 49.376 0.50 32.08 ? 46   ARG A NE  1 
ATOM   342  N  NE  B ARG A 1 46  ? -18.838 51.632 51.319 0.50 32.46 ? 46   ARG A NE  1 
ATOM   343  C  CZ  A ARG A 1 46  ? -17.177 51.185 48.442 0.50 33.68 ? 46   ARG A CZ  1 
ATOM   344  C  CZ  B ARG A 1 46  ? -20.140 51.738 51.068 0.50 34.35 ? 46   ARG A CZ  1 
ATOM   345  N  NH1 A ARG A 1 46  ? -17.253 49.897 48.759 0.50 33.77 ? 46   ARG A NH1 1 
ATOM   346  N  NH1 B ARG A 1 46  ? -20.613 52.802 50.429 0.50 34.49 ? 46   ARG A NH1 1 
ATOM   347  N  NH2 A ARG A 1 46  ? -16.983 51.537 47.181 0.50 34.98 ? 46   ARG A NH2 1 
ATOM   348  N  NH2 B ARG A 1 46  ? -20.971 50.785 51.472 0.50 34.54 ? 46   ARG A NH2 1 
ATOM   349  N  N   . ARG A 1 47  ? -12.688 53.622 50.104 1.00 24.72 ? 47   ARG A N   1 
ATOM   350  C  CA  . ARG A 1 47  ? -11.963 54.402 49.103 1.00 25.09 ? 47   ARG A CA  1 
ATOM   351  C  C   . ARG A 1 47  ? -12.760 55.659 48.727 1.00 24.53 ? 47   ARG A C   1 
ATOM   352  O  O   . ARG A 1 47  ? -13.988 55.637 48.729 1.00 23.36 ? 47   ARG A O   1 
ATOM   353  C  CB  . ARG A 1 47  ? -11.705 53.555 47.845 1.00 26.24 ? 47   ARG A CB  1 
ATOM   354  C  CG  . ARG A 1 47  ? -10.879 52.341 48.119 1.00 29.48 ? 47   ARG A CG  1 
ATOM   355  C  CD  . ARG A 1 47  ? -10.585 51.533 46.855 0.80 34.15 ? 47   ARG A CD  1 
ATOM   356  N  NE  . ARG A 1 47  ? -9.784  50.345 47.171 0.80 36.44 ? 47   ARG A NE  1 
ATOM   357  C  CZ  . ARG A 1 47  ? -10.280 49.164 47.541 0.80 37.83 ? 47   ARG A CZ  1 
ATOM   358  N  NH1 . ARG A 1 47  ? -11.594 48.980 47.672 0.80 36.21 ? 47   ARG A NH1 1 
ATOM   359  N  NH2 . ARG A 1 47  ? -9.450  48.156 47.791 0.80 38.69 ? 47   ARG A NH2 1 
ATOM   360  N  N   . PRO A 1 48  ? -12.058 56.776 48.449 1.00 24.38 ? 48   PRO A N   1 
ATOM   361  C  CA  . PRO A 1 48  ? -12.773 57.969 48.051 1.00 25.02 ? 48   PRO A CA  1 
ATOM   362  C  C   . PRO A 1 48  ? -13.436 57.798 46.677 1.00 26.16 ? 48   PRO A C   1 
ATOM   363  O  O   . PRO A 1 48  ? -12.965 57.001 45.849 1.00 24.65 ? 48   PRO A O   1 
ATOM   364  C  CB  . PRO A 1 48  ? -11.677 59.026 47.965 1.00 24.71 ? 48   PRO A CB  1 
ATOM   365  C  CG  . PRO A 1 48  ? -10.415 58.249 47.686 1.00 24.37 ? 48   PRO A CG  1 
ATOM   366  C  CD  . PRO A 1 48  ? -10.595 56.962 48.435 1.00 23.97 ? 48   PRO A CD  1 
ATOM   367  N  N   . GLU A 1 49  ? -14.537 58.520 46.490 1.00 27.36 ? 49   GLU A N   1 
ATOM   368  C  CA  A GLU A 1 49  ? -15.244 58.622 45.203 0.50 28.34 ? 49   GLU A CA  1 
ATOM   369  C  CA  B GLU A 1 49  ? -15.175 58.603 45.184 0.50 28.06 ? 49   GLU A CA  1 
ATOM   370  C  C   . GLU A 1 49  ? -15.019 60.012 44.628 1.00 28.17 ? 49   GLU A C   1 
ATOM   371  O  O   . GLU A 1 49  ? -15.066 60.994 45.380 1.00 27.60 ? 49   GLU A O   1 
ATOM   372  C  CB  A GLU A 1 49  ? -16.758 58.431 45.377 0.50 28.40 ? 49   GLU A CB  1 
ATOM   373  C  CB  B GLU A 1 49  ? -16.649 58.183 45.251 0.50 28.04 ? 49   GLU A CB  1 
ATOM   374  C  CG  A GLU A 1 49  ? -17.210 57.007 45.659 0.50 31.34 ? 49   GLU A CG  1 
ATOM   375  C  CG  B GLU A 1 49  ? -16.841 56.703 45.623 0.50 29.36 ? 49   GLU A CG  1 
ATOM   376  C  CD  A GLU A 1 49  ? -18.702 56.825 45.437 0.50 34.05 ? 49   GLU A CD  1 
ATOM   377  C  CD  B GLU A 1 49  ? -16.175 55.749 44.641 0.50 30.31 ? 49   GLU A CD  1 
ATOM   378  O  OE1 A GLU A 1 49  ? -19.422 57.845 45.309 0.50 35.28 ? 49   GLU A OE1 1 
ATOM   379  O  OE1 B GLU A 1 49  ? -16.149 56.058 43.430 0.50 30.07 ? 49   GLU A OE1 1 
ATOM   380  O  OE2 A GLU A 1 49  ? -19.153 55.663 45.383 0.50 35.89 ? 49   GLU A OE2 1 
ATOM   381  O  OE2 B GLU A 1 49  ? -15.688 54.678 45.075 0.50 31.72 ? 49   GLU A OE2 1 
ATOM   382  N  N   . PRO A 1 50  ? -14.808 60.115 43.289 1.00 28.63 ? 50   PRO A N   1 
ATOM   383  C  CA  . PRO A 1 50  ? -14.634 61.432 42.660 1.00 28.61 ? 50   PRO A CA  1 
ATOM   384  C  C   . PRO A 1 50  ? -15.808 62.348 42.982 1.00 28.82 ? 50   PRO A C   1 
ATOM   385  O  O   . PRO A 1 50  ? -16.945 61.870 43.073 1.00 29.97 ? 50   PRO A O   1 
ATOM   386  C  CB  . PRO A 1 50  ? -14.636 61.128 41.160 1.00 28.59 ? 50   PRO A CB  1 
ATOM   387  C  CG  . PRO A 1 50  ? -14.450 59.676 41.018 1.00 29.75 ? 50   PRO A CG  1 
ATOM   388  C  CD  . PRO A 1 50  ? -14.854 59.015 42.298 1.00 28.48 ? 50   PRO A CD  1 
ATOM   389  N  N   . LYS A 1 51  ? -15.546 63.636 43.175 1.00 29.02 ? 51   LYS A N   1 
ATOM   390  C  CA  . LYS A 1 51  ? -16.616 64.588 43.469 1.00 29.85 ? 51   LYS A CA  1 
ATOM   391  C  C   . LYS A 1 51  ? -17.526 64.736 42.233 1.00 30.68 ? 51   LYS A C   1 
ATOM   392  O  O   . LYS A 1 51  ? -17.037 64.968 41.129 1.00 29.95 ? 51   LYS A O   1 
ATOM   393  C  CB  . LYS A 1 51  ? -16.017 65.954 43.835 1.00 29.51 ? 51   LYS A CB  1 
ATOM   394  C  CG  . LYS A 1 51  ? -17.033 67.093 43.951 1.00 29.10 ? 51   LYS A CG  1 
ATOM   395  C  CD  . LYS A 1 51  ? -17.884 66.936 45.212 1.00 30.66 ? 51   LYS A CD  1 
ATOM   396  C  CE  . LYS A 1 51  ? -18.839 68.103 45.392 1.00 30.08 ? 51   LYS A CE  1 
ATOM   397  N  NZ  . LYS A 1 51  ? -19.632 67.881 46.643 1.00 31.48 ? 51   LYS A NZ  1 
ATOM   398  N  N   . LYS A 1 52  ? -18.836 64.599 42.422 1.00 31.82 ? 52   LYS A N   1 
ATOM   399  C  CA  . LYS A 1 52  ? -19.785 64.833 41.328 1.00 33.06 ? 52   LYS A CA  1 
ATOM   400  C  C   . LYS A 1 52  ? -19.784 66.312 40.958 1.00 33.25 ? 52   LYS A C   1 
ATOM   401  O  O   . LYS A 1 52  ? -19.839 67.170 41.850 1.00 32.89 ? 52   LYS A O   1 
ATOM   402  C  CB  . LYS A 1 52  ? -21.192 64.382 41.725 1.00 33.61 ? 52   LYS A CB  1 
ATOM   403  C  CG  . LYS A 1 52  ? -21.312 62.877 41.879 1.00 35.98 ? 52   LYS A CG  1 
ATOM   404  C  CD  . LYS A 1 52  ? -22.577 62.496 42.628 1.00 41.28 ? 52   LYS A CD  1 
ATOM   405  C  CE  . LYS A 1 52  ? -22.605 60.989 42.898 1.00 43.90 ? 52   LYS A CE  1 
ATOM   406  N  NZ  . LYS A 1 52  ? -23.791 60.595 43.716 1.00 45.88 ? 52   LYS A NZ  1 
ATOM   407  N  N   . PRO A 1 53  ? -19.712 66.620 39.644 1.00 33.79 ? 53   PRO A N   1 
ATOM   408  C  CA  . PRO A 1 53  ? -19.691 68.012 39.185 1.00 34.21 ? 53   PRO A CA  1 
ATOM   409  C  C   . PRO A 1 53  ? -20.911 68.779 39.685 1.00 34.40 ? 53   PRO A C   1 
ATOM   410  O  O   . PRO A 1 53  ? -21.970 68.184 39.885 1.00 34.14 ? 53   PRO A O   1 
ATOM   411  C  CB  . PRO A 1 53  ? -19.726 67.888 37.654 1.00 34.27 ? 53   PRO A CB  1 
ATOM   412  C  CG  . PRO A 1 53  ? -19.246 66.516 37.366 1.00 35.27 ? 53   PRO A CG  1 
ATOM   413  C  CD  . PRO A 1 53  ? -19.711 65.670 38.513 1.00 33.96 ? 53   PRO A CD  1 
ATOM   414  N  N   . TRP A 1 54  ? -20.747 70.077 39.917 1.00 34.91 ? 54   TRP A N   1 
ATOM   415  C  CA  . TRP A 1 54  ? -21.835 70.919 40.425 1.00 36.12 ? 54   TRP A CA  1 
ATOM   416  C  C   . TRP A 1 54  ? -22.250 71.969 39.389 1.00 36.94 ? 54   TRP A C   1 
ATOM   417  O  O   . TRP A 1 54  ? -21.460 72.342 38.504 1.00 36.88 ? 54   TRP A O   1 
ATOM   418  C  CB  . TRP A 1 54  ? -21.417 71.613 41.735 1.00 35.73 ? 54   TRP A CB  1 
ATOM   419  C  CG  . TRP A 1 54  ? -20.163 72.404 41.567 1.00 34.33 ? 54   TRP A CG  1 
ATOM   420  C  CD1 . TRP A 1 54  ? -20.059 73.696 41.140 1.00 32.67 ? 54   TRP A CD1 1 
ATOM   421  C  CD2 . TRP A 1 54  ? -18.830 71.939 41.779 1.00 33.66 ? 54   TRP A CD2 1 
ATOM   422  N  NE1 . TRP A 1 54  ? -18.733 74.064 41.073 1.00 33.38 ? 54   TRP A NE1 1 
ATOM   423  C  CE2 . TRP A 1 54  ? -17.962 73.001 41.467 1.00 33.81 ? 54   TRP A CE2 1 
ATOM   424  C  CE3 . TRP A 1 54  ? -18.283 70.721 42.203 1.00 34.92 ? 54   TRP A CE3 1 
ATOM   425  C  CZ2 . TRP A 1 54  ? -16.577 72.887 41.576 1.00 35.10 ? 54   TRP A CZ2 1 
ATOM   426  C  CZ3 . TRP A 1 54  ? -16.909 70.611 42.308 1.00 33.37 ? 54   TRP A CZ3 1 
ATOM   427  C  CH2 . TRP A 1 54  ? -16.073 71.686 41.996 1.00 34.60 ? 54   TRP A CH2 1 
ATOM   428  N  N   . SER A 1 55  ? -23.490 72.443 39.506 1.00 38.24 ? 55   SER A N   1 
ATOM   429  C  CA  . SER A 1 55  ? -23.969 73.584 38.730 1.00 39.17 ? 55   SER A CA  1 
ATOM   430  C  C   . SER A 1 55  ? -23.704 74.852 39.525 1.00 39.15 ? 55   SER A C   1 
ATOM   431  O  O   . SER A 1 55  ? -23.441 74.788 40.730 1.00 39.93 ? 55   SER A O   1 
ATOM   432  C  CB  . SER A 1 55  ? -25.469 73.461 38.457 1.00 39.70 ? 55   SER A CB  1 
ATOM   433  O  OG  . SER A 1 55  ? -25.718 72.424 37.519 1.00 42.46 ? 55   SER A OG  1 
ATOM   434  N  N   . GLY A 1 56  ? -23.786 76.002 38.865 1.00 38.43 ? 56   GLY A N   1 
ATOM   435  C  CA  . GLY A 1 56  ? -23.540 77.264 39.543 1.00 37.77 ? 56   GLY A CA  1 
ATOM   436  C  C   . GLY A 1 56  ? -22.073 77.418 39.904 1.00 37.16 ? 56   GLY A C   1 
ATOM   437  O  O   . GLY A 1 56  ? -21.208 76.728 39.355 1.00 37.07 ? 56   GLY A O   1 
ATOM   438  N  N   . VAL A 1 57  ? -21.803 78.322 40.834 1.00 36.12 ? 57   VAL A N   1 
ATOM   439  C  CA  . VAL A 1 57  ? -20.443 78.742 41.116 1.00 35.49 ? 57   VAL A CA  1 
ATOM   440  C  C   . VAL A 1 57  ? -20.098 78.286 42.539 1.00 35.41 ? 57   VAL A C   1 
ATOM   441  O  O   . VAL A 1 57  ? -20.783 78.648 43.503 1.00 35.12 ? 57   VAL A O   1 
ATOM   442  C  CB  . VAL A 1 57  ? -20.284 80.280 40.943 1.00 35.70 ? 57   VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 57  ? -18.857 80.724 41.232 1.00 34.81 ? 57   VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 57  ? -20.694 80.722 39.525 1.00 35.10 ? 57   VAL A CG2 1 
ATOM   445  N  N   . TRP A 1 58  ? -19.066 77.455 42.662 1.00 34.71 ? 58   TRP A N   1 
ATOM   446  C  CA  . TRP A 1 58  ? -18.618 77.025 43.983 1.00 33.81 ? 58   TRP A CA  1 
ATOM   447  C  C   . TRP A 1 58  ? -17.922 78.197 44.670 1.00 33.91 ? 58   TRP A C   1 
ATOM   448  O  O   . TRP A 1 58  ? -16.982 78.784 44.125 1.00 33.87 ? 58   TRP A O   1 
ATOM   449  C  CB  . TRP A 1 58  ? -17.688 75.808 43.906 1.00 33.52 ? 58   TRP A CB  1 
ATOM   450  C  CG  . TRP A 1 58  ? -17.395 75.243 45.289 1.00 32.64 ? 58   TRP A CG  1 
ATOM   451  C  CD1 . TRP A 1 58  ? -16.473 75.712 46.190 1.00 31.34 ? 58   TRP A CD1 1 
ATOM   452  C  CD2 . TRP A 1 58  ? -18.056 74.145 45.927 1.00 29.84 ? 58   TRP A CD2 1 
ATOM   453  N  NE1 . TRP A 1 58  ? -16.514 74.966 47.336 1.00 30.44 ? 58   TRP A NE1 1 
ATOM   454  C  CE2 . TRP A 1 58  ? -17.473 73.996 47.207 1.00 30.21 ? 58   TRP A CE2 1 
ATOM   455  C  CE3 . TRP A 1 58  ? -19.070 73.259 45.537 1.00 31.15 ? 58   TRP A CE3 1 
ATOM   456  C  CZ2 . TRP A 1 58  ? -17.880 73.001 48.111 1.00 30.05 ? 58   TRP A CZ2 1 
ATOM   457  C  CZ3 . TRP A 1 58  ? -19.478 72.263 46.435 1.00 30.64 ? 58   TRP A CZ3 1 
ATOM   458  C  CH2 . TRP A 1 58  ? -18.882 72.149 47.708 1.00 30.64 ? 58   TRP A CH2 1 
ATOM   459  N  N   . ASN A 1 59  ? -18.404 78.546 45.859 1.00 33.81 ? 59   ASN A N   1 
ATOM   460  C  CA  . ASN A 1 59  ? -17.779 79.589 46.646 1.00 34.75 ? 59   ASN A CA  1 
ATOM   461  C  C   . ASN A 1 59  ? -16.484 79.075 47.294 1.00 33.30 ? 59   ASN A C   1 
ATOM   462  O  O   . ASN A 1 59  ? -16.522 78.315 48.265 1.00 32.90 ? 59   ASN A O   1 
ATOM   463  C  CB  . ASN A 1 59  ? -18.756 80.134 47.701 1.00 35.99 ? 59   ASN A CB  1 
ATOM   464  C  CG  . ASN A 1 59  ? -18.248 81.413 48.368 1.00 40.74 ? 59   ASN A CG  1 
ATOM   465  O  OD1 . ASN A 1 59  ? -17.043 81.589 48.559 1.00 41.36 ? 59   ASN A OD1 1 
ATOM   466  N  ND2 . ASN A 1 59  ? -19.173 82.312 48.723 1.00 48.03 ? 59   ASN A ND2 1 
ATOM   467  N  N   . ALA A 1 60  ? -15.358 79.512 46.742 1.00 32.06 ? 60   ALA A N   1 
ATOM   468  C  CA  . ALA A 1 60  ? -14.030 79.096 47.176 1.00 31.63 ? 60   ALA A CA  1 
ATOM   469  C  C   . ALA A 1 60  ? -13.294 80.259 47.841 1.00 31.37 ? 60   ALA A C   1 
ATOM   470  O  O   . ALA A 1 60  ? -12.115 80.508 47.571 1.00 30.97 ? 60   ALA A O   1 
ATOM   471  C  CB  . ALA A 1 60  ? -13.217 78.559 45.967 1.00 31.38 ? 60   ALA A CB  1 
ATOM   472  N  N   . SER A 1 61  ? -13.993 80.985 48.706 1.00 31.18 ? 61   SER A N   1 
ATOM   473  C  CA  . SER A 1 61  ? -13.389 82.158 49.325 1.00 31.44 ? 61   SER A CA  1 
ATOM   474  C  C   . SER A 1 61  ? -12.876 81.876 50.739 1.00 31.56 ? 61   SER A C   1 
ATOM   475  O  O   . SER A 1 61  ? -12.144 82.701 51.307 1.00 31.86 ? 61   SER A O   1 
ATOM   476  C  CB  . SER A 1 61  ? -14.396 83.308 49.374 1.00 31.04 ? 61   SER A CB  1 
ATOM   477  O  OG  . SER A 1 61  ? -15.465 82.927 50.213 1.00 31.05 ? 61   SER A OG  1 
ATOM   478  N  N   . THR A 1 62  ? -13.274 80.734 51.304 1.00 31.36 ? 62   THR A N   1 
ATOM   479  C  CA  . THR A 1 62  ? -12.933 80.400 52.686 1.00 31.42 ? 62   THR A CA  1 
ATOM   480  C  C   . THR A 1 62  ? -12.364 78.995 52.862 1.00 30.16 ? 62   THR A C   1 
ATOM   481  O  O   . THR A 1 62  ? -12.743 78.061 52.157 1.00 29.64 ? 62   THR A O   1 
ATOM   482  C  CB  . THR A 1 62  ? -14.140 80.585 53.641 1.00 31.54 ? 62   THR A CB  1 
ATOM   483  O  OG1 . THR A 1 62  ? -15.126 79.586 53.383 1.00 34.60 ? 62   THR A OG1 1 
ATOM   484  C  CG2 . THR A 1 62  ? -14.779 81.945 53.439 1.00 33.88 ? 62   THR A CG2 1 
ATOM   485  N  N   . TYR A 1 63  ? -11.458 78.861 53.829 1.00 28.52 ? 63   TYR A N   1 
ATOM   486  C  CA  . TYR A 1 63  ? -10.909 77.569 54.208 1.00 27.20 ? 63   TYR A CA  1 
ATOM   487  C  C   . TYR A 1 63  ? -11.976 76.504 54.528 1.00 26.21 ? 63   TYR A C   1 
ATOM   488  O  O   . TYR A 1 63  ? -13.006 76.805 55.116 1.00 26.95 ? 63   TYR A O   1 
ATOM   489  C  CB  . TYR A 1 63  ? -9.949  77.725 55.386 1.00 26.62 ? 63   TYR A CB  1 
ATOM   490  C  CG  . TYR A 1 63  ? -8.507  78.035 55.036 1.00 26.62 ? 63   TYR A CG  1 
ATOM   491  C  CD1 . TYR A 1 63  ? -7.869  77.450 53.925 1.00 24.87 ? 63   TYR A CD1 1 
ATOM   492  C  CD2 . TYR A 1 63  ? -7.745  78.854 55.874 1.00 26.99 ? 63   TYR A CD2 1 
ATOM   493  C  CE1 . TYR A 1 63  ? -6.523  77.722 53.647 1.00 24.62 ? 63   TYR A CE1 1 
ATOM   494  C  CE2 . TYR A 1 63  ? -6.396  79.114 55.613 1.00 26.14 ? 63   TYR A CE2 1 
ATOM   495  C  CZ  . TYR A 1 63  ? -5.792  78.550 54.508 1.00 25.79 ? 63   TYR A CZ  1 
ATOM   496  O  OH  . TYR A 1 63  ? -4.456  78.835 54.278 1.00 25.52 ? 63   TYR A OH  1 
ATOM   497  N  N   . PRO A 1 64  ? -11.728 75.241 54.129 1.00 25.23 ? 64   PRO A N   1 
ATOM   498  C  CA  . PRO A 1 64  ? -12.644 74.135 54.437 1.00 24.77 ? 64   PRO A CA  1 
ATOM   499  C  C   . PRO A 1 64  ? -12.570 73.661 55.904 1.00 24.74 ? 64   PRO A C   1 
ATOM   500  O  O   . PRO A 1 64  ? -11.696 74.099 56.656 1.00 24.65 ? 64   PRO A O   1 
ATOM   501  C  CB  . PRO A 1 64  ? -12.134 73.016 53.517 1.00 24.88 ? 64   PRO A CB  1 
ATOM   502  C  CG  . PRO A 1 64  ? -10.636 73.263 53.458 1.00 25.12 ? 64   PRO A CG  1 
ATOM   503  C  CD  . PRO A 1 64  ? -10.500 74.781 53.454 1.00 24.62 ? 64   PRO A CD  1 
ATOM   504  N  N   . ASN A 1 65  ? -13.482 72.774 56.293 1.00 24.71 ? 65   ASN A N   1 
ATOM   505  C  CA  . ASN A 1 65  ? -13.361 71.984 57.536 1.00 25.71 ? 65   ASN A CA  1 
ATOM   506  C  C   . ASN A 1 65  ? -12.073 71.155 57.555 1.00 25.08 ? 65   ASN A C   1 
ATOM   507  O  O   . ASN A 1 65  ? -11.535 70.814 56.496 1.00 25.88 ? 65   ASN A O   1 
ATOM   508  C  CB  . ASN A 1 65  ? -14.528 70.995 57.674 1.00 25.42 ? 65   ASN A CB  1 
ATOM   509  C  CG  . ASN A 1 65  ? -15.893 71.672 57.702 1.00 30.27 ? 65   ASN A CG  1 
ATOM   510  O  OD1 . ASN A 1 65  ? -16.086 72.715 58.336 1.00 31.44 ? 65   ASN A OD1 1 
ATOM   511  N  ND2 . ASN A 1 65  ? -16.868 71.038 57.037 1.00 33.82 ? 65   ASN A ND2 1 
ATOM   512  N  N   . ASN A 1 66  ? -11.571 70.830 58.745 1.00 24.44 ? 66   ASN A N   1 
ATOM   513  C  CA  . ASN A 1 66  ? -10.444 69.894 58.870 1.00 24.11 ? 66   ASN A CA  1 
ATOM   514  C  C   . ASN A 1 66  ? -10.983 68.498 59.118 1.00 23.38 ? 66   ASN A C   1 
ATOM   515  O  O   . ASN A 1 66  ? -12.096 68.353 59.610 1.00 23.83 ? 66   ASN A O   1 
ATOM   516  C  CB  . ASN A 1 66  ? -9.507  70.292 60.024 1.00 23.59 ? 66   ASN A CB  1 
ATOM   517  C  CG  . ASN A 1 66  ? -8.963  71.720 59.889 1.00 25.53 ? 66   ASN A CG  1 
ATOM   518  O  OD1 . ASN A 1 66  ? -8.925  72.462 60.874 1.00 25.36 ? 66   ASN A OD1 1 
ATOM   519  N  ND2 . ASN A 1 66  ? -8.527  72.106 58.673 1.00 24.40 ? 66   ASN A ND2 1 
ATOM   520  N  N   . CYS A 1 67  ? -10.200 67.472 58.810 1.00 22.90 ? 67   CYS A N   1 
ATOM   521  C  CA  . CYS A 1 67  ? -10.639 66.108 59.060 1.00 22.80 ? 67   CYS A CA  1 
ATOM   522  C  C   . CYS A 1 67  ? -10.684 65.837 60.574 1.00 23.32 ? 67   CYS A C   1 
ATOM   523  O  O   . CYS A 1 67  ? -10.034 66.533 61.363 1.00 23.16 ? 67   CYS A O   1 
ATOM   524  C  CB  . CYS A 1 67  ? -9.753  65.097 58.314 1.00 23.15 ? 67   CYS A CB  1 
ATOM   525  S  SG  . CYS A 1 67  ? -9.837  65.265 56.516 0.90 22.29 ? 67   CYS A SG  1 
ATOM   526  N  N   . GLN A 1 68  ? -11.514 64.880 60.965 1.00 23.25 ? 68   GLN A N   1 
ATOM   527  C  CA  . GLN A 1 68  ? -11.661 64.487 62.373 1.00 23.43 ? 68   GLN A CA  1 
ATOM   528  C  C   . GLN A 1 68  ? -10.353 63.903 62.863 1.00 22.99 ? 68   GLN A C   1 
ATOM   529  O  O   . GLN A 1 68  ? -9.774  63.022 62.217 1.00 22.75 ? 68   GLN A O   1 
ATOM   530  C  CB  . GLN A 1 68  ? -12.763 63.448 62.518 1.00 23.25 ? 68   GLN A CB  1 
ATOM   531  C  CG  . GLN A 1 68  ? -14.160 64.020 62.303 1.00 24.42 ? 68   GLN A CG  1 
ATOM   532  C  CD  . GLN A 1 68  ? -14.669 64.872 63.469 1.00 26.87 ? 68   GLN A CD  1 
ATOM   533  O  OE1 . GLN A 1 68  ? -15.783 65.400 63.407 1.00 29.47 ? 68   GLN A OE1 1 
ATOM   534  N  NE2 . GLN A 1 68  ? -13.885 64.981 64.535 1.00 22.84 ? 68   GLN A NE2 1 
ATOM   535  N  N   . GLN A 1 69  ? -9.875  64.418 63.988 1.00 22.09 ? 69   GLN A N   1 
ATOM   536  C  CA  . GLN A 1 69  ? -8.582  63.999 64.516 1.00 21.88 ? 69   GLN A CA  1 
ATOM   537  C  C   . GLN A 1 69  ? -8.465  64.212 66.018 1.00 21.77 ? 69   GLN A C   1 
ATOM   538  O  O   . GLN A 1 69  ? -9.152  65.051 66.592 1.00 21.28 ? 69   GLN A O   1 
ATOM   539  C  CB  . GLN A 1 69  ? -7.435  64.742 63.817 1.00 20.99 ? 69   GLN A CB  1 
ATOM   540  C  CG  . GLN A 1 69  ? -7.509  66.271 63.958 1.00 22.36 ? 69   GLN A CG  1 
ATOM   541  C  CD  . GLN A 1 69  ? -6.643  66.988 62.950 1.00 22.07 ? 69   GLN A CD  1 
ATOM   542  O  OE1 . GLN A 1 69  ? -5.484  67.310 63.224 1.00 21.83 ? 69   GLN A OE1 1 
ATOM   543  N  NE2 . GLN A 1 69  ? -7.196  67.216 61.744 1.00 22.03 ? 69   GLN A NE2 1 
ATOM   544  N  N   . TYR A 1 70  ? -7.561  63.448 66.618 1.00 22.36 ? 70   TYR A N   1 
ATOM   545  C  CA  . TYR A 1 70  ? -7.013  63.727 67.949 1.00 23.58 ? 70   TYR A CA  1 
ATOM   546  C  C   . TYR A 1 70  ? -6.470  65.141 68.003 1.00 24.11 ? 70   TYR A C   1 
ATOM   547  O  O   . TYR A 1 70  ? -5.724  65.560 67.101 1.00 24.25 ? 70   TYR A O   1 
ATOM   548  C  CB  . TYR A 1 70  ? -5.895  62.714 68.253 1.00 23.78 ? 70   TYR A CB  1 
ATOM   549  C  CG  . TYR A 1 70  ? -5.180  62.979 69.559 1.00 26.54 ? 70   TYR A CG  1 
ATOM   550  C  CD1 . TYR A 1 70  ? -5.705  62.526 70.773 1.00 26.32 ? 70   TYR A CD1 1 
ATOM   551  C  CD2 . TYR A 1 70  ? -3.987  63.712 69.581 1.00 27.34 ? 70   TYR A CD2 1 
ATOM   552  C  CE1 . TYR A 1 70  ? -5.035  62.780 71.985 1.00 28.73 ? 70   TYR A CE1 1 
ATOM   553  C  CE2 . TYR A 1 70  ? -3.320  63.976 70.787 1.00 28.37 ? 70   TYR A CE2 1 
ATOM   554  C  CZ  . TYR A 1 70  ? -3.846  63.509 71.972 1.00 29.68 ? 70   TYR A CZ  1 
ATOM   555  O  OH  . TYR A 1 70  ? -3.171  63.784 73.151 1.00 32.90 ? 70   TYR A OH  1 
ATOM   556  N  N   . VAL A 1 71  ? -6.839  65.885 69.052 1.00 24.52 ? 71   VAL A N   1 
ATOM   557  C  CA  . VAL A 1 71  ? -6.385  67.269 69.225 1.00 25.47 ? 71   VAL A CA  1 
ATOM   558  C  C   . VAL A 1 71  ? -5.452  67.374 70.445 1.00 26.44 ? 71   VAL A C   1 
ATOM   559  O  O   . VAL A 1 71  ? -5.800  66.932 71.551 1.00 26.22 ? 71   VAL A O   1 
ATOM   560  C  CB  . VAL A 1 71  ? -7.574  68.254 69.395 1.00 25.75 ? 71   VAL A CB  1 
ATOM   561  C  CG1 . VAL A 1 71  ? -7.085  69.658 69.844 1.00 25.41 ? 71   VAL A CG1 1 
ATOM   562  C  CG2 . VAL A 1 71  ? -8.415  68.343 68.091 1.00 26.11 ? 71   VAL A CG2 1 
ATOM   563  N  N   . ASP A 1 72  ? -4.272  67.946 70.233 1.00 27.41 ? 72   ASP A N   1 
ATOM   564  C  CA  . ASP A 1 72  ? -3.253  68.054 71.289 1.00 28.57 ? 72   ASP A CA  1 
ATOM   565  C  C   . ASP A 1 72  ? -3.704  69.064 72.332 1.00 29.04 ? 72   ASP A C   1 
ATOM   566  O  O   . ASP A 1 72  ? -3.918  70.228 72.008 1.00 29.21 ? 72   ASP A O   1 
ATOM   567  C  CB  . ASP A 1 72  ? -1.913  68.480 70.678 1.00 28.62 ? 72   ASP A CB  1 
ATOM   568  C  CG  . ASP A 1 72  ? -0.811  68.685 71.728 1.00 30.09 ? 72   ASP A CG  1 
ATOM   569  O  OD1 . ASP A 1 72  ? -0.938  68.187 72.868 1.00 32.63 ? 72   ASP A OD1 1 
ATOM   570  O  OD2 . ASP A 1 72  ? 0.211   69.302 71.387 1.00 29.05 ? 72   ASP A OD2 1 
ATOM   571  N  N   . GLU A 1 73  ? -3.882  68.609 73.574 1.00 30.39 ? 73   GLU A N   1 
ATOM   572  C  CA  . GLU A 1 73  ? -4.232  69.501 74.696 1.00 31.70 ? 73   GLU A CA  1 
ATOM   573  C  C   . GLU A 1 73  ? -3.173  69.475 75.803 1.00 32.34 ? 73   GLU A C   1 
ATOM   574  O  O   . GLU A 1 73  ? -3.456  69.827 76.957 1.00 32.46 ? 73   GLU A O   1 
ATOM   575  C  CB  . GLU A 1 73  ? -5.586  69.110 75.292 1.00 31.90 ? 73   GLU A CB  1 
ATOM   576  C  CG  . GLU A 1 73  ? -6.764  69.515 74.463 1.00 35.47 ? 73   GLU A CG  1 
ATOM   577  C  CD  . GLU A 1 73  ? -8.087  69.077 75.089 1.00 41.09 ? 73   GLU A CD  1 
ATOM   578  O  OE1 . GLU A 1 73  ? -8.234  69.118 76.338 1.00 42.12 ? 73   GLU A OE1 1 
ATOM   579  O  OE2 . GLU A 1 73  ? -8.982  68.676 74.317 1.00 43.05 ? 73   GLU A OE2 1 
ATOM   580  N  N   . GLN A 1 74  ? -1.965  69.054 75.450 1.00 32.06 ? 74   GLN A N   1 
ATOM   581  C  CA  . GLN A 1 74  ? -0.883  68.919 76.416 1.00 32.60 ? 74   GLN A CA  1 
ATOM   582  C  C   . GLN A 1 74  ? -0.431  70.271 76.988 1.00 32.25 ? 74   GLN A C   1 
ATOM   583  O  O   . GLN A 1 74  ? -0.098  70.361 78.160 1.00 32.64 ? 74   GLN A O   1 
ATOM   584  C  CB  . GLN A 1 74  ? 0.285   68.126 75.799 1.00 32.05 ? 74   GLN A CB  1 
ATOM   585  C  CG  . GLN A 1 74  ? 1.510   67.956 76.693 1.00 35.67 ? 74   GLN A CG  1 
ATOM   586  C  CD  . GLN A 1 74  ? 1.244   67.117 77.940 1.00 38.94 ? 74   GLN A CD  1 
ATOM   587  O  OE1 . GLN A 1 74  ? 0.841   65.960 77.852 1.00 41.67 ? 74   GLN A OE1 1 
ATOM   588  N  NE2 . GLN A 1 74  ? 1.470   67.708 79.109 1.00 40.78 ? 74   GLN A NE2 1 
ATOM   589  N  N   . PHE A 1 75  ? -0.449  71.321 76.172 1.00 31.65 ? 75   PHE A N   1 
ATOM   590  C  CA  . PHE A 1 75  ? -0.129  72.670 76.640 1.00 31.24 ? 75   PHE A CA  1 
ATOM   591  C  C   . PHE A 1 75  ? -1.182  73.705 76.208 1.00 32.18 ? 75   PHE A C   1 
ATOM   592  O  O   . PHE A 1 75  ? -0.949  74.476 75.266 1.00 32.34 ? 75   PHE A O   1 
ATOM   593  C  CB  . PHE A 1 75  ? 1.265   73.098 76.158 1.00 30.42 ? 75   PHE A CB  1 
ATOM   594  C  CG  . PHE A 1 75  ? 2.348   72.084 76.422 1.00 28.01 ? 75   PHE A CG  1 
ATOM   595  C  CD1 . PHE A 1 75  ? 2.875   71.912 77.709 1.00 25.79 ? 75   PHE A CD1 1 
ATOM   596  C  CD2 . PHE A 1 75  ? 2.873   71.326 75.372 1.00 26.69 ? 75   PHE A CD2 1 
ATOM   597  C  CE1 . PHE A 1 75  ? 3.885   70.978 77.948 1.00 25.93 ? 75   PHE A CE1 1 
ATOM   598  C  CE2 . PHE A 1 75  ? 3.899   70.403 75.585 1.00 25.81 ? 75   PHE A CE2 1 
ATOM   599  C  CZ  . PHE A 1 75  ? 4.408   70.217 76.888 1.00 25.06 ? 75   PHE A CZ  1 
ATOM   600  N  N   . PRO A 1 76  ? -2.343  73.749 76.903 1.00 33.02 ? 76   PRO A N   1 
ATOM   601  C  CA  . PRO A 1 76  ? -3.452  74.594 76.440 1.00 33.66 ? 76   PRO A CA  1 
ATOM   602  C  C   . PRO A 1 76  ? -3.048  76.050 76.285 1.00 34.13 ? 76   PRO A C   1 
ATOM   603  O  O   . PRO A 1 76  ? -2.430  76.615 77.174 1.00 35.48 ? 76   PRO A O   1 
ATOM   604  C  CB  . PRO A 1 76  ? -4.503  74.438 77.553 1.00 33.80 ? 76   PRO A CB  1 
ATOM   605  C  CG  . PRO A 1 76  ? -4.217  73.113 78.130 1.00 33.61 ? 76   PRO A CG  1 
ATOM   606  C  CD  . PRO A 1 76  ? -2.708  73.017 78.128 1.00 33.21 ? 76   PRO A CD  1 
ATOM   607  N  N   . GLY A 1 77  ? -3.379  76.655 75.153 1.00 34.46 ? 77   GLY A N   1 
ATOM   608  C  CA  . GLY A 1 77  ? -3.054  78.065 74.919 1.00 33.89 ? 77   GLY A CA  1 
ATOM   609  C  C   . GLY A 1 77  ? -1.636  78.344 74.440 1.00 33.23 ? 77   GLY A C   1 
ATOM   610  O  O   . GLY A 1 77  ? -1.312  79.477 74.117 1.00 34.41 ? 77   GLY A O   1 
ATOM   611  N  N   . PHE A 1 78  ? -0.780  77.329 74.400 1.00 32.03 ? 78   PHE A N   1 
ATOM   612  C  CA  . PHE A 1 78  ? 0.617   77.534 74.041 1.00 30.77 ? 78   PHE A CA  1 
ATOM   613  C  C   . PHE A 1 78  ? 0.738   77.488 72.517 1.00 30.37 ? 78   PHE A C   1 
ATOM   614  O  O   . PHE A 1 78  ? 0.294   76.529 71.890 1.00 29.92 ? 78   PHE A O   1 
ATOM   615  C  CB  . PHE A 1 78  ? 1.459   76.445 74.713 1.00 30.42 ? 78   PHE A CB  1 
ATOM   616  C  CG  . PHE A 1 78  ? 2.913   76.500 74.386 1.00 29.28 ? 78   PHE A CG  1 
ATOM   617  C  CD1 . PHE A 1 78  ? 3.690   77.592 74.765 1.00 30.05 ? 78   PHE A CD1 1 
ATOM   618  C  CD2 . PHE A 1 78  ? 3.520   75.445 73.728 1.00 26.31 ? 78   PHE A CD2 1 
ATOM   619  C  CE1 . PHE A 1 78  ? 5.037   77.633 74.464 1.00 28.63 ? 78   PHE A CE1 1 
ATOM   620  C  CE2 . PHE A 1 78  ? 4.851   75.479 73.431 1.00 25.99 ? 78   PHE A CE2 1 
ATOM   621  C  CZ  . PHE A 1 78  ? 5.619   76.574 73.803 1.00 26.87 ? 78   PHE A CZ  1 
ATOM   622  N  N   . SER A 1 79  ? 1.320   78.522 71.920 1.00 29.91 ? 79   SER A N   1 
ATOM   623  C  CA  . SER A 1 79  ? 1.372   78.605 70.445 1.00 29.88 ? 79   SER A CA  1 
ATOM   624  C  C   . SER A 1 79  ? 2.229   77.518 69.792 1.00 29.20 ? 79   SER A C   1 
ATOM   625  O  O   . SER A 1 79  ? 1.929   77.079 68.676 1.00 29.22 ? 79   SER A O   1 
ATOM   626  C  CB  . SER A 1 79  ? 1.846   79.978 69.981 1.00 29.84 ? 79   SER A CB  1 
ATOM   627  O  OG  . SER A 1 79  ? 3.219   80.125 70.268 1.00 31.06 ? 79   SER A OG  1 
ATOM   628  N  N   . GLY A 1 80  ? 3.289   77.087 70.476 1.00 28.05 ? 80   GLY A N   1 
ATOM   629  C  CA  . GLY A 1 80  ? 4.172   76.037 69.947 1.00 27.33 ? 80   GLY A CA  1 
ATOM   630  C  C   . GLY A 1 80  ? 3.468   74.740 69.572 1.00 27.17 ? 80   GLY A C   1 
ATOM   631  O  O   . GLY A 1 80  ? 3.865   74.060 68.610 1.00 26.05 ? 80   GLY A O   1 
ATOM   632  N  N   . SER A 1 81  ? 2.449   74.385 70.356 1.00 26.98 ? 81   SER A N   1 
ATOM   633  C  CA  . SER A 1 81  ? 1.679   73.161 70.148 1.00 27.56 ? 81   SER A CA  1 
ATOM   634  C  C   . SER A 1 81  ? 0.388   73.447 69.399 1.00 27.36 ? 81   SER A C   1 
ATOM   635  O  O   . SER A 1 81  ? -0.022  72.682 68.519 1.00 26.69 ? 81   SER A O   1 
ATOM   636  C  CB  . SER A 1 81  ? 1.365   72.476 71.490 1.00 28.25 ? 81   SER A CB  1 
ATOM   637  O  OG  . SER A 1 81  ? 0.709   73.361 72.393 1.00 30.63 ? 81   SER A OG  1 
ATOM   638  N  N   . GLU A 1 82  ? -0.257  74.557 69.733 1.00 27.17 ? 82   GLU A N   1 
ATOM   639  C  CA  . GLU A 1 82  ? -1.550  74.840 69.122 1.00 28.09 ? 82   GLU A CA  1 
ATOM   640  C  C   . GLU A 1 82  ? -1.476  75.202 67.628 1.00 27.34 ? 82   GLU A C   1 
ATOM   641  O  O   . GLU A 1 82  ? -2.468  75.061 66.911 1.00 27.09 ? 82   GLU A O   1 
ATOM   642  C  CB  . GLU A 1 82  ? -2.348  75.842 69.955 1.00 29.03 ? 82   GLU A CB  1 
ATOM   643  C  CG  . GLU A 1 82  ? -3.013  75.093 71.125 1.00 33.24 ? 82   GLU A CG  1 
ATOM   644  C  CD  . GLU A 1 82  ? -3.726  75.964 72.095 1.00 39.47 ? 82   GLU A CD  1 
ATOM   645  O  OE1 . GLU A 1 82  ? -3.552  77.198 72.032 1.00 41.61 ? 82   GLU A OE1 1 
ATOM   646  O  OE2 . GLU A 1 82  ? -4.468  75.403 72.940 1.00 41.53 ? 82   GLU A OE2 1 
ATOM   647  N  N   . MET A 1 83  ? -0.298  75.628 67.174 1.00 25.46 ? 83   MET A N   1 
ATOM   648  C  CA  . MET A 1 83  ? -0.078  75.928 65.756 1.00 25.74 ? 83   MET A CA  1 
ATOM   649  C  C   . MET A 1 83  ? -0.249  74.685 64.849 1.00 25.09 ? 83   MET A C   1 
ATOM   650  O  O   . MET A 1 83  ? -0.394  74.837 63.641 1.00 24.95 ? 83   MET A O   1 
ATOM   651  C  CB  . MET A 1 83  ? 1.310   76.544 65.534 1.00 25.53 ? 83   MET A CB  1 
ATOM   652  C  CG  . MET A 1 83  ? 2.450   75.560 65.771 1.00 26.92 ? 83   MET A CG  1 
ATOM   653  S  SD  . MET A 1 83  ? 4.096   76.228 65.462 1.00 31.28 ? 83   MET A SD  1 
ATOM   654  C  CE  . MET A 1 83  ? 4.191   76.159 63.673 1.00 29.09 ? 83   MET A CE  1 
ATOM   655  N  N   . TRP A 1 84  ? -0.243  73.479 65.446 1.00 23.97 ? 84   TRP A N   1 
ATOM   656  C  CA  . TRP A 1 84  ? -0.392  72.224 64.714 1.00 24.56 ? 84   TRP A CA  1 
ATOM   657  C  C   . TRP A 1 84  ? -1.811  71.674 64.776 1.00 24.34 ? 84   TRP A C   1 
ATOM   658  O  O   . TRP A 1 84  ? -2.152  70.759 64.020 1.00 24.54 ? 84   TRP A O   1 
ATOM   659  C  CB  . TRP A 1 84  ? 0.606   71.160 65.215 1.00 24.41 ? 84   TRP A CB  1 
ATOM   660  C  CG  . TRP A 1 84  ? 2.035   71.621 65.163 1.00 26.07 ? 84   TRP A CG  1 
ATOM   661  C  CD1 . TRP A 1 84  ? 2.836   71.928 66.227 1.00 27.03 ? 84   TRP A CD1 1 
ATOM   662  C  CD2 . TRP A 1 84  ? 2.832   71.837 63.985 1.00 26.62 ? 84   TRP A CD2 1 
ATOM   663  N  NE1 . TRP A 1 84  ? 4.083   72.317 65.788 1.00 28.52 ? 84   TRP A NE1 1 
ATOM   664  C  CE2 . TRP A 1 84  ? 4.110   72.264 64.418 1.00 27.07 ? 84   TRP A CE2 1 
ATOM   665  C  CE3 . TRP A 1 84  ? 2.595   71.693 62.604 1.00 25.58 ? 84   TRP A CE3 1 
ATOM   666  C  CZ2 . TRP A 1 84  ? 5.152   72.556 63.522 1.00 27.01 ? 84   TRP A CZ2 1 
ATOM   667  C  CZ3 . TRP A 1 84  ? 3.627   71.984 61.715 1.00 24.86 ? 84   TRP A CZ3 1 
ATOM   668  C  CH2 . TRP A 1 84  ? 4.890   72.414 62.178 1.00 25.83 ? 84   TRP A CH2 1 
ATOM   669  N  N   . ASN A 1 85  ? -2.626  72.239 65.665 1.00 24.35 ? 85   ASN A N   1 
ATOM   670  C  CA  . ASN A 1 85  ? -3.995  71.767 65.890 1.00 24.84 ? 85   ASN A CA  1 
ATOM   671  C  C   . ASN A 1 85  ? -4.921  72.302 64.810 1.00 24.84 ? 85   ASN A C   1 
ATOM   672  O  O   . ASN A 1 85  ? -4.627  73.358 64.226 1.00 24.47 ? 85   ASN A O   1 
ATOM   673  C  CB  . ASN A 1 85  ? -4.510  72.235 67.262 1.00 25.25 ? 85   ASN A CB  1 
ATOM   674  C  CG  . ASN A 1 85  ? -4.063  71.318 68.414 1.00 26.96 ? 85   ASN A CG  1 
ATOM   675  O  OD1 . ASN A 1 85  ? -3.743  70.141 68.216 1.00 31.82 ? 85   ASN A OD1 1 
ATOM   676  N  ND2 . ASN A 1 85  ? -4.088  71.848 69.620 1.00 27.39 ? 85   ASN A ND2 1 
ATOM   677  N  N   . PRO A 1 86  ? -6.039  71.594 64.549 1.00 24.92 ? 86   PRO A N   1 
ATOM   678  C  CA  . PRO A 1 86  ? -7.035  72.106 63.614 1.00 25.47 ? 86   PRO A CA  1 
ATOM   679  C  C   . PRO A 1 86  ? -7.433  73.521 64.027 1.00 26.68 ? 86   PRO A C   1 
ATOM   680  O  O   . PRO A 1 86  ? -7.670  73.768 65.227 1.00 26.19 ? 86   PRO A O   1 
ATOM   681  C  CB  . PRO A 1 86  ? -8.244  71.201 63.842 1.00 25.11 ? 86   PRO A CB  1 
ATOM   682  C  CG  . PRO A 1 86  ? -7.739  69.994 64.497 1.00 25.34 ? 86   PRO A CG  1 
ATOM   683  C  CD  . PRO A 1 86  ? -6.476  70.348 65.207 1.00 24.17 ? 86   PRO A CD  1 
ATOM   684  N  N   . ASN A 1 87  ? -7.491  74.430 63.056 1.00 26.84 ? 87   ASN A N   1 
ATOM   685  C  CA  . ASN A 1 87  ? -7.965  75.783 63.302 1.00 27.35 ? 87   ASN A CA  1 
ATOM   686  C  C   . ASN A 1 87  ? -9.308  76.066 62.624 1.00 28.10 ? 87   ASN A C   1 
ATOM   687  O  O   . ASN A 1 87  ? -9.750  77.210 62.580 1.00 27.90 ? 87   ASN A O   1 
ATOM   688  C  CB  . ASN A 1 87  ? -6.913  76.793 62.853 1.00 27.79 ? 87   ASN A CB  1 
ATOM   689  C  CG  . ASN A 1 87  ? -6.608  76.704 61.348 1.00 29.06 ? 87   ASN A CG  1 
ATOM   690  O  OD1 . ASN A 1 87  ? -6.999  75.746 60.661 1.00 27.59 ? 87   ASN A OD1 1 
ATOM   691  N  ND2 . ASN A 1 87  ? -5.921  77.719 60.834 1.00 29.47 ? 87   ASN A ND2 1 
ATOM   692  N  N   . ARG A 1 88  ? -9.929  75.021 62.071 1.00 27.72 ? 88   ARG A N   1 
ATOM   693  C  CA  A ARG A 1 88  ? -11.299 75.122 61.592 0.50 28.14 ? 88   ARG A CA  1 
ATOM   694  C  CA  B ARG A 1 88  ? -11.288 75.083 61.544 0.50 28.19 ? 88   ARG A CA  1 
ATOM   695  C  C   . ARG A 1 88  ? -12.095 74.005 62.257 1.00 28.41 ? 88   ARG A C   1 
ATOM   696  O  O   . ARG A 1 88  ? -11.519 73.143 62.928 1.00 28.92 ? 88   ARG A O   1 
ATOM   697  C  CB  A ARG A 1 88  ? -11.372 75.048 60.052 0.50 27.92 ? 88   ARG A CB  1 
ATOM   698  C  CB  B ARG A 1 88  ? -11.305 74.827 60.026 0.50 27.98 ? 88   ARG A CB  1 
ATOM   699  C  CG  A ARG A 1 88  ? -10.756 76.252 59.317 0.50 27.59 ? 88   ARG A CG  1 
ATOM   700  C  CG  B ARG A 1 88  ? -10.257 75.595 59.236 0.50 27.82 ? 88   ARG A CG  1 
ATOM   701  C  CD  A ARG A 1 88  ? -11.442 77.573 59.696 0.50 27.53 ? 88   ARG A CD  1 
ATOM   702  C  CD  B ARG A 1 88  ? -10.547 77.076 59.226 0.50 27.94 ? 88   ARG A CD  1 
ATOM   703  N  NE  A ARG A 1 88  ? -10.986 78.704 58.885 0.50 26.60 ? 88   ARG A NE  1 
ATOM   704  N  NE  B ARG A 1 88  ? -11.691 77.409 58.378 0.50 28.05 ? 88   ARG A NE  1 
ATOM   705  C  CZ  A ARG A 1 88  ? -9.950  79.483 59.188 0.50 26.19 ? 88   ARG A CZ  1 
ATOM   706  C  CZ  B ARG A 1 88  ? -12.149 78.644 58.202 0.50 29.13 ? 88   ARG A CZ  1 
ATOM   707  N  NH1 A ARG A 1 88  ? -9.243  79.264 60.289 0.50 24.47 ? 88   ARG A NH1 1 
ATOM   708  N  NH1 B ARG A 1 88  ? -11.563 79.656 58.833 0.50 28.83 ? 88   ARG A NH1 1 
ATOM   709  N  NH2 A ARG A 1 88  ? -9.623  80.486 58.385 0.50 26.30 ? 88   ARG A NH2 1 
ATOM   710  N  NH2 B ARG A 1 88  ? -13.188 78.869 57.397 0.50 27.62 ? 88   ARG A NH2 1 
ATOM   711  N  N   . GLU A 1 89  ? -13.413 74.041 62.103 1.00 28.64 ? 89   GLU A N   1 
ATOM   712  C  CA  A GLU A 1 89  ? -14.278 72.983 62.616 0.50 29.04 ? 89   GLU A CA  1 
ATOM   713  C  CA  B GLU A 1 89  ? -14.287 72.989 62.608 0.50 29.04 ? 89   GLU A CA  1 
ATOM   714  C  C   . GLU A 1 89  ? -13.861 71.638 62.020 1.00 28.82 ? 89   GLU A C   1 
ATOM   715  O  O   . GLU A 1 89  ? -13.439 71.565 60.856 1.00 28.33 ? 89   GLU A O   1 
ATOM   716  C  CB  A GLU A 1 89  ? -15.743 73.267 62.274 0.50 29.75 ? 89   GLU A CB  1 
ATOM   717  C  CB  B GLU A 1 89  ? -15.733 73.304 62.221 0.50 29.74 ? 89   GLU A CB  1 
ATOM   718  C  CG  A GLU A 1 89  ? -16.338 74.476 62.987 0.50 31.65 ? 89   GLU A CG  1 
ATOM   719  C  CG  B GLU A 1 89  ? -16.778 72.336 62.749 0.50 31.65 ? 89   GLU A CG  1 
ATOM   720  C  CD  A GLU A 1 89  ? -16.404 74.294 64.486 0.50 35.23 ? 89   GLU A CD  1 
ATOM   721  C  CD  B GLU A 1 89  ? -18.184 72.875 62.598 0.50 34.95 ? 89   GLU A CD  1 
ATOM   722  O  OE1 A GLU A 1 89  ? -16.491 73.130 64.942 0.50 36.86 ? 89   GLU A OE1 1 
ATOM   723  O  OE1 B GLU A 1 89  ? -19.038 72.150 62.050 0.50 36.51 ? 89   GLU A OE1 1 
ATOM   724  O  OE2 A GLU A 1 89  ? -16.365 75.316 65.206 0.50 36.93 ? 89   GLU A OE2 1 
ATOM   725  O  OE2 B GLU A 1 89  ? -18.428 74.032 63.013 0.50 37.25 ? 89   GLU A OE2 1 
ATOM   726  N  N   . MET A 1 90  ? -13.970 70.580 62.814 1.00 27.87 ? 90   MET A N   1 
ATOM   727  C  CA  . MET A 1 90  ? -13.629 69.248 62.333 1.00 26.97 ? 90   MET A CA  1 
ATOM   728  C  C   . MET A 1 90  ? -14.861 68.590 61.756 1.00 27.09 ? 90   MET A C   1 
ATOM   729  O  O   . MET A 1 90  ? -15.966 68.714 62.303 1.00 26.72 ? 90   MET A O   1 
ATOM   730  C  CB  . MET A 1 90  ? -13.043 68.381 63.452 1.00 27.37 ? 90   MET A CB  1 
ATOM   731  C  CG  . MET A 1 90  ? -11.613 68.774 63.845 1.00 26.42 ? 90   MET A CG  1 
ATOM   732  S  SD  . MET A 1 90  ? -10.856 67.602 64.988 1.00 26.76 ? 90   MET A SD  1 
ATOM   733  C  CE  . MET A 1 90  ? -11.987 67.716 66.392 1.00 26.03 ? 90   MET A CE  1 
ATOM   734  N  N   . SER A 1 91  ? -14.681 67.901 60.637 1.00 25.94 ? 91   SER A N   1 
ATOM   735  C  CA  . SER A 1 91  ? -15.780 67.197 60.018 1.00 25.54 ? 91   SER A CA  1 
ATOM   736  C  C   . SER A 1 91  ? -15.253 66.006 59.256 1.00 25.23 ? 91   SER A C   1 
ATOM   737  O  O   . SER A 1 91  ? -14.134 66.055 58.719 1.00 24.90 ? 91   SER A O   1 
ATOM   738  C  CB  . SER A 1 91  ? -16.511 68.121 59.030 1.00 24.83 ? 91   SER A CB  1 
ATOM   739  O  OG  . SER A 1 91  ? -17.667 67.465 58.548 1.00 25.78 ? 91   SER A OG  1 
ATOM   740  N  N   . GLU A 1 92  ? -16.059 64.947 59.164 1.00 24.94 ? 92   GLU A N   1 
ATOM   741  C  CA  . GLU A 1 92  ? -15.711 63.878 58.226 1.00 24.78 ? 92   GLU A CA  1 
ATOM   742  C  C   . GLU A 1 92  ? -15.841 64.367 56.776 1.00 24.84 ? 92   GLU A C   1 
ATOM   743  O  O   . GLU A 1 92  ? -15.246 63.788 55.848 1.00 24.27 ? 92   GLU A O   1 
ATOM   744  C  CB  . GLU A 1 92  ? -16.559 62.642 58.445 1.00 24.99 ? 92   GLU A CB  1 
ATOM   745  C  CG  . GLU A 1 92  ? -16.172 61.836 59.675 1.00 24.34 ? 92   GLU A CG  1 
ATOM   746  C  CD  . GLU A 1 92  ? -16.971 60.577 59.739 1.00 25.93 ? 92   GLU A CD  1 
ATOM   747  O  OE1 . GLU A 1 92  ? -18.118 60.644 60.229 1.00 27.69 ? 92   GLU A OE1 1 
ATOM   748  O  OE2 . GLU A 1 92  ? -16.456 59.532 59.279 1.00 25.21 ? 92   GLU A OE2 1 
ATOM   749  N  N   . ASP A 1 93  ? -16.624 65.429 56.590 1.00 24.69 ? 93   ASP A N   1 
ATOM   750  C  CA  . ASP A 1 93  ? -16.731 66.073 55.291 1.00 24.41 ? 93   ASP A CA  1 
ATOM   751  C  C   . ASP A 1 93  ? -15.542 67.021 55.161 1.00 23.55 ? 93   ASP A C   1 
ATOM   752  O  O   . ASP A 1 93  ? -15.651 68.200 55.485 1.00 23.26 ? 93   ASP A O   1 
ATOM   753  C  CB  . ASP A 1 93  ? -18.067 66.823 55.181 1.00 25.31 ? 93   ASP A CB  1 
ATOM   754  C  CG  . ASP A 1 93  ? -18.247 67.530 53.833 1.00 26.40 ? 93   ASP A CG  1 
ATOM   755  O  OD1 . ASP A 1 93  ? -17.324 67.495 52.983 1.00 26.69 ? 93   ASP A OD1 1 
ATOM   756  O  OD2 . ASP A 1 93  ? -19.320 68.134 53.633 1.00 30.22 ? 93   ASP A OD2 1 
ATOM   757  N  N   . CYS A 1 94  ? -14.397 66.509 54.704 1.00 22.66 ? 94   CYS A N   1 
ATOM   758  C  CA  . CYS A 1 94  ? -13.161 67.291 54.800 1.00 22.36 ? 94   CYS A CA  1 
ATOM   759  C  C   . CYS A 1 94  ? -12.235 67.164 53.605 1.00 22.76 ? 94   CYS A C   1 
ATOM   760  O  O   . CYS A 1 94  ? -11.078 67.630 53.666 1.00 21.87 ? 94   CYS A O   1 
ATOM   761  C  CB  . CYS A 1 94  ? -12.373 66.880 56.070 1.00 22.32 ? 94   CYS A CB  1 
ATOM   762  S  SG  . CYS A 1 94  ? -11.856 65.146 56.067 0.90 21.36 ? 94   CYS A SG  1 
ATOM   763  N  N   . LEU A 1 95  ? -12.720 66.550 52.523 1.00 22.93 ? 95   LEU A N   1 
ATOM   764  C  CA  . LEU A 1 95  ? -11.840 66.303 51.382 1.00 22.88 ? 95   LEU A CA  1 
ATOM   765  C  C   . LEU A 1 95  ? -11.881 67.458 50.386 1.00 23.37 ? 95   LEU A C   1 
ATOM   766  O  O   . LEU A 1 95  ? -12.687 67.457 49.439 1.00 23.20 ? 95   LEU A O   1 
ATOM   767  C  CB  . LEU A 1 95  ? -12.139 64.948 50.742 1.00 22.62 ? 95   LEU A CB  1 
ATOM   768  C  CG  . LEU A 1 95  ? -11.848 63.715 51.622 1.00 22.92 ? 95   LEU A CG  1 
ATOM   769  C  CD1 . LEU A 1 95  ? -12.157 62.462 50.835 1.00 23.77 ? 95   LEU A CD1 1 
ATOM   770  C  CD2 . LEU A 1 95  ? -10.396 63.671 52.155 1.00 20.28 ? 95   LEU A CD2 1 
ATOM   771  N  N   . TYR A 1 96  ? -11.014 68.441 50.647 1.00 23.28 ? 96   TYR A N   1 
ATOM   772  C  CA  . TYR A 1 96  ? -10.962 69.704 49.928 1.00 23.44 ? 96   TYR A CA  1 
ATOM   773  C  C   . TYR A 1 96  ? -9.524  70.073 49.651 1.00 22.80 ? 96   TYR A C   1 
ATOM   774  O  O   . TYR A 1 96  ? -8.597  69.582 50.321 1.00 23.76 ? 96   TYR A O   1 
ATOM   775  C  CB  . TYR A 1 96  ? -11.651 70.829 50.745 1.00 23.55 ? 96   TYR A CB  1 
ATOM   776  C  CG  . TYR A 1 96  ? -13.114 70.564 50.954 1.00 24.07 ? 96   TYR A CG  1 
ATOM   777  C  CD1 . TYR A 1 96  ? -13.547 69.820 52.047 1.00 23.75 ? 96   TYR A CD1 1 
ATOM   778  C  CD2 . TYR A 1 96  ? -14.070 71.019 50.037 1.00 23.68 ? 96   TYR A CD2 1 
ATOM   779  C  CE1 . TYR A 1 96  ? -14.888 69.533 52.231 1.00 26.05 ? 96   TYR A CE1 1 
ATOM   780  C  CE2 . TYR A 1 96  ? -15.428 70.739 50.217 1.00 25.70 ? 96   TYR A CE2 1 
ATOM   781  C  CZ  . TYR A 1 96  ? -15.822 69.989 51.309 1.00 25.47 ? 96   TYR A CZ  1 
ATOM   782  O  OH  . TYR A 1 96  ? -17.137 69.682 51.520 1.00 26.39 ? 96   TYR A OH  1 
ATOM   783  N  N   . LEU A 1 97  ? -9.316  70.917 48.651 1.00 22.45 ? 97   LEU A N   1 
ATOM   784  C  CA  . LEU A 1 97  ? -7.975  71.434 48.377 1.00 22.03 ? 97   LEU A CA  1 
ATOM   785  C  C   . LEU A 1 97  ? -7.979  72.953 48.220 1.00 22.18 ? 97   LEU A C   1 
ATOM   786  O  O   . LEU A 1 97  ? -9.033  73.572 47.970 1.00 22.59 ? 97   LEU A O   1 
ATOM   787  C  CB  . LEU A 1 97  ? -7.315  70.707 47.178 1.00 22.47 ? 97   LEU A CB  1 
ATOM   788  C  CG  . LEU A 1 97  ? -8.040  70.688 45.812 1.00 22.68 ? 97   LEU A CG  1 
ATOM   789  C  CD1 . LEU A 1 97  ? -7.881  72.018 45.102 1.00 22.23 ? 97   LEU A CD1 1 
ATOM   790  C  CD2 . LEU A 1 97  ? -7.525  69.573 44.922 1.00 23.52 ? 97   LEU A CD2 1 
ATOM   791  N  N   . ASN A 1 98  ? -6.797  73.543 48.345 1.00 22.51 ? 98   ASN A N   1 
ATOM   792  C  CA  . ASN A 1 98  ? -6.640  74.986 48.308 1.00 22.37 ? 98   ASN A CA  1 
ATOM   793  C  C   . ASN A 1 98  ? -5.601  75.310 47.254 1.00 22.63 ? 98   ASN A C   1 
ATOM   794  O  O   . ASN A 1 98  ? -4.612  74.591 47.121 1.00 22.50 ? 98   ASN A O   1 
ATOM   795  C  CB  . ASN A 1 98  ? -6.205  75.538 49.688 1.00 22.15 ? 98   ASN A CB  1 
ATOM   796  C  CG  . ASN A 1 98  ? -7.043  74.965 50.846 1.00 22.33 ? 98   ASN A CG  1 
ATOM   797  O  OD1 . ASN A 1 98  ? -8.234  75.207 50.931 1.00 21.10 ? 98   ASN A OD1 1 
ATOM   798  N  ND2 . ASN A 1 98  ? -6.402  74.195 51.743 1.00 22.26 ? 98   ASN A ND2 1 
ATOM   799  N  N   . ILE A 1 99  ? -5.828  76.379 46.497 1.00 22.29 ? 99   ILE A N   1 
ATOM   800  C  CA  . ILE A 1 99  ? -4.897  76.784 45.457 1.00 22.63 ? 99   ILE A CA  1 
ATOM   801  C  C   . ILE A 1 99  ? -4.579  78.284 45.543 1.00 23.61 ? 99   ILE A C   1 
ATOM   802  O  O   . ILE A 1 99  ? -5.503  79.109 45.581 1.00 23.91 ? 99   ILE A O   1 
ATOM   803  C  CB  . ILE A 1 99  ? -5.476  76.510 44.046 1.00 23.01 ? 99   ILE A CB  1 
ATOM   804  C  CG1 . ILE A 1 99  ? -6.115  75.113 43.969 1.00 22.46 ? 99   ILE A CG1 1 
ATOM   805  C  CG2 . ILE A 1 99  ? -4.374  76.753 43.003 1.00 21.03 ? 99   ILE A CG2 1 
ATOM   806  C  CD1 . ILE A 1 99  ? -6.784  74.774 42.614 1.00 25.77 ? 99   ILE A CD1 1 
ATOM   807  N  N   . TRP A 1 100 ? -3.296  78.627 45.580 1.00 23.84 ? 100  TRP A N   1 
ATOM   808  C  CA  . TRP A 1 100 ? -2.866  80.025 45.491 1.00 25.57 ? 100  TRP A CA  1 
ATOM   809  C  C   . TRP A 1 100 ? -2.309  80.233 44.090 1.00 26.18 ? 100  TRP A C   1 
ATOM   810  O  O   . TRP A 1 100 ? -1.487  79.444 43.621 1.00 26.73 ? 100  TRP A O   1 
ATOM   811  C  CB  . TRP A 1 100 ? -1.808  80.404 46.556 1.00 25.37 ? 100  TRP A CB  1 
ATOM   812  C  CG  . TRP A 1 100 ? -2.402  80.466 47.960 1.00 25.72 ? 100  TRP A CG  1 
ATOM   813  C  CD1 . TRP A 1 100 ? -2.899  81.572 48.610 1.00 25.69 ? 100  TRP A CD1 1 
ATOM   814  C  CD2 . TRP A 1 100 ? -2.586  79.365 48.847 1.00 24.23 ? 100  TRP A CD2 1 
ATOM   815  N  NE1 . TRP A 1 100 ? -3.377  81.221 49.851 1.00 25.75 ? 100  TRP A NE1 1 
ATOM   816  C  CE2 . TRP A 1 100 ? -3.192  79.870 50.024 1.00 26.85 ? 100  TRP A CE2 1 
ATOM   817  C  CE3 . TRP A 1 100 ? -2.291  77.994 48.769 1.00 23.38 ? 100  TRP A CE3 1 
ATOM   818  C  CZ2 . TRP A 1 100 ? -3.508  79.049 51.120 1.00 25.91 ? 100  TRP A CZ2 1 
ATOM   819  C  CZ3 . TRP A 1 100 ? -2.615  77.173 49.866 1.00 22.95 ? 100  TRP A CZ3 1 
ATOM   820  C  CH2 . TRP A 1 100 ? -3.212  77.708 51.019 1.00 25.78 ? 100  TRP A CH2 1 
ATOM   821  N  N   . VAL A 1 101 ? -2.773  81.293 43.432 1.00 26.81 ? 101  VAL A N   1 
ATOM   822  C  CA  . VAL A 1 101 ? -2.449  81.533 42.029 1.00 27.29 ? 101  VAL A CA  1 
ATOM   823  C  C   . VAL A 1 101 ? -1.865  82.942 41.859 1.00 27.82 ? 101  VAL A C   1 
ATOM   824  O  O   . VAL A 1 101 ? -2.499  83.914 42.239 1.00 27.89 ? 101  VAL A O   1 
ATOM   825  C  CB  . VAL A 1 101 ? -3.703  81.344 41.111 1.00 27.03 ? 101  VAL A CB  1 
ATOM   826  C  CG1 . VAL A 1 101 ? -3.346  81.601 39.646 1.00 26.14 ? 101  VAL A CG1 1 
ATOM   827  C  CG2 . VAL A 1 101 ? -4.318  79.931 41.261 1.00 25.80 ? 101  VAL A CG2 1 
ATOM   828  N  N   . PRO A 1 102 ? -0.658  83.054 41.281 1.00 28.74 ? 102  PRO A N   1 
ATOM   829  C  CA  . PRO A 1 102 ? -0.128  84.396 40.995 1.00 29.75 ? 102  PRO A CA  1 
ATOM   830  C  C   . PRO A 1 102 ? -1.116  85.283 40.201 1.00 31.16 ? 102  PRO A C   1 
ATOM   831  O  O   . PRO A 1 102 ? -2.016  84.775 39.491 1.00 30.81 ? 102  PRO A O   1 
ATOM   832  C  CB  . PRO A 1 102 ? 1.128   84.116 40.171 1.00 29.62 ? 102  PRO A CB  1 
ATOM   833  C  CG  . PRO A 1 102 ? 1.540   82.693 40.571 1.00 29.01 ? 102  PRO A CG  1 
ATOM   834  C  CD  . PRO A 1 102 ? 0.247   81.980 40.817 1.00 28.99 ? 102  PRO A CD  1 
ATOM   835  N  N   . SER A 1 103 ? -0.966  86.593 40.392 1.00 32.38 ? 103  SER A N   1 
ATOM   836  C  CA  . SER A 1 103 ? -1.754  87.611 39.709 1.00 33.93 ? 103  SER A CA  1 
ATOM   837  C  C   . SER A 1 103 ? -0.804  88.528 38.915 1.00 34.48 ? 103  SER A C   1 
ATOM   838  O  O   . SER A 1 103 ? 0.122   89.082 39.491 1.00 34.36 ? 103  SER A O   1 
ATOM   839  C  CB  . SER A 1 103 ? -2.542  88.432 40.731 1.00 34.14 ? 103  SER A CB  1 
ATOM   840  O  OG  . SER A 1 103 ? -3.347  89.394 40.081 1.00 35.49 ? 103  SER A OG  1 
ATOM   841  N  N   . PRO A 1 104 ? -1.028  88.683 37.588 1.00 34.78 ? 104  PRO A N   1 
ATOM   842  C  CA  . PRO A 1 104 ? -2.131  88.100 36.809 1.00 34.26 ? 104  PRO A CA  1 
ATOM   843  C  C   . PRO A 1 104 ? -1.991  86.582 36.666 1.00 33.10 ? 104  PRO A C   1 
ATOM   844  O  O   . PRO A 1 104 ? -0.892  86.055 36.823 1.00 31.98 ? 104  PRO A O   1 
ATOM   845  C  CB  . PRO A 1 104 ? -1.993  88.786 35.438 1.00 34.74 ? 104  PRO A CB  1 
ATOM   846  C  CG  . PRO A 1 104 ? -0.537  89.115 35.335 1.00 35.49 ? 104  PRO A CG  1 
ATOM   847  C  CD  . PRO A 1 104 ? -0.099  89.461 36.736 1.00 35.17 ? 104  PRO A CD  1 
ATOM   848  N  N   . ARG A 1 105 ? -3.098  85.901 36.380 1.00 32.24 ? 105  ARG A N   1 
ATOM   849  C  CA  . ARG A 1 105 ? -3.113  84.439 36.241 1.00 32.24 ? 105  ARG A CA  1 
ATOM   850  C  C   . ARG A 1 105 ? -2.052  83.970 35.247 1.00 32.38 ? 105  ARG A C   1 
ATOM   851  O  O   . ARG A 1 105 ? -2.002  84.465 34.127 1.00 32.46 ? 105  ARG A O   1 
ATOM   852  C  CB  . ARG A 1 105 ? -4.490  83.929 35.798 1.00 31.59 ? 105  ARG A CB  1 
ATOM   853  C  CG  . ARG A 1 105 ? -4.590  82.394 35.751 1.00 30.67 ? 105  ARG A CG  1 
ATOM   854  C  CD  . ARG A 1 105 ? -5.930  81.932 35.224 1.00 28.02 ? 105  ARG A CD  1 
ATOM   855  N  NE  . ARG A 1 105 ? -7.033  82.536 35.968 1.00 29.26 ? 105  ARG A NE  1 
ATOM   856  C  CZ  . ARG A 1 105 ? -8.313  82.499 35.597 1.00 30.40 ? 105  ARG A CZ  1 
ATOM   857  N  NH1 . ARG A 1 105 ? -8.680  81.889 34.472 1.00 28.56 ? 105  ARG A NH1 1 
ATOM   858  N  NH2 . ARG A 1 105 ? -9.235  83.088 36.355 1.00 29.54 ? 105  ARG A NH2 1 
ATOM   859  N  N   . PRO A 1 106 ? -1.196  83.019 35.658 1.00 32.51 ? 106  PRO A N   1 
ATOM   860  C  CA  . PRO A 1 106 ? -0.175  82.510 34.731 1.00 32.14 ? 106  PRO A CA  1 
ATOM   861  C  C   . PRO A 1 106 ? -0.803  81.668 33.631 1.00 31.96 ? 106  PRO A C   1 
ATOM   862  O  O   . PRO A 1 106 ? -2.002  81.361 33.669 1.00 30.56 ? 106  PRO A O   1 
ATOM   863  C  CB  . PRO A 1 106 ? 0.714   81.619 35.615 1.00 32.34 ? 106  PRO A CB  1 
ATOM   864  C  CG  . PRO A 1 106 ? 0.303   81.933 37.056 1.00 32.93 ? 106  PRO A CG  1 
ATOM   865  C  CD  . PRO A 1 106 ? -1.123  82.369 36.980 1.00 32.57 ? 106  PRO A CD  1 
ATOM   866  N  N   . LYS A 1 107 ? 0.017   81.295 32.660 1.00 32.31 ? 107  LYS A N   1 
ATOM   867  C  CA  . LYS A 1 107 ? -0.458  80.529 31.531 1.00 33.23 ? 107  LYS A CA  1 
ATOM   868  C  C   . LYS A 1 107 ? -0.184  79.044 31.719 1.00 33.12 ? 107  LYS A C   1 
ATOM   869  O  O   . LYS A 1 107 ? -1.089  78.220 31.592 1.00 33.07 ? 107  LYS A O   1 
ATOM   870  C  CB  . LYS A 1 107 ? 0.157   81.069 30.234 1.00 33.23 ? 107  LYS A CB  1 
ATOM   871  C  CG  . LYS A 1 107 ? -0.137  82.561 30.012 1.00 34.83 ? 107  LYS A CG  1 
ATOM   872  C  CD  . LYS A 1 107 ? -1.640  82.827 30.020 1.00 35.67 ? 107  LYS A CD  1 
ATOM   873  C  CE  . LYS A 1 107 ? -1.931  84.317 30.054 1.00 37.14 ? 107  LYS A CE  1 
ATOM   874  N  NZ  . LYS A 1 107 ? -3.383  84.518 30.254 1.00 38.71 ? 107  LYS A NZ  1 
ATOM   875  N  N   . SER A 1 108 ? 1.061   78.709 32.022 1.00 33.24 ? 108  SER A N   1 
ATOM   876  C  CA  . SER A 1 108 ? 1.449   77.319 32.197 1.00 33.89 ? 108  SER A CA  1 
ATOM   877  C  C   . SER A 1 108 ? 2.656   77.237 33.129 1.00 33.36 ? 108  SER A C   1 
ATOM   878  O  O   . SER A 1 108 ? 3.766   76.934 32.704 1.00 33.69 ? 108  SER A O   1 
ATOM   879  C  CB  . SER A 1 108 ? 1.762   76.685 30.846 1.00 33.98 ? 108  SER A CB  1 
ATOM   880  O  OG  . SER A 1 108 ? 2.281   75.386 31.012 1.00 36.39 ? 108  SER A OG  1 
ATOM   881  N  N   . THR A 1 109 ? 2.426   77.493 34.407 1.00 32.22 ? 109  THR A N   1 
ATOM   882  C  CA  . THR A 1 109 ? 3.532   77.600 35.334 1.00 31.86 ? 109  THR A CA  1 
ATOM   883  C  C   . THR A 1 109 ? 3.697   76.353 36.227 1.00 30.53 ? 109  THR A C   1 
ATOM   884  O  O   . THR A 1 109 ? 2.803   75.518 36.328 1.00 31.12 ? 109  THR A O   1 
ATOM   885  C  CB  . THR A 1 109 ? 3.428   78.893 36.166 1.00 31.65 ? 109  THR A CB  1 
ATOM   886  O  OG1 . THR A 1 109 ? 4.707   79.181 36.741 1.00 36.12 ? 109  THR A OG1 1 
ATOM   887  C  CG2 . THR A 1 109 ? 2.432   78.740 37.288 1.00 32.31 ? 109  THR A CG2 1 
ATOM   888  N  N   . THR A 1 110 ? 4.872   76.231 36.834 1.00 29.61 ? 110  THR A N   1 
ATOM   889  C  CA  . THR A 1 110 ? 5.193   75.170 37.788 1.00 28.19 ? 110  THR A CA  1 
ATOM   890  C  C   . THR A 1 110 ? 4.172   75.108 38.926 1.00 26.64 ? 110  THR A C   1 
ATOM   891  O  O   . THR A 1 110 ? 3.731   76.140 39.436 1.00 25.35 ? 110  THR A O   1 
ATOM   892  C  CB  . THR A 1 110 ? 6.591   75.414 38.328 1.00 28.95 ? 110  THR A CB  1 
ATOM   893  O  OG1 . THR A 1 110 ? 7.514   75.315 37.232 1.00 30.38 ? 110  THR A OG1 1 
ATOM   894  C  CG2 . THR A 1 110 ? 6.982   74.400 39.435 1.00 28.17 ? 110  THR A CG2 1 
ATOM   895  N  N   . VAL A 1 111 ? 3.781   73.882 39.277 1.00 25.13 ? 111  VAL A N   1 
ATOM   896  C  CA  . VAL A 1 111 ? 2.815   73.605 40.342 1.00 23.79 ? 111  VAL A CA  1 
ATOM   897  C  C   . VAL A 1 111 ? 3.509   72.827 41.480 1.00 23.42 ? 111  VAL A C   1 
ATOM   898  O  O   . VAL A 1 111 ? 4.302   71.919 41.220 1.00 23.21 ? 111  VAL A O   1 
ATOM   899  C  CB  . VAL A 1 111 ? 1.655   72.766 39.776 1.00 24.03 ? 111  VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 111 ? 0.625   72.360 40.864 1.00 23.20 ? 111  VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 111 ? 0.980   73.491 38.566 1.00 22.64 ? 111  VAL A CG2 1 
ATOM   902  N  N   . MET A 1 112 ? 3.214   73.202 42.727 1.00 22.94 ? 112  MET A N   1 
ATOM   903  C  CA  . MET A 1 112 ? 3.724   72.507 43.918 1.00 22.41 ? 112  MET A CA  1 
ATOM   904  C  C   . MET A 1 112 ? 2.511   72.141 44.752 1.00 22.40 ? 112  MET A C   1 
ATOM   905  O  O   . MET A 1 112 ? 1.631   72.982 44.990 1.00 22.84 ? 112  MET A O   1 
ATOM   906  C  CB  . MET A 1 112 ? 4.672   73.406 44.722 1.00 22.64 ? 112  MET A CB  1 
ATOM   907  C  CG  . MET A 1 112 ? 5.908   73.856 43.952 1.00 22.63 ? 112  MET A CG  1 
ATOM   908  S  SD  . MET A 1 112 ? 7.114   74.847 44.892 1.00 24.90 ? 112  MET A SD  1 
ATOM   909  C  CE  . MET A 1 112 ? 7.699   73.630 46.088 1.00 26.56 ? 112  MET A CE  1 
ATOM   910  N  N   . VAL A 1 113 ? 2.443   70.870 45.141 1.00 21.31 ? 113  VAL A N   1 
ATOM   911  C  CA  . VAL A 1 113 ? 1.346   70.358 45.898 1.00 20.23 ? 113  VAL A CA  1 
ATOM   912  C  C   . VAL A 1 113 ? 1.857   69.901 47.272 1.00 20.46 ? 113  VAL A C   1 
ATOM   913  O  O   . VAL A 1 113 ? 2.634   68.939 47.367 1.00 19.41 ? 113  VAL A O   1 
ATOM   914  C  CB  . VAL A 1 113 ? 0.627   69.159 45.200 1.00 20.00 ? 113  VAL A CB  1 
ATOM   915  C  CG1 . VAL A 1 113 ? -0.620  68.728 46.046 1.00 19.44 ? 113  VAL A CG1 1 
ATOM   916  C  CG2 . VAL A 1 113 ? 0.192   69.535 43.778 1.00 20.18 ? 113  VAL A CG2 1 
ATOM   917  N  N   . TRP A 1 114 ? 1.326   70.547 48.308 1.00 20.20 ? 114  TRP A N   1 
ATOM   918  C  CA  . TRP A 1 114 ? 1.732   70.307 49.695 1.00 20.43 ? 114  TRP A CA  1 
ATOM   919  C  C   . TRP A 1 114 ? 0.888   69.214 50.322 1.00 19.43 ? 114  TRP A C   1 
ATOM   920  O  O   . TRP A 1 114 ? -0.347  69.246 50.231 1.00 19.58 ? 114  TRP A O   1 
ATOM   921  C  CB  . TRP A 1 114 ? 1.579   71.590 50.521 1.00 19.56 ? 114  TRP A CB  1 
ATOM   922  C  CG  . TRP A 1 114 ? 1.888   71.406 51.993 1.00 20.43 ? 114  TRP A CG  1 
ATOM   923  C  CD1 . TRP A 1 114 ? 0.995   71.448 53.026 1.00 20.55 ? 114  TRP A CD1 1 
ATOM   924  C  CD2 . TRP A 1 114 ? 3.172   71.147 52.582 1.00 18.79 ? 114  TRP A CD2 1 
ATOM   925  N  NE1 . TRP A 1 114 ? 1.637   71.227 54.232 1.00 19.68 ? 114  TRP A NE1 1 
ATOM   926  C  CE2 . TRP A 1 114 ? 2.976   71.051 53.986 1.00 21.83 ? 114  TRP A CE2 1 
ATOM   927  C  CE3 . TRP A 1 114 ? 4.464   71.008 52.069 1.00 21.89 ? 114  TRP A CE3 1 
ATOM   928  C  CZ2 . TRP A 1 114 ? 4.026   70.821 54.874 1.00 20.85 ? 114  TRP A CZ2 1 
ATOM   929  C  CZ3 . TRP A 1 114 ? 5.520   70.776 52.952 1.00 21.68 ? 114  TRP A CZ3 1 
ATOM   930  C  CH2 . TRP A 1 114 ? 5.292   70.682 54.342 1.00 21.37 ? 114  TRP A CH2 1 
ATOM   931  N  N   . ILE A 1 115 ? 1.561   68.262 50.965 1.00 18.62 ? 115  ILE A N   1 
ATOM   932  C  CA  . ILE A 1 115 ? 0.898   67.175 51.681 1.00 18.73 ? 115  ILE A CA  1 
ATOM   933  C  C   . ILE A 1 115 ? 1.268   67.281 53.159 1.00 19.06 ? 115  ILE A C   1 
ATOM   934  O  O   . ILE A 1 115 ? 2.431   67.069 53.514 1.00 18.40 ? 115  ILE A O   1 
ATOM   935  C  CB  . ILE A 1 115 ? 1.349   65.788 51.158 1.00 19.37 ? 115  ILE A CB  1 
ATOM   936  C  CG1 . ILE A 1 115 ? 1.100   65.704 49.629 1.00 19.22 ? 115  ILE A CG1 1 
ATOM   937  C  CG2 . ILE A 1 115 ? 0.670   64.663 51.997 1.00 18.61 ? 115  ILE A CG2 1 
ATOM   938  C  CD1 . ILE A 1 115 ? 1.301   64.307 48.963 1.00 18.91 ? 115  ILE A CD1 1 
ATOM   939  N  N   . TYR A 1 116 ? 0.297   67.625 54.012 1.00 18.79 ? 116  TYR A N   1 
ATOM   940  C  CA  . TYR A 1 116 ? 0.609   67.861 55.432 1.00 19.24 ? 116  TYR A CA  1 
ATOM   941  C  C   . TYR A 1 116 ? 1.037   66.602 56.172 1.00 19.59 ? 116  TYR A C   1 
ATOM   942  O  O   . TYR A 1 116 ? 0.655   65.463 55.796 1.00 19.43 ? 116  TYR A O   1 
ATOM   943  C  CB  . TYR A 1 116 ? -0.528  68.596 56.177 1.00 18.55 ? 116  TYR A CB  1 
ATOM   944  C  CG  . TYR A 1 116 ? -1.889  67.895 56.178 1.00 18.49 ? 116  TYR A CG  1 
ATOM   945  C  CD1 . TYR A 1 116 ? -2.096  66.699 56.866 1.00 18.34 ? 116  TYR A CD1 1 
ATOM   946  C  CD2 . TYR A 1 116 ? -2.964  68.441 55.488 1.00 18.53 ? 116  TYR A CD2 1 
ATOM   947  C  CE1 . TYR A 1 116 ? -3.340  66.063 56.862 1.00 17.38 ? 116  TYR A CE1 1 
ATOM   948  C  CE2 . TYR A 1 116 ? -4.222  67.823 55.498 1.00 18.18 ? 116  TYR A CE2 1 
ATOM   949  C  CZ  . TYR A 1 116 ? -4.396  66.641 56.162 1.00 16.45 ? 116  TYR A CZ  1 
ATOM   950  O  OH  . TYR A 1 116 ? -5.640  66.045 56.148 1.00 18.25 ? 116  TYR A OH  1 
ATOM   951  N  N   . GLY A 1 117 ? 1.841   66.803 57.223 1.00 19.77 ? 117  GLY A N   1 
ATOM   952  C  CA  . GLY A 1 117 ? 2.218   65.695 58.127 1.00 19.38 ? 117  GLY A CA  1 
ATOM   953  C  C   . GLY A 1 117 ? 1.288   65.661 59.329 1.00 19.86 ? 117  GLY A C   1 
ATOM   954  O  O   . GLY A 1 117 ? 0.233   66.301 59.316 1.00 19.78 ? 117  GLY A O   1 
ATOM   955  N  N   . GLY A 1 118 ? 1.696   64.935 60.366 1.00 19.53 ? 118  GLY A N   1 
ATOM   956  C  CA  . GLY A 1 118 ? 0.868   64.713 61.556 1.00 18.89 ? 118  GLY A CA  1 
ATOM   957  C  C   . GLY A 1 118 ? 0.777   63.251 61.926 1.00 18.93 ? 118  GLY A C   1 
ATOM   958  O  O   . GLY A 1 118 ? -0.211  62.822 62.507 1.00 20.31 ? 118  GLY A O   1 
ATOM   959  N  N   . GLY A 1 119 ? 1.802   62.482 61.578 1.00 19.39 ? 119  GLY A N   1 
ATOM   960  C  CA  . GLY A 1 119 ? 1.899   61.059 61.963 1.00 19.17 ? 119  GLY A CA  1 
ATOM   961  C  C   . GLY A 1 119 ? 0.774   60.166 61.470 1.00 19.65 ? 119  GLY A C   1 
ATOM   962  O  O   . GLY A 1 119 ? 0.520   59.104 62.049 1.00 19.72 ? 119  GLY A O   1 
ATOM   963  N  N   . PHE A 1 120 ? 0.084   60.608 60.414 1.00 19.40 ? 120  PHE A N   1 
ATOM   964  C  CA  . PHE A 1 120 ? -1.121  59.941 59.887 1.00 19.35 ? 120  PHE A CA  1 
ATOM   965  C  C   . PHE A 1 120 ? -2.314  59.957 60.839 1.00 19.54 ? 120  PHE A C   1 
ATOM   966  O  O   . PHE A 1 120 ? -3.364  59.381 60.532 1.00 20.09 ? 120  PHE A O   1 
ATOM   967  C  CB  . PHE A 1 120 ? -0.828  58.508 59.392 1.00 18.94 ? 120  PHE A CB  1 
ATOM   968  C  CG  . PHE A 1 120 ? 0.162   58.446 58.247 1.00 19.64 ? 120  PHE A CG  1 
ATOM   969  C  CD1 . PHE A 1 120 ? -0.211  58.849 56.956 1.00 19.54 ? 120  PHE A CD1 1 
ATOM   970  C  CD2 . PHE A 1 120 ? 1.446   57.954 58.444 1.00 18.78 ? 120  PHE A CD2 1 
ATOM   971  C  CE1 . PHE A 1 120 ? 0.693   58.776 55.883 1.00 19.46 ? 120  PHE A CE1 1 
ATOM   972  C  CE2 . PHE A 1 120 ? 2.369   57.857 57.371 1.00 18.33 ? 120  PHE A CE2 1 
ATOM   973  C  CZ  . PHE A 1 120 ? 1.991   58.269 56.081 1.00 19.58 ? 120  PHE A CZ  1 
ATOM   974  N  N   . TYR A 1 121 ? -2.186  60.612 61.990 1.00 19.96 ? 121  TYR A N   1 
ATOM   975  C  CA  . TYR A 1 121 ? -3.318  60.655 62.939 1.00 20.37 ? 121  TYR A CA  1 
ATOM   976  C  C   . TYR A 1 121 ? -3.897  62.063 63.055 1.00 21.00 ? 121  TYR A C   1 
ATOM   977  O  O   . TYR A 1 121 ? -4.921  62.275 63.711 1.00 20.53 ? 121  TYR A O   1 
ATOM   978  C  CB  . TYR A 1 121 ? -2.907  60.132 64.332 1.00 21.06 ? 121  TYR A CB  1 
ATOM   979  C  CG  . TYR A 1 121 ? -1.946  61.037 65.090 1.00 20.27 ? 121  TYR A CG  1 
ATOM   980  C  CD1 . TYR A 1 121 ? -2.422  62.090 65.899 1.00 22.34 ? 121  TYR A CD1 1 
ATOM   981  C  CD2 . TYR A 1 121 ? -0.569  60.847 64.998 1.00 18.88 ? 121  TYR A CD2 1 
ATOM   982  C  CE1 . TYR A 1 121 ? -1.527  62.945 66.586 1.00 21.40 ? 121  TYR A CE1 1 
ATOM   983  C  CE2 . TYR A 1 121 ? 0.327   61.685 65.687 1.00 20.29 ? 121  TYR A CE2 1 
ATOM   984  C  CZ  . TYR A 1 121 ? -0.166  62.720 66.479 1.00 23.62 ? 121  TYR A CZ  1 
ATOM   985  O  OH  . TYR A 1 121 ? 0.722   63.546 67.158 1.00 28.02 ? 121  TYR A OH  1 
ATOM   986  N  N   . SER A 1 122 ? -3.230  63.031 62.426 1.00 20.95 ? 122  SER A N   1 
ATOM   987  C  CA  . SER A 1 122 ? -3.649  64.416 62.538 1.00 20.35 ? 122  SER A CA  1 
ATOM   988  C  C   . SER A 1 122 ? -3.123  65.209 61.355 1.00 20.56 ? 122  SER A C   1 
ATOM   989  O  O   . SER A 1 122 ? -2.365  64.675 60.532 1.00 20.77 ? 122  SER A O   1 
ATOM   990  C  CB  . SER A 1 122 ? -3.088  65.014 63.844 1.00 20.37 ? 122  SER A CB  1 
ATOM   991  O  OG  . SER A 1 122 ? -1.669  65.062 63.809 1.00 19.82 ? 122  SER A OG  1 
ATOM   992  N  N   . GLY A 1 123 ? -3.469  66.494 61.318 1.00 20.27 ? 123  GLY A N   1 
ATOM   993  C  CA  . GLY A 1 123 ? -2.970  67.409 60.298 1.00 20.71 ? 123  GLY A CA  1 
ATOM   994  C  C   . GLY A 1 123 ? -4.111  68.149 59.614 1.00 20.91 ? 123  GLY A C   1 
ATOM   995  O  O   . GLY A 1 123 ? -5.240  67.692 59.626 1.00 21.51 ? 123  GLY A O   1 
ATOM   996  N  N   . SER A 1 124 ? -3.803  69.299 59.034 1.00 21.53 ? 124  SER A N   1 
ATOM   997  C  CA  . SER A 1 124 ? -4.792  70.182 58.425 1.00 22.03 ? 124  SER A CA  1 
ATOM   998  C  C   . SER A 1 124 ? -4.100  70.953 57.310 1.00 22.12 ? 124  SER A C   1 
ATOM   999  O  O   . SER A 1 124 ? -2.940  71.320 57.440 1.00 22.29 ? 124  SER A O   1 
ATOM   1000 C  CB  . SER A 1 124 ? -5.297  71.218 59.444 1.00 21.75 ? 124  SER A CB  1 
ATOM   1001 O  OG  . SER A 1 124 ? -5.978  70.611 60.522 1.00 23.75 ? 124  SER A OG  1 
ATOM   1002 N  N   . SER A 1 125 ? -4.824  71.240 56.238 1.00 22.58 ? 125  SER A N   1 
ATOM   1003 C  CA  . SER A 1 125 ? -4.257  72.007 55.129 1.00 23.42 ? 125  SER A CA  1 
ATOM   1004 C  C   . SER A 1 125 ? -4.279  73.509 55.462 1.00 24.16 ? 125  SER A C   1 
ATOM   1005 O  O   . SER A 1 125 ? -3.617  74.316 54.802 1.00 24.75 ? 125  SER A O   1 
ATOM   1006 C  CB  . SER A 1 125 ? -5.066  71.744 53.851 1.00 23.13 ? 125  SER A CB  1 
ATOM   1007 O  OG  . SER A 1 125 ? -6.407  72.204 53.986 1.00 23.91 ? 125  SER A OG  1 
ATOM   1008 N  N   . THR A 1 126 ? -5.026  73.856 56.506 1.00 24.12 ? 126  THR A N   1 
ATOM   1009 C  CA  . THR A 1 126 ? -5.421  75.246 56.788 1.00 24.18 ? 126  THR A CA  1 
ATOM   1010 C  C   . THR A 1 126 ? -4.546  75.955 57.809 1.00 24.49 ? 126  THR A C   1 
ATOM   1011 O  O   . THR A 1 126 ? -4.782  77.107 58.128 1.00 23.86 ? 126  THR A O   1 
ATOM   1012 C  CB  . THR A 1 126 ? -6.889  75.275 57.266 1.00 24.40 ? 126  THR A CB  1 
ATOM   1013 O  OG1 . THR A 1 126 ? -7.030  74.434 58.418 1.00 23.45 ? 126  THR A OG1 1 
ATOM   1014 C  CG2 . THR A 1 126 ? -7.817  74.740 56.167 1.00 23.59 ? 126  THR A CG2 1 
ATOM   1015 N  N   . LEU A 1 127 ? -3.520  75.278 58.311 1.00 25.07 ? 127  LEU A N   1 
ATOM   1016 C  CA  . LEU A 1 127 ? -2.644  75.863 59.322 1.00 25.89 ? 127  LEU A CA  1 
ATOM   1017 C  C   . LEU A 1 127 ? -1.987  77.149 58.823 1.00 26.79 ? 127  LEU A C   1 
ATOM   1018 O  O   . LEU A 1 127 ? -1.635  77.238 57.645 1.00 26.16 ? 127  LEU A O   1 
ATOM   1019 C  CB  . LEU A 1 127 ? -1.568  74.845 59.734 1.00 25.56 ? 127  LEU A CB  1 
ATOM   1020 C  CG  . LEU A 1 127 ? -2.042  73.466 60.232 1.00 25.83 ? 127  LEU A CG  1 
ATOM   1021 C  CD1 . LEU A 1 127 ? -0.849  72.661 60.778 1.00 23.59 ? 127  LEU A CD1 1 
ATOM   1022 C  CD2 . LEU A 1 127 ? -3.148  73.610 61.271 1.00 25.54 ? 127  LEU A CD2 1 
ATOM   1023 N  N   . ASP A 1 128 ? -1.805  78.134 59.715 1.00 27.27 ? 128  ASP A N   1 
ATOM   1024 C  CA  . ASP A 1 128 ? -1.098  79.390 59.365 1.00 27.68 ? 128  ASP A CA  1 
ATOM   1025 C  C   . ASP A 1 128 ? 0.256   79.125 58.762 1.00 26.82 ? 128  ASP A C   1 
ATOM   1026 O  O   . ASP A 1 128 ? 0.719   79.854 57.875 1.00 26.30 ? 128  ASP A O   1 
ATOM   1027 C  CB  . ASP A 1 128 ? -0.873  80.274 60.603 1.00 28.67 ? 128  ASP A CB  1 
ATOM   1028 C  CG  . ASP A 1 128 ? -2.161  80.779 61.200 1.00 31.79 ? 128  ASP A CG  1 
ATOM   1029 O  OD1 . ASP A 1 128 ? -3.202  80.762 60.513 1.00 35.60 ? 128  ASP A OD1 1 
ATOM   1030 O  OD2 . ASP A 1 128 ? -2.131  81.201 62.375 1.00 39.03 ? 128  ASP A OD2 1 
ATOM   1031 N  N   . VAL A 1 129 ? 0.904   78.081 59.261 1.00 25.69 ? 129  VAL A N   1 
ATOM   1032 C  CA  . VAL A 1 129 ? 2.236   77.743 58.816 1.00 25.18 ? 129  VAL A CA  1 
ATOM   1033 C  C   . VAL A 1 129 ? 2.259   77.135 57.382 1.00 24.83 ? 129  VAL A C   1 
ATOM   1034 O  O   . VAL A 1 129 ? 3.316   77.067 56.760 1.00 25.07 ? 129  VAL A O   1 
ATOM   1035 C  CB  . VAL A 1 129 ? 2.954   76.858 59.898 1.00 25.92 ? 129  VAL A CB  1 
ATOM   1036 C  CG1 . VAL A 1 129 ? 2.473   75.398 59.869 1.00 25.18 ? 129  VAL A CG1 1 
ATOM   1037 C  CG2 . VAL A 1 129 ? 4.419   76.946 59.767 1.00 26.20 ? 129  VAL A CG2 1 
ATOM   1038 N  N   . TYR A 1 130 ? 1.097   76.736 56.864 1.00 24.53 ? 130  TYR A N   1 
ATOM   1039 C  CA  . TYR A 1 130 ? 0.984   76.197 55.478 1.00 24.49 ? 130  TYR A CA  1 
ATOM   1040 C  C   . TYR A 1 130 ? 0.320   77.199 54.509 1.00 24.83 ? 130  TYR A C   1 
ATOM   1041 O  O   . TYR A 1 130 ? -0.105  76.831 53.404 1.00 24.35 ? 130  TYR A O   1 
ATOM   1042 C  CB  . TYR A 1 130 ? 0.159   74.901 55.452 1.00 24.00 ? 130  TYR A CB  1 
ATOM   1043 C  CG  . TYR A 1 130 ? 0.629   73.769 56.356 1.00 22.34 ? 130  TYR A CG  1 
ATOM   1044 C  CD1 . TYR A 1 130 ? 1.966   73.637 56.725 1.00 20.45 ? 130  TYR A CD1 1 
ATOM   1045 C  CD2 . TYR A 1 130 ? -0.274  72.816 56.806 1.00 22.27 ? 130  TYR A CD2 1 
ATOM   1046 C  CE1 . TYR A 1 130 ? 2.388   72.579 57.547 1.00 21.57 ? 130  TYR A CE1 1 
ATOM   1047 C  CE2 . TYR A 1 130 ? 0.130   71.764 57.636 1.00 22.22 ? 130  TYR A CE2 1 
ATOM   1048 C  CZ  . TYR A 1 130 ? 1.461   71.650 57.995 1.00 20.88 ? 130  TYR A CZ  1 
ATOM   1049 O  OH  . TYR A 1 130 ? 1.859   70.600 58.815 1.00 22.36 ? 130  TYR A OH  1 
ATOM   1050 N  N   . ASN A 1 131 ? 0.203   78.454 54.935 1.00 25.51 ? 131  ASN A N   1 
ATOM   1051 C  CA  . ASN A 1 131 ? -0.380  79.503 54.082 1.00 26.02 ? 131  ASN A CA  1 
ATOM   1052 C  C   . ASN A 1 131 ? 0.453   79.620 52.813 1.00 25.91 ? 131  ASN A C   1 
ATOM   1053 O  O   . ASN A 1 131 ? 1.608   80.066 52.849 1.00 26.30 ? 131  ASN A O   1 
ATOM   1054 C  CB  . ASN A 1 131 ? -0.445  80.845 54.836 1.00 25.91 ? 131  ASN A CB  1 
ATOM   1055 C  CG  . ASN A 1 131 ? -1.375  81.872 54.162 1.00 27.77 ? 131  ASN A CG  1 
ATOM   1056 O  OD1 . ASN A 1 131 ? -1.683  81.778 52.971 1.00 27.31 ? 131  ASN A OD1 1 
ATOM   1057 N  ND2 . ASN A 1 131 ? -1.806  82.873 54.938 1.00 30.33 ? 131  ASN A ND2 1 
ATOM   1058 N  N   . GLY A 1 132 ? -0.115  79.186 51.690 1.00 25.82 ? 132  GLY A N   1 
ATOM   1059 C  CA  . GLY A 1 132 ? 0.651   79.126 50.452 1.00 26.06 ? 132  GLY A CA  1 
ATOM   1060 C  C   . GLY A 1 132 ? 0.918   80.460 49.768 1.00 26.72 ? 132  GLY A C   1 
ATOM   1061 O  O   . GLY A 1 132 ? 1.662   80.515 48.786 1.00 26.17 ? 132  GLY A O   1 
ATOM   1062 N  N   . LYS A 1 133 ? 0.327   81.537 50.282 1.00 27.22 ? 133  LYS A N   1 
ATOM   1063 C  CA  . LYS A 1 133 ? 0.397   82.830 49.570 1.00 27.97 ? 133  LYS A CA  1 
ATOM   1064 C  C   . LYS A 1 133 ? 1.812   83.367 49.369 1.00 28.30 ? 133  LYS A C   1 
ATOM   1065 O  O   . LYS A 1 133 ? 2.122   83.859 48.280 1.00 28.56 ? 133  LYS A O   1 
ATOM   1066 C  CB  . LYS A 1 133 ? -0.546  83.875 50.173 1.00 27.60 ? 133  LYS A CB  1 
ATOM   1067 C  CG  . LYS A 1 133 ? -0.060  84.525 51.458 1.00 28.21 ? 133  LYS A CG  1 
ATOM   1068 C  CD  . LYS A 1 133 ? -1.199  85.257 52.121 1.00 29.39 ? 133  LYS A CD  1 
ATOM   1069 C  CE  . LYS A 1 133 ? -0.687  86.234 53.174 1.00 31.41 ? 133  LYS A CE  1 
ATOM   1070 N  NZ  . LYS A 1 133 ? -1.828  87.014 53.725 1.00 32.39 ? 133  LYS A NZ  1 
ATOM   1071 N  N   . TYR A 1 134 ? 2.677   83.252 50.382 1.00 28.65 ? 134  TYR A N   1 
ATOM   1072 C  CA  . TYR A 1 134 ? 4.025   83.824 50.304 1.00 28.65 ? 134  TYR A CA  1 
ATOM   1073 C  C   . TYR A 1 134 ? 4.868   83.131 49.252 1.00 29.03 ? 134  TYR A C   1 
ATOM   1074 O  O   . TYR A 1 134 ? 5.564   83.789 48.472 1.00 29.20 ? 134  TYR A O   1 
ATOM   1075 C  CB  . TYR A 1 134 ? 4.737   83.797 51.673 1.00 29.04 ? 134  TYR A CB  1 
ATOM   1076 C  CG  . TYR A 1 134 ? 3.877   84.340 52.785 1.00 30.41 ? 134  TYR A CG  1 
ATOM   1077 C  CD1 . TYR A 1 134 ? 3.599   85.709 52.876 1.00 31.49 ? 134  TYR A CD1 1 
ATOM   1078 C  CD2 . TYR A 1 134 ? 3.313   83.487 53.732 1.00 32.39 ? 134  TYR A CD2 1 
ATOM   1079 C  CE1 . TYR A 1 134 ? 2.793   86.212 53.883 1.00 32.57 ? 134  TYR A CE1 1 
ATOM   1080 C  CE2 . TYR A 1 134 ? 2.498   83.982 54.746 1.00 34.03 ? 134  TYR A CE2 1 
ATOM   1081 C  CZ  . TYR A 1 134 ? 2.244   85.347 54.814 1.00 34.59 ? 134  TYR A CZ  1 
ATOM   1082 O  OH  . TYR A 1 134 ? 1.428   85.838 55.816 1.00 37.01 ? 134  TYR A OH  1 
ATOM   1083 N  N   . LEU A 1 135 ? 4.803   81.799 49.221 1.00 28.77 ? 135  LEU A N   1 
ATOM   1084 C  CA  . LEU A 1 135 ? 5.578   81.026 48.261 1.00 28.80 ? 135  LEU A CA  1 
ATOM   1085 C  C   . LEU A 1 135 ? 5.053   81.234 46.838 1.00 28.61 ? 135  LEU A C   1 
ATOM   1086 O  O   . LEU A 1 135 ? 5.827   81.437 45.909 1.00 29.07 ? 135  LEU A O   1 
ATOM   1087 C  CB  . LEU A 1 135 ? 5.546   79.535 48.633 1.00 28.83 ? 135  LEU A CB  1 
ATOM   1088 C  CG  . LEU A 1 135 ? 6.360   78.530 47.830 1.00 29.60 ? 135  LEU A CG  1 
ATOM   1089 C  CD1 . LEU A 1 135 ? 7.845   78.927 47.735 1.00 28.10 ? 135  LEU A CD1 1 
ATOM   1090 C  CD2 . LEU A 1 135 ? 6.196   77.141 48.482 1.00 29.79 ? 135  LEU A CD2 1 
ATOM   1091 N  N   . ALA A 1 136 ? 3.740   81.184 46.682 1.00 28.80 ? 136  ALA A N   1 
ATOM   1092 C  CA  . ALA A 1 136 ? 3.109   81.366 45.380 1.00 29.46 ? 136  ALA A CA  1 
ATOM   1093 C  C   . ALA A 1 136 ? 3.472   82.747 44.828 1.00 30.04 ? 136  ALA A C   1 
ATOM   1094 O  O   . ALA A 1 136 ? 3.902   82.875 43.677 1.00 30.56 ? 136  ALA A O   1 
ATOM   1095 C  CB  . ALA A 1 136 ? 1.600   81.210 45.500 1.00 28.55 ? 136  ALA A CB  1 
ATOM   1096 N  N   . TYR A 1 137 ? 3.341   83.766 45.669 1.00 30.23 ? 137  TYR A N   1 
ATOM   1097 C  CA  . TYR A 1 137 ? 3.654   85.127 45.267 1.00 30.75 ? 137  TYR A CA  1 
ATOM   1098 C  C   . TYR A 1 137 ? 5.133   85.320 44.939 1.00 30.95 ? 137  TYR A C   1 
ATOM   1099 O  O   . TYR A 1 137 ? 5.477   85.853 43.879 1.00 31.15 ? 137  TYR A O   1 
ATOM   1100 C  CB  . TYR A 1 137 ? 3.187   86.124 46.332 1.00 30.83 ? 137  TYR A CB  1 
ATOM   1101 C  CG  . TYR A 1 137 ? 3.654   87.525 46.070 1.00 32.56 ? 137  TYR A CG  1 
ATOM   1102 C  CD1 . TYR A 1 137 ? 3.053   88.310 45.078 1.00 34.42 ? 137  TYR A CD1 1 
ATOM   1103 C  CD2 . TYR A 1 137 ? 4.712   88.067 46.802 1.00 33.50 ? 137  TYR A CD2 1 
ATOM   1104 C  CE1 . TYR A 1 137 ? 3.502   89.617 44.821 1.00 35.89 ? 137  TYR A CE1 1 
ATOM   1105 C  CE2 . TYR A 1 137 ? 5.165   89.364 46.562 1.00 35.34 ? 137  TYR A CE2 1 
ATOM   1106 C  CZ  . TYR A 1 137 ? 4.552   90.130 45.576 1.00 36.68 ? 137  TYR A CZ  1 
ATOM   1107 O  OH  . TYR A 1 137 ? 5.005   91.407 45.358 1.00 39.04 ? 137  TYR A OH  1 
ATOM   1108 N  N   . THR A 1 138 ? 6.010   84.871 45.835 1.00 30.50 ? 138  THR A N   1 
ATOM   1109 C  CA  . THR A 1 138 ? 7.428   85.179 45.724 1.00 30.17 ? 138  THR A CA  1 
ATOM   1110 C  C   . THR A 1 138 ? 8.075   84.417 44.577 1.00 30.28 ? 138  THR A C   1 
ATOM   1111 O  O   . THR A 1 138 ? 8.868   84.981 43.821 1.00 30.40 ? 138  THR A O   1 
ATOM   1112 C  CB  . THR A 1 138 ? 8.170   84.881 47.051 1.00 30.57 ? 138  THR A CB  1 
ATOM   1113 O  OG1 . THR A 1 138 ? 7.569   85.649 48.103 1.00 30.02 ? 138  THR A OG1 1 
ATOM   1114 C  CG2 . THR A 1 138 ? 9.647   85.210 46.953 1.00 30.38 ? 138  THR A CG2 1 
ATOM   1115 N  N   . GLU A 1 139 ? 7.741   83.137 44.450 1.00 29.32 ? 139  GLU A N   1 
ATOM   1116 C  CA  . GLU A 1 139 ? 8.386   82.293 43.458 1.00 29.54 ? 139  GLU A CA  1 
ATOM   1117 C  C   . GLU A 1 139 ? 7.561   82.073 42.183 1.00 29.63 ? 139  GLU A C   1 
ATOM   1118 O  O   . GLU A 1 139 ? 8.016   81.383 41.274 1.00 29.84 ? 139  GLU A O   1 
ATOM   1119 C  CB  . GLU A 1 139 ? 8.815   80.964 44.095 1.00 29.38 ? 139  GLU A CB  1 
ATOM   1120 C  CG  . GLU A 1 139 ? 9.901   81.148 45.162 1.00 29.01 ? 139  GLU A CG  1 
ATOM   1121 C  CD  . GLU A 1 139 ? 11.209  81.622 44.574 1.00 30.97 ? 139  GLU A CD  1 
ATOM   1122 O  OE1 . GLU A 1 139 ? 11.579  81.155 43.479 1.00 34.78 ? 139  GLU A OE1 1 
ATOM   1123 O  OE2 . GLU A 1 139 ? 11.881  82.456 45.200 1.00 29.73 ? 139  GLU A OE2 1 
ATOM   1124 N  N   . GLU A 1 140 ? 6.356   82.647 42.136 1.00 29.88 ? 140  GLU A N   1 
ATOM   1125 C  CA  . GLU A 1 140 ? 5.499   82.584 40.946 1.00 30.92 ? 140  GLU A CA  1 
ATOM   1126 C  C   . GLU A 1 140 ? 5.161   81.146 40.568 1.00 29.78 ? 140  GLU A C   1 
ATOM   1127 O  O   . GLU A 1 140 ? 5.325   80.730 39.419 1.00 29.69 ? 140  GLU A O   1 
ATOM   1128 C  CB  . GLU A 1 140 ? 6.130   83.357 39.770 1.00 31.74 ? 140  GLU A CB  1 
ATOM   1129 C  CG  . GLU A 1 140 ? 6.371   84.812 40.123 1.00 36.22 ? 140  GLU A CG  1 
ATOM   1130 C  CD  . GLU A 1 140 ? 6.854   85.640 38.948 1.00 42.26 ? 140  GLU A CD  1 
ATOM   1131 O  OE1 . GLU A 1 140 ? 8.080   85.662 38.668 1.00 44.49 ? 140  GLU A OE1 1 
ATOM   1132 O  OE2 . GLU A 1 140 ? 5.994   86.279 38.317 1.00 45.13 ? 140  GLU A OE2 1 
ATOM   1133 N  N   . VAL A 1 141 ? 4.692   80.391 41.559 1.00 28.42 ? 141  VAL A N   1 
ATOM   1134 C  CA  . VAL A 1 141 ? 4.184   79.052 41.322 1.00 26.67 ? 141  VAL A CA  1 
ATOM   1135 C  C   . VAL A 1 141 ? 2.716   79.007 41.674 1.00 26.23 ? 141  VAL A C   1 
ATOM   1136 O  O   . VAL A 1 141 ? 2.224   79.834 42.442 1.00 26.36 ? 141  VAL A O   1 
ATOM   1137 C  CB  . VAL A 1 141 ? 4.970   77.965 42.122 1.00 26.94 ? 141  VAL A CB  1 
ATOM   1138 C  CG1 . VAL A 1 141 ? 6.460   77.963 41.731 1.00 26.70 ? 141  VAL A CG1 1 
ATOM   1139 C  CG2 . VAL A 1 141 ? 4.791   78.165 43.645 1.00 25.89 ? 141  VAL A CG2 1 
ATOM   1140 N  N   . VAL A 1 142 ? 2.013   78.030 41.112 1.00 25.70 ? 142  VAL A N   1 
ATOM   1141 C  CA  . VAL A 1 142 ? 0.678   77.695 41.559 1.00 25.24 ? 142  VAL A CA  1 
ATOM   1142 C  C   . VAL A 1 142 ? 0.871   76.727 42.732 1.00 25.61 ? 142  VAL A C   1 
ATOM   1143 O  O   . VAL A 1 142 ? 1.462   75.664 42.574 1.00 25.48 ? 142  VAL A O   1 
ATOM   1144 C  CB  . VAL A 1 142 ? -0.150  77.067 40.415 1.00 25.25 ? 142  VAL A CB  1 
ATOM   1145 C  CG1 . VAL A 1 142 ? -1.455  76.514 40.917 1.00 24.83 ? 142  VAL A CG1 1 
ATOM   1146 C  CG2 . VAL A 1 142 ? -0.431  78.130 39.346 1.00 25.73 ? 142  VAL A CG2 1 
ATOM   1147 N  N   . LEU A 1 143 ? 0.406   77.132 43.911 1.00 25.61 ? 143  LEU A N   1 
ATOM   1148 C  CA  . LEU A 1 143 ? 0.639   76.352 45.131 1.00 24.99 ? 143  LEU A CA  1 
ATOM   1149 C  C   . LEU A 1 143 ? -0.659  75.708 45.530 1.00 23.87 ? 143  LEU A C   1 
ATOM   1150 O  O   . LEU A 1 143 ? -1.658  76.402 45.760 1.00 24.04 ? 143  LEU A O   1 
ATOM   1151 C  CB  . LEU A 1 143 ? 1.165   77.249 46.276 1.00 25.23 ? 143  LEU A CB  1 
ATOM   1152 C  CG  . LEU A 1 143 ? 1.811   76.585 47.520 1.00 26.00 ? 143  LEU A CG  1 
ATOM   1153 C  CD1 . LEU A 1 143 ? 0.770   75.843 48.376 1.00 26.35 ? 143  LEU A CD1 1 
ATOM   1154 C  CD2 . LEU A 1 143 ? 2.912   75.644 47.128 1.00 28.04 ? 143  LEU A CD2 1 
ATOM   1155 N  N   . VAL A 1 144 ? -0.657  74.384 45.610 1.00 22.55 ? 144  VAL A N   1 
ATOM   1156 C  CA  . VAL A 1 144 ? -1.849  73.656 46.030 1.00 21.77 ? 144  VAL A CA  1 
ATOM   1157 C  C   . VAL A 1 144 ? -1.596  72.984 47.386 1.00 21.99 ? 144  VAL A C   1 
ATOM   1158 O  O   . VAL A 1 144 ? -0.509  72.417 47.605 1.00 21.73 ? 144  VAL A O   1 
ATOM   1159 C  CB  . VAL A 1 144 ? -2.218  72.528 45.009 1.00 21.74 ? 144  VAL A CB  1 
ATOM   1160 C  CG1 . VAL A 1 144 ? -3.428  71.705 45.486 1.00 20.45 ? 144  VAL A CG1 1 
ATOM   1161 C  CG2 . VAL A 1 144 ? -2.459  73.108 43.602 1.00 21.11 ? 144  VAL A CG2 1 
ATOM   1162 N  N   . SER A 1 145 ? -2.600  73.003 48.268 1.00 21.81 ? 145  SER A N   1 
ATOM   1163 C  CA  . SER A 1 145 ? -2.556  72.118 49.433 1.00 21.88 ? 145  SER A CA  1 
ATOM   1164 C  C   . SER A 1 145 ? -3.749  71.200 49.434 1.00 21.51 ? 145  SER A C   1 
ATOM   1165 O  O   . SER A 1 145 ? -4.883  71.633 49.286 1.00 21.40 ? 145  SER A O   1 
ATOM   1166 C  CB  . SER A 1 145 ? -2.415  72.886 50.767 1.00 21.97 ? 145  SER A CB  1 
ATOM   1167 O  OG  . SER A 1 145 ? -3.491  73.805 50.985 1.00 23.12 ? 145  SER A OG  1 
ATOM   1168 N  N   . LEU A 1 146 ? -3.490  69.907 49.582 1.00 21.20 ? 146  LEU A N   1 
ATOM   1169 C  CA  . LEU A 1 146 ? -4.578  68.936 49.595 1.00 21.40 ? 146  LEU A CA  1 
ATOM   1170 C  C   . LEU A 1 146 ? -4.916  68.537 51.027 1.00 21.79 ? 146  LEU A C   1 
ATOM   1171 O  O   . LEU A 1 146 ? -4.296  69.012 51.972 1.00 22.18 ? 146  LEU A O   1 
ATOM   1172 C  CB  . LEU A 1 146 ? -4.218  67.710 48.735 1.00 21.00 ? 146  LEU A CB  1 
ATOM   1173 C  CG  . LEU A 1 146 ? -2.918  66.934 48.997 1.00 21.45 ? 146  LEU A CG  1 
ATOM   1174 C  CD1 . LEU A 1 146 ? -2.905  66.166 50.348 1.00 20.63 ? 146  LEU A CD1 1 
ATOM   1175 C  CD2 . LEU A 1 146 ? -2.634  65.971 47.842 1.00 20.04 ? 146  LEU A CD2 1 
ATOM   1176 N  N   . SER A 1 147 ? -5.900  67.666 51.189 1.00 22.77 ? 147  SER A N   1 
ATOM   1177 C  CA  . SER A 1 147 ? -6.180  67.092 52.496 1.00 22.93 ? 147  SER A CA  1 
ATOM   1178 C  C   . SER A 1 147 ? -6.435  65.607 52.307 1.00 22.63 ? 147  SER A C   1 
ATOM   1179 O  O   . SER A 1 147 ? -6.540  65.125 51.178 1.00 22.70 ? 147  SER A O   1 
ATOM   1180 C  CB  . SER A 1 147 ? -7.361  67.794 53.165 1.00 23.22 ? 147  SER A CB  1 
ATOM   1181 O  OG  . SER A 1 147 ? -8.559  67.505 52.471 1.00 25.87 ? 147  SER A OG  1 
ATOM   1182 N  N   . TYR A 1 148 ? -6.493  64.879 53.414 1.00 21.50 ? 148  TYR A N   1 
ATOM   1183 C  CA  . TYR A 1 148 ? -6.714  63.446 53.392 1.00 20.91 ? 148  TYR A CA  1 
ATOM   1184 C  C   . TYR A 1 148 ? -7.148  63.011 54.784 1.00 21.30 ? 148  TYR A C   1 
ATOM   1185 O  O   . TYR A 1 148 ? -6.746  63.625 55.786 1.00 21.03 ? 148  TYR A O   1 
ATOM   1186 C  CB  . TYR A 1 148 ? -5.443  62.676 52.929 1.00 19.85 ? 148  TYR A CB  1 
ATOM   1187 C  CG  . TYR A 1 148 ? -4.204  62.859 53.800 1.00 19.06 ? 148  TYR A CG  1 
ATOM   1188 C  CD1 . TYR A 1 148 ? -3.379  63.989 53.657 1.00 18.90 ? 148  TYR A CD1 1 
ATOM   1189 C  CD2 . TYR A 1 148 ? -3.853  61.902 54.764 1.00 19.83 ? 148  TYR A CD2 1 
ATOM   1190 C  CE1 . TYR A 1 148 ? -2.220  64.163 54.464 1.00 18.51 ? 148  TYR A CE1 1 
ATOM   1191 C  CE2 . TYR A 1 148 ? -2.688  62.074 55.581 1.00 18.88 ? 148  TYR A CE2 1 
ATOM   1192 C  CZ  . TYR A 1 148 ? -1.895  63.192 55.421 1.00 18.70 ? 148  TYR A CZ  1 
ATOM   1193 O  OH  . TYR A 1 148 ? -0.774  63.358 56.233 1.00 20.00 ? 148  TYR A OH  1 
ATOM   1194 N  N   . ARG A 1 149 ? -7.949  61.949 54.833 1.00 20.90 ? 149  ARG A N   1 
ATOM   1195 C  CA  . ARG A 1 149 ? -8.428  61.414 56.094 1.00 20.95 ? 149  ARG A CA  1 
ATOM   1196 C  C   . ARG A 1 149 ? -7.255  60.841 56.881 1.00 20.97 ? 149  ARG A C   1 
ATOM   1197 O  O   . ARG A 1 149 ? -6.360  60.204 56.315 1.00 20.40 ? 149  ARG A O   1 
ATOM   1198 C  CB  . ARG A 1 149 ? -9.487  60.333 55.875 1.00 20.18 ? 149  ARG A CB  1 
ATOM   1199 C  CG  . ARG A 1 149 ? -10.825 60.864 55.346 1.00 19.89 ? 149  ARG A CG  1 
ATOM   1200 C  CD  . ARG A 1 149 ? -11.693 59.689 54.872 1.00 21.05 ? 149  ARG A CD  1 
ATOM   1201 N  NE  . ARG A 1 149 ? -11.310 59.238 53.527 1.00 19.75 ? 149  ARG A NE  1 
ATOM   1202 C  CZ  . ARG A 1 149 ? -11.824 58.172 52.924 1.00 22.45 ? 149  ARG A CZ  1 
ATOM   1203 N  NH1 . ARG A 1 149 ? -12.711 57.406 53.562 1.00 21.42 ? 149  ARG A NH1 1 
ATOM   1204 N  NH2 . ARG A 1 149 ? -11.437 57.858 51.692 1.00 21.90 ? 149  ARG A NH2 1 
ATOM   1205 N  N   . VAL A 1 150 ? -7.277  61.094 58.188 1.00 21.09 ? 150  VAL A N   1 
ATOM   1206 C  CA  . VAL A 1 150 ? -6.237  60.624 59.097 1.00 20.62 ? 150  VAL A CA  1 
ATOM   1207 C  C   . VAL A 1 150 ? -6.860  59.708 60.168 1.00 21.31 ? 150  VAL A C   1 
ATOM   1208 O  O   . VAL A 1 150 ? -8.095  59.565 60.236 1.00 20.58 ? 150  VAL A O   1 
ATOM   1209 C  CB  . VAL A 1 150 ? -5.471  61.833 59.764 1.00 20.41 ? 150  VAL A CB  1 
ATOM   1210 C  CG1 . VAL A 1 150 ? -4.684  62.584 58.736 1.00 20.54 ? 150  VAL A CG1 1 
ATOM   1211 C  CG2 . VAL A 1 150 ? -6.441  62.785 60.522 1.00 19.34 ? 150  VAL A CG2 1 
ATOM   1212 N  N   . GLY A 1 151 ? -6.012  59.105 61.007 1.00 21.10 ? 151  GLY A N   1 
ATOM   1213 C  CA  . GLY A 1 151 ? -6.486  58.214 62.052 1.00 21.63 ? 151  GLY A CA  1 
ATOM   1214 C  C   . GLY A 1 151 ? -7.224  57.018 61.477 1.00 22.45 ? 151  GLY A C   1 
ATOM   1215 O  O   . GLY A 1 151 ? -6.959  56.607 60.343 1.00 22.61 ? 151  GLY A O   1 
ATOM   1216 N  N   . ALA A 1 152 ? -8.150  56.454 62.252 1.00 21.92 ? 152  ALA A N   1 
ATOM   1217 C  CA  . ALA A 1 152 ? -8.937  55.328 61.785 1.00 21.81 ? 152  ALA A CA  1 
ATOM   1218 C  C   . ALA A 1 152 ? -9.752  55.670 60.509 1.00 21.96 ? 152  ALA A C   1 
ATOM   1219 O  O   . ALA A 1 152 ? -9.919  54.827 59.633 1.00 21.29 ? 152  ALA A O   1 
ATOM   1220 C  CB  . ALA A 1 152 ? -9.876  54.793 62.927 1.00 21.85 ? 152  ALA A CB  1 
ATOM   1221 N  N   . PHE A 1 153 ? -10.242 56.902 60.404 1.00 21.60 ? 153  PHE A N   1 
ATOM   1222 C  CA  . PHE A 1 153 ? -11.010 57.318 59.222 1.00 21.85 ? 153  PHE A CA  1 
ATOM   1223 C  C   . PHE A 1 153 ? -10.216 57.163 57.924 1.00 21.73 ? 153  PHE A C   1 
ATOM   1224 O  O   . PHE A 1 153 ? -10.799 56.856 56.884 1.00 21.65 ? 153  PHE A O   1 
ATOM   1225 C  CB  . PHE A 1 153 ? -11.563 58.741 59.377 1.00 21.80 ? 153  PHE A CB  1 
ATOM   1226 C  CG  . PHE A 1 153 ? -12.163 58.999 60.732 1.00 23.37 ? 153  PHE A CG  1 
ATOM   1227 C  CD1 . PHE A 1 153 ? -11.344 59.395 61.802 1.00 23.06 ? 153  PHE A CD1 1 
ATOM   1228 C  CD2 . PHE A 1 153 ? -13.538 58.829 60.952 1.00 25.11 ? 153  PHE A CD2 1 
ATOM   1229 C  CE1 . PHE A 1 153 ? -11.878 59.620 63.078 1.00 26.15 ? 153  PHE A CE1 1 
ATOM   1230 C  CE2 . PHE A 1 153 ? -14.088 59.044 62.222 1.00 25.68 ? 153  PHE A CE2 1 
ATOM   1231 C  CZ  . PHE A 1 153 ? -13.248 59.450 63.294 1.00 25.53 ? 153  PHE A CZ  1 
ATOM   1232 N  N   . GLY A 1 154 ? -8.893  57.340 57.998 1.00 21.62 ? 154  GLY A N   1 
ATOM   1233 C  CA  . GLY A 1 154 ? -8.035  57.207 56.825 1.00 21.61 ? 154  GLY A CA  1 
ATOM   1234 C  C   . GLY A 1 154 ? -7.312  55.884 56.669 1.00 21.90 ? 154  GLY A C   1 
ATOM   1235 O  O   . GLY A 1 154 ? -6.918  55.523 55.560 1.00 21.74 ? 154  GLY A O   1 
ATOM   1236 N  N   . PHE A 1 155 ? -7.128  55.158 57.772 1.00 21.35 ? 155  PHE A N   1 
ATOM   1237 C  CA  . PHE A 1 155 ? -6.158  54.072 57.783 1.00 21.27 ? 155  PHE A CA  1 
ATOM   1238 C  C   . PHE A 1 155 ? -6.566  52.798 58.508 1.00 21.75 ? 155  PHE A C   1 
ATOM   1239 O  O   . PHE A 1 155 ? -5.792  51.847 58.551 1.00 22.30 ? 155  PHE A O   1 
ATOM   1240 C  CB  . PHE A 1 155 ? -4.773  54.608 58.230 1.00 21.28 ? 155  PHE A CB  1 
ATOM   1241 C  CG  . PHE A 1 155 ? -4.215  55.647 57.278 1.00 21.53 ? 155  PHE A CG  1 
ATOM   1242 C  CD1 . PHE A 1 155 ? -3.616  55.258 56.071 1.00 21.71 ? 155  PHE A CD1 1 
ATOM   1243 C  CD2 . PHE A 1 155 ? -4.355  57.003 57.545 1.00 20.83 ? 155  PHE A CD2 1 
ATOM   1244 C  CE1 . PHE A 1 155 ? -3.133  56.227 55.158 1.00 21.49 ? 155  PHE A CE1 1 
ATOM   1245 C  CE2 . PHE A 1 155 ? -3.891  57.970 56.641 1.00 19.88 ? 155  PHE A CE2 1 
ATOM   1246 C  CZ  . PHE A 1 155 ? -3.277  57.581 55.452 1.00 21.58 ? 155  PHE A CZ  1 
ATOM   1247 N  N   . LEU A 1 156 ? -7.778  52.745 59.051 1.00 22.60 ? 156  LEU A N   1 
ATOM   1248 C  CA  . LEU A 1 156 ? -8.269  51.463 59.596 1.00 23.95 ? 156  LEU A CA  1 
ATOM   1249 C  C   . LEU A 1 156 ? -8.191  50.419 58.475 1.00 24.32 ? 156  LEU A C   1 
ATOM   1250 O  O   . LEU A 1 156 ? -8.729  50.658 57.387 1.00 25.42 ? 156  LEU A O   1 
ATOM   1251 C  CB  . LEU A 1 156 ? -9.730  51.577 60.060 1.00 24.30 ? 156  LEU A CB  1 
ATOM   1252 C  CG  . LEU A 1 156 ? -10.307 50.288 60.674 1.00 25.58 ? 156  LEU A CG  1 
ATOM   1253 C  CD1 . LEU A 1 156 ? -10.327 50.445 62.189 1.00 27.53 ? 156  LEU A CD1 1 
ATOM   1254 C  CD2 . LEU A 1 156 ? -11.728 50.050 60.152 1.00 26.39 ? 156  LEU A CD2 1 
ATOM   1255 N  N   . ALA A 1 157 ? -7.518  49.295 58.722 1.00 23.97 ? 157  ALA A N   1 
ATOM   1256 C  CA  . ALA A 1 157 ? -7.256  48.302 57.669 1.00 24.13 ? 157  ALA A CA  1 
ATOM   1257 C  C   . ALA A 1 157 ? -7.726  46.909 58.073 1.00 25.11 ? 157  ALA A C   1 
ATOM   1258 O  O   . ALA A 1 157 ? -7.178  46.309 59.016 1.00 24.44 ? 157  ALA A O   1 
ATOM   1259 C  CB  . ALA A 1 157 ? -5.788  48.266 57.312 1.00 23.35 ? 157  ALA A CB  1 
ATOM   1260 N  N   . LEU A 1 158 ? -8.725  46.399 57.340 1.00 25.69 ? 158  LEU A N   1 
ATOM   1261 C  CA  . LEU A 1 158 ? -9.193  45.019 57.493 1.00 26.96 ? 158  LEU A CA  1 
ATOM   1262 C  C   . LEU A 1 158 ? -8.970  44.314 56.152 1.00 27.98 ? 158  LEU A C   1 
ATOM   1263 O  O   . LEU A 1 158 ? -9.873  44.210 55.321 1.00 28.39 ? 158  LEU A O   1 
ATOM   1264 C  CB  . LEU A 1 158 ? -10.662 44.989 57.959 1.00 26.44 ? 158  LEU A CB  1 
ATOM   1265 C  CG  . LEU A 1 158 ? -10.884 45.350 59.447 1.00 26.99 ? 158  LEU A CG  1 
ATOM   1266 C  CD1 . LEU A 1 158 ? -12.340 45.672 59.742 1.00 25.91 ? 158  LEU A CD1 1 
ATOM   1267 C  CD2 . LEU A 1 158 ? -10.372 44.237 60.398 1.00 27.54 ? 158  LEU A CD2 1 
ATOM   1268 N  N   . HIS A 1 159 ? -7.742  43.873 55.929 1.00 28.97 ? 159  HIS A N   1 
ATOM   1269 C  CA  . HIS A 1 159 ? -7.335  43.425 54.608 1.00 30.63 ? 159  HIS A CA  1 
ATOM   1270 C  C   . HIS A 1 159 ? -8.207  42.264 54.168 1.00 31.28 ? 159  HIS A C   1 
ATOM   1271 O  O   . HIS A 1 159 ? -8.442  41.335 54.938 1.00 31.21 ? 159  HIS A O   1 
ATOM   1272 C  CB  . HIS A 1 159 ? -5.860  43.042 54.597 1.00 30.45 ? 159  HIS A CB  1 
ATOM   1273 C  CG  . HIS A 1 159 ? -5.367  42.600 53.257 1.00 31.92 ? 159  HIS A CG  1 
ATOM   1274 N  ND1 . HIS A 1 159 ? -5.310  43.448 52.169 1.00 33.71 ? 159  HIS A ND1 1 
ATOM   1275 C  CD2 . HIS A 1 159 ? -4.920  41.396 52.823 1.00 32.23 ? 159  HIS A CD2 1 
ATOM   1276 C  CE1 . HIS A 1 159 ? -4.840  42.785 51.125 1.00 33.85 ? 159  HIS A CE1 1 
ATOM   1277 N  NE2 . HIS A 1 159 ? -4.599  41.539 51.494 1.00 33.18 ? 159  HIS A NE2 1 
ATOM   1278 N  N   . GLY A 1 160 ? -8.716  42.344 52.939 1.00 32.76 ? 160  GLY A N   1 
ATOM   1279 C  CA  . GLY A 1 160 ? -9.639  41.330 52.427 1.00 33.30 ? 160  GLY A CA  1 
ATOM   1280 C  C   . GLY A 1 160 ? -11.030 41.920 52.340 1.00 34.29 ? 160  GLY A C   1 
ATOM   1281 O  O   . GLY A 1 160 ? -11.852 41.467 51.551 1.00 34.57 ? 160  GLY A O   1 
ATOM   1282 N  N   . SER A 1 161 ? -11.295 42.945 53.150 1.00 33.92 ? 161  SER A N   1 
ATOM   1283 C  CA  . SER A 1 161 ? -12.553 43.660 53.075 1.00 34.02 ? 161  SER A CA  1 
ATOM   1284 C  C   . SER A 1 161 ? -12.440 44.745 52.004 1.00 34.20 ? 161  SER A C   1 
ATOM   1285 O  O   . SER A 1 161 ? -11.345 45.292 51.778 1.00 34.24 ? 161  SER A O   1 
ATOM   1286 C  CB  . SER A 1 161 ? -12.891 44.272 54.436 1.00 34.41 ? 161  SER A CB  1 
ATOM   1287 O  OG  . SER A 1 161 ? -13.833 45.331 54.326 1.00 35.44 ? 161  SER A OG  1 
ATOM   1288 N  N   . GLN A 1 162 ? -13.561 45.045 51.343 1.00 33.70 ? 162  GLN A N   1 
ATOM   1289 C  CA  . GLN A 1 162 ? -13.625 46.156 50.387 1.00 34.06 ? 162  GLN A CA  1 
ATOM   1290 C  C   . GLN A 1 162 ? -14.233 47.382 51.038 1.00 32.85 ? 162  GLN A C   1 
ATOM   1291 O  O   . GLN A 1 162 ? -14.189 48.492 50.491 1.00 33.75 ? 162  GLN A O   1 
ATOM   1292 C  CB  . GLN A 1 162 ? -14.427 45.761 49.133 1.00 35.10 ? 162  GLN A CB  1 
ATOM   1293 C  CG  . GLN A 1 162 ? -13.716 44.742 48.241 1.00 38.20 ? 162  GLN A CG  1 
ATOM   1294 C  CD  . GLN A 1 162 ? -12.284 45.154 47.900 1.00 42.74 ? 162  GLN A CD  1 
ATOM   1295 O  OE1 . GLN A 1 162 ? -12.013 46.318 47.570 1.00 45.84 ? 162  GLN A OE1 1 
ATOM   1296 N  NE2 . GLN A 1 162 ? -11.357 44.200 47.990 1.00 44.14 ? 162  GLN A NE2 1 
ATOM   1297 N  N   . GLU A 1 163 ? -14.806 47.172 52.212 1.00 31.69 ? 163  GLU A N   1 
ATOM   1298 C  CA  . GLU A 1 163 ? -15.440 48.237 52.968 1.00 30.82 ? 163  GLU A CA  1 
ATOM   1299 C  C   . GLU A 1 163 ? -14.426 49.017 53.817 1.00 29.57 ? 163  GLU A C   1 
ATOM   1300 O  O   . GLU A 1 163 ? -14.602 50.215 54.021 1.00 29.64 ? 163  GLU A O   1 
ATOM   1301 C  CB  . GLU A 1 163 ? -16.542 47.666 53.866 1.00 31.88 ? 163  GLU A CB  1 
ATOM   1302 C  CG  . GLU A 1 163 ? -17.766 47.134 53.108 1.00 34.28 ? 163  GLU A CG  1 
ATOM   1303 C  CD  . GLU A 1 163 ? -18.450 48.206 52.283 1.00 38.65 ? 163  GLU A CD  1 
ATOM   1304 O  OE1 . GLU A 1 163 ? -18.419 49.400 52.671 1.00 37.81 ? 163  GLU A OE1 1 
ATOM   1305 O  OE2 . GLU A 1 163 ? -19.021 47.851 51.228 1.00 42.54 ? 163  GLU A OE2 1 
ATOM   1306 N  N   . ALA A 1 164 ? -13.390 48.332 54.308 1.00 27.49 ? 164  ALA A N   1 
ATOM   1307 C  CA  . ALA A 1 164 ? -12.306 48.970 55.067 1.00 27.40 ? 164  ALA A CA  1 
ATOM   1308 C  C   . ALA A 1 164 ? -10.973 48.368 54.648 1.00 26.09 ? 164  ALA A C   1 
ATOM   1309 O  O   . ALA A 1 164 ? -10.344 47.645 55.428 1.00 26.50 ? 164  ALA A O   1 
ATOM   1310 C  CB  . ALA A 1 164 ? -12.525 48.826 56.602 1.00 26.82 ? 164  ALA A CB  1 
ATOM   1311 N  N   . PRO A 1 165 ? -10.533 48.659 53.409 1.00 25.67 ? 165  PRO A N   1 
ATOM   1312 C  CA  . PRO A 1 165 ? -9.343  47.975 52.906 1.00 25.21 ? 165  PRO A CA  1 
ATOM   1313 C  C   . PRO A 1 165 ? -8.021  48.529 53.445 1.00 25.19 ? 165  PRO A C   1 
ATOM   1314 O  O   . PRO A 1 165 ? -6.983  47.880 53.283 1.00 25.07 ? 165  PRO A O   1 
ATOM   1315 C  CB  . PRO A 1 165 ? -9.418  48.224 51.401 1.00 24.99 ? 165  PRO A CB  1 
ATOM   1316 C  CG  . PRO A 1 165 ? -10.096 49.563 51.285 1.00 25.61 ? 165  PRO A CG  1 
ATOM   1317 C  CD  . PRO A 1 165 ? -11.046 49.666 52.454 1.00 24.98 ? 165  PRO A CD  1 
ATOM   1318 N  N   . GLY A 1 166 ? -8.045  49.716 54.055 1.00 24.28 ? 166  GLY A N   1 
ATOM   1319 C  CA  . GLY A 1 166 ? -6.784  50.365 54.446 1.00 23.66 ? 166  GLY A CA  1 
ATOM   1320 C  C   . GLY A 1 166 ? -6.336  51.350 53.368 1.00 23.91 ? 166  GLY A C   1 
ATOM   1321 O  O   . GLY A 1 166 ? -6.871  51.335 52.247 1.00 23.76 ? 166  GLY A O   1 
ATOM   1322 N  N   . ASN A 1 167 ? -5.368  52.206 53.713 1.00 23.21 ? 167  ASN A N   1 
ATOM   1323 C  CA  . ASN A 1 167 ? -4.742  53.135 52.769 1.00 22.53 ? 167  ASN A CA  1 
ATOM   1324 C  C   . ASN A 1 167 ? -5.666  54.197 52.163 1.00 21.90 ? 167  ASN A C   1 
ATOM   1325 O  O   . ASN A 1 167 ? -5.260  54.888 51.247 1.00 21.50 ? 167  ASN A O   1 
ATOM   1326 C  CB  . ASN A 1 167 ? -3.993  52.359 51.647 1.00 23.07 ? 167  ASN A CB  1 
ATOM   1327 C  CG  . ASN A 1 167 ? -2.795  51.588 52.176 1.00 23.62 ? 167  ASN A CG  1 
ATOM   1328 O  OD1 . ASN A 1 167 ? -2.205  51.980 53.192 1.00 23.10 ? 167  ASN A OD1 1 
ATOM   1329 N  ND2 . ASN A 1 167 ? -2.430  50.483 51.505 1.00 22.11 ? 167  ASN A ND2 1 
ATOM   1330 N  N   . VAL A 1 168 ? -6.885  54.350 52.672 1.00 20.93 ? 168  VAL A N   1 
ATOM   1331 C  CA  . VAL A 1 168 ? -7.829  55.248 52.008 1.00 21.42 ? 168  VAL A CA  1 
ATOM   1332 C  C   . VAL A 1 168 ? -7.389  56.714 52.075 1.00 21.65 ? 168  VAL A C   1 
ATOM   1333 O  O   . VAL A 1 168 ? -7.626  57.470 51.134 1.00 21.72 ? 168  VAL A O   1 
ATOM   1334 C  CB  . VAL A 1 168 ? -9.329  54.980 52.391 1.00 21.49 ? 168  VAL A CB  1 
ATOM   1335 C  CG1 . VAL A 1 168 ? -9.698  53.498 52.072 1.00 21.32 ? 168  VAL A CG1 1 
ATOM   1336 C  CG2 . VAL A 1 168 ? -9.616  55.294 53.848 1.00 20.65 ? 168  VAL A CG2 1 
ATOM   1337 N  N   . GLY A 1 169 ? -6.675  57.095 53.140 1.00 21.23 ? 169  GLY A N   1 
ATOM   1338 C  CA  . GLY A 1 169 ? -6.083  58.442 53.207 1.00 20.84 ? 169  GLY A CA  1 
ATOM   1339 C  C   . GLY A 1 169 ? -5.028  58.667 52.123 1.00 20.72 ? 169  GLY A C   1 
ATOM   1340 O  O   . GLY A 1 169 ? -4.879  59.776 51.617 1.00 20.60 ? 169  GLY A O   1 
ATOM   1341 N  N   . LEU A 1 170 ? -4.260  57.637 51.785 1.00 20.72 ? 170  LEU A N   1 
ATOM   1342 C  CA  . LEU A 1 170 ? -3.310  57.754 50.661 1.00 20.70 ? 170  LEU A CA  1 
ATOM   1343 C  C   . LEU A 1 170 ? -4.065  57.870 49.341 1.00 20.72 ? 170  LEU A C   1 
ATOM   1344 O  O   . LEU A 1 170 ? -3.638  58.594 48.441 1.00 20.78 ? 170  LEU A O   1 
ATOM   1345 C  CB  . LEU A 1 170 ? -2.356  56.556 50.606 1.00 20.27 ? 170  LEU A CB  1 
ATOM   1346 C  CG  . LEU A 1 170 ? -1.225  56.528 51.647 1.00 19.86 ? 170  LEU A CG  1 
ATOM   1347 C  CD1 . LEU A 1 170 ? -0.588  55.140 51.712 1.00 17.36 ? 170  LEU A CD1 1 
ATOM   1348 C  CD2 . LEU A 1 170 ? -0.168  57.610 51.332 1.00 19.84 ? 170  LEU A CD2 1 
ATOM   1349 N  N   . LEU A 1 171 ? -5.181  57.160 49.236 1.00 20.65 ? 171  LEU A N   1 
ATOM   1350 C  CA  . LEU A 1 171 ? -6.041  57.286 48.053 1.00 21.45 ? 171  LEU A CA  1 
ATOM   1351 C  C   . LEU A 1 171 ? -6.742  58.656 47.985 1.00 21.66 ? 171  LEU A C   1 
ATOM   1352 O  O   . LEU A 1 171 ? -6.969  59.182 46.884 1.00 20.95 ? 171  LEU A O   1 
ATOM   1353 C  CB  . LEU A 1 171 ? -7.051  56.145 47.996 1.00 21.35 ? 171  LEU A CB  1 
ATOM   1354 C  CG  . LEU A 1 171 ? -6.449  54.745 47.800 1.00 22.86 ? 171  LEU A CG  1 
ATOM   1355 C  CD1 . LEU A 1 171 ? -7.552  53.690 47.873 1.00 23.84 ? 171  LEU A CD1 1 
ATOM   1356 C  CD2 . LEU A 1 171 ? -5.706  54.612 46.467 1.00 22.14 ? 171  LEU A CD2 1 
ATOM   1357 N  N   . ASP A 1 172 ? -7.071  59.241 49.148 1.00 21.76 ? 172  ASP A N   1 
ATOM   1358 C  CA  . ASP A 1 172 ? -7.540  60.652 49.187 1.00 21.72 ? 172  ASP A CA  1 
ATOM   1359 C  C   . ASP A 1 172 ? -6.475  61.547 48.579 1.00 21.48 ? 172  ASP A C   1 
ATOM   1360 O  O   . ASP A 1 172 ? -6.767  62.409 47.749 1.00 22.55 ? 172  ASP A O   1 
ATOM   1361 C  CB  . ASP A 1 172 ? -7.824  61.147 50.624 1.00 21.99 ? 172  ASP A CB  1 
ATOM   1362 C  CG  . ASP A 1 172 ? -8.956  60.419 51.299 1.00 22.11 ? 172  ASP A CG  1 
ATOM   1363 O  OD1 . ASP A 1 172 ? -9.744  59.728 50.619 1.00 22.78 ? 172  ASP A OD1 1 
ATOM   1364 O  OD2 . ASP A 1 172 ? -9.065  60.537 52.545 1.00 22.75 ? 172  ASP A OD2 1 
ATOM   1365 N  N   . GLN A 1 173 ? -5.223  61.368 48.988 1.00 21.02 ? 173  GLN A N   1 
ATOM   1366 C  CA  . GLN A 1 173 ? -4.158  62.188 48.427 1.00 20.49 ? 173  GLN A CA  1 
ATOM   1367 C  C   . GLN A 1 173 ? -4.051  61.999 46.906 1.00 20.88 ? 173  GLN A C   1 
ATOM   1368 O  O   . GLN A 1 173 ? -3.887  62.975 46.179 1.00 20.16 ? 173  GLN A O   1 
ATOM   1369 C  CB  . GLN A 1 173 ? -2.809  61.831 49.059 1.00 20.58 ? 173  GLN A CB  1 
ATOM   1370 C  CG  . GLN A 1 173 ? -2.747  62.045 50.558 1.00 19.50 ? 173  GLN A CG  1 
ATOM   1371 C  CD  . GLN A 1 173 ? -1.419  61.556 51.118 1.00 20.81 ? 173  GLN A CD  1 
ATOM   1372 O  OE1 . GLN A 1 173 ? -0.483  61.282 50.366 1.00 19.65 ? 173  GLN A OE1 1 
ATOM   1373 N  NE2 . GLN A 1 173 ? -1.334  61.448 52.441 1.00 20.32 ? 173  GLN A NE2 1 
ATOM   1374 N  N   . ARG A 1 174 ? -4.100  60.740 46.444 1.00 20.30 ? 174  ARG A N   1 
ATOM   1375 C  CA  . ARG A 1 174 ? -4.005  60.444 45.012 1.00 20.64 ? 174  ARG A CA  1 
ATOM   1376 C  C   . ARG A 1 174 ? -5.164  61.111 44.237 1.00 21.06 ? 174  ARG A C   1 
ATOM   1377 O  O   . ARG A 1 174 ? -4.952  61.669 43.156 1.00 21.76 ? 174  ARG A O   1 
ATOM   1378 C  CB  . ARG A 1 174 ? -4.007  58.916 44.767 1.00 20.45 ? 174  ARG A CB  1 
ATOM   1379 C  CG  . ARG A 1 174 ? -3.919  58.509 43.263 1.00 20.81 ? 174  ARG A CG  1 
ATOM   1380 C  CD  . ARG A 1 174 ? -4.170  57.023 43.131 1.00 21.37 ? 174  ARG A CD  1 
ATOM   1381 N  NE  . ARG A 1 174 ? -3.018  56.253 43.580 1.00 21.19 ? 174  ARG A NE  1 
ATOM   1382 C  CZ  . ARG A 1 174 ? -3.015  54.926 43.680 1.00 21.66 ? 174  ARG A CZ  1 
ATOM   1383 N  NH1 . ARG A 1 174 ? -4.105  54.225 43.395 1.00 20.71 ? 174  ARG A NH1 1 
ATOM   1384 N  NH2 . ARG A 1 174 ? -1.924  54.304 44.060 1.00 23.46 ? 174  ARG A NH2 1 
ATOM   1385 N  N   . MET A 1 175 ? -6.373  61.064 44.791 1.00 21.31 ? 175  MET A N   1 
ATOM   1386 C  CA  . MET A 1 175 ? -7.530  61.685 44.135 1.00 22.03 ? 175  MET A CA  1 
ATOM   1387 C  C   . MET A 1 175 ? -7.393  63.207 44.010 1.00 22.24 ? 175  MET A C   1 
ATOM   1388 O  O   . MET A 1 175 ? -7.788  63.795 42.992 1.00 22.09 ? 175  MET A O   1 
ATOM   1389 C  CB  . MET A 1 175 ? -8.838  61.338 44.840 1.00 22.30 ? 175  MET A CB  1 
ATOM   1390 C  CG  . MET A 1 175 ? -10.051 61.805 44.010 1.00 25.11 ? 175  MET A CG  1 
ATOM   1391 S  SD  . MET A 1 175 ? -11.560 61.040 44.533 1.00 33.04 ? 175  MET A SD  1 
ATOM   1392 C  CE  . MET A 1 175 ? -11.306 59.376 43.859 1.00 26.76 ? 175  MET A CE  1 
ATOM   1393 N  N   . ALA A 1 176 ? -6.826  63.842 45.035 1.00 21.36 ? 176  ALA A N   1 
ATOM   1394 C  CA  . ALA A 1 176 ? -6.498  65.256 44.926 1.00 21.21 ? 176  ALA A CA  1 
ATOM   1395 C  C   . ALA A 1 176 ? -5.446  65.480 43.833 1.00 20.77 ? 176  ALA A C   1 
ATOM   1396 O  O   . ALA A 1 176 ? -5.543  66.449 43.080 1.00 20.56 ? 176  ALA A O   1 
ATOM   1397 C  CB  . ALA A 1 176 ? -6.011  65.815 46.264 1.00 20.89 ? 176  ALA A CB  1 
ATOM   1398 N  N   . LEU A 1 177 ? -4.432  64.614 43.759 1.00 20.65 ? 177  LEU A N   1 
ATOM   1399 C  CA  . LEU A 1 177 ? -3.445  64.715 42.668 1.00 21.42 ? 177  LEU A CA  1 
ATOM   1400 C  C   . LEU A 1 177 ? -4.069  64.503 41.286 1.00 21.00 ? 177  LEU A C   1 
ATOM   1401 O  O   . LEU A 1 177 ? -3.650  65.123 40.319 1.00 21.49 ? 177  LEU A O   1 
ATOM   1402 C  CB  . LEU A 1 177 ? -2.251  63.751 42.854 1.00 21.09 ? 177  LEU A CB  1 
ATOM   1403 C  CG  . LEU A 1 177 ? -1.432  63.973 44.139 1.00 22.13 ? 177  LEU A CG  1 
ATOM   1404 C  CD1 . LEU A 1 177 ? -0.361  62.911 44.294 1.00 21.27 ? 177  LEU A CD1 1 
ATOM   1405 C  CD2 . LEU A 1 177 ? -0.820  65.376 44.190 1.00 20.97 ? 177  LEU A CD2 1 
ATOM   1406 N  N   . GLN A 1 178 ? -5.033  63.597 41.209 1.00 21.93 ? 178  GLN A N   1 
ATOM   1407 C  CA  . GLN A 1 178 ? -5.769  63.338 39.968 1.00 23.04 ? 178  GLN A CA  1 
ATOM   1408 C  C   . GLN A 1 178 ? -6.516  64.607 39.552 1.00 22.99 ? 178  GLN A C   1 
ATOM   1409 O  O   . GLN A 1 178 ? -6.478  64.997 38.387 1.00 23.58 ? 178  GLN A O   1 
ATOM   1410 C  CB  . GLN A 1 178 ? -6.741  62.168 40.162 1.00 22.66 ? 178  GLN A CB  1 
ATOM   1411 C  CG  . GLN A 1 178 ? -7.567  61.794 38.914 1.00 25.19 ? 178  GLN A CG  1 
ATOM   1412 C  CD  . GLN A 1 178 ? -6.719  61.106 37.852 1.00 27.01 ? 178  GLN A CD  1 
ATOM   1413 O  OE1 . GLN A 1 178 ? -6.044  60.115 38.127 1.00 25.23 ? 178  GLN A OE1 1 
ATOM   1414 N  NE2 . GLN A 1 178 ? -6.744  61.641 36.634 1.00 28.31 ? 178  GLN A NE2 1 
ATOM   1415 N  N   . TRP A 1 179 ? -7.160  65.265 40.517 1.00 22.87 ? 179  TRP A N   1 
ATOM   1416 C  CA  . TRP A 1 179 ? -7.904  66.489 40.244 1.00 23.02 ? 179  TRP A CA  1 
ATOM   1417 C  C   . TRP A 1 179 ? -6.981  67.595 39.766 1.00 23.44 ? 179  TRP A C   1 
ATOM   1418 O  O   . TRP A 1 179 ? -7.341  68.344 38.852 1.00 24.13 ? 179  TRP A O   1 
ATOM   1419 C  CB  . TRP A 1 179 ? -8.704  66.941 41.478 1.00 23.10 ? 179  TRP A CB  1 
ATOM   1420 C  CG  . TRP A 1 179 ? -9.740  67.970 41.166 1.00 22.62 ? 179  TRP A CG  1 
ATOM   1421 C  CD1 . TRP A 1 179 ? -11.059 67.746 40.891 1.00 24.02 ? 179  TRP A CD1 1 
ATOM   1422 C  CD2 . TRP A 1 179 ? -9.556  69.401 41.111 1.00 23.26 ? 179  TRP A CD2 1 
ATOM   1423 N  NE1 . TRP A 1 179 ? -11.695 68.941 40.645 1.00 24.90 ? 179  TRP A NE1 1 
ATOM   1424 C  CE2 . TRP A 1 179 ? -10.800 69.967 40.789 1.00 23.59 ? 179  TRP A CE2 1 
ATOM   1425 C  CE3 . TRP A 1 179 ? -8.459  70.248 41.299 1.00 21.66 ? 179  TRP A CE3 1 
ATOM   1426 C  CZ2 . TRP A 1 179 ? -10.977 71.339 40.635 1.00 22.97 ? 179  TRP A CZ2 1 
ATOM   1427 C  CZ3 . TRP A 1 179 ? -8.635  71.602 41.154 1.00 22.85 ? 179  TRP A CZ3 1 
ATOM   1428 C  CH2 . TRP A 1 179 ? -9.887  72.138 40.829 1.00 21.75 ? 179  TRP A CH2 1 
ATOM   1429 N  N   . VAL A 1 180 ? -5.805  67.713 40.384 1.00 22.50 ? 180  VAL A N   1 
ATOM   1430 C  CA  . VAL A 1 180 ? -4.803  68.679 39.969 1.00 22.69 ? 180  VAL A CA  1 
ATOM   1431 C  C   . VAL A 1 180 ? -4.344  68.347 38.538 1.00 23.42 ? 180  VAL A C   1 
ATOM   1432 O  O   . VAL A 1 180 ? -4.264  69.214 37.674 1.00 23.29 ? 180  VAL A O   1 
ATOM   1433 C  CB  . VAL A 1 180 ? -3.584  68.688 40.944 1.00 22.59 ? 180  VAL A CB  1 
ATOM   1434 C  CG1 . VAL A 1 180 ? -2.367  69.463 40.358 1.00 21.96 ? 180  VAL A CG1 1 
ATOM   1435 C  CG2 . VAL A 1 180 ? -3.984  69.285 42.287 1.00 22.37 ? 180  VAL A CG2 1 
ATOM   1436 N  N   . HIS A 1 181 ? -4.047  67.082 38.291 1.00 23.32 ? 181  HIS A N   1 
ATOM   1437 C  CA  . HIS A 1 181 ? -3.671  66.663 36.952 1.00 24.24 ? 181  HIS A CA  1 
ATOM   1438 C  C   . HIS A 1 181 ? -4.712  67.100 35.911 1.00 24.33 ? 181  HIS A C   1 
ATOM   1439 O  O   . HIS A 1 181 ? -4.360  67.665 34.875 1.00 24.44 ? 181  HIS A O   1 
ATOM   1440 C  CB  . HIS A 1 181 ? -3.502  65.152 36.920 1.00 24.25 ? 181  HIS A CB  1 
ATOM   1441 C  CG  . HIS A 1 181 ? -3.141  64.623 35.573 1.00 27.80 ? 181  HIS A CG  1 
ATOM   1442 N  ND1 . HIS A 1 181 ? -1.843  64.604 35.110 1.00 27.98 ? 181  HIS A ND1 1 
ATOM   1443 C  CD2 . HIS A 1 181 ? -3.908  64.103 34.584 1.00 29.61 ? 181  HIS A CD2 1 
ATOM   1444 C  CE1 . HIS A 1 181 ? -1.824  64.088 33.893 1.00 29.90 ? 181  HIS A CE1 1 
ATOM   1445 N  NE2 . HIS A 1 181 ? -3.062  63.773 33.552 1.00 31.05 ? 181  HIS A NE2 1 
ATOM   1446 N  N   . ASP A 1 182 ? -5.984  66.872 36.222 1.00 24.01 ? 182  ASP A N   1 
ATOM   1447 C  CA  . ASP A 1 182 ? -7.074  67.132 35.297 1.00 24.74 ? 182  ASP A CA  1 
ATOM   1448 C  C   . ASP A 1 182 ? -7.487  68.597 35.169 1.00 25.10 ? 182  ASP A C   1 
ATOM   1449 O  O   . ASP A 1 182 ? -8.031  68.989 34.128 1.00 25.32 ? 182  ASP A O   1 
ATOM   1450 C  CB  . ASP A 1 182 ? -8.296  66.308 35.697 1.00 24.05 ? 182  ASP A CB  1 
ATOM   1451 C  CG  . ASP A 1 182 ? -8.063  64.830 35.535 1.00 25.08 ? 182  ASP A CG  1 
ATOM   1452 O  OD1 . ASP A 1 182 ? -7.121  64.466 34.810 1.00 26.38 ? 182  ASP A OD1 1 
ATOM   1453 O  OD2 . ASP A 1 182 ? -8.817  64.038 36.132 1.00 25.22 ? 182  ASP A OD2 1 
ATOM   1454 N  N   . ASN A 1 183 ? -7.213  69.410 36.190 1.00 24.48 ? 183  ASN A N   1 
ATOM   1455 C  CA  . ASN A 1 183 ? -7.827  70.728 36.251 1.00 24.26 ? 183  ASN A CA  1 
ATOM   1456 C  C   . ASN A 1 183 ? -6.890  71.886 36.459 1.00 24.73 ? 183  ASN A C   1 
ATOM   1457 O  O   . ASN A 1 183 ? -7.307  73.040 36.270 1.00 25.27 ? 183  ASN A O   1 
ATOM   1458 C  CB  . ASN A 1 183 ? -8.903  70.768 37.341 1.00 24.21 ? 183  ASN A CB  1 
ATOM   1459 C  CG  . ASN A 1 183 ? -10.099 69.910 37.003 1.00 25.72 ? 183  ASN A CG  1 
ATOM   1460 O  OD1 . ASN A 1 183 ? -10.917 70.274 36.142 1.00 24.37 ? 183  ASN A OD1 1 
ATOM   1461 N  ND2 . ASN A 1 183 ? -10.216 68.763 37.673 1.00 25.73 ? 183  ASN A ND2 1 
ATOM   1462 N  N   . ILE A 1 184 ? -5.640  71.621 36.852 1.00 24.20 ? 184  ILE A N   1 
ATOM   1463 C  CA  . ILE A 1 184 ? -4.760  72.729 37.226 1.00 24.62 ? 184  ILE A CA  1 
ATOM   1464 C  C   . ILE A 1 184 ? -4.462  73.691 36.062 1.00 24.44 ? 184  ILE A C   1 
ATOM   1465 O  O   . ILE A 1 184 ? -4.164  74.869 36.283 1.00 24.77 ? 184  ILE A O   1 
ATOM   1466 C  CB  . ILE A 1 184 ? -3.433  72.259 37.931 1.00 24.43 ? 184  ILE A CB  1 
ATOM   1467 C  CG1 . ILE A 1 184 ? -2.903  73.358 38.858 1.00 24.60 ? 184  ILE A CG1 1 
ATOM   1468 C  CG2 . ILE A 1 184 ? -2.345  71.839 36.910 1.00 23.70 ? 184  ILE A CG2 1 
ATOM   1469 C  CD1 . ILE A 1 184 ? -3.822  73.692 40.031 1.00 21.96 ? 184  ILE A CD1 1 
ATOM   1470 N  N   . GLN A 1 185 ? -4.549  73.189 34.829 1.00 24.50 ? 185  GLN A N   1 
ATOM   1471 C  CA  . GLN A 1 185 ? -4.306  74.022 33.635 1.00 24.24 ? 185  GLN A CA  1 
ATOM   1472 C  C   . GLN A 1 185 ? -5.237  75.244 33.621 1.00 23.96 ? 185  GLN A C   1 
ATOM   1473 O  O   . GLN A 1 185 ? -4.846  76.307 33.157 1.00 24.82 ? 185  GLN A O   1 
ATOM   1474 C  CB  . GLN A 1 185 ? -4.480  73.195 32.342 1.00 23.71 ? 185  GLN A CB  1 
ATOM   1475 C  CG  . GLN A 1 185 ? -5.933  72.766 32.097 1.00 24.45 ? 185  GLN A CG  1 
ATOM   1476 C  CD  . GLN A 1 185 ? -6.068  71.622 31.104 1.00 26.43 ? 185  GLN A CD  1 
ATOM   1477 O  OE1 . GLN A 1 185 ? -5.910  70.463 31.460 1.00 27.02 ? 185  GLN A OE1 1 
ATOM   1478 N  NE2 . GLN A 1 185 ? -6.378  71.951 29.847 1.00 24.78 ? 185  GLN A NE2 1 
ATOM   1479 N  N   . PHE A 1 186 ? -6.452  75.095 34.143 1.00 23.80 ? 186  PHE A N   1 
ATOM   1480 C  CA  . PHE A 1 186 ? -7.431  76.201 34.129 1.00 24.77 ? 186  PHE A CA  1 
ATOM   1481 C  C   . PHE A 1 186 ? -7.079  77.310 35.108 1.00 25.22 ? 186  PHE A C   1 
ATOM   1482 O  O   . PHE A 1 186 ? -7.532  78.457 34.950 1.00 24.83 ? 186  PHE A O   1 
ATOM   1483 C  CB  . PHE A 1 186 ? -8.846  75.672 34.349 1.00 24.42 ? 186  PHE A CB  1 
ATOM   1484 C  CG  . PHE A 1 186 ? -9.206  74.569 33.396 1.00 25.78 ? 186  PHE A CG  1 
ATOM   1485 C  CD1 . PHE A 1 186 ? -9.237  74.819 32.014 1.00 25.65 ? 186  PHE A CD1 1 
ATOM   1486 C  CD2 . PHE A 1 186 ? -9.460  73.281 33.854 1.00 25.00 ? 186  PHE A CD2 1 
ATOM   1487 C  CE1 . PHE A 1 186 ? -9.548  73.792 31.099 1.00 26.84 ? 186  PHE A CE1 1 
ATOM   1488 C  CE2 . PHE A 1 186 ? -9.770  72.253 32.956 1.00 28.00 ? 186  PHE A CE2 1 
ATOM   1489 C  CZ  . PHE A 1 186 ? -9.816  72.519 31.557 1.00 26.97 ? 186  PHE A CZ  1 
ATOM   1490 N  N   . PHE A 1 187 ? -6.229  76.972 36.091 1.00 25.18 ? 187  PHE A N   1 
ATOM   1491 C  CA  . PHE A 1 187 ? -5.738  77.949 37.067 1.00 25.46 ? 187  PHE A CA  1 
ATOM   1492 C  C   . PHE A 1 187 ? -4.416  78.514 36.612 1.00 25.48 ? 187  PHE A C   1 
ATOM   1493 O  O   . PHE A 1 187 ? -3.806  79.322 37.302 1.00 26.00 ? 187  PHE A O   1 
ATOM   1494 C  CB  . PHE A 1 187 ? -5.626  77.328 38.475 1.00 25.47 ? 187  PHE A CB  1 
ATOM   1495 C  CG  . PHE A 1 187 ? -6.932  76.798 39.001 1.00 25.11 ? 187  PHE A CG  1 
ATOM   1496 C  CD1 . PHE A 1 187 ? -7.356  75.523 38.683 1.00 22.99 ? 187  PHE A CD1 1 
ATOM   1497 C  CD2 . PHE A 1 187 ? -7.750  77.600 39.798 1.00 25.27 ? 187  PHE A CD2 1 
ATOM   1498 C  CE1 . PHE A 1 187 ? -8.581  75.039 39.159 1.00 24.35 ? 187  PHE A CE1 1 
ATOM   1499 C  CE2 . PHE A 1 187 ? -8.958  77.134 40.277 1.00 24.07 ? 187  PHE A CE2 1 
ATOM   1500 C  CZ  . PHE A 1 187 ? -9.382  75.842 39.955 1.00 23.87 ? 187  PHE A CZ  1 
ATOM   1501 N  N   . GLY A 1 188 ? -3.977  78.111 35.425 1.00 25.88 ? 188  GLY A N   1 
ATOM   1502 C  CA  . GLY A 1 188 ? -2.705  78.582 34.892 1.00 25.70 ? 188  GLY A CA  1 
ATOM   1503 C  C   . GLY A 1 188 ? -1.532  77.698 35.259 1.00 26.43 ? 188  GLY A C   1 
ATOM   1504 O  O   . GLY A 1 188 ? -0.373  78.073 35.053 1.00 26.39 ? 188  GLY A O   1 
ATOM   1505 N  N   . GLY A 1 189 ? -1.826  76.507 35.782 1.00 26.51 ? 189  GLY A N   1 
ATOM   1506 C  CA  . GLY A 1 189 ? -0.774  75.560 36.148 1.00 26.51 ? 189  GLY A CA  1 
ATOM   1507 C  C   . GLY A 1 189 ? -0.447  74.603 35.017 1.00 26.99 ? 189  GLY A C   1 
ATOM   1508 O  O   . GLY A 1 189 ? -1.298  74.306 34.173 1.00 26.70 ? 189  GLY A O   1 
ATOM   1509 N  N   . ASP A 1 190 ? 0.795   74.134 34.981 1.00 26.67 ? 190  ASP A N   1 
ATOM   1510 C  CA  . ASP A 1 190 ? 1.200   73.109 34.026 1.00 27.34 ? 190  ASP A CA  1 
ATOM   1511 C  C   . ASP A 1 190 ? 1.111   71.728 34.675 1.00 27.05 ? 190  ASP A C   1 
ATOM   1512 O  O   . ASP A 1 190 ? 1.940   71.400 35.519 1.00 28.06 ? 190  ASP A O   1 
ATOM   1513 C  CB  . ASP A 1 190 ? 2.636   73.394 33.570 1.00 26.79 ? 190  ASP A CB  1 
ATOM   1514 C  CG  . ASP A 1 190 ? 3.197   72.323 32.676 1.00 28.59 ? 190  ASP A CG  1 
ATOM   1515 O  OD1 . ASP A 1 190 ? 2.462   71.417 32.227 1.00 30.24 ? 190  ASP A OD1 1 
ATOM   1516 O  OD2 . ASP A 1 190 ? 4.414   72.370 32.424 1.00 31.18 ? 190  ASP A OD2 1 
ATOM   1517 N  N   . PRO A 1 191 ? 0.135   70.892 34.259 1.00 27.20 ? 191  PRO A N   1 
ATOM   1518 C  CA  . PRO A 1 191 ? 0.001   69.576 34.889 1.00 26.71 ? 191  PRO A CA  1 
ATOM   1519 C  C   . PRO A 1 191 ? 1.174   68.619 34.633 1.00 27.55 ? 191  PRO A C   1 
ATOM   1520 O  O   . PRO A 1 191 ? 1.250   67.571 35.278 1.00 27.52 ? 191  PRO A O   1 
ATOM   1521 C  CB  . PRO A 1 191 ? -1.295  69.018 34.273 1.00 26.62 ? 191  PRO A CB  1 
ATOM   1522 C  CG  . PRO A 1 191 ? -1.437  69.743 32.958 1.00 25.99 ? 191  PRO A CG  1 
ATOM   1523 C  CD  . PRO A 1 191 ? -0.910  71.125 33.233 1.00 26.58 ? 191  PRO A CD  1 
ATOM   1524 N  N   . LYS A 1 192 ? 2.073   68.963 33.714 1.00 27.83 ? 192  LYS A N   1 
ATOM   1525 C  CA  . LYS A 1 192 ? 3.260   68.140 33.458 1.00 28.78 ? 192  LYS A CA  1 
ATOM   1526 C  C   . LYS A 1 192 ? 4.473   68.539 34.308 1.00 27.77 ? 192  LYS A C   1 
ATOM   1527 O  O   . LYS A 1 192 ? 5.523   67.900 34.238 1.00 26.92 ? 192  LYS A O   1 
ATOM   1528 C  CB  . LYS A 1 192 ? 3.631   68.164 31.961 1.00 29.73 ? 192  LYS A CB  1 
ATOM   1529 C  CG  . LYS A 1 192 ? 2.473   67.703 31.043 1.00 34.72 ? 192  LYS A CG  1 
ATOM   1530 C  CD  . LYS A 1 192 ? 2.081   66.225 31.251 1.00 39.96 ? 192  LYS A CD  1 
ATOM   1531 C  CE  . LYS A 1 192 ? 0.751   65.918 30.517 1.00 43.82 ? 192  LYS A CE  1 
ATOM   1532 N  NZ  . LYS A 1 192 ? -0.426  66.647 31.114 1.00 46.77 ? 192  LYS A NZ  1 
ATOM   1533 N  N   . THR A 1 193 ? 4.319   69.600 35.092 1.00 26.59 ? 193  THR A N   1 
ATOM   1534 C  CA  . THR A 1 193 ? 5.387   70.073 35.964 1.00 26.50 ? 193  THR A CA  1 
ATOM   1535 C  C   . THR A 1 193 ? 4.849   70.304 37.399 1.00 25.40 ? 193  THR A C   1 
ATOM   1536 O  O   . THR A 1 193 ? 4.909   71.407 37.941 1.00 25.10 ? 193  THR A O   1 
ATOM   1537 C  CB  . THR A 1 193 ? 6.069   71.334 35.374 1.00 26.71 ? 193  THR A CB  1 
ATOM   1538 O  OG1 . THR A 1 193 ? 6.338   71.109 33.979 1.00 28.98 ? 193  THR A OG1 1 
ATOM   1539 C  CG2 . THR A 1 193 ? 7.387   71.612 36.081 1.00 25.84 ? 193  THR A CG2 1 
ATOM   1540 N  N   . VAL A 1 194 ? 4.310   69.233 37.973 1.00 24.36 ? 194  VAL A N   1 
ATOM   1541 C  CA  . VAL A 1 194 ? 3.799   69.214 39.336 1.00 23.89 ? 194  VAL A CA  1 
ATOM   1542 C  C   . VAL A 1 194 ? 4.852   68.590 40.261 1.00 24.03 ? 194  VAL A C   1 
ATOM   1543 O  O   . VAL A 1 194 ? 5.310   67.475 40.011 1.00 23.78 ? 194  VAL A O   1 
ATOM   1544 C  CB  . VAL A 1 194 ? 2.508   68.386 39.419 1.00 24.23 ? 194  VAL A CB  1 
ATOM   1545 C  CG1 . VAL A 1 194 ? 1.996   68.268 40.887 1.00 23.74 ? 194  VAL A CG1 1 
ATOM   1546 C  CG2 . VAL A 1 194 ? 1.434   69.011 38.551 1.00 23.70 ? 194  VAL A CG2 1 
ATOM   1547 N  N   . THR A 1 195 ? 5.243   69.332 41.298 1.00 23.40 ? 195  THR A N   1 
ATOM   1548 C  CA  . THR A 1 195 ? 6.088   68.797 42.369 1.00 22.94 ? 195  THR A CA  1 
ATOM   1549 C  C   . THR A 1 195 ? 5.201   68.512 43.594 1.00 22.49 ? 195  THR A C   1 
ATOM   1550 O  O   . THR A 1 195 ? 4.464   69.391 44.065 1.00 23.42 ? 195  THR A O   1 
ATOM   1551 C  CB  . THR A 1 195 ? 7.231   69.743 42.729 1.00 22.44 ? 195  THR A CB  1 
ATOM   1552 O  OG1 . THR A 1 195 ? 8.162   69.789 41.643 1.00 21.95 ? 195  THR A OG1 1 
ATOM   1553 C  CG2 . THR A 1 195 ? 8.000   69.265 44.010 1.00 21.70 ? 195  THR A CG2 1 
ATOM   1554 N  N   . ILE A 1 196 ? 5.227   67.279 44.074 1.00 21.38 ? 196  ILE A N   1 
ATOM   1555 C  CA  . ILE A 1 196 ? 4.618   67.008 45.384 1.00 20.99 ? 196  ILE A CA  1 
ATOM   1556 C  C   . ILE A 1 196 ? 5.665   67.189 46.493 1.00 21.35 ? 196  ILE A C   1 
ATOM   1557 O  O   . ILE A 1 196 ? 6.822   66.754 46.365 1.00 21.53 ? 196  ILE A O   1 
ATOM   1558 C  CB  . ILE A 1 196 ? 3.923   65.636 45.462 1.00 20.67 ? 196  ILE A CB  1 
ATOM   1559 C  CG1 . ILE A 1 196 ? 4.912   64.478 45.246 1.00 19.82 ? 196  ILE A CG1 1 
ATOM   1560 C  CG2 . ILE A 1 196 ? 2.773   65.556 44.435 1.00 22.60 ? 196  ILE A CG2 1 
ATOM   1561 C  CD1 . ILE A 1 196 ? 4.279   63.083 45.518 1.00 19.49 ? 196  ILE A CD1 1 
ATOM   1562 N  N   . PHE A 1 197 ? 5.262   67.865 47.563 1.00 21.33 ? 197  PHE A N   1 
ATOM   1563 C  CA  . PHE A 1 197 ? 6.147   68.060 48.719 1.00 21.15 ? 197  PHE A CA  1 
ATOM   1564 C  C   . PHE A 1 197 ? 5.374   67.931 50.024 1.00 20.94 ? 197  PHE A C   1 
ATOM   1565 O  O   . PHE A 1 197 ? 4.197   68.247 50.083 1.00 20.78 ? 197  PHE A O   1 
ATOM   1566 C  CB  . PHE A 1 197 ? 7.037   69.322 48.618 1.00 20.10 ? 197  PHE A CB  1 
ATOM   1567 C  CG  . PHE A 1 197 ? 6.327   70.664 48.816 1.00 20.66 ? 197  PHE A CG  1 
ATOM   1568 C  CD1 . PHE A 1 197 ? 5.178   70.998 48.112 1.00 20.01 ? 197  PHE A CD1 1 
ATOM   1569 C  CD2 . PHE A 1 197 ? 6.906   71.635 49.646 1.00 21.38 ? 197  PHE A CD2 1 
ATOM   1570 C  CE1 . PHE A 1 197 ? 4.574   72.259 48.275 1.00 20.69 ? 197  PHE A CE1 1 
ATOM   1571 C  CE2 . PHE A 1 197 ? 6.312   72.910 49.825 1.00 21.31 ? 197  PHE A CE2 1 
ATOM   1572 C  CZ  . PHE A 1 197 ? 5.144   73.215 49.142 1.00 21.05 ? 197  PHE A CZ  1 
ATOM   1573 N  N   . GLY A 1 198 ? 6.042   67.407 51.048 1.00 21.47 ? 198  GLY A N   1 
ATOM   1574 C  CA  . GLY A 1 198 ? 5.380   67.163 52.322 1.00 20.49 ? 198  GLY A CA  1 
ATOM   1575 C  C   . GLY A 1 198 ? 6.406   66.971 53.415 1.00 20.15 ? 198  GLY A C   1 
ATOM   1576 O  O   . GLY A 1 198 ? 7.569   66.658 53.141 1.00 20.00 ? 198  GLY A O   1 
ATOM   1577 N  N   . GLU A 1 199 ? 5.964   67.150 54.653 1.00 20.19 ? 199  GLU A N   1 
ATOM   1578 C  CA  . GLU A 1 199 ? 6.853   67.012 55.795 1.00 20.18 ? 199  GLU A CA  1 
ATOM   1579 C  C   . GLU A 1 199 ? 6.364   65.901 56.736 1.00 19.94 ? 199  GLU A C   1 
ATOM   1580 O  O   . GLU A 1 199 ? 5.153   65.748 56.941 1.00 19.71 ? 199  GLU A O   1 
ATOM   1581 C  CB  . GLU A 1 199 ? 7.001   68.356 56.513 1.00 20.44 ? 199  GLU A CB  1 
ATOM   1582 C  CG  . GLU A 1 199 ? 8.022   68.334 57.684 1.00 20.83 ? 199  GLU A CG  1 
ATOM   1583 C  CD  . GLU A 1 199 ? 7.382   67.962 59.027 1.00 22.77 ? 199  GLU A CD  1 
ATOM   1584 O  OE1 . GLU A 1 199 ? 6.143   67.851 59.089 1.00 21.68 ? 199  GLU A OE1 1 
ATOM   1585 O  OE2 . GLU A 1 199 ? 8.120   67.774 60.026 1.00 24.09 ? 199  GLU A OE2 1 
ATOM   1586 N  N   . SER A 1 200 ? 7.315   65.136 57.280 1.00 20.45 ? 200  SER A N   1 
ATOM   1587 C  CA  . SER A 1 200 ? 7.050   64.074 58.272 1.00 21.37 ? 200  SER A CA  1 
ATOM   1588 C  C   . SER A 1 200 ? 6.138   63.014 57.630 1.00 20.77 ? 200  SER A C   1 
ATOM   1589 O  O   . SER A 1 200 ? 6.556   62.410 56.626 1.00 20.75 ? 200  SER A O   1 
ATOM   1590 C  CB  . SER A 1 200 ? 6.506   64.685 59.588 1.00 22.24 ? 200  SER A CB  1 
ATOM   1591 O  OG  . SER A 1 200 ? 6.485   63.768 60.669 1.00 25.65 ? 200  SER A OG  1 
ATOM   1592 N  N   . ALA A 1 201 ? 4.929   62.772 58.151 1.00 19.62 ? 201  ALA A N   1 
ATOM   1593 C  CA  . ALA A 1 201 ? 4.008   61.863 57.438 1.00 19.67 ? 201  ALA A CA  1 
ATOM   1594 C  C   . ALA A 1 201 ? 3.704   62.300 55.993 1.00 19.54 ? 201  ALA A C   1 
ATOM   1595 O  O   . ALA A 1 201 ? 3.424   61.449 55.140 1.00 20.08 ? 201  ALA A O   1 
ATOM   1596 C  CB  . ALA A 1 201 ? 2.696   61.644 58.205 1.00 19.03 ? 201  ALA A CB  1 
ATOM   1597 N  N   . GLY A 1 202 ? 3.722   63.611 55.722 1.00 19.16 ? 202  GLY A N   1 
ATOM   1598 C  CA  . GLY A 1 202 ? 3.560   64.100 54.352 1.00 18.28 ? 202  GLY A CA  1 
ATOM   1599 C  C   . GLY A 1 202 ? 4.770   63.747 53.495 1.00 18.61 ? 202  GLY A C   1 
ATOM   1600 O  O   . GLY A 1 202 ? 4.627   63.477 52.301 1.00 19.56 ? 202  GLY A O   1 
ATOM   1601 N  N   . GLY A 1 203 ? 5.962   63.749 54.094 1.00 18.93 ? 203  GLY A N   1 
ATOM   1602 C  CA  . GLY A 1 203 ? 7.200   63.312 53.424 1.00 18.34 ? 203  GLY A CA  1 
ATOM   1603 C  C   . GLY A 1 203 ? 7.175   61.813 53.156 1.00 19.13 ? 203  GLY A C   1 
ATOM   1604 O  O   . GLY A 1 203 ? 7.493   61.362 52.052 1.00 19.05 ? 203  GLY A O   1 
ATOM   1605 N  N   . ALA A 1 204 ? 6.788   61.028 54.164 1.00 18.22 ? 204  ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 204 ? 6.550   59.595 53.960 1.00 18.47 ? 204  ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 204 ? 5.556   59.371 52.804 1.00 18.55 ? 204  ALA A C   1 
ATOM   1608 O  O   . ALA A 1 204 ? 5.800   58.556 51.892 1.00 18.28 ? 204  ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 204 ? 6.018   58.968 55.251 1.00 17.75 ? 204  ALA A CB  1 
ATOM   1610 N  N   . SER A 1 205 ? 4.444   60.095 52.848 1.00 18.66 ? 205  SER A N   1 
ATOM   1611 C  CA  . SER A 1 205 ? 3.411   60.009 51.812 1.00 19.83 ? 205  SER A CA  1 
ATOM   1612 C  C   . SER A 1 205 ? 3.970   60.283 50.399 1.00 20.18 ? 205  SER A C   1 
ATOM   1613 O  O   . SER A 1 205 ? 3.666   59.527 49.467 1.00 20.15 ? 205  SER A O   1 
ATOM   1614 C  CB  . SER A 1 205 ? 2.264   61.001 52.095 1.00 19.35 ? 205  SER A CB  1 
ATOM   1615 O  OG  . SER A 1 205 ? 1.485   60.562 53.198 1.00 22.18 ? 205  SER A OG  1 
ATOM   1616 N  N   . VAL A 1 206 ? 4.729   61.374 50.249 1.00 20.30 ? 206  VAL A N   1 
ATOM   1617 C  CA  . VAL A 1 206 ? 5.402   61.681 48.983 1.00 20.58 ? 206  VAL A CA  1 
ATOM   1618 C  C   . VAL A 1 206 ? 6.206   60.446 48.483 1.00 21.28 ? 206  VAL A C   1 
ATOM   1619 O  O   . VAL A 1 206 ? 6.067   60.028 47.326 1.00 20.63 ? 206  VAL A O   1 
ATOM   1620 C  CB  . VAL A 1 206 ? 6.292   62.952 49.084 1.00 20.66 ? 206  VAL A CB  1 
ATOM   1621 C  CG1 . VAL A 1 206 ? 7.279   63.038 47.926 1.00 19.32 ? 206  VAL A CG1 1 
ATOM   1622 C  CG2 . VAL A 1 206 ? 5.416   64.243 49.188 1.00 18.65 ? 206  VAL A CG2 1 
ATOM   1623 N  N   . GLY A 1 207 ? 7.014   59.851 49.362 1.00 21.45 ? 207  GLY A N   1 
ATOM   1624 C  CA  . GLY A 1 207 ? 7.747   58.625 49.024 1.00 20.19 ? 207  GLY A CA  1 
ATOM   1625 C  C   . GLY A 1 207 ? 6.840   57.467 48.635 1.00 20.79 ? 207  GLY A C   1 
ATOM   1626 O  O   . GLY A 1 207 ? 7.181   56.649 47.761 1.00 21.30 ? 207  GLY A O   1 
ATOM   1627 N  N   . MET A 1 208 ? 5.683   57.379 49.282 1.00 19.69 ? 208  MET A N   1 
ATOM   1628 C  CA  . MET A 1 208 ? 4.741   56.317 48.990 1.00 19.34 ? 208  MET A CA  1 
ATOM   1629 C  C   . MET A 1 208 ? 4.134   56.503 47.590 1.00 19.33 ? 208  MET A C   1 
ATOM   1630 O  O   . MET A 1 208 ? 3.870   55.523 46.907 1.00 19.82 ? 208  MET A O   1 
ATOM   1631 C  CB  . MET A 1 208 ? 3.663   56.273 50.073 1.00 18.87 ? 208  MET A CB  1 
ATOM   1632 C  CG  . MET A 1 208 ? 4.255   55.745 51.401 1.00 19.54 ? 208  MET A CG  1 
ATOM   1633 S  SD  . MET A 1 208 ? 3.151   55.905 52.797 1.00 20.18 ? 208  MET A SD  1 
ATOM   1634 C  CE  . MET A 1 208 ? 4.067   54.888 53.984 1.00 19.00 ? 208  MET A CE  1 
ATOM   1635 N  N   . HIS A 1 209 ? 3.921   57.749 47.176 1.00 18.56 ? 209  HIS A N   1 
ATOM   1636 C  CA  . HIS A 1 209 ? 3.439   58.000 45.803 1.00 20.16 ? 209  HIS A CA  1 
ATOM   1637 C  C   . HIS A 1 209 ? 4.523   57.745 44.762 1.00 20.27 ? 209  HIS A C   1 
ATOM   1638 O  O   . HIS A 1 209 ? 4.219   57.331 43.644 1.00 21.31 ? 209  HIS A O   1 
ATOM   1639 C  CB  . HIS A 1 209 ? 2.870   59.411 45.691 1.00 19.08 ? 209  HIS A CB  1 
ATOM   1640 C  CG  . HIS A 1 209 ? 1.644   59.600 46.516 1.00 19.80 ? 209  HIS A CG  1 
ATOM   1641 N  ND1 . HIS A 1 209 ? 0.502   58.853 46.321 1.00 20.06 ? 209  HIS A ND1 1 
ATOM   1642 C  CD2 . HIS A 1 209 ? 1.377   60.437 47.553 1.00 20.65 ? 209  HIS A CD2 1 
ATOM   1643 C  CE1 . HIS A 1 209 ? -0.427  59.233 47.188 1.00 21.05 ? 209  HIS A CE1 1 
ATOM   1644 N  NE2 . HIS A 1 209 ? 0.076   60.198 47.942 1.00 19.65 ? 209  HIS A NE2 1 
ATOM   1645 N  N   . ILE A 1 210 ? 5.783   57.977 45.137 1.00 20.84 ? 210  ILE A N   1 
ATOM   1646 C  CA  . ILE A 1 210 ? 6.922   57.594 44.296 1.00 21.57 ? 210  ILE A CA  1 
ATOM   1647 C  C   . ILE A 1 210 ? 6.913   56.074 44.060 1.00 22.19 ? 210  ILE A C   1 
ATOM   1648 O  O   . ILE A 1 210 ? 7.111   55.611 42.922 1.00 22.28 ? 210  ILE A O   1 
ATOM   1649 C  CB  . ILE A 1 210 ? 8.247   58.062 44.900 1.00 21.39 ? 210  ILE A CB  1 
ATOM   1650 C  CG1 . ILE A 1 210 ? 8.377   59.589 44.779 1.00 21.03 ? 210  ILE A CG1 1 
ATOM   1651 C  CG2 . ILE A 1 210 ? 9.466   57.336 44.264 1.00 22.86 ? 210  ILE A CG2 1 
ATOM   1652 C  CD1 . ILE A 1 210 ? 9.608   60.151 45.465 1.00 21.35 ? 210  ILE A CD1 1 
ATOM   1653 N  N   . LEU A 1 211 ? 6.640   55.309 45.119 1.00 22.28 ? 211  LEU A N   1 
ATOM   1654 C  CA  . LEU A 1 211 ? 6.641   53.864 45.038 1.00 23.12 ? 211  LEU A CA  1 
ATOM   1655 C  C   . LEU A 1 211 ? 5.412   53.269 44.337 1.00 23.06 ? 211  LEU A C   1 
ATOM   1656 O  O   . LEU A 1 211 ? 5.546   52.349 43.531 1.00 23.83 ? 211  LEU A O   1 
ATOM   1657 C  CB  . LEU A 1 211 ? 6.762   53.242 46.441 1.00 23.40 ? 211  LEU A CB  1 
ATOM   1658 C  CG  . LEU A 1 211 ? 8.128   53.351 47.123 1.00 25.86 ? 211  LEU A CG  1 
ATOM   1659 C  CD1 . LEU A 1 211 ? 7.913   53.302 48.647 1.00 28.47 ? 211  LEU A CD1 1 
ATOM   1660 C  CD2 . LEU A 1 211 ? 9.036   52.238 46.687 1.00 26.54 ? 211  LEU A CD2 1 
ATOM   1661 N  N   . SER A 1 212 ? 4.227   53.742 44.684 1.00 22.68 ? 212  SER A N   1 
ATOM   1662 C  CA  . SER A 1 212 ? 2.993   53.099 44.224 1.00 23.22 ? 212  SER A CA  1 
ATOM   1663 C  C   . SER A 1 212 ? 2.791   53.294 42.710 1.00 22.79 ? 212  SER A C   1 
ATOM   1664 O  O   . SER A 1 212 ? 2.634   54.435 42.254 1.00 22.58 ? 212  SER A O   1 
ATOM   1665 C  CB  . SER A 1 212 ? 1.784   53.676 44.932 1.00 22.67 ? 212  SER A CB  1 
ATOM   1666 O  OG  . SER A 1 212 ? 0.603   52.977 44.532 1.00 24.06 ? 212  SER A OG  1 
ATOM   1667 N  N   . PRO A 1 213 ? 2.774   52.192 41.949 1.00 22.67 ? 213  PRO A N   1 
ATOM   1668 C  CA  . PRO A 1 213 ? 2.512   52.260 40.491 1.00 22.79 ? 213  PRO A CA  1 
ATOM   1669 C  C   . PRO A 1 213 ? 1.285   53.106 40.180 1.00 22.35 ? 213  PRO A C   1 
ATOM   1670 O  O   . PRO A 1 213 ? 1.305   53.880 39.230 1.00 22.33 ? 213  PRO A O   1 
ATOM   1671 C  CB  . PRO A 1 213 ? 2.291   50.785 40.103 1.00 23.14 ? 213  PRO A CB  1 
ATOM   1672 C  CG  . PRO A 1 213 ? 3.124   50.017 41.121 1.00 23.61 ? 213  PRO A CG  1 
ATOM   1673 C  CD  . PRO A 1 213 ? 2.998   50.808 42.409 1.00 23.00 ? 213  PRO A CD  1 
ATOM   1674 N  N   . GLY A 1 214 ? 0.243   53.004 41.006 1.00 22.48 ? 214  GLY A N   1 
ATOM   1675 C  CA  . GLY A 1 214 ? -0.995  53.761 40.766 1.00 22.86 ? 214  GLY A CA  1 
ATOM   1676 C  C   . GLY A 1 214 ? -0.918  55.262 41.005 1.00 23.00 ? 214  GLY A C   1 
ATOM   1677 O  O   . GLY A 1 214 ? -1.864  55.994 40.671 1.00 23.08 ? 214  GLY A O   1 
ATOM   1678 N  N   . SER A 1 215 ? 0.190   55.737 41.574 1.00 22.02 ? 215  SER A N   1 
ATOM   1679 C  CA  . SER A 1 215 ? 0.351   57.188 41.807 1.00 21.83 ? 215  SER A CA  1 
ATOM   1680 C  C   . SER A 1 215 ? 1.395   57.847 40.906 1.00 21.73 ? 215  SER A C   1 
ATOM   1681 O  O   . SER A 1 215 ? 1.331   59.067 40.675 1.00 21.72 ? 215  SER A O   1 
ATOM   1682 C  CB  . SER A 1 215 ? 0.793   57.481 43.259 1.00 21.21 ? 215  SER A CB  1 
ATOM   1683 O  OG  . SER A 1 215 ? -0.206  57.172 44.198 1.00 20.46 ? 215  SER A OG  1 
ATOM   1684 N  N   . ARG A 1 216 ? 2.376   57.058 40.463 1.00 22.27 ? 216  ARG A N   1 
ATOM   1685 C  CA  . ARG A 1 216 ? 3.597   57.580 39.803 1.00 23.24 ? 216  ARG A CA  1 
ATOM   1686 C  C   . ARG A 1 216 ? 3.351   58.571 38.669 1.00 23.72 ? 216  ARG A C   1 
ATOM   1687 O  O   . ARG A 1 216 ? 4.104   59.534 38.507 1.00 24.48 ? 216  ARG A O   1 
ATOM   1688 C  CB  . ARG A 1 216 ? 4.414   56.436 39.209 1.00 23.45 ? 216  ARG A CB  1 
ATOM   1689 C  CG  . ARG A 1 216 ? 5.086   55.600 40.219 1.00 25.29 ? 216  ARG A CG  1 
ATOM   1690 C  CD  . ARG A 1 216 ? 5.873   54.509 39.549 1.00 24.08 ? 216  ARG A CD  1 
ATOM   1691 N  NE  . ARG A 1 216 ? 6.046   53.423 40.500 1.00 25.90 ? 216  ARG A NE  1 
ATOM   1692 C  CZ  . ARG A 1 216 ? 6.527   52.231 40.194 1.00 26.04 ? 216  ARG A CZ  1 
ATOM   1693 N  NH1 . ARG A 1 216 ? 6.882   51.965 38.937 1.00 25.91 ? 216  ARG A NH1 1 
ATOM   1694 N  NH2 . ARG A 1 216 ? 6.633   51.311 41.144 1.00 25.28 ? 216  ARG A NH2 1 
ATOM   1695 N  N   . ASP A 1 217 ? 2.325   58.318 37.867 1.00 23.81 ? 217  ASP A N   1 
ATOM   1696 C  CA  . ASP A 1 217 ? 2.094   59.126 36.653 1.00 24.73 ? 217  ASP A CA  1 
ATOM   1697 C  C   . ASP A 1 217 ? 1.482   60.493 36.937 1.00 24.41 ? 217  ASP A C   1 
ATOM   1698 O  O   . ASP A 1 217 ? 1.365   61.317 36.026 1.00 23.90 ? 217  ASP A O   1 
ATOM   1699 C  CB  . ASP A 1 217 ? 1.178   58.378 35.674 1.00 24.17 ? 217  ASP A CB  1 
ATOM   1700 C  CG  . ASP A 1 217 ? 1.789   57.082 35.156 1.00 26.33 ? 217  ASP A CG  1 
ATOM   1701 O  OD1 . ASP A 1 217 ? 2.930   56.732 35.532 1.00 26.05 ? 217  ASP A OD1 1 
ATOM   1702 O  OD2 . ASP A 1 217 ? 1.104   56.393 34.370 1.00 27.32 ? 217  ASP A OD2 1 
ATOM   1703 N  N   . LEU A 1 218 ? 1.087   60.737 38.192 1.00 24.19 ? 218  LEU A N   1 
ATOM   1704 C  CA  . LEU A 1 218 ? 0.348   61.958 38.518 1.00 23.92 ? 218  LEU A CA  1 
ATOM   1705 C  C   . LEU A 1 218 ? 1.211   63.151 38.934 1.00 24.09 ? 218  LEU A C   1 
ATOM   1706 O  O   . LEU A 1 218 ? 0.684   64.223 39.273 1.00 25.87 ? 218  LEU A O   1 
ATOM   1707 C  CB  . LEU A 1 218 ? -0.746  61.676 39.561 1.00 23.38 ? 218  LEU A CB  1 
ATOM   1708 C  CG  . LEU A 1 218 ? -1.889  60.775 39.098 1.00 23.57 ? 218  LEU A CG  1 
ATOM   1709 C  CD1 . LEU A 1 218 ? -2.717  60.327 40.308 1.00 22.54 ? 218  LEU A CD1 1 
ATOM   1710 C  CD2 . LEU A 1 218 ? -2.757  61.549 38.100 1.00 22.90 ? 218  LEU A CD2 1 
ATOM   1711 N  N   . PHE A 1 219 ? 2.524   62.995 38.908 1.00 22.92 ? 219  PHE A N   1 
ATOM   1712 C  CA  . PHE A 1 219 ? 3.387   64.117 39.277 1.00 22.05 ? 219  PHE A CA  1 
ATOM   1713 C  C   . PHE A 1 219 ? 4.724   63.945 38.592 1.00 22.11 ? 219  PHE A C   1 
ATOM   1714 O  O   . PHE A 1 219 ? 5.038   62.874 38.068 1.00 22.10 ? 219  PHE A O   1 
ATOM   1715 C  CB  . PHE A 1 219 ? 3.544   64.237 40.813 1.00 21.69 ? 219  PHE A CB  1 
ATOM   1716 C  CG  . PHE A 1 219 ? 4.167   63.021 41.443 1.00 21.16 ? 219  PHE A CG  1 
ATOM   1717 C  CD1 . PHE A 1 219 ? 3.407   61.879 41.697 1.00 20.71 ? 219  PHE A CD1 1 
ATOM   1718 C  CD2 . PHE A 1 219 ? 5.526   63.007 41.740 1.00 21.24 ? 219  PHE A CD2 1 
ATOM   1719 C  CE1 . PHE A 1 219 ? 4.017   60.717 42.271 1.00 20.31 ? 219  PHE A CE1 1 
ATOM   1720 C  CE2 . PHE A 1 219 ? 6.125   61.891 42.314 1.00 19.67 ? 219  PHE A CE2 1 
ATOM   1721 C  CZ  . PHE A 1 219 ? 5.366   60.735 42.560 1.00 19.17 ? 219  PHE A CZ  1 
ATOM   1722 N  N   . ARG A 1 220 ? 5.508   65.012 38.613 1.00 21.94 ? 220  ARG A N   1 
ATOM   1723 C  CA  . ARG A 1 220 ? 6.753   65.087 37.905 1.00 22.59 ? 220  ARG A CA  1 
ATOM   1724 C  C   . ARG A 1 220 ? 7.956   64.810 38.813 1.00 22.71 ? 220  ARG A C   1 
ATOM   1725 O  O   . ARG A 1 220 ? 8.867   64.068 38.444 1.00 22.82 ? 220  ARG A O   1 
ATOM   1726 C  CB  . ARG A 1 220 ? 6.875   66.504 37.316 1.00 22.17 ? 220  ARG A CB  1 
ATOM   1727 C  CG  . ARG A 1 220 ? 8.147   66.805 36.547 1.00 25.11 ? 220  ARG A CG  1 
ATOM   1728 C  CD  . ARG A 1 220 ? 8.296   65.912 35.342 1.00 28.45 ? 220  ARG A CD  1 
ATOM   1729 N  NE  . ARG A 1 220 ? 9.406   66.324 34.467 1.00 32.16 ? 220  ARG A NE  1 
ATOM   1730 C  CZ  . ARG A 1 220 ? 9.279   67.151 33.425 1.00 32.06 ? 220  ARG A CZ  1 
ATOM   1731 N  NH1 . ARG A 1 220 ? 8.097   67.681 33.111 1.00 29.20 ? 220  ARG A NH1 1 
ATOM   1732 N  NH2 . ARG A 1 220 ? 10.339  67.431 32.676 1.00 30.59 ? 220  ARG A NH2 1 
ATOM   1733 N  N   . ARG A 1 221 ? 7.981   65.447 39.975 1.00 22.11 ? 221  ARG A N   1 
ATOM   1734 C  CA  . ARG A 1 221 ? 9.133   65.314 40.882 1.00 22.44 ? 221  ARG A CA  1 
ATOM   1735 C  C   . ARG A 1 221 ? 8.666   65.537 42.306 1.00 21.76 ? 221  ARG A C   1 
ATOM   1736 O  O   . ARG A 1 221 ? 7.479   65.750 42.539 1.00 21.47 ? 221  ARG A O   1 
ATOM   1737 C  CB  . ARG A 1 221 ? 10.296  66.252 40.503 1.00 22.28 ? 221  ARG A CB  1 
ATOM   1738 C  CG  . ARG A 1 221 ? 9.902   67.701 40.232 1.00 24.98 ? 221  ARG A CG  1 
ATOM   1739 C  CD  . ARG A 1 221 ? 11.108  68.547 39.748 1.00 26.92 ? 221  ARG A CD  1 
ATOM   1740 N  NE  . ARG A 1 221 ? 11.678  68.058 38.495 1.00 26.80 ? 221  ARG A NE  1 
ATOM   1741 C  CZ  . ARG A 1 221 ? 11.492  68.639 37.305 1.00 27.94 ? 221  ARG A CZ  1 
ATOM   1742 N  NH1 . ARG A 1 221 ? 10.759  69.739 37.187 1.00 25.36 ? 221  ARG A NH1 1 
ATOM   1743 N  NH2 . ARG A 1 221 ? 12.047  68.117 36.224 1.00 25.00 ? 221  ARG A NH2 1 
ATOM   1744 N  N   . ALA A 1 222 ? 9.590   65.476 43.258 1.00 22.10 ? 222  ALA A N   1 
ATOM   1745 C  CA  . ALA A 1 222 ? 9.175   65.256 44.647 1.00 21.98 ? 222  ALA A CA  1 
ATOM   1746 C  C   . ALA A 1 222 ? 10.159  65.841 45.650 1.00 21.78 ? 222  ALA A C   1 
ATOM   1747 O  O   . ALA A 1 222 ? 11.359  65.840 45.421 1.00 21.03 ? 222  ALA A O   1 
ATOM   1748 C  CB  . ALA A 1 222 ? 8.960   63.744 44.899 1.00 21.94 ? 222  ALA A CB  1 
ATOM   1749 N  N   . ILE A 1 223 ? 9.614   66.361 46.746 1.00 21.53 ? 223  ILE A N   1 
ATOM   1750 C  CA  . ILE A 1 223 ? 10.412  66.875 47.849 1.00 21.33 ? 223  ILE A CA  1 
ATOM   1751 C  C   . ILE A 1 223 ? 9.935   66.201 49.150 1.00 21.07 ? 223  ILE A C   1 
ATOM   1752 O  O   . ILE A 1 223 ? 8.730   66.138 49.413 1.00 20.33 ? 223  ILE A O   1 
ATOM   1753 C  CB  . ILE A 1 223 ? 10.267  68.409 47.990 1.00 21.40 ? 223  ILE A CB  1 
ATOM   1754 C  CG1 . ILE A 1 223 ? 10.803  69.131 46.737 1.00 22.06 ? 223  ILE A CG1 1 
ATOM   1755 C  CG2 . ILE A 1 223 ? 11.010  68.915 49.235 1.00 21.70 ? 223  ILE A CG2 1 
ATOM   1756 C  CD1 . ILE A 1 223 ? 10.432  70.617 46.683 1.00 21.97 ? 223  ILE A CD1 1 
ATOM   1757 N  N   . LEU A 1 224 ? 10.881  65.701 49.947 1.00 20.48 ? 224  LEU A N   1 
ATOM   1758 C  CA  . LEU A 1 224 ? 10.522  64.990 51.192 1.00 20.90 ? 224  LEU A CA  1 
ATOM   1759 C  C   . LEU A 1 224 ? 11.234  65.677 52.351 1.00 20.84 ? 224  LEU A C   1 
ATOM   1760 O  O   . LEU A 1 224 ? 12.451  65.709 52.385 1.00 20.86 ? 224  LEU A O   1 
ATOM   1761 C  CB  . LEU A 1 224 ? 10.937  63.514 51.129 1.00 20.05 ? 224  LEU A CB  1 
ATOM   1762 C  CG  . LEU A 1 224 ? 10.342  62.569 50.070 1.00 21.08 ? 224  LEU A CG  1 
ATOM   1763 C  CD1 . LEU A 1 224 ? 11.007  62.769 48.700 1.00 19.77 ? 224  LEU A CD1 1 
ATOM   1764 C  CD2 . LEU A 1 224 ? 10.503  61.111 50.520 1.00 19.80 ? 224  LEU A CD2 1 
ATOM   1765 N  N   . GLN A 1 225 ? 10.469  66.216 53.294 1.00 20.76 ? 225  GLN A N   1 
ATOM   1766 C  CA  . GLN A 1 225 ? 11.030  66.900 54.455 1.00 20.61 ? 225  GLN A CA  1 
ATOM   1767 C  C   . GLN A 1 225 ? 10.847  66.040 55.720 1.00 20.40 ? 225  GLN A C   1 
ATOM   1768 O  O   . GLN A 1 225 ? 9.724   65.768 56.117 1.00 20.65 ? 225  GLN A O   1 
ATOM   1769 C  CB  . GLN A 1 225 ? 10.326  68.251 54.604 1.00 20.22 ? 225  GLN A CB  1 
ATOM   1770 C  CG  . GLN A 1 225 ? 10.601  69.191 53.400 1.00 21.44 ? 225  GLN A CG  1 
ATOM   1771 C  CD  . GLN A 1 225 ? 9.715   70.422 53.357 1.00 21.96 ? 225  GLN A CD  1 
ATOM   1772 O  OE1 . GLN A 1 225 ? 9.387   70.901 52.276 1.00 22.63 ? 225  GLN A OE1 1 
ATOM   1773 N  NE2 . GLN A 1 225 ? 9.334   70.949 54.528 1.00 20.64 ? 225  GLN A NE2 1 
ATOM   1774 N  N   . SER A 1 226 ? 11.946  65.592 56.329 1.00 20.79 ? 226  SER A N   1 
ATOM   1775 C  CA  . SER A 1 226 ? 11.888  64.831 57.595 1.00 21.04 ? 226  SER A CA  1 
ATOM   1776 C  C   . SER A 1 226 ? 10.922  63.654 57.541 1.00 20.83 ? 226  SER A C   1 
ATOM   1777 O  O   . SER A 1 226 ? 10.172  63.407 58.484 1.00 21.03 ? 226  SER A O   1 
ATOM   1778 C  CB  . SER A 1 226 ? 11.472  65.749 58.749 1.00 21.02 ? 226  SER A CB  1 
ATOM   1779 O  OG  . SER A 1 226 ? 12.407  66.796 58.907 1.00 20.43 ? 226  SER A OG  1 
ATOM   1780 N  N   . GLY A 1 227 ? 10.941  62.915 56.442 1.00 21.04 ? 227  GLY A N   1 
ATOM   1781 C  CA  . GLY A 1 227 ? 10.006  61.802 56.295 1.00 20.49 ? 227  GLY A CA  1 
ATOM   1782 C  C   . GLY A 1 227 ? 10.411  60.981 55.102 1.00 21.07 ? 227  GLY A C   1 
ATOM   1783 O  O   . GLY A 1 227 ? 10.941  61.519 54.111 1.00 21.00 ? 227  GLY A O   1 
ATOM   1784 N  N   . SER A 1 228 ? 10.181  59.675 55.215 1.00 20.77 ? 228  SER A N   1 
ATOM   1785 C  CA  A SER A 1 228 ? 10.470  58.763 54.126 0.50 20.83 ? 228  SER A CA  1 
ATOM   1786 C  CA  B SER A 1 228 ? 10.575  58.701 54.206 0.50 21.02 ? 228  SER A CA  1 
ATOM   1787 C  C   . SER A 1 228 ? 9.559   57.547 54.234 1.00 20.73 ? 228  SER A C   1 
ATOM   1788 O  O   . SER A 1 228 ? 9.065   57.219 55.306 1.00 20.51 ? 228  SER A O   1 
ATOM   1789 C  CB  A SER A 1 228 ? 11.967  58.405 54.056 0.50 20.72 ? 228  SER A CB  1 
ATOM   1790 C  CB  B SER A 1 228 ? 11.978  58.193 54.549 0.50 20.87 ? 228  SER A CB  1 
ATOM   1791 O  OG  A SER A 1 228 ? 12.371  57.586 55.128 0.50 20.45 ? 228  SER A OG  1 
ATOM   1792 O  OG  B SER A 1 228 ? 12.621  57.628 53.431 0.50 21.88 ? 228  SER A OG  1 
ATOM   1793 N  N   . PRO A 1 229 ? 9.267   56.903 53.077 1.00 20.94 ? 229  PRO A N   1 
ATOM   1794 C  CA  . PRO A 1 229 ? 8.197   55.908 53.109 1.00 20.77 ? 229  PRO A CA  1 
ATOM   1795 C  C   . PRO A 1 229 ? 8.515   54.691 53.968 1.00 21.00 ? 229  PRO A C   1 
ATOM   1796 O  O   . PRO A 1 229 ? 7.605   54.036 54.466 1.00 21.04 ? 229  PRO A O   1 
ATOM   1797 C  CB  . PRO A 1 229 ? 8.038   55.509 51.622 1.00 21.35 ? 229  PRO A CB  1 
ATOM   1798 C  CG  . PRO A 1 229 ? 9.380   55.782 51.023 1.00 21.13 ? 229  PRO A CG  1 
ATOM   1799 C  CD  . PRO A 1 229 ? 9.854   57.036 51.727 1.00 21.35 ? 229  PRO A CD  1 
ATOM   1800 N  N   . ASN A 1 230 ? 9.801   54.411 54.144 1.00 20.20 ? 230  ASN A N   1 
ATOM   1801 C  CA  . ASN A 1 230 ? 10.259  53.281 54.936 1.00 20.59 ? 230  ASN A CA  1 
ATOM   1802 C  C   . ASN A 1 230 ? 10.443  53.600 56.426 1.00 20.66 ? 230  ASN A C   1 
ATOM   1803 O  O   . ASN A 1 230 ? 11.008  52.773 57.139 1.00 21.17 ? 230  ASN A O   1 
ATOM   1804 C  CB  . ASN A 1 230 ? 11.609  52.798 54.379 1.00 20.97 ? 230  ASN A CB  1 
ATOM   1805 C  CG  . ASN A 1 230 ? 12.609  53.920 54.265 1.00 22.18 ? 230  ASN A CG  1 
ATOM   1806 O  OD1 . ASN A 1 230 ? 12.283  55.007 53.762 1.00 24.21 ? 230  ASN A OD1 1 
ATOM   1807 N  ND2 . ASN A 1 230 ? 13.836  53.684 54.735 1.00 22.89 ? 230  ASN A ND2 1 
ATOM   1808 N  N   . CYS A 1 231 ? 9.991   54.763 56.905 1.00 19.80 ? 231  CYS A N   1 
ATOM   1809 C  CA  . CYS A 1 231 ? 10.111  55.062 58.353 1.00 20.37 ? 231  CYS A CA  1 
ATOM   1810 C  C   . CYS A 1 231 ? 9.405   53.988 59.209 1.00 20.40 ? 231  CYS A C   1 
ATOM   1811 O  O   . CYS A 1 231 ? 8.342   53.484 58.818 1.00 19.96 ? 231  CYS A O   1 
ATOM   1812 C  CB  . CYS A 1 231 ? 9.553   56.446 58.688 1.00 19.93 ? 231  CYS A CB  1 
ATOM   1813 S  SG  . CYS A 1 231 ? 10.554  57.784 58.087 1.00 21.72 ? 231  CYS A SG  1 
ATOM   1814 N  N   . PRO A 1 232 ? 9.987   53.636 60.382 1.00 20.78 ? 232  PRO A N   1 
ATOM   1815 C  CA  . PRO A 1 232 ? 9.425   52.499 61.140 1.00 20.60 ? 232  PRO A CA  1 
ATOM   1816 C  C   . PRO A 1 232 ? 7.987   52.742 61.625 1.00 20.54 ? 232  PRO A C   1 
ATOM   1817 O  O   . PRO A 1 232 ? 7.257   51.785 61.848 1.00 21.55 ? 232  PRO A O   1 
ATOM   1818 C  CB  . PRO A 1 232 ? 10.410  52.322 62.328 1.00 20.73 ? 232  PRO A CB  1 
ATOM   1819 C  CG  . PRO A 1 232 ? 11.086  53.687 62.475 1.00 21.40 ? 232  PRO A CG  1 
ATOM   1820 C  CD  . PRO A 1 232 ? 11.211  54.183 61.020 1.00 20.40 ? 232  PRO A CD  1 
ATOM   1821 N  N   . TRP A 1 233 ? 7.593   54.003 61.762 1.00 19.42 ? 233  TRP A N   1 
ATOM   1822 C  CA  . TRP A 1 233 ? 6.246   54.384 62.176 1.00 19.28 ? 233  TRP A CA  1 
ATOM   1823 C  C   . TRP A 1 233 ? 5.262   54.540 60.998 1.00 19.02 ? 233  TRP A C   1 
ATOM   1824 O  O   . TRP A 1 233 ? 4.054   54.709 61.216 1.00 18.34 ? 233  TRP A O   1 
ATOM   1825 C  CB  . TRP A 1 233 ? 6.304   55.728 62.929 1.00 18.49 ? 233  TRP A CB  1 
ATOM   1826 C  CG  . TRP A 1 233 ? 7.090   56.764 62.192 1.00 19.75 ? 233  TRP A CG  1 
ATOM   1827 C  CD1 . TRP A 1 233 ? 8.435   56.988 62.298 1.00 19.11 ? 233  TRP A CD1 1 
ATOM   1828 C  CD2 . TRP A 1 233 ? 6.602   57.695 61.207 1.00 20.28 ? 233  TRP A CD2 1 
ATOM   1829 N  NE1 . TRP A 1 233 ? 8.812   58.003 61.456 1.00 20.80 ? 233  TRP A NE1 1 
ATOM   1830 C  CE2 . TRP A 1 233 ? 7.710   58.451 60.769 1.00 20.31 ? 233  TRP A CE2 1 
ATOM   1831 C  CE3 . TRP A 1 233 ? 5.334   57.957 60.653 1.00 20.44 ? 233  TRP A CE3 1 
ATOM   1832 C  CZ2 . TRP A 1 233 ? 7.602   59.470 59.810 1.00 21.03 ? 233  TRP A CZ2 1 
ATOM   1833 C  CZ3 . TRP A 1 233 ? 5.221   58.970 59.680 1.00 20.87 ? 233  TRP A CZ3 1 
ATOM   1834 C  CH2 . TRP A 1 233 ? 6.353   59.725 59.282 1.00 21.59 ? 233  TRP A CH2 1 
ATOM   1835 N  N   . ALA A 1 234 ? 5.766   54.518 59.765 1.00 19.08 ? 234  ALA A N   1 
ATOM   1836 C  CA  . ALA A 1 234 ? 4.945   54.955 58.614 1.00 19.54 ? 234  ALA A CA  1 
ATOM   1837 C  C   . ALA A 1 234 ? 4.061   53.874 57.977 1.00 19.56 ? 234  ALA A C   1 
ATOM   1838 O  O   . ALA A 1 234 ? 3.193   54.188 57.165 1.00 19.44 ? 234  ALA A O   1 
ATOM   1839 C  CB  . ALA A 1 234 ? 5.825   55.618 57.551 1.00 19.02 ? 234  ALA A CB  1 
ATOM   1840 N  N   . SER A 1 235 ? 4.291   52.610 58.314 1.00 19.62 ? 235  SER A N   1 
ATOM   1841 C  CA  . SER A 1 235 ? 3.448   51.529 57.793 1.00 20.14 ? 235  SER A CA  1 
ATOM   1842 C  C   . SER A 1 235 ? 3.439   50.356 58.752 1.00 20.79 ? 235  SER A C   1 
ATOM   1843 O  O   . SER A 1 235 ? 4.312   50.257 59.614 1.00 20.87 ? 235  SER A O   1 
ATOM   1844 C  CB  . SER A 1 235 ? 3.924   51.061 56.408 1.00 19.69 ? 235  SER A CB  1 
ATOM   1845 O  OG  . SER A 1 235 ? 5.229   50.519 56.474 1.00 22.95 ? 235  SER A OG  1 
ATOM   1846 N  N   . VAL A 1 236 ? 2.448   49.480 58.587 1.00 20.71 ? 236  VAL A N   1 
ATOM   1847 C  CA  . VAL A 1 236 ? 2.347   48.226 59.325 1.00 21.10 ? 236  VAL A CA  1 
ATOM   1848 C  C   . VAL A 1 236 ? 1.954   47.127 58.330 1.00 22.14 ? 236  VAL A C   1 
ATOM   1849 O  O   . VAL A 1 236 ? 1.558   47.423 57.182 1.00 21.35 ? 236  VAL A O   1 
ATOM   1850 C  CB  . VAL A 1 236 ? 1.275   48.289 60.471 1.00 21.26 ? 236  VAL A CB  1 
ATOM   1851 C  CG1 . VAL A 1 236 ? 1.710   49.270 61.583 1.00 19.74 ? 236  VAL A CG1 1 
ATOM   1852 C  CG2 . VAL A 1 236 ? -0.112  48.678 59.925 1.00 20.96 ? 236  VAL A CG2 1 
ATOM   1853 N  N   . SER A 1 237 ? 2.064   45.874 58.760 1.00 21.82 ? 237  SER A N   1 
ATOM   1854 C  CA  . SER A 1 237 ? 1.657   44.744 57.935 1.00 23.31 ? 237  SER A CA  1 
ATOM   1855 C  C   . SER A 1 237 ? 0.146   44.652 57.951 1.00 23.70 ? 237  SER A C   1 
ATOM   1856 O  O   . SER A 1 237 ? -0.520  45.264 58.799 1.00 23.26 ? 237  SER A O   1 
ATOM   1857 C  CB  . SER A 1 237 ? 2.227   43.435 58.512 1.00 23.97 ? 237  SER A CB  1 
ATOM   1858 O  OG  . SER A 1 237 ? 1.664   43.214 59.803 1.00 23.14 ? 237  SER A OG  1 
ATOM   1859 N  N   . VAL A 1 238 ? -0.410  43.855 57.044 1.00 23.86 ? 238  VAL A N   1 
ATOM   1860 C  CA  . VAL A 1 238 ? -1.857  43.651 57.062 1.00 23.93 ? 238  VAL A CA  1 
ATOM   1861 C  C   . VAL A 1 238 ? -2.323  42.924 58.317 1.00 23.69 ? 238  VAL A C   1 
ATOM   1862 O  O   . VAL A 1 238 ? -3.422  43.192 58.806 1.00 24.32 ? 238  VAL A O   1 
ATOM   1863 C  CB  . VAL A 1 238 ? -2.418  42.975 55.767 1.00 23.86 ? 238  VAL A CB  1 
ATOM   1864 C  CG1 . VAL A 1 238 ? -2.300  43.927 54.570 1.00 24.59 ? 238  VAL A CG1 1 
ATOM   1865 C  CG2 . VAL A 1 238 ? -1.728  41.667 55.477 1.00 25.27 ? 238  VAL A CG2 1 
ATOM   1866 N  N   . ALA A 1 239 ? -1.500  42.015 58.841 1.00 24.28 ? 239  ALA A N   1 
ATOM   1867 C  CA  . ALA A 1 239 ? -1.844  41.319 60.092 1.00 23.94 ? 239  ALA A CA  1 
ATOM   1868 C  C   . ALA A 1 239 ? -1.925  42.311 61.257 1.00 23.46 ? 239  ALA A C   1 
ATOM   1869 O  O   . ALA A 1 239 ? -2.839  42.236 62.069 1.00 24.22 ? 239  ALA A O   1 
ATOM   1870 C  CB  . ALA A 1 239 ? -0.820  40.227 60.403 1.00 23.97 ? 239  ALA A CB  1 
ATOM   1871 N  N   . GLU A 1 240 ? -0.958  43.224 61.336 1.00 23.05 ? 240  GLU A N   1 
ATOM   1872 C  CA  . GLU A 1 240 ? -0.902  44.204 62.443 1.00 23.13 ? 240  GLU A CA  1 
ATOM   1873 C  C   . GLU A 1 240 ? -2.039  45.214 62.313 1.00 23.28 ? 240  GLU A C   1 
ATOM   1874 O  O   . GLU A 1 240 ? -2.701  45.553 63.309 1.00 23.55 ? 240  GLU A O   1 
ATOM   1875 C  CB  . GLU A 1 240 ? 0.484   44.870 62.553 1.00 22.73 ? 240  GLU A CB  1 
ATOM   1876 C  CG  . GLU A 1 240 ? 0.626   45.962 63.670 1.00 23.08 ? 240  GLU A CG  1 
ATOM   1877 C  CD  . GLU A 1 240 ? 0.289   45.459 65.103 1.00 25.37 ? 240  GLU A CD  1 
ATOM   1878 O  OE1 . GLU A 1 240 ? 0.289   44.232 65.357 1.00 26.60 ? 240  GLU A OE1 1 
ATOM   1879 O  OE2 . GLU A 1 240 ? 0.023   46.300 65.980 1.00 23.89 ? 240  GLU A OE2 1 
ATOM   1880 N  N   . GLY A 1 241 ? -2.311  45.654 61.078 1.00 23.16 ? 241  GLY A N   1 
ATOM   1881 C  CA  . GLY A 1 241 ? -3.458  46.521 60.830 1.00 22.71 ? 241  GLY A CA  1 
ATOM   1882 C  C   . GLY A 1 241 ? -4.777  45.884 61.253 1.00 22.77 ? 241  GLY A C   1 
ATOM   1883 O  O   . GLY A 1 241 ? -5.603  46.512 61.916 1.00 22.56 ? 241  GLY A O   1 
ATOM   1884 N  N   . ARG A 1 242 ? -4.972  44.626 60.865 1.00 22.90 ? 242  ARG A N   1 
ATOM   1885 C  CA  . ARG A 1 242 ? -6.136  43.850 61.291 1.00 23.69 ? 242  ARG A CA  1 
ATOM   1886 C  C   . ARG A 1 242 ? -6.239  43.778 62.825 1.00 23.59 ? 242  ARG A C   1 
ATOM   1887 O  O   . ARG A 1 242 ? -7.303  44.037 63.395 1.00 24.20 ? 242  ARG A O   1 
ATOM   1888 C  CB  . ARG A 1 242 ? -6.070  42.437 60.660 1.00 23.23 ? 242  ARG A CB  1 
ATOM   1889 C  CG  . ARG A 1 242 ? -7.122  41.459 61.157 1.00 25.55 ? 242  ARG A CG  1 
ATOM   1890 C  CD  . ARG A 1 242 ? -7.308  40.261 60.161 1.00 27.36 ? 242  ARG A CD  1 
ATOM   1891 N  NE  . ARG A 1 242 ? -7.931  40.730 58.923 1.00 27.43 ? 242  ARG A NE  1 
ATOM   1892 C  CZ  . ARG A 1 242 ? -9.236  40.931 58.762 1.00 27.07 ? 242  ARG A CZ  1 
ATOM   1893 N  NH1 . ARG A 1 242 ? -10.102 40.672 59.743 1.00 27.49 ? 242  ARG A NH1 1 
ATOM   1894 N  NH2 . ARG A 1 242 ? -9.680  41.395 57.608 1.00 27.52 ? 242  ARG A NH2 1 
ATOM   1895 N  N   . ARG A 1 243 ? -5.133  43.440 63.483 1.00 23.84 ? 243  ARG A N   1 
ATOM   1896 C  CA  . ARG A 1 243 ? -5.103  43.331 64.948 1.00 24.19 ? 243  ARG A CA  1 
ATOM   1897 C  C   . ARG A 1 243 ? -5.568  44.628 65.620 1.00 23.72 ? 243  ARG A C   1 
ATOM   1898 O  O   . ARG A 1 243 ? -6.432  44.617 66.504 1.00 23.57 ? 243  ARG A O   1 
ATOM   1899 C  CB  . ARG A 1 243 ? -3.701  42.940 65.419 1.00 24.53 ? 243  ARG A CB  1 
ATOM   1900 C  CG  . ARG A 1 243 ? -3.634  42.498 66.901 1.00 27.78 ? 243  ARG A CG  1 
ATOM   1901 C  CD  . ARG A 1 243 ? -2.200  42.609 67.492 1.00 30.07 ? 243  ARG A CD  1 
ATOM   1902 N  NE  . ARG A 1 243 ? -1.693  43.987 67.498 1.00 30.24 ? 243  ARG A NE  1 
ATOM   1903 C  CZ  . ARG A 1 243 ? -2.075  44.941 68.351 1.00 31.27 ? 243  ARG A CZ  1 
ATOM   1904 N  NH1 . ARG A 1 243 ? -2.996  44.712 69.288 1.00 30.97 ? 243  ARG A NH1 1 
ATOM   1905 N  NH2 . ARG A 1 243 ? -1.545  46.149 68.250 1.00 31.83 ? 243  ARG A NH2 1 
ATOM   1906 N  N   . ARG A 1 244 ? -5.035  45.749 65.151 1.00 23.52 ? 244  ARG A N   1 
ATOM   1907 C  CA  . ARG A 1 244 ? -5.364  47.047 65.731 1.00 22.73 ? 244  ARG A CA  1 
ATOM   1908 C  C   . ARG A 1 244 ? -6.803  47.446 65.462 1.00 22.83 ? 244  ARG A C   1 
ATOM   1909 O  O   . ARG A 1 244 ? -7.437  48.057 66.331 1.00 22.96 ? 244  ARG A O   1 
ATOM   1910 C  CB  . ARG A 1 244 ? -4.410  48.139 65.242 1.00 22.47 ? 244  ARG A CB  1 
ATOM   1911 C  CG  . ARG A 1 244 ? -2.985  47.902 65.583 1.00 21.43 ? 244  ARG A CG  1 
ATOM   1912 C  CD  . ARG A 1 244 ? -2.128  49.012 65.030 1.00 22.25 ? 244  ARG A CD  1 
ATOM   1913 N  NE  . ARG A 1 244 ? -0.706  48.742 65.261 1.00 19.31 ? 244  ARG A NE  1 
ATOM   1914 C  CZ  . ARG A 1 244 ? 0.269   49.621 65.052 1.00 20.27 ? 244  ARG A CZ  1 
ATOM   1915 N  NH1 . ARG A 1 244 ? 0.000   50.842 64.610 1.00 20.76 ? 244  ARG A NH1 1 
ATOM   1916 N  NH2 . ARG A 1 244 ? 1.525   49.270 65.280 1.00 19.81 ? 244  ARG A NH2 1 
ATOM   1917 N  N   . ALA A 1 245 ? -7.326  47.112 64.268 1.00 22.83 ? 245  ALA A N   1 
ATOM   1918 C  CA  . ALA A 1 245 ? -8.739  47.393 63.954 1.00 22.79 ? 245  ALA A CA  1 
ATOM   1919 C  C   . ALA A 1 245 ? -9.695  46.627 64.879 1.00 23.21 ? 245  ALA A C   1 
ATOM   1920 O  O   . ALA A 1 245 ? -10.699 47.176 65.348 1.00 23.01 ? 245  ALA A O   1 
ATOM   1921 C  CB  . ALA A 1 245 ? -9.053  47.049 62.466 1.00 23.46 ? 245  ALA A CB  1 
ATOM   1922 N  N   . VAL A 1 246 ? -9.380  45.355 65.122 1.00 23.54 ? 246  VAL A N   1 
ATOM   1923 C  CA  . VAL A 1 246 ? -10.176 44.503 66.020 1.00 24.71 ? 246  VAL A CA  1 
ATOM   1924 C  C   . VAL A 1 246 ? -10.083 44.998 67.470 1.00 24.93 ? 246  VAL A C   1 
ATOM   1925 O  O   . VAL A 1 246 ? -11.091 45.041 68.184 1.00 26.07 ? 246  VAL A O   1 
ATOM   1926 C  CB  . VAL A 1 246 ? -9.718  43.032 65.936 1.00 25.04 ? 246  VAL A CB  1 
ATOM   1927 C  CG1 . VAL A 1 246 ? -10.385 42.183 67.021 1.00 25.18 ? 246  VAL A CG1 1 
ATOM   1928 C  CG2 . VAL A 1 246 ? -10.004 42.457 64.529 1.00 26.62 ? 246  VAL A CG2 1 
ATOM   1929 N  N   . GLU A 1 247 ? -8.881  45.392 67.883 1.00 24.60 ? 247  GLU A N   1 
ATOM   1930 C  CA  . GLU A 1 247 ? -8.640  46.007 69.199 1.00 24.98 ? 247  GLU A CA  1 
ATOM   1931 C  C   . GLU A 1 247 ? -9.403  47.329 69.384 1.00 25.02 ? 247  GLU A C   1 
ATOM   1932 O  O   . GLU A 1 247 ? -9.953  47.580 70.462 1.00 25.28 ? 247  GLU A O   1 
ATOM   1933 C  CB  . GLU A 1 247 ? -7.118  46.180 69.433 1.00 25.22 ? 247  GLU A CB  1 
ATOM   1934 C  CG  . GLU A 1 247 ? -6.695  46.565 70.869 1.00 27.03 ? 247  GLU A CG  1 
ATOM   1935 C  CD  . GLU A 1 247 ? -7.121  45.551 71.958 1.00 30.88 ? 247  GLU A CD  1 
ATOM   1936 O  OE1 . GLU A 1 247 ? -7.378  44.357 71.660 1.00 30.89 ? 247  GLU A OE1 1 
ATOM   1937 O  OE2 . GLU A 1 247 ? -7.192  45.968 73.133 1.00 30.98 ? 247  GLU A OE2 1 
ATOM   1938 N  N   . LEU A 1 248 ? -9.473  48.161 68.338 1.00 24.56 ? 248  LEU A N   1 
ATOM   1939 C  CA  . LEU A 1 248 ? -10.362 49.334 68.366 1.00 24.88 ? 248  LEU A CA  1 
ATOM   1940 C  C   . LEU A 1 248 ? -11.827 48.938 68.624 1.00 25.03 ? 248  LEU A C   1 
ATOM   1941 O  O   . LEU A 1 248 ? -12.499 49.538 69.463 1.00 25.12 ? 248  LEU A O   1 
ATOM   1942 C  CB  . LEU A 1 248 ? -10.249 50.153 67.068 1.00 24.55 ? 248  LEU A CB  1 
ATOM   1943 C  CG  . LEU A 1 248 ? -10.922 51.529 67.058 1.00 25.57 ? 248  LEU A CG  1 
ATOM   1944 C  CD1 . LEU A 1 248 ? -10.064 52.566 67.845 1.00 25.72 ? 248  LEU A CD1 1 
ATOM   1945 C  CD2 . LEU A 1 248 ? -11.120 51.993 65.620 1.00 25.46 ? 248  LEU A CD2 1 
ATOM   1946 N  N   . GLY A 1 249 ? -12.314 47.934 67.894 1.00 25.48 ? 249  GLY A N   1 
ATOM   1947 C  CA  . GLY A 1 249 ? -13.665 47.397 68.102 1.00 25.71 ? 249  GLY A CA  1 
ATOM   1948 C  C   . GLY A 1 249 ? -13.909 46.906 69.527 1.00 26.43 ? 249  GLY A C   1 
ATOM   1949 O  O   . GLY A 1 249 ? -14.980 47.160 70.105 1.00 26.10 ? 249  GLY A O   1 
ATOM   1950 N  N   . ARG A 1 250 ? -12.917 46.212 70.077 1.00 27.07 ? 250  ARG A N   1 
ATOM   1951 C  CA  A ARG A 1 250 ? -12.946 45.729 71.456 0.60 27.99 ? 250  ARG A CA  1 
ATOM   1952 C  CA  B ARG A 1 250 ? -12.955 45.745 71.470 0.40 28.25 ? 250  ARG A CA  1 
ATOM   1953 C  C   . ARG A 1 250 ? -13.115 46.905 72.447 1.00 28.58 ? 250  ARG A C   1 
ATOM   1954 O  O   . ARG A 1 250 ? -13.902 46.826 73.400 1.00 28.71 ? 250  ARG A O   1 
ATOM   1955 C  CB  A ARG A 1 250 ? -11.652 44.946 71.715 0.60 28.02 ? 250  ARG A CB  1 
ATOM   1956 C  CB  B ARG A 1 250 ? -11.696 44.946 71.830 0.40 28.47 ? 250  ARG A CB  1 
ATOM   1957 C  CG  A ARG A 1 250 ? -11.671 43.949 72.862 0.60 28.00 ? 250  ARG A CG  1 
ATOM   1958 C  CG  B ARG A 1 250 ? -11.798 43.464 71.559 0.40 29.80 ? 250  ARG A CG  1 
ATOM   1959 C  CD  A ARG A 1 250 ? -10.351 43.171 72.871 0.60 28.51 ? 250  ARG A CD  1 
ATOM   1960 C  CD  B ARG A 1 250 ? -11.136 42.626 72.643 0.40 31.68 ? 250  ARG A CD  1 
ATOM   1961 N  NE  A ARG A 1 250 ? -10.409 41.951 72.063 0.60 30.38 ? 250  ARG A NE  1 
ATOM   1962 N  NE  B ARG A 1 250 ? -11.113 41.208 72.277 0.40 34.04 ? 250  ARG A NE  1 
ATOM   1963 C  CZ  A ARG A 1 250 ? -9.712  41.694 70.951 0.60 31.25 ? 250  ARG A CZ  1 
ATOM   1964 C  CZ  B ARG A 1 250 ? -12.080 40.338 72.554 0.40 33.86 ? 250  ARG A CZ  1 
ATOM   1965 N  NH1 A ARG A 1 250 ? -8.848  42.575 70.437 0.60 29.75 ? 250  ARG A NH1 1 
ATOM   1966 N  NH1 B ARG A 1 250 ? -13.165 40.728 73.212 0.40 34.13 ? 250  ARG A NH1 1 
ATOM   1967 N  NH2 A ARG A 1 250 ? -9.881  40.521 70.347 0.60 28.75 ? 250  ARG A NH2 1 
ATOM   1968 N  NH2 B ARG A 1 250 ? -11.961 39.075 72.172 0.40 34.62 ? 250  ARG A NH2 1 
ATOM   1969 N  N   . ASN A 1 251 ? -12.384 47.998 72.206 1.00 28.72 ? 251  ASN A N   1 
ATOM   1970 C  CA  . ASN A 1 251 ? -12.484 49.212 73.033 1.00 28.68 ? 251  ASN A CA  1 
ATOM   1971 C  C   . ASN A 1 251 ? -13.859 49.870 72.992 1.00 29.14 ? 251  ASN A C   1 
ATOM   1972 O  O   . ASN A 1 251 ? -14.238 50.601 73.912 1.00 29.53 ? 251  ASN A O   1 
ATOM   1973 C  CB  . ASN A 1 251 ? -11.420 50.256 72.613 1.00 28.34 ? 251  ASN A CB  1 
ATOM   1974 C  CG  . ASN A 1 251 ? -10.090 50.070 73.325 1.00 27.97 ? 251  ASN A CG  1 
ATOM   1975 O  OD1 . ASN A 1 251 ? -9.793  50.780 74.287 1.00 27.87 ? 251  ASN A OD1 1 
ATOM   1976 N  ND2 . ASN A 1 251 ? -9.271  49.132 72.847 1.00 24.24 ? 251  ASN A ND2 1 
ATOM   1977 N  N   . LEU A 1 252 ? -14.597 49.625 71.910 1.00 29.40 ? 252  LEU A N   1 
ATOM   1978 C  CA  . LEU A 1 252 ? -15.888 50.253 71.703 1.00 30.09 ? 252  LEU A CA  1 
ATOM   1979 C  C   . LEU A 1 252 ? -17.017 49.240 71.853 1.00 30.64 ? 252  LEU A C   1 
ATOM   1980 O  O   . LEU A 1 252 ? -18.150 49.495 71.447 1.00 31.11 ? 252  LEU A O   1 
ATOM   1981 C  CB  . LEU A 1 252 ? -15.928 50.951 70.334 1.00 30.35 ? 252  LEU A CB  1 
ATOM   1982 C  CG  . LEU A 1 252 ? -14.893 52.082 70.201 1.00 30.63 ? 252  LEU A CG  1 
ATOM   1983 C  CD1 . LEU A 1 252 ? -14.752 52.584 68.776 1.00 31.08 ? 252  LEU A CD1 1 
ATOM   1984 C  CD2 . LEU A 1 252 ? -15.223 53.231 71.134 1.00 31.50 ? 252  LEU A CD2 1 
ATOM   1985 N  N   . ASN A 1 253 ? -16.683 48.089 72.429 1.00 31.39 ? 253  ASN A N   1 
ATOM   1986 C  CA  . ASN A 1 253 ? -17.648 47.022 72.713 1.00 32.38 ? 253  ASN A CA  1 
ATOM   1987 C  C   . ASN A 1 253 ? -18.388 46.578 71.463 1.00 32.89 ? 253  ASN A C   1 
ATOM   1988 O  O   . ASN A 1 253 ? -19.607 46.374 71.491 1.00 33.55 ? 253  ASN A O   1 
ATOM   1989 C  CB  . ASN A 1 253 ? -18.622 47.463 73.829 1.00 32.41 ? 253  ASN A CB  1 
ATOM   1990 C  CG  . ASN A 1 253 ? -17.885 47.928 75.083 0.50 32.25 ? 253  ASN A CG  1 
ATOM   1991 O  OD1 . ASN A 1 253 ? -17.827 49.123 75.374 0.50 32.18 ? 253  ASN A OD1 1 
ATOM   1992 N  ND2 . ASN A 1 253 ? -17.276 46.984 75.799 0.50 31.57 ? 253  ASN A ND2 1 
ATOM   1993 N  N   . CYS A 1 254 ? -17.651 46.442 70.363 1.00 32.47 ? 254  CYS A N   1 
ATOM   1994 C  CA  . CYS A 1 254 ? -18.238 45.994 69.095 1.00 32.49 ? 254  CYS A CA  1 
ATOM   1995 C  C   . CYS A 1 254 ? -18.398 44.480 69.013 1.00 32.82 ? 254  CYS A C   1 
ATOM   1996 O  O   . CYS A 1 254 ? -17.638 43.716 69.617 1.00 32.23 ? 254  CYS A O   1 
ATOM   1997 C  CB  . CYS A 1 254 ? -17.394 46.473 67.897 1.00 32.15 ? 254  CYS A CB  1 
ATOM   1998 S  SG  . CYS A 1 254 ? -17.471 48.265 67.629 0.90 30.92 ? 254  CYS A SG  1 
ATOM   1999 N  N   . ASN A 1 255 ? -19.382 44.055 68.229 1.00 33.46 ? 255  ASN A N   1 
ATOM   2000 C  CA  . ASN A 1 255 ? -19.448 42.676 67.791 1.00 34.22 ? 255  ASN A CA  1 
ATOM   2001 C  C   . ASN A 1 255 ? -18.221 42.396 66.924 1.00 34.24 ? 255  ASN A C   1 
ATOM   2002 O  O   . ASN A 1 255 ? -17.992 43.093 65.926 1.00 34.94 ? 255  ASN A O   1 
ATOM   2003 C  CB  . ASN A 1 255 ? -20.743 42.458 66.994 1.00 34.60 ? 255  ASN A CB  1 
ATOM   2004 C  CG  . ASN A 1 255 ? -20.966 41.006 66.631 1.00 35.67 ? 255  ASN A CG  1 
ATOM   2005 O  OD1 . ASN A 1 255 ? -20.040 40.295 66.232 1.00 35.76 ? 255  ASN A OD1 1 
ATOM   2006 N  ND2 . ASN A 1 255 ? -22.205 40.555 66.774 1.00 37.33 ? 255  ASN A ND2 1 
ATOM   2007 N  N   . LEU A 1 256 ? -17.441 41.387 67.290 1.00 34.14 ? 256  LEU A N   1 
ATOM   2008 C  CA  . LEU A 1 256 ? -16.192 41.080 66.578 1.00 34.68 ? 256  LEU A CA  1 
ATOM   2009 C  C   . LEU A 1 256 ? -16.240 39.790 65.764 1.00 35.08 ? 256  LEU A C   1 
ATOM   2010 O  O   . LEU A 1 256 ? -15.199 39.286 65.343 1.00 35.12 ? 256  LEU A O   1 
ATOM   2011 C  CB  . LEU A 1 256 ? -15.030 40.975 67.570 1.00 34.64 ? 256  LEU A CB  1 
ATOM   2012 C  CG  . LEU A 1 256 ? -14.817 42.148 68.525 1.00 34.40 ? 256  LEU A CG  1 
ATOM   2013 C  CD1 . LEU A 1 256 ? -13.681 41.789 69.456 1.00 34.21 ? 256  LEU A CD1 1 
ATOM   2014 C  CD2 . LEU A 1 256 ? -14.522 43.429 67.765 1.00 34.53 ? 256  LEU A CD2 1 
ATOM   2015 N  N   . ASN A 1 257 ? -17.434 39.252 65.542 1.00 35.74 ? 257  ASN A N   1 
ATOM   2016 C  CA  . ASN A 1 257 ? -17.549 37.941 64.889 1.00 36.75 ? 257  ASN A CA  1 
ATOM   2017 C  C   . ASN A 1 257 ? -17.192 37.915 63.395 1.00 36.46 ? 257  ASN A C   1 
ATOM   2018 O  O   . ASN A 1 257 ? -16.823 36.862 62.865 1.00 37.12 ? 257  ASN A O   1 
ATOM   2019 C  CB  . ASN A 1 257 ? -18.937 37.338 65.137 1.00 37.72 ? 257  ASN A CB  1 
ATOM   2020 C  CG  . ASN A 1 257 ? -19.160 36.964 66.595 1.00 40.50 ? 257  ASN A CG  1 
ATOM   2021 O  OD1 . ASN A 1 257 ? -18.212 36.704 67.338 1.00 43.48 ? 257  ASN A OD1 1 
ATOM   2022 N  ND2 . ASN A 1 257 ? -20.424 36.942 67.012 1.00 44.40 ? 257  ASN A ND2 1 
ATOM   2023 N  N   . SER A 1 258 ? -17.310 39.060 62.724 1.00 35.45 ? 258  SER A N   1 
ATOM   2024 C  CA  . SER A 1 258 ? -16.906 39.192 61.315 1.00 34.92 ? 258  SER A CA  1 
ATOM   2025 C  C   . SER A 1 258 ? -16.495 40.628 60.983 1.00 34.15 ? 258  SER A C   1 
ATOM   2026 O  O   . SER A 1 258 ? -16.855 41.561 61.717 1.00 33.40 ? 258  SER A O   1 
ATOM   2027 C  CB  . SER A 1 258 ? -18.067 38.803 60.394 1.00 34.89 ? 258  SER A CB  1 
ATOM   2028 O  OG  . SER A 1 258 ? -19.078 39.786 60.462 1.00 34.33 ? 258  SER A OG  1 
ATOM   2029 N  N   . ASP A 1 259 ? -15.784 40.799 59.863 1.00 33.56 ? 259  ASP A N   1 
ATOM   2030 C  CA  . ASP A 1 259 ? -15.470 42.134 59.337 1.00 33.42 ? 259  ASP A CA  1 
ATOM   2031 C  C   . ASP A 1 259 ? -16.722 42.971 59.146 1.00 33.31 ? 259  ASP A C   1 
ATOM   2032 O  O   . ASP A 1 259 ? -16.749 44.135 59.512 1.00 33.53 ? 259  ASP A O   1 
ATOM   2033 C  CB  . ASP A 1 259 ? -14.668 42.062 58.033 1.00 33.23 ? 259  ASP A CB  1 
ATOM   2034 C  CG  . ASP A 1 259 ? -13.256 41.559 58.247 1.00 34.63 ? 259  ASP A CG  1 
ATOM   2035 O  OD1 . ASP A 1 259 ? -12.869 41.337 59.420 1.00 36.27 ? 259  ASP A OD1 1 
ATOM   2036 O  OD2 . ASP A 1 259 ? -12.516 41.381 57.250 1.00 35.52 ? 259  ASP A OD2 1 
ATOM   2037 N  N   . GLU A 1 260 ? -17.771 42.357 58.606 1.00 33.25 ? 260  GLU A N   1 
ATOM   2038 C  CA  . GLU A 1 260 ? -19.038 43.041 58.366 1.00 32.93 ? 260  GLU A CA  1 
ATOM   2039 C  C   . GLU A 1 260 ? -19.641 43.567 59.663 1.00 32.41 ? 260  GLU A C   1 
ATOM   2040 O  O   . GLU A 1 260 ? -20.133 44.694 59.712 1.00 32.33 ? 260  GLU A O   1 
ATOM   2041 C  CB  . GLU A 1 260 ? -20.037 42.101 57.673 1.00 33.52 ? 260  GLU A CB  1 
ATOM   2042 C  CG  . GLU A 1 260 ? -19.632 41.606 56.267 1.00 35.81 ? 260  GLU A CG  1 
ATOM   2043 C  CD  . GLU A 1 260 ? -18.335 40.776 56.205 0.60 36.97 ? 260  GLU A CD  1 
ATOM   2044 O  OE1 . GLU A 1 260 ? -18.016 40.011 57.144 0.60 35.35 ? 260  GLU A OE1 1 
ATOM   2045 O  OE2 . GLU A 1 260 ? -17.625 40.892 55.180 0.60 38.82 ? 260  GLU A OE2 1 
ATOM   2046 N  N   . GLU A 1 261 ? -19.635 42.747 60.710 1.00 31.78 ? 261  GLU A N   1 
ATOM   2047 C  CA  A GLU A 1 261 ? -20.165 43.167 62.017 0.50 31.66 ? 261  GLU A CA  1 
ATOM   2048 C  CA  B GLU A 1 261 ? -20.178 43.184 61.989 0.50 31.59 ? 261  GLU A CA  1 
ATOM   2049 C  C   . GLU A 1 261 ? -19.308 44.278 62.627 1.00 30.95 ? 261  GLU A C   1 
ATOM   2050 O  O   . GLU A 1 261 ? -19.831 45.248 63.161 1.00 30.36 ? 261  GLU A O   1 
ATOM   2051 C  CB  A GLU A 1 261 ? -20.268 41.984 62.998 0.50 31.90 ? 261  GLU A CB  1 
ATOM   2052 C  CB  B GLU A 1 261 ? -20.406 41.979 62.915 0.50 31.87 ? 261  GLU A CB  1 
ATOM   2053 C  CG  A GLU A 1 261 ? -21.451 41.030 62.752 0.50 33.46 ? 261  GLU A CG  1 
ATOM   2054 C  CG  B GLU A 1 261 ? -21.648 41.162 62.498 0.50 32.94 ? 261  GLU A CG  1 
ATOM   2055 C  CD  A GLU A 1 261 ? -22.768 41.503 63.375 0.50 34.83 ? 261  GLU A CD  1 
ATOM   2056 C  CD  B GLU A 1 261 ? -21.565 39.690 62.852 0.50 33.59 ? 261  GLU A CD  1 
ATOM   2057 O  OE1 A GLU A 1 261 ? -22.796 42.553 64.055 0.50 35.00 ? 261  GLU A OE1 1 
ATOM   2058 O  OE1 B GLU A 1 261 ? -20.473 39.101 62.725 0.50 34.56 ? 261  GLU A OE1 1 
ATOM   2059 O  OE2 A GLU A 1 261 ? -23.789 40.810 63.182 0.50 35.56 ? 261  GLU A OE2 1 
ATOM   2060 O  OE2 B GLU A 1 261 ? -22.607 39.117 63.236 0.50 33.57 ? 261  GLU A OE2 1 
ATOM   2061 N  N   . LEU A 1 262 ? -17.988 44.130 62.537 1.00 30.36 ? 262  LEU A N   1 
ATOM   2062 C  CA  . LEU A 1 262 ? -17.056 45.122 63.122 1.00 29.88 ? 262  LEU A CA  1 
ATOM   2063 C  C   . LEU A 1 262 ? -17.181 46.478 62.442 1.00 29.65 ? 262  LEU A C   1 
ATOM   2064 O  O   . LEU A 1 262 ? -17.368 47.508 63.098 1.00 29.36 ? 262  LEU A O   1 
ATOM   2065 C  CB  . LEU A 1 262 ? -15.611 44.604 63.063 1.00 29.66 ? 262  LEU A CB  1 
ATOM   2066 C  CG  . LEU A 1 262 ? -14.439 45.502 63.514 1.00 28.66 ? 262  LEU A CG  1 
ATOM   2067 C  CD1 . LEU A 1 262 ? -14.656 46.066 64.917 1.00 27.15 ? 262  LEU A CD1 1 
ATOM   2068 C  CD2 . LEU A 1 262 ? -13.121 44.725 63.425 1.00 25.84 ? 262  LEU A CD2 1 
ATOM   2069 N  N   . ILE A 1 263 ? -17.129 46.471 61.114 1.00 29.82 ? 263  ILE A N   1 
ATOM   2070 C  CA  . ILE A 1 263 ? -17.236 47.708 60.338 1.00 29.93 ? 263  ILE A CA  1 
ATOM   2071 C  C   . ILE A 1 263 ? -18.568 48.410 60.593 1.00 30.30 ? 263  ILE A C   1 
ATOM   2072 O  O   . ILE A 1 263 ? -18.629 49.641 60.748 1.00 29.63 ? 263  ILE A O   1 
ATOM   2073 C  CB  . ILE A 1 263 ? -16.982 47.434 58.824 1.00 29.78 ? 263  ILE A CB  1 
ATOM   2074 C  CG1 . ILE A 1 263 ? -15.537 46.958 58.624 1.00 29.88 ? 263  ILE A CG1 1 
ATOM   2075 C  CG2 . ILE A 1 263 ? -17.279 48.651 57.983 1.00 29.17 ? 263  ILE A CG2 1 
ATOM   2076 C  CD1 . ILE A 1 263 ? -15.267 46.290 57.282 1.00 29.35 ? 263  ILE A CD1 1 
ATOM   2077 N  N   . HIS A 1 264 ? -19.641 47.629 60.663 1.00 30.97 ? 264  HIS A N   1 
ATOM   2078 C  CA  . HIS A 1 264 ? -20.960 48.214 60.915 1.00 31.62 ? 264  HIS A CA  1 
ATOM   2079 C  C   . HIS A 1 264 ? -21.006 48.903 62.276 1.00 31.28 ? 264  HIS A C   1 
ATOM   2080 O  O   . HIS A 1 264 ? -21.484 50.031 62.386 1.00 30.75 ? 264  HIS A O   1 
ATOM   2081 C  CB  . HIS A 1 264 ? -22.078 47.168 60.799 1.00 32.72 ? 264  HIS A CB  1 
ATOM   2082 C  CG  . HIS A 1 264 ? -23.404 47.678 61.258 1.00 35.45 ? 264  HIS A CG  1 
ATOM   2083 N  ND1 . HIS A 1 264 ? -24.238 48.411 60.442 1.00 39.48 ? 264  HIS A ND1 1 
ATOM   2084 C  CD2 . HIS A 1 264 ? -24.017 47.612 62.463 1.00 38.46 ? 264  HIS A CD2 1 
ATOM   2085 C  CE1 . HIS A 1 264 ? -25.320 48.757 61.119 1.00 40.44 ? 264  HIS A CE1 1 
ATOM   2086 N  NE2 . HIS A 1 264 ? -25.209 48.285 62.349 1.00 40.54 ? 264  HIS A NE2 1 
ATOM   2087 N  N   . CYS A 1 265 ? -20.498 48.228 63.306 1.00 31.80 ? 265  CYS A N   1 
ATOM   2088 C  CA  . CYS A 1 265 ? -20.412 48.831 64.639 1.00 31.83 ? 265  CYS A CA  1 
ATOM   2089 C  C   . CYS A 1 265 ? -19.595 50.132 64.577 1.00 31.39 ? 265  CYS A C   1 
ATOM   2090 O  O   . CYS A 1 265 ? -20.025 51.176 65.069 1.00 31.42 ? 265  CYS A O   1 
ATOM   2091 C  CB  . CYS A 1 265 ? -19.780 47.852 65.638 1.00 32.40 ? 265  CYS A CB  1 
ATOM   2092 S  SG  . CYS A 1 265 ? -19.445 48.609 67.277 0.90 35.45 ? 265  CYS A SG  1 
ATOM   2093 N  N   . LEU A 1 266 ? -18.429 50.065 63.942 1.00 30.83 ? 266  LEU A N   1 
ATOM   2094 C  CA  . LEU A 1 266 ? -17.529 51.226 63.875 1.00 30.57 ? 266  LEU A CA  1 
ATOM   2095 C  C   . LEU A 1 266 ? -18.142 52.387 63.096 1.00 30.79 ? 266  LEU A C   1 
ATOM   2096 O  O   . LEU A 1 266 ? -17.882 53.545 63.402 1.00 30.38 ? 266  LEU A O   1 
ATOM   2097 C  CB  . LEU A 1 266 ? -16.160 50.841 63.307 1.00 29.91 ? 266  LEU A CB  1 
ATOM   2098 C  CG  . LEU A 1 266 ? -15.286 49.890 64.136 1.00 29.61 ? 266  LEU A CG  1 
ATOM   2099 C  CD1 . LEU A 1 266 ? -13.992 49.593 63.395 1.00 27.28 ? 266  LEU A CD1 1 
ATOM   2100 C  CD2 . LEU A 1 266 ? -14.991 50.472 65.533 1.00 29.35 ? 266  LEU A CD2 1 
ATOM   2101 N  N   . ARG A 1 267 ? -18.991 52.076 62.120 1.00 30.87 ? 267  ARG A N   1 
ATOM   2102 C  CA  . ARG A 1 267 ? -19.642 53.126 61.339 1.00 31.08 ? 267  ARG A CA  1 
ATOM   2103 C  C   . ARG A 1 267 ? -20.763 53.840 62.093 1.00 31.62 ? 267  ARG A C   1 
ATOM   2104 O  O   . ARG A 1 267 ? -21.114 54.972 61.743 1.00 31.30 ? 267  ARG A O   1 
ATOM   2105 C  CB  . ARG A 1 267 ? -20.143 52.581 59.989 1.00 31.23 ? 267  ARG A CB  1 
ATOM   2106 C  CG  . ARG A 1 267 ? -19.029 52.295 58.987 1.00 29.77 ? 267  ARG A CG  1 
ATOM   2107 C  CD  . ARG A 1 267 ? -19.568 51.835 57.622 1.00 30.26 ? 267  ARG A CD  1 
ATOM   2108 N  NE  . ARG A 1 267 ? -18.484 51.777 56.637 1.00 30.31 ? 267  ARG A NE  1 
ATOM   2109 C  CZ  . ARG A 1 267 ? -18.466 50.986 55.560 1.00 30.63 ? 267  ARG A CZ  1 
ATOM   2110 N  NH1 . ARG A 1 267 ? -19.475 50.159 55.318 1.00 27.60 ? 267  ARG A NH1 1 
ATOM   2111 N  NH2 . ARG A 1 267 ? -17.420 51.006 54.732 1.00 29.29 ? 267  ARG A NH2 1 
ATOM   2112 N  N   . GLU A 1 268 ? -21.305 53.197 63.129 1.00 32.28 ? 268  GLU A N   1 
ATOM   2113 C  CA  A GLU A 1 268 ? -22.392 53.773 63.932 0.60 32.91 ? 268  GLU A CA  1 
ATOM   2114 C  CA  B GLU A 1 268 ? -22.392 53.781 63.923 0.40 32.74 ? 268  GLU A CA  1 
ATOM   2115 C  C   . GLU A 1 268 ? -21.874 54.788 64.943 1.00 32.82 ? 268  GLU A C   1 
ATOM   2116 O  O   . GLU A 1 268 ? -22.618 55.657 65.400 1.00 32.99 ? 268  GLU A O   1 
ATOM   2117 C  CB  A GLU A 1 268 ? -23.139 52.671 64.684 0.60 33.34 ? 268  GLU A CB  1 
ATOM   2118 C  CB  B GLU A 1 268 ? -23.183 52.694 64.654 0.40 33.01 ? 268  GLU A CB  1 
ATOM   2119 C  CG  A GLU A 1 268 ? -24.005 51.791 63.810 0.60 35.96 ? 268  GLU A CG  1 
ATOM   2120 C  CG  B GLU A 1 268 ? -23.953 51.760 63.749 0.40 34.61 ? 268  GLU A CG  1 
ATOM   2121 C  CD  A GLU A 1 268 ? -25.372 52.396 63.547 0.60 38.34 ? 268  GLU A CD  1 
ATOM   2122 C  CD  B GLU A 1 268 ? -24.946 50.906 64.506 0.40 35.88 ? 268  GLU A CD  1 
ATOM   2123 O  OE1 A GLU A 1 268 ? -26.131 52.572 64.525 0.60 39.87 ? 268  GLU A OE1 1 
ATOM   2124 O  OE1 B GLU A 1 268 ? -24.747 50.695 65.721 0.40 36.40 ? 268  GLU A OE1 1 
ATOM   2125 O  OE2 A GLU A 1 268 ? -25.693 52.670 62.368 0.60 39.49 ? 268  GLU A OE2 1 
ATOM   2126 O  OE2 B GLU A 1 268 ? -25.927 50.450 63.881 0.40 36.92 ? 268  GLU A OE2 1 
ATOM   2127 N  N   . LYS A 1 269 ? -20.598 54.662 65.297 1.00 32.64 ? 269  LYS A N   1 
ATOM   2128 C  CA  . LYS A 1 269 ? -19.979 55.508 66.318 1.00 32.74 ? 269  LYS A CA  1 
ATOM   2129 C  C   . LYS A 1 269 ? -19.791 56.933 65.838 1.00 32.48 ? 269  LYS A C   1 
ATOM   2130 O  O   . LYS A 1 269 ? -19.539 57.178 64.653 1.00 33.07 ? 269  LYS A O   1 
ATOM   2131 C  CB  . LYS A 1 269 ? -18.619 54.938 66.739 1.00 32.76 ? 269  LYS A CB  1 
ATOM   2132 C  CG  . LYS A 1 269 ? -18.650 53.509 67.242 1.00 33.85 ? 269  LYS A CG  1 
ATOM   2133 C  CD  . LYS A 1 269 ? -19.511 53.382 68.489 1.00 33.93 ? 269  LYS A CD  1 
ATOM   2134 C  CE  . LYS A 1 269 ? -19.563 51.948 68.949 1.00 35.84 ? 269  LYS A CE  1 
ATOM   2135 N  NZ  . LYS A 1 269 ? -20.600 51.817 70.009 1.00 39.05 ? 269  LYS A NZ  1 
ATOM   2136 N  N   . LYS A 1 270 ? -19.921 57.874 66.762 1.00 31.65 ? 270  LYS A N   1 
ATOM   2137 C  CA  . LYS A 1 270 ? -19.552 59.247 66.486 1.00 31.35 ? 270  LYS A CA  1 
ATOM   2138 C  C   . LYS A 1 270 ? -18.030 59.322 66.297 1.00 29.60 ? 270  LYS A C   1 
ATOM   2139 O  O   . LYS A 1 270 ? -17.306 58.509 66.863 1.00 29.06 ? 270  LYS A O   1 
ATOM   2140 C  CB  . LYS A 1 270 ? -20.028 60.173 67.607 1.00 31.95 ? 270  LYS A CB  1 
ATOM   2141 C  CG  . LYS A 1 270 ? -21.547 60.363 67.617 1.00 36.09 ? 270  LYS A CG  1 
ATOM   2142 C  CD  . LYS A 1 270 ? -21.992 61.407 68.650 1.00 41.27 ? 270  LYS A CD  1 
ATOM   2143 C  CE  . LYS A 1 270 ? -22.380 60.758 69.988 1.00 45.45 ? 270  LYS A CE  1 
ATOM   2144 N  NZ  . LYS A 1 270 ? -23.460 61.543 70.707 1.00 46.90 ? 270  LYS A NZ  1 
ATOM   2145 N  N   . PRO A 1 271 ? -17.548 60.274 65.471 1.00 28.36 ? 271  PRO A N   1 
ATOM   2146 C  CA  . PRO A 1 271 ? -16.108 60.316 65.224 1.00 28.07 ? 271  PRO A CA  1 
ATOM   2147 C  C   . PRO A 1 271 ? -15.281 60.372 66.517 1.00 27.36 ? 271  PRO A C   1 
ATOM   2148 O  O   . PRO A 1 271 ? -14.300 59.634 66.639 1.00 26.42 ? 271  PRO A O   1 
ATOM   2149 C  CB  . PRO A 1 271 ? -15.918 61.594 64.398 1.00 27.81 ? 271  PRO A CB  1 
ATOM   2150 C  CG  . PRO A 1 271 ? -17.238 61.793 63.711 1.00 28.26 ? 271  PRO A CG  1 
ATOM   2151 C  CD  . PRO A 1 271 ? -18.280 61.279 64.678 1.00 28.25 ? 271  PRO A CD  1 
ATOM   2152 N  N   . GLN A 1 272 ? -15.697 61.210 67.466 1.00 27.36 ? 272  GLN A N   1 
ATOM   2153 C  CA  . GLN A 1 272 ? -14.957 61.381 68.721 1.00 27.75 ? 272  GLN A CA  1 
ATOM   2154 C  C   . GLN A 1 272 ? -14.849 60.096 69.528 1.00 27.38 ? 272  GLN A C   1 
ATOM   2155 O  O   . GLN A 1 272 ? -13.883 59.905 70.267 1.00 27.02 ? 272  GLN A O   1 
ATOM   2156 C  CB  . GLN A 1 272 ? -15.563 62.490 69.586 1.00 27.96 ? 272  GLN A CB  1 
ATOM   2157 C  CG  . GLN A 1 272 ? -14.603 62.961 70.715 1.00 29.48 ? 272  GLN A CG  1 
ATOM   2158 C  CD  . GLN A 1 272 ? -13.210 63.377 70.185 1.00 31.50 ? 272  GLN A CD  1 
ATOM   2159 O  OE1 . GLN A 1 272 ? -13.099 64.126 69.209 1.00 31.89 ? 272  GLN A OE1 1 
ATOM   2160 N  NE2 . GLN A 1 272 ? -12.159 62.898 70.841 1.00 30.00 ? 272  GLN A NE2 1 
ATOM   2161 N  N   . GLU A 1 273 ? -15.835 59.211 69.380 1.00 27.00 ? 273  GLU A N   1 
ATOM   2162 C  CA  . GLU A 1 273 ? -15.779 57.920 70.055 1.00 26.93 ? 273  GLU A CA  1 
ATOM   2163 C  C   . GLU A 1 273 ? -14.576 57.111 69.600 1.00 26.60 ? 273  GLU A C   1 
ATOM   2164 O  O   . GLU A 1 273 ? -13.941 56.441 70.418 1.00 26.76 ? 273  GLU A O   1 
ATOM   2165 C  CB  . GLU A 1 273 ? -17.076 57.122 69.853 1.00 26.68 ? 273  GLU A CB  1 
ATOM   2166 C  CG  . GLU A 1 273 ? -18.282 57.772 70.498 1.00 28.70 ? 273  GLU A CG  1 
ATOM   2167 C  CD  . GLU A 1 273 ? -19.518 56.923 70.353 1.00 31.71 ? 273  GLU A CD  1 
ATOM   2168 O  OE1 . GLU A 1 273 ? -19.654 55.954 71.125 1.00 30.99 ? 273  GLU A OE1 1 
ATOM   2169 O  OE2 . GLU A 1 273 ? -20.343 57.216 69.460 1.00 31.63 ? 273  GLU A OE2 1 
ATOM   2170 N  N   . LEU A 1 274 ? -14.269 57.159 68.301 1.00 25.37 ? 274  LEU A N   1 
ATOM   2171 C  CA  . LEU A 1 274 ? -13.106 56.441 67.768 1.00 25.55 ? 274  LEU A CA  1 
ATOM   2172 C  C   . LEU A 1 274 ? -11.810 57.073 68.265 1.00 24.35 ? 274  LEU A C   1 
ATOM   2173 O  O   . LEU A 1 274 ? -10.901 56.376 68.706 1.00 24.25 ? 274  LEU A O   1 
ATOM   2174 C  CB  . LEU A 1 274 ? -13.118 56.437 66.228 1.00 25.87 ? 274  LEU A CB  1 
ATOM   2175 C  CG  . LEU A 1 274 ? -13.887 55.332 65.490 1.00 28.32 ? 274  LEU A CG  1 
ATOM   2176 C  CD1 . LEU A 1 274 ? -15.253 55.085 66.044 1.00 28.54 ? 274  LEU A CD1 1 
ATOM   2177 C  CD2 . LEU A 1 274 ? -13.970 55.617 63.978 1.00 29.02 ? 274  LEU A CD2 1 
ATOM   2178 N  N   . ILE A 1 275 ? -11.753 58.397 68.182 1.00 24.08 ? 275  ILE A N   1 
ATOM   2179 C  CA  . ILE A 1 275 ? -10.583 59.179 68.558 1.00 24.12 ? 275  ILE A CA  1 
ATOM   2180 C  C   . ILE A 1 275 ? -10.215 58.978 70.042 1.00 24.06 ? 275  ILE A C   1 
ATOM   2181 O  O   . ILE A 1 275 ? -9.035  58.842 70.374 1.00 23.77 ? 275  ILE A O   1 
ATOM   2182 C  CB  . ILE A 1 275 ? -10.817 60.665 68.230 1.00 24.13 ? 275  ILE A CB  1 
ATOM   2183 C  CG1 . ILE A 1 275 ? -10.842 60.851 66.704 1.00 24.33 ? 275  ILE A CG1 1 
ATOM   2184 C  CG2 . ILE A 1 275 ? -9.732  61.581 68.869 1.00 23.28 ? 275  ILE A CG2 1 
ATOM   2185 C  CD1 . ILE A 1 275 ? -11.479 62.142 66.241 1.00 22.52 ? 275  ILE A CD1 1 
ATOM   2186 N  N   . ASP A 1 276 ? -11.228 58.917 70.899 1.00 23.64 ? 276  ASP A N   1 
ATOM   2187 C  CA  . ASP A 1 276 ? -11.031 58.759 72.348 1.00 24.56 ? 276  ASP A CA  1 
ATOM   2188 C  C   . ASP A 1 276 ? -10.310 57.475 72.761 1.00 24.36 ? 276  ASP A C   1 
ATOM   2189 O  O   . ASP A 1 276 ? -9.690  57.438 73.822 1.00 25.24 ? 276  ASP A O   1 
ATOM   2190 C  CB  . ASP A 1 276 ? -12.376 58.847 73.087 1.00 24.89 ? 276  ASP A CB  1 
ATOM   2191 C  CG  . ASP A 1 276 ? -12.882 60.278 73.232 1.00 26.74 ? 276  ASP A CG  1 
ATOM   2192 O  OD1 . ASP A 1 276 ? -12.142 61.263 72.978 1.00 29.42 ? 276  ASP A OD1 1 
ATOM   2193 O  OD2 . ASP A 1 276 ? -14.052 60.411 73.599 1.00 29.88 ? 276  ASP A OD2 1 
ATOM   2194 N  N   . VAL A 1 277 ? -10.404 56.421 71.952 1.00 23.62 ? 277  VAL A N   1 
ATOM   2195 C  CA  . VAL A 1 277 ? -9.740  55.152 72.266 1.00 23.06 ? 277  VAL A CA  1 
ATOM   2196 C  C   . VAL A 1 277 ? -8.616  54.782 71.277 1.00 22.96 ? 277  VAL A C   1 
ATOM   2197 O  O   . VAL A 1 277 ? -7.976  53.756 71.420 1.00 23.46 ? 277  VAL A O   1 
ATOM   2198 C  CB  . VAL A 1 277 ? -10.757 53.953 72.409 1.00 23.55 ? 277  VAL A CB  1 
ATOM   2199 C  CG1 . VAL A 1 277 ? -11.721 54.168 73.573 1.00 23.11 ? 277  VAL A CG1 1 
ATOM   2200 C  CG2 . VAL A 1 277 ? -11.529 53.683 71.089 1.00 21.79 ? 277  VAL A CG2 1 
ATOM   2201 N  N   . GLU A 1 278 ? -8.377  55.635 70.284 1.00 22.76 ? 278  GLU A N   1 
ATOM   2202 C  CA  . GLU A 1 278 ? -7.388  55.399 69.228 1.00 22.79 ? 278  GLU A CA  1 
ATOM   2203 C  C   . GLU A 1 278 ? -6.016  54.941 69.735 1.00 22.40 ? 278  GLU A C   1 
ATOM   2204 O  O   . GLU A 1 278 ? -5.414  54.020 69.179 1.00 21.21 ? 278  GLU A O   1 
ATOM   2205 C  CB  . GLU A 1 278 ? -7.223  56.684 68.398 1.00 22.59 ? 278  GLU A CB  1 
ATOM   2206 C  CG  . GLU A 1 278 ? -6.122  56.632 67.355 1.00 24.42 ? 278  GLU A CG  1 
ATOM   2207 C  CD  . GLU A 1 278 ? -5.979  57.934 66.580 1.00 24.63 ? 278  GLU A CD  1 
ATOM   2208 O  OE1 . GLU A 1 278 ? -6.971  58.691 66.460 1.00 25.85 ? 278  GLU A OE1 1 
ATOM   2209 O  OE2 . GLU A 1 278 ? -4.863  58.187 66.089 1.00 26.42 ? 278  GLU A OE2 1 
ATOM   2210 N  N   . TRP A 1 279 ? -5.513  55.606 70.770 1.00 22.70 ? 279  TRP A N   1 
ATOM   2211 C  CA  . TRP A 1 279 ? -4.155  55.337 71.264 1.00 23.32 ? 279  TRP A CA  1 
ATOM   2212 C  C   . TRP A 1 279 ? -4.040  54.018 72.025 1.00 24.44 ? 279  TRP A C   1 
ATOM   2213 O  O   . TRP A 1 279 ? -2.937  53.514 72.220 1.00 25.50 ? 279  TRP A O   1 
ATOM   2214 C  CB  . TRP A 1 279 ? -3.667  56.514 72.113 1.00 23.91 ? 279  TRP A CB  1 
ATOM   2215 C  CG  . TRP A 1 279 ? -3.498  57.744 71.298 1.00 24.45 ? 279  TRP A CG  1 
ATOM   2216 C  CD1 . TRP A 1 279 ? -4.389  58.785 71.153 1.00 25.00 ? 279  TRP A CD1 1 
ATOM   2217 C  CD2 . TRP A 1 279 ? -2.371  58.062 70.477 1.00 23.44 ? 279  TRP A CD2 1 
ATOM   2218 N  NE1 . TRP A 1 279 ? -3.865  59.733 70.305 1.00 25.04 ? 279  TRP A NE1 1 
ATOM   2219 C  CE2 . TRP A 1 279 ? -2.627  59.311 69.879 1.00 24.94 ? 279  TRP A CE2 1 
ATOM   2220 C  CE3 . TRP A 1 279 ? -1.165  57.406 70.193 1.00 25.07 ? 279  TRP A CE3 1 
ATOM   2221 C  CZ2 . TRP A 1 279 ? -1.709  59.927 68.997 1.00 26.19 ? 279  TRP A CZ2 1 
ATOM   2222 C  CZ3 . TRP A 1 279 ? -0.241  58.023 69.323 1.00 26.13 ? 279  TRP A CZ3 1 
ATOM   2223 C  CH2 . TRP A 1 279 ? -0.524  59.266 68.737 1.00 23.75 ? 279  TRP A CH2 1 
ATOM   2224 N  N   . ASN A 1 280 ? -5.176  53.431 72.399 1.00 23.86 ? 280  ASN A N   1 
ATOM   2225 C  CA  . ASN A 1 280 ? -5.196  52.171 73.145 1.00 24.32 ? 280  ASN A CA  1 
ATOM   2226 C  C   . ASN A 1 280 ? -4.844  50.913 72.354 1.00 24.30 ? 280  ASN A C   1 
ATOM   2227 O  O   . ASN A 1 280 ? -4.719  49.842 72.945 1.00 24.99 ? 280  ASN A O   1 
ATOM   2228 C  CB  . ASN A 1 280 ? -6.570  51.992 73.825 1.00 23.78 ? 280  ASN A CB  1 
ATOM   2229 C  CG  . ASN A 1 280 ? -6.923  53.160 74.758 1.00 25.10 ? 280  ASN A CG  1 
ATOM   2230 O  OD1 . ASN A 1 280 ? -6.054  53.975 75.134 1.00 24.42 ? 280  ASN A OD1 1 
ATOM   2231 N  ND2 . ASN A 1 280 ? -8.193  53.241 75.145 1.00 25.12 ? 280  ASN A ND2 1 
ATOM   2232 N  N   . VAL A 1 281 ? -4.701  51.019 71.030 1.00 24.07 ? 281  VAL A N   1 
ATOM   2233 C  CA  . VAL A 1 281 ? -4.509  49.816 70.191 1.00 23.77 ? 281  VAL A CA  1 
ATOM   2234 C  C   . VAL A 1 281 ? -3.049  49.519 69.867 1.00 23.98 ? 281  VAL A C   1 
ATOM   2235 O  O   . VAL A 1 281 ? -2.748  48.497 69.235 1.00 22.67 ? 281  VAL A O   1 
ATOM   2236 C  CB  . VAL A 1 281 ? -5.324  49.876 68.845 1.00 24.61 ? 281  VAL A CB  1 
ATOM   2237 C  CG1 . VAL A 1 281 ? -6.803  50.171 69.118 1.00 23.93 ? 281  VAL A CG1 1 
ATOM   2238 C  CG2 . VAL A 1 281 ? -4.736  50.922 67.894 1.00 24.83 ? 281  VAL A CG2 1 
ATOM   2239 N  N   . LEU A 1 282 ? -2.137  50.411 70.281 1.00 23.62 ? 282  LEU A N   1 
ATOM   2240 C  CA  . LEU A 1 282 ? -0.717  50.201 69.997 1.00 23.44 ? 282  LEU A CA  1 
ATOM   2241 C  C   . LEU A 1 282 ? -0.235  48.944 70.689 1.00 24.55 ? 282  LEU A C   1 
ATOM   2242 O  O   . LEU A 1 282 ? -0.631  48.688 71.837 1.00 24.60 ? 282  LEU A O   1 
ATOM   2243 C  CB  . LEU A 1 282 ? 0.132   51.388 70.457 1.00 23.06 ? 282  LEU A CB  1 
ATOM   2244 C  CG  . LEU A 1 282 ? 0.040   52.654 69.591 1.00 22.52 ? 282  LEU A CG  1 
ATOM   2245 C  CD1 . LEU A 1 282 ? 0.808   53.773 70.250 1.00 22.94 ? 282  LEU A CD1 1 
ATOM   2246 C  CD2 . LEU A 1 282 ? 0.583   52.379 68.166 1.00 19.81 ? 282  LEU A CD2 1 
ATOM   2247 N  N   . PRO A 1 283 ? 0.641   48.176 70.014 1.00 24.80 ? 283  PRO A N   1 
ATOM   2248 C  CA  . PRO A 1 283 ? 1.081   46.898 70.568 1.00 25.47 ? 283  PRO A CA  1 
ATOM   2249 C  C   . PRO A 1 283 ? 2.136   47.058 71.654 1.00 25.96 ? 283  PRO A C   1 
ATOM   2250 O  O   . PRO A 1 283 ? 2.302   46.140 72.444 1.00 26.46 ? 283  PRO A O   1 
ATOM   2251 C  CB  . PRO A 1 283 ? 1.684   46.176 69.358 1.00 25.35 ? 283  PRO A CB  1 
ATOM   2252 C  CG  . PRO A 1 283 ? 2.231   47.327 68.500 1.00 24.89 ? 283  PRO A CG  1 
ATOM   2253 C  CD  . PRO A 1 283 ? 1.220   48.440 68.674 1.00 24.41 ? 283  PRO A CD  1 
ATOM   2254 N  N   . PHE A 1 284 ? 2.837   48.195 71.695 1.00 25.40 ? 284  PHE A N   1 
ATOM   2255 C  CA  . PHE A 1 284 ? 3.938   48.371 72.640 1.00 25.23 ? 284  PHE A CA  1 
ATOM   2256 C  C   . PHE A 1 284 ? 3.792   49.662 73.407 1.00 24.54 ? 284  PHE A C   1 
ATOM   2257 O  O   . PHE A 1 284 ? 3.102   50.562 72.974 1.00 23.94 ? 284  PHE A O   1 
ATOM   2258 C  CB  . PHE A 1 284 ? 5.297   48.438 71.927 1.00 25.43 ? 284  PHE A CB  1 
ATOM   2259 C  CG  . PHE A 1 284 ? 5.584   47.284 71.003 1.00 27.26 ? 284  PHE A CG  1 
ATOM   2260 C  CD1 . PHE A 1 284 ? 5.707   45.988 71.495 1.00 29.59 ? 284  PHE A CD1 1 
ATOM   2261 C  CD2 . PHE A 1 284 ? 5.804   47.513 69.648 1.00 28.79 ? 284  PHE A CD2 1 
ATOM   2262 C  CE1 . PHE A 1 284 ? 6.003   44.913 70.633 1.00 32.45 ? 284  PHE A CE1 1 
ATOM   2263 C  CE2 . PHE A 1 284 ? 6.102   46.466 68.777 1.00 30.78 ? 284  PHE A CE2 1 
ATOM   2264 C  CZ  . PHE A 1 284 ? 6.206   45.159 69.266 1.00 32.25 ? 284  PHE A CZ  1 
ATOM   2265 N  N   . ASP A 1 285 ? 4.476   49.737 74.547 1.00 24.20 ? 285  ASP A N   1 
ATOM   2266 C  CA  . ASP A 1 285 ? 4.734   50.989 75.246 1.00 23.75 ? 285  ASP A CA  1 
ATOM   2267 C  C   . ASP A 1 285 ? 5.787   51.757 74.436 1.00 23.33 ? 285  ASP A C   1 
ATOM   2268 O  O   . ASP A 1 285 ? 6.966   51.424 74.461 1.00 24.16 ? 285  ASP A O   1 
ATOM   2269 C  CB  . ASP A 1 285 ? 5.269   50.676 76.650 1.00 23.73 ? 285  ASP A CB  1 
ATOM   2270 C  CG  . ASP A 1 285 ? 5.355   51.904 77.546 1.00 24.69 ? 285  ASP A CG  1 
ATOM   2271 O  OD1 . ASP A 1 285 ? 4.856   52.991 77.162 1.00 22.38 ? 285  ASP A OD1 1 
ATOM   2272 O  OD2 . ASP A 1 285 ? 5.909   51.753 78.663 1.00 25.01 ? 285  ASP A OD2 1 
ATOM   2273 N  N   . SER A 1 286 ? 5.375   52.792 73.724 1.00 22.34 ? 286  SER A N   1 
ATOM   2274 C  CA  . SER A 1 286 ? 6.246   53.372 72.707 1.00 22.04 ? 286  SER A CA  1 
ATOM   2275 C  C   . SER A 1 286 ? 6.135   54.876 72.628 1.00 21.49 ? 286  SER A C   1 
ATOM   2276 O  O   . SER A 1 286 ? 5.166   55.465 73.119 1.00 22.01 ? 286  SER A O   1 
ATOM   2277 C  CB  . SER A 1 286 ? 5.896   52.781 71.325 1.00 21.44 ? 286  SER A CB  1 
ATOM   2278 O  OG  . SER A 1 286 ? 4.515   53.028 71.029 1.00 22.63 ? 286  SER A OG  1 
ATOM   2279 N  N   . ILE A 1 287 ? 7.152   55.497 72.025 1.00 20.24 ? 287  ILE A N   1 
ATOM   2280 C  CA  . ILE A 1 287 ? 7.011   56.837 71.463 1.00 20.08 ? 287  ILE A CA  1 
ATOM   2281 C  C   . ILE A 1 287 ? 7.288   56.764 69.949 1.00 19.69 ? 287  ILE A C   1 
ATOM   2282 O  O   . ILE A 1 287 ? 7.906   55.802 69.469 1.00 19.71 ? 287  ILE A O   1 
ATOM   2283 C  CB  . ILE A 1 287 ? 7.929   57.867 72.140 1.00 20.04 ? 287  ILE A CB  1 
ATOM   2284 C  CG1 . ILE A 1 287 ? 9.411   57.484 71.950 1.00 19.83 ? 287  ILE A CG1 1 
ATOM   2285 C  CG2 . ILE A 1 287 ? 7.527   58.039 73.651 1.00 21.08 ? 287  ILE A CG2 1 
ATOM   2286 C  CD1 . ILE A 1 287 ? 10.389  58.557 72.485 1.00 20.08 ? 287  ILE A CD1 1 
ATOM   2287 N  N   . PHE A 1 288 ? 6.819   57.770 69.214 1.00 19.90 ? 288  PHE A N   1 
ATOM   2288 C  CA  . PHE A 1 288 ? 6.963   57.833 67.738 1.00 19.71 ? 288  PHE A CA  1 
ATOM   2289 C  C   . PHE A 1 288 ? 6.353   56.587 67.068 1.00 20.30 ? 288  PHE A C   1 
ATOM   2290 O  O   . PHE A 1 288 ? 6.921   56.026 66.126 1.00 20.26 ? 288  PHE A O   1 
ATOM   2291 C  CB  . PHE A 1 288 ? 8.435   58.013 67.325 1.00 19.00 ? 288  PHE A CB  1 
ATOM   2292 C  CG  . PHE A 1 288 ? 8.649   59.030 66.204 1.00 19.28 ? 288  PHE A CG  1 
ATOM   2293 C  CD1 . PHE A 1 288 ? 7.845   59.019 65.044 1.00 19.14 ? 288  PHE A CD1 1 
ATOM   2294 C  CD2 . PHE A 1 288 ? 9.651   59.980 66.306 1.00 17.37 ? 288  PHE A CD2 1 
ATOM   2295 C  CE1 . PHE A 1 288 ? 8.037   59.956 64.019 1.00 20.21 ? 288  PHE A CE1 1 
ATOM   2296 C  CE2 . PHE A 1 288 ? 9.871   60.917 65.278 1.00 20.29 ? 288  PHE A CE2 1 
ATOM   2297 C  CZ  . PHE A 1 288 ? 9.055   60.905 64.128 1.00 20.08 ? 288  PHE A CZ  1 
ATOM   2298 N  N   . ARG A 1 289 ? 5.222   56.132 67.599 1.00 20.58 ? 289  ARG A N   1 
ATOM   2299 C  CA  . ARG A 1 289 ? 4.427   55.094 66.953 1.00 20.95 ? 289  ARG A CA  1 
ATOM   2300 C  C   . ARG A 1 289 ? 2.980   55.551 66.984 1.00 21.08 ? 289  ARG A C   1 
ATOM   2301 O  O   . ARG A 1 289 ? 2.504   56.084 68.005 1.00 21.45 ? 289  ARG A O   1 
ATOM   2302 C  CB  . ARG A 1 289 ? 4.568   53.736 67.648 1.00 21.14 ? 289  ARG A CB  1 
ATOM   2303 C  CG  . ARG A 1 289 ? 5.955   53.102 67.577 1.00 20.99 ? 289  ARG A CG  1 
ATOM   2304 C  CD  . ARG A 1 289 ? 6.351   52.741 66.124 1.00 21.02 ? 289  ARG A CD  1 
ATOM   2305 N  NE  . ARG A 1 289 ? 7.627   52.016 66.090 1.00 19.55 ? 289  ARG A NE  1 
ATOM   2306 C  CZ  . ARG A 1 289 ? 8.820   52.587 65.968 1.00 21.34 ? 289  ARG A CZ  1 
ATOM   2307 N  NH1 . ARG A 1 289 ? 8.932   53.913 65.890 1.00 18.90 ? 289  ARG A NH1 1 
ATOM   2308 N  NH2 . ARG A 1 289 ? 9.917   51.826 65.938 1.00 20.06 ? 289  ARG A NH2 1 
ATOM   2309 N  N   . PHE A 1 290 ? 2.287   55.349 65.862 1.00 20.20 ? 290  PHE A N   1 
ATOM   2310 C  CA  . PHE A 1 290 ? 0.924   55.833 65.689 1.00 20.15 ? 290  PHE A CA  1 
ATOM   2311 C  C   . PHE A 1 290 ? 0.018   54.668 65.270 1.00 20.04 ? 290  PHE A C   1 
ATOM   2312 O  O   . PHE A 1 290 ? 0.449   53.717 64.608 1.00 20.47 ? 290  PHE A O   1 
ATOM   2313 C  CB  . PHE A 1 290 ? 0.900   56.991 64.673 1.00 20.50 ? 290  PHE A CB  1 
ATOM   2314 C  CG  . PHE A 1 290 ? 2.086   57.933 64.808 1.00 20.28 ? 290  PHE A CG  1 
ATOM   2315 C  CD1 . PHE A 1 290 ? 2.242   58.723 65.953 1.00 22.06 ? 290  PHE A CD1 1 
ATOM   2316 C  CD2 . PHE A 1 290 ? 3.061   57.989 63.822 1.00 21.35 ? 290  PHE A CD2 1 
ATOM   2317 C  CE1 . PHE A 1 290 ? 3.343   59.576 66.091 1.00 22.46 ? 290  PHE A CE1 1 
ATOM   2318 C  CE2 . PHE A 1 290 ? 4.162   58.833 63.937 1.00 21.37 ? 290  PHE A CE2 1 
ATOM   2319 C  CZ  . PHE A 1 290 ? 4.308   59.636 65.083 1.00 22.68 ? 290  PHE A CZ  1 
ATOM   2320 N  N   . SER A 1 291 ? -1.235  54.762 65.659 1.00 19.86 ? 291  SER A N   1 
ATOM   2321 C  CA  . SER A 1 291 ? -2.163  53.638 65.601 1.00 21.27 ? 291  SER A CA  1 
ATOM   2322 C  C   . SER A 1 291 ? -2.610  53.253 64.186 1.00 20.84 ? 291  SER A C   1 
ATOM   2323 O  O   . SER A 1 291 ? -2.492  52.083 63.799 1.00 20.86 ? 291  SER A O   1 
ATOM   2324 C  CB  . SER A 1 291 ? -3.386  53.945 66.466 1.00 20.82 ? 291  SER A CB  1 
ATOM   2325 O  OG  . SER A 1 291 ? -3.016  53.883 67.833 1.00 24.31 ? 291  SER A OG  1 
ATOM   2326 N  N   . PHE A 1 292 ? -3.104  54.232 63.421 1.00 19.91 ? 292  PHE A N   1 
ATOM   2327 C  CA  . PHE A 1 292 ? -3.672  53.915 62.104 1.00 19.43 ? 292  PHE A CA  1 
ATOM   2328 C  C   . PHE A 1 292 ? -2.833  54.497 60.989 1.00 19.12 ? 292  PHE A C   1 
ATOM   2329 O  O   . PHE A 1 292 ? -2.803  55.713 60.800 1.00 18.23 ? 292  PHE A O   1 
ATOM   2330 C  CB  . PHE A 1 292 ? -5.156  54.299 62.063 1.00 19.41 ? 292  PHE A CB  1 
ATOM   2331 C  CG  . PHE A 1 292 ? -5.959  53.532 63.054 1.00 20.58 ? 292  PHE A CG  1 
ATOM   2332 C  CD1 . PHE A 1 292 ? -6.242  52.176 62.830 1.00 21.70 ? 292  PHE A CD1 1 
ATOM   2333 C  CD2 . PHE A 1 292 ? -6.328  54.109 64.262 1.00 20.85 ? 292  PHE A CD2 1 
ATOM   2334 C  CE1 . PHE A 1 292 ? -6.926  51.426 63.778 1.00 21.62 ? 292  PHE A CE1 1 
ATOM   2335 C  CE2 . PHE A 1 292 ? -7.026  53.377 65.216 1.00 22.01 ? 292  PHE A CE2 1 
ATOM   2336 C  CZ  . PHE A 1 292 ? -7.310  52.031 64.985 1.00 21.68 ? 292  PHE A CZ  1 
ATOM   2337 N  N   . VAL A 1 293 ? -2.081  53.629 60.309 1.00 19.00 ? 293  VAL A N   1 
ATOM   2338 C  CA  . VAL A 1 293 ? -1.098  54.093 59.325 1.00 19.89 ? 293  VAL A CA  1 
ATOM   2339 C  C   . VAL A 1 293 ? -1.226  53.242 58.048 1.00 20.39 ? 293  VAL A C   1 
ATOM   2340 O  O   . VAL A 1 293 ? -1.946  52.228 58.067 1.00 20.99 ? 293  VAL A O   1 
ATOM   2341 C  CB  . VAL A 1 293 ? 0.367   54.033 59.862 1.00 19.85 ? 293  VAL A CB  1 
ATOM   2342 C  CG1 . VAL A 1 293 ? 0.577   54.984 61.047 1.00 20.43 ? 293  VAL A CG1 1 
ATOM   2343 C  CG2 . VAL A 1 293 ? 0.778   52.605 60.210 1.00 20.50 ? 293  VAL A CG2 1 
ATOM   2344 N  N   . PRO A 1 294 ? -0.561  53.663 56.951 1.00 20.44 ? 294  PRO A N   1 
ATOM   2345 C  CA  . PRO A 1 294 ? -0.538  52.886 55.725 1.00 21.23 ? 294  PRO A CA  1 
ATOM   2346 C  C   . PRO A 1 294 ? -0.221  51.414 55.952 1.00 22.11 ? 294  PRO A C   1 
ATOM   2347 O  O   . PRO A 1 294 ? 0.587   51.074 56.816 1.00 22.34 ? 294  PRO A O   1 
ATOM   2348 C  CB  . PRO A 1 294 ? 0.569   53.557 54.918 1.00 20.97 ? 294  PRO A CB  1 
ATOM   2349 C  CG  . PRO A 1 294 ? 0.319   55.052 55.217 1.00 20.85 ? 294  PRO A CG  1 
ATOM   2350 C  CD  . PRO A 1 294 ? -0.040  55.035 56.728 1.00 20.98 ? 294  PRO A CD  1 
ATOM   2351 N  N   . VAL A 1 295 ? -0.859  50.557 55.159 1.00 22.34 ? 295  VAL A N   1 
ATOM   2352 C  CA  A VAL A 1 295 ? -0.703  49.114 55.284 0.50 22.20 ? 295  VAL A CA  1 
ATOM   2353 C  CA  B VAL A 1 295 ? -0.673  49.106 55.284 0.50 22.66 ? 295  VAL A CA  1 
ATOM   2354 C  C   . VAL A 1 295 ? -0.048  48.537 54.009 1.00 22.87 ? 295  VAL A C   1 
ATOM   2355 O  O   . VAL A 1 295 ? -0.389  48.936 52.896 1.00 23.13 ? 295  VAL A O   1 
ATOM   2356 C  CB  A VAL A 1 295 ? -2.084  48.480 55.636 0.50 22.40 ? 295  VAL A CB  1 
ATOM   2357 C  CB  B VAL A 1 295 ? -2.003  48.390 55.630 0.50 22.93 ? 295  VAL A CB  1 
ATOM   2358 C  CG1 A VAL A 1 295 ? -3.085  48.567 54.468 0.50 20.34 ? 295  VAL A CG1 1 
ATOM   2359 C  CG1 B VAL A 1 295 ? -1.931  46.923 55.317 0.50 24.01 ? 295  VAL A CG1 1 
ATOM   2360 C  CG2 A VAL A 1 295 ? -1.935  47.075 56.171 0.50 22.25 ? 295  VAL A CG2 1 
ATOM   2361 C  CG2 B VAL A 1 295 ? -2.329  48.558 57.102 0.50 22.47 ? 295  VAL A CG2 1 
ATOM   2362 N  N   . ILE A 1 296 ? 0.908   47.622 54.169 1.00 23.36 ? 296  ILE A N   1 
ATOM   2363 C  CA  . ILE A 1 296 ? 1.586   47.015 53.022 1.00 23.70 ? 296  ILE A CA  1 
ATOM   2364 C  C   . ILE A 1 296 ? 0.634   45.948 52.450 1.00 24.27 ? 296  ILE A C   1 
ATOM   2365 O  O   . ILE A 1 296 ? 0.630   44.798 52.901 1.00 24.58 ? 296  ILE A O   1 
ATOM   2366 C  CB  . ILE A 1 296 ? 2.958   46.408 53.441 1.00 23.45 ? 296  ILE A CB  1 
ATOM   2367 C  CG1 . ILE A 1 296 ? 3.829   47.456 54.160 1.00 22.28 ? 296  ILE A CG1 1 
ATOM   2368 C  CG2 . ILE A 1 296 ? 3.681   45.735 52.240 1.00 24.37 ? 296  ILE A CG2 1 
ATOM   2369 C  CD1 . ILE A 1 296 ? 4.084   48.804 53.391 1.00 19.72 ? 296  ILE A CD1 1 
ATOM   2370 N  N   . ASP A 1 297 ? -0.171  46.352 51.463 1.00 24.27 ? 297  ASP A N   1 
ATOM   2371 C  CA  . ASP A 1 297 ? -1.381  45.610 51.077 1.00 24.80 ? 297  ASP A CA  1 
ATOM   2372 C  C   . ASP A 1 297 ? -1.269  44.729 49.826 1.00 25.77 ? 297  ASP A C   1 
ATOM   2373 O  O   . ASP A 1 297 ? -2.190  43.969 49.533 1.00 25.62 ? 297  ASP A O   1 
ATOM   2374 C  CB  . ASP A 1 297 ? -2.551  46.587 50.889 1.00 24.61 ? 297  ASP A CB  1 
ATOM   2375 C  CG  . ASP A 1 297 ? -2.294  47.601 49.773 1.00 25.20 ? 297  ASP A CG  1 
ATOM   2376 O  OD1 . ASP A 1 297 ? -1.126  47.827 49.396 1.00 25.03 ? 297  ASP A OD1 1 
ATOM   2377 O  OD2 . ASP A 1 297 ? -3.269  48.181 49.275 1.00 27.49 ? 297  ASP A OD2 1 
ATOM   2378 N  N   . GLY A 1 298 ? -0.164  44.833 49.088 1.00 26.35 ? 298  GLY A N   1 
ATOM   2379 C  CA  . GLY A 1 298 ? -0.041  44.105 47.815 1.00 27.34 ? 298  GLY A CA  1 
ATOM   2380 C  C   . GLY A 1 298 ? -0.788  44.774 46.658 1.00 28.31 ? 298  GLY A C   1 
ATOM   2381 O  O   . GLY A 1 298 ? -0.854  44.214 45.561 1.00 28.67 ? 298  GLY A O   1 
ATOM   2382 N  N   . GLU A 1 299 ? -1.340  45.969 46.888 1.00 27.58 ? 299  GLU A N   1 
ATOM   2383 C  CA  A GLU A 1 299 ? -2.075  46.691 45.858 0.50 27.98 ? 299  GLU A CA  1 
ATOM   2384 C  CA  B GLU A 1 299 ? -2.062  46.690 45.839 0.50 28.13 ? 299  GLU A CA  1 
ATOM   2385 C  C   . GLU A 1 299 ? -1.516  48.115 45.706 1.00 27.46 ? 299  GLU A C   1 
ATOM   2386 O  O   . GLU A 1 299 ? -0.820  48.430 44.734 1.00 26.99 ? 299  GLU A O   1 
ATOM   2387 C  CB  A GLU A 1 299 ? -3.571  46.684 46.198 0.50 28.45 ? 299  GLU A CB  1 
ATOM   2388 C  CB  B GLU A 1 299 ? -3.585  46.655 46.078 0.50 28.72 ? 299  GLU A CB  1 
ATOM   2389 C  CG  A GLU A 1 299 ? -4.462  47.357 45.164 0.50 31.56 ? 299  GLU A CG  1 
ATOM   2390 C  CG  B GLU A 1 299 ? -4.419  47.304 44.950 0.50 32.50 ? 299  GLU A CG  1 
ATOM   2391 C  CD  A GLU A 1 299 ? -4.350  46.716 43.795 0.50 33.49 ? 299  GLU A CD  1 
ATOM   2392 C  CD  B GLU A 1 299 ? -5.926  47.089 45.100 0.50 35.80 ? 299  GLU A CD  1 
ATOM   2393 O  OE1 A GLU A 1 299 ? -4.091  45.493 43.725 0.50 34.70 ? 299  GLU A OE1 1 
ATOM   2394 O  OE1 B GLU A 1 299 ? -6.369  45.913 45.105 0.50 37.91 ? 299  GLU A OE1 1 
ATOM   2395 O  OE2 A GLU A 1 299 ? -4.526  47.436 42.794 0.50 34.64 ? 299  GLU A OE2 1 
ATOM   2396 O  OE2 B GLU A 1 299 ? -6.665  48.098 45.195 0.50 36.62 ? 299  GLU A OE2 1 
ATOM   2397 N  N   . PHE A 1 300 ? -1.800  48.977 46.681 1.00 26.33 ? 300  PHE A N   1 
ATOM   2398 C  CA  . PHE A 1 300 ? -1.150  50.281 46.705 1.00 24.94 ? 300  PHE A CA  1 
ATOM   2399 C  C   . PHE A 1 300 ? 0.366   50.082 46.713 1.00 24.81 ? 300  PHE A C   1 
ATOM   2400 O  O   . PHE A 1 300 ? 1.093   50.755 45.969 1.00 24.53 ? 300  PHE A O   1 
ATOM   2401 C  CB  . PHE A 1 300 ? -1.610  51.117 47.914 1.00 24.41 ? 300  PHE A CB  1 
ATOM   2402 C  CG  . PHE A 1 300 ? -1.186  52.551 47.833 1.00 23.23 ? 300  PHE A CG  1 
ATOM   2403 C  CD1 . PHE A 1 300 ? 0.118   52.918 48.139 1.00 22.00 ? 300  PHE A CD1 1 
ATOM   2404 C  CD2 . PHE A 1 300 ? -2.080  53.534 47.415 1.00 22.26 ? 300  PHE A CD2 1 
ATOM   2405 C  CE1 . PHE A 1 300 ? 0.522   54.256 48.061 1.00 23.71 ? 300  PHE A CE1 1 
ATOM   2406 C  CE2 . PHE A 1 300 ? -1.677  54.864 47.317 1.00 21.62 ? 300  PHE A CE2 1 
ATOM   2407 C  CZ  . PHE A 1 300 ? -0.380  55.219 47.650 1.00 22.11 ? 300  PHE A CZ  1 
ATOM   2408 N  N   . PHE A 1 301 ? 0.834   49.164 47.565 1.00 24.44 ? 301  PHE A N   1 
ATOM   2409 C  CA  . PHE A 1 301 ? 2.238   48.736 47.590 1.00 24.66 ? 301  PHE A CA  1 
ATOM   2410 C  C   . PHE A 1 301 ? 2.248   47.289 47.098 1.00 25.38 ? 301  PHE A C   1 
ATOM   2411 O  O   . PHE A 1 301 ? 1.754   46.399 47.808 1.00 26.03 ? 301  PHE A O   1 
ATOM   2412 C  CB  . PHE A 1 301 ? 2.793   48.800 49.029 1.00 24.64 ? 301  PHE A CB  1 
ATOM   2413 C  CG  . PHE A 1 301 ? 2.699   50.169 49.652 1.00 22.95 ? 301  PHE A CG  1 
ATOM   2414 C  CD1 . PHE A 1 301 ? 3.562   51.188 49.250 1.00 22.19 ? 301  PHE A CD1 1 
ATOM   2415 C  CD2 . PHE A 1 301 ? 1.723   50.448 50.617 1.00 23.52 ? 301  PHE A CD2 1 
ATOM   2416 C  CE1 . PHE A 1 301 ? 3.473   52.466 49.806 1.00 23.16 ? 301  PHE A CE1 1 
ATOM   2417 C  CE2 . PHE A 1 301 ? 1.620   51.749 51.196 1.00 21.31 ? 301  PHE A CE2 1 
ATOM   2418 C  CZ  . PHE A 1 301 ? 2.484   52.751 50.783 1.00 21.00 ? 301  PHE A CZ  1 
ATOM   2419 N  N   . PRO A 1 302 ? 2.766   47.041 45.877 1.00 25.59 ? 302  PRO A N   1 
ATOM   2420 C  CA  . PRO A 1 302 ? 2.678   45.667 45.353 1.00 25.76 ? 302  PRO A CA  1 
ATOM   2421 C  C   . PRO A 1 302 ? 3.475   44.621 46.147 1.00 26.38 ? 302  PRO A C   1 
ATOM   2422 O  O   . PRO A 1 302 ? 3.009   43.488 46.268 1.00 26.38 ? 302  PRO A O   1 
ATOM   2423 C  CB  . PRO A 1 302 ? 3.205   45.790 43.911 1.00 26.28 ? 302  PRO A CB  1 
ATOM   2424 C  CG  . PRO A 1 302 ? 3.915   47.149 43.849 1.00 27.29 ? 302  PRO A CG  1 
ATOM   2425 C  CD  . PRO A 1 302 ? 3.195   48.009 44.847 1.00 25.05 ? 302  PRO A CD  1 
ATOM   2426 N  N   . THR A 1 303 ? 4.669   44.989 46.639 1.00 26.59 ? 303  THR A N   1 
ATOM   2427 C  CA  . THR A 1 303 ? 5.484   44.130 47.501 1.00 26.90 ? 303  THR A CA  1 
ATOM   2428 C  C   . THR A 1 303 ? 5.968   44.944 48.716 1.00 26.96 ? 303  THR A C   1 
ATOM   2429 O  O   . THR A 1 303 ? 5.567   46.109 48.896 1.00 26.06 ? 303  THR A O   1 
ATOM   2430 C  CB  . THR A 1 303 ? 6.726   43.507 46.767 1.00 27.15 ? 303  THR A CB  1 
ATOM   2431 O  OG1 . THR A 1 303 ? 7.654   44.531 46.383 1.00 27.17 ? 303  THR A OG1 1 
ATOM   2432 C  CG2 . THR A 1 303 ? 6.337   42.704 45.529 1.00 29.57 ? 303  THR A CG2 1 
ATOM   2433 N  N   . SER A 1 304 ? 6.847   44.348 49.526 1.00 26.50 ? 304  SER A N   1 
ATOM   2434 C  CA  . SER A 1 304 ? 7.428   45.052 50.665 1.00 26.40 ? 304  SER A CA  1 
ATOM   2435 C  C   . SER A 1 304 ? 8.185   46.282 50.186 1.00 26.40 ? 304  SER A C   1 
ATOM   2436 O  O   . SER A 1 304 ? 8.743   46.292 49.077 1.00 25.93 ? 304  SER A O   1 
ATOM   2437 C  CB  . SER A 1 304 ? 8.380   44.156 51.442 1.00 26.55 ? 304  SER A CB  1 
ATOM   2438 O  OG  . SER A 1 304 ? 9.490   43.835 50.629 1.00 25.60 ? 304  SER A OG  1 
ATOM   2439 N  N   . LEU A 1 305 ? 8.233   47.303 51.038 1.00 26.18 ? 305  LEU A N   1 
ATOM   2440 C  CA  . LEU A 1 305 ? 8.936   48.527 50.692 1.00 26.15 ? 305  LEU A CA  1 
ATOM   2441 C  C   . LEU A 1 305 ? 10.400  48.246 50.395 1.00 26.61 ? 305  LEU A C   1 
ATOM   2442 O  O   . LEU A 1 305 ? 10.963  48.814 49.451 1.00 26.67 ? 305  LEU A O   1 
ATOM   2443 C  CB  . LEU A 1 305 ? 8.785   49.604 51.778 1.00 26.10 ? 305  LEU A CB  1 
ATOM   2444 C  CG  . LEU A 1 305 ? 7.345   49.983 52.185 1.00 25.58 ? 305  LEU A CG  1 
ATOM   2445 C  CD1 . LEU A 1 305 ? 7.361   51.025 53.313 1.00 25.07 ? 305  LEU A CD1 1 
ATOM   2446 C  CD2 . LEU A 1 305 ? 6.526   50.514 50.999 1.00 24.11 ? 305  LEU A CD2 1 
ATOM   2447 N  N   . GLU A 1 306 ? 11.018  47.369 51.188 1.00 26.76 ? 306  GLU A N   1 
ATOM   2448 C  CA  . GLU A 1 306 ? 12.421  47.041 50.970 1.00 27.59 ? 306  GLU A CA  1 
ATOM   2449 C  C   . GLU A 1 306 ? 12.655  46.391 49.598 1.00 26.80 ? 306  GLU A C   1 
ATOM   2450 O  O   . GLU A 1 306 ? 13.619  46.726 48.918 1.00 26.26 ? 306  GLU A O   1 
ATOM   2451 C  CB  . GLU A 1 306 ? 12.973  46.152 52.105 1.00 28.34 ? 306  GLU A CB  1 
ATOM   2452 C  CG  . GLU A 1 306 ? 14.458  45.766 51.935 1.00 32.00 ? 306  GLU A CG  1 
ATOM   2453 C  CD  . GLU A 1 306 ? 15.434  46.948 52.024 1.00 36.80 ? 306  GLU A CD  1 
ATOM   2454 O  OE1 . GLU A 1 306 ? 15.030  48.091 52.355 1.00 39.62 ? 306  GLU A OE1 1 
ATOM   2455 O  OE2 . GLU A 1 306 ? 16.635  46.734 51.752 1.00 40.57 ? 306  GLU A OE2 1 
ATOM   2456 N  N   . SER A 1 307 ? 11.797  45.459 49.193 1.00 26.68 ? 307  SER A N   1 
ATOM   2457 C  CA  . SER A 1 307 ? 12.011  44.825 47.881 1.00 27.50 ? 307  SER A CA  1 
ATOM   2458 C  C   . SER A 1 307 ? 11.769  45.809 46.727 1.00 26.86 ? 307  SER A C   1 
ATOM   2459 O  O   . SER A 1 307 ? 12.491  45.771 45.733 1.00 26.85 ? 307  SER A O   1 
ATOM   2460 C  CB  . SER A 1 307 ? 11.198  43.538 47.691 1.00 27.42 ? 307  SER A CB  1 
ATOM   2461 O  OG  . SER A 1 307 ? 9.819   43.754 47.955 1.00 28.95 ? 307  SER A OG  1 
ATOM   2462 N  N   . MET A 1 308 ? 10.786  46.697 46.879 1.00 26.41 ? 308  MET A N   1 
ATOM   2463 C  CA  . MET A 1 308 ? 10.551  47.749 45.877 1.00 26.37 ? 308  MET A CA  1 
ATOM   2464 C  C   . MET A 1 308 ? 11.791  48.630 45.713 1.00 26.98 ? 308  MET A C   1 
ATOM   2465 O  O   . MET A 1 308 ? 12.241  48.872 44.597 1.00 26.59 ? 308  MET A O   1 
ATOM   2466 C  CB  . MET A 1 308 ? 9.298   48.571 46.222 1.00 26.07 ? 308  MET A CB  1 
ATOM   2467 C  CG  . MET A 1 308 ? 8.005   47.748 46.179 1.00 24.92 ? 308  MET A CG  1 
ATOM   2468 S  SD  . MET A 1 308 ? 6.515   48.723 46.461 1.00 26.10 ? 308  MET A SD  1 
ATOM   2469 C  CE  . MET A 1 308 ? 6.454   49.679 44.932 1.00 24.09 ? 308  MET A CE  1 
ATOM   2470 N  N   . LEU A 1 309 ? 12.372  49.055 46.833 1.00 27.34 ? 309  LEU A N   1 
ATOM   2471 C  CA  . LEU A 1 309 ? 13.524  49.938 46.808 1.00 28.59 ? 309  LEU A CA  1 
ATOM   2472 C  C   . LEU A 1 309 ? 14.753  49.243 46.227 1.00 29.25 ? 309  LEU A C   1 
ATOM   2473 O  O   . LEU A 1 309 ? 15.515  49.849 45.476 1.00 29.52 ? 309  LEU A O   1 
ATOM   2474 C  CB  . LEU A 1 309 ? 13.836  50.466 48.220 1.00 28.44 ? 309  LEU A CB  1 
ATOM   2475 C  CG  . LEU A 1 309 ? 12.895  51.543 48.786 1.00 28.58 ? 309  LEU A CG  1 
ATOM   2476 C  CD1 . LEU A 1 309 ? 13.220  51.871 50.252 1.00 28.15 ? 309  LEU A CD1 1 
ATOM   2477 C  CD2 . LEU A 1 309 ? 12.916  52.809 47.934 1.00 27.68 ? 309  LEU A CD2 1 
ATOM   2478 N  N   . ASN A 1 310 ? 14.924  47.974 46.585 1.00 29.69 ? 310  ASN A N   1 
ATOM   2479 C  CA  A ASN A 1 310 ? 16.075  47.188 46.144 0.50 30.18 ? 310  ASN A CA  1 
ATOM   2480 C  CA  B ASN A 1 310 ? 16.067  47.177 46.136 0.50 29.94 ? 310  ASN A CA  1 
ATOM   2481 C  C   . ASN A 1 310 ? 16.050  46.916 44.634 1.00 30.34 ? 310  ASN A C   1 
ATOM   2482 O  O   . ASN A 1 310 ? 17.087  46.937 43.984 1.00 30.80 ? 310  ASN A O   1 
ATOM   2483 C  CB  A ASN A 1 310 ? 16.145  45.877 46.931 0.50 30.10 ? 310  ASN A CB  1 
ATOM   2484 C  CB  B ASN A 1 310 ? 16.122  45.851 46.898 0.50 29.74 ? 310  ASN A CB  1 
ATOM   2485 C  CG  A ASN A 1 310 ? 17.522  45.249 46.897 0.50 31.23 ? 310  ASN A CG  1 
ATOM   2486 C  CG  B ASN A 1 310 ? 16.771  45.992 48.249 0.50 29.57 ? 310  ASN A CG  1 
ATOM   2487 O  OD1 A ASN A 1 310 ? 18.528  45.909 47.173 0.50 30.79 ? 310  ASN A OD1 1 
ATOM   2488 O  OD1 B ASN A 1 310 ? 17.569  46.901 48.466 0.50 29.71 ? 310  ASN A OD1 1 
ATOM   2489 N  ND2 A ASN A 1 310 ? 17.577  43.961 46.563 0.50 31.91 ? 310  ASN A ND2 1 
ATOM   2490 N  ND2 B ASN A 1 310 ? 16.445  45.091 49.166 0.50 30.28 ? 310  ASN A ND2 1 
ATOM   2491 N  N   . SER A 1 311 ? 14.861  46.682 44.083 1.00 30.58 ? 311  SER A N   1 
ATOM   2492 C  CA  . SER A 1 311 ? 14.710  46.340 42.668 1.00 30.83 ? 311  SER A CA  1 
ATOM   2493 C  C   . SER A 1 311 ? 14.479  47.556 41.740 1.00 30.74 ? 311  SER A C   1 
ATOM   2494 O  O   . SER A 1 311 ? 14.342  47.391 40.529 1.00 31.13 ? 311  SER A O   1 
ATOM   2495 C  CB  . SER A 1 311 ? 13.555  45.349 42.516 1.00 31.01 ? 311  SER A CB  1 
ATOM   2496 O  OG  . SER A 1 311 ? 12.327  45.989 42.839 1.00 32.55 ? 311  SER A OG  1 
ATOM   2497 N  N   . GLY A 1 312 ? 14.430  48.764 42.300 1.00 29.75 ? 312  GLY A N   1 
ATOM   2498 C  CA  . GLY A 1 312 ? 14.135  49.958 41.512 1.00 28.99 ? 312  GLY A CA  1 
ATOM   2499 C  C   . GLY A 1 312 ? 12.676  50.020 41.070 1.00 28.54 ? 312  GLY A C   1 
ATOM   2500 O  O   . GLY A 1 312 ? 12.343  50.629 40.048 1.00 28.40 ? 312  GLY A O   1 
ATOM   2501 N  N   . ASN A 1 313 ? 11.801  49.378 41.830 1.00 27.13 ? 313  ASN A N   1 
ATOM   2502 C  CA  . ASN A 1 313 ? 10.386  49.442 41.527 1.00 26.63 ? 313  ASN A CA  1 
ATOM   2503 C  C   . ASN A 1 313 ? 9.770   50.727 42.100 1.00 25.98 ? 313  ASN A C   1 
ATOM   2504 O  O   . ASN A 1 313 ? 9.073   50.700 43.122 1.00 26.05 ? 313  ASN A O   1 
ATOM   2505 C  CB  . ASN A 1 313 ? 9.666   48.193 42.040 1.00 26.35 ? 313  ASN A CB  1 
ATOM   2506 C  CG  . ASN A 1 313 ? 8.250   48.075 41.501 1.00 27.55 ? 313  ASN A CG  1 
ATOM   2507 O  OD1 . ASN A 1 313 ? 7.791   48.920 40.722 1.00 27.59 ? 313  ASN A OD1 1 
ATOM   2508 N  ND2 . ASN A 1 313 ? 7.538   47.047 41.938 1.00 27.33 ? 313  ASN A ND2 1 
ATOM   2509 N  N   . PHE A 1 314 ? 10.043  51.844 41.429 1.00 25.33 ? 314  PHE A N   1 
ATOM   2510 C  CA  . PHE A 1 314 ? 9.547   53.155 41.821 1.00 24.59 ? 314  PHE A CA  1 
ATOM   2511 C  C   . PHE A 1 314 ? 9.726   54.154 40.683 1.00 24.72 ? 314  PHE A C   1 
ATOM   2512 O  O   . PHE A 1 314 ? 10.462  53.891 39.729 1.00 23.96 ? 314  PHE A O   1 
ATOM   2513 C  CB  . PHE A 1 314 ? 10.246  53.679 43.099 1.00 24.13 ? 314  PHE A CB  1 
ATOM   2514 C  CG  . PHE A 1 314 ? 11.770  53.568 43.103 1.00 21.98 ? 314  PHE A CG  1 
ATOM   2515 C  CD1 . PHE A 1 314 ? 12.561  54.508 42.459 1.00 21.59 ? 314  PHE A CD1 1 
ATOM   2516 C  CD2 . PHE A 1 314 ? 12.402  52.540 43.824 1.00 22.36 ? 314  PHE A CD2 1 
ATOM   2517 C  CE1 . PHE A 1 314 ? 13.958  54.423 42.497 1.00 21.55 ? 314  PHE A CE1 1 
ATOM   2518 C  CE2 . PHE A 1 314 ? 13.797  52.435 43.890 1.00 20.83 ? 314  PHE A CE2 1 
ATOM   2519 C  CZ  . PHE A 1 314 ? 14.588  53.380 43.227 1.00 22.49 ? 314  PHE A CZ  1 
ATOM   2520 N  N   . LYS A 1 315 ? 9.063   55.303 40.800 1.00 24.65 ? 315  LYS A N   1 
ATOM   2521 C  CA  . LYS A 1 315 ? 9.214   56.378 39.824 1.00 24.72 ? 315  LYS A CA  1 
ATOM   2522 C  C   . LYS A 1 315 ? 10.646  56.918 39.821 1.00 25.36 ? 315  LYS A C   1 
ATOM   2523 O  O   . LYS A 1 315 ? 11.189  57.277 40.872 1.00 25.05 ? 315  LYS A O   1 
ATOM   2524 C  CB  . LYS A 1 315 ? 8.235   57.509 40.125 1.00 24.60 ? 315  LYS A CB  1 
ATOM   2525 C  CG  . LYS A 1 315 ? 8.222   58.614 39.099 1.00 23.23 ? 315  LYS A CG  1 
ATOM   2526 C  CD  . LYS A 1 315 ? 7.320   59.762 39.554 1.00 23.00 ? 315  LYS A CD  1 
ATOM   2527 C  CE  . LYS A 1 315 ? 7.282   60.853 38.502 1.00 25.77 ? 315  LYS A CE  1 
ATOM   2528 N  NZ  . LYS A 1 315 ? 6.429   60.437 37.345 1.00 21.67 ? 315  LYS A NZ  1 
ATOM   2529 N  N   . LYS A 1 316 ? 11.249  56.975 38.637 1.00 24.87 ? 316  LYS A N   1 
ATOM   2530 C  CA  . LYS A 1 316 ? 12.594  57.489 38.495 1.00 25.61 ? 316  LYS A CA  1 
ATOM   2531 C  C   . LYS A 1 316 ? 12.529  58.929 38.022 1.00 25.85 ? 316  LYS A C   1 
ATOM   2532 O  O   . LYS A 1 316 ? 12.065  59.222 36.921 1.00 26.18 ? 316  LYS A O   1 
ATOM   2533 C  CB  . LYS A 1 316 ? 13.403  56.586 37.565 1.00 26.98 ? 316  LYS A CB  1 
ATOM   2534 C  CG  . LYS A 1 316 ? 13.512  55.191 38.185 1.00 29.57 ? 316  LYS A CG  1 
ATOM   2535 C  CD  . LYS A 1 316 ? 14.032  54.181 37.230 1.00 35.80 ? 316  LYS A CD  1 
ATOM   2536 C  CE  . LYS A 1 316 ? 14.084  52.826 37.913 1.00 36.58 ? 316  LYS A CE  1 
ATOM   2537 N  NZ  . LYS A 1 316 ? 12.715  52.344 38.151 1.00 37.17 ? 316  LYS A NZ  1 
ATOM   2538 N  N   . THR A 1 317 ? 12.916  59.839 38.904 1.00 24.82 ? 317  THR A N   1 
ATOM   2539 C  CA  . THR A 1 317 ? 12.838  61.257 38.607 1.00 24.58 ? 317  THR A CA  1 
ATOM   2540 C  C   . THR A 1 317 ? 13.859  61.947 39.507 1.00 24.15 ? 317  THR A C   1 
ATOM   2541 O  O   . THR A 1 317 ? 14.745  61.274 40.031 1.00 24.17 ? 317  THR A O   1 
ATOM   2542 C  CB  . THR A 1 317 ? 11.385  61.774 38.798 1.00 24.60 ? 317  THR A CB  1 
ATOM   2543 O  OG1 . THR A 1 317 ? 11.314  63.153 38.442 1.00 24.61 ? 317  THR A OG1 1 
ATOM   2544 C  CG2 . THR A 1 317 ? 10.882  61.555 40.268 1.00 22.70 ? 317  THR A CG2 1 
ATOM   2545 N  N   . GLN A 1 318 ? 13.756  63.266 39.676 1.00 24.03 ? 318  GLN A N   1 
ATOM   2546 C  CA  . GLN A 1 318 ? 14.641  63.979 40.596 1.00 23.27 ? 318  GLN A CA  1 
ATOM   2547 C  C   . GLN A 1 318 ? 13.933  64.115 41.942 1.00 23.38 ? 318  GLN A C   1 
ATOM   2548 O  O   . GLN A 1 318 ? 12.706  64.279 41.992 1.00 22.81 ? 318  GLN A O   1 
ATOM   2549 C  CB  . GLN A 1 318 ? 15.027  65.376 40.081 1.00 23.66 ? 318  GLN A CB  1 
ATOM   2550 C  CG  . GLN A 1 318 ? 15.536  65.428 38.635 1.00 24.61 ? 318  GLN A CG  1 
ATOM   2551 C  CD  . GLN A 1 318 ? 14.404  65.319 37.610 1.00 26.46 ? 318  GLN A CD  1 
ATOM   2552 O  OE1 . GLN A 1 318 ? 13.298  65.852 37.802 1.00 24.57 ? 318  GLN A OE1 1 
ATOM   2553 N  NE2 . GLN A 1 318 ? 14.677  64.611 36.517 1.00 26.68 ? 318  GLN A NE2 1 
ATOM   2554 N  N   . ILE A 1 319 ? 14.703  64.025 43.025 1.00 22.92 ? 319  ILE A N   1 
ATOM   2555 C  CA  . ILE A 1 319 ? 14.167  64.289 44.366 1.00 23.26 ? 319  ILE A CA  1 
ATOM   2556 C  C   . ILE A 1 319 ? 15.054  65.259 45.139 1.00 22.77 ? 319  ILE A C   1 
ATOM   2557 O  O   . ILE A 1 319 ? 16.272  65.291 44.944 1.00 22.70 ? 319  ILE A O   1 
ATOM   2558 C  CB  . ILE A 1 319 ? 13.975  62.996 45.194 1.00 23.20 ? 319  ILE A CB  1 
ATOM   2559 C  CG1 . ILE A 1 319 ? 15.306  62.259 45.395 1.00 23.40 ? 319  ILE A CG1 1 
ATOM   2560 C  CG2 . ILE A 1 319 ? 12.932  62.083 44.520 1.00 22.21 ? 319  ILE A CG2 1 
ATOM   2561 C  CD1 . ILE A 1 319 ? 15.253  61.107 46.443 1.00 22.20 ? 319  ILE A CD1 1 
ATOM   2562 N  N   . LEU A 1 320 ? 14.413  66.034 46.009 1.00 22.00 ? 320  LEU A N   1 
ATOM   2563 C  CA  . LEU A 1 320 ? 15.098  66.907 46.949 1.00 21.81 ? 320  LEU A CA  1 
ATOM   2564 C  C   . LEU A 1 320 ? 14.526  66.581 48.325 1.00 21.68 ? 320  LEU A C   1 
ATOM   2565 O  O   . LEU A 1 320 ? 13.294  66.518 48.503 1.00 21.24 ? 320  LEU A O   1 
ATOM   2566 C  CB  . LEU A 1 320 ? 14.859  68.375 46.592 1.00 21.79 ? 320  LEU A CB  1 
ATOM   2567 C  CG  . LEU A 1 320 ? 15.544  69.490 47.393 1.00 22.47 ? 320  LEU A CG  1 
ATOM   2568 C  CD1 . LEU A 1 320 ? 15.720  70.734 46.512 1.00 24.12 ? 320  LEU A CD1 1 
ATOM   2569 C  CD2 . LEU A 1 320 ? 14.732  69.872 48.647 1.00 23.11 ? 320  LEU A CD2 1 
ATOM   2570 N  N   . LEU A 1 321 ? 15.409  66.365 49.297 1.00 20.93 ? 321  LEU A N   1 
ATOM   2571 C  CA  . LEU A 1 321 ? 14.956  65.893 50.600 1.00 21.19 ? 321  LEU A CA  1 
ATOM   2572 C  C   . LEU A 1 321 ? 16.021  66.141 51.683 1.00 21.72 ? 321  LEU A C   1 
ATOM   2573 O  O   . LEU A 1 321 ? 17.159  66.540 51.387 1.00 21.10 ? 321  LEU A O   1 
ATOM   2574 C  CB  . LEU A 1 321 ? 14.566  64.402 50.514 1.00 20.23 ? 321  LEU A CB  1 
ATOM   2575 C  CG  . LEU A 1 321 ? 15.682  63.354 50.452 1.00 21.97 ? 321  LEU A CG  1 
ATOM   2576 C  CD1 . LEU A 1 321 ? 15.026  61.979 50.429 1.00 19.68 ? 321  LEU A CD1 1 
ATOM   2577 C  CD2 . LEU A 1 321 ? 16.666  63.533 49.243 1.00 22.08 ? 321  LEU A CD2 1 
ATOM   2578 N  N   . GLY A 1 322 ? 15.634  65.920 52.936 1.00 21.63 ? 322  GLY A N   1 
ATOM   2579 C  CA  . GLY A 1 322 ? 16.543  66.184 54.042 1.00 21.96 ? 322  GLY A CA  1 
ATOM   2580 C  C   . GLY A 1 322 ? 15.852  66.172 55.390 1.00 21.85 ? 322  GLY A C   1 
ATOM   2581 O  O   . GLY A 1 322 ? 14.675  65.801 55.512 1.00 20.92 ? 322  GLY A O   1 
ATOM   2582 N  N   . VAL A 1 323 ? 16.603  66.580 56.403 1.00 22.25 ? 323  VAL A N   1 
ATOM   2583 C  CA  . VAL A 1 323 ? 16.180  66.386 57.786 1.00 22.51 ? 323  VAL A CA  1 
ATOM   2584 C  C   . VAL A 1 323 ? 16.601  67.619 58.587 1.00 22.88 ? 323  VAL A C   1 
ATOM   2585 O  O   . VAL A 1 323 ? 17.388  68.439 58.093 1.00 23.16 ? 323  VAL A O   1 
ATOM   2586 C  CB  . VAL A 1 323 ? 16.820  65.110 58.409 1.00 21.83 ? 323  VAL A CB  1 
ATOM   2587 C  CG1 . VAL A 1 323 ? 16.453  63.833 57.619 1.00 20.45 ? 323  VAL A CG1 1 
ATOM   2588 C  CG2 . VAL A 1 323 ? 18.338  65.257 58.494 1.00 21.78 ? 323  VAL A CG2 1 
ATOM   2589 N  N   . ASN A 1 324 ? 16.064  67.737 59.807 1.00 23.55 ? 324  ASN A N   1 
ATOM   2590 C  CA  . ASN A 1 324 ? 16.427  68.786 60.780 1.00 23.41 ? 324  ASN A CA  1 
ATOM   2591 C  C   . ASN A 1 324 ? 17.418  68.232 61.813 1.00 23.82 ? 324  ASN A C   1 
ATOM   2592 O  O   . ASN A 1 324 ? 17.529  67.011 61.957 1.00 24.24 ? 324  ASN A O   1 
ATOM   2593 C  CB  . ASN A 1 324 ? 15.162  69.304 61.471 1.00 23.39 ? 324  ASN A CB  1 
ATOM   2594 C  CG  . ASN A 1 324 ? 14.238  70.043 60.509 1.00 24.73 ? 324  ASN A CG  1 
ATOM   2595 O  OD1 . ASN A 1 324 ? 14.545  70.165 59.307 1.00 23.45 ? 324  ASN A OD1 1 
ATOM   2596 N  ND2 . ASN A 1 324 ? 13.095  70.521 61.018 1.00 23.77 ? 324  ASN A ND2 1 
ATOM   2597 N  N   . LYS A 1 325 ? 18.130  69.108 62.529 1.00 24.21 ? 325  LYS A N   1 
ATOM   2598 C  CA  A LYS A 1 325 ? 19.164  68.662 63.478 0.40 24.14 ? 325  LYS A CA  1 
ATOM   2599 C  CA  B LYS A 1 325 ? 19.167  68.673 63.489 0.60 24.29 ? 325  LYS A CA  1 
ATOM   2600 C  C   . LYS A 1 325 ? 18.609  67.835 64.646 1.00 24.02 ? 325  LYS A C   1 
ATOM   2601 O  O   . LYS A 1 325 ? 19.201  66.814 65.024 1.00 23.15 ? 325  LYS A O   1 
ATOM   2602 C  CB  A LYS A 1 325 ? 20.001  69.848 63.988 0.40 24.43 ? 325  LYS A CB  1 
ATOM   2603 C  CB  B LYS A 1 325 ? 19.981  69.872 64.018 0.60 24.71 ? 325  LYS A CB  1 
ATOM   2604 C  CG  A LYS A 1 325 ? 21.225  69.458 64.831 0.40 24.80 ? 325  LYS A CG  1 
ATOM   2605 C  CG  B LYS A 1 325 ? 21.003  69.536 65.137 0.60 25.59 ? 325  LYS A CG  1 
ATOM   2606 C  CD  A LYS A 1 325 ? 22.123  70.670 65.091 0.40 25.97 ? 325  LYS A CD  1 
ATOM   2607 C  CD  B LYS A 1 325 ? 21.913  70.731 65.475 0.60 27.47 ? 325  LYS A CD  1 
ATOM   2608 C  CE  A LYS A 1 325 ? 23.203  70.363 66.131 0.40 25.72 ? 325  LYS A CE  1 
ATOM   2609 C  CE  B LYS A 1 325 ? 21.210  71.844 66.238 0.60 27.47 ? 325  LYS A CE  1 
ATOM   2610 N  NZ  A LYS A 1 325 ? 22.795  70.765 67.516 0.40 25.35 ? 325  LYS A NZ  1 
ATOM   2611 N  NZ  B LYS A 1 325 ? 20.907  71.559 67.689 0.60 28.57 ? 325  LYS A NZ  1 
ATOM   2612 N  N   . ASP A 1 326 ? 17.470  68.248 65.201 1.00 24.01 ? 326  ASP A N   1 
ATOM   2613 C  CA  . ASP A 1 326 ? 16.925  67.558 66.388 1.00 24.38 ? 326  ASP A CA  1 
ATOM   2614 C  C   . ASP A 1 326 ? 15.555  66.969 66.149 1.00 24.47 ? 326  ASP A C   1 
ATOM   2615 O  O   . ASP A 1 326 ? 14.543  67.489 66.618 1.00 25.14 ? 326  ASP A O   1 
ATOM   2616 C  CB  . ASP A 1 326 ? 16.893  68.523 67.569 1.00 24.72 ? 326  ASP A CB  1 
ATOM   2617 C  CG  . ASP A 1 326 ? 18.255  69.147 67.815 1.00 26.15 ? 326  ASP A CG  1 
ATOM   2618 O  OD1 . ASP A 1 326 ? 19.128  68.466 68.377 1.00 29.83 ? 326  ASP A OD1 1 
ATOM   2619 O  OD2 . ASP A 1 326 ? 18.468  70.283 67.376 1.00 24.64 ? 326  ASP A OD2 1 
ATOM   2620 N  N   . GLU A 1 327 ? 15.527  65.875 65.403 1.00 24.52 ? 327  GLU A N   1 
ATOM   2621 C  CA  . GLU A 1 327 ? 14.265  65.262 65.021 1.00 24.15 ? 327  GLU A CA  1 
ATOM   2622 C  C   . GLU A 1 327 ? 13.574  64.584 66.209 1.00 24.87 ? 327  GLU A C   1 
ATOM   2623 O  O   . GLU A 1 327 ? 12.353  64.454 66.195 1.00 25.76 ? 327  GLU A O   1 
ATOM   2624 C  CB  . GLU A 1 327 ? 14.472  64.252 63.873 1.00 24.24 ? 327  GLU A CB  1 
ATOM   2625 C  CG  . GLU A 1 327 ? 14.961  64.844 62.524 1.00 22.66 ? 327  GLU A CG  1 
ATOM   2626 C  CD  . GLU A 1 327 ? 13.877  65.561 61.726 1.00 25.39 ? 327  GLU A CD  1 
ATOM   2627 O  OE1 . GLU A 1 327 ? 12.751  65.709 62.220 1.00 28.49 ? 327  GLU A OE1 1 
ATOM   2628 O  OE2 . GLU A 1 327 ? 14.153  65.999 60.584 1.00 25.84 ? 327  GLU A OE2 1 
ATOM   2629 N  N   . GLY A 1 328 ? 14.334  64.172 67.231 1.00 23.95 ? 328  GLY A N   1 
ATOM   2630 C  CA  . GLY A 1 328 ? 13.766  63.412 68.351 1.00 23.80 ? 328  GLY A CA  1 
ATOM   2631 C  C   . GLY A 1 328 ? 13.046  64.173 69.461 1.00 23.95 ? 328  GLY A C   1 
ATOM   2632 O  O   . GLY A 1 328 ? 12.175  63.630 70.160 1.00 22.78 ? 328  GLY A O   1 
ATOM   2633 N  N   . SER A 1 329 ? 13.407  65.433 69.643 1.00 24.36 ? 329  SER A N   1 
ATOM   2634 C  CA  . SER A 1 329 ? 13.047  66.139 70.878 1.00 24.63 ? 329  SER A CA  1 
ATOM   2635 C  C   . SER A 1 329 ? 11.544  66.317 71.113 1.00 25.18 ? 329  SER A C   1 
ATOM   2636 O  O   . SER A 1 329 ? 11.086  66.212 72.265 1.00 23.60 ? 329  SER A O   1 
ATOM   2637 C  CB  . SER A 1 329 ? 13.800  67.465 70.967 1.00 25.09 ? 329  SER A CB  1 
ATOM   2638 O  OG  . SER A 1 329 ? 13.455  68.303 69.889 1.00 25.83 ? 329  SER A OG  1 
ATOM   2639 N  N   . PHE A 1 330 ? 10.768  66.538 70.040 1.00 25.17 ? 330  PHE A N   1 
ATOM   2640 C  CA  . PHE A 1 330 ? 9.314   66.698 70.161 1.00 25.63 ? 330  PHE A CA  1 
ATOM   2641 C  C   . PHE A 1 330 ? 8.667   65.509 70.878 1.00 25.44 ? 330  PHE A C   1 
ATOM   2642 O  O   . PHE A 1 330 ? 7.826   65.683 71.783 1.00 25.17 ? 330  PHE A O   1 
ATOM   2643 C  CB  . PHE A 1 330 ? 8.651   66.848 68.770 1.00 26.22 ? 330  PHE A CB  1 
ATOM   2644 C  CG  . PHE A 1 330 ? 7.682   68.007 68.655 1.00 28.89 ? 330  PHE A CG  1 
ATOM   2645 C  CD1 . PHE A 1 330 ? 6.903   68.410 69.730 1.00 31.61 ? 330  PHE A CD1 1 
ATOM   2646 C  CD2 . PHE A 1 330 ? 7.540   68.679 67.437 1.00 31.96 ? 330  PHE A CD2 1 
ATOM   2647 C  CE1 . PHE A 1 330 ? 6.016   69.471 69.617 1.00 32.94 ? 330  PHE A CE1 1 
ATOM   2648 C  CE2 . PHE A 1 330 ? 6.655   69.754 67.300 1.00 33.43 ? 330  PHE A CE2 1 
ATOM   2649 C  CZ  . PHE A 1 330 ? 5.887   70.151 68.400 1.00 36.59 ? 330  PHE A CZ  1 
ATOM   2650 N  N   . PHE A 1 331 ? 9.037   64.304 70.443 1.00 24.32 ? 331  PHE A N   1 
ATOM   2651 C  CA  . PHE A 1 331 ? 8.404   63.066 70.905 1.00 25.01 ? 331  PHE A CA  1 
ATOM   2652 C  C   . PHE A 1 331 ? 8.877   62.644 72.291 1.00 24.24 ? 331  PHE A C   1 
ATOM   2653 O  O   . PHE A 1 331 ? 8.108   62.075 73.062 1.00 23.23 ? 331  PHE A O   1 
ATOM   2654 C  CB  . PHE A 1 331 ? 8.601   61.950 69.860 1.00 25.12 ? 331  PHE A CB  1 
ATOM   2655 C  CG  . PHE A 1 331 ? 8.089   62.353 68.497 1.00 27.38 ? 331  PHE A CG  1 
ATOM   2656 C  CD1 . PHE A 1 331 ? 8.887   63.118 67.639 1.00 30.58 ? 331  PHE A CD1 1 
ATOM   2657 C  CD2 . PHE A 1 331 ? 6.783   62.088 68.135 1.00 28.50 ? 331  PHE A CD2 1 
ATOM   2658 C  CE1 . PHE A 1 331 ? 8.391   63.549 66.394 1.00 32.31 ? 331  PHE A CE1 1 
ATOM   2659 C  CE2 . PHE A 1 331 ? 6.278   62.510 66.883 1.00 30.28 ? 331  PHE A CE2 1 
ATOM   2660 C  CZ  . PHE A 1 331 ? 7.080   63.231 66.027 1.00 30.65 ? 331  PHE A CZ  1 
ATOM   2661 N  N   . LEU A 1 332 ? 10.140  62.923 72.586 1.00 23.45 ? 332  LEU A N   1 
ATOM   2662 C  CA  . LEU A 1 332 ? 10.663  62.741 73.941 1.00 23.34 ? 332  LEU A CA  1 
ATOM   2663 C  C   . LEU A 1 332 ? 9.935   63.662 74.939 1.00 23.56 ? 332  LEU A C   1 
ATOM   2664 O  O   . LEU A 1 332 ? 9.492   63.209 75.995 1.00 23.11 ? 332  LEU A O   1 
ATOM   2665 C  CB  . LEU A 1 332 ? 12.161  63.003 73.962 1.00 22.63 ? 332  LEU A CB  1 
ATOM   2666 C  CG  . LEU A 1 332 ? 12.985  61.923 73.265 1.00 22.40 ? 332  LEU A CG  1 
ATOM   2667 C  CD1 . LEU A 1 332 ? 14.352  62.514 72.922 1.00 21.74 ? 332  LEU A CD1 1 
ATOM   2668 C  CD2 . LEU A 1 332 ? 13.132  60.653 74.127 1.00 21.11 ? 332  LEU A CD2 1 
ATOM   2669 N  N   . LEU A 1 333 ? 9.795   64.938 74.583 1.00 23.71 ? 333  LEU A N   1 
ATOM   2670 C  CA  . LEU A 1 333 ? 9.078   65.892 75.427 1.00 24.90 ? 333  LEU A CA  1 
ATOM   2671 C  C   . LEU A 1 333 ? 7.695   65.371 75.796 1.00 25.82 ? 333  LEU A C   1 
ATOM   2672 O  O   . LEU A 1 333 ? 7.286   65.428 76.969 1.00 25.58 ? 333  LEU A O   1 
ATOM   2673 C  CB  . LEU A 1 333 ? 8.948   67.264 74.758 1.00 24.74 ? 333  LEU A CB  1 
ATOM   2674 C  CG  . LEU A 1 333 ? 7.954   68.226 75.448 1.00 25.47 ? 333  LEU A CG  1 
ATOM   2675 C  CD1 . LEU A 1 333 ? 8.377   68.560 76.910 1.00 23.90 ? 333  LEU A CD1 1 
ATOM   2676 C  CD2 . LEU A 1 333 ? 7.765   69.519 74.652 1.00 26.14 ? 333  LEU A CD2 1 
ATOM   2677 N  N   . TYR A 1 334 ? 6.976   64.864 74.795 1.00 26.04 ? 334  TYR A N   1 
ATOM   2678 C  CA  . TYR A 1 334 ? 5.604   64.438 75.004 1.00 26.56 ? 334  TYR A CA  1 
ATOM   2679 C  C   . TYR A 1 334 ? 5.518   63.070 75.643 1.00 26.74 ? 334  TYR A C   1 
ATOM   2680 O  O   . TYR A 1 334 ? 4.566   62.800 76.376 1.00 27.93 ? 334  TYR A O   1 
ATOM   2681 C  CB  . TYR A 1 334 ? 4.825   64.430 73.689 1.00 26.43 ? 334  TYR A CB  1 
ATOM   2682 C  CG  . TYR A 1 334 ? 4.238   65.776 73.320 1.00 26.59 ? 334  TYR A CG  1 
ATOM   2683 C  CD1 . TYR A 1 334 ? 5.061   66.848 72.958 1.00 25.93 ? 334  TYR A CD1 1 
ATOM   2684 C  CD2 . TYR A 1 334 ? 2.863   65.976 73.323 1.00 25.30 ? 334  TYR A CD2 1 
ATOM   2685 C  CE1 . TYR A 1 334 ? 4.516   68.087 72.609 1.00 25.81 ? 334  TYR A CE1 1 
ATOM   2686 C  CE2 . TYR A 1 334 ? 2.312   67.207 72.972 1.00 25.73 ? 334  TYR A CE2 1 
ATOM   2687 C  CZ  . TYR A 1 334 ? 3.155   68.258 72.616 1.00 25.13 ? 334  TYR A CZ  1 
ATOM   2688 O  OH  . TYR A 1 334 ? 2.614   69.480 72.286 1.00 24.69 ? 334  TYR A OH  1 
ATOM   2689 N  N   . GLY A 1 335 ? 6.503   62.212 75.399 1.00 25.83 ? 335  GLY A N   1 
ATOM   2690 C  CA  . GLY A 1 335 ? 6.299   60.794 75.705 1.00 25.22 ? 335  GLY A CA  1 
ATOM   2691 C  C   . GLY A 1 335 ? 7.247   60.079 76.648 1.00 25.01 ? 335  GLY A C   1 
ATOM   2692 O  O   . GLY A 1 335 ? 6.971   58.940 77.023 1.00 25.18 ? 335  GLY A O   1 
ATOM   2693 N  N   . ALA A 1 336 ? 8.350   60.721 77.033 1.00 24.33 ? 336  ALA A N   1 
ATOM   2694 C  CA  . ALA A 1 336 ? 9.402   60.058 77.802 1.00 24.57 ? 336  ALA A CA  1 
ATOM   2695 C  C   . ALA A 1 336 ? 9.595   60.707 79.186 1.00 25.11 ? 336  ALA A C   1 
ATOM   2696 O  O   . ALA A 1 336 ? 9.594   61.930 79.296 1.00 24.03 ? 336  ALA A O   1 
ATOM   2697 C  CB  . ALA A 1 336 ? 10.723  60.089 77.030 1.00 23.36 ? 336  ALA A CB  1 
ATOM   2698 N  N   . PRO A 1 337 ? 9.784   59.885 80.239 1.00 26.40 ? 337  PRO A N   1 
ATOM   2699 C  CA  . PRO A 1 337 ? 10.014  60.464 81.580 1.00 26.98 ? 337  PRO A CA  1 
ATOM   2700 C  C   . PRO A 1 337 ? 11.306  61.283 81.641 1.00 27.06 ? 337  PRO A C   1 
ATOM   2701 O  O   . PRO A 1 337 ? 12.309  60.928 80.992 1.00 27.15 ? 337  PRO A O   1 
ATOM   2702 C  CB  . PRO A 1 337 ? 10.113  59.222 82.488 1.00 27.88 ? 337  PRO A CB  1 
ATOM   2703 C  CG  . PRO A 1 337 ? 10.670  58.143 81.573 1.00 27.97 ? 337  PRO A CG  1 
ATOM   2704 C  CD  . PRO A 1 337 ? 9.929   58.411 80.245 1.00 26.61 ? 337  PRO A CD  1 
ATOM   2705 N  N   . GLY A 1 338 ? 11.272  62.385 82.396 1.00 26.49 ? 338  GLY A N   1 
ATOM   2706 C  CA  . GLY A 1 338 ? 12.449  63.231 82.581 1.00 25.66 ? 338  GLY A CA  1 
ATOM   2707 C  C   . GLY A 1 338 ? 12.451  64.459 81.698 1.00 25.80 ? 338  GLY A C   1 
ATOM   2708 O  O   . GLY A 1 338 ? 13.183  65.437 81.958 1.00 24.54 ? 338  GLY A O   1 
ATOM   2709 N  N   . PHE A 1 339 ? 11.613  64.430 80.655 1.00 24.85 ? 339  PHE A N   1 
ATOM   2710 C  CA  . PHE A 1 339 ? 11.551  65.543 79.717 1.00 25.31 ? 339  PHE A CA  1 
ATOM   2711 C  C   . PHE A 1 339 ? 10.357  66.422 80.037 1.00 25.10 ? 339  PHE A C   1 
ATOM   2712 O  O   . PHE A 1 339 ? 9.228   65.928 80.158 1.00 25.92 ? 339  PHE A O   1 
ATOM   2713 C  CB  . PHE A 1 339 ? 11.461  65.033 78.261 1.00 24.39 ? 339  PHE A CB  1 
ATOM   2714 C  CG  . PHE A 1 339 ? 12.692  64.295 77.782 1.00 23.94 ? 339  PHE A CG  1 
ATOM   2715 C  CD1 . PHE A 1 339 ? 12.852  62.929 78.042 1.00 22.26 ? 339  PHE A CD1 1 
ATOM   2716 C  CD2 . PHE A 1 339 ? 13.672  64.957 77.049 1.00 22.10 ? 339  PHE A CD2 1 
ATOM   2717 C  CE1 . PHE A 1 339 ? 13.976  62.233 77.581 1.00 21.69 ? 339  PHE A CE1 1 
ATOM   2718 C  CE2 . PHE A 1 339 ? 14.803  64.272 76.579 1.00 23.42 ? 339  PHE A CE2 1 
ATOM   2719 C  CZ  . PHE A 1 339 ? 14.954  62.902 76.846 1.00 21.58 ? 339  PHE A CZ  1 
ATOM   2720 N  N   . SER A 1 340 ? 10.577  67.724 80.176 1.00 25.58 ? 340  SER A N   1 
ATOM   2721 C  CA  . SER A 1 340 ? 9.435   68.629 80.363 1.00 26.18 ? 340  SER A CA  1 
ATOM   2722 C  C   . SER A 1 340 ? 9.658   69.959 79.664 1.00 25.93 ? 340  SER A C   1 
ATOM   2723 O  O   . SER A 1 340 ? 10.795  70.319 79.381 1.00 25.87 ? 340  SER A O   1 
ATOM   2724 C  CB  . SER A 1 340 ? 9.130   68.826 81.860 1.00 27.01 ? 340  SER A CB  1 
ATOM   2725 O  OG  . SER A 1 340 ? 10.333  68.942 82.590 1.00 30.32 ? 340  SER A OG  1 
ATOM   2726 N  N   . LYS A 1 341 ? 8.574   70.683 79.389 1.00 25.48 ? 341  LYS A N   1 
ATOM   2727 C  CA  . LYS A 1 341 ? 8.664   71.906 78.590 1.00 26.23 ? 341  LYS A CA  1 
ATOM   2728 C  C   . LYS A 1 341 ? 9.469   73.016 79.265 1.00 26.47 ? 341  LYS A C   1 
ATOM   2729 O  O   . LYS A 1 341 ? 10.162  73.783 78.591 1.00 25.77 ? 341  LYS A O   1 
ATOM   2730 C  CB  . LYS A 1 341 ? 7.278   72.446 78.232 1.00 26.24 ? 341  LYS A CB  1 
ATOM   2731 C  CG  . LYS A 1 341 ? 7.323   73.466 77.064 1.00 25.69 ? 341  LYS A CG  1 
ATOM   2732 C  CD  . LYS A 1 341 ? 5.944   73.926 76.629 1.00 26.70 ? 341  LYS A CD  1 
ATOM   2733 C  CE  . LYS A 1 341 ? 5.238   74.769 77.703 1.00 29.02 ? 341  LYS A CE  1 
ATOM   2734 N  NZ  . LYS A 1 341 ? 6.024   76.007 78.023 1.00 33.11 ? 341  LYS A NZ  1 
ATOM   2735 N  N   . ASP A 1 342 ? 9.361   73.097 80.590 1.00 26.47 ? 342  ASP A N   1 
ATOM   2736 C  CA  . ASP A 1 342 ? 9.895   74.247 81.328 1.00 26.89 ? 342  ASP A CA  1 
ATOM   2737 C  C   . ASP A 1 342 ? 11.178  73.981 82.116 1.00 27.30 ? 342  ASP A C   1 
ATOM   2738 O  O   . ASP A 1 342 ? 11.554  74.768 82.981 1.00 27.20 ? 342  ASP A O   1 
ATOM   2739 C  CB  . ASP A 1 342 ? 8.811   74.841 82.243 1.00 25.86 ? 342  ASP A CB  1 
ATOM   2740 C  CG  . ASP A 1 342 ? 7.580   75.300 81.477 1.00 26.65 ? 342  ASP A CG  1 
ATOM   2741 O  OD1 . ASP A 1 342 ? 7.672   75.487 80.242 1.00 26.43 ? 342  ASP A OD1 1 
ATOM   2742 O  OD2 . ASP A 1 342 ? 6.508   75.483 82.111 1.00 24.09 ? 342  ASP A OD2 1 
ATOM   2743 N  N   . SER A 1 343 ? 11.855  72.878 81.833 1.00 28.20 ? 343  SER A N   1 
ATOM   2744 C  CA  . SER A 1 343 ? 13.168  72.665 82.428 1.00 29.48 ? 343  SER A CA  1 
ATOM   2745 C  C   . SER A 1 343 ? 14.163  72.264 81.356 1.00 29.93 ? 343  SER A C   1 
ATOM   2746 O  O   . SER A 1 343 ? 13.762  71.890 80.240 1.00 30.17 ? 343  SER A O   1 
ATOM   2747 C  CB  . SER A 1 343 ? 13.105  71.592 83.512 1.00 29.84 ? 343  SER A CB  1 
ATOM   2748 O  OG  . SER A 1 343 ? 13.332  70.318 82.966 1.00 31.66 ? 343  SER A OG  1 
ATOM   2749 N  N   . GLU A 1 344 ? 15.449  72.314 81.700 1.00 29.38 ? 344  GLU A N   1 
ATOM   2750 C  CA  . GLU A 1 344 ? 16.513  71.914 80.786 1.00 29.50 ? 344  GLU A CA  1 
ATOM   2751 C  C   . GLU A 1 344 ? 16.480  70.419 80.471 1.00 28.67 ? 344  GLU A C   1 
ATOM   2752 O  O   . GLU A 1 344 ? 17.211  69.956 79.592 1.00 27.41 ? 344  GLU A O   1 
ATOM   2753 C  CB  . GLU A 1 344 ? 17.889  72.283 81.356 1.00 29.89 ? 344  GLU A CB  1 
ATOM   2754 C  CG  . GLU A 1 344 ? 18.239  73.767 81.242 1.00 33.17 ? 344  GLU A CG  1 
ATOM   2755 C  CD  . GLU A 1 344 ? 19.597  74.097 81.844 0.60 34.65 ? 344  GLU A CD  1 
ATOM   2756 O  OE1 . GLU A 1 344 ? 20.393  73.166 82.097 0.60 34.49 ? 344  GLU A OE1 1 
ATOM   2757 O  OE2 . GLU A 1 344 ? 19.859  75.293 82.067 0.60 37.19 ? 344  GLU A OE2 1 
ATOM   2758 N  N   . SER A 1 345 ? 15.649  69.678 81.205 1.00 28.24 ? 345  SER A N   1 
ATOM   2759 C  CA  . SER A 1 345 ? 15.447  68.239 80.986 1.00 28.47 ? 345  SER A CA  1 
ATOM   2760 C  C   . SER A 1 345 ? 16.744  67.442 80.957 1.00 28.83 ? 345  SER A C   1 
ATOM   2761 O  O   . SER A 1 345 ? 16.949  66.604 80.078 1.00 28.03 ? 345  SER A O   1 
ATOM   2762 C  CB  . SER A 1 345 ? 14.648  67.974 79.698 1.00 28.18 ? 345  SER A CB  1 
ATOM   2763 O  OG  . SER A 1 345 ? 13.361  68.538 79.788 1.00 28.17 ? 345  SER A OG  1 
ATOM   2764 N  N   . LYS A 1 346 ? 17.618  67.683 81.930 1.00 29.46 ? 346  LYS A N   1 
ATOM   2765 C  CA  . LYS A 1 346 ? 18.804  66.842 82.084 1.00 30.50 ? 346  LYS A CA  1 
ATOM   2766 C  C   . LYS A 1 346 ? 18.349  65.450 82.474 1.00 30.59 ? 346  LYS A C   1 
ATOM   2767 O  O   . LYS A 1 346 ? 17.457  65.287 83.312 1.00 30.97 ? 346  LYS A O   1 
ATOM   2768 C  CB  . LYS A 1 346 ? 19.757  67.418 83.134 1.00 31.03 ? 346  LYS A CB  1 
ATOM   2769 C  CG  . LYS A 1 346 ? 20.402  68.725 82.708 1.00 32.57 ? 346  LYS A CG  1 
ATOM   2770 C  CD  . LYS A 1 346 ? 21.423  69.189 83.742 1.00 37.44 ? 346  LYS A CD  1 
ATOM   2771 C  CE  . LYS A 1 346 ? 21.691  70.682 83.587 1.00 40.30 ? 346  LYS A CE  1 
ATOM   2772 N  NZ  . LYS A 1 346 ? 22.313  71.280 84.824 1.00 44.36 ? 346  LYS A NZ  1 
ATOM   2773 N  N   . ILE A 1 347 ? 18.944  64.445 81.849 1.00 30.97 ? 347  ILE A N   1 
ATOM   2774 C  CA  . ILE A 1 347 ? 18.418  63.093 81.925 1.00 31.50 ? 347  ILE A CA  1 
ATOM   2775 C  C   . ILE A 1 347 ? 19.334  62.146 82.744 1.00 32.49 ? 347  ILE A C   1 
ATOM   2776 O  O   . ILE A 1 347 ? 20.514  61.946 82.425 1.00 32.71 ? 347  ILE A O   1 
ATOM   2777 C  CB  . ILE A 1 347 ? 18.130  62.538 80.480 1.00 31.32 ? 347  ILE A CB  1 
ATOM   2778 C  CG1 . ILE A 1 347 ? 17.017  63.349 79.793 1.00 29.89 ? 347  ILE A CG1 1 
ATOM   2779 C  CG2 . ILE A 1 347 ? 17.789  61.056 80.496 1.00 31.27 ? 347  ILE A CG2 1 
ATOM   2780 C  CD1 . ILE A 1 347 ? 15.703  63.385 80.532 1.00 28.66 ? 347  ILE A CD1 1 
ATOM   2781 N  N   . SER A 1 348 ? 18.763  61.568 83.792 1.00 34.03 ? 348  SER A N   1 
ATOM   2782 C  CA  . SER A 1 348 ? 19.465  60.584 84.609 1.00 35.44 ? 348  SER A CA  1 
ATOM   2783 C  C   . SER A 1 348 ? 19.694  59.309 83.806 1.00 36.34 ? 348  SER A C   1 
ATOM   2784 O  O   . SER A 1 348 ? 18.997  59.047 82.807 1.00 35.62 ? 348  SER A O   1 
ATOM   2785 C  CB  . SER A 1 348 ? 18.634  60.248 85.838 1.00 35.19 ? 348  SER A CB  1 
ATOM   2786 O  OG  . SER A 1 348 ? 17.520  59.458 85.481 1.00 36.05 ? 348  SER A OG  1 
ATOM   2787 N  N   . ARG A 1 349 ? 20.653  58.512 84.266 1.00 36.65 ? 349  ARG A N   1 
ATOM   2788 C  CA  . ARG A 1 349 ? 20.971  57.236 83.655 1.00 37.55 ? 349  ARG A CA  1 
ATOM   2789 C  C   . ARG A 1 349 ? 19.729  56.352 83.585 1.00 37.21 ? 349  ARG A C   1 
ATOM   2790 O  O   . ARG A 1 349 ? 19.528  55.627 82.614 1.00 37.38 ? 349  ARG A O   1 
ATOM   2791 C  CB  . ARG A 1 349 ? 22.062  56.531 84.475 1.00 38.40 ? 349  ARG A CB  1 
ATOM   2792 C  CG  . ARG A 1 349 ? 22.713  55.359 83.782 1.00 40.21 ? 349  ARG A CG  1 
ATOM   2793 C  CD  . ARG A 1 349 ? 23.615  55.876 82.688 1.00 45.18 ? 349  ARG A CD  1 
ATOM   2794 N  NE  . ARG A 1 349 ? 23.613  54.985 81.548 1.00 45.97 ? 349  ARG A NE  1 
ATOM   2795 C  CZ  . ARG A 1 349 ? 23.780  55.376 80.289 1.00 45.81 ? 349  ARG A CZ  1 
ATOM   2796 N  NH1 . ARG A 1 349 ? 23.973  56.660 79.994 1.00 44.38 ? 349  ARG A NH1 1 
ATOM   2797 N  NH2 . ARG A 1 349 ? 23.757  54.463 79.330 1.00 44.00 ? 349  ARG A NH2 1 
ATOM   2798 N  N   . GLU A 1 350 ? 18.913  56.435 84.629 1.00 36.73 ? 350  GLU A N   1 
ATOM   2799 C  CA  A GLU A 1 350 ? 17.697  55.638 84.748 0.60 36.96 ? 350  GLU A CA  1 
ATOM   2800 C  CA  B GLU A 1 350 ? 17.693  55.649 84.758 0.40 36.80 ? 350  GLU A CA  1 
ATOM   2801 C  C   . GLU A 1 350 ? 16.620  56.076 83.748 1.00 36.70 ? 350  GLU A C   1 
ATOM   2802 O  O   . GLU A 1 350 ? 15.912  55.240 83.176 1.00 36.63 ? 350  GLU A O   1 
ATOM   2803 C  CB  A GLU A 1 350 ? 17.142  55.719 86.176 0.60 37.10 ? 350  GLU A CB  1 
ATOM   2804 C  CB  B GLU A 1 350 ? 17.176  55.789 86.191 0.40 36.89 ? 350  GLU A CB  1 
ATOM   2805 C  CG  A GLU A 1 350 ? 17.968  54.990 87.254 0.60 37.94 ? 350  GLU A CG  1 
ATOM   2806 C  CG  B GLU A 1 350 ? 15.720  55.447 86.419 0.40 37.05 ? 350  GLU A CG  1 
ATOM   2807 C  CD  A GLU A 1 350 ? 19.374  55.539 87.421 0.60 38.31 ? 350  GLU A CD  1 
ATOM   2808 C  CD  B GLU A 1 350 ? 15.150  56.219 87.590 0.40 37.58 ? 350  GLU A CD  1 
ATOM   2809 O  OE1 A GLU A 1 350 ? 19.550  56.784 87.438 0.60 38.07 ? 350  GLU A OE1 1 
ATOM   2810 O  OE1 B GLU A 1 350 ? 14.740  55.590 88.585 0.40 38.00 ? 350  GLU A OE1 1 
ATOM   2811 O  OE2 A GLU A 1 350 ? 20.311  54.716 87.530 0.60 39.26 ? 350  GLU A OE2 1 
ATOM   2812 O  OE2 B GLU A 1 350 ? 15.134  57.464 87.523 0.40 38.28 ? 350  GLU A OE2 1 
ATOM   2813 N  N   . ASP A 1 351 ? 16.489  57.381 83.545 1.00 35.95 ? 351  ASP A N   1 
ATOM   2814 C  CA  . ASP A 1 351 ? 15.513  57.884 82.592 1.00 35.26 ? 351  ASP A CA  1 
ATOM   2815 C  C   . ASP A 1 351 ? 16.021  57.662 81.167 1.00 34.23 ? 351  ASP A C   1 
ATOM   2816 O  O   . ASP A 1 351 ? 15.230  57.506 80.245 1.00 34.20 ? 351  ASP A O   1 
ATOM   2817 C  CB  . ASP A 1 351 ? 15.157  59.348 82.872 1.00 35.65 ? 351  ASP A CB  1 
ATOM   2818 C  CG  . ASP A 1 351 ? 14.095  59.502 83.966 1.00 36.38 ? 351  ASP A CG  1 
ATOM   2819 O  OD1 . ASP A 1 351 ? 13.457  58.499 84.370 1.00 38.69 ? 351  ASP A OD1 1 
ATOM   2820 O  OD2 . ASP A 1 351 ? 13.875  60.646 84.418 1.00 38.09 ? 351  ASP A OD2 1 
ATOM   2821 N  N   . PHE A 1 352 ? 17.339  57.607 81.001 1.00 33.10 ? 352  PHE A N   1 
ATOM   2822 C  CA  . PHE A 1 352 ? 17.929  57.234 79.731 1.00 32.59 ? 352  PHE A CA  1 
ATOM   2823 C  C   . PHE A 1 352 ? 17.467  55.832 79.331 1.00 32.67 ? 352  PHE A C   1 
ATOM   2824 O  O   . PHE A 1 352 ? 16.992  55.633 78.211 1.00 32.22 ? 352  PHE A O   1 
ATOM   2825 C  CB  . PHE A 1 352 ? 19.454  57.298 79.788 1.00 31.96 ? 352  PHE A CB  1 
ATOM   2826 C  CG  . PHE A 1 352 ? 20.119  57.093 78.461 1.00 31.35 ? 352  PHE A CG  1 
ATOM   2827 C  CD1 . PHE A 1 352 ? 20.200  58.136 77.541 1.00 27.73 ? 352  PHE A CD1 1 
ATOM   2828 C  CD2 . PHE A 1 352 ? 20.678  55.857 78.132 1.00 30.28 ? 352  PHE A CD2 1 
ATOM   2829 C  CE1 . PHE A 1 352 ? 20.828  57.955 76.317 1.00 29.28 ? 352  PHE A CE1 1 
ATOM   2830 C  CE2 . PHE A 1 352 ? 21.290  55.666 76.909 1.00 30.24 ? 352  PHE A CE2 1 
ATOM   2831 C  CZ  . PHE A 1 352 ? 21.371  56.713 75.995 1.00 29.63 ? 352  PHE A CZ  1 
ATOM   2832 N  N   . MET A 1 353 ? 17.585  54.881 80.262 1.00 32.37 ? 353  MET A N   1 
ATOM   2833 C  CA  A MET A 1 353 ? 17.201  53.487 80.021 0.50 32.12 ? 353  MET A CA  1 
ATOM   2834 C  CA  B MET A 1 353 ? 17.206  53.495 80.000 0.50 32.32 ? 353  MET A CA  1 
ATOM   2835 C  C   . MET A 1 353 ? 15.719  53.363 79.688 1.00 31.70 ? 353  MET A C   1 
ATOM   2836 O  O   . MET A 1 353 ? 15.343  52.654 78.763 1.00 31.75 ? 353  MET A O   1 
ATOM   2837 C  CB  A MET A 1 353 ? 17.559  52.603 81.227 0.50 32.25 ? 353  MET A CB  1 
ATOM   2838 C  CB  B MET A 1 353 ? 17.603  52.601 81.176 0.50 32.62 ? 353  MET A CB  1 
ATOM   2839 C  CG  A MET A 1 353 ? 19.050  52.597 81.563 0.50 32.59 ? 353  MET A CG  1 
ATOM   2840 C  CG  B MET A 1 353 ? 19.056  52.785 81.590 0.50 33.88 ? 353  MET A CG  1 
ATOM   2841 S  SD  A MET A 1 353 ? 19.578  51.361 82.777 0.50 35.63 ? 353  MET A SD  1 
ATOM   2842 S  SD  B MET A 1 353 ? 20.246  52.179 80.374 0.50 38.79 ? 353  MET A SD  1 
ATOM   2843 C  CE  A MET A 1 353 ? 18.640  51.863 84.213 0.50 31.62 ? 353  MET A CE  1 
ATOM   2844 C  CE  B MET A 1 353 ? 20.446  50.512 81.002 0.50 36.98 ? 353  MET A CE  1 
ATOM   2845 N  N   . SER A 1 354 ? 14.880  54.052 80.453 1.00 30.92 ? 354  SER A N   1 
ATOM   2846 C  CA  . SER A 1 354 ? 13.448  54.090 80.168 1.00 30.58 ? 354  SER A CA  1 
ATOM   2847 C  C   . SER A 1 354 ? 13.175  54.644 78.761 1.00 29.36 ? 354  SER A C   1 
ATOM   2848 O  O   . SER A 1 354 ? 12.347  54.104 78.027 1.00 28.96 ? 354  SER A O   1 
ATOM   2849 C  CB  . SER A 1 354 ? 12.726  54.959 81.197 1.00 30.90 ? 354  SER A CB  1 
ATOM   2850 O  OG  . SER A 1 354 ? 12.782  54.351 82.474 1.00 35.58 ? 354  SER A OG  1 
ATOM   2851 N  N   . GLY A 1 355 ? 13.874  55.725 78.423 1.00 28.28 ? 355  GLY A N   1 
ATOM   2852 C  CA  . GLY A 1 355 ? 13.814  56.364 77.103 1.00 27.36 ? 355  GLY A CA  1 
ATOM   2853 C  C   . GLY A 1 355 ? 14.233  55.442 75.967 1.00 26.78 ? 355  GLY A C   1 
ATOM   2854 O  O   . GLY A 1 355 ? 13.547  55.358 74.928 1.00 26.17 ? 355  GLY A O   1 
ATOM   2855 N  N   . VAL A 1 356 ? 15.337  54.726 76.159 1.00 25.32 ? 356  VAL A N   1 
ATOM   2856 C  CA  . VAL A 1 356 ? 15.794  53.802 75.131 1.00 24.87 ? 356  VAL A CA  1 
ATOM   2857 C  C   . VAL A 1 356 ? 14.711  52.762 74.854 1.00 24.29 ? 356  VAL A C   1 
ATOM   2858 O  O   . VAL A 1 356 ? 14.410  52.457 73.695 1.00 23.85 ? 356  VAL A O   1 
ATOM   2859 C  CB  . VAL A 1 356 ? 17.126  53.109 75.501 1.00 25.02 ? 356  VAL A CB  1 
ATOM   2860 C  CG1 . VAL A 1 356 ? 17.425  51.977 74.524 1.00 25.26 ? 356  VAL A CG1 1 
ATOM   2861 C  CG2 . VAL A 1 356 ? 18.255  54.119 75.482 1.00 25.47 ? 356  VAL A CG2 1 
ATOM   2862 N  N   . LYS A 1 357 ? 14.124  52.227 75.917 1.00 24.49 ? 357  LYS A N   1 
ATOM   2863 C  CA  . LYS A 1 357 ? 13.087  51.210 75.773 1.00 25.13 ? 357  LYS A CA  1 
ATOM   2864 C  C   . LYS A 1 357 ? 11.848  51.737 75.039 1.00 24.27 ? 357  LYS A C   1 
ATOM   2865 O  O   . LYS A 1 357 ? 11.275  51.036 74.206 1.00 24.37 ? 357  LYS A O   1 
ATOM   2866 C  CB  . LYS A 1 357 ? 12.693  50.601 77.130 1.00 25.51 ? 357  LYS A CB  1 
ATOM   2867 C  CG  . LYS A 1 357 ? 12.177  49.188 76.954 1.00 31.22 ? 357  LYS A CG  1 
ATOM   2868 C  CD  . LYS A 1 357 ? 11.238  48.715 78.057 1.00 37.45 ? 357  LYS A CD  1 
ATOM   2869 C  CE  . LYS A 1 357 ? 10.890  47.244 77.844 1.00 39.54 ? 357  LYS A CE  1 
ATOM   2870 N  NZ  . LYS A 1 357 ? 10.808  46.871 76.390 1.00 41.01 ? 357  LYS A NZ  1 
ATOM   2871 N  N   . LEU A 1 358 ? 11.435  52.965 75.347 1.00 23.68 ? 358  LEU A N   1 
ATOM   2872 C  CA  . LEU A 1 358 ? 10.291  53.575 74.668 1.00 23.06 ? 358  LEU A CA  1 
ATOM   2873 C  C   . LEU A 1 358 ? 10.598  53.865 73.191 1.00 23.13 ? 358  LEU A C   1 
ATOM   2874 O  O   . LEU A 1 358 ? 9.715   53.766 72.342 1.00 23.01 ? 358  LEU A O   1 
ATOM   2875 C  CB  . LEU A 1 358 ? 9.886   54.882 75.362 1.00 23.74 ? 358  LEU A CB  1 
ATOM   2876 C  CG  . LEU A 1 358 ? 9.250   54.773 76.754 1.00 23.32 ? 358  LEU A CG  1 
ATOM   2877 C  CD1 . LEU A 1 358 ? 9.195   56.136 77.382 1.00 23.19 ? 358  LEU A CD1 1 
ATOM   2878 C  CD2 . LEU A 1 358 ? 7.854   54.139 76.664 1.00 22.63 ? 358  LEU A CD2 1 
ATOM   2879 N  N   . SER A 1 359 ? 11.854  54.219 72.901 1.00 23.33 ? 359  SER A N   1 
ATOM   2880 C  CA  . SER A 1 359 ? 12.275  54.616 71.557 1.00 23.74 ? 359  SER A CA  1 
ATOM   2881 C  C   . SER A 1 359 ? 12.424  53.462 70.571 1.00 24.22 ? 359  SER A C   1 
ATOM   2882 O  O   . SER A 1 359 ? 12.281  53.660 69.363 1.00 24.68 ? 359  SER A O   1 
ATOM   2883 C  CB  . SER A 1 359 ? 13.588  55.382 71.626 1.00 23.32 ? 359  SER A CB  1 
ATOM   2884 O  OG  . SER A 1 359 ? 13.434  56.496 72.479 1.00 23.57 ? 359  SER A OG  1 
ATOM   2885 N  N   . VAL A 1 360 ? 12.730  52.268 71.077 1.00 24.37 ? 360  VAL A N   1 
ATOM   2886 C  CA  . VAL A 1 360 ? 12.937  51.106 70.220 1.00 24.42 ? 360  VAL A CA  1 
ATOM   2887 C  C   . VAL A 1 360 ? 12.055  49.975 70.744 1.00 25.07 ? 360  VAL A C   1 
ATOM   2888 O  O   . VAL A 1 360 ? 12.562  48.954 71.222 1.00 25.36 ? 360  VAL A O   1 
ATOM   2889 C  CB  . VAL A 1 360 ? 14.432  50.704 70.156 1.00 24.42 ? 360  VAL A CB  1 
ATOM   2890 C  CG1 . VAL A 1 360 ? 14.694  49.844 68.951 1.00 24.32 ? 360  VAL A CG1 1 
ATOM   2891 C  CG2 . VAL A 1 360 ? 15.347  51.971 70.112 1.00 24.66 ? 360  VAL A CG2 1 
ATOM   2892 N  N   . PRO A 1 361 ? 10.721  50.161 70.658 1.00 25.85 ? 361  PRO A N   1 
ATOM   2893 C  CA  . PRO A 1 361 ? 9.787   49.298 71.377 1.00 26.48 ? 361  PRO A CA  1 
ATOM   2894 C  C   . PRO A 1 361 ? 9.769   47.885 70.831 1.00 27.36 ? 361  PRO A C   1 
ATOM   2895 O  O   . PRO A 1 361 ? 9.410   46.965 71.547 1.00 28.17 ? 361  PRO A O   1 
ATOM   2896 C  CB  . PRO A 1 361 ? 8.438   49.992 71.157 1.00 26.49 ? 361  PRO A CB  1 
ATOM   2897 C  CG  . PRO A 1 361 ? 8.596   50.706 69.842 1.00 26.82 ? 361  PRO A CG  1 
ATOM   2898 C  CD  . PRO A 1 361 ? 10.013  51.217 69.902 1.00 25.37 ? 361  PRO A CD  1 
ATOM   2899 N  N   . HIS A 1 362 ? 10.202  47.715 69.587 1.00 28.00 ? 362  HIS A N   1 
ATOM   2900 C  CA  . HIS A 1 362 ? 10.247  46.409 68.959 1.00 28.72 ? 362  HIS A CA  1 
ATOM   2901 C  C   . HIS A 1 362 ? 11.518  45.621 69.282 1.00 29.36 ? 362  HIS A C   1 
ATOM   2902 O  O   . HIS A 1 362 ? 11.635  44.467 68.879 1.00 29.71 ? 362  HIS A O   1 
ATOM   2903 C  CB  . HIS A 1 362 ? 10.118  46.565 67.440 1.00 28.85 ? 362  HIS A CB  1 
ATOM   2904 C  CG  . HIS A 1 362 ? 11.189  47.419 66.837 1.00 28.06 ? 362  HIS A CG  1 
ATOM   2905 N  ND1 . HIS A 1 362 ? 11.258  48.783 67.044 1.00 26.34 ? 362  HIS A ND1 1 
ATOM   2906 C  CD2 . HIS A 1 362 ? 12.234  47.103 66.033 1.00 26.50 ? 362  HIS A CD2 1 
ATOM   2907 C  CE1 . HIS A 1 362 ? 12.295  49.270 66.385 1.00 28.51 ? 362  HIS A CE1 1 
ATOM   2908 N  NE2 . HIS A 1 362 ? 12.910  48.270 65.770 1.00 27.26 ? 362  HIS A NE2 1 
ATOM   2909 N  N   . ALA A 1 363 ? 12.465  46.219 69.999 1.00 29.24 ? 363  ALA A N   1 
ATOM   2910 C  CA  . ALA A 1 363 ? 13.743  45.530 70.268 1.00 29.64 ? 363  ALA A CA  1 
ATOM   2911 C  C   . ALA A 1 363 ? 13.643  44.581 71.450 1.00 29.64 ? 363  ALA A C   1 
ATOM   2912 O  O   . ALA A 1 363 ? 12.944  44.873 72.421 1.00 30.74 ? 363  ALA A O   1 
ATOM   2913 C  CB  . ALA A 1 363 ? 14.872  46.542 70.512 1.00 28.57 ? 363  ALA A CB  1 
ATOM   2914 N  N   . ASN A 1 364 ? 14.362  43.464 71.380 1.00 29.40 ? 364  ASN A N   1 
ATOM   2915 C  CA  . ASN A 1 364 ? 14.553  42.599 72.547 1.00 29.23 ? 364  ASN A CA  1 
ATOM   2916 C  C   . ASN A 1 364 ? 15.650  43.204 73.443 1.00 28.98 ? 364  ASN A C   1 
ATOM   2917 O  O   . ASN A 1 364 ? 16.221  44.245 73.104 1.00 28.04 ? 364  ASN A O   1 
ATOM   2918 C  CB  . ASN A 1 364 ? 14.889  41.152 72.115 1.00 29.25 ? 364  ASN A CB  1 
ATOM   2919 C  CG  . ASN A 1 364 ? 16.149  41.062 71.256 1.00 30.01 ? 364  ASN A CG  1 
ATOM   2920 O  OD1 . ASN A 1 364 ? 16.896  42.032 71.118 1.00 28.86 ? 364  ASN A OD1 1 
ATOM   2921 N  ND2 . ASN A 1 364 ? 16.391  39.881 70.675 1.00 30.33 ? 364  ASN A ND2 1 
ATOM   2922 N  N   . ASP A 1 365 ? 15.959  42.540 74.556 1.00 28.25 ? 365  ASP A N   1 
ATOM   2923 C  CA  . ASP A 1 365 ? 16.928  43.065 75.512 1.00 28.44 ? 365  ASP A CA  1 
ATOM   2924 C  C   . ASP A 1 365 ? 18.329  43.232 74.932 1.00 27.41 ? 365  ASP A C   1 
ATOM   2925 O  O   . ASP A 1 365 ? 18.985  44.223 75.215 1.00 27.62 ? 365  ASP A O   1 
ATOM   2926 C  CB  . ASP A 1 365 ? 16.959  42.221 76.795 1.00 29.01 ? 365  ASP A CB  1 
ATOM   2927 C  CG  . ASP A 1 365 ? 15.764  42.487 77.694 0.50 30.06 ? 365  ASP A CG  1 
ATOM   2928 O  OD1 . ASP A 1 365 ? 14.785  43.136 77.246 0.50 31.10 ? 365  ASP A OD1 1 
ATOM   2929 O  OD2 . ASP A 1 365 ? 15.807  42.053 78.860 0.50 31.95 ? 365  ASP A OD2 1 
ATOM   2930 N  N   . LEU A 1 366 ? 18.779  42.283 74.114 1.00 26.63 ? 366  LEU A N   1 
ATOM   2931 C  CA  . LEU A 1 366 ? 20.071  42.433 73.434 1.00 26.49 ? 366  LEU A CA  1 
ATOM   2932 C  C   . LEU A 1 366 ? 20.083  43.678 72.541 1.00 25.84 ? 366  LEU A C   1 
ATOM   2933 O  O   . LEU A 1 366 ? 21.055  44.411 72.520 1.00 26.13 ? 366  LEU A O   1 
ATOM   2934 C  CB  . LEU A 1 366 ? 20.419  41.187 72.617 1.00 26.35 ? 366  LEU A CB  1 
ATOM   2935 C  CG  . LEU A 1 366 ? 21.790  41.161 71.918 1.00 26.82 ? 366  LEU A CG  1 
ATOM   2936 C  CD1 . LEU A 1 366 ? 22.933  41.123 72.928 1.00 27.28 ? 366  LEU A CD1 1 
ATOM   2937 C  CD2 . LEU A 1 366 ? 21.908  39.999 70.922 1.00 26.52 ? 366  LEU A CD2 1 
ATOM   2938 N  N   . GLY A 1 367 ? 18.998  43.908 71.803 1.00 25.69 ? 367  GLY A N   1 
ATOM   2939 C  CA  . GLY A 1 367 ? 18.913  45.064 70.915 1.00 24.89 ? 367  GLY A CA  1 
ATOM   2940 C  C   . GLY A 1 367 ? 18.996  46.340 71.720 1.00 24.64 ? 367  GLY A C   1 
ATOM   2941 O  O   . GLY A 1 367 ? 19.696  47.282 71.329 1.00 23.86 ? 367  GLY A O   1 
ATOM   2942 N  N   . LEU A 1 368 ? 18.288  46.370 72.853 1.00 24.90 ? 368  LEU A N   1 
ATOM   2943 C  CA  . LEU A 1 368 ? 18.345  47.532 73.748 1.00 25.62 ? 368  LEU A CA  1 
ATOM   2944 C  C   . LEU A 1 368 ? 19.765  47.767 74.257 1.00 25.35 ? 368  LEU A C   1 
ATOM   2945 O  O   . LEU A 1 368 ? 20.222  48.902 74.298 1.00 25.45 ? 368  LEU A O   1 
ATOM   2946 C  CB  . LEU A 1 368 ? 17.363  47.391 74.916 1.00 25.84 ? 368  LEU A CB  1 
ATOM   2947 C  CG  . LEU A 1 368 ? 15.877  47.349 74.535 1.00 27.38 ? 368  LEU A CG  1 
ATOM   2948 C  CD1 . LEU A 1 368 ? 15.003  47.011 75.744 1.00 28.23 ? 368  LEU A CD1 1 
ATOM   2949 C  CD2 . LEU A 1 368 ? 15.404  48.646 73.857 1.00 26.36 ? 368  LEU A CD2 1 
ATOM   2950 N  N   . ASP A 1 369 ? 20.466  46.693 74.629 1.00 25.17 ? 369  ASP A N   1 
ATOM   2951 C  CA  . ASP A 1 369 ? 21.880  46.812 75.018 1.00 25.24 ? 369  ASP A CA  1 
ATOM   2952 C  C   . ASP A 1 369 ? 22.725  47.392 73.892 1.00 24.06 ? 369  ASP A C   1 
ATOM   2953 O  O   . ASP A 1 369 ? 23.609  48.195 74.145 1.00 23.91 ? 369  ASP A O   1 
ATOM   2954 C  CB  . ASP A 1 369 ? 22.472  45.451 75.394 1.00 25.27 ? 369  ASP A CB  1 
ATOM   2955 C  CG  . ASP A 1 369 ? 21.947  44.926 76.711 1.00 27.99 ? 369  ASP A CG  1 
ATOM   2956 O  OD1 . ASP A 1 369 ? 21.207  45.628 77.428 1.00 28.29 ? 369  ASP A OD1 1 
ATOM   2957 O  OD2 . ASP A 1 369 ? 22.289  43.786 77.024 1.00 33.50 ? 369  ASP A OD2 1 
ATOM   2958 N  N   . ALA A 1 370 ? 22.461  46.955 72.660 1.00 22.86 ? 370  ALA A N   1 
ATOM   2959 C  CA  . ALA A 1 370 ? 23.200  47.461 71.493 1.00 22.53 ? 370  ALA A CA  1 
ATOM   2960 C  C   . ALA A 1 370 ? 23.011  48.976 71.321 1.00 22.16 ? 370  ALA A C   1 
ATOM   2961 O  O   . ALA A 1 370 ? 23.971  49.720 71.108 1.00 21.93 ? 370  ALA A O   1 
ATOM   2962 C  CB  . ALA A 1 370 ? 22.773  46.717 70.218 1.00 22.13 ? 370  ALA A CB  1 
ATOM   2963 N  N   . VAL A 1 371 ? 21.767  49.423 71.418 1.00 22.37 ? 371  VAL A N   1 
ATOM   2964 C  CA  . VAL A 1 371 ? 21.451  50.840 71.282 1.00 22.25 ? 371  VAL A CA  1 
ATOM   2965 C  C   . VAL A 1 371 ? 22.137  51.645 72.389 1.00 22.29 ? 371  VAL A C   1 
ATOM   2966 O  O   . VAL A 1 371 ? 22.791  52.671 72.135 1.00 21.82 ? 371  VAL A O   1 
ATOM   2967 C  CB  . VAL A 1 371 ? 19.917  51.088 71.349 1.00 21.98 ? 371  VAL A CB  1 
ATOM   2968 C  CG1 . VAL A 1 371 ? 19.648  52.581 71.365 1.00 22.67 ? 371  VAL A CG1 1 
ATOM   2969 C  CG2 . VAL A 1 371 ? 19.170  50.393 70.163 1.00 21.47 ? 371  VAL A CG2 1 
ATOM   2970 N  N   . THR A 1 372 ? 21.972  51.182 73.620 1.00 22.84 ? 372  THR A N   1 
ATOM   2971 C  CA  . THR A 1 372 ? 22.580  51.846 74.777 1.00 24.37 ? 372  THR A CA  1 
ATOM   2972 C  C   . THR A 1 372 ? 24.090  51.999 74.615 1.00 24.86 ? 372  THR A C   1 
ATOM   2973 O  O   . THR A 1 372 ? 24.635  53.089 74.823 1.00 25.23 ? 372  THR A O   1 
ATOM   2974 C  CB  . THR A 1 372 ? 22.223  51.092 76.073 1.00 24.83 ? 372  THR A CB  1 
ATOM   2975 O  OG1 . THR A 1 372 ? 20.799  51.111 76.223 1.00 26.28 ? 372  THR A OG1 1 
ATOM   2976 C  CG2 . THR A 1 372 ? 22.864  51.757 77.299 1.00 25.68 ? 372  THR A CG2 1 
ATOM   2977 N  N   . LEU A 1 373 ? 24.759  50.920 74.203 1.00 25.61 ? 373  LEU A N   1 
ATOM   2978 C  CA  . LEU A 1 373 ? 26.205  50.952 74.004 1.00 25.81 ? 373  LEU A CA  1 
ATOM   2979 C  C   . LEU A 1 373 ? 26.602  51.936 72.909 1.00 26.09 ? 373  LEU A C   1 
ATOM   2980 O  O   . LEU A 1 373 ? 27.610  52.644 73.020 1.00 25.70 ? 373  LEU A O   1 
ATOM   2981 C  CB  . LEU A 1 373 ? 26.724  49.554 73.633 1.00 26.25 ? 373  LEU A CB  1 
ATOM   2982 C  CG  . LEU A 1 373 ? 28.229  49.487 73.356 1.00 27.34 ? 373  LEU A CG  1 
ATOM   2983 C  CD1 . LEU A 1 373 ? 28.995  49.923 74.601 1.00 27.86 ? 373  LEU A CD1 1 
ATOM   2984 C  CD2 . LEU A 1 373 ? 28.662  48.103 72.912 1.00 28.64 ? 373  LEU A CD2 1 
ATOM   2985 N  N   . GLN A 1 374 ? 25.815  51.956 71.837 1.00 25.90 ? 374  GLN A N   1 
ATOM   2986 C  CA  . GLN A 1 374 ? 26.091  52.811 70.691 1.00 26.55 ? 374  GLN A CA  1 
ATOM   2987 C  C   . GLN A 1 374 ? 25.969  54.292 71.049 1.00 25.88 ? 374  GLN A C   1 
ATOM   2988 O  O   . GLN A 1 374 ? 26.678  55.120 70.497 1.00 26.05 ? 374  GLN A O   1 
ATOM   2989 C  CB  . GLN A 1 374 ? 25.132  52.438 69.555 1.00 26.58 ? 374  GLN A CB  1 
ATOM   2990 C  CG  . GLN A 1 374 ? 25.485  52.983 68.207 1.00 30.47 ? 374  GLN A CG  1 
ATOM   2991 C  CD  . GLN A 1 374 ? 26.702  52.304 67.565 1.00 32.82 ? 374  GLN A CD  1 
ATOM   2992 O  OE1 . GLN A 1 374 ? 27.164  51.238 68.002 1.00 32.53 ? 374  GLN A OE1 1 
ATOM   2993 N  NE2 . GLN A 1 374 ? 27.231  52.939 66.530 1.00 34.81 ? 374  GLN A NE2 1 
ATOM   2994 N  N   . TYR A 1 375 ? 25.075  54.622 71.978 1.00 26.12 ? 375  TYR A N   1 
ATOM   2995 C  CA  . TYR A 1 375 ? 24.805  56.026 72.311 1.00 26.32 ? 375  TYR A CA  1 
ATOM   2996 C  C   . TYR A 1 375 ? 25.269  56.503 73.706 1.00 27.00 ? 375  TYR A C   1 
ATOM   2997 O  O   . TYR A 1 375 ? 24.961  57.627 74.108 1.00 28.07 ? 375  TYR A O   1 
ATOM   2998 C  CB  . TYR A 1 375 ? 23.309  56.311 72.130 1.00 25.97 ? 375  TYR A CB  1 
ATOM   2999 C  CG  . TYR A 1 375 ? 22.913  56.414 70.666 1.00 25.28 ? 375  TYR A CG  1 
ATOM   3000 C  CD1 . TYR A 1 375 ? 22.543  55.273 69.933 1.00 24.22 ? 375  TYR A CD1 1 
ATOM   3001 C  CD2 . TYR A 1 375 ? 22.925  57.648 70.013 1.00 24.65 ? 375  TYR A CD2 1 
ATOM   3002 C  CE1 . TYR A 1 375 ? 22.176  55.368 68.573 1.00 23.25 ? 375  TYR A CE1 1 
ATOM   3003 C  CE2 . TYR A 1 375 ? 22.564  57.758 68.659 1.00 24.54 ? 375  TYR A CE2 1 
ATOM   3004 C  CZ  . TYR A 1 375 ? 22.182  56.618 67.951 1.00 24.23 ? 375  TYR A CZ  1 
ATOM   3005 O  OH  . TYR A 1 375 ? 21.842  56.748 66.612 1.00 23.95 ? 375  TYR A OH  1 
ATOM   3006 N  N   . THR A 1 376 ? 25.984  55.661 74.445 1.00 26.73 ? 376  THR A N   1 
ATOM   3007 C  CA  . THR A 1 376 ? 26.489  56.069 75.761 1.00 26.26 ? 376  THR A CA  1 
ATOM   3008 C  C   . THR A 1 376 ? 27.965  56.420 75.687 1.00 26.68 ? 376  THR A C   1 
ATOM   3009 O  O   . THR A 1 376 ? 28.768  55.648 75.166 1.00 26.21 ? 376  THR A O   1 
ATOM   3010 C  CB  . THR A 1 376 ? 26.295  54.962 76.828 1.00 26.13 ? 376  THR A CB  1 
ATOM   3011 O  OG1 . THR A 1 376 ? 24.921  54.588 76.887 1.00 25.26 ? 376  THR A OG1 1 
ATOM   3012 C  CG2 . THR A 1 376 ? 26.742  55.448 78.241 1.00 26.52 ? 376  THR A CG2 1 
ATOM   3013 N  N   . ASP A 1 377 ? 28.315  57.592 76.209 1.00 27.41 ? 377  ASP A N   1 
ATOM   3014 C  CA  . ASP A 1 377 ? 29.715  57.941 76.447 1.00 28.17 ? 377  ASP A CA  1 
ATOM   3015 C  C   . ASP A 1 377 ? 30.133  57.346 77.796 1.00 28.23 ? 377  ASP A C   1 
ATOM   3016 O  O   . ASP A 1 377 ? 29.839  57.915 78.860 1.00 27.62 ? 377  ASP A O   1 
ATOM   3017 C  CB  . ASP A 1 377 ? 29.882  59.462 76.496 1.00 28.62 ? 377  ASP A CB  1 
ATOM   3018 C  CG  . ASP A 1 377 ? 31.337  59.887 76.703 1.00 30.46 ? 377  ASP A CG  1 
ATOM   3019 O  OD1 . ASP A 1 377 ? 32.233  59.011 76.850 1.00 29.81 ? 377  ASP A OD1 1 
ATOM   3020 O  OD2 . ASP A 1 377 ? 31.572  61.109 76.716 1.00 31.65 ? 377  ASP A OD2 1 
ATOM   3021 N  N   . TRP A 1 378 ? 30.811  56.206 77.753 1.00 28.61 ? 378  TRP A N   1 
ATOM   3022 C  CA  . TRP A 1 378 ? 31.175  55.508 78.977 1.00 29.70 ? 378  TRP A CA  1 
ATOM   3023 C  C   . TRP A 1 378 ? 32.304  56.170 79.762 1.00 30.54 ? 378  TRP A C   1 
ATOM   3024 O  O   . TRP A 1 378 ? 32.631  55.736 80.867 1.00 30.50 ? 378  TRP A O   1 
ATOM   3025 C  CB  . TRP A 1 378 ? 31.447  54.016 78.708 1.00 29.63 ? 378  TRP A CB  1 
ATOM   3026 C  CG  . TRP A 1 378 ? 30.142  53.244 78.628 1.00 31.05 ? 378  TRP A CG  1 
ATOM   3027 C  CD1 . TRP A 1 378 ? 29.627  52.605 77.537 1.00 30.09 ? 378  TRP A CD1 1 
ATOM   3028 C  CD2 . TRP A 1 378 ? 29.183  53.078 79.681 1.00 33.24 ? 378  TRP A CD2 1 
ATOM   3029 N  NE1 . TRP A 1 378 ? 28.422  52.036 77.849 1.00 30.55 ? 378  TRP A NE1 1 
ATOM   3030 C  CE2 . TRP A 1 378 ? 28.122  52.312 79.159 1.00 33.43 ? 378  TRP A CE2 1 
ATOM   3031 C  CE3 . TRP A 1 378 ? 29.123  53.502 81.024 1.00 36.55 ? 378  TRP A CE3 1 
ATOM   3032 C  CZ2 . TRP A 1 378 ? 26.997  51.954 79.927 1.00 36.34 ? 378  TRP A CZ2 1 
ATOM   3033 C  CZ3 . TRP A 1 378 ? 28.000  53.148 81.797 1.00 38.44 ? 378  TRP A CZ3 1 
ATOM   3034 C  CH2 . TRP A 1 378 ? 26.954  52.381 81.239 1.00 37.92 ? 378  TRP A CH2 1 
ATOM   3035 N  N   . MET A 1 379 ? 32.879  57.231 79.206 1.00 31.62 ? 379  MET A N   1 
ATOM   3036 C  CA  . MET A 1 379 ? 33.842  58.046 79.955 1.00 33.69 ? 379  MET A CA  1 
ATOM   3037 C  C   . MET A 1 379 ? 33.134  59.077 80.820 1.00 34.29 ? 379  MET A C   1 
ATOM   3038 O  O   . MET A 1 379 ? 33.785  59.753 81.614 1.00 35.37 ? 379  MET A O   1 
ATOM   3039 C  CB  . MET A 1 379 ? 34.782  58.801 79.020 1.00 33.66 ? 379  MET A CB  1 
ATOM   3040 C  CG  . MET A 1 379 ? 35.734  57.948 78.203 1.00 36.23 ? 379  MET A CG  1 
ATOM   3041 S  SD  . MET A 1 379 ? 36.846  58.973 77.192 1.00 41.99 ? 379  MET A SD  1 
ATOM   3042 C  CE  . MET A 1 379 ? 35.754  59.582 75.908 1.00 40.63 ? 379  MET A CE  1 
ATOM   3043 N  N   . ASP A 1 380 ? 31.817  59.214 80.646 1.00 34.44 ? 380  ASP A N   1 
ATOM   3044 C  CA  . ASP A 1 380 ? 31.047  60.307 81.250 1.00 35.13 ? 380  ASP A CA  1 
ATOM   3045 C  C   . ASP A 1 380 ? 29.536  59.990 81.225 1.00 35.60 ? 380  ASP A C   1 
ATOM   3046 O  O   . ASP A 1 380 ? 28.724  60.774 80.726 1.00 35.75 ? 380  ASP A O   1 
ATOM   3047 C  CB  . ASP A 1 380 ? 31.363  61.620 80.508 1.00 34.93 ? 380  ASP A CB  1 
ATOM   3048 C  CG  . ASP A 1 380 ? 30.773  62.858 81.191 1.00 34.52 ? 380  ASP A CG  1 
ATOM   3049 O  OD1 . ASP A 1 380 ? 30.427  62.795 82.381 1.00 33.92 ? 380  ASP A OD1 1 
ATOM   3050 O  OD2 . ASP A 1 380 ? 30.636  63.895 80.516 1.00 34.58 ? 380  ASP A OD2 1 
ATOM   3051 N  N   . ASP A 1 381 ? 29.168  58.845 81.789 1.00 36.55 ? 381  ASP A N   1 
ATOM   3052 C  CA  . ASP A 1 381 ? 27.828  58.267 81.590 1.00 37.87 ? 381  ASP A CA  1 
ATOM   3053 C  C   . ASP A 1 381 ? 26.711  58.898 82.426 1.00 38.37 ? 381  ASP A C   1 
ATOM   3054 O  O   . ASP A 1 381 ? 25.531  58.629 82.186 1.00 38.43 ? 381  ASP A O   1 
ATOM   3055 C  CB  . ASP A 1 381 ? 27.863  56.765 81.853 1.00 37.70 ? 381  ASP A CB  1 
ATOM   3056 C  CG  . ASP A 1 381 ? 28.491  56.431 83.204 1.00 39.85 ? 381  ASP A CG  1 
ATOM   3057 O  OD1 . ASP A 1 381 ? 29.701  56.705 83.388 1.00 40.48 ? 381  ASP A OD1 1 
ATOM   3058 O  OD2 . ASP A 1 381 ? 27.767  55.915 84.078 1.00 40.79 ? 381  ASP A OD2 1 
ATOM   3059 N  N   . ASN A 1 382 ? 27.084  59.716 83.409 1.00 38.75 ? 382  ASN A N   1 
ATOM   3060 C  CA  . ASN A 1 382 ? 26.110  60.369 84.283 1.00 39.25 ? 382  ASN A CA  1 
ATOM   3061 C  C   . ASN A 1 382 ? 25.851  61.818 83.912 1.00 38.61 ? 382  ASN A C   1 
ATOM   3062 O  O   . ASN A 1 382 ? 25.260  62.577 84.681 1.00 39.57 ? 382  ASN A O   1 
ATOM   3063 C  CB  . ASN A 1 382 ? 26.558  60.268 85.749 1.00 40.04 ? 382  ASN A CB  1 
ATOM   3064 C  CG  . ASN A 1 382 ? 26.288  58.901 86.332 1.00 42.38 ? 382  ASN A CG  1 
ATOM   3065 O  OD1 . ASN A 1 382 ? 25.191  58.357 86.180 1.00 45.21 ? 382  ASN A OD1 1 
ATOM   3066 N  ND2 . ASN A 1 382 ? 27.296  58.319 86.984 1.00 45.98 ? 382  ASN A ND2 1 
ATOM   3067 N  N   . ASN A 1 383 ? 26.323  62.205 82.741 1.00 37.33 ? 383  ASN A N   1 
ATOM   3068 C  CA  . ASN A 1 383 ? 26.153  63.544 82.257 1.00 35.92 ? 383  ASN A CA  1 
ATOM   3069 C  C   . ASN A 1 383 ? 24.712  63.677 81.743 1.00 35.77 ? 383  ASN A C   1 
ATOM   3070 O  O   . ASN A 1 383 ? 24.315  62.989 80.796 1.00 35.55 ? 383  ASN A O   1 
ATOM   3071 C  CB  . ASN A 1 383 ? 27.183  63.786 81.157 1.00 35.85 ? 383  ASN A CB  1 
ATOM   3072 C  CG  . ASN A 1 383 ? 27.162  65.195 80.629 1.00 35.31 ? 383  ASN A CG  1 
ATOM   3073 O  OD1 . ASN A 1 383 ? 26.109  65.831 80.539 1.00 33.26 ? 383  ASN A OD1 1 
ATOM   3074 N  ND2 . ASN A 1 383 ? 28.332  65.685 80.242 1.00 34.55 ? 383  ASN A ND2 1 
ATOM   3075 N  N   . GLY A 1 384 ? 23.938  64.548 82.393 1.00 34.46 ? 384  GLY A N   1 
ATOM   3076 C  CA  . GLY A 1 384 ? 22.520  64.715 82.108 1.00 33.52 ? 384  GLY A CA  1 
ATOM   3077 C  C   . GLY A 1 384 ? 22.232  65.325 80.748 1.00 32.68 ? 384  GLY A C   1 
ATOM   3078 O  O   . GLY A 1 384 ? 21.228  64.983 80.121 1.00 32.01 ? 384  GLY A O   1 
ATOM   3079 N  N   . ILE A 1 385 ? 23.114  66.222 80.309 1.00 32.12 ? 385  ILE A N   1 
ATOM   3080 C  CA  . ILE A 1 385 ? 23.043  66.848 78.992 1.00 32.28 ? 385  ILE A CA  1 
ATOM   3081 C  C   . ILE A 1 385 ? 23.329  65.813 77.906 1.00 31.80 ? 385  ILE A C   1 
ATOM   3082 O  O   . ILE A 1 385 ? 22.587  65.716 76.928 1.00 31.14 ? 385  ILE A O   1 
ATOM   3083 C  CB  . ILE A 1 385 ? 24.031  68.038 78.858 1.00 32.29 ? 385  ILE A CB  1 
ATOM   3084 C  CG1 . ILE A 1 385 ? 23.786  69.093 79.942 1.00 34.22 ? 385  ILE A CG1 1 
ATOM   3085 C  CG2 . ILE A 1 385 ? 23.990  68.666 77.459 1.00 32.96 ? 385  ILE A CG2 1 
ATOM   3086 C  CD1 . ILE A 1 385 ? 22.412  69.670 79.947 1.00 37.98 ? 385  ILE A CD1 1 
ATOM   3087 N  N   . LYS A 1 386 ? 24.407  65.049 78.085 1.00 31.15 ? 386  LYS A N   1 
ATOM   3088 C  CA  . LYS A 1 386 ? 24.774  63.986 77.151 1.00 30.78 ? 386  LYS A CA  1 
ATOM   3089 C  C   . LYS A 1 386 ? 23.685  62.923 77.038 1.00 29.88 ? 386  LYS A C   1 
ATOM   3090 O  O   . LYS A 1 386 ? 23.392  62.448 75.942 1.00 29.58 ? 386  LYS A O   1 
ATOM   3091 C  CB  . LYS A 1 386 ? 26.112  63.334 77.526 1.00 30.61 ? 386  LYS A CB  1 
ATOM   3092 C  CG  . LYS A 1 386 ? 27.316  64.195 77.171 1.00 32.98 ? 386  LYS A CG  1 
ATOM   3093 C  CD  . LYS A 1 386 ? 28.634  63.432 77.278 1.00 34.50 ? 386  LYS A CD  1 
ATOM   3094 C  CE  . LYS A 1 386 ? 29.812  64.394 77.140 1.00 37.47 ? 386  LYS A CE  1 
ATOM   3095 N  NZ  . LYS A 1 386 ? 31.151  63.717 77.276 1.00 36.54 ? 386  LYS A NZ  1 
ATOM   3096 N  N   . ASN A 1 387 ? 23.091  62.559 78.164 1.00 28.99 ? 387  ASN A N   1 
ATOM   3097 C  CA  . ASN A 1 387 ? 21.991  61.603 78.151 1.00 29.18 ? 387  ASN A CA  1 
ATOM   3098 C  C   . ASN A 1 387 ? 20.751  62.154 77.415 1.00 28.25 ? 387  ASN A C   1 
ATOM   3099 O  O   . ASN A 1 387 ? 20.119  61.439 76.641 1.00 27.55 ? 387  ASN A O   1 
ATOM   3100 C  CB  . ASN A 1 387 ? 21.644  61.166 79.566 1.00 29.30 ? 387  ASN A CB  1 
ATOM   3101 C  CG  . ASN A 1 387 ? 22.704  60.239 80.175 1.00 31.82 ? 387  ASN A CG  1 
ATOM   3102 O  OD1 . ASN A 1 387 ? 23.581  59.716 79.477 1.00 32.63 ? 387  ASN A OD1 1 
ATOM   3103 N  ND2 . ASN A 1 387 ? 22.618  60.034 81.482 1.00 33.10 ? 387  ASN A ND2 1 
ATOM   3104 N  N   . ARG A 1 388 ? 20.433  63.422 77.661 1.00 27.05 ? 388  ARG A N   1 
ATOM   3105 C  CA  . ARG A 1 388 ? 19.310  64.085 77.004 1.00 26.82 ? 388  ARG A CA  1 
ATOM   3106 C  C   . ARG A 1 388 ? 19.560  64.157 75.492 1.00 26.46 ? 388  ARG A C   1 
ATOM   3107 O  O   . ARG A 1 388 ? 18.712  63.744 74.708 1.00 25.91 ? 388  ARG A O   1 
ATOM   3108 C  CB  . ARG A 1 388 ? 19.089  65.490 77.577 1.00 26.61 ? 388  ARG A CB  1 
ATOM   3109 C  CG  . ARG A 1 388 ? 17.895  66.250 76.985 1.00 26.08 ? 388  ARG A CG  1 
ATOM   3110 C  CD  . ARG A 1 388 ? 18.009  67.712 77.314 1.00 25.93 ? 388  ARG A CD  1 
ATOM   3111 N  NE  . ARG A 1 388 ? 19.112  68.292 76.556 1.00 24.97 ? 388  ARG A NE  1 
ATOM   3112 C  CZ  . ARG A 1 388 ? 19.795  69.373 76.916 1.00 27.36 ? 388  ARG A CZ  1 
ATOM   3113 N  NH1 . ARG A 1 388 ? 19.494  70.022 78.038 1.00 27.12 ? 388  ARG A NH1 1 
ATOM   3114 N  NH2 . ARG A 1 388 ? 20.780  69.809 76.142 1.00 27.68 ? 388  ARG A NH2 1 
ATOM   3115 N  N   . ASP A 1 389 ? 20.726  64.661 75.107 1.00 26.27 ? 389  ASP A N   1 
ATOM   3116 C  CA  . ASP A 1 389 ? 21.123  64.750 73.694 1.00 26.87 ? 389  ASP A CA  1 
ATOM   3117 C  C   . ASP A 1 389 ? 21.254  63.383 73.007 1.00 26.78 ? 389  ASP A C   1 
ATOM   3118 O  O   . ASP A 1 389 ? 20.934  63.253 71.821 1.00 26.71 ? 389  ASP A O   1 
ATOM   3119 C  CB  . ASP A 1 389 ? 22.431  65.523 73.546 1.00 27.27 ? 389  ASP A CB  1 
ATOM   3120 C  CG  . ASP A 1 389 ? 22.300  66.996 73.926 1.00 27.87 ? 389  ASP A CG  1 
ATOM   3121 O  OD1 . ASP A 1 389 ? 21.181  67.517 74.096 1.00 29.43 ? 389  ASP A OD1 1 
ATOM   3122 O  OD2 . ASP A 1 389 ? 23.347  67.644 74.052 1.00 32.29 ? 389  ASP A OD2 1 
ATOM   3123 N  N   . GLY A 1 390 ? 21.719  62.380 73.754 1.00 26.00 ? 390  GLY A N   1 
ATOM   3124 C  CA  . GLY A 1 390 ? 21.808  61.007 73.265 1.00 25.59 ? 390  GLY A CA  1 
ATOM   3125 C  C   . GLY A 1 390 ? 20.439  60.472 72.862 1.00 25.49 ? 390  GLY A C   1 
ATOM   3126 O  O   . GLY A 1 390 ? 20.293  59.840 71.819 1.00 24.99 ? 390  GLY A O   1 
ATOM   3127 N  N   . LEU A 1 391 ? 19.442  60.723 73.704 1.00 25.39 ? 391  LEU A N   1 
ATOM   3128 C  CA  . LEU A 1 391 ? 18.082  60.284 73.447 1.00 25.19 ? 391  LEU A CA  1 
ATOM   3129 C  C   . LEU A 1 391 ? 17.453  60.971 72.241 1.00 24.93 ? 391  LEU A C   1 
ATOM   3130 O  O   . LEU A 1 391 ? 16.754  60.311 71.478 1.00 23.55 ? 391  LEU A O   1 
ATOM   3131 C  CB  . LEU A 1 391 ? 17.201  60.445 74.686 1.00 25.79 ? 391  LEU A CB  1 
ATOM   3132 C  CG  . LEU A 1 391 ? 17.179  59.222 75.608 1.00 26.29 ? 391  LEU A CG  1 
ATOM   3133 C  CD1 . LEU A 1 391 ? 16.320  59.504 76.841 1.00 26.48 ? 391  LEU A CD1 1 
ATOM   3134 C  CD2 . LEU A 1 391 ? 16.649  57.970 74.887 1.00 27.97 ? 391  LEU A CD2 1 
ATOM   3135 N  N   . ASP A 1 392 ? 17.668  62.286 72.113 1.00 24.87 ? 392  ASP A N   1 
ATOM   3136 C  CA  A ASP A 1 392 ? 17.281  63.042 70.934 0.50 25.70 ? 392  ASP A CA  1 
ATOM   3137 C  CA  B ASP A 1 392 ? 17.252  63.030 70.910 0.50 25.25 ? 392  ASP A CA  1 
ATOM   3138 C  C   . ASP A 1 392 ? 17.832  62.366 69.677 1.00 25.18 ? 392  ASP A C   1 
ATOM   3139 O  O   . ASP A 1 392 ? 17.110  62.121 68.725 1.00 25.37 ? 392  ASP A O   1 
ATOM   3140 C  CB  A ASP A 1 392 ? 17.842  64.460 71.062 0.50 26.10 ? 392  ASP A CB  1 
ATOM   3141 C  CB  B ASP A 1 392 ? 17.671  64.516 70.952 0.50 25.17 ? 392  ASP A CB  1 
ATOM   3142 C  CG  A ASP A 1 392 ? 16.934  65.497 70.479 0.50 28.34 ? 392  ASP A CG  1 
ATOM   3143 C  CG  B ASP A 1 392 ? 17.630  65.186 69.564 0.50 25.87 ? 392  ASP A CG  1 
ATOM   3144 O  OD1 A ASP A 1 392 ? 16.207  65.181 69.515 0.50 31.02 ? 392  ASP A OD1 1 
ATOM   3145 O  OD1 B ASP A 1 392 ? 16.529  65.385 69.014 0.50 26.40 ? 392  ASP A OD1 1 
ATOM   3146 O  OD2 A ASP A 1 392 ? 16.952  66.642 70.984 0.50 32.44 ? 392  ASP A OD2 1 
ATOM   3147 O  OD2 B ASP A 1 392 ? 18.701  65.528 69.017 0.50 27.61 ? 392  ASP A OD2 1 
ATOM   3148 N  N   . ASP A 1 393 ? 19.128  62.065 69.697 1.00 24.66 ? 393  ASP A N   1 
ATOM   3149 C  CA  . ASP A 1 393 ? 19.760  61.367 68.566 1.00 23.88 ? 393  ASP A CA  1 
ATOM   3150 C  C   . ASP A 1 393 ? 19.151  59.989 68.333 1.00 23.40 ? 393  ASP A C   1 
ATOM   3151 O  O   . ASP A 1 393 ? 18.872  59.644 67.196 1.00 22.98 ? 393  ASP A O   1 
ATOM   3152 C  CB  . ASP A 1 393 ? 21.263  61.232 68.743 1.00 23.66 ? 393  ASP A CB  1 
ATOM   3153 C  CG  . ASP A 1 393 ? 22.002  62.539 68.498 1.00 25.64 ? 393  ASP A CG  1 
ATOM   3154 O  OD1 . ASP A 1 393 ? 21.549  63.357 67.674 1.00 25.16 ? 393  ASP A OD1 1 
ATOM   3155 O  OD2 . ASP A 1 393 ? 23.050  62.745 69.132 1.00 24.54 ? 393  ASP A OD2 1 
ATOM   3156 N  N   . ILE A 1 394 ? 18.938  59.201 69.396 1.00 22.22 ? 394  ILE A N   1 
ATOM   3157 C  CA  . ILE A 1 394 ? 18.363  57.874 69.199 1.00 20.77 ? 394  ILE A CA  1 
ATOM   3158 C  C   . ILE A 1 394 ? 17.019  57.977 68.470 1.00 21.17 ? 394  ILE A C   1 
ATOM   3159 O  O   . ILE A 1 394 ? 16.777  57.266 67.486 1.00 21.41 ? 394  ILE A O   1 
ATOM   3160 C  CB  . ILE A 1 394 ? 18.187  57.103 70.537 1.00 21.05 ? 394  ILE A CB  1 
ATOM   3161 C  CG1 . ILE A 1 394 ? 19.554  56.641 71.074 1.00 19.54 ? 394  ILE A CG1 1 
ATOM   3162 C  CG2 . ILE A 1 394 ? 17.229  55.912 70.363 1.00 17.53 ? 394  ILE A CG2 1 
ATOM   3163 C  CD1 . ILE A 1 394 ? 19.561  56.389 72.596 1.00 20.32 ? 394  ILE A CD1 1 
ATOM   3164 N  N   . VAL A 1 395 ? 16.152  58.849 68.964 1.00 20.43 ? 395  VAL A N   1 
ATOM   3165 C  CA  . VAL A 1 395 ? 14.812  58.952 68.443 1.00 20.85 ? 395  VAL A CA  1 
ATOM   3166 C  C   . VAL A 1 395 ? 14.845  59.522 67.018 1.00 21.07 ? 395  VAL A C   1 
ATOM   3167 O  O   . VAL A 1 395 ? 14.173  58.990 66.130 1.00 20.79 ? 395  VAL A O   1 
ATOM   3168 C  CB  . VAL A 1 395 ? 13.907  59.805 69.364 1.00 21.35 ? 395  VAL A CB  1 
ATOM   3169 C  CG1 . VAL A 1 395 ? 12.541  60.027 68.731 1.00 19.86 ? 395  VAL A CG1 1 
ATOM   3170 C  CG2 . VAL A 1 395 ? 13.781  59.167 70.753 1.00 21.70 ? 395  VAL A CG2 1 
ATOM   3171 N  N   . GLY A 1 396 ? 15.623  60.591 66.818 1.00 20.88 ? 396  GLY A N   1 
ATOM   3172 C  CA  . GLY A 1 396 ? 15.783  61.210 65.494 1.00 21.23 ? 396  GLY A CA  1 
ATOM   3173 C  C   . GLY A 1 396 ? 16.386  60.261 64.455 1.00 21.84 ? 396  GLY A C   1 
ATOM   3174 O  O   . GLY A 1 396 ? 15.858  60.136 63.343 1.00 21.02 ? 396  GLY A O   1 
ATOM   3175 N  N   . ASP A 1 397 ? 17.501  59.614 64.814 1.00 21.45 ? 397  ASP A N   1 
ATOM   3176 C  CA  . ASP A 1 397 ? 18.213  58.682 63.914 1.00 22.01 ? 397  ASP A CA  1 
ATOM   3177 C  C   . ASP A 1 397 ? 17.337  57.485 63.549 1.00 21.83 ? 397  ASP A C   1 
ATOM   3178 O  O   . ASP A 1 397 ? 17.216  57.123 62.372 1.00 21.91 ? 397  ASP A O   1 
ATOM   3179 C  CB  . ASP A 1 397 ? 19.513  58.143 64.550 1.00 22.03 ? 397  ASP A CB  1 
ATOM   3180 C  CG  . ASP A 1 397 ? 20.592  59.211 64.761 1.00 23.33 ? 397  ASP A CG  1 
ATOM   3181 O  OD1 . ASP A 1 397 ? 20.499  60.339 64.218 1.00 24.85 ? 397  ASP A OD1 1 
ATOM   3182 O  OD2 . ASP A 1 397 ? 21.574  58.903 65.483 1.00 21.46 ? 397  ASP A OD2 1 
ATOM   3183 N  N   . HIS A 1 398 ? 16.728  56.856 64.552 1.00 21.13 ? 398  HIS A N   1 
ATOM   3184 C  CA  . HIS A 1 398 ? 15.902  55.679 64.304 1.00 20.48 ? 398  HIS A CA  1 
ATOM   3185 C  C   . HIS A 1 398 ? 14.649  55.982 63.475 1.00 20.91 ? 398  HIS A C   1 
ATOM   3186 O  O   . HIS A 1 398 ? 14.303  55.201 62.584 1.00 20.67 ? 398  HIS A O   1 
ATOM   3187 C  CB  . HIS A 1 398 ? 15.510  54.998 65.620 1.00 20.27 ? 398  HIS A CB  1 
ATOM   3188 C  CG  . HIS A 1 398 ? 14.487  53.925 65.466 1.00 20.36 ? 398  HIS A CG  1 
ATOM   3189 N  ND1 . HIS A 1 398 ? 14.713  52.777 64.740 1.00 21.54 ? 398  HIS A ND1 1 
ATOM   3190 C  CD2 . HIS A 1 398 ? 13.229  53.820 65.957 1.00 21.06 ? 398  HIS A CD2 1 
ATOM   3191 C  CE1 . HIS A 1 398 ? 13.633  52.013 64.780 1.00 21.74 ? 398  HIS A CE1 1 
ATOM   3192 N  NE2 . HIS A 1 398 ? 12.717  52.627 65.509 1.00 21.63 ? 398  HIS A NE2 1 
ATOM   3193 N  N   . ASN A 1 399 ? 13.971  57.098 63.765 1.00 20.36 ? 399  ASN A N   1 
ATOM   3194 C  CA  . ASN A 1 399 ? 12.648  57.328 63.198 1.00 19.87 ? 399  ASN A CA  1 
ATOM   3195 C  C   . ASN A 1 399 ? 12.658  58.179 61.940 1.00 20.24 ? 399  ASN A C   1 
ATOM   3196 O  O   . ASN A 1 399 ? 11.730  58.112 61.144 1.00 20.28 ? 399  ASN A O   1 
ATOM   3197 C  CB  . ASN A 1 399 ? 11.717  57.955 64.241 1.00 18.58 ? 399  ASN A CB  1 
ATOM   3198 C  CG  . ASN A 1 399 ? 11.308  56.961 65.333 1.00 19.94 ? 399  ASN A CG  1 
ATOM   3199 O  OD1 . ASN A 1 399 ? 10.572  55.997 65.077 1.00 19.66 ? 399  ASN A OD1 1 
ATOM   3200 N  ND2 . ASN A 1 399 ? 11.791  57.190 66.555 1.00 18.57 ? 399  ASN A ND2 1 
ATOM   3201 N  N   . VAL A 1 400 ? 13.675  59.023 61.785 1.00 20.44 ? 400  VAL A N   1 
ATOM   3202 C  CA  . VAL A 1 400 ? 13.666  59.971 60.662 1.00 20.34 ? 400  VAL A CA  1 
ATOM   3203 C  C   . VAL A 1 400 ? 14.934  59.885 59.823 1.00 20.80 ? 400  VAL A C   1 
ATOM   3204 O  O   . VAL A 1 400 ? 14.872  59.514 58.648 1.00 20.76 ? 400  VAL A O   1 
ATOM   3205 C  CB  . VAL A 1 400 ? 13.438  61.426 61.121 1.00 19.58 ? 400  VAL A CB  1 
ATOM   3206 C  CG1 . VAL A 1 400 ? 13.525  62.363 59.933 1.00 19.56 ? 400  VAL A CG1 1 
ATOM   3207 C  CG2 . VAL A 1 400 ? 12.053  61.564 61.849 1.00 19.55 ? 400  VAL A CG2 1 
ATOM   3208 N  N   . ILE A 1 401 ? 16.077  60.211 60.426 1.00 20.65 ? 401  ILE A N   1 
ATOM   3209 C  CA  . ILE A 1 401 ? 17.302  60.404 59.657 1.00 20.79 ? 401  ILE A CA  1 
ATOM   3210 C  C   . ILE A 1 401 ? 17.795  59.122 59.004 1.00 21.25 ? 401  ILE A C   1 
ATOM   3211 O  O   . ILE A 1 401 ? 18.069  59.103 57.792 1.00 20.80 ? 401  ILE A O   1 
ATOM   3212 C  CB  . ILE A 1 401 ? 18.419  61.064 60.480 1.00 20.87 ? 401  ILE A CB  1 
ATOM   3213 C  CG1 . ILE A 1 401 ? 17.930  62.416 61.029 1.00 20.80 ? 401  ILE A CG1 1 
ATOM   3214 C  CG2 . ILE A 1 401 ? 19.706  61.222 59.607 1.00 19.16 ? 401  ILE A CG2 1 
ATOM   3215 C  CD1 . ILE A 1 401 ? 18.924  63.106 62.012 1.00 20.50 ? 401  ILE A CD1 1 
ATOM   3216 N  N   . CYS A 1 402 ? 17.899  58.043 59.775 1.00 21.11 ? 402  CYS A N   1 
ATOM   3217 C  CA  . CYS A 1 402 ? 18.419  56.816 59.179 1.00 20.95 ? 402  CYS A CA  1 
ATOM   3218 C  C   . CYS A 1 402 ? 17.487  56.166 58.141 1.00 21.15 ? 402  CYS A C   1 
ATOM   3219 O  O   . CYS A 1 402 ? 17.975  55.709 57.110 1.00 21.68 ? 402  CYS A O   1 
ATOM   3220 C  CB  . CYS A 1 402 ? 19.000  55.856 60.226 1.00 21.63 ? 402  CYS A CB  1 
ATOM   3221 S  SG  . CYS A 1 402 ? 20.441  56.620 61.086 0.90 21.93 ? 402  CYS A SG  1 
ATOM   3222 N  N   . PRO A 1 403 ? 16.155  56.126 58.394 1.00 21.29 ? 403  PRO A N   1 
ATOM   3223 C  CA  . PRO A 1 403 ? 15.280  55.662 57.299 1.00 21.43 ? 403  PRO A CA  1 
ATOM   3224 C  C   . PRO A 1 403 ? 15.421  56.526 56.043 1.00 21.82 ? 403  PRO A C   1 
ATOM   3225 O  O   . PRO A 1 403 ? 15.487  55.979 54.943 1.00 20.80 ? 403  PRO A O   1 
ATOM   3226 C  CB  . PRO A 1 403 ? 13.870  55.786 57.875 1.00 21.35 ? 403  PRO A CB  1 
ATOM   3227 C  CG  . PRO A 1 403 ? 14.060  55.740 59.381 1.00 22.00 ? 403  PRO A CG  1 
ATOM   3228 C  CD  . PRO A 1 403 ? 15.424  56.307 59.663 1.00 20.76 ? 403  PRO A CD  1 
ATOM   3229 N  N   . LEU A 1 404 ? 15.474  57.853 56.210 1.00 21.85 ? 404  LEU A N   1 
ATOM   3230 C  CA  . LEU A 1 404 ? 15.638  58.741 55.067 1.00 22.85 ? 404  LEU A CA  1 
ATOM   3231 C  C   . LEU A 1 404 ? 16.955  58.458 54.343 1.00 22.99 ? 404  LEU A C   1 
ATOM   3232 O  O   . LEU A 1 404 ? 16.974  58.366 53.119 1.00 24.27 ? 404  LEU A O   1 
ATOM   3233 C  CB  . LEU A 1 404 ? 15.496  60.222 55.459 1.00 22.10 ? 404  LEU A CB  1 
ATOM   3234 C  CG  . LEU A 1 404 ? 15.565  61.255 54.310 1.00 23.14 ? 404  LEU A CG  1 
ATOM   3235 C  CD1 . LEU A 1 404 ? 14.592  62.422 54.522 1.00 22.07 ? 404  LEU A CD1 1 
ATOM   3236 C  CD2 . LEU A 1 404 ? 16.989  61.781 54.160 1.00 23.28 ? 404  LEU A CD2 1 
ATOM   3237 N  N   . MET A 1 405 ? 18.044  58.288 55.086 1.00 23.22 ? 405  MET A N   1 
ATOM   3238 C  CA  . MET A 1 405 ? 19.338  57.947 54.473 1.00 23.37 ? 405  MET A CA  1 
ATOM   3239 C  C   . MET A 1 405 ? 19.311  56.624 53.726 1.00 23.83 ? 405  MET A C   1 
ATOM   3240 O  O   . MET A 1 405 ? 19.927  56.481 52.664 1.00 23.38 ? 405  MET A O   1 
ATOM   3241 C  CB  . MET A 1 405 ? 20.488  57.986 55.495 1.00 23.27 ? 405  MET A CB  1 
ATOM   3242 C  CG  . MET A 1 405 ? 20.818  59.410 55.950 1.00 23.03 ? 405  MET A CG  1 
ATOM   3243 S  SD  . MET A 1 405 ? 20.912  60.642 54.609 1.00 26.03 ? 405  MET A SD  1 
ATOM   3244 C  CE  . MET A 1 405 ? 22.341  60.018 53.728 1.00 24.12 ? 405  MET A CE  1 
ATOM   3245 N  N   . HIS A 1 406 ? 18.569  55.664 54.254 1.00 23.89 ? 406  HIS A N   1 
ATOM   3246 C  CA  . HIS A 1 406 ? 18.443  54.390 53.577 1.00 24.70 ? 406  HIS A CA  1 
ATOM   3247 C  C   . HIS A 1 406 ? 17.656  54.589 52.256 1.00 24.43 ? 406  HIS A C   1 
ATOM   3248 O  O   . HIS A 1 406 ? 18.039  54.093 51.192 1.00 24.14 ? 406  HIS A O   1 
ATOM   3249 C  CB  . HIS A 1 406 ? 17.744  53.390 54.482 1.00 24.32 ? 406  HIS A CB  1 
ATOM   3250 C  CG  . HIS A 1 406 ? 17.611  52.034 53.877 1.00 27.55 ? 406  HIS A CG  1 
ATOM   3251 N  ND1 . HIS A 1 406 ? 18.672  51.158 53.773 1.00 30.18 ? 406  HIS A ND1 1 
ATOM   3252 C  CD2 . HIS A 1 406 ? 16.540  51.399 53.339 1.00 27.82 ? 406  HIS A CD2 1 
ATOM   3253 C  CE1 . HIS A 1 406 ? 18.258  50.040 53.202 1.00 30.16 ? 406  HIS A CE1 1 
ATOM   3254 N  NE2 . HIS A 1 406 ? 16.970  50.162 52.928 1.00 30.65 ? 406  HIS A NE2 1 
ATOM   3255 N  N   . PHE A 1 407 ? 16.585  55.355 52.334 1.00 24.61 ? 407  PHE A N   1 
ATOM   3256 C  CA  . PHE A 1 407 ? 15.834  55.714 51.137 1.00 24.74 ? 407  PHE A CA  1 
ATOM   3257 C  C   . PHE A 1 407 ? 16.716  56.418 50.109 1.00 25.53 ? 407  PHE A C   1 
ATOM   3258 O  O   . PHE A 1 407 ? 16.704  56.023 48.949 1.00 24.62 ? 407  PHE A O   1 
ATOM   3259 C  CB  . PHE A 1 407 ? 14.642  56.600 51.495 1.00 24.35 ? 407  PHE A CB  1 
ATOM   3260 C  CG  . PHE A 1 407 ? 13.830  57.023 50.306 1.00 23.51 ? 407  PHE A CG  1 
ATOM   3261 C  CD1 . PHE A 1 407 ? 12.967  56.117 49.679 1.00 22.72 ? 407  PHE A CD1 1 
ATOM   3262 C  CD2 . PHE A 1 407 ? 13.920  58.324 49.817 1.00 22.87 ? 407  PHE A CD2 1 
ATOM   3263 C  CE1 . PHE A 1 407 ? 12.196  56.519 48.568 1.00 23.36 ? 407  PHE A CE1 1 
ATOM   3264 C  CE2 . PHE A 1 407 ? 13.172  58.729 48.716 1.00 21.57 ? 407  PHE A CE2 1 
ATOM   3265 C  CZ  . PHE A 1 407 ? 12.308  57.822 48.096 1.00 22.23 ? 407  PHE A CZ  1 
ATOM   3266 N  N   . VAL A 1 408 ? 17.465  57.444 50.536 1.00 26.44 ? 408  VAL A N   1 
ATOM   3267 C  CA  A VAL A 1 408 ? 18.259  58.218 49.587 0.50 27.28 ? 408  VAL A CA  1 
ATOM   3268 C  CA  B VAL A 1 408 ? 18.327  58.241 49.659 0.50 27.37 ? 408  VAL A CA  1 
ATOM   3269 C  C   . VAL A 1 408 ? 19.288  57.354 48.873 1.00 28.01 ? 408  VAL A C   1 
ATOM   3270 O  O   . VAL A 1 408 ? 19.482  57.518 47.669 1.00 27.73 ? 408  VAL A O   1 
ATOM   3271 C  CB  A VAL A 1 408 ? 18.935  59.499 50.170 0.50 27.38 ? 408  VAL A CB  1 
ATOM   3272 C  CB  B VAL A 1 408 ? 19.169  59.273 50.466 0.50 27.48 ? 408  VAL A CB  1 
ATOM   3273 C  CG1 A VAL A 1 408 ? 17.934  60.376 50.860 0.50 28.89 ? 408  VAL A CG1 1 
ATOM   3274 C  CG1 B VAL A 1 408 ? 20.300  59.839 49.629 0.50 27.99 ? 408  VAL A CG1 1 
ATOM   3275 C  CG2 A VAL A 1 408 ? 20.076  59.172 51.109 0.50 26.91 ? 408  VAL A CG2 1 
ATOM   3276 C  CG2 B VAL A 1 408 ? 18.314  60.411 50.964 0.50 28.61 ? 408  VAL A CG2 1 
ATOM   3277 N  N   . ASN A 1 409 ? 19.908  56.423 49.590 1.00 28.32 ? 409  ASN A N   1 
ATOM   3278 C  CA  . ASN A 1 409 ? 20.926  55.595 48.981 1.00 29.88 ? 409  ASN A CA  1 
ATOM   3279 C  C   . ASN A 1 409 ? 20.307  54.572 48.013 1.00 29.23 ? 409  ASN A C   1 
ATOM   3280 O  O   . ASN A 1 409 ? 20.814  54.392 46.897 1.00 29.46 ? 409  ASN A O   1 
ATOM   3281 C  CB  . ASN A 1 409 ? 21.878  54.997 50.041 1.00 30.47 ? 409  ASN A CB  1 
ATOM   3282 C  CG  . ASN A 1 409 ? 23.060  55.967 50.411 1.00 35.07 ? 409  ASN A CG  1 
ATOM   3283 O  OD1 . ASN A 1 409 ? 23.066  56.575 51.489 1.00 38.09 ? 409  ASN A OD1 1 
ATOM   3284 N  ND2 . ASN A 1 409 ? 24.055  56.099 49.505 1.00 35.67 ? 409  ASN A ND2 1 
ATOM   3285 N  N   . LYS A 1 410 ? 19.181  53.967 48.389 1.00 27.91 ? 410  LYS A N   1 
ATOM   3286 C  CA  . LYS A 1 410 ? 18.471  53.081 47.459 1.00 28.11 ? 410  LYS A CA  1 
ATOM   3287 C  C   . LYS A 1 410 ? 17.924  53.806 46.207 1.00 27.77 ? 410  LYS A C   1 
ATOM   3288 O  O   . LYS A 1 410 ? 18.006  53.273 45.088 1.00 27.03 ? 410  LYS A O   1 
ATOM   3289 C  CB  . LYS A 1 410 ? 17.344  52.329 48.161 1.00 28.42 ? 410  LYS A CB  1 
ATOM   3290 C  CG  . LYS A 1 410 ? 17.815  51.379 49.261 1.00 30.55 ? 410  LYS A CG  1 
ATOM   3291 C  CD  . LYS A 1 410 ? 18.514  50.157 48.676 1.00 33.65 ? 410  LYS A CD  1 
ATOM   3292 C  CE  . LYS A 1 410 ? 19.241  49.356 49.758 1.00 35.14 ? 410  LYS A CE  1 
ATOM   3293 N  NZ  . LYS A 1 410 ? 19.747  48.061 49.192 1.00 35.04 ? 410  LYS A NZ  1 
ATOM   3294 N  N   . TYR A 1 411 ? 17.376  55.006 46.413 1.00 26.68 ? 411  TYR A N   1 
ATOM   3295 C  CA  . TYR A 1 411 ? 16.742  55.768 45.348 1.00 26.37 ? 411  TYR A CA  1 
ATOM   3296 C  C   . TYR A 1 411 ? 17.785  56.233 44.329 1.00 26.75 ? 411  TYR A C   1 
ATOM   3297 O  O   . TYR A 1 411 ? 17.594  56.086 43.116 1.00 26.55 ? 411  TYR A O   1 
ATOM   3298 C  CB  . TYR A 1 411 ? 15.975  57.002 45.888 1.00 25.77 ? 411  TYR A CB  1 
ATOM   3299 C  CG  . TYR A 1 411 ? 15.128  57.612 44.780 1.00 25.01 ? 411  TYR A CG  1 
ATOM   3300 C  CD1 . TYR A 1 411 ? 13.849  57.116 44.520 1.00 24.72 ? 411  TYR A CD1 1 
ATOM   3301 C  CD2 . TYR A 1 411 ? 15.630  58.627 43.957 1.00 23.61 ? 411  TYR A CD2 1 
ATOM   3302 C  CE1 . TYR A 1 411 ? 13.073  57.616 43.473 1.00 24.62 ? 411  TYR A CE1 1 
ATOM   3303 C  CE2 . TYR A 1 411 ? 14.856  59.150 42.907 1.00 23.48 ? 411  TYR A CE2 1 
ATOM   3304 C  CZ  . TYR A 1 411 ? 13.585  58.623 42.667 1.00 25.47 ? 411  TYR A CZ  1 
ATOM   3305 O  OH  . TYR A 1 411 ? 12.811  59.099 41.631 1.00 25.78 ? 411  TYR A OH  1 
ATOM   3306 N  N   . THR A 1 412 ? 18.871  56.799 44.847 1.00 26.48 ? 412  THR A N   1 
ATOM   3307 C  CA  . THR A 1 412 ? 19.954  57.350 44.052 1.00 27.67 ? 412  THR A CA  1 
ATOM   3308 C  C   . THR A 1 412 ? 20.594  56.368 43.059 1.00 28.03 ? 412  THR A C   1 
ATOM   3309 O  O   . THR A 1 412 ? 21.133  56.797 42.052 1.00 28.37 ? 412  THR A O   1 
ATOM   3310 C  CB  . THR A 1 412 ? 20.996  58.007 44.972 1.00 27.47 ? 412  THR A CB  1 
ATOM   3311 O  OG1 . THR A 1 412 ? 20.343  59.064 45.685 1.00 27.90 ? 412  THR A OG1 1 
ATOM   3312 C  CG2 . THR A 1 412 ? 22.170  58.592 44.179 1.00 27.57 ? 412  THR A CG2 1 
ATOM   3313 N  N   . LYS A 1 413 ? 20.516  55.074 43.342 1.00 28.44 ? 413  LYS A N   1 
ATOM   3314 C  CA  A LYS A 1 413 ? 21.005  54.066 42.419 0.50 29.13 ? 413  LYS A CA  1 
ATOM   3315 C  CA  B LYS A 1 413 ? 20.985  54.038 42.425 0.50 29.06 ? 413  LYS A CA  1 
ATOM   3316 C  C   . LYS A 1 413 ? 20.203  54.042 41.102 1.00 29.51 ? 413  LYS A C   1 
ATOM   3317 O  O   . LYS A 1 413 ? 20.758  53.750 40.052 1.00 29.44 ? 413  LYS A O   1 
ATOM   3318 C  CB  A LYS A 1 413 ? 21.004  52.683 43.079 0.50 29.25 ? 413  LYS A CB  1 
ATOM   3319 C  CB  B LYS A 1 413 ? 20.884  52.648 43.074 0.50 29.13 ? 413  LYS A CB  1 
ATOM   3320 C  CG  A LYS A 1 413 ? 22.088  52.489 44.150 0.50 30.15 ? 413  LYS A CG  1 
ATOM   3321 C  CG  B LYS A 1 413 ? 21.482  51.511 42.228 0.50 29.64 ? 413  LYS A CG  1 
ATOM   3322 C  CD  A LYS A 1 413 ? 22.071  51.062 44.685 0.50 31.44 ? 413  LYS A CD  1 
ATOM   3323 C  CD  B LYS A 1 413 ? 21.242  50.127 42.836 0.50 31.56 ? 413  LYS A CD  1 
ATOM   3324 C  CE  A LYS A 1 413 ? 22.766  50.956 46.036 0.50 32.21 ? 413  LYS A CE  1 
ATOM   3325 C  CE  B LYS A 1 413 ? 21.710  49.021 41.888 0.50 32.21 ? 413  LYS A CE  1 
ATOM   3326 N  NZ  A LYS A 1 413 ? 22.294  49.751 46.783 0.50 32.08 ? 413  LYS A NZ  1 
ATOM   3327 N  NZ  B LYS A 1 413 ? 21.448  47.647 42.418 0.50 32.62 ? 413  LYS A NZ  1 
ATOM   3328 N  N   . PHE A 1 414 ? 18.902  54.355 41.160 1.00 29.19 ? 414  PHE A N   1 
ATOM   3329 C  CA  . PHE A 1 414 ? 18.051  54.311 39.953 1.00 28.94 ? 414  PHE A CA  1 
ATOM   3330 C  C   . PHE A 1 414 ? 17.521  55.666 39.480 1.00 28.79 ? 414  PHE A C   1 
ATOM   3331 O  O   . PHE A 1 414 ? 17.054  55.780 38.343 1.00 28.72 ? 414  PHE A O   1 
ATOM   3332 C  CB  . PHE A 1 414 ? 16.858  53.381 40.170 1.00 28.75 ? 414  PHE A CB  1 
ATOM   3333 C  CG  . PHE A 1 414 ? 17.227  51.944 40.339 1.00 30.87 ? 414  PHE A CG  1 
ATOM   3334 C  CD1 . PHE A 1 414 ? 17.314  51.097 39.232 1.00 33.32 ? 414  PHE A CD1 1 
ATOM   3335 C  CD2 . PHE A 1 414 ? 17.471  51.423 41.608 1.00 32.06 ? 414  PHE A CD2 1 
ATOM   3336 C  CE1 . PHE A 1 414 ? 17.640  49.749 39.387 1.00 35.28 ? 414  PHE A CE1 1 
ATOM   3337 C  CE2 . PHE A 1 414 ? 17.796  50.076 41.781 1.00 34.30 ? 414  PHE A CE2 1 
ATOM   3338 C  CZ  . PHE A 1 414 ? 17.890  49.233 40.669 1.00 35.27 ? 414  PHE A CZ  1 
ATOM   3339 N  N   . GLY A 1 415 ? 17.580  56.681 40.343 1.00 27.99 ? 415  GLY A N   1 
ATOM   3340 C  CA  . GLY A 1 415 ? 16.904  57.961 40.069 1.00 27.98 ? 415  GLY A CA  1 
ATOM   3341 C  C   . GLY A 1 415 ? 17.651  58.887 39.126 1.00 27.67 ? 415  GLY A C   1 
ATOM   3342 O  O   . GLY A 1 415 ? 18.731  58.567 38.639 1.00 27.57 ? 415  GLY A O   1 
ATOM   3343 N  N   . ASN A 1 416 ? 17.086  60.059 38.895 1.00 28.16 ? 416  ASN A N   1 
ATOM   3344 C  CA  . ASN A 1 416 ? 17.615  60.964 37.891 1.00 28.37 ? 416  ASN A CA  1 
ATOM   3345 C  C   . ASN A 1 416 ? 18.206  62.232 38.519 1.00 28.29 ? 416  ASN A C   1 
ATOM   3346 O  O   . ASN A 1 416 ? 18.448  63.230 37.834 1.00 28.35 ? 416  ASN A O   1 
ATOM   3347 C  CB  . ASN A 1 416 ? 16.530  61.282 36.846 1.00 29.23 ? 416  ASN A CB  1 
ATOM   3348 C  CG  . ASN A 1 416 ? 17.081  62.051 35.656 1.00 31.08 ? 416  ASN A CG  1 
ATOM   3349 O  OD1 . ASN A 1 416 ? 16.576  63.117 35.302 1.00 29.78 ? 416  ASN A OD1 1 
ATOM   3350 N  ND2 . ASN A 1 416 ? 18.141  61.527 35.060 1.00 34.85 ? 416  ASN A ND2 1 
ATOM   3351 N  N   . GLY A 1 417 ? 18.457  62.184 39.830 1.00 27.30 ? 417  GLY A N   1 
ATOM   3352 C  CA  . GLY A 1 417 ? 19.101  63.299 40.515 1.00 26.93 ? 417  GLY A CA  1 
ATOM   3353 C  C   . GLY A 1 417 ? 18.580  63.545 41.923 1.00 26.52 ? 417  GLY A C   1 
ATOM   3354 O  O   . GLY A 1 417 ? 17.366  63.740 42.120 1.00 26.60 ? 417  GLY A O   1 
ATOM   3355 N  N   . THR A 1 418 ? 19.500  63.535 42.886 1.00 25.11 ? 418  THR A N   1 
ATOM   3356 C  CA  . THR A 1 418 ? 19.174  63.640 44.317 1.00 24.80 ? 418  THR A CA  1 
ATOM   3357 C  C   . THR A 1 418 ? 19.877  64.835 44.930 1.00 24.44 ? 418  THR A C   1 
ATOM   3358 O  O   . THR A 1 418 ? 21.100  64.994 44.747 1.00 24.85 ? 418  THR A O   1 
ATOM   3359 C  CB  . THR A 1 418 ? 19.587  62.347 45.081 1.00 24.69 ? 418  THR A CB  1 
ATOM   3360 O  OG1 . THR A 1 418 ? 18.911  61.228 44.506 1.00 25.13 ? 418  THR A OG1 1 
ATOM   3361 C  CG2 . THR A 1 418 ? 19.206  62.439 46.589 1.00 24.44 ? 418  THR A CG2 1 
ATOM   3362 N  N   . TYR A 1 419 ? 19.111  65.670 45.637 1.00 24.05 ? 419  TYR A N   1 
ATOM   3363 C  CA  . TYR A 1 419 ? 19.654  66.790 46.423 1.00 23.52 ? 419  TYR A CA  1 
ATOM   3364 C  C   . TYR A 1 419 ? 19.261  66.623 47.893 1.00 23.51 ? 419  TYR A C   1 
ATOM   3365 O  O   . TYR A 1 419 ? 18.055  66.544 48.224 1.00 23.34 ? 419  TYR A O   1 
ATOM   3366 C  CB  . TYR A 1 419 ? 19.174  68.153 45.882 1.00 23.32 ? 419  TYR A CB  1 
ATOM   3367 C  CG  . TYR A 1 419 ? 19.626  68.376 44.445 1.00 24.38 ? 419  TYR A CG  1 
ATOM   3368 C  CD1 . TYR A 1 419 ? 20.855  68.988 44.170 1.00 25.41 ? 419  TYR A CD1 1 
ATOM   3369 C  CD2 . TYR A 1 419 ? 18.845  67.936 43.370 1.00 25.46 ? 419  TYR A CD2 1 
ATOM   3370 C  CE1 . TYR A 1 419 ? 21.291  69.166 42.851 1.00 27.09 ? 419  TYR A CE1 1 
ATOM   3371 C  CE2 . TYR A 1 419 ? 19.270  68.104 42.045 1.00 25.38 ? 419  TYR A CE2 1 
ATOM   3372 C  CZ  . TYR A 1 419 ? 20.493  68.732 41.805 1.00 28.26 ? 419  TYR A CZ  1 
ATOM   3373 O  OH  . TYR A 1 419 ? 20.927  68.915 40.522 1.00 29.50 ? 419  TYR A OH  1 
ATOM   3374 N  N   . LEU A 1 420 ? 20.280  66.568 48.752 1.00 22.90 ? 420  LEU A N   1 
ATOM   3375 C  CA  . LEU A 1 420 ? 20.126  66.278 50.189 1.00 23.12 ? 420  LEU A CA  1 
ATOM   3376 C  C   . LEU A 1 420 ? 20.468  67.508 51.042 1.00 22.88 ? 420  LEU A C   1 
ATOM   3377 O  O   . LEU A 1 420 ? 21.457  68.185 50.766 1.00 23.41 ? 420  LEU A O   1 
ATOM   3378 C  CB  . LEU A 1 420 ? 21.020  65.101 50.581 1.00 23.05 ? 420  LEU A CB  1 
ATOM   3379 C  CG  . LEU A 1 420 ? 20.940  64.572 52.034 1.00 23.44 ? 420  LEU A CG  1 
ATOM   3380 C  CD1 . LEU A 1 420 ? 19.527  64.099 52.382 1.00 21.69 ? 420  LEU A CD1 1 
ATOM   3381 C  CD2 . LEU A 1 420 ? 21.932  63.452 52.234 1.00 23.40 ? 420  LEU A CD2 1 
ATOM   3382 N  N   . TYR A 1 421 ? 19.642  67.820 52.046 1.00 22.73 ? 421  TYR A N   1 
ATOM   3383 C  CA  . TYR A 1 421 ? 19.951  68.921 52.965 1.00 23.44 ? 421  TYR A CA  1 
ATOM   3384 C  C   . TYR A 1 421 ? 19.903  68.519 54.447 1.00 24.15 ? 421  TYR A C   1 
ATOM   3385 O  O   . TYR A 1 421 ? 19.258  67.542 54.830 1.00 23.76 ? 421  TYR A O   1 
ATOM   3386 C  CB  . TYR A 1 421 ? 19.006  70.110 52.755 1.00 23.21 ? 421  TYR A CB  1 
ATOM   3387 C  CG  . TYR A 1 421 ? 17.590  69.853 53.226 1.00 23.60 ? 421  TYR A CG  1 
ATOM   3388 C  CD1 . TYR A 1 421 ? 17.245  69.985 54.587 1.00 24.01 ? 421  TYR A CD1 1 
ATOM   3389 C  CD2 . TYR A 1 421 ? 16.590  69.466 52.322 1.00 22.69 ? 421  TYR A CD2 1 
ATOM   3390 C  CE1 . TYR A 1 421 ? 15.930  69.737 55.036 1.00 22.41 ? 421  TYR A CE1 1 
ATOM   3391 C  CE2 . TYR A 1 421 ? 15.256  69.216 52.764 1.00 21.89 ? 421  TYR A CE2 1 
ATOM   3392 C  CZ  . TYR A 1 421 ? 14.939  69.342 54.114 1.00 21.79 ? 421  TYR A CZ  1 
ATOM   3393 O  OH  . TYR A 1 421 ? 13.648  69.094 54.540 1.00 19.79 ? 421  TYR A OH  1 
ATOM   3394 N  N   . PHE A 1 422 ? 20.553  69.331 55.268 1.00 25.39 ? 422  PHE A N   1 
ATOM   3395 C  CA  . PHE A 1 422 ? 20.507  69.193 56.724 1.00 25.62 ? 422  PHE A CA  1 
ATOM   3396 C  C   . PHE A 1 422 ? 20.148  70.567 57.284 1.00 25.27 ? 422  PHE A C   1 
ATOM   3397 O  O   . PHE A 1 422 ? 20.976  71.489 57.259 1.00 26.02 ? 422  PHE A O   1 
ATOM   3398 C  CB  . PHE A 1 422 ? 21.863  68.698 57.233 1.00 26.01 ? 422  PHE A CB  1 
ATOM   3399 C  CG  . PHE A 1 422 ? 21.922  68.475 58.728 1.00 27.32 ? 422  PHE A CG  1 
ATOM   3400 C  CD1 . PHE A 1 422 ? 21.395  67.318 59.296 1.00 29.47 ? 422  PHE A CD1 1 
ATOM   3401 C  CD2 . PHE A 1 422 ? 22.536  69.410 59.550 1.00 28.86 ? 422  PHE A CD2 1 
ATOM   3402 C  CE1 . PHE A 1 422 ? 21.454  67.096 60.691 1.00 31.25 ? 422  PHE A CE1 1 
ATOM   3403 C  CE2 . PHE A 1 422 ? 22.604  69.210 60.944 1.00 30.74 ? 422  PHE A CE2 1 
ATOM   3404 C  CZ  . PHE A 1 422 ? 22.059  68.051 61.511 1.00 30.73 ? 422  PHE A CZ  1 
ATOM   3405 N  N   . PHE A 1 423 ? 18.906  70.721 57.743 1.00 24.57 ? 423  PHE A N   1 
ATOM   3406 C  CA  . PHE A 1 423 ? 18.424  72.005 58.244 1.00 24.65 ? 423  PHE A CA  1 
ATOM   3407 C  C   . PHE A 1 423 ? 18.794  72.132 59.720 1.00 25.58 ? 423  PHE A C   1 
ATOM   3408 O  O   . PHE A 1 423 ? 18.390  71.292 60.544 1.00 25.15 ? 423  PHE A O   1 
ATOM   3409 C  CB  . PHE A 1 423 ? 16.908  72.160 58.040 1.00 23.47 ? 423  PHE A CB  1 
ATOM   3410 C  CG  . PHE A 1 423 ? 16.343  73.477 58.534 1.00 23.83 ? 423  PHE A CG  1 
ATOM   3411 C  CD1 . PHE A 1 423 ? 16.329  74.601 57.712 1.00 23.79 ? 423  PHE A CD1 1 
ATOM   3412 C  CD2 . PHE A 1 423 ? 15.797  73.581 59.820 1.00 22.71 ? 423  PHE A CD2 1 
ATOM   3413 C  CE1 . PHE A 1 423 ? 15.788  75.807 58.157 1.00 23.73 ? 423  PHE A CE1 1 
ATOM   3414 C  CE2 . PHE A 1 423 ? 15.272  74.778 60.286 1.00 22.97 ? 423  PHE A CE2 1 
ATOM   3415 C  CZ  . PHE A 1 423 ? 15.261  75.899 59.467 1.00 23.76 ? 423  PHE A CZ  1 
ATOM   3416 N  N   . ASN A 1 424 ? 19.585  73.153 60.043 1.00 25.84 ? 424  ASN A N   1 
ATOM   3417 C  CA  . ASN A 1 424 ? 20.124  73.258 61.396 1.00 26.91 ? 424  ASN A CA  1 
ATOM   3418 C  C   . ASN A 1 424 ? 20.120  74.678 61.949 1.00 27.48 ? 424  ASN A C   1 
ATOM   3419 O  O   . ASN A 1 424 ? 21.001  75.055 62.719 1.00 28.86 ? 424  ASN A O   1 
ATOM   3420 C  CB  . ASN A 1 424 ? 21.498  72.555 61.526 1.00 26.19 ? 424  ASN A CB  1 
ATOM   3421 C  CG  . ASN A 1 424 ? 22.601  73.213 60.684 1.00 27.40 ? 424  ASN A CG  1 
ATOM   3422 O  OD1 . ASN A 1 424 ? 22.334  74.078 59.846 1.00 26.19 ? 424  ASN A OD1 1 
ATOM   3423 N  ND2 . ASN A 1 424 ? 23.850  72.794 60.915 1.00 24.51 ? 424  ASN A ND2 1 
ATOM   3424 N  N   . HIS A 1 425 ? 19.104  75.450 61.574 1.00 27.34 ? 425  HIS A N   1 
ATOM   3425 C  CA  . HIS A 1 425 ? 18.937  76.789 62.101 1.00 28.00 ? 425  HIS A CA  1 
ATOM   3426 C  C   . HIS A 1 425 ? 17.860  76.825 63.180 1.00 28.76 ? 425  HIS A C   1 
ATOM   3427 O  O   . HIS A 1 425 ? 16.707  76.442 62.952 1.00 27.76 ? 425  HIS A O   1 
ATOM   3428 C  CB  . HIS A 1 425 ? 18.578  77.803 61.009 1.00 27.94 ? 425  HIS A CB  1 
ATOM   3429 C  CG  . HIS A 1 425 ? 18.301  79.165 61.562 1.00 28.69 ? 425  HIS A CG  1 
ATOM   3430 N  ND1 . HIS A 1 425 ? 19.301  79.981 62.043 1.00 30.08 ? 425  HIS A ND1 1 
ATOM   3431 C  CD2 . HIS A 1 425 ? 17.136  79.817 61.793 1.00 29.16 ? 425  HIS A CD2 1 
ATOM   3432 C  CE1 . HIS A 1 425 ? 18.764  81.087 62.526 1.00 30.05 ? 425  HIS A CE1 1 
ATOM   3433 N  NE2 . HIS A 1 425 ? 17.454  81.014 62.378 1.00 30.21 ? 425  HIS A NE2 1 
ATOM   3434 N  N   . ARG A 1 426 ? 18.240  77.304 64.354 1.00 29.65 ? 426  ARG A N   1 
ATOM   3435 C  CA  . ARG A 1 426 ? 17.293  77.448 65.454 1.00 31.01 ? 426  ARG A CA  1 
ATOM   3436 C  C   . ARG A 1 426 ? 16.676  78.832 65.332 1.00 31.08 ? 426  ARG A C   1 
ATOM   3437 O  O   . ARG A 1 426 ? 17.391  79.823 65.385 1.00 31.76 ? 426  ARG A O   1 
ATOM   3438 C  CB  . ARG A 1 426 ? 18.029  77.263 66.792 1.00 31.78 ? 426  ARG A CB  1 
ATOM   3439 C  CG  . ARG A 1 426 ? 17.343  77.886 68.002 1.00 33.04 ? 426  ARG A CG  1 
ATOM   3440 C  CD  . ARG A 1 426 ? 16.513  76.882 68.758 1.00 32.44 ? 426  ARG A CD  1 
ATOM   3441 N  NE  . ARG A 1 426 ? 15.810  77.503 69.877 1.00 32.40 ? 426  ARG A NE  1 
ATOM   3442 C  CZ  . ARG A 1 426 ? 15.055  76.835 70.746 1.00 33.03 ? 426  ARG A CZ  1 
ATOM   3443 N  NH1 . ARG A 1 426 ? 14.904  75.503 70.636 1.00 30.17 ? 426  ARG A NH1 1 
ATOM   3444 N  NH2 . ARG A 1 426 ? 14.436  77.502 71.717 1.00 30.66 ? 426  ARG A NH2 1 
ATOM   3445 N  N   . ALA A 1 427 ? 15.363  78.907 65.142 1.00 30.80 ? 427  ALA A N   1 
ATOM   3446 C  CA  . ALA A 1 427 ? 14.716  80.204 64.897 1.00 31.14 ? 427  ALA A CA  1 
ATOM   3447 C  C   . ALA A 1 427 ? 14.801  81.129 66.114 1.00 31.77 ? 427  ALA A C   1 
ATOM   3448 O  O   . ALA A 1 427 ? 14.589  80.695 67.263 1.00 31.02 ? 427  ALA A O   1 
ATOM   3449 C  CB  . ALA A 1 427 ? 13.274  80.024 64.481 1.00 31.15 ? 427  ALA A CB  1 
ATOM   3450 N  N   . SER A 1 428 ? 15.085  82.401 65.838 1.00 31.72 ? 428  SER A N   1 
ATOM   3451 C  CA  . SER A 1 428 ? 15.317  83.412 66.868 1.00 32.93 ? 428  SER A CA  1 
ATOM   3452 C  C   . SER A 1 428 ? 14.095  83.609 67.756 1.00 33.21 ? 428  SER A C   1 
ATOM   3453 O  O   . SER A 1 428 ? 14.234  83.986 68.909 1.00 34.16 ? 428  SER A O   1 
ATOM   3454 C  CB  . SER A 1 428 ? 15.728  84.747 66.222 1.00 33.08 ? 428  SER A CB  1 
ATOM   3455 O  OG  . SER A 1 428 ? 14.632  85.294 65.499 1.00 32.17 ? 428  SER A OG  1 
ATOM   3456 N  N   . ASN A 1 429 ? 12.907  83.325 67.226 1.00 33.38 ? 429  ASN A N   1 
ATOM   3457 C  CA  . ASN A 1 429 ? 11.646  83.549 67.945 1.00 33.67 ? 429  ASN A CA  1 
ATOM   3458 C  C   . ASN A 1 429 ? 10.932  82.252 68.392 1.00 33.34 ? 429  ASN A C   1 
ATOM   3459 O  O   . ASN A 1 429 ? 9.729   82.256 68.664 1.00 33.23 ? 429  ASN A O   1 
ATOM   3460 C  CB  . ASN A 1 429 ? 10.699  84.356 67.058 1.00 34.02 ? 429  ASN A CB  1 
ATOM   3461 C  CG  . ASN A 1 429 ? 10.372  83.630 65.753 1.00 35.58 ? 429  ASN A CG  1 
ATOM   3462 O  OD1 . ASN A 1 429 ? 10.807  82.491 65.533 1.00 33.54 ? 429  ASN A OD1 1 
ATOM   3463 N  ND2 . ASN A 1 429 ? 9.616   84.294 64.878 1.00 34.96 ? 429  ASN A ND2 1 
ATOM   3464 N  N   . LEU A 1 430 ? 11.672  81.150 68.443 1.00 32.69 ? 430  LEU A N   1 
ATOM   3465 C  CA  . LEU A 1 430 ? 11.104  79.838 68.786 1.00 32.84 ? 430  LEU A CA  1 
ATOM   3466 C  C   . LEU A 1 430 ? 10.512  79.866 70.206 1.00 32.19 ? 430  LEU A C   1 
ATOM   3467 O  O   . LEU A 1 430 ? 11.115  80.433 71.119 1.00 32.39 ? 430  LEU A O   1 
ATOM   3468 C  CB  . LEU A 1 430 ? 12.210  78.791 68.661 1.00 33.03 ? 430  LEU A CB  1 
ATOM   3469 C  CG  . LEU A 1 430 ? 11.981  77.401 68.034 1.00 35.71 ? 430  LEU A CG  1 
ATOM   3470 C  CD1 . LEU A 1 430 ? 11.863  76.375 69.118 1.00 38.28 ? 430  LEU A CD1 1 
ATOM   3471 C  CD2 . LEU A 1 430 ? 10.796  77.332 67.086 1.00 35.13 ? 430  LEU A CD2 1 
ATOM   3472 N  N   . VAL A 1 431 ? 9.322   79.304 70.393 1.00 31.21 ? 431  VAL A N   1 
ATOM   3473 C  CA  . VAL A 1 431 ? 8.683   79.372 71.713 1.00 30.70 ? 431  VAL A CA  1 
ATOM   3474 C  C   . VAL A 1 431 ? 9.014   78.159 72.595 1.00 29.66 ? 431  VAL A C   1 
ATOM   3475 O  O   . VAL A 1 431 ? 8.825   78.191 73.819 1.00 29.21 ? 431  VAL A O   1 
ATOM   3476 C  CB  . VAL A 1 431 ? 7.155   79.603 71.614 1.00 30.68 ? 431  VAL A CB  1 
ATOM   3477 C  CG1 . VAL A 1 431 ? 6.860   80.975 70.985 1.00 31.39 ? 431  VAL A CG1 1 
ATOM   3478 C  CG2 . VAL A 1 431 ? 6.480   78.481 70.802 1.00 32.27 ? 431  VAL A CG2 1 
ATOM   3479 N  N   . TRP A 1 432 ? 9.511   77.096 71.964 1.00 28.46 ? 432  TRP A N   1 
ATOM   3480 C  CA  . TRP A 1 432 ? 9.902   75.874 72.668 1.00 27.38 ? 432  TRP A CA  1 
ATOM   3481 C  C   . TRP A 1 432 ? 11.238  76.085 73.374 1.00 27.00 ? 432  TRP A C   1 
ATOM   3482 O  O   . TRP A 1 432 ? 12.025  76.949 72.960 1.00 27.17 ? 432  TRP A O   1 
ATOM   3483 C  CB  . TRP A 1 432 ? 10.030  74.699 71.686 1.00 27.17 ? 432  TRP A CB  1 
ATOM   3484 C  CG  . TRP A 1 432 ? 8.719   74.268 71.092 1.00 25.90 ? 432  TRP A CG  1 
ATOM   3485 C  CD1 . TRP A 1 432 ? 8.266   74.522 69.823 1.00 25.28 ? 432  TRP A CD1 1 
ATOM   3486 C  CD2 . TRP A 1 432 ? 7.700   73.492 71.736 1.00 25.66 ? 432  TRP A CD2 1 
ATOM   3487 N  NE1 . TRP A 1 432 ? 7.018   73.966 69.642 1.00 25.59 ? 432  TRP A NE1 1 
ATOM   3488 C  CE2 . TRP A 1 432 ? 6.646   73.324 70.797 1.00 26.02 ? 432  TRP A CE2 1 
ATOM   3489 C  CE3 . TRP A 1 432 ? 7.558   72.943 73.025 1.00 23.79 ? 432  TRP A CE3 1 
ATOM   3490 C  CZ2 . TRP A 1 432 ? 5.464   72.634 71.105 1.00 24.88 ? 432  TRP A CZ2 1 
ATOM   3491 C  CZ3 . TRP A 1 432 ? 6.385   72.232 73.325 1.00 24.99 ? 432  TRP A CZ3 1 
ATOM   3492 C  CH2 . TRP A 1 432 ? 5.358   72.078 72.363 1.00 26.56 ? 432  TRP A CH2 1 
ATOM   3493 N  N   . PRO A 1 433 ? 11.511  75.290 74.429 1.00 26.71 ? 433  PRO A N   1 
ATOM   3494 C  CA  . PRO A 1 433 ? 12.780  75.444 75.134 1.00 27.08 ? 433  PRO A CA  1 
ATOM   3495 C  C   . PRO A 1 433 ? 14.012  75.147 74.279 1.00 27.39 ? 433  PRO A C   1 
ATOM   3496 O  O   . PRO A 1 433 ? 13.966  74.339 73.338 1.00 26.94 ? 433  PRO A O   1 
ATOM   3497 C  CB  . PRO A 1 433 ? 12.682  74.406 76.257 1.00 26.95 ? 433  PRO A CB  1 
ATOM   3498 C  CG  . PRO A 1 433 ? 11.709  73.376 75.725 1.00 26.28 ? 433  PRO A CG  1 
ATOM   3499 C  CD  . PRO A 1 433 ? 10.683  74.234 75.048 1.00 26.02 ? 433  PRO A CD  1 
ATOM   3500 N  N   . GLU A 1 434 ? 15.104  75.798 74.653 1.00 27.45 ? 434  GLU A N   1 
ATOM   3501 C  CA  . GLU A 1 434 ? 16.402  75.677 74.001 1.00 28.01 ? 434  GLU A CA  1 
ATOM   3502 C  C   . GLU A 1 434 ? 16.915  74.237 73.864 1.00 27.25 ? 434  GLU A C   1 
ATOM   3503 O  O   . GLU A 1 434 ? 17.547  73.895 72.849 1.00 27.13 ? 434  GLU A O   1 
ATOM   3504 C  CB  . GLU A 1 434 ? 17.423  76.529 74.767 1.00 28.63 ? 434  GLU A CB  1 
ATOM   3505 C  CG  . GLU A 1 434 ? 18.626  76.931 73.940 1.00 32.59 ? 434  GLU A CG  1 
ATOM   3506 C  CD  . GLU A 1 434 ? 18.298  78.015 72.914 0.50 34.23 ? 434  GLU A CD  1 
ATOM   3507 O  OE1 . GLU A 1 434 ? 17.394  78.842 73.178 0.50 35.70 ? 434  GLU A OE1 1 
ATOM   3508 O  OE2 . GLU A 1 434 ? 18.949  78.040 71.847 0.50 34.69 ? 434  GLU A OE2 1 
ATOM   3509 N  N   . TRP A 1 435 ? 16.658  73.394 74.870 1.00 26.06 ? 435  TRP A N   1 
ATOM   3510 C  CA  . TRP A 1 435 ? 17.136  72.001 74.828 1.00 25.22 ? 435  TRP A CA  1 
ATOM   3511 C  C   . TRP A 1 435 ? 16.594  71.220 73.619 1.00 25.08 ? 435  TRP A C   1 
ATOM   3512 O  O   . TRP A 1 435 ? 17.224  70.270 73.156 1.00 24.81 ? 435  TRP A O   1 
ATOM   3513 C  CB  . TRP A 1 435 ? 16.841  71.224 76.140 1.00 25.52 ? 435  TRP A CB  1 
ATOM   3514 C  CG  . TRP A 1 435 ? 15.386  70.838 76.432 1.00 24.25 ? 435  TRP A CG  1 
ATOM   3515 C  CD1 . TRP A 1 435 ? 14.521  71.492 77.269 1.00 23.42 ? 435  TRP A CD1 1 
ATOM   3516 C  CD2 . TRP A 1 435 ? 14.662  69.683 75.936 1.00 23.20 ? 435  TRP A CD2 1 
ATOM   3517 N  NE1 . TRP A 1 435 ? 13.310  70.828 77.324 1.00 22.55 ? 435  TRP A NE1 1 
ATOM   3518 C  CE2 . TRP A 1 435 ? 13.363  69.729 76.501 1.00 22.52 ? 435  TRP A CE2 1 
ATOM   3519 C  CE3 . TRP A 1 435 ? 14.980  68.638 75.054 1.00 22.25 ? 435  TRP A CE3 1 
ATOM   3520 C  CZ2 . TRP A 1 435 ? 12.376  68.763 76.215 1.00 23.28 ? 435  TRP A CZ2 1 
ATOM   3521 C  CZ3 . TRP A 1 435 ? 13.999  67.664 74.771 1.00 23.06 ? 435  TRP A CZ3 1 
ATOM   3522 C  CH2 . TRP A 1 435 ? 12.709  67.744 75.340 1.00 22.64 ? 435  TRP A CH2 1 
ATOM   3523 N  N   . MET A 1 436 ? 15.430  71.617 73.126 1.00 24.35 ? 436  MET A N   1 
ATOM   3524 C  CA  . MET A 1 436 ? 14.810  70.898 72.013 1.00 24.21 ? 436  MET A CA  1 
ATOM   3525 C  C   . MET A 1 436 ? 15.495  71.152 70.672 1.00 24.02 ? 436  MET A C   1 
ATOM   3526 O  O   . MET A 1 436 ? 15.309  70.373 69.743 1.00 23.77 ? 436  MET A O   1 
ATOM   3527 C  CB  . MET A 1 436 ? 13.320  71.192 71.932 1.00 23.92 ? 436  MET A CB  1 
ATOM   3528 C  CG  . MET A 1 436 ? 12.548  70.611 73.091 1.00 23.02 ? 436  MET A CG  1 
ATOM   3529 S  SD  . MET A 1 436 ? 10.833  71.122 73.103 1.00 23.68 ? 436  MET A SD  1 
ATOM   3530 C  CE  . MET A 1 436 ? 10.155  69.968 71.886 1.00 24.52 ? 436  MET A CE  1 
ATOM   3531 N  N   . GLY A 1 437 ? 16.278  72.232 70.593 1.00 23.93 ? 437  GLY A N   1 
ATOM   3532 C  CA  . GLY A 1 437 ? 17.111  72.539 69.423 1.00 23.82 ? 437  GLY A CA  1 
ATOM   3533 C  C   . GLY A 1 437 ? 16.316  72.891 68.169 1.00 23.96 ? 437  GLY A C   1 
ATOM   3534 O  O   . GLY A 1 437 ? 15.382  73.710 68.200 1.00 23.78 ? 437  GLY A O   1 
ATOM   3535 N  N   . VAL A 1 438 ? 16.694  72.262 67.061 1.00 23.96 ? 438  VAL A N   1 
ATOM   3536 C  CA  . VAL A 1 438 ? 16.042  72.491 65.767 1.00 23.57 ? 438  VAL A CA  1 
ATOM   3537 C  C   . VAL A 1 438 ? 15.016  71.379 65.531 1.00 23.41 ? 438  VAL A C   1 
ATOM   3538 O  O   . VAL A 1 438 ? 15.340  70.270 65.077 1.00 22.72 ? 438  VAL A O   1 
ATOM   3539 C  CB  . VAL A 1 438 ? 17.090  72.568 64.630 1.00 24.19 ? 438  VAL A CB  1 
ATOM   3540 C  CG1 . VAL A 1 438 ? 16.425  72.965 63.287 1.00 23.09 ? 438  VAL A CG1 1 
ATOM   3541 C  CG2 . VAL A 1 438 ? 18.210  73.582 64.998 1.00 24.13 ? 438  VAL A CG2 1 
ATOM   3542 N  N   . ILE A 1 439 ? 13.775  71.709 65.849 1.00 23.62 ? 439  ILE A N   1 
ATOM   3543 C  CA  . ILE A 1 439 ? 12.727  70.724 66.070 1.00 24.22 ? 439  ILE A CA  1 
ATOM   3544 C  C   . ILE A 1 439 ? 12.100  70.186 64.771 1.00 24.66 ? 439  ILE A C   1 
ATOM   3545 O  O   . ILE A 1 439 ? 12.027  70.888 63.761 1.00 23.77 ? 439  ILE A O   1 
ATOM   3546 C  CB  . ILE A 1 439 ? 11.621  71.325 66.995 1.00 24.36 ? 439  ILE A CB  1 
ATOM   3547 C  CG1 . ILE A 1 439 ? 12.231  71.761 68.338 1.00 25.13 ? 439  ILE A CG1 1 
ATOM   3548 C  CG2 . ILE A 1 439 ? 10.497  70.345 67.235 1.00 24.62 ? 439  ILE A CG2 1 
ATOM   3549 C  CD1 . ILE A 1 439 ? 11.314  72.684 69.152 1.00 25.97 ? 439  ILE A CD1 1 
ATOM   3550 N  N   . HIS A 1 440 ? 11.700  68.916 64.830 1.00 25.00 ? 440  HIS A N   1 
ATOM   3551 C  CA  . HIS A 1 440 ? 10.790  68.299 63.877 1.00 25.94 ? 440  HIS A CA  1 
ATOM   3552 C  C   . HIS A 1 440 ? 9.678   69.278 63.496 1.00 25.37 ? 440  HIS A C   1 
ATOM   3553 O  O   . HIS A 1 440 ? 8.867   69.656 64.339 1.00 26.42 ? 440  HIS A O   1 
ATOM   3554 C  CB  . HIS A 1 440 ? 10.178  67.055 64.533 1.00 26.20 ? 440  HIS A CB  1 
ATOM   3555 C  CG  . HIS A 1 440 ? 9.507   66.129 63.574 1.00 28.88 ? 440  HIS A CG  1 
ATOM   3556 N  ND1 . HIS A 1 440 ? 10.188  65.488 62.557 1.00 31.28 ? 440  HIS A ND1 1 
ATOM   3557 C  CD2 . HIS A 1 440 ? 8.225   65.704 63.495 1.00 30.09 ? 440  HIS A CD2 1 
ATOM   3558 C  CE1 . HIS A 1 440 ? 9.352   64.708 61.893 1.00 29.77 ? 440  HIS A CE1 1 
ATOM   3559 N  NE2 . HIS A 1 440 ? 8.155   64.823 62.442 1.00 30.60 ? 440  HIS A NE2 1 
ATOM   3560 N  N   . GLY A 1 441 ? 9.662   69.709 62.239 1.00 24.47 ? 441  GLY A N   1 
ATOM   3561 C  CA  . GLY A 1 441 ? 8.587   70.557 61.739 1.00 23.45 ? 441  GLY A CA  1 
ATOM   3562 C  C   . GLY A 1 441 ? 8.952   72.019 61.606 1.00 23.51 ? 441  GLY A C   1 
ATOM   3563 O  O   . GLY A 1 441 ? 8.198   72.793 61.025 1.00 22.74 ? 441  GLY A O   1 
ATOM   3564 N  N   . TYR A 1 442 ? 10.106  72.418 62.146 1.00 23.49 ? 442  TYR A N   1 
ATOM   3565 C  CA  . TYR A 1 442 ? 10.383  73.845 62.254 1.00 23.68 ? 442  TYR A CA  1 
ATOM   3566 C  C   . TYR A 1 442 ? 11.139  74.452 61.071 1.00 24.40 ? 442  TYR A C   1 
ATOM   3567 O  O   . TYR A 1 442 ? 11.437  75.654 61.058 1.00 24.53 ? 442  TYR A O   1 
ATOM   3568 C  CB  . TYR A 1 442 ? 10.906  74.219 63.669 1.00 24.04 ? 442  TYR A CB  1 
ATOM   3569 C  CG  . TYR A 1 442 ? 9.717   74.241 64.593 1.00 24.95 ? 442  TYR A CG  1 
ATOM   3570 C  CD1 . TYR A 1 442 ? 9.211   73.053 65.153 1.00 22.60 ? 442  TYR A CD1 1 
ATOM   3571 C  CD2 . TYR A 1 442 ? 9.019   75.428 64.826 1.00 24.64 ? 442  TYR A CD2 1 
ATOM   3572 C  CE1 . TYR A 1 442 ? 8.070   73.070 65.952 1.00 24.23 ? 442  TYR A CE1 1 
ATOM   3573 C  CE2 . TYR A 1 442 ? 7.888   75.443 65.623 1.00 25.04 ? 442  TYR A CE2 1 
ATOM   3574 C  CZ  . TYR A 1 442 ? 7.428   74.261 66.181 1.00 24.42 ? 442  TYR A CZ  1 
ATOM   3575 O  OH  . TYR A 1 442 ? 6.296   74.278 66.943 1.00 28.55 ? 442  TYR A OH  1 
ATOM   3576 N  N   . GLU A 1 443 ? 11.399  73.628 60.053 1.00 24.13 ? 443  GLU A N   1 
ATOM   3577 C  CA  . GLU A 1 443 ? 11.841  74.155 58.759 1.00 24.34 ? 443  GLU A CA  1 
ATOM   3578 C  C   . GLU A 1 443 ? 10.640  74.639 57.925 1.00 24.11 ? 443  GLU A C   1 
ATOM   3579 O  O   . GLU A 1 443 ? 10.811  75.429 56.990 1.00 23.77 ? 443  GLU A O   1 
ATOM   3580 C  CB  . GLU A 1 443 ? 12.681  73.113 57.981 1.00 24.13 ? 443  GLU A CB  1 
ATOM   3581 C  CG  . GLU A 1 443 ? 11.878  72.131 57.082 1.00 23.99 ? 443  GLU A CG  1 
ATOM   3582 C  CD  . GLU A 1 443 ? 10.937  71.183 57.848 1.00 24.45 ? 443  GLU A CD  1 
ATOM   3583 O  OE1 . GLU A 1 443 ? 10.958  71.126 59.103 1.00 23.31 ? 443  GLU A OE1 1 
ATOM   3584 O  OE2 . GLU A 1 443 ? 10.157  70.480 57.178 1.00 24.64 ? 443  GLU A OE2 1 
ATOM   3585 N  N   . ILE A 1 444 ? 9.431   74.179 58.267 1.00 24.19 ? 444  ILE A N   1 
ATOM   3586 C  CA  . ILE A 1 444 ? 8.267   74.432 57.416 1.00 24.13 ? 444  ILE A CA  1 
ATOM   3587 C  C   . ILE A 1 444 ? 8.010   75.932 57.254 1.00 25.11 ? 444  ILE A C   1 
ATOM   3588 O  O   . ILE A 1 444 ? 7.698   76.417 56.155 1.00 25.01 ? 444  ILE A O   1 
ATOM   3589 C  CB  . ILE A 1 444 ? 6.988   73.702 57.922 1.00 24.20 ? 444  ILE A CB  1 
ATOM   3590 C  CG1 . ILE A 1 444 ? 7.187   72.180 57.876 1.00 23.36 ? 444  ILE A CG1 1 
ATOM   3591 C  CG2 . ILE A 1 444 ? 5.753   74.111 57.087 1.00 22.43 ? 444  ILE A CG2 1 
ATOM   3592 C  CD1 . ILE A 1 444 ? 6.058   71.407 58.505 1.00 18.95 ? 444  ILE A CD1 1 
ATOM   3593 N  N   . GLU A 1 445 ? 8.168   76.662 58.352 1.00 25.01 ? 445  GLU A N   1 
ATOM   3594 C  CA  . GLU A 1 445 ? 7.945   78.097 58.351 1.00 25.80 ? 445  GLU A CA  1 
ATOM   3595 C  C   . GLU A 1 445 ? 8.900   78.818 57.411 1.00 25.06 ? 445  GLU A C   1 
ATOM   3596 O  O   . GLU A 1 445 ? 8.527   79.830 56.837 1.00 25.73 ? 445  GLU A O   1 
ATOM   3597 C  CB  . GLU A 1 445 ? 7.971   78.691 59.779 1.00 25.57 ? 445  GLU A CB  1 
ATOM   3598 C  CG  . GLU A 1 445 ? 9.202   78.371 60.593 1.00 26.53 ? 445  GLU A CG  1 
ATOM   3599 C  CD  . GLU A 1 445 ? 8.943   78.485 62.083 1.00 29.40 ? 445  GLU A CD  1 
ATOM   3600 O  OE1 . GLU A 1 445 ? 8.146   77.685 62.610 1.00 29.44 ? 445  GLU A OE1 1 
ATOM   3601 O  OE2 . GLU A 1 445 ? 9.549   79.369 62.720 1.00 30.30 ? 445  GLU A OE2 1 
ATOM   3602 N  N   . PHE A 1 446 ? 10.099  78.272 57.226 1.00 25.67 ? 446  PHE A N   1 
ATOM   3603 C  CA  . PHE A 1 446 ? 11.070  78.821 56.274 1.00 25.85 ? 446  PHE A CA  1 
ATOM   3604 C  C   . PHE A 1 446 ? 10.693  78.477 54.824 1.00 26.42 ? 446  PHE A C   1 
ATOM   3605 O  O   . PHE A 1 446 ? 10.800  79.321 53.922 1.00 26.17 ? 446  PHE A O   1 
ATOM   3606 C  CB  . PHE A 1 446 ? 12.490  78.368 56.615 1.00 25.86 ? 446  PHE A CB  1 
ATOM   3607 C  CG  . PHE A 1 446 ? 13.054  79.064 57.830 1.00 28.16 ? 446  PHE A CG  1 
ATOM   3608 C  CD1 . PHE A 1 446 ? 12.764  78.595 59.115 1.00 27.31 ? 446  PHE A CD1 1 
ATOM   3609 C  CD2 . PHE A 1 446 ? 13.809  80.240 57.689 1.00 28.68 ? 446  PHE A CD2 1 
ATOM   3610 C  CE1 . PHE A 1 446 ? 13.247  79.265 60.247 1.00 27.70 ? 446  PHE A CE1 1 
ATOM   3611 C  CE2 . PHE A 1 446 ? 14.284  80.920 58.806 1.00 27.48 ? 446  PHE A CE2 1 
ATOM   3612 C  CZ  . PHE A 1 446 ? 14.001  80.425 60.095 1.00 28.46 ? 446  PHE A CZ  1 
ATOM   3613 N  N   . VAL A 1 447 ? 10.233  77.243 54.617 1.00 25.83 ? 447  VAL A N   1 
ATOM   3614 C  CA  . VAL A 1 447 ? 9.808   76.773 53.285 1.00 25.32 ? 447  VAL A CA  1 
ATOM   3615 C  C   . VAL A 1 447 ? 8.609   77.594 52.778 1.00 25.14 ? 447  VAL A C   1 
ATOM   3616 O  O   . VAL A 1 447 ? 8.521   77.916 51.597 1.00 24.83 ? 447  VAL A O   1 
ATOM   3617 C  CB  . VAL A 1 447 ? 9.471   75.277 53.319 1.00 24.40 ? 447  VAL A CB  1 
ATOM   3618 C  CG1 . VAL A 1 447 ? 8.737   74.844 52.030 1.00 25.40 ? 447  VAL A CG1 1 
ATOM   3619 C  CG2 . VAL A 1 447 ? 10.742  74.461 53.528 1.00 23.62 ? 447  VAL A CG2 1 
ATOM   3620 N  N   . PHE A 1 448 ? 7.711   77.958 53.686 1.00 25.52 ? 448  PHE A N   1 
ATOM   3621 C  CA  . PHE A 1 448 ? 6.528   78.736 53.332 1.00 26.11 ? 448  PHE A CA  1 
ATOM   3622 C  C   . PHE A 1 448 ? 6.667   80.265 53.425 1.00 26.76 ? 448  PHE A C   1 
ATOM   3623 O  O   . PHE A 1 448 ? 5.674   80.985 53.248 1.00 26.66 ? 448  PHE A O   1 
ATOM   3624 C  CB  . PHE A 1 448 ? 5.332   78.260 54.144 1.00 25.27 ? 448  PHE A CB  1 
ATOM   3625 C  CG  . PHE A 1 448 ? 4.709   77.012 53.594 1.00 26.28 ? 448  PHE A CG  1 
ATOM   3626 C  CD1 . PHE A 1 448 ? 5.273   75.757 53.858 1.00 24.05 ? 448  PHE A CD1 1 
ATOM   3627 C  CD2 . PHE A 1 448 ? 3.575   77.087 52.791 1.00 24.60 ? 448  PHE A CD2 1 
ATOM   3628 C  CE1 . PHE A 1 448 ? 4.704   74.584 53.321 1.00 25.72 ? 448  PHE A CE1 1 
ATOM   3629 C  CE2 . PHE A 1 448 ? 2.988   75.920 52.260 1.00 25.26 ? 448  PHE A CE2 1 
ATOM   3630 C  CZ  . PHE A 1 448 ? 3.556   74.671 52.523 1.00 24.83 ? 448  PHE A CZ  1 
ATOM   3631 N  N   . GLY A 1 449 ? 7.874   80.751 53.710 1.00 27.77 ? 449  GLY A N   1 
ATOM   3632 C  CA  . GLY A 1 449 ? 8.153   82.207 53.718 1.00 29.00 ? 449  GLY A CA  1 
ATOM   3633 C  C   . GLY A 1 449 ? 7.583   83.070 54.842 1.00 30.07 ? 449  GLY A C   1 
ATOM   3634 O  O   . GLY A 1 449 ? 7.408   84.289 54.674 1.00 30.35 ? 449  GLY A O   1 
ATOM   3635 N  N   . LEU A 1 450 ? 7.293   82.471 55.993 1.00 30.10 ? 450  LEU A N   1 
ATOM   3636 C  CA  A LEU A 1 450 ? 6.755   83.228 57.118 0.50 30.32 ? 450  LEU A CA  1 
ATOM   3637 C  CA  B LEU A 1 450 ? 6.759   83.228 57.125 0.50 30.34 ? 450  LEU A CA  1 
ATOM   3638 C  C   . LEU A 1 450 ? 7.734   84.314 57.601 1.00 30.49 ? 450  LEU A C   1 
ATOM   3639 O  O   . LEU A 1 450 ? 7.298   85.370 58.022 1.00 30.63 ? 450  LEU A O   1 
ATOM   3640 C  CB  A LEU A 1 450 ? 6.343   82.304 58.269 0.50 30.08 ? 450  LEU A CB  1 
ATOM   3641 C  CB  B LEU A 1 450 ? 6.372   82.314 58.291 0.50 30.11 ? 450  LEU A CB  1 
ATOM   3642 C  CG  A LEU A 1 450 ? 4.971   81.625 58.172 0.50 30.28 ? 450  LEU A CG  1 
ATOM   3643 C  CG  B LEU A 1 450 ? 5.083   81.504 58.144 0.50 30.38 ? 450  LEU A CG  1 
ATOM   3644 C  CD1 A LEU A 1 450 ? 3.855   82.642 58.293 0.50 29.55 ? 450  LEU A CD1 1 
ATOM   3645 C  CD1 B LEU A 1 450 ? 4.582   81.058 59.506 0.50 28.57 ? 450  LEU A CD1 1 
ATOM   3646 C  CD2 A LEU A 1 450 ? 4.817   80.817 56.886 0.50 28.74 ? 450  LEU A CD2 1 
ATOM   3647 C  CD2 B LEU A 1 450 ? 4.023   82.316 57.437 0.50 30.06 ? 450  LEU A CD2 1 
ATOM   3648 N  N   . PRO A 1 451 ? 9.064   84.061 57.514 1.00 30.93 ? 451  PRO A N   1 
ATOM   3649 C  CA  . PRO A 1 451 ? 10.043  85.097 57.898 1.00 32.12 ? 451  PRO A CA  1 
ATOM   3650 C  C   . PRO A 1 451 ? 10.072  86.367 57.035 1.00 33.34 ? 451  PRO A C   1 
ATOM   3651 O  O   . PRO A 1 451 ? 10.820  87.301 57.349 1.00 33.16 ? 451  PRO A O   1 
ATOM   3652 C  CB  . PRO A 1 451 ? 11.383  84.369 57.767 1.00 32.07 ? 451  PRO A CB  1 
ATOM   3653 C  CG  . PRO A 1 451 ? 11.026  82.928 58.049 1.00 31.27 ? 451  PRO A CG  1 
ATOM   3654 C  CD  . PRO A 1 451 ? 9.752   82.772 57.284 1.00 31.16 ? 451  PRO A CD  1 
ATOM   3655 N  N   . LEU A 1 452 ? 9.272   86.397 55.970 1.00 33.61 ? 452  LEU A N   1 
ATOM   3656 C  CA  . LEU A 1 452 ? 9.138   87.596 55.154 1.00 34.15 ? 452  LEU A CA  1 
ATOM   3657 C  C   . LEU A 1 452 ? 8.099   88.527 55.729 1.00 35.13 ? 452  LEU A C   1 
ATOM   3658 O  O   . LEU A 1 452 ? 8.008   89.674 55.295 1.00 35.83 ? 452  LEU A O   1 
ATOM   3659 C  CB  . LEU A 1 452 ? 8.758   87.240 53.715 1.00 33.09 ? 452  LEU A CB  1 
ATOM   3660 C  CG  . LEU A 1 452 ? 9.838   86.733 52.764 1.00 32.39 ? 452  LEU A CG  1 
ATOM   3661 C  CD1 . LEU A 1 452 ? 10.547  85.443 53.261 1.00 29.65 ? 452  LEU A CD1 1 
ATOM   3662 C  CD2 . LEU A 1 452 ? 9.218   86.518 51.377 1.00 30.98 ? 452  LEU A CD2 1 
ATOM   3663 N  N   . VAL A 1 453 ? 7.301   88.028 56.675 1.00 35.83 ? 453  VAL A N   1 
ATOM   3664 C  CA  . VAL A 1 453 ? 6.251   88.810 57.304 1.00 37.00 ? 453  VAL A CA  1 
ATOM   3665 C  C   . VAL A 1 453 ? 6.802   89.583 58.517 1.00 38.18 ? 453  VAL A C   1 
ATOM   3666 O  O   . VAL A 1 453 ? 7.177   88.991 59.544 1.00 37.22 ? 453  VAL A O   1 
ATOM   3667 C  CB  . VAL A 1 453 ? 5.064   87.929 57.750 1.00 36.98 ? 453  VAL A CB  1 
ATOM   3668 C  CG1 . VAL A 1 453 ? 3.936   88.795 58.319 1.00 37.53 ? 453  VAL A CG1 1 
ATOM   3669 C  CG2 . VAL A 1 453 ? 4.545   87.099 56.595 1.00 36.94 ? 453  VAL A CG2 1 
ATOM   3670 N  N   . LYS A 1 454 ? 6.830   90.906 58.375 1.00 39.73 ? 454  LYS A N   1 
ATOM   3671 C  CA  . LYS A 1 454 ? 7.333   91.841 59.394 1.00 41.38 ? 454  LYS A CA  1 
ATOM   3672 C  C   . LYS A 1 454 ? 6.830   91.545 60.817 1.00 41.60 ? 454  LYS A C   1 
ATOM   3673 O  O   . LYS A 1 454 ? 7.628   91.387 61.743 1.00 41.52 ? 454  LYS A O   1 
ATOM   3674 C  CB  . LYS A 1 454 ? 6.965   93.269 58.971 1.00 41.91 ? 454  LYS A CB  1 
ATOM   3675 C  CG  . LYS A 1 454 ? 7.588   94.381 59.787 1.00 45.15 ? 454  LYS A CG  1 
ATOM   3676 C  CD  . LYS A 1 454 ? 7.254   95.757 59.167 1.00 49.98 ? 454  LYS A CD  1 
ATOM   3677 C  CE  . LYS A 1 454 ? 7.753   96.921 60.038 1.00 53.38 ? 454  LYS A CE  1 
ATOM   3678 N  NZ  . LYS A 1 454 ? 9.238   96.889 60.251 1.00 55.42 ? 454  LYS A NZ  1 
ATOM   3679 N  N   . GLU A 1 455 ? 5.512   91.440 60.968 1.00 42.14 ? 455  GLU A N   1 
ATOM   3680 C  CA  . GLU A 1 455 ? 4.860   91.249 62.268 1.00 43.28 ? 455  GLU A CA  1 
ATOM   3681 C  C   . GLU A 1 455 ? 5.238   89.960 63.005 1.00 43.13 ? 455  GLU A C   1 
ATOM   3682 O  O   . GLU A 1 455 ? 4.941   89.820 64.194 1.00 43.44 ? 455  GLU A O   1 
ATOM   3683 C  CB  . GLU A 1 455 ? 3.331   91.308 62.119 1.00 43.81 ? 455  GLU A CB  1 
ATOM   3684 C  CG  . GLU A 1 455 ? 2.776   92.650 61.624 1.00 47.86 ? 455  GLU A CG  1 
ATOM   3685 C  CD  . GLU A 1 455 ? 2.983   92.899 60.120 1.00 52.50 ? 455  GLU A CD  1 
ATOM   3686 O  OE1 . GLU A 1 455 ? 3.332   91.948 59.378 1.00 53.60 ? 455  GLU A OE1 1 
ATOM   3687 O  OE2 . GLU A 1 455 ? 2.785   94.060 59.678 1.00 55.00 ? 455  GLU A OE2 1 
ATOM   3688 N  N   . LEU A 1 456 ? 5.898   89.027 62.325 1.00 42.68 ? 456  LEU A N   1 
ATOM   3689 C  CA  . LEU A 1 456 ? 6.243   87.754 62.957 1.00 42.44 ? 456  LEU A CA  1 
ATOM   3690 C  C   . LEU A 1 456 ? 7.601   87.758 63.664 1.00 42.65 ? 456  LEU A C   1 
ATOM   3691 O  O   . LEU A 1 456 ? 7.963   86.775 64.317 1.00 42.88 ? 456  LEU A O   1 
ATOM   3692 C  CB  . LEU A 1 456 ? 6.128   86.589 61.966 1.00 41.76 ? 456  LEU A CB  1 
ATOM   3693 C  CG  . LEU A 1 456 ? 4.730   86.337 61.395 1.00 41.68 ? 456  LEU A CG  1 
ATOM   3694 C  CD1 . LEU A 1 456 ? 4.778   85.184 60.395 1.00 39.44 ? 456  LEU A CD1 1 
ATOM   3695 C  CD2 . LEU A 1 456 ? 3.690   86.076 62.489 1.00 40.23 ? 456  LEU A CD2 1 
ATOM   3696 N  N   . ASN A 1 457 ? 8.343   88.859 63.531 1.00 42.74 ? 457  ASN A N   1 
ATOM   3697 C  CA  . ASN A 1 457 ? 9.540   89.120 64.359 1.00 42.63 ? 457  ASN A CA  1 
ATOM   3698 C  C   . ASN A 1 457 ? 10.722  88.196 64.112 1.00 41.70 ? 457  ASN A C   1 
ATOM   3699 O  O   . ASN A 1 457 ? 11.422  87.823 65.069 1.00 41.78 ? 457  ASN A O   1 
ATOM   3700 C  CB  . ASN A 1 457 ? 9.203   89.076 65.868 1.00 43.60 ? 457  ASN A CB  1 
ATOM   3701 C  CG  . ASN A 1 457 ? 8.188   90.131 66.281 1.00 46.05 ? 457  ASN A CG  1 
ATOM   3702 O  OD1 . ASN A 1 457 ? 8.210   91.259 65.782 1.00 50.22 ? 457  ASN A OD1 1 
ATOM   3703 N  ND2 . ASN A 1 457 ? 7.294   89.769 67.203 1.00 48.54 ? 457  ASN A ND2 1 
ATOM   3704 N  N   . TYR A 1 458 ? 10.936  87.798 62.858 1.00 39.75 ? 458  TYR A N   1 
ATOM   3705 C  CA  . TYR A 1 458 ? 12.142  87.048 62.513 1.00 38.40 ? 458  TYR A CA  1 
ATOM   3706 C  C   . TYR A 1 458 ? 13.250  88.061 62.253 1.00 38.06 ? 458  TYR A C   1 
ATOM   3707 O  O   . TYR A 1 458 ? 12.969  89.234 62.041 1.00 38.71 ? 458  TYR A O   1 
ATOM   3708 C  CB  . TYR A 1 458 ? 11.926  86.184 61.263 1.00 37.57 ? 458  TYR A CB  1 
ATOM   3709 C  CG  . TYR A 1 458 ? 11.045  84.964 61.447 1.00 35.90 ? 458  TYR A CG  1 
ATOM   3710 C  CD1 . TYR A 1 458 ? 11.595  83.735 61.825 1.00 33.94 ? 458  TYR A CD1 1 
ATOM   3711 C  CD2 . TYR A 1 458 ? 9.669   85.024 61.202 1.00 34.24 ? 458  TYR A CD2 1 
ATOM   3712 C  CE1 . TYR A 1 458 ? 10.785  82.597 61.982 1.00 32.77 ? 458  TYR A CE1 1 
ATOM   3713 C  CE2 . TYR A 1 458 ? 8.851   83.884 61.334 1.00 33.02 ? 458  TYR A CE2 1 
ATOM   3714 C  CZ  . TYR A 1 458 ? 9.420   82.678 61.732 1.00 31.15 ? 458  TYR A CZ  1 
ATOM   3715 O  OH  . TYR A 1 458 ? 8.626   81.550 61.877 1.00 30.66 ? 458  TYR A OH  1 
ATOM   3716 N  N   . THR A 1 459 ? 14.501  87.624 62.256 1.00 37.48 ? 459  THR A N   1 
ATOM   3717 C  CA  . THR A 1 459 ? 15.599  88.526 61.937 1.00 37.18 ? 459  THR A CA  1 
ATOM   3718 C  C   . THR A 1 459 ? 15.740  88.716 60.418 1.00 37.06 ? 459  THR A C   1 
ATOM   3719 O  O   . THR A 1 459 ? 15.171  87.954 59.629 1.00 36.50 ? 459  THR A O   1 
ATOM   3720 C  CB  . THR A 1 459 ? 16.946  88.016 62.485 1.00 36.85 ? 459  THR A CB  1 
ATOM   3721 O  OG1 . THR A 1 459 ? 17.359  86.856 61.750 1.00 37.02 ? 459  THR A OG1 1 
ATOM   3722 C  CG2 . THR A 1 459 ? 16.852  87.704 63.987 1.00 37.31 ? 459  THR A CG2 1 
ATOM   3723 N  N   . ALA A 1 460 ? 16.522  89.720 60.023 1.00 36.25 ? 460  ALA A N   1 
ATOM   3724 C  CA  . ALA A 1 460 ? 16.872  89.927 58.617 1.00 35.86 ? 460  ALA A CA  1 
ATOM   3725 C  C   . ALA A 1 460 ? 17.528  88.688 58.004 1.00 35.17 ? 460  ALA A C   1 
ATOM   3726 O  O   . ALA A 1 460 ? 17.235  88.323 56.866 1.00 35.41 ? 460  ALA A O   1 
ATOM   3727 C  CB  . ALA A 1 460 ? 17.795  91.160 58.464 1.00 36.27 ? 460  ALA A CB  1 
ATOM   3728 N  N   . GLU A 1 461 ? 18.423  88.051 58.750 1.00 34.51 ? 461  GLU A N   1 
ATOM   3729 C  CA  . GLU A 1 461 ? 19.150  86.876 58.256 1.00 34.72 ? 461  GLU A CA  1 
ATOM   3730 C  C   . GLU A 1 461 ? 18.188  85.704 58.045 1.00 33.79 ? 461  GLU A C   1 
ATOM   3731 O  O   . GLU A 1 461 ? 18.385  84.881 57.153 1.00 34.21 ? 461  GLU A O   1 
ATOM   3732 C  CB  . GLU A 1 461 ? 20.256  86.454 59.231 1.00 34.93 ? 461  GLU A CB  1 
ATOM   3733 C  CG  . GLU A 1 461 ? 21.410  87.458 59.407 1.00 38.60 ? 461  GLU A CG  1 
ATOM   3734 C  CD  . GLU A 1 461 ? 21.011  88.723 60.169 1.00 43.13 ? 461  GLU A CD  1 
ATOM   3735 O  OE1 . GLU A 1 461 ? 20.108  88.675 61.044 1.00 43.86 ? 461  GLU A OE1 1 
ATOM   3736 O  OE2 . GLU A 1 461 ? 21.605  89.785 59.878 1.00 48.09 ? 461  GLU A OE2 1 
ATOM   3737 N  N   . GLU A 1 462 ? 17.151  85.641 58.873 1.00 32.92 ? 462  GLU A N   1 
ATOM   3738 C  CA  . GLU A 1 462 ? 16.148  84.584 58.757 1.00 31.94 ? 462  GLU A CA  1 
ATOM   3739 C  C   . GLU A 1 462 ? 15.258  84.771 57.536 1.00 31.77 ? 462  GLU A C   1 
ATOM   3740 O  O   . GLU A 1 462 ? 14.934  83.787 56.861 1.00 30.24 ? 462  GLU A O   1 
ATOM   3741 C  CB  . GLU A 1 462 ? 15.350  84.456 60.053 1.00 31.85 ? 462  GLU A CB  1 
ATOM   3742 C  CG  . GLU A 1 462 ? 16.186  83.719 61.124 1.00 30.97 ? 462  GLU A CG  1 
ATOM   3743 C  CD  . GLU A 1 462 ? 15.582  83.765 62.507 1.00 31.16 ? 462  GLU A CD  1 
ATOM   3744 O  OE1 . GLU A 1 462 ? 14.734  84.638 62.777 1.00 31.78 ? 462  GLU A OE1 1 
ATOM   3745 O  OE2 . GLU A 1 462 ? 15.973  82.919 63.337 1.00 32.60 ? 462  GLU A OE2 1 
ATOM   3746 N  N   . GLU A 1 463 ? 14.889  86.025 57.241 1.00 31.23 ? 463  GLU A N   1 
ATOM   3747 C  CA  . GLU A 1 463 ? 14.192  86.338 55.987 1.00 32.08 ? 463  GLU A CA  1 
ATOM   3748 C  C   . GLU A 1 463 ? 15.027  85.869 54.796 1.00 31.90 ? 463  GLU A C   1 
ATOM   3749 O  O   . GLU A 1 463 ? 14.501  85.214 53.883 1.00 32.58 ? 463  GLU A O   1 
ATOM   3750 C  CB  . GLU A 1 463 ? 13.866  87.842 55.852 1.00 32.57 ? 463  GLU A CB  1 
ATOM   3751 C  CG  . GLU A 1 463 ? 13.577  88.271 54.393 1.00 34.21 ? 463  GLU A CG  1 
ATOM   3752 C  CD  . GLU A 1 463 ? 12.828  89.597 54.232 1.00 36.89 ? 463  GLU A CD  1 
ATOM   3753 O  OE1 . GLU A 1 463 ? 12.650  90.347 55.214 1.00 38.55 ? 463  GLU A OE1 1 
ATOM   3754 O  OE2 . GLU A 1 463 ? 12.401  89.889 53.093 1.00 36.84 ? 463  GLU A OE2 1 
ATOM   3755 N  N   . ALA A 1 464 ? 16.325  86.182 54.825 1.00 31.27 ? 464  ALA A N   1 
ATOM   3756 C  CA  . ALA A 1 464 ? 17.240  85.800 53.757 1.00 30.98 ? 464  ALA A CA  1 
ATOM   3757 C  C   . ALA A 1 464 ? 17.319  84.285 53.610 1.00 30.62 ? 464  ALA A C   1 
ATOM   3758 O  O   . ALA A 1 464 ? 17.307  83.765 52.486 1.00 30.15 ? 464  ALA A O   1 
ATOM   3759 C  CB  . ALA A 1 464 ? 18.649  86.389 53.989 1.00 30.88 ? 464  ALA A CB  1 
ATOM   3760 N  N   . LEU A 1 465 ? 17.418  83.580 54.739 1.00 29.48 ? 465  LEU A N   1 
ATOM   3761 C  CA  . LEU A 1 465 ? 17.400  82.114 54.712 1.00 28.78 ? 465  LEU A CA  1 
ATOM   3762 C  C   . LEU A 1 465 ? 16.113  81.564 54.082 1.00 27.99 ? 465  LEU A C   1 
ATOM   3763 O  O   . LEU A 1 465 ? 16.151  80.638 53.282 1.00 28.40 ? 465  LEU A O   1 
ATOM   3764 C  CB  . LEU A 1 465 ? 17.580  81.546 56.126 1.00 28.61 ? 465  LEU A CB  1 
ATOM   3765 C  CG  . LEU A 1 465 ? 17.558  80.024 56.318 1.00 26.99 ? 465  LEU A CG  1 
ATOM   3766 C  CD1 . LEU A 1 465 ? 18.544  79.261 55.404 1.00 27.13 ? 465  LEU A CD1 1 
ATOM   3767 C  CD2 . LEU A 1 465 ? 17.852  79.724 57.786 1.00 27.08 ? 465  LEU A CD2 1 
ATOM   3768 N  N   . SER A 1 466 ? 14.985  82.127 54.471 1.00 27.73 ? 466  SER A N   1 
ATOM   3769 C  CA  . SER A 1 466 ? 13.686  81.727 53.933 1.00 28.06 ? 466  SER A CA  1 
ATOM   3770 C  C   . SER A 1 466 ? 13.621  81.943 52.412 1.00 28.32 ? 466  SER A C   1 
ATOM   3771 O  O   . SER A 1 466 ? 13.201  81.053 51.663 1.00 27.41 ? 466  SER A O   1 
ATOM   3772 C  CB  . SER A 1 466 ? 12.579  82.499 54.628 1.00 27.90 ? 466  SER A CB  1 
ATOM   3773 O  OG  . SER A 1 466 ? 11.308  82.058 54.186 1.00 27.56 ? 466  SER A OG  1 
ATOM   3774 N  N   . ARG A 1 467 ? 14.063  83.118 51.963 1.00 28.09 ? 467  ARG A N   1 
ATOM   3775 C  CA  . ARG A 1 467 ? 14.094  83.418 50.517 1.00 28.58 ? 467  ARG A CA  1 
ATOM   3776 C  C   . ARG A 1 467 ? 14.983  82.439 49.767 1.00 28.16 ? 467  ARG A C   1 
ATOM   3777 O  O   . ARG A 1 467 ? 14.637  81.980 48.687 1.00 28.52 ? 467  ARG A O   1 
ATOM   3778 C  CB  . ARG A 1 467 ? 14.543  84.864 50.262 1.00 28.30 ? 467  ARG A CB  1 
ATOM   3779 C  CG  . ARG A 1 467 ? 13.495  85.875 50.654 1.00 28.89 ? 467  ARG A CG  1 
ATOM   3780 C  CD  . ARG A 1 467 ? 13.937  87.329 50.388 1.00 30.82 ? 467  ARG A CD  1 
ATOM   3781 N  NE  . ARG A 1 467 ? 12.885  88.257 50.803 1.00 30.96 ? 467  ARG A NE  1 
ATOM   3782 C  CZ  . ARG A 1 467 ? 11.832  88.582 50.058 1.00 31.86 ? 467  ARG A CZ  1 
ATOM   3783 N  NH1 . ARG A 1 467 ? 11.695  88.060 48.843 1.00 31.62 ? 467  ARG A NH1 1 
ATOM   3784 N  NH2 . ARG A 1 467 ? 10.916  89.429 50.521 1.00 31.09 ? 467  ARG A NH2 1 
ATOM   3785 N  N   . ARG A 1 468 ? 16.121  82.112 50.359 1.00 28.41 ? 468  ARG A N   1 
ATOM   3786 C  CA  . ARG A 1 468 ? 17.047  81.137 49.793 1.00 28.50 ? 468  ARG A CA  1 
ATOM   3787 C  C   . ARG A 1 468 ? 16.380  79.750 49.660 1.00 27.94 ? 468  ARG A C   1 
ATOM   3788 O  O   . ARG A 1 468 ? 16.508  79.080 48.630 1.00 26.88 ? 468  ARG A O   1 
ATOM   3789 C  CB  . ARG A 1 468 ? 18.273  81.061 50.699 1.00 29.44 ? 468  ARG A CB  1 
ATOM   3790 C  CG  . ARG A 1 468 ? 19.479  80.300 50.150 1.00 34.25 ? 468  ARG A CG  1 
ATOM   3791 C  CD  . ARG A 1 468 ? 20.647  80.402 51.162 1.00 40.22 ? 468  ARG A CD  1 
ATOM   3792 N  NE  . ARG A 1 468 ? 21.430  79.162 51.196 1.00 44.38 ? 468  ARG A NE  1 
ATOM   3793 C  CZ  . ARG A 1 468 ? 21.937  78.640 52.304 1.00 47.43 ? 468  ARG A CZ  1 
ATOM   3794 N  NH1 . ARG A 1 468 ? 21.741  79.255 53.461 1.00 48.67 ? 468  ARG A NH1 1 
ATOM   3795 N  NH2 . ARG A 1 468 ? 22.638  77.506 52.259 1.00 49.50 ? 468  ARG A NH2 1 
ATOM   3796 N  N   . ILE A 1 469 ? 15.669  79.336 50.711 1.00 27.10 ? 469  ILE A N   1 
ATOM   3797 C  CA  . ILE A 1 469 ? 15.013  78.020 50.739 1.00 26.24 ? 469  ILE A CA  1 
ATOM   3798 C  C   . ILE A 1 469 ? 13.856  77.968 49.743 1.00 26.36 ? 469  ILE A C   1 
ATOM   3799 O  O   . ILE A 1 469 ? 13.777  77.045 48.933 1.00 26.44 ? 469  ILE A O   1 
ATOM   3800 C  CB  . ILE A 1 469 ? 14.567  77.636 52.183 1.00 25.47 ? 469  ILE A CB  1 
ATOM   3801 C  CG1 . ILE A 1 469 ? 15.811  77.287 53.017 1.00 24.99 ? 469  ILE A CG1 1 
ATOM   3802 C  CG2 . ILE A 1 469 ? 13.561  76.462 52.161 1.00 23.34 ? 469  ILE A CG2 1 
ATOM   3803 C  CD1 . ILE A 1 469 ? 15.598  77.200 54.528 1.00 24.44 ? 469  ILE A CD1 1 
ATOM   3804 N  N   . MET A 1 470 ? 12.971  78.961 49.799 1.00 26.62 ? 470  MET A N   1 
ATOM   3805 C  CA  . MET A 1 470 ? 11.855  79.055 48.850 1.00 27.28 ? 470  MET A CA  1 
ATOM   3806 C  C   . MET A 1 470 ? 12.361  78.988 47.404 1.00 27.65 ? 470  MET A C   1 
ATOM   3807 O  O   . MET A 1 470 ? 11.747  78.334 46.546 1.00 27.61 ? 470  MET A O   1 
ATOM   3808 C  CB  . MET A 1 470 ? 11.061  80.340 49.068 1.00 26.79 ? 470  MET A CB  1 
ATOM   3809 C  CG  . MET A 1 470 ? 10.173  80.317 50.306 1.00 27.23 ? 470  MET A CG  1 
ATOM   3810 S  SD  . MET A 1 470 ? 8.892   81.567 50.283 1.00 29.65 ? 470  MET A SD  1 
ATOM   3811 C  CE  . MET A 1 470 ? 9.982   82.965 50.501 1.00 27.20 ? 470  MET A CE  1 
ATOM   3812 N  N   . HIS A 1 471 ? 13.492  79.646 47.150 1.00 27.97 ? 471  HIS A N   1 
ATOM   3813 C  CA  . HIS A 1 471 ? 14.068  79.666 45.809 1.00 28.40 ? 471  HIS A CA  1 
ATOM   3814 C  C   . HIS A 1 471 ? 14.687  78.335 45.398 1.00 27.79 ? 471  HIS A C   1 
ATOM   3815 O  O   . HIS A 1 471 ? 14.551  77.923 44.239 1.00 26.96 ? 471  HIS A O   1 
ATOM   3816 C  CB  . HIS A 1 471 ? 15.065  80.818 45.619 1.00 29.15 ? 471  HIS A CB  1 
ATOM   3817 C  CG  . HIS A 1 471 ? 15.360  81.112 44.177 1.00 32.78 ? 471  HIS A CG  1 
ATOM   3818 N  ND1 . HIS A 1 471 ? 14.385  81.528 43.291 1.00 38.10 ? 471  HIS A ND1 1 
ATOM   3819 C  CD2 . HIS A 1 471 ? 16.504  81.010 43.460 1.00 35.42 ? 471  HIS A CD2 1 
ATOM   3820 C  CE1 . HIS A 1 471 ? 14.924  81.691 42.093 1.00 39.01 ? 471  HIS A CE1 1 
ATOM   3821 N  NE2 . HIS A 1 471 ? 16.208  81.379 42.168 1.00 38.03 ? 471  HIS A NE2 1 
ATOM   3822 N  N   . TYR A 1 472 ? 15.376  77.659 46.323 1.00 26.64 ? 472  TYR A N   1 
ATOM   3823 C  CA  . TYR A 1 472 ? 15.828  76.288 46.058 1.00 26.41 ? 472  TYR A CA  1 
ATOM   3824 C  C   . TYR A 1 472 ? 14.649  75.366 45.723 1.00 25.99 ? 472  TYR A C   1 
ATOM   3825 O  O   . TYR A 1 472 ? 14.683  74.628 44.724 1.00 25.93 ? 472  TYR A O   1 
ATOM   3826 C  CB  . TYR A 1 472 ? 16.558  75.683 47.266 1.00 26.83 ? 472  TYR A CB  1 
ATOM   3827 C  CG  . TYR A 1 472 ? 17.962  76.167 47.567 1.00 28.78 ? 472  TYR A CG  1 
ATOM   3828 C  CD1 . TYR A 1 472 ? 18.893  76.423 46.547 1.00 31.86 ? 472  TYR A CD1 1 
ATOM   3829 C  CD2 . TYR A 1 472 ? 18.390  76.278 48.894 1.00 30.50 ? 472  TYR A CD2 1 
ATOM   3830 C  CE1 . TYR A 1 472 ? 20.205  76.831 46.857 1.00 33.66 ? 472  TYR A CE1 1 
ATOM   3831 C  CE2 . TYR A 1 472 ? 19.679  76.669 49.216 1.00 31.80 ? 472  TYR A CE2 1 
ATOM   3832 C  CZ  . TYR A 1 472 ? 20.579  76.952 48.207 1.00 34.42 ? 472  TYR A CZ  1 
ATOM   3833 O  OH  . TYR A 1 472 ? 21.845  77.339 48.566 1.00 35.08 ? 472  TYR A OH  1 
ATOM   3834 N  N   . TRP A 1 473 ? 13.631  75.378 46.587 1.00 24.74 ? 473  TRP A N   1 
ATOM   3835 C  CA  . TRP A 1 473 ? 12.480  74.480 46.450 1.00 25.03 ? 473  TRP A CA  1 
ATOM   3836 C  C   . TRP A 1 473 ? 11.748  74.726 45.109 1.00 25.17 ? 473  TRP A C   1 
ATOM   3837 O  O   . TRP A 1 473 ? 11.508  73.786 44.353 1.00 24.33 ? 473  TRP A O   1 
ATOM   3838 C  CB  . TRP A 1 473 ? 11.502  74.712 47.602 1.00 24.64 ? 473  TRP A CB  1 
ATOM   3839 C  CG  . TRP A 1 473 ? 11.623  73.778 48.798 1.00 24.50 ? 473  TRP A CG  1 
ATOM   3840 C  CD1 . TRP A 1 473 ? 10.598  73.078 49.372 1.00 23.56 ? 473  TRP A CD1 1 
ATOM   3841 C  CD2 . TRP A 1 473 ? 12.805  73.458 49.568 1.00 23.18 ? 473  TRP A CD2 1 
ATOM   3842 N  NE1 . TRP A 1 473 ? 11.056  72.349 50.443 1.00 23.92 ? 473  TRP A NE1 1 
ATOM   3843 C  CE2 . TRP A 1 473 ? 12.402  72.561 50.591 1.00 23.93 ? 473  TRP A CE2 1 
ATOM   3844 C  CE3 . TRP A 1 473 ? 14.153  73.843 49.497 1.00 23.08 ? 473  TRP A CE3 1 
ATOM   3845 C  CZ2 . TRP A 1 473 ? 13.301  72.042 51.541 1.00 23.42 ? 473  TRP A CZ2 1 
ATOM   3846 C  CZ3 . TRP A 1 473 ? 15.051  73.338 50.442 1.00 22.91 ? 473  TRP A CZ3 1 
ATOM   3847 C  CH2 . TRP A 1 473 ? 14.618  72.445 51.456 1.00 23.98 ? 473  TRP A CH2 1 
ATOM   3848 N  N   . ALA A 1 474 ? 11.421  75.993 44.834 1.00 24.83 ? 474  ALA A N   1 
ATOM   3849 C  CA  . ALA A 1 474 ? 10.723  76.369 43.595 1.00 25.72 ? 474  ALA A CA  1 
ATOM   3850 C  C   . ALA A 1 474 ? 11.550  76.170 42.325 1.00 25.74 ? 474  ALA A C   1 
ATOM   3851 O  O   . ALA A 1 474 ? 11.005  75.769 41.304 1.00 26.28 ? 474  ALA A O   1 
ATOM   3852 C  CB  . ALA A 1 474 ? 10.215  77.801 43.670 1.00 25.24 ? 474  ALA A CB  1 
ATOM   3853 N  N   . THR A 1 475 ? 12.852  76.453 42.379 1.00 26.29 ? 475  THR A N   1 
ATOM   3854 C  CA  . THR A 1 475 ? 13.731  76.241 41.218 1.00 26.09 ? 475  THR A CA  1 
ATOM   3855 C  C   . THR A 1 475 ? 13.847  74.746 40.958 1.00 26.24 ? 475  THR A C   1 
ATOM   3856 O  O   . THR A 1 475 ? 13.788  74.284 39.800 1.00 26.57 ? 475  THR A O   1 
ATOM   3857 C  CB  . THR A 1 475 ? 15.119  76.885 41.447 1.00 26.36 ? 475  THR A CB  1 
ATOM   3858 O  OG1 . THR A 1 475 ? 14.942  78.285 41.653 1.00 25.48 ? 475  THR A OG1 1 
ATOM   3859 C  CG2 . THR A 1 475 ? 16.051  76.684 40.263 1.00 27.08 ? 475  THR A CG2 1 
ATOM   3860 N  N   . PHE A 1 476 ? 13.985  73.977 42.039 1.00 25.22 ? 476  PHE A N   1 
ATOM   3861 C  CA  . PHE A 1 476 ? 13.914  72.534 41.915 1.00 24.98 ? 476  PHE A CA  1 
ATOM   3862 C  C   . PHE A 1 476 ? 12.594  72.076 41.290 1.00 24.80 ? 476  PHE A C   1 
ATOM   3863 O  O   . PHE A 1 476 ? 12.598  71.227 40.400 1.00 25.32 ? 476  PHE A O   1 
ATOM   3864 C  CB  . PHE A 1 476 ? 14.131  71.812 43.261 1.00 24.95 ? 476  PHE A CB  1 
ATOM   3865 C  CG  . PHE A 1 476 ? 13.937  70.322 43.166 1.00 22.97 ? 476  PHE A CG  1 
ATOM   3866 C  CD1 . PHE A 1 476 ? 14.966  69.511 42.690 1.00 23.17 ? 476  PHE A CD1 1 
ATOM   3867 C  CD2 . PHE A 1 476 ? 12.722  69.738 43.512 1.00 22.80 ? 476  PHE A CD2 1 
ATOM   3868 C  CE1 . PHE A 1 476 ? 14.797  68.126 42.581 1.00 21.73 ? 476  PHE A CE1 1 
ATOM   3869 C  CE2 . PHE A 1 476 ? 12.538  68.346 43.391 1.00 20.99 ? 476  PHE A CE2 1 
ATOM   3870 C  CZ  . PHE A 1 476 ? 13.580  67.552 42.934 1.00 21.54 ? 476  PHE A CZ  1 
ATOM   3871 N  N   . ALA A 1 477 ? 11.471  72.606 41.760 1.00 24.83 ? 477  ALA A N   1 
ATOM   3872 C  CA  . ALA A 1 477 ? 10.176  72.206 41.209 1.00 25.88 ? 477  ALA A CA  1 
ATOM   3873 C  C   . ALA A 1 477 ? 10.125  72.501 39.697 1.00 26.57 ? 477  ALA A C   1 
ATOM   3874 O  O   . ALA A 1 477 ? 9.596   71.697 38.909 1.00 26.35 ? 477  ALA A O   1 
ATOM   3875 C  CB  . ALA A 1 477 ? 9.046   72.914 41.926 1.00 25.41 ? 477  ALA A CB  1 
ATOM   3876 N  N   . LYS A 1 478 ? 10.704  73.639 39.314 1.00 27.18 ? 478  LYS A N   1 
ATOM   3877 C  CA  . LYS A 1 478 ? 10.693  74.101 37.920 1.00 28.17 ? 478  LYS A CA  1 
ATOM   3878 C  C   . LYS A 1 478 ? 11.567  73.249 36.991 1.00 28.41 ? 478  LYS A C   1 
ATOM   3879 O  O   . LYS A 1 478 ? 11.155  72.922 35.876 1.00 28.75 ? 478  LYS A O   1 
ATOM   3880 C  CB  . LYS A 1 478 ? 11.119  75.569 37.853 1.00 28.57 ? 478  LYS A CB  1 
ATOM   3881 C  CG  . LYS A 1 478 ? 10.061  76.511 38.367 0.80 30.52 ? 478  LYS A CG  1 
ATOM   3882 C  CD  . LYS A 1 478 ? 10.626  77.869 38.790 0.80 34.43 ? 478  LYS A CD  1 
ATOM   3883 C  CE  . LYS A 1 478 ? 9.531   78.694 39.414 0.80 35.50 ? 478  LYS A CE  1 
ATOM   3884 N  NZ  . LYS A 1 478 ? 9.950   80.092 39.734 0.80 39.14 ? 478  LYS A NZ  1 
ATOM   3885 N  N   . THR A 1 479 ? 12.744  72.852 37.468 1.00 28.02 ? 479  THR A N   1 
ATOM   3886 C  CA  . THR A 1 479 ? 13.796  72.370 36.581 1.00 28.07 ? 479  THR A CA  1 
ATOM   3887 C  C   . THR A 1 479 ? 14.388  71.021 36.948 1.00 28.34 ? 479  THR A C   1 
ATOM   3888 O  O   . THR A 1 479 ? 15.098  70.420 36.137 1.00 28.05 ? 479  THR A O   1 
ATOM   3889 C  CB  . THR A 1 479 ? 14.963  73.382 36.527 1.00 28.48 ? 479  THR A CB  1 
ATOM   3890 O  OG1 . THR A 1 479 ? 15.595  73.452 37.811 1.00 27.92 ? 479  THR A OG1 1 
ATOM   3891 C  CG2 . THR A 1 479 ? 14.455  74.782 36.128 1.00 28.57 ? 479  THR A CG2 1 
ATOM   3892 N  N   . GLY A 1 480 ? 14.130  70.546 38.172 1.00 27.56 ? 480  GLY A N   1 
ATOM   3893 C  CA  . GLY A 1 480 ? 14.776  69.319 38.644 1.00 27.17 ? 480  GLY A CA  1 
ATOM   3894 C  C   . GLY A 1 480 ? 16.131  69.575 39.277 1.00 27.12 ? 480  GLY A C   1 
ATOM   3895 O  O   . GLY A 1 480 ? 16.873  68.634 39.591 1.00 27.72 ? 480  GLY A O   1 
ATOM   3896 N  N   . ASN A 1 481 ? 16.452  70.849 39.463 1.00 27.17 ? 481  ASN A N   1 
ATOM   3897 C  CA  . ASN A 1 481 ? 17.739  71.285 40.010 1.00 27.50 ? 481  ASN A CA  1 
ATOM   3898 C  C   . ASN A 1 481 ? 17.488  72.556 40.824 1.00 27.53 ? 481  ASN A C   1 
ATOM   3899 O  O   . ASN A 1 481 ? 16.950  73.513 40.279 1.00 27.46 ? 481  ASN A O   1 
ATOM   3900 C  CB  . ASN A 1 481 ? 18.700  71.559 38.838 1.00 27.93 ? 481  ASN A CB  1 
ATOM   3901 C  CG  . ASN A 1 481 ? 20.137  71.855 39.276 1.00 29.04 ? 481  ASN A CG  1 
ATOM   3902 O  OD1 . ASN A 1 481 ? 20.396  72.350 40.373 1.00 30.31 ? 481  ASN A OD1 1 
ATOM   3903 N  ND2 . ASN A 1 481 ? 21.080  71.576 38.385 1.00 30.51 ? 481  ASN A ND2 1 
ATOM   3904 N  N   . PRO A 1 482 ? 17.856  72.580 42.132 1.00 27.63 ? 482  PRO A N   1 
ATOM   3905 C  CA  . PRO A 1 482 ? 17.590  73.774 42.976 1.00 28.14 ? 482  PRO A CA  1 
ATOM   3906 C  C   . PRO A 1 482 ? 18.473  74.990 42.640 1.00 29.56 ? 482  PRO A C   1 
ATOM   3907 O  O   . PRO A 1 482 ? 18.183  76.109 43.084 1.00 28.86 ? 482  PRO A O   1 
ATOM   3908 C  CB  . PRO A 1 482 ? 17.940  73.291 44.387 1.00 27.27 ? 482  PRO A CB  1 
ATOM   3909 C  CG  . PRO A 1 482 ? 19.017  72.249 44.146 1.00 27.74 ? 482  PRO A CG  1 
ATOM   3910 C  CD  . PRO A 1 482 ? 18.538  71.521 42.902 1.00 27.26 ? 482  PRO A CD  1 
ATOM   3911 N  N   . ASN A 1 483 ? 19.541  74.749 41.882 1.00 31.79 ? 483  ASN A N   1 
ATOM   3912 C  CA  . ASN A 1 483 ? 20.496  75.787 41.486 1.00 34.47 ? 483  ASN A CA  1 
ATOM   3913 C  C   . ASN A 1 483 ? 20.039  76.534 40.234 1.00 37.04 ? 483  ASN A C   1 
ATOM   3914 O  O   . ASN A 1 483 ? 19.670  75.911 39.235 1.00 36.32 ? 483  ASN A O   1 
ATOM   3915 C  CB  . ASN A 1 483 ? 21.871  75.161 41.218 1.00 34.11 ? 483  ASN A CB  1 
ATOM   3916 C  CG  . ASN A 1 483 ? 22.431  74.442 42.438 1.00 33.21 ? 483  ASN A CG  1 
ATOM   3917 O  OD1 . ASN A 1 483 ? 22.756  75.076 43.438 1.00 32.89 ? 483  ASN A OD1 1 
ATOM   3918 N  ND2 . ASN A 1 483 ? 22.527  73.115 42.360 1.00 30.53 ? 483  ASN A ND2 1 
ATOM   3919 N  N   . GLU A 1 484 ? 20.056  77.862 40.306 1.00 40.63 ? 484  GLU A N   1 
ATOM   3920 C  CA  . GLU A 1 484 ? 19.895  78.726 39.129 1.00 44.59 ? 484  GLU A CA  1 
ATOM   3921 C  C   . GLU A 1 484 ? 21.045  78.512 38.158 1.00 46.65 ? 484  GLU A C   1 
ATOM   3922 O  O   . GLU A 1 484 ? 22.214  78.623 38.554 1.00 46.82 ? 484  GLU A O   1 
ATOM   3923 C  CB  . GLU A 1 484 ? 19.933  80.196 39.543 1.00 45.05 ? 484  GLU A CB  1 
ATOM   3924 C  CG  . GLU A 1 484 ? 18.638  80.774 40.004 1.00 47.29 ? 484  GLU A CG  1 
ATOM   3925 C  CD  . GLU A 1 484 ? 17.755  81.225 38.866 1.00 50.06 ? 484  GLU A CD  1 
ATOM   3926 O  OE1 . GLU A 1 484 ? 17.994  80.820 37.705 1.00 52.09 ? 484  GLU A OE1 1 
ATOM   3927 O  OE2 . GLU A 1 484 ? 16.804  81.982 39.139 1.00 51.26 ? 484  GLU A OE2 1 
ATOM   3928 N  N   . PRO A 1 485 ? 20.735  78.222 36.877 1.00 49.23 ? 485  PRO A N   1 
ATOM   3929 C  CA  . PRO A 1 485 ? 21.839  78.110 35.926 1.00 50.78 ? 485  PRO A CA  1 
ATOM   3930 C  C   . PRO A 1 485 ? 22.546  79.456 35.825 1.00 52.40 ? 485  PRO A C   1 
ATOM   3931 O  O   . PRO A 1 485 ? 21.898  80.519 35.898 1.00 52.27 ? 485  PRO A O   1 
ATOM   3932 C  CB  . PRO A 1 485 ? 21.146  77.775 34.593 1.00 50.86 ? 485  PRO A CB  1 
ATOM   3933 C  CG  . PRO A 1 485 ? 19.718  77.443 34.940 1.00 50.61 ? 485  PRO A CG  1 
ATOM   3934 C  CD  . PRO A 1 485 ? 19.432  78.233 36.191 1.00 49.45 ? 485  PRO A CD  1 
ATOM   3935 N  N   . HIS A 1 486 ? 23.868  79.380 35.704 1.00 53.85 ? 486  HIS A N   1 
ATOM   3936 C  CA  A HIS A 1 486 ? 24.745  80.546 35.567 0.50 54.78 ? 486  HIS A CA  1 
ATOM   3937 C  CA  B HIS A 1 486 ? 24.732  80.561 35.562 0.50 54.74 ? 486  HIS A CA  1 
ATOM   3938 C  C   . HIS A 1 486 ? 24.458  81.685 36.577 1.00 55.10 ? 486  HIS A C   1 
ATOM   3939 O  O   . HIS A 1 486 ? 24.411  82.869 36.220 1.00 55.63 ? 486  HIS A O   1 
ATOM   3940 C  CB  A HIS A 1 486 ? 24.768  81.037 34.103 0.50 54.97 ? 486  HIS A CB  1 
ATOM   3941 C  CB  B HIS A 1 486 ? 24.805  81.082 34.096 0.50 54.92 ? 486  HIS A CB  1 
ATOM   3942 C  CG  A HIS A 1 486 ? 24.873  79.928 33.095 0.50 55.41 ? 486  HIS A CG  1 
ATOM   3943 C  CG  B HIS A 1 486 ? 23.499  81.567 33.528 0.50 55.18 ? 486  HIS A CG  1 
ATOM   3944 N  ND1 A HIS A 1 486 ? 26.052  79.260 32.839 0.50 55.56 ? 486  HIS A ND1 1 
ATOM   3945 N  ND1 B HIS A 1 486 ? 22.842  80.910 32.508 0.50 55.34 ? 486  HIS A ND1 1 
ATOM   3946 C  CD2 A HIS A 1 486 ? 23.941  79.365 32.287 0.50 55.80 ? 486  HIS A CD2 1 
ATOM   3947 C  CD2 B HIS A 1 486 ? 22.749  82.661 33.811 0.50 55.53 ? 486  HIS A CD2 1 
ATOM   3948 C  CE1 A HIS A 1 486 ? 25.843  78.336 31.917 0.50 55.88 ? 486  HIS A CE1 1 
ATOM   3949 C  CE1 B HIS A 1 486 ? 21.737  81.566 32.202 0.50 55.57 ? 486  HIS A CE1 1 
ATOM   3950 N  NE2 A HIS A 1 486 ? 24.570  78.379 31.566 0.50 56.04 ? 486  HIS A NE2 1 
ATOM   3951 N  NE2 B HIS A 1 486 ? 21.656  82.631 32.979 0.50 55.60 ? 486  HIS A NE2 1 
ATOM   3952 N  N   . SER A 1 487 ? 24.273  81.317 37.846 1.00 55.27 ? 487  SER A N   1 
ATOM   3953 C  CA  . SER A 1 487 ? 24.281  82.315 38.926 1.00 55.23 ? 487  SER A CA  1 
ATOM   3954 C  C   . SER A 1 487 ? 25.648  82.210 39.622 1.00 54.71 ? 487  SER A C   1 
ATOM   3955 O  O   . SER A 1 487 ? 26.352  81.208 39.451 1.00 54.65 ? 487  SER A O   1 
ATOM   3956 C  CB  . SER A 1 487 ? 23.118  82.128 39.908 1.00 55.41 ? 487  SER A CB  1 
ATOM   3957 O  OG  . SER A 1 487 ? 23.515  81.433 41.082 1.00 55.94 ? 487  SER A OG  1 
ATOM   3958 N  N   . GLN A 1 488 ? 26.025  83.242 40.380 1.00 54.36 ? 488  GLN A N   1 
ATOM   3959 C  CA  A GLN A 1 488 ? 27.344  83.249 41.017 0.50 53.93 ? 488  GLN A CA  1 
ATOM   3960 C  CA  B GLN A 1 488 ? 27.331  83.313 41.053 0.50 54.04 ? 488  GLN A CA  1 
ATOM   3961 C  C   . GLN A 1 488 ? 27.331  82.614 42.412 1.00 53.49 ? 488  GLN A C   1 
ATOM   3962 O  O   . GLN A 1 488 ? 28.396  82.246 42.939 1.00 53.54 ? 488  GLN A O   1 
ATOM   3963 C  CB  A GLN A 1 488 ? 27.944  84.663 41.050 0.50 54.23 ? 488  GLN A CB  1 
ATOM   3964 C  CB  B GLN A 1 488 ? 27.776  84.773 41.244 0.50 54.39 ? 488  GLN A CB  1 
ATOM   3965 C  CG  A GLN A 1 488 ? 28.168  85.293 39.663 0.50 54.42 ? 488  GLN A CG  1 
ATOM   3966 C  CG  B GLN A 1 488 ? 27.846  85.606 39.965 0.50 55.15 ? 488  GLN A CG  1 
ATOM   3967 C  CD  A GLN A 1 488 ? 29.144  84.513 38.788 0.50 54.22 ? 488  GLN A CD  1 
ATOM   3968 C  CD  B GLN A 1 488 ? 26.642  86.506 39.793 0.50 55.84 ? 488  GLN A CD  1 
ATOM   3969 O  OE1 A GLN A 1 488 ? 29.727  83.515 39.213 0.50 53.90 ? 488  GLN A OE1 1 
ATOM   3970 O  OE1 B GLN A 1 488 ? 25.664  86.135 39.144 0.50 56.30 ? 488  GLN A OE1 1 
ATOM   3971 N  NE2 A GLN A 1 488 ? 29.323  84.974 37.555 0.50 54.04 ? 488  GLN A NE2 1 
ATOM   3972 N  NE2 B GLN A 1 488 ? 26.703  87.696 40.384 0.50 55.92 ? 488  GLN A NE2 1 
ATOM   3973 N  N   . GLU A 1 489 ? 26.136  82.453 42.990 1.00 52.10 ? 489  GLU A N   1 
ATOM   3974 C  CA  . GLU A 1 489 ? 25.988  81.852 44.326 1.00 50.12 ? 489  GLU A CA  1 
ATOM   3975 C  C   . GLU A 1 489 ? 26.574  80.444 44.419 1.00 48.09 ? 489  GLU A C   1 
ATOM   3976 O  O   . GLU A 1 489 ? 26.743  79.762 43.403 1.00 48.14 ? 489  GLU A O   1 
ATOM   3977 C  CB  . GLU A 1 489 ? 24.527  81.895 44.798 1.00 50.43 ? 489  GLU A CB  1 
ATOM   3978 C  CG  . GLU A 1 489 ? 24.004  83.325 45.045 1.00 51.38 ? 489  GLU A CG  1 
ATOM   3979 C  CD  . GLU A 1 489 ? 24.928  84.171 45.928 0.50 51.73 ? 489  GLU A CD  1 
ATOM   3980 O  OE1 . GLU A 1 489 ? 25.401  83.672 46.975 0.50 52.51 ? 489  GLU A OE1 1 
ATOM   3981 O  OE2 . GLU A 1 489 ? 25.176  85.344 45.577 0.50 51.27 ? 489  GLU A OE2 1 
ATOM   3982 N  N   . SER A 1 490 ? 26.916  80.028 45.636 1.00 46.31 ? 490  SER A N   1 
ATOM   3983 C  CA  A SER A 1 490 ? 27.524  78.713 45.840 0.50 45.04 ? 490  SER A CA  1 
ATOM   3984 C  CA  B SER A 1 490 ? 27.516  78.712 45.868 0.50 44.86 ? 490  SER A CA  1 
ATOM   3985 C  C   . SER A 1 490 ? 26.517  77.594 45.543 1.00 43.77 ? 490  SER A C   1 
ATOM   3986 O  O   . SER A 1 490 ? 25.347  77.690 45.900 1.00 43.64 ? 490  SER A O   1 
ATOM   3987 C  CB  A SER A 1 490 ? 28.097  78.585 47.250 0.50 45.30 ? 490  SER A CB  1 
ATOM   3988 C  CB  B SER A 1 490 ? 28.030  78.608 47.310 0.50 45.08 ? 490  SER A CB  1 
ATOM   3989 O  OG  A SER A 1 490 ? 29.063  77.550 47.299 0.50 46.03 ? 490  SER A OG  1 
ATOM   3990 O  OG  B SER A 1 490 ? 27.247  79.391 48.199 0.50 44.68 ? 490  SER A OG  1 
ATOM   3991 N  N   . LYS A 1 491 ? 26.987  76.549 44.862 1.00 41.60 ? 491  LYS A N   1 
ATOM   3992 C  CA  . LYS A 1 491 ? 26.119  75.493 44.354 1.00 39.38 ? 491  LYS A CA  1 
ATOM   3993 C  C   . LYS A 1 491 ? 25.798  74.368 45.358 1.00 37.76 ? 491  LYS A C   1 
ATOM   3994 O  O   . LYS A 1 491 ? 26.671  73.912 46.109 1.00 37.61 ? 491  LYS A O   1 
ATOM   3995 C  CB  . LYS A 1 491 ? 26.716  74.876 43.083 1.00 39.72 ? 491  LYS A CB  1 
ATOM   3996 C  CG  . LYS A 1 491 ? 26.721  75.800 41.862 0.50 40.05 ? 491  LYS A CG  1 
ATOM   3997 C  CD  . LYS A 1 491 ? 27.321  75.089 40.657 0.50 41.15 ? 491  LYS A CD  1 
ATOM   3998 C  CE  . LYS A 1 491 ? 27.701  76.072 39.566 0.50 41.85 ? 491  LYS A CE  1 
ATOM   3999 N  NZ  . LYS A 1 491 ? 28.452  75.394 38.474 0.50 41.88 ? 491  LYS A NZ  1 
ATOM   4000 N  N   . TRP A 1 492 ? 24.540  73.931 45.341 1.00 34.94 ? 492  TRP A N   1 
ATOM   4001 C  CA  . TRP A 1 492 ? 24.091  72.749 46.080 1.00 32.12 ? 492  TRP A CA  1 
ATOM   4002 C  C   . TRP A 1 492 ? 24.432  71.555 45.207 1.00 31.23 ? 492  TRP A C   1 
ATOM   4003 O  O   . TRP A 1 492 ? 23.815  71.364 44.153 1.00 31.04 ? 492  TRP A O   1 
ATOM   4004 C  CB  . TRP A 1 492 ? 22.580  72.849 46.305 1.00 31.77 ? 492  TRP A CB  1 
ATOM   4005 C  CG  . TRP A 1 492 ? 21.923  71.756 47.138 1.00 29.38 ? 492  TRP A CG  1 
ATOM   4006 C  CD1 . TRP A 1 492 ? 22.406  70.501 47.418 1.00 26.99 ? 492  TRP A CD1 1 
ATOM   4007 C  CD2 . TRP A 1 492 ? 20.625  71.829 47.739 1.00 25.76 ? 492  TRP A CD2 1 
ATOM   4008 N  NE1 . TRP A 1 492 ? 21.484  69.798 48.175 1.00 25.69 ? 492  TRP A NE1 1 
ATOM   4009 C  CE2 . TRP A 1 492 ? 20.391  70.595 48.393 1.00 25.75 ? 492  TRP A CE2 1 
ATOM   4010 C  CE3 . TRP A 1 492 ? 19.646  72.830 47.807 1.00 24.84 ? 492  TRP A CE3 1 
ATOM   4011 C  CZ2 . TRP A 1 492 ? 19.210  70.333 49.108 1.00 23.56 ? 492  TRP A CZ2 1 
ATOM   4012 C  CZ3 . TRP A 1 492 ? 18.453  72.560 48.506 1.00 25.80 ? 492  TRP A CZ3 1 
ATOM   4013 C  CH2 . TRP A 1 492 ? 18.256  71.314 49.141 1.00 24.96 ? 492  TRP A CH2 1 
ATOM   4014 N  N   . PRO A 1 493 ? 25.442  70.760 45.604 1.00 30.57 ? 493  PRO A N   1 
ATOM   4015 C  CA  . PRO A 1 493 ? 25.844  69.657 44.727 1.00 30.26 ? 493  PRO A CA  1 
ATOM   4016 C  C   . PRO A 1 493 ? 24.860  68.506 44.744 1.00 30.54 ? 493  PRO A C   1 
ATOM   4017 O  O   . PRO A 1 493 ? 24.135  68.316 45.737 1.00 30.40 ? 493  PRO A O   1 
ATOM   4018 C  CB  . PRO A 1 493 ? 27.183  69.196 45.320 1.00 30.55 ? 493  PRO A CB  1 
ATOM   4019 C  CG  . PRO A 1 493 ? 27.109  69.599 46.768 1.00 30.48 ? 493  PRO A CG  1 
ATOM   4020 C  CD  . PRO A 1 493 ? 26.302  70.868 46.800 1.00 30.27 ? 493  PRO A CD  1 
ATOM   4021 N  N   . LEU A 1 494 ? 24.846  67.754 43.646 1.00 29.75 ? 494  LEU A N   1 
ATOM   4022 C  CA  . LEU A 1 494 ? 24.106  66.523 43.538 1.00 29.96 ? 494  LEU A CA  1 
ATOM   4023 C  C   . LEU A 1 494 ? 24.631  65.504 44.562 1.00 29.73 ? 494  LEU A C   1 
ATOM   4024 O  O   . LEU A 1 494 ? 25.861  65.352 44.748 1.00 28.58 ? 494  LEU A O   1 
ATOM   4025 C  CB  . LEU A 1 494 ? 24.298  65.990 42.123 1.00 30.26 ? 494  LEU A CB  1 
ATOM   4026 C  CG  . LEU A 1 494 ? 23.280  65.316 41.203 1.00 31.45 ? 494  LEU A CG  1 
ATOM   4027 C  CD1 . LEU A 1 494 ? 21.818  65.736 41.327 1.00 30.49 ? 494  LEU A CD1 1 
ATOM   4028 C  CD2 . LEU A 1 494 ? 23.786  65.481 39.755 1.00 32.05 ? 494  LEU A CD2 1 
ATOM   4029 N  N   . PHE A 1 495 ? 23.700  64.818 45.229 1.00 28.73 ? 495  PHE A N   1 
ATOM   4030 C  CA  . PHE A 1 495 ? 24.045  63.673 46.046 1.00 28.97 ? 495  PHE A CA  1 
ATOM   4031 C  C   . PHE A 1 495 ? 24.319  62.496 45.109 1.00 29.74 ? 495  PHE A C   1 
ATOM   4032 O  O   . PHE A 1 495 ? 23.470  62.118 44.300 1.00 29.54 ? 495  PHE A O   1 
ATOM   4033 C  CB  . PHE A 1 495 ? 22.915  63.333 47.043 1.00 28.16 ? 495  PHE A CB  1 
ATOM   4034 C  CG  . PHE A 1 495 ? 23.140  62.053 47.800 1.00 27.51 ? 495  PHE A CG  1 
ATOM   4035 C  CD1 . PHE A 1 495 ? 22.909  60.816 47.198 1.00 27.35 ? 495  PHE A CD1 1 
ATOM   4036 C  CD2 . PHE A 1 495 ? 23.590  62.080 49.119 1.00 27.37 ? 495  PHE A CD2 1 
ATOM   4037 C  CE1 . PHE A 1 495 ? 23.136  59.606 47.891 1.00 28.04 ? 495  PHE A CE1 1 
ATOM   4038 C  CE2 . PHE A 1 495 ? 23.807  60.887 49.831 1.00 27.57 ? 495  PHE A CE2 1 
ATOM   4039 C  CZ  . PHE A 1 495 ? 23.586  59.645 49.217 1.00 27.33 ? 495  PHE A CZ  1 
ATOM   4040 N  N   . THR A 1 496 ? 25.499  61.903 45.226 1.00 30.83 ? 496  THR A N   1 
ATOM   4041 C  CA  . THR A 1 496 ? 25.811  60.702 44.456 1.00 32.64 ? 496  THR A CA  1 
ATOM   4042 C  C   . THR A 1 496 ? 26.179  59.562 45.393 1.00 34.11 ? 496  THR A C   1 
ATOM   4043 O  O   . THR A 1 496 ? 26.638  59.803 46.502 1.00 34.08 ? 496  THR A O   1 
ATOM   4044 C  CB  . THR A 1 496 ? 26.993  60.943 43.508 1.00 32.65 ? 496  THR A CB  1 
ATOM   4045 O  OG1 . THR A 1 496 ? 28.158  61.214 44.297 1.00 32.25 ? 496  THR A OG1 1 
ATOM   4046 C  CG2 . THR A 1 496 ? 26.707  62.138 42.570 1.00 31.92 ? 496  THR A CG2 1 
ATOM   4047 N  N   . THR A 1 497 ? 25.989  58.330 44.930 1.00 36.08 ? 497  THR A N   1 
ATOM   4048 C  CA  . THR A 1 497 ? 26.377  57.133 45.676 1.00 38.38 ? 497  THR A CA  1 
ATOM   4049 C  C   . THR A 1 497 ? 27.833  57.181 46.140 1.00 38.81 ? 497  THR A C   1 
ATOM   4050 O  O   . THR A 1 497 ? 28.157  56.728 47.248 1.00 39.35 ? 497  THR A O   1 
ATOM   4051 C  CB  . THR A 1 497 ? 26.196  55.877 44.809 1.00 38.45 ? 497  THR A CB  1 
ATOM   4052 O  OG1 . THR A 1 497 ? 24.849  55.833 44.324 1.00 41.20 ? 497  THR A OG1 1 
ATOM   4053 C  CG2 . THR A 1 497 ? 26.485  54.613 45.609 1.00 39.99 ? 497  THR A CG2 1 
ATOM   4054 N  N   . LYS A 1 498 ? 28.698  57.740 45.295 1.00 38.89 ? 498  LYS A N   1 
ATOM   4055 C  CA  . LYS A 1 498 ? 30.126  57.751 45.558 1.00 39.20 ? 498  LYS A CA  1 
ATOM   4056 C  C   . LYS A 1 498 ? 30.567  58.794 46.571 1.00 38.32 ? 498  LYS A C   1 
ATOM   4057 O  O   . LYS A 1 498 ? 31.355  58.478 47.467 1.00 38.86 ? 498  LYS A O   1 
ATOM   4058 C  CB  . LYS A 1 498 ? 30.907  57.950 44.252 1.00 39.82 ? 498  LYS A CB  1 
ATOM   4059 C  CG  . LYS A 1 498 ? 32.419  57.778 44.397 1.00 42.35 ? 498  LYS A CG  1 
ATOM   4060 C  CD  . LYS A 1 498 ? 33.105  57.989 43.050 1.00 46.37 ? 498  LYS A CD  1 
ATOM   4061 C  CE  . LYS A 1 498 ? 34.606  58.137 43.188 1.00 48.56 ? 498  LYS A CE  1 
ATOM   4062 N  NZ  . LYS A 1 498 ? 35.177  58.459 41.842 1.00 50.91 ? 498  LYS A NZ  1 
ATOM   4063 N  N   . GLU A 1 499 ? 30.086  60.032 46.427 1.00 37.04 ? 499  GLU A N   1 
ATOM   4064 C  CA  A GLU A 1 499 ? 30.572  61.125 47.264 0.60 36.58 ? 499  GLU A CA  1 
ATOM   4065 C  CA  B GLU A 1 499 ? 30.565  61.135 47.257 0.40 36.44 ? 499  GLU A CA  1 
ATOM   4066 C  C   . GLU A 1 499 ? 29.573  61.566 48.350 1.00 35.88 ? 499  GLU A C   1 
ATOM   4067 O  O   . GLU A 1 499 ? 29.941  62.260 49.293 1.00 35.14 ? 499  GLU A O   1 
ATOM   4068 C  CB  A GLU A 1 499 ? 31.018  62.314 46.402 0.60 36.77 ? 499  GLU A CB  1 
ATOM   4069 C  CB  B GLU A 1 499 ? 30.976  62.326 46.383 0.40 36.52 ? 499  GLU A CB  1 
ATOM   4070 C  CG  A GLU A 1 499 ? 32.184  62.010 45.429 0.60 38.37 ? 499  GLU A CG  1 
ATOM   4071 C  CG  B GLU A 1 499 ? 31.972  61.968 45.273 0.40 37.26 ? 499  GLU A CG  1 
ATOM   4072 C  CD  A GLU A 1 499 ? 33.558  61.902 46.106 0.60 40.60 ? 499  GLU A CD  1 
ATOM   4073 C  CD  B GLU A 1 499 ? 32.717  63.174 44.734 0.40 38.13 ? 499  GLU A CD  1 
ATOM   4074 O  OE1 A GLU A 1 499 ? 33.732  62.375 47.255 0.60 41.04 ? 499  GLU A OE1 1 
ATOM   4075 O  OE1 B GLU A 1 499 ? 33.685  63.614 45.388 0.40 39.05 ? 499  GLU A OE1 1 
ATOM   4076 O  OE2 A GLU A 1 499 ? 34.481  61.343 45.474 0.60 42.33 ? 499  GLU A OE2 1 
ATOM   4077 O  OE2 B GLU A 1 499 ? 32.349  63.673 43.650 0.40 38.99 ? 499  GLU A OE2 1 
ATOM   4078 N  N   . GLN A 1 500 ? 28.314  61.169 48.204 1.00 35.12 ? 500  GLN A N   1 
ATOM   4079 C  CA  . GLN A 1 500 ? 27.292  61.365 49.253 1.00 34.73 ? 500  GLN A CA  1 
ATOM   4080 C  C   . GLN A 1 500 ? 27.224  62.761 49.883 1.00 33.20 ? 500  GLN A C   1 
ATOM   4081 O  O   . GLN A 1 500 ? 27.049  62.910 51.098 1.00 32.79 ? 500  GLN A O   1 
ATOM   4082 C  CB  . GLN A 1 500 ? 27.450  60.266 50.319 1.00 35.22 ? 500  GLN A CB  1 
ATOM   4083 C  CG  . GLN A 1 500 ? 27.193  58.866 49.744 1.00 38.65 ? 500  GLN A CG  1 
ATOM   4084 C  CD  . GLN A 1 500 ? 27.713  57.736 50.609 1.00 43.36 ? 500  GLN A CD  1 
ATOM   4085 O  OE1 . GLN A 1 500 ? 27.571  57.754 51.830 1.00 44.94 ? 500  GLN A OE1 1 
ATOM   4086 N  NE2 . GLN A 1 500 ? 28.314  56.729 49.969 1.00 45.00 ? 500  GLN A NE2 1 
ATOM   4087 N  N   . LYS A 1 501 ? 27.327  63.784 49.041 1.00 31.50 ? 501  LYS A N   1 
ATOM   4088 C  CA  . LYS A 1 501 ? 27.357  65.172 49.500 1.00 30.65 ? 501  LYS A CA  1 
ATOM   4089 C  C   . LYS A 1 501 ? 25.982  65.726 49.827 1.00 29.51 ? 501  LYS A C   1 
ATOM   4090 O  O   . LYS A 1 501 ? 24.987  65.359 49.203 1.00 29.58 ? 501  LYS A O   1 
ATOM   4091 C  CB  . LYS A 1 501 ? 27.997  66.082 48.442 1.00 30.70 ? 501  LYS A CB  1 
ATOM   4092 C  CG  . LYS A 1 501 ? 29.447  65.749 48.125 1.00 32.74 ? 501  LYS A CG  1 
ATOM   4093 C  CD  . LYS A 1 501 ? 29.965  66.636 46.982 1.00 35.35 ? 501  LYS A CD  1 
ATOM   4094 C  CE  . LYS A 1 501 ? 31.370  66.222 46.538 1.00 36.93 ? 501  LYS A CE  1 
ATOM   4095 N  NZ  . LYS A 1 501 ? 31.839  67.121 45.438 1.00 39.32 ? 501  LYS A NZ  1 
ATOM   4096 N  N   . PHE A 1 502 ? 25.958  66.639 50.788 1.00 28.62 ? 502  PHE A N   1 
ATOM   4097 C  CA  . PHE A 1 502 ? 24.769  67.394 51.157 1.00 28.84 ? 502  PHE A CA  1 
ATOM   4098 C  C   . PHE A 1 502 ? 25.156  68.758 51.659 1.00 28.64 ? 502  PHE A C   1 
ATOM   4099 O  O   . PHE A 1 502 ? 26.314  69.009 51.959 1.00 29.43 ? 502  PHE A O   1 
ATOM   4100 C  CB  . PHE A 1 502 ? 23.933  66.661 52.223 1.00 28.66 ? 502  PHE A CB  1 
ATOM   4101 C  CG  . PHE A 1 502 ? 24.614  66.497 53.563 1.00 28.08 ? 502  PHE A CG  1 
ATOM   4102 C  CD1 . PHE A 1 502 ? 25.555  65.486 53.763 1.00 28.08 ? 502  PHE A CD1 1 
ATOM   4103 C  CD2 . PHE A 1 502 ? 24.261  67.313 54.644 1.00 27.44 ? 502  PHE A CD2 1 
ATOM   4104 C  CE1 . PHE A 1 502 ? 26.170  65.315 55.019 1.00 28.69 ? 502  PHE A CE1 1 
ATOM   4105 C  CE2 . PHE A 1 502 ? 24.864  67.150 55.906 1.00 26.37 ? 502  PHE A CE2 1 
ATOM   4106 C  CZ  . PHE A 1 502 ? 25.817  66.141 56.088 1.00 27.75 ? 502  PHE A CZ  1 
ATOM   4107 N  N   . ILE A 1 503 ? 24.186  69.649 51.746 1.00 29.02 ? 503  ILE A N   1 
ATOM   4108 C  CA  . ILE A 1 503 ? 24.457  70.970 52.280 1.00 29.25 ? 503  ILE A CA  1 
ATOM   4109 C  C   . ILE A 1 503 ? 23.736  71.185 53.600 1.00 29.80 ? 503  ILE A C   1 
ATOM   4110 O  O   . ILE A 1 503 ? 22.728  70.522 53.879 1.00 29.57 ? 503  ILE A O   1 
ATOM   4111 C  CB  . ILE A 1 503 ? 24.052  72.098 51.281 1.00 29.02 ? 503  ILE A CB  1 
ATOM   4112 C  CG1 . ILE A 1 503 ? 22.529  72.135 51.062 1.00 29.12 ? 503  ILE A CG1 1 
ATOM   4113 C  CG2 . ILE A 1 503 ? 24.806  71.940 49.940 1.00 28.35 ? 503  ILE A CG2 1 
ATOM   4114 C  CD1 . ILE A 1 503 ? 22.014  73.458 50.470 1.00 30.09 ? 503  ILE A CD1 1 
ATOM   4115 N  N   . ASP A 1 504 ? 24.259  72.113 54.404 1.00 30.35 ? 504  ASP A N   1 
ATOM   4116 C  CA  A ASP A 1 504 ? 23.519  72.595 55.558 0.50 30.22 ? 504  ASP A CA  1 
ATOM   4117 C  CA  B ASP A 1 504 ? 23.545  72.640 55.568 0.50 31.12 ? 504  ASP A CA  1 
ATOM   4118 C  C   . ASP A 1 504 ? 22.597  73.705 55.080 1.00 30.75 ? 504  ASP A C   1 
ATOM   4119 O  O   . ASP A 1 504 ? 22.789  74.243 53.990 1.00 30.98 ? 504  ASP A O   1 
ATOM   4120 C  CB  A ASP A 1 504 ? 24.452  73.070 56.689 0.50 29.99 ? 504  ASP A CB  1 
ATOM   4121 C  CB  B ASP A 1 504 ? 24.503  73.316 56.547 0.50 31.76 ? 504  ASP A CB  1 
ATOM   4122 C  CG  A ASP A 1 504 ? 25.519  74.065 56.218 0.50 28.95 ? 504  ASP A CG  1 
ATOM   4123 C  CG  B ASP A 1 504 ? 25.362  72.344 57.282 0.50 34.09 ? 504  ASP A CG  1 
ATOM   4124 O  OD1 A ASP A 1 504 ? 25.308  74.775 55.213 0.50 27.06 ? 504  ASP A OD1 1 
ATOM   4125 O  OD1 B ASP A 1 504 ? 24.911  71.199 57.499 0.50 36.60 ? 504  ASP A OD1 1 
ATOM   4126 O  OD2 A ASP A 1 504 ? 26.576  74.141 56.875 0.50 28.66 ? 504  ASP A OD2 1 
ATOM   4127 O  OD2 B ASP A 1 504 ? 26.500  72.726 57.645 0.50 36.95 ? 504  ASP A OD2 1 
ATOM   4128 N  N   . LEU A 1 505 ? 21.590  74.018 55.888 1.00 30.78 ? 505  LEU A N   1 
ATOM   4129 C  CA  . LEU A 1 505 ? 20.697  75.135 55.634 1.00 31.05 ? 505  LEU A CA  1 
ATOM   4130 C  C   . LEU A 1 505 ? 20.592  75.938 56.925 1.00 32.18 ? 505  LEU A C   1 
ATOM   4131 O  O   . LEU A 1 505 ? 19.893  75.536 57.871 1.00 31.48 ? 505  LEU A O   1 
ATOM   4132 C  CB  . LEU A 1 505 ? 19.308  74.670 55.167 1.00 30.56 ? 505  LEU A CB  1 
ATOM   4133 C  CG  . LEU A 1 505 ? 19.158  74.120 53.735 1.00 30.22 ? 505  LEU A CG  1 
ATOM   4134 C  CD1 . LEU A 1 505 ? 17.756  73.534 53.522 1.00 26.86 ? 505  LEU A CD1 1 
ATOM   4135 C  CD2 . LEU A 1 505 ? 19.435  75.220 52.701 1.00 28.17 ? 505  LEU A CD2 1 
ATOM   4136 N  N   . ASN A 1 506 ? 21.317  77.055 56.961 1.00 32.80 ? 506  ASN A N   1 
ATOM   4137 C  CA  . ASN A 1 506 ? 21.298  77.980 58.092 1.00 34.57 ? 506  ASN A CA  1 
ATOM   4138 C  C   . ASN A 1 506 ? 21.691  79.386 57.621 1.00 35.90 ? 506  ASN A C   1 
ATOM   4139 O  O   . ASN A 1 506 ? 21.929  79.595 56.427 1.00 35.55 ? 506  ASN A O   1 
ATOM   4140 C  CB  . ASN A 1 506 ? 22.206  77.474 59.231 1.00 34.54 ? 506  ASN A CB  1 
ATOM   4141 C  CG  . ASN A 1 506 ? 23.633  77.222 58.776 1.00 34.34 ? 506  ASN A CG  1 
ATOM   4142 O  OD1 . ASN A 1 506 ? 24.324  78.140 58.353 1.00 36.70 ? 506  ASN A OD1 1 
ATOM   4143 N  ND2 . ASN A 1 506 ? 24.075  75.981 58.862 1.00 31.98 ? 506  ASN A ND2 1 
ATOM   4144 N  N   . THR A 1 507 ? 21.739  80.346 58.545 1.00 37.62 ? 507  THR A N   1 
ATOM   4145 C  CA  . THR A 1 507 ? 22.038  81.743 58.198 1.00 38.99 ? 507  THR A CA  1 
ATOM   4146 C  C   . THR A 1 507 ? 23.514  82.001 57.866 1.00 40.39 ? 507  THR A C   1 
ATOM   4147 O  O   . THR A 1 507 ? 23.876  83.106 57.473 1.00 41.13 ? 507  THR A O   1 
ATOM   4148 C  CB  . THR A 1 507 ? 21.632  82.717 59.322 1.00 38.76 ? 507  THR A CB  1 
ATOM   4149 O  OG1 . THR A 1 507 ? 22.389  82.421 60.501 1.00 39.10 ? 507  THR A OG1 1 
ATOM   4150 C  CG2 . THR A 1 507 ? 20.153  82.631 59.626 1.00 38.49 ? 507  THR A CG2 1 
ATOM   4151 N  N   . GLU A 1 508 ? 24.367  80.999 58.041 1.00 41.74 ? 508  GLU A N   1 
ATOM   4152 C  CA  . GLU A 1 508 ? 25.789  81.147 57.738 1.00 43.06 ? 508  GLU A CA  1 
ATOM   4153 C  C   . GLU A 1 508 ? 26.090  80.720 56.307 1.00 43.34 ? 508  GLU A C   1 
ATOM   4154 O  O   . GLU A 1 508 ? 25.256  80.064 55.681 1.00 43.19 ? 508  GLU A O   1 
ATOM   4155 C  CB  . GLU A 1 508 ? 26.624  80.332 58.715 1.00 43.27 ? 508  GLU A CB  1 
ATOM   4156 C  CG  . GLU A 1 508 ? 26.672  80.937 60.112 1.00 47.19 ? 508  GLU A CG  1 
ATOM   4157 C  CD  . GLU A 1 508 ? 27.138  79.946 61.154 1.00 51.71 ? 508  GLU A CD  1 
ATOM   4158 O  OE1 . GLU A 1 508 ? 27.705  78.896 60.771 1.00 53.94 ? 508  GLU A OE1 1 
ATOM   4159 O  OE2 . GLU A 1 508 ? 26.930  80.211 62.361 1.00 54.96 ? 508  GLU A OE2 1 
ATOM   4160 N  N   . PRO A 1 509 ? 27.276  81.099 55.774 1.00 43.63 ? 509  PRO A N   1 
ATOM   4161 C  CA  . PRO A 1 509 ? 27.595  80.659 54.416 1.00 43.87 ? 509  PRO A CA  1 
ATOM   4162 C  C   . PRO A 1 509 ? 27.472  79.137 54.279 1.00 43.78 ? 509  PRO A C   1 
ATOM   4163 O  O   . PRO A 1 509 ? 27.965  78.403 55.137 1.00 43.85 ? 509  PRO A O   1 
ATOM   4164 C  CB  . PRO A 1 509 ? 29.046  81.121 54.226 1.00 43.95 ? 509  PRO A CB  1 
ATOM   4165 C  CG  . PRO A 1 509 ? 29.148  82.354 55.098 1.00 44.30 ? 509  PRO A CG  1 
ATOM   4166 C  CD  . PRO A 1 509 ? 28.296  82.024 56.312 1.00 43.86 ? 509  PRO A CD  1 
ATOM   4167 N  N   . MET A 1 510 ? 26.799  78.691 53.217 1.00 43.57 ? 510  MET A N   1 
ATOM   4168 C  CA  . MET A 1 510 ? 26.550  77.268 52.946 1.00 43.49 ? 510  MET A CA  1 
ATOM   4169 C  C   . MET A 1 510 ? 27.844  76.465 52.984 1.00 42.78 ? 510  MET A C   1 
ATOM   4170 O  O   . MET A 1 510 ? 28.853  76.892 52.429 1.00 42.80 ? 510  MET A O   1 
ATOM   4171 C  CB  . MET A 1 510 ? 25.872  77.106 51.575 1.00 44.11 ? 510  MET A CB  1 
ATOM   4172 C  CG  . MET A 1 510 ? 25.584  75.660 51.125 1.00 46.53 ? 510  MET A CG  1 
ATOM   4173 S  SD  . MET A 1 510 ? 25.619  75.467 49.311 1.00 52.46 ? 510  MET A SD  1 
ATOM   4174 C  CE  . MET A 1 510 ? 27.379  75.273 49.057 1.00 52.31 ? 510  MET A CE  1 
ATOM   4175 N  N   . LYS A 1 511 ? 27.814  75.316 53.654 1.00 41.31 ? 511  LYS A N   1 
ATOM   4176 C  CA  . LYS A 1 511 ? 28.912  74.369 53.583 1.00 40.22 ? 511  LYS A CA  1 
ATOM   4177 C  C   . LYS A 1 511 ? 28.412  73.069 53.000 1.00 39.05 ? 511  LYS A C   1 
ATOM   4178 O  O   . LYS A 1 511 ? 27.247  72.702 53.189 1.00 38.30 ? 511  LYS A O   1 
ATOM   4179 C  CB  . LYS A 1 511 ? 29.515  74.097 54.958 1.00 40.68 ? 511  LYS A CB  1 
ATOM   4180 C  CG  . LYS A 1 511 ? 30.259  75.273 55.572 1.00 43.28 ? 511  LYS A CG  1 
ATOM   4181 C  CD  . LYS A 1 511 ? 31.040  74.824 56.803 1.00 46.89 ? 511  LYS A CD  1 
ATOM   4182 C  CE  . LYS A 1 511 ? 31.510  76.000 57.640 1.00 49.21 ? 511  LYS A CE  1 
ATOM   4183 N  NZ  . LYS A 1 511 ? 32.335  75.517 58.800 1.00 51.48 ? 511  LYS A NZ  1 
ATOM   4184 N  N   . VAL A 1 512 ? 29.305  72.378 52.296 1.00 37.58 ? 512  VAL A N   1 
ATOM   4185 C  CA  . VAL A 1 512 ? 29.021  71.063 51.759 1.00 36.54 ? 512  VAL A CA  1 
ATOM   4186 C  C   . VAL A 1 512 ? 29.612  70.036 52.728 1.00 35.95 ? 512  VAL A C   1 
ATOM   4187 O  O   . VAL A 1 512 ? 30.734  70.211 53.198 1.00 35.50 ? 512  VAL A O   1 
ATOM   4188 C  CB  . VAL A 1 512 ? 29.620  70.896 50.339 1.00 36.62 ? 512  VAL A CB  1 
ATOM   4189 C  CG1 . VAL A 1 512 ? 29.488  69.446 49.828 1.00 36.17 ? 512  VAL A CG1 1 
ATOM   4190 C  CG2 . VAL A 1 512 ? 28.947  71.859 49.360 1.00 36.97 ? 512  VAL A CG2 1 
ATOM   4191 N  N   . HIS A 1 513 ? 28.851  68.984 53.035 1.00 34.63 ? 513  HIS A N   1 
ATOM   4192 C  CA  . HIS A 1 513 ? 29.324  67.914 53.920 1.00 33.74 ? 513  HIS A CA  1 
ATOM   4193 C  C   . HIS A 1 513 ? 29.126  66.597 53.217 1.00 33.20 ? 513  HIS A C   1 
ATOM   4194 O  O   . HIS A 1 513 ? 28.506  66.555 52.161 1.00 32.36 ? 513  HIS A O   1 
ATOM   4195 C  CB  . HIS A 1 513 ? 28.538  67.899 55.239 1.00 33.97 ? 513  HIS A CB  1 
ATOM   4196 C  CG  . HIS A 1 513 ? 28.467  69.224 55.920 1.00 33.86 ? 513  HIS A CG  1 
ATOM   4197 N  ND1 . HIS A 1 513 ? 29.464  69.688 56.750 1.00 35.64 ? 513  HIS A ND1 1 
ATOM   4198 C  CD2 . HIS A 1 513 ? 27.522  70.190 55.891 1.00 34.78 ? 513  HIS A CD2 1 
ATOM   4199 C  CE1 . HIS A 1 513 ? 29.137  70.880 57.209 1.00 34.07 ? 513  HIS A CE1 1 
ATOM   4200 N  NE2 . HIS A 1 513 ? 27.961  71.209 56.703 1.00 35.33 ? 513  HIS A NE2 1 
ATOM   4201 N  N   . GLN A 1 514 ? 29.627  65.514 53.805 1.00 32.77 ? 514  GLN A N   1 
ATOM   4202 C  CA  . GLN A 1 514 ? 29.448  64.193 53.212 1.00 32.91 ? 514  GLN A CA  1 
ATOM   4203 C  C   . GLN A 1 514 ? 29.008  63.168 54.240 1.00 32.37 ? 514  GLN A C   1 
ATOM   4204 O  O   . GLN A 1 514 ? 29.346  63.281 55.426 1.00 32.02 ? 514  GLN A O   1 
ATOM   4205 C  CB  . GLN A 1 514 ? 30.745  63.716 52.539 1.00 33.66 ? 514  GLN A CB  1 
ATOM   4206 C  CG  . GLN A 1 514 ? 31.186  64.561 51.342 1.00 36.07 ? 514  GLN A CG  1 
ATOM   4207 C  CD  . GLN A 1 514 ? 32.550  64.149 50.823 1.00 39.19 ? 514  GLN A CD  1 
ATOM   4208 O  OE1 . GLN A 1 514 ? 33.558  64.735 51.201 1.00 41.67 ? 514  GLN A OE1 1 
ATOM   4209 N  NE2 . GLN A 1 514 ? 32.590  63.120 49.979 1.00 38.23 ? 514  GLN A NE2 1 
ATOM   4210 N  N   . ARG A 1 515 ? 28.263  62.169 53.768 1.00 31.52 ? 515  ARG A N   1 
ATOM   4211 C  CA  . ARG A 1 515 ? 27.945  60.967 54.548 1.00 31.23 ? 515  ARG A CA  1 
ATOM   4212 C  C   . ARG A 1 515 ? 27.173  61.275 55.845 1.00 30.18 ? 515  ARG A C   1 
ATOM   4213 O  O   . ARG A 1 515 ? 27.662  61.009 56.954 1.00 29.58 ? 515  ARG A O   1 
ATOM   4214 C  CB  . ARG A 1 515 ? 29.232  60.165 54.835 1.00 31.77 ? 515  ARG A CB  1 
ATOM   4215 C  CG  . ARG A 1 515 ? 29.887  59.597 53.574 1.00 34.12 ? 515  ARG A CG  1 
ATOM   4216 C  CD  . ARG A 1 515 ? 30.984  58.573 53.874 1.00 39.27 ? 515  ARG A CD  1 
ATOM   4217 N  NE  . ARG A 1 515 ? 31.357  57.827 52.668 1.00 42.44 ? 515  ARG A NE  1 
ATOM   4218 C  CZ  . ARG A 1 515 ? 32.183  56.777 52.634 1.00 46.01 ? 515  ARG A CZ  1 
ATOM   4219 N  NH1 . ARG A 1 515 ? 32.762  56.313 53.743 1.00 45.67 ? 515  ARG A NH1 1 
ATOM   4220 N  NH2 . ARG A 1 515 ? 32.435  56.181 51.474 1.00 46.33 ? 515  ARG A NH2 1 
ATOM   4221 N  N   . LEU A 1 516 ? 25.977  61.839 55.688 1.00 28.47 ? 516  LEU A N   1 
ATOM   4222 C  CA  . LEU A 1 516 ? 25.140  62.263 56.816 1.00 27.73 ? 516  LEU A CA  1 
ATOM   4223 C  C   . LEU A 1 516 ? 24.891  61.122 57.806 1.00 26.92 ? 516  LEU A C   1 
ATOM   4224 O  O   . LEU A 1 516 ? 24.339  60.084 57.446 1.00 25.97 ? 516  LEU A O   1 
ATOM   4225 C  CB  . LEU A 1 516 ? 23.824  62.886 56.315 1.00 27.27 ? 516  LEU A CB  1 
ATOM   4226 C  CG  . LEU A 1 516 ? 22.749  63.383 57.292 1.00 29.11 ? 516  LEU A CG  1 
ATOM   4227 C  CD1 . LEU A 1 516 ? 23.248  64.394 58.301 1.00 29.43 ? 516  LEU A CD1 1 
ATOM   4228 C  CD2 . LEU A 1 516 ? 21.591  63.990 56.508 1.00 29.93 ? 516  LEU A CD2 1 
ATOM   4229 N  N   . ARG A 1 517 ? 25.363  61.319 59.036 1.00 26.46 ? 517  ARG A N   1 
ATOM   4230 C  CA  . ARG A 1 517 ? 25.190  60.374 60.153 1.00 26.68 ? 517  ARG A CA  1 
ATOM   4231 C  C   . ARG A 1 517 ? 25.466  58.921 59.788 1.00 25.97 ? 517  ARG A C   1 
ATOM   4232 O  O   . ARG A 1 517 ? 24.798  57.999 60.256 1.00 25.89 ? 517  ARG A O   1 
ATOM   4233 C  CB  . ARG A 1 517 ? 23.838  60.611 60.851 1.00 26.89 ? 517  ARG A CB  1 
ATOM   4234 C  CG  . ARG A 1 517 ? 23.882  62.038 61.475 1.00 30.18 ? 517  ARG A CG  1 
ATOM   4235 C  CD  . ARG A 1 517 ? 22.945  62.321 62.606 1.00 31.29 ? 517  ARG A CD  1 
ATOM   4236 N  NE  . ARG A 1 517 ? 23.015  61.421 63.755 1.00 32.07 ? 517  ARG A NE  1 
ATOM   4237 C  CZ  . ARG A 1 517 ? 23.842  61.540 64.800 1.00 33.62 ? 517  ARG A CZ  1 
ATOM   4238 N  NH1 . ARG A 1 517 ? 24.775  62.491 64.836 1.00 34.86 ? 517  ARG A NH1 1 
ATOM   4239 N  NH2 . ARG A 1 517 ? 23.763  60.668 65.806 1.00 28.78 ? 517  ARG A NH2 1 
ATOM   4240 N  N   . VAL A 1 518 ? 26.496  58.730 58.971 1.00 25.28 ? 518  VAL A N   1 
ATOM   4241 C  CA  . VAL A 1 518 ? 26.760  57.437 58.366 1.00 25.19 ? 518  VAL A CA  1 
ATOM   4242 C  C   . VAL A 1 518 ? 27.036  56.358 59.424 1.00 24.86 ? 518  VAL A C   1 
ATOM   4243 O  O   . VAL A 1 518 ? 26.542  55.242 59.308 1.00 24.29 ? 518  VAL A O   1 
ATOM   4244 C  CB  . VAL A 1 518 ? 27.887  57.521 57.294 1.00 25.16 ? 518  VAL A CB  1 
ATOM   4245 C  CG1 . VAL A 1 518 ? 29.239  57.990 57.908 1.00 25.00 ? 518  VAL A CG1 1 
ATOM   4246 C  CG2 . VAL A 1 518 ? 28.039  56.194 56.537 1.00 25.14 ? 518  VAL A CG2 1 
ATOM   4247 N  N   . GLN A 1 519 ? 27.794  56.706 60.465 1.00 25.04 ? 519  GLN A N   1 
ATOM   4248 C  CA  . GLN A 1 519 ? 28.139  55.729 61.510 1.00 25.41 ? 519  GLN A CA  1 
ATOM   4249 C  C   . GLN A 1 519 ? 26.864  55.175 62.166 1.00 24.58 ? 519  GLN A C   1 
ATOM   4250 O  O   . GLN A 1 519 ? 26.641  53.961 62.214 1.00 23.78 ? 519  GLN A O   1 
ATOM   4251 C  CB  . GLN A 1 519 ? 29.040  56.382 62.585 1.00 25.96 ? 519  GLN A CB  1 
ATOM   4252 C  CG  . GLN A 1 519 ? 29.725  55.359 63.501 1.00 28.79 ? 519  GLN A CG  1 
ATOM   4253 C  CD  . GLN A 1 519 ? 30.876  54.617 62.802 1.00 31.81 ? 519  GLN A CD  1 
ATOM   4254 O  OE1 . GLN A 1 519 ? 31.593  55.191 61.955 1.00 32.40 ? 519  GLN A OE1 1 
ATOM   4255 N  NE2 . GLN A 1 519 ? 31.057  53.338 63.153 1.00 31.35 ? 519  GLN A NE2 1 
ATOM   4256 N  N   . MET A 1 520 ? 26.026  56.071 62.669 1.00 23.97 ? 520  MET A N   1 
ATOM   4257 C  CA  . MET A 1 520 ? 24.793  55.644 63.319 1.00 24.62 ? 520  MET A CA  1 
ATOM   4258 C  C   . MET A 1 520 ? 23.833  54.950 62.332 1.00 24.36 ? 520  MET A C   1 
ATOM   4259 O  O   . MET A 1 520 ? 23.114  54.016 62.700 1.00 24.62 ? 520  MET A O   1 
ATOM   4260 C  CB  . MET A 1 520 ? 24.124  56.827 64.021 1.00 24.89 ? 520  MET A CB  1 
ATOM   4261 C  CG  . MET A 1 520 ? 24.932  57.373 65.189 1.00 28.16 ? 520  MET A CG  1 
ATOM   4262 S  SD  . MET A 1 520 ? 25.376  56.054 66.364 1.00 36.45 ? 520  MET A SD  1 
ATOM   4263 C  CE  . MET A 1 520 ? 25.966  57.063 67.744 1.00 35.89 ? 520  MET A CE  1 
ATOM   4264 N  N   . CYS A 1 521 ? 23.824  55.387 61.075 1.00 24.05 ? 521  CYS A N   1 
ATOM   4265 C  CA  . CYS A 1 521 ? 22.880  54.777 60.125 1.00 24.17 ? 521  CYS A CA  1 
ATOM   4266 C  C   . CYS A 1 521 ? 23.292  53.371 59.698 1.00 23.41 ? 521  CYS A C   1 
ATOM   4267 O  O   . CYS A 1 521 ? 22.443  52.565 59.392 1.00 23.94 ? 521  CYS A O   1 
ATOM   4268 C  CB  . CYS A 1 521 ? 22.528  55.712 58.962 1.00 23.77 ? 521  CYS A CB  1 
ATOM   4269 S  SG  . CYS A 1 521 ? 21.701  57.215 59.579 0.90 26.04 ? 521  CYS A SG  1 
ATOM   4270 N  N   . VAL A 1 522 ? 24.578  53.041 59.765 1.00 23.51 ? 522  VAL A N   1 
ATOM   4271 C  CA  . VAL A 1 522 ? 24.970  51.629 59.588 1.00 23.09 ? 522  VAL A CA  1 
ATOM   4272 C  C   . VAL A 1 522 ? 24.424  50.793 60.751 1.00 23.07 ? 522  VAL A C   1 
ATOM   4273 O  O   . VAL A 1 522 ? 23.987  49.646 60.571 1.00 23.33 ? 522  VAL A O   1 
ATOM   4274 C  CB  . VAL A 1 522 ? 26.499  51.441 59.489 1.00 23.19 ? 522  VAL A CB  1 
ATOM   4275 C  CG1 . VAL A 1 522 ? 26.879  49.934 59.545 1.00 23.01 ? 522  VAL A CG1 1 
ATOM   4276 C  CG2 . VAL A 1 522 ? 27.027  52.077 58.203 1.00 22.65 ? 522  VAL A CG2 1 
ATOM   4277 N  N   . PHE A 1 523 ? 24.450  51.365 61.950 1.00 22.40 ? 523  PHE A N   1 
ATOM   4278 C  CA  . PHE A 1 523 ? 23.873  50.683 63.097 1.00 22.46 ? 523  PHE A CA  1 
ATOM   4279 C  C   . PHE A 1 523 ? 22.365  50.468 62.872 1.00 22.18 ? 523  PHE A C   1 
ATOM   4280 O  O   . PHE A 1 523 ? 21.859  49.355 63.005 1.00 22.59 ? 523  PHE A O   1 
ATOM   4281 C  CB  . PHE A 1 523 ? 24.149  51.460 64.402 1.00 22.03 ? 523  PHE A CB  1 
ATOM   4282 C  CG  . PHE A 1 523 ? 23.394  50.913 65.589 1.00 22.23 ? 523  PHE A CG  1 
ATOM   4283 C  CD1 . PHE A 1 523 ? 23.895  49.827 66.307 1.00 23.93 ? 523  PHE A CD1 1 
ATOM   4284 C  CD2 . PHE A 1 523 ? 22.180  51.465 65.970 1.00 21.44 ? 523  PHE A CD2 1 
ATOM   4285 C  CE1 . PHE A 1 523 ? 23.181  49.296 67.403 1.00 25.19 ? 523  PHE A CE1 1 
ATOM   4286 C  CE2 . PHE A 1 523 ? 21.466  50.952 67.056 1.00 22.84 ? 523  PHE A CE2 1 
ATOM   4287 C  CZ  . PHE A 1 523 ? 21.972  49.857 67.771 1.00 24.51 ? 523  PHE A CZ  1 
ATOM   4288 N  N   . TRP A 1 524 ? 21.645  51.529 62.521 1.00 22.00 ? 524  TRP A N   1 
ATOM   4289 C  CA  . TRP A 1 524 ? 20.178  51.419 62.432 1.00 22.14 ? 524  TRP A CA  1 
ATOM   4290 C  C   . TRP A 1 524 ? 19.704  50.652 61.204 1.00 22.94 ? 524  TRP A C   1 
ATOM   4291 O  O   . TRP A 1 524 ? 18.683  49.980 61.264 1.00 22.61 ? 524  TRP A O   1 
ATOM   4292 C  CB  . TRP A 1 524 ? 19.504  52.802 62.462 1.00 21.41 ? 524  TRP A CB  1 
ATOM   4293 C  CG  . TRP A 1 524 ? 19.615  53.471 63.810 1.00 21.74 ? 524  TRP A CG  1 
ATOM   4294 C  CD1 . TRP A 1 524 ? 20.434  54.514 64.144 1.00 21.38 ? 524  TRP A CD1 1 
ATOM   4295 C  CD2 . TRP A 1 524 ? 18.924  53.100 65.010 1.00 21.98 ? 524  TRP A CD2 1 
ATOM   4296 N  NE1 . TRP A 1 524 ? 20.267  54.841 65.471 1.00 23.25 ? 524  TRP A NE1 1 
ATOM   4297 C  CE2 . TRP A 1 524 ? 19.342  53.988 66.025 1.00 22.41 ? 524  TRP A CE2 1 
ATOM   4298 C  CE3 . TRP A 1 524 ? 17.975  52.110 65.321 1.00 20.99 ? 524  TRP A CE3 1 
ATOM   4299 C  CZ2 . TRP A 1 524 ? 18.856  53.908 67.345 1.00 21.26 ? 524  TRP A CZ2 1 
ATOM   4300 C  CZ3 . TRP A 1 524 ? 17.475  52.045 66.626 1.00 21.46 ? 524  TRP A CZ3 1 
ATOM   4301 C  CH2 . TRP A 1 524 ? 17.919  52.939 67.619 1.00 19.85 ? 524  TRP A CH2 1 
ATOM   4302 N  N   . ASN A 1 525 ? 20.445  50.764 60.104 1.00 23.94 ? 525  ASN A N   1 
ATOM   4303 C  CA  . ASN A 1 525 ? 20.003  50.208 58.811 1.00 25.39 ? 525  ASN A CA  1 
ATOM   4304 C  C   . ASN A 1 525 ? 20.550  48.825 58.518 1.00 26.19 ? 525  ASN A C   1 
ATOM   4305 O  O   . ASN A 1 525 ? 19.924  48.065 57.784 1.00 26.88 ? 525  ASN A O   1 
ATOM   4306 C  CB  . ASN A 1 525 ? 20.339  51.171 57.657 1.00 24.60 ? 525  ASN A CB  1 
ATOM   4307 C  CG  . ASN A 1 525 ? 19.571  52.462 57.757 1.00 25.20 ? 525  ASN A CG  1 
ATOM   4308 O  OD1 . ASN A 1 525 ? 18.479  52.480 58.308 1.00 27.81 ? 525  ASN A OD1 1 
ATOM   4309 N  ND2 . ASN A 1 525 ? 20.136  53.548 57.257 1.00 24.70 ? 525  ASN A ND2 1 
ATOM   4310 N  N   . GLN A 1 526 ? 21.702  48.487 59.095 1.00 26.11 ? 526  GLN A N   1 
ATOM   4311 C  CA  A GLN A 1 526 ? 22.346  47.206 58.801 0.50 26.44 ? 526  GLN A CA  1 
ATOM   4312 C  CA  B GLN A 1 526 ? 22.312  47.199 58.804 0.50 26.50 ? 526  GLN A CA  1 
ATOM   4313 C  C   . GLN A 1 526 ? 22.475  46.327 60.043 1.00 26.54 ? 526  GLN A C   1 
ATOM   4314 O  O   . GLN A 1 526 ? 21.976  45.198 60.072 1.00 26.64 ? 526  GLN A O   1 
ATOM   4315 C  CB  A GLN A 1 526 ? 23.722  47.414 58.147 0.50 26.81 ? 526  GLN A CB  1 
ATOM   4316 C  CB  B GLN A 1 526 ? 23.639  47.370 58.055 0.50 26.90 ? 526  GLN A CB  1 
ATOM   4317 C  CG  A GLN A 1 526 ? 23.737  48.448 57.004 0.50 28.51 ? 526  GLN A CG  1 
ATOM   4318 C  CG  B GLN A 1 526 ? 23.478  47.622 56.538 0.50 28.91 ? 526  GLN A CG  1 
ATOM   4319 C  CD  A GLN A 1 526 ? 24.982  48.365 56.130 0.50 30.74 ? 526  GLN A CD  1 
ATOM   4320 C  CD  B GLN A 1 526 ? 23.177  49.077 56.180 0.50 30.58 ? 526  GLN A CD  1 
ATOM   4321 O  OE1 A GLN A 1 526 ? 25.562  49.385 55.760 0.50 33.01 ? 526  GLN A OE1 1 
ATOM   4322 O  OE1 B GLN A 1 526 ? 23.783  50.006 56.719 0.50 31.74 ? 526  GLN A OE1 1 
ATOM   4323 N  NE2 A GLN A 1 526 ? 25.403  47.147 55.803 0.50 32.26 ? 526  GLN A NE2 1 
ATOM   4324 N  NE2 B GLN A 1 526 ? 22.250  49.276 55.243 0.50 30.70 ? 526  GLN A NE2 1 
ATOM   4325 N  N   . PHE A 1 527 ? 23.142  46.841 61.079 1.00 25.85 ? 527  PHE A N   1 
ATOM   4326 C  CA  . PHE A 1 527 ? 23.442  45.978 62.236 1.00 25.04 ? 527  PHE A CA  1 
ATOM   4327 C  C   . PHE A 1 527 ? 22.245  45.588 63.105 1.00 24.84 ? 527  PHE A C   1 
ATOM   4328 O  O   . PHE A 1 527 ? 21.989  44.400 63.323 1.00 24.40 ? 527  PHE A O   1 
ATOM   4329 C  CB  . PHE A 1 527 ? 24.573  46.555 63.112 1.00 25.16 ? 527  PHE A CB  1 
ATOM   4330 C  CG  . PHE A 1 527 ? 24.926  45.663 64.278 1.00 24.37 ? 527  PHE A CG  1 
ATOM   4331 C  CD1 . PHE A 1 527 ? 25.616  44.464 64.061 1.00 23.74 ? 527  PHE A CD1 1 
ATOM   4332 C  CD2 . PHE A 1 527 ? 24.541  45.998 65.574 1.00 23.77 ? 527  PHE A CD2 1 
ATOM   4333 C  CE1 . PHE A 1 527 ? 25.936  43.603 65.122 1.00 24.31 ? 527  PHE A CE1 1 
ATOM   4334 C  CE2 . PHE A 1 527 ? 24.864  45.150 66.656 1.00 24.31 ? 527  PHE A CE2 1 
ATOM   4335 C  CZ  . PHE A 1 527 ? 25.558  43.944 66.420 1.00 24.53 ? 527  PHE A CZ  1 
ATOM   4336 N  N   . LEU A 1 528 ? 21.517  46.581 63.603 1.00 24.40 ? 528  LEU A N   1 
ATOM   4337 C  CA  . LEU A 1 528 ? 20.402  46.291 64.501 1.00 24.45 ? 528  LEU A CA  1 
ATOM   4338 C  C   . LEU A 1 528 ? 19.345  45.344 63.868 1.00 24.84 ? 528  LEU A C   1 
ATOM   4339 O  O   . LEU A 1 528 ? 18.972  44.369 64.492 1.00 23.30 ? 528  LEU A O   1 
ATOM   4340 C  CB  . LEU A 1 528 ? 19.757  47.573 65.067 1.00 24.18 ? 528  LEU A CB  1 
ATOM   4341 C  CG  . LEU A 1 528 ? 18.652  47.309 66.128 1.00 24.19 ? 528  LEU A CG  1 
ATOM   4342 C  CD1 . LEU A 1 528 ? 19.188  46.482 67.327 1.00 25.00 ? 528  LEU A CD1 1 
ATOM   4343 C  CD2 . LEU A 1 528 ? 17.968  48.586 66.617 1.00 22.83 ? 528  LEU A CD2 1 
ATOM   4344 N  N   . PRO A 1 529 ? 18.884  45.622 62.624 1.00 25.76 ? 529  PRO A N   1 
ATOM   4345 C  CA  . PRO A 1 529 ? 17.929  44.685 61.998 1.00 26.37 ? 529  PRO A CA  1 
ATOM   4346 C  C   . PRO A 1 529 ? 18.486  43.254 61.909 1.00 27.23 ? 529  PRO A C   1 
ATOM   4347 O  O   . PRO A 1 529 ? 17.760  42.290 62.158 1.00 27.70 ? 529  PRO A O   1 
ATOM   4348 C  CB  . PRO A 1 529 ? 17.726  45.277 60.590 1.00 26.69 ? 529  PRO A CB  1 
ATOM   4349 C  CG  . PRO A 1 529 ? 18.052  46.734 60.739 1.00 26.50 ? 529  PRO A CG  1 
ATOM   4350 C  CD  . PRO A 1 529 ? 19.217  46.737 61.723 1.00 25.42 ? 529  PRO A CD  1 
ATOM   4351 N  N   . LYS A 1 530 ? 19.768  43.110 61.591 1.00 27.64 ? 530  LYS A N   1 
ATOM   4352 C  CA  . LYS A 1 530 ? 20.389  41.783 61.599 1.00 28.76 ? 530  LYS A CA  1 
ATOM   4353 C  C   . LYS A 1 530 ? 20.389  41.166 63.008 1.00 29.18 ? 530  LYS A C   1 
ATOM   4354 O  O   . LYS A 1 530 ? 19.983  40.006 63.188 1.00 29.30 ? 530  LYS A O   1 
ATOM   4355 C  CB  . LYS A 1 530 ? 21.801  41.838 61.015 1.00 29.07 ? 530  LYS A CB  1 
ATOM   4356 C  CG  . LYS A 1 530 ? 22.430  40.476 60.827 1.00 31.37 ? 530  LYS A CG  1 
ATOM   4357 C  CD  . LYS A 1 530 ? 23.695  40.564 60.012 1.00 35.93 ? 530  LYS A CD  1 
ATOM   4358 C  CE  . LYS A 1 530 ? 24.305  39.176 59.805 1.00 38.58 ? 530  LYS A CE  1 
ATOM   4359 N  NZ  . LYS A 1 530 ? 25.558  39.252 58.984 1.00 38.86 ? 530  LYS A NZ  1 
ATOM   4360 N  N   . LEU A 1 531 ? 20.804  41.943 64.009 1.00 28.41 ? 531  LEU A N   1 
ATOM   4361 C  CA  . LEU A 1 531 ? 20.759  41.474 65.390 1.00 29.03 ? 531  LEU A CA  1 
ATOM   4362 C  C   . LEU A 1 531 ? 19.356  40.990 65.770 1.00 29.48 ? 531  LEU A C   1 
ATOM   4363 O  O   . LEU A 1 531 ? 19.199  39.905 66.328 1.00 28.88 ? 531  LEU A O   1 
ATOM   4364 C  CB  . LEU A 1 531 ? 21.230  42.576 66.354 1.00 28.08 ? 531  LEU A CB  1 
ATOM   4365 C  CG  . LEU A 1 531 ? 21.302  42.220 67.850 1.00 28.67 ? 531  LEU A CG  1 
ATOM   4366 C  CD1 . LEU A 1 531 ? 22.341  43.079 68.580 1.00 28.20 ? 531  LEU A CD1 1 
ATOM   4367 C  CD2 . LEU A 1 531 ? 19.944  42.340 68.539 1.00 26.93 ? 531  LEU A CD2 1 
ATOM   4368 N  N   . LEU A 1 532 ? 18.348  41.809 65.477 1.00 30.66 ? 532  LEU A N   1 
ATOM   4369 C  CA  . LEU A 1 532 ? 16.977  41.477 65.853 1.00 32.90 ? 532  LEU A CA  1 
ATOM   4370 C  C   . LEU A 1 532 ? 16.432  40.255 65.119 1.00 34.67 ? 532  LEU A C   1 
ATOM   4371 O  O   . LEU A 1 532 ? 15.684  39.481 65.699 1.00 35.60 ? 532  LEU A O   1 
ATOM   4372 C  CB  . LEU A 1 532 ? 16.040  42.679 65.664 1.00 32.42 ? 532  LEU A CB  1 
ATOM   4373 C  CG  . LEU A 1 532 ? 16.293  43.895 66.567 1.00 31.53 ? 532  LEU A CG  1 
ATOM   4374 C  CD1 . LEU A 1 532 ? 15.300  45.017 66.230 1.00 32.18 ? 532  LEU A CD1 1 
ATOM   4375 C  CD2 . LEU A 1 532 ? 16.190  43.525 68.049 1.00 29.78 ? 532  LEU A CD2 1 
ATOM   4376 N  N   . ASN A 1 533 ? 16.810  40.088 63.858 1.00 36.85 ? 533  ASN A N   1 
ATOM   4377 C  CA  . ASN A 1 533 ? 16.377  38.941 63.067 1.00 39.86 ? 533  ASN A CA  1 
ATOM   4378 C  C   . ASN A 1 533 ? 17.037  37.628 63.499 1.00 41.34 ? 533  ASN A C   1 
ATOM   4379 O  O   . ASN A 1 533 ? 16.512  36.546 63.244 1.00 41.52 ? 533  ASN A O   1 
ATOM   4380 C  CB  . ASN A 1 533 ? 16.646  39.183 61.580 1.00 39.80 ? 533  ASN A CB  1 
ATOM   4381 C  CG  . ASN A 1 533 ? 16.086  38.075 60.702 1.00 42.76 ? 533  ASN A CG  1 
ATOM   4382 O  OD1 . ASN A 1 533 ? 16.836  37.273 60.133 1.00 45.05 ? 533  ASN A OD1 1 
ATOM   4383 N  ND2 . ASN A 1 533 ? 14.758  37.999 60.621 1.00 44.72 ? 533  ASN A ND2 1 
ATOM   4384 N  N   . ALA A 1 534 ? 18.195  37.728 64.142 1.00 43.10 ? 534  ALA A N   1 
ATOM   4385 C  CA  . ALA A 1 534 ? 18.938  36.548 64.550 1.00 45.08 ? 534  ALA A CA  1 
ATOM   4386 C  C   . ALA A 1 534 ? 18.441  36.070 65.903 1.00 46.64 ? 534  ALA A C   1 
ATOM   4387 O  O   . ALA A 1 534 ? 18.196  34.876 66.084 1.00 47.38 ? 534  ALA A O   1 
ATOM   4388 C  CB  . ALA A 1 534 ? 20.427  36.843 64.593 1.00 44.92 ? 534  ALA A CB  1 
ATOM   4389 N  N   . THR A 1 535 ? 18.284  37.016 66.834 1.00 48.09 ? 535  THR A N   1 
ATOM   4390 C  CA  . THR A 1 535 ? 17.884  36.747 68.225 1.00 49.04 ? 535  THR A CA  1 
ATOM   4391 C  C   . THR A 1 535 ? 16.373  36.770 68.425 1.00 49.78 ? 535  THR A C   1 
ATOM   4392 O  O   . THR A 1 535 ? 15.693  37.688 67.962 1.00 50.72 ? 535  THR A O   1 
ATOM   4393 C  CB  . THR A 1 535 ? 18.536  37.749 69.245 1.00 49.30 ? 535  THR A CB  1 
ATOM   4394 O  OG1 . THR A 1 535 ? 18.605  39.072 68.695 1.00 48.19 ? 535  THR A OG1 1 
ATOM   4395 C  CG2 . THR A 1 535 ? 19.923  37.308 69.606 1.00 49.86 ? 535  THR A CG2 1 
HETATM 4396 C  C1  . NAG B 2 .   ? 18.763  62.171 33.937 1.00 40.04 ? 1    NAG B C1  1 
HETATM 4397 C  C2  . NAG B 2 .   ? 20.283  62.029 34.013 1.00 42.65 ? 1    NAG B C2  1 
HETATM 4398 C  C3  . NAG B 2 .   ? 20.937  62.564 32.738 1.00 46.05 ? 1    NAG B C3  1 
HETATM 4399 C  C4  . NAG B 2 .   ? 20.258  62.053 31.463 1.00 49.02 ? 1    NAG B C4  1 
HETATM 4400 C  C5  . NAG B 2 .   ? 18.741  62.246 31.570 1.00 47.79 ? 1    NAG B C5  1 
HETATM 4401 C  C6  . NAG B 2 .   ? 17.975  61.697 30.360 1.00 48.66 ? 1    NAG B C6  1 
HETATM 4402 C  C7  . NAG B 2 .   ? 21.249  62.190 36.269 1.00 39.60 ? 1    NAG B C7  1 
HETATM 4403 C  C8  . NAG B 2 .   ? 21.833  63.119 37.293 1.00 38.82 ? 1    NAG B C8  1 
HETATM 4404 N  N2  . NAG B 2 .   ? 20.858  62.765 35.127 1.00 39.56 ? 1    NAG B N2  1 
HETATM 4405 O  O3  . NAG B 2 .   ? 22.313  62.245 32.770 1.00 45.69 ? 1    NAG B O3  1 
HETATM 4406 O  O4  . NAG B 2 .   ? 20.769  62.774 30.360 1.00 55.63 ? 1    NAG B O4  1 
HETATM 4407 O  O5  . NAG B 2 .   ? 18.274  61.598 32.742 1.00 42.92 ? 1    NAG B O5  1 
HETATM 4408 O  O6  . NAG B 2 .   ? 17.860  60.287 30.444 1.00 50.58 ? 1    NAG B O6  1 
HETATM 4409 O  O7  . NAG B 2 .   ? 21.139  60.982 36.508 1.00 38.47 ? 1    NAG B O7  1 
HETATM 4410 C  C1  . NAG B 2 .   ? 21.353  61.907 29.359 1.00 60.01 ? 2    NAG B C1  1 
HETATM 4411 C  C2  . NAG B 2 .   ? 21.468  62.712 28.056 1.00 62.12 ? 2    NAG B C2  1 
HETATM 4412 C  C3  . NAG B 2 .   ? 22.161  61.892 26.965 1.00 63.43 ? 2    NAG B C3  1 
HETATM 4413 C  C4  . NAG B 2 .   ? 23.483  61.311 27.477 1.00 63.66 ? 2    NAG B C4  1 
HETATM 4414 C  C5  . NAG B 2 .   ? 23.279  60.577 28.817 1.00 63.44 ? 2    NAG B C5  1 
HETATM 4415 C  C6  . NAG B 2 .   ? 24.599  60.144 29.449 1.00 63.16 ? 2    NAG B C6  1 
HETATM 4416 C  C7  . NAG B 2 .   ? 19.799  64.497 27.804 1.00 64.38 ? 2    NAG B C7  1 
HETATM 4417 C  C8  . NAG B 2 .   ? 18.437  64.887 27.300 1.00 64.53 ? 2    NAG B C8  1 
HETATM 4418 N  N2  . NAG B 2 .   ? 20.171  63.222 27.612 1.00 62.65 ? 2    NAG B N2  1 
HETATM 4419 O  O3  . NAG B 2 .   ? 22.410  62.713 25.841 1.00 64.45 ? 2    NAG B O3  1 
HETATM 4420 O  O4  . NAG B 2 .   ? 24.048  60.466 26.489 1.00 64.36 ? 2    NAG B O4  1 
HETATM 4421 O  O5  . NAG B 2 .   ? 22.624  61.417 29.754 1.00 61.10 ? 2    NAG B O5  1 
HETATM 4422 O  O6  . NAG B 2 .   ? 25.382  61.292 29.697 1.00 63.76 ? 2    NAG B O6  1 
HETATM 4423 O  O7  . NAG B 2 .   ? 20.508  65.346 28.365 1.00 64.78 ? 2    NAG B O7  1 
HETATM 4424 C  C1  . NAG C 3 .   ? -18.833 83.573 49.352 1.00 55.41 ? 1    NAG C C1  1 
HETATM 4425 C  C2  . NAG C 3 .   ? -19.893 84.667 49.158 1.00 59.01 ? 1    NAG C C2  1 
HETATM 4426 C  C3  . NAG C 3 .   ? -19.523 85.967 49.883 1.00 60.41 ? 1    NAG C C3  1 
HETATM 4427 C  C4  . NAG C 3 .   ? -19.127 85.710 51.330 1.00 61.51 ? 1    NAG C C4  1 
HETATM 4428 C  C5  . NAG C 3 .   ? -18.075 84.592 51.372 1.00 62.07 ? 1    NAG C C5  1 
HETATM 4429 C  C6  . NAG C 3 .   ? -17.647 84.264 52.798 1.00 64.22 ? 1    NAG C C6  1 
HETATM 4430 C  C7  . NAG C 3 .   ? -21.257 84.508 47.150 1.00 60.37 ? 1    NAG C C7  1 
HETATM 4431 C  C8  . NAG C 3 .   ? -21.457 84.923 45.718 1.00 60.14 ? 1    NAG C C8  1 
HETATM 4432 N  N2  . NAG C 3 .   ? -20.169 84.980 47.764 1.00 59.03 ? 1    NAG C N2  1 
HETATM 4433 O  O3  . NAG C 3 .   ? -20.613 86.861 49.881 1.00 61.13 ? 1    NAG C O3  1 
HETATM 4434 O  O4  . NAG C 3 .   ? -18.647 86.925 51.872 1.00 62.19 ? 1    NAG C O4  1 
HETATM 4435 O  O5  . NAG C 3 .   ? -18.575 83.417 50.740 1.00 58.70 ? 1    NAG C O5  1 
HETATM 4436 O  O6  . NAG C 3 .   ? -18.609 83.428 53.403 1.00 70.17 ? 1    NAG C O6  1 
HETATM 4437 O  O7  . NAG C 3 .   ? -22.073 83.758 47.698 1.00 60.83 ? 1    NAG C O7  1 
HETATM 4438 C  C1  . FUC C 3 .   ? -18.749 83.011 54.660 1.00 78.86 ? 2    FUC C C1  1 
HETATM 4439 C  C2  . FUC C 3 .   ? -19.974 83.607 55.360 1.00 81.16 ? 2    FUC C C2  1 
HETATM 4440 C  C3  . FUC C 3 .   ? -21.233 82.829 54.947 1.00 81.82 ? 2    FUC C C3  1 
HETATM 4441 C  C4  . FUC C 3 .   ? -21.047 81.316 55.143 1.00 82.33 ? 2    FUC C C4  1 
HETATM 4442 C  C5  . FUC C 3 .   ? -19.726 80.831 54.525 1.00 82.00 ? 2    FUC C C5  1 
HETATM 4443 C  C6  . FUC C 3 .   ? -19.451 79.360 54.843 1.00 82.23 ? 2    FUC C C6  1 
HETATM 4444 O  O2  . FUC C 3 .   ? -20.089 84.986 55.062 1.00 80.67 ? 2    FUC C O2  1 
HETATM 4445 O  O3  . FUC C 3 .   ? -22.362 83.273 55.671 1.00 82.12 ? 2    FUC C O3  1 
HETATM 4446 O  O4  . FUC C 3 .   ? -21.091 80.992 56.520 1.00 82.82 ? 2    FUC C O4  1 
HETATM 4447 O  O5  . FUC C 3 .   ? -18.638 81.630 54.975 1.00 81.16 ? 2    FUC C O5  1 
HETATM 4448 C  C7  . GD8 D 4 .   ? 5.492   68.541 62.992 0.90 34.62 ? 605  GD8 A C7  1 
HETATM 4449 C  C4  . GD8 D 4 .   ? 4.525   67.529 63.610 0.90 34.29 ? 605  GD8 A C4  1 
HETATM 4450 C  C6  . GD8 D 4 .   ? 5.185   66.876 64.820 0.90 36.23 ? 605  GD8 A C6  1 
HETATM 4451 C  C5  . GD8 D 4 .   ? 3.289   68.267 64.100 0.90 34.68 ? 605  GD8 A C5  1 
HETATM 4452 C  C2  . GD8 D 4 .   ? 4.135   66.468 62.526 0.90 34.15 ? 605  GD8 A C2  1 
HETATM 4453 C  C3  . GD8 D 4 .   ? 3.961   67.218 61.176 0.90 29.55 ? 605  GD8 A C3  1 
HETATM 4454 O  O2  . GD8 D 4 .   ? 5.116   65.380 62.495 0.90 32.13 ? 605  GD8 A O2  1 
HETATM 4455 P  P   . GD8 D 4 .   ? 5.187   63.940 61.644 0.90 32.17 ? 605  GD8 A P   1 
HETATM 4456 C  C1  . GD8 D 4 .   ? 5.454   62.701 62.918 0.90 30.60 ? 605  GD8 A C1  1 
HETATM 4457 O  O1  . GD8 D 4 .   ? 3.960   63.609 60.857 0.90 27.67 ? 605  GD8 A O1  1 
HETATM 4458 C  C   . TRS E 5 .   ? 6.623   63.829 80.298 1.00 35.30 ? 606  TRS A C   1 
HETATM 4459 C  C1  . TRS E 5 .   ? 5.901   65.147 80.542 1.00 35.53 ? 606  TRS A C1  1 
HETATM 4460 C  C2  . TRS E 5 .   ? 7.582   63.480 81.450 1.00 35.53 ? 606  TRS A C2  1 
HETATM 4461 C  C3  . TRS E 5 .   ? 5.570   62.722 80.170 1.00 34.12 ? 606  TRS A C3  1 
HETATM 4462 N  N   . TRS E 5 .   ? 7.423   63.964 79.069 1.00 33.66 ? 606  TRS A N   1 
HETATM 4463 O  O1  . TRS E 5 .   ? 4.825   65.255 79.582 1.00 36.87 ? 606  TRS A O1  1 
HETATM 4464 O  O2  . TRS E 5 .   ? 6.989   63.728 82.718 1.00 37.66 ? 606  TRS A O2  1 
HETATM 4465 O  O3  . TRS E 5 .   ? 6.239   61.463 80.067 1.00 34.02 ? 606  TRS A O3  1 
HETATM 4466 C  C   . TRS F 5 .   ? 12.481  91.558 59.275 1.00 59.88 ? 607  TRS A C   1 
HETATM 4467 C  C1  . TRS F 5 .   ? 11.530  92.451 58.457 1.00 59.92 ? 607  TRS A C1  1 
HETATM 4468 C  C2  . TRS F 5 .   ? 13.037  90.428 58.409 1.00 59.79 ? 607  TRS A C2  1 
HETATM 4469 C  C3  . TRS F 5 .   ? 13.668  92.398 59.796 1.00 59.59 ? 607  TRS A C3  1 
HETATM 4470 N  N   . TRS F 5 .   ? 11.735  90.954 60.390 1.00 59.67 ? 607  TRS A N   1 
HETATM 4471 O  O1  . TRS F 5 .   ? 10.377  91.706 58.027 1.00 60.31 ? 607  TRS A O1  1 
HETATM 4472 O  O2  . TRS F 5 .   ? 13.968  90.940 57.449 1.00 59.95 ? 607  TRS A O2  1 
HETATM 4473 O  O3  . TRS F 5 .   ? 13.396  92.914 61.098 1.00 59.47 ? 607  TRS A O3  1 
HETATM 4474 O  O1  . PG4 G 6 .   ? -13.689 81.150 29.066 1.00 51.73 ? 608  PG4 A O1  1 
HETATM 4475 C  C1  . PG4 G 6 .   ? -12.766 81.435 30.110 1.00 53.92 ? 608  PG4 A C1  1 
HETATM 4476 C  C2  . PG4 G 6 .   ? -11.458 81.956 29.515 1.00 54.59 ? 608  PG4 A C2  1 
HETATM 4477 O  O2  . PG4 G 6 .   ? -10.563 82.138 30.600 1.00 56.40 ? 608  PG4 A O2  1 
HETATM 4478 C  C3  . PG4 G 6 .   ? -9.201  81.831 30.262 1.00 57.14 ? 608  PG4 A C3  1 
HETATM 4479 C  C4  . PG4 G 6 .   ? -8.506  83.181 30.357 1.00 58.46 ? 608  PG4 A C4  1 
HETATM 4480 O  O3  . PG4 G 6 .   ? -7.241  83.116 31.030 1.00 60.77 ? 608  PG4 A O3  1 
HETATM 4481 C  C5  . PG4 G 6 .   ? -6.609  84.420 31.023 1.00 62.02 ? 608  PG4 A C5  1 
HETATM 4482 C  C6  . PG4 G 6 .   ? -6.838  85.146 32.340 1.00 63.47 ? 608  PG4 A C6  1 
HETATM 4483 O  O4  . PG4 G 6 .   ? -8.083  85.862 32.230 1.00 64.29 ? 608  PG4 A O4  1 
HETATM 4484 C  C7  . PG4 G 6 .   ? -8.714  86.001 33.516 1.00 65.48 ? 608  PG4 A C7  1 
HETATM 4485 C  C8  . PG4 G 6 .   ? -8.481  87.421 34.053 1.00 66.35 ? 608  PG4 A C8  1 
HETATM 4486 O  O5  . PG4 G 6 .   ? -9.047  88.382 33.157 1.00 66.95 ? 608  PG4 A O5  1 
HETATM 4487 O  O1  . PG4 H 6 .   ? -17.246 75.697 27.109 1.00 66.03 ? 609  PG4 A O1  1 
HETATM 4488 C  C1  . PG4 H 6 .   ? -17.241 77.135 27.061 1.00 66.15 ? 609  PG4 A C1  1 
HETATM 4489 C  C2  . PG4 H 6 .   ? -16.564 77.724 28.316 1.00 65.22 ? 609  PG4 A C2  1 
HETATM 4490 O  O2  . PG4 H 6 .   ? -15.170 77.329 28.426 1.00 63.10 ? 609  PG4 A O2  1 
HETATM 4491 C  C3  . PG4 H 6 .   ? -14.604 77.872 29.648 1.00 60.63 ? 609  PG4 A C3  1 
HETATM 4492 C  C4  . PG4 H 6 .   ? -13.280 77.176 29.959 1.00 57.60 ? 609  PG4 A C4  1 
HETATM 4493 O  O3  . PG4 H 6 .   ? -13.534 75.785 30.132 1.00 54.55 ? 609  PG4 A O3  1 
HETATM 4494 C  C5  . PG4 H 6 .   ? -12.669 75.271 31.128 1.00 53.10 ? 609  PG4 A C5  1 
HETATM 4495 C  C6  . PG4 H 6 .   ? -13.231 73.979 31.699 1.00 52.12 ? 609  PG4 A C6  1 
HETATM 4496 O  O4  . PG4 H 6 .   ? -13.583 73.115 30.616 1.00 51.96 ? 609  PG4 A O4  1 
HETATM 4497 C  C7  . PG4 H 6 .   ? -13.427 71.762 31.008 1.00 53.49 ? 609  PG4 A C7  1 
HETATM 4498 C  C8  . PG4 H 6 .   ? -14.209 70.885 30.043 1.00 53.56 ? 609  PG4 A C8  1 
HETATM 4499 O  O5  . PG4 H 6 .   ? -15.520 71.427 29.906 1.00 55.94 ? 609  PG4 A O5  1 
HETATM 4500 O  O1  . PG4 I 6 .   ? 3.149   37.023 55.426 1.00 67.06 ? 610  PG4 A O1  1 
HETATM 4501 C  C1  . PG4 I 6 .   ? 4.388   37.731 55.568 1.00 66.57 ? 610  PG4 A C1  1 
HETATM 4502 C  C2  . PG4 I 6 .   ? 4.220   39.181 55.097 1.00 65.34 ? 610  PG4 A C2  1 
HETATM 4503 O  O2  . PG4 I 6 .   ? 4.613   39.336 53.715 1.00 64.17 ? 610  PG4 A O2  1 
HETATM 4504 C  C3  . PG4 I 6 .   ? 5.575   40.404 53.584 1.00 62.25 ? 610  PG4 A C3  1 
HETATM 4505 C  C4  . PG4 I 6 .   ? 5.352   41.149 52.271 1.00 60.01 ? 610  PG4 A C4  1 
HETATM 4506 O  O3  . PG4 I 6 .   ? 3.959   41.478 52.131 1.00 57.43 ? 610  PG4 A O3  1 
HETATM 4507 C  C5  . PG4 I 6 .   ? 3.629   41.776 50.773 1.00 54.94 ? 610  PG4 A C5  1 
HETATM 4508 C  C6  . PG4 I 6 .   ? 2.252   42.396 50.750 1.00 53.79 ? 610  PG4 A C6  1 
HETATM 4509 O  O4  . PG4 I 6 .   ? 1.261   41.386 50.595 1.00 52.66 ? 610  PG4 A O4  1 
HETATM 4510 C  C7  . PG4 I 6 .   ? 0.160   41.630 51.469 1.00 52.27 ? 610  PG4 A C7  1 
HETATM 4511 C  C8  . PG4 I 6 .   ? -0.786  40.441 51.392 1.00 52.60 ? 610  PG4 A C8  1 
HETATM 4512 O  O5  . PG4 I 6 .   ? -0.636  39.641 52.570 1.00 53.00 ? 610  PG4 A O5  1 
HETATM 4513 O  O1  . PG4 J 6 .   ? 29.827  70.548 62.785 1.00 70.19 ? 611  PG4 A O1  1 
HETATM 4514 C  C1  . PG4 J 6 .   ? 28.625  71.314 62.920 1.00 69.02 ? 611  PG4 A C1  1 
HETATM 4515 C  C2  . PG4 J 6 .   ? 28.032  71.549 61.528 1.00 67.83 ? 611  PG4 A C2  1 
HETATM 4516 O  O2  . PG4 J 6 .   ? 27.853  70.290 60.848 1.00 66.07 ? 611  PG4 A O2  1 
HETATM 4517 C  C3  . PG4 J 6 .   ? 26.637  70.329 60.097 1.00 64.38 ? 611  PG4 A C3  1 
HETATM 4518 C  C4  . PG4 J 6 .   ? 26.491  69.043 59.308 1.00 63.33 ? 611  PG4 A C4  1 
HETATM 4519 O  O3  . PG4 J 6 .   ? 26.321  67.997 60.253 1.00 62.61 ? 611  PG4 A O3  1 
HETATM 4520 C  C5  . PG4 J 6 .   ? 25.387  67.031 59.794 1.00 62.07 ? 611  PG4 A C5  1 
HETATM 4521 C  C6  . PG4 J 6 .   ? 25.055  66.128 60.958 1.00 62.98 ? 611  PG4 A C6  1 
HETATM 4522 O  O4  . PG4 J 6 .   ? 26.246  65.594 61.539 1.00 64.40 ? 611  PG4 A O4  1 
HETATM 4523 C  C7  . PG4 J 6 .   ? 25.943  64.783 62.691 1.00 65.87 ? 611  PG4 A C7  1 
HETATM 4524 C  C8  . PG4 J 6 .   ? 26.441  65.425 63.989 1.00 67.44 ? 611  PG4 A C8  1 
HETATM 4525 O  O5  . PG4 J 6 .   ? 27.598  64.728 64.475 1.00 68.70 ? 611  PG4 A O5  1 
HETATM 4526 O  O1  . PG4 K 6 .   ? -2.717  59.176 75.177 1.00 52.92 ? 612  PG4 A O1  1 
HETATM 4527 C  C1  . PG4 K 6 .   ? -1.433  59.317 74.558 1.00 53.60 ? 612  PG4 A C1  1 
HETATM 4528 C  C2  . PG4 K 6 .   ? -1.521  60.363 73.455 1.00 53.51 ? 612  PG4 A C2  1 
HETATM 4529 O  O2  . PG4 K 6 .   ? -0.231  60.512 72.877 1.00 54.69 ? 612  PG4 A O2  1 
HETATM 4530 C  C3  . PG4 K 6 .   ? -0.193  61.740 72.117 1.00 56.17 ? 612  PG4 A C3  1 
HETATM 4531 C  C4  . PG4 K 6 .   ? 1.241   61.916 71.655 1.00 58.04 ? 612  PG4 A C4  1 
HETATM 4532 O  O3  . PG4 K 6 .   ? 1.377   62.803 70.524 1.00 59.92 ? 612  PG4 A O3  1 
HETATM 4533 C  C5  . PG4 K 6 .   ? 2.675   62.636 69.912 1.00 60.69 ? 612  PG4 A C5  1 
HETATM 4534 C  C6  . PG4 K 6 .   ? 3.536   63.830 70.334 1.00 62.14 ? 612  PG4 A C6  1 
HETATM 4535 O  O4  . PG4 K 6 .   ? 3.953   64.695 69.258 1.00 62.85 ? 612  PG4 A O4  1 
HETATM 4536 C  C7  . PG4 K 6 .   ? 3.265   65.961 69.310 1.00 63.15 ? 612  PG4 A C7  1 
HETATM 4537 C  C8  . PG4 K 6 .   ? 3.974   66.924 68.358 1.00 63.22 ? 612  PG4 A C8  1 
HETATM 4538 O  O5  . PG4 K 6 .   ? 3.016   67.760 67.692 1.00 64.12 ? 612  PG4 A O5  1 
HETATM 4539 C  C1  . PEG L 7 .   ? -20.950 75.876 47.820 1.00 60.82 ? 613  PEG A C1  1 
HETATM 4540 O  O1  . PEG L 7 .   ? -20.602 77.103 47.170 1.00 58.19 ? 613  PEG A O1  1 
HETATM 4541 C  C2  . PEG L 7 .   ? -20.464 75.895 49.276 1.00 62.55 ? 613  PEG A C2  1 
HETATM 4542 O  O2  . PEG L 7 .   ? -19.231 76.662 49.417 1.00 64.18 ? 613  PEG A O2  1 
HETATM 4543 C  C3  . PEG L 7 .   ? -18.817 76.782 50.804 1.00 65.33 ? 613  PEG A C3  1 
HETATM 4544 C  C4  . PEG L 7 .   ? -19.390 78.047 51.457 1.00 66.71 ? 613  PEG A C4  1 
HETATM 4545 O  O4  . PEG L 7 .   ? -18.362 79.039 51.611 1.00 67.72 ? 613  PEG A O4  1 
HETATM 4546 CL CL  . CL  M 8 .   ? 20.743  71.180 71.464 1.00 77.58 ? 614  CL  A CL  1 
HETATM 4547 O  O   . HOH N 9 .   ? 17.514  57.265 88.037 0.40 39.19 ? 701  HOH A O   1 
HETATM 4548 O  O   . HOH N 9 .   ? 26.292  73.716 59.676 0.60 24.67 ? 702  HOH A O   1 
HETATM 4549 O  O   . HOH N 9 .   ? 1.400   86.462 36.917 1.00 42.71 ? 703  HOH A O   1 
HETATM 4550 O  O   . HOH N 9 .   ? 11.941  67.469 83.523 1.00 27.49 ? 704  HOH A O   1 
HETATM 4551 O  O   . HOH N 9 .   ? -4.397  79.937 58.553 1.00 37.59 ? 705  HOH A O   1 
HETATM 4552 O  O   . HOH N 9 .   ? -19.405 50.910 74.830 1.00 52.97 ? 706  HOH A O   1 
HETATM 4553 O  O   . HOH N 9 .   ? -12.019 89.226 39.186 1.00 55.63 ? 707  HOH A O   1 
HETATM 4554 O  O   . HOH N 9 .   ? -21.662 58.701 45.875 1.00 76.91 ? 708  HOH A O   1 
HETATM 4555 O  O   . HOH N 9 .   ? -4.334  43.413 45.044 1.00 52.05 ? 709  HOH A O   1 
HETATM 4556 O  O   . HOH N 9 .   ? 28.659  77.078 59.374 1.00 56.26 ? 710  HOH A O   1 
HETATM 4557 O  O   . HOH N 9 .   ? 0.615   93.062 52.139 1.00 54.05 ? 711  HOH A O   1 
HETATM 4558 O  O   . HOH N 9 .   ? 13.413  87.276 66.458 1.00 47.20 ? 712  HOH A O   1 
HETATM 4559 O  O   . HOH N 9 .   ? 34.770  65.858 45.532 1.00 61.53 ? 713  HOH A O   1 
HETATM 4560 O  O   . HOH N 9 .   ? 23.227  78.613 46.843 1.00 53.10 ? 714  HOH A O   1 
HETATM 4561 O  O   . HOH N 9 .   ? -8.776  46.115 44.434 0.50 45.64 ? 715  HOH A O   1 
HETATM 4562 O  O   . HOH N 9 .   ? -23.582 56.916 51.184 1.00 58.53 ? 716  HOH A O   1 
HETATM 4563 O  O   . HOH N 9 .   ? 5.514   59.199 79.228 1.00 48.28 ? 717  HOH A O   1 
HETATM 4564 O  O   . HOH N 9 .   ? 22.888  59.386 86.220 1.00 37.41 ? 718  HOH A O   1 
HETATM 4565 O  O   . HOH N 9 .   ? -3.432  68.466 79.082 1.00 34.09 ? 719  HOH A O   1 
HETATM 4566 O  O   . HOH N 9 .   ? 22.820  73.589 82.652 1.00 59.00 ? 720  HOH A O   1 
HETATM 4567 O  O   . HOH N 9 .   ? 3.690   80.436 51.468 1.00 22.29 ? 721  HOH A O   1 
HETATM 4568 O  O   . HOH N 9 .   ? 20.583  84.158 56.138 1.00 35.25 ? 722  HOH A O   1 
HETATM 4569 O  O   . HOH N 9 .   ? -4.776  85.201 39.650 1.00 30.14 ? 723  HOH A O   1 
HETATM 4570 O  O   . HOH N 9 .   ? 31.463  68.216 57.236 1.00 54.73 ? 724  HOH A O   1 
HETATM 4571 O  O   . HOH N 9 .   ? 19.239  50.718 78.176 1.00 53.66 ? 725  HOH A O   1 
HETATM 4572 O  O   . HOH N 9 .   ? -8.307  71.067 52.759 1.00 28.57 ? 726  HOH A O   1 
HETATM 4573 O  O   . HOH N 9 .   ? 5.357   57.433 35.718 1.00 44.29 ? 727  HOH A O   1 
HETATM 4574 O  O   . HOH N 9 .   ? 17.159  35.713 58.162 1.00 66.36 ? 728  HOH A O   1 
HETATM 4575 O  O   . HOH N 9 .   ? 23.362  55.423 46.336 1.00 48.44 ? 729  HOH A O   1 
HETATM 4576 O  O   . HOH N 9 .   ? -15.819 54.048 47.530 1.00 37.65 ? 730  HOH A O   1 
HETATM 4577 O  O   . HOH N 9 .   ? 13.327  45.050 78.064 1.00 67.59 ? 731  HOH A O   1 
HETATM 4578 O  O   . HOH N 9 .   ? 8.838   49.778 74.958 1.00 30.75 ? 732  HOH A O   1 
HETATM 4579 O  O   . HOH N 9 .   ? -5.710  47.661 49.794 1.00 45.94 ? 733  HOH A O   1 
HETATM 4580 O  O   . HOH N 9 .   ? 12.601  83.360 47.473 1.00 31.27 ? 734  HOH A O   1 
HETATM 4581 O  O   . HOH N 9 .   ? 16.582  50.490 78.224 1.00 35.64 ? 735  HOH A O   1 
HETATM 4582 O  O   . HOH N 9 .   ? 3.042   41.696 61.322 1.00 54.30 ? 736  HOH A O   1 
HETATM 4583 O  O   . HOH N 9 .   ? -6.565  45.976 51.636 1.00 32.53 ? 737  HOH A O   1 
HETATM 4584 O  O   . HOH N 9 .   ? 5.471   53.227 80.703 1.00 40.40 ? 738  HOH A O   1 
HETATM 4585 O  O   . HOH N 9 .   ? 5.450   67.396 78.321 1.00 40.70 ? 739  HOH A O   1 
HETATM 4586 O  O   . HOH N 9 .   ? -20.562 74.923 37.654 1.00 34.28 ? 740  HOH A O   1 
HETATM 4587 O  O   . HOH N 9 .   ? 16.061  52.778 59.108 1.00 28.15 ? 741  HOH A O   1 
HETATM 4588 O  O   . HOH N 9 .   ? -3.419  86.142 32.802 1.00 42.71 ? 742  HOH A O   1 
HETATM 4589 O  O   . HOH N 9 .   ? 27.041  46.624 57.711 1.00 52.32 ? 743  HOH A O   1 
HETATM 4590 O  O   . HOH N 9 .   ? -17.940 55.038 72.806 1.00 38.48 ? 744  HOH A O   1 
HETATM 4591 O  O   . HOH N 9 .   ? 24.541  54.128 42.425 1.00 57.41 ? 745  HOH A O   1 
HETATM 4592 O  O   . HOH N 9 .   ? -12.484 64.469 41.770 1.00 25.04 ? 746  HOH A O   1 
HETATM 4593 O  O   . HOH N 9 .   ? 24.481  61.018 70.395 1.00 53.20 ? 747  HOH A O   1 
HETATM 4594 O  O   . HOH N 9 .   ? -23.491 49.127 53.944 1.00 60.45 ? 748  HOH A O   1 
HETATM 4595 O  O   . HOH N 9 .   ? -25.758 55.202 61.887 1.00 68.58 ? 749  HOH A O   1 
HETATM 4596 O  O   . HOH N 9 .   ? 27.756  65.959 43.102 1.00 34.58 ? 750  HOH A O   1 
HETATM 4597 O  O   . HOH N 9 .   ? -18.447 69.451 62.173 1.00 50.83 ? 751  HOH A O   1 
HETATM 4598 O  O   . HOH N 9 .   ? 10.352  51.819 37.224 1.00 41.85 ? 752  HOH A O   1 
HETATM 4599 O  O   . HOH N 9 .   ? -3.625  77.637 31.296 1.00 33.66 ? 753  HOH A O   1 
HETATM 4600 O  O   . HOH N 9 .   ? 29.461  61.136 84.124 1.00 48.29 ? 754  HOH A O   1 
HETATM 4601 O  O   . HOH N 9 .   ? -3.731  75.760 64.620 1.00 30.38 ? 755  HOH A O   1 
HETATM 4602 O  O   . HOH N 9 .   ? -6.802  48.321 74.154 1.00 25.38 ? 756  HOH A O   1 
HETATM 4603 O  O   . HOH N 9 .   ? -3.936  61.464 75.293 1.00 51.87 ? 757  HOH A O   1 
HETATM 4604 O  O   . HOH N 9 .   ? 1.607   63.854 35.534 1.00 36.58 ? 758  HOH A O   1 
HETATM 4605 O  O   . HOH N 9 .   ? 22.377  54.738 53.192 1.00 51.49 ? 759  HOH A O   1 
HETATM 4606 O  O   . HOH N 9 .   ? -4.800  50.221 48.780 1.00 48.90 ? 760  HOH A O   1 
HETATM 4607 O  O   . HOH N 9 .   ? 17.941  50.650 44.993 1.00 30.44 ? 761  HOH A O   1 
HETATM 4608 O  O   . HOH N 9 .   ? 27.163  76.663 57.114 1.00 38.09 ? 762  HOH A O   1 
HETATM 4609 O  O   . HOH N 9 .   ? -2.188  75.239 52.835 1.00 26.57 ? 763  HOH A O   1 
HETATM 4610 O  O   . HOH N 9 .   ? 19.223  46.814 52.007 1.00 55.61 ? 764  HOH A O   1 
HETATM 4611 O  O   . HOH N 9 .   ? -22.364 37.304 65.314 1.00 64.56 ? 765  HOH A O   1 
HETATM 4612 O  O   . HOH N 9 .   ? 17.847  74.928 37.656 1.00 32.19 ? 766  HOH A O   1 
HETATM 4613 O  O   . HOH N 9 .   ? 5.051   50.440 62.192 1.00 20.36 ? 767  HOH A O   1 
HETATM 4614 O  O   . HOH N 9 .   ? 13.399  49.599 53.723 1.00 37.70 ? 768  HOH A O   1 
HETATM 4615 O  O   . HOH N 9 .   ? -15.845 81.189 27.597 1.00 59.73 ? 769  HOH A O   1 
HETATM 4616 O  O   . HOH N 9 .   ? 10.593  68.548 59.719 1.00 23.55 ? 770  HOH A O   1 
HETATM 4617 O  O   . HOH N 9 .   ? 23.864  70.204 74.136 1.00 50.35 ? 771  HOH A O   1 
HETATM 4618 O  O   . HOH N 9 .   ? 2.278   63.998 76.896 1.00 38.09 ? 772  HOH A O   1 
HETATM 4619 O  O   . HOH N 9 .   ? 32.570  57.610 61.774 1.00 41.49 ? 773  HOH A O   1 
HETATM 4620 O  O   . HOH N 9 .   ? 26.326  50.520 77.444 1.00 45.35 ? 774  HOH A O   1 
HETATM 4621 O  O   . HOH N 9 .   ? 4.489   55.349 78.242 1.00 30.47 ? 775  HOH A O   1 
HETATM 4622 O  O   . HOH N 9 .   ? 24.832  58.216 25.394 1.00 59.29 ? 776  HOH A O   1 
HETATM 4623 O  O   . HOH N 9 .   ? -15.585 40.939 72.220 1.00 59.38 ? 777  HOH A O   1 
HETATM 4624 O  O   . HOH N 9 .   ? -6.883  56.380 74.488 1.00 46.56 ? 778  HOH A O   1 
HETATM 4625 O  O   . HOH N 9 .   ? -19.628 62.665 60.960 1.00 35.09 ? 779  HOH A O   1 
HETATM 4626 O  O   . HOH N 9 .   ? 25.600  66.438 74.666 1.00 40.18 ? 780  HOH A O   1 
HETATM 4627 O  O   . HOH N 9 .   ? -15.513 66.966 49.376 1.00 26.07 ? 781  HOH A O   1 
HETATM 4628 O  O   . HOH N 9 .   ? 22.718  77.662 43.908 1.00 35.16 ? 782  HOH A O   1 
HETATM 4629 O  O   . HOH N 9 .   ? 14.117  39.763 68.310 1.00 53.32 ? 783  HOH A O   1 
HETATM 4630 O  O   . HOH N 9 .   ? 4.991   77.496 81.364 1.00 39.73 ? 784  HOH A O   1 
HETATM 4631 O  O   . HOH N 9 .   ? 11.887  61.496 85.919 1.00 41.15 ? 785  HOH A O   1 
HETATM 4632 O  O   . HOH N 9 .   ? 11.369  42.222 51.521 1.00 45.55 ? 786  HOH A O   1 
HETATM 4633 O  O   . HOH N 9 .   ? 19.081  65.658 37.033 1.00 44.93 ? 787  HOH A O   1 
HETATM 4634 O  O   . HOH N 9 .   ? 9.756   73.932 33.883 1.00 43.50 ? 788  HOH A O   1 
HETATM 4635 O  O   . HOH N 9 .   ? 0.803   73.832 29.479 1.00 64.53 ? 789  HOH A O   1 
HETATM 4636 O  O   . HOH N 9 .   ? -15.382 44.738 74.036 1.00 44.15 ? 790  HOH A O   1 
HETATM 4637 O  O   . HOH N 9 .   ? -15.728 43.547 51.468 1.00 56.45 ? 791  HOH A O   1 
HETATM 4638 O  O   . HOH N 9 .   ? 18.376  85.109 50.484 1.00 30.58 ? 792  HOH A O   1 
HETATM 4639 O  O   . HOH N 9 .   ? -25.085 71.375 41.318 1.00 56.61 ? 793  HOH A O   1 
HETATM 4640 O  O   . HOH N 9 .   ? 1.302   70.552 80.390 1.00 46.80 ? 794  HOH A O   1 
HETATM 4641 O  O   . HOH N 9 .   ? 7.265   70.503 39.261 1.00 27.04 ? 795  HOH A O   1 
HETATM 4642 O  O   . HOH N 9 .   ? -21.546 65.942 45.476 1.00 53.84 ? 796  HOH A O   1 
HETATM 4643 O  O   . HOH N 9 .   ? 13.193  36.873 68.255 1.00 56.58 ? 797  HOH A O   1 
HETATM 4644 O  O   . HOH N 9 .   ? 18.935  75.226 71.030 1.00 41.13 ? 798  HOH A O   1 
HETATM 4645 O  O   . HOH N 9 .   ? 12.060  56.250 84.372 1.00 41.81 ? 799  HOH A O   1 
HETATM 4646 O  O   . HOH N 9 .   ? -0.874  65.028 72.719 1.00 44.36 ? 800  HOH A O   1 
HETATM 4647 O  O   . HOH N 9 .   ? 21.979  59.683 38.657 1.00 36.94 ? 801  HOH A O   1 
HETATM 4648 O  O   . HOH N 9 .   ? 13.518  81.545 71.073 1.00 57.70 ? 802  HOH A O   1 
HETATM 4649 O  O   . HOH N 9 .   ? 34.040  61.814 77.372 1.00 56.57 ? 803  HOH A O   1 
HETATM 4650 O  O   . HOH N 9 .   ? 3.079   80.364 32.481 1.00 43.32 ? 804  HOH A O   1 
HETATM 4651 O  O   . HOH N 9 .   ? 22.000  61.914 42.104 1.00 26.49 ? 805  HOH A O   1 
HETATM 4652 O  O   . HOH N 9 .   ? -2.958  79.434 56.381 1.00 35.36 ? 806  HOH A O   1 
HETATM 4653 O  O   . HOH N 9 .   ? -4.339  69.693 62.396 1.00 22.91 ? 807  HOH A O   1 
HETATM 4654 O  O   . HOH N 9 .   ? 15.498  52.982 61.752 1.00 25.51 ? 808  HOH A O   1 
HETATM 4655 O  O   . HOH N 9 .   ? 12.007  77.504 62.874 1.00 31.48 ? 809  HOH A O   1 
HETATM 4656 O  O   . HOH N 9 .   ? -8.488  66.754 72.554 1.00 43.22 ? 810  HOH A O   1 
HETATM 4657 O  O   . HOH N 9 .   ? 20.973  43.963 57.947 1.00 42.96 ? 811  HOH A O   1 
HETATM 4658 O  O   . HOH N 9 .   ? 7.422   66.214 83.543 1.00 62.13 ? 812  HOH A O   1 
HETATM 4659 O  O   . HOH N 9 .   ? -11.265 68.862 75.660 1.00 59.81 ? 813  HOH A O   1 
HETATM 4660 O  O   . HOH N 9 .   ? -21.027 49.234 70.454 1.00 51.29 ? 814  HOH A O   1 
HETATM 4661 O  O   . HOH N 9 .   ? 12.198  80.010 41.151 1.00 66.00 ? 815  HOH A O   1 
HETATM 4662 O  O   . HOH N 9 .   ? 13.391  68.851 57.175 1.00 20.63 ? 816  HOH A O   1 
HETATM 4663 O  O   . HOH N 9 .   ? 10.598  55.596 68.664 1.00 22.20 ? 817  HOH A O   1 
HETATM 4664 O  O   . HOH N 9 .   ? -13.502 40.884 54.831 1.00 45.14 ? 818  HOH A O   1 
HETATM 4665 O  O   . HOH N 9 .   ? -8.025  72.534 67.556 1.00 31.56 ? 819  HOH A O   1 
HETATM 4666 O  O   . HOH N 9 .   ? 17.613  54.188 36.286 1.00 57.70 ? 820  HOH A O   1 
HETATM 4667 O  O   . HOH N 9 .   ? -0.141  65.973 36.888 1.00 31.55 ? 821  HOH A O   1 
HETATM 4668 O  O   . HOH N 9 .   ? -4.136  82.145 32.286 1.00 38.19 ? 822  HOH A O   1 
HETATM 4669 O  O   . HOH N 9 .   ? 5.016   57.362 76.144 1.00 32.16 ? 823  HOH A O   1 
HETATM 4670 O  O   . HOH N 9 .   ? -0.997  66.140 40.041 1.00 28.21 ? 824  HOH A O   1 
HETATM 4671 O  O   . HOH N 9 .   ? 14.916  65.382 84.108 1.00 33.23 ? 825  HOH A O   1 
HETATM 4672 O  O   . HOH N 9 .   ? 4.102   77.742 78.652 1.00 41.31 ? 826  HOH A O   1 
HETATM 4673 O  O   . HOH N 9 .   ? 9.734   88.588 60.176 1.00 40.65 ? 827  HOH A O   1 
HETATM 4674 O  O   . HOH N 9 .   ? 18.592  67.522 73.464 1.00 38.84 ? 828  HOH A O   1 
HETATM 4675 O  O   . HOH N 9 .   ? -14.472 62.887 74.491 1.00 48.34 ? 829  HOH A O   1 
HETATM 4676 O  O   . HOH N 9 .   ? 25.080  58.411 55.506 1.00 30.56 ? 830  HOH A O   1 
HETATM 4677 O  O   . HOH N 9 .   ? -21.237 61.280 50.434 1.00 31.08 ? 831  HOH A O   1 
HETATM 4678 O  O   . HOH N 9 .   ? -3.497  50.726 59.638 1.00 22.10 ? 832  HOH A O   1 
HETATM 4679 O  O   . HOH N 9 .   ? 28.837  67.826 61.152 1.00 66.93 ? 833  HOH A O   1 
HETATM 4680 O  O   . HOH N 9 .   ? -24.835 50.892 51.435 1.00 73.07 ? 834  HOH A O   1 
HETATM 4681 O  O   . HOH N 9 .   ? -5.371  58.997 75.433 1.00 51.63 ? 835  HOH A O   1 
HETATM 4682 O  O   . HOH N 9 .   ? -8.862  44.528 51.148 1.00 31.93 ? 836  HOH A O   1 
HETATM 4683 O  O   . HOH N 9 .   ? 13.253  58.945 79.163 1.00 28.76 ? 837  HOH A O   1 
HETATM 4684 O  O   . HOH N 9 .   ? -0.117  69.068 59.766 1.00 22.46 ? 838  HOH A O   1 
HETATM 4685 O  O   . HOH N 9 .   ? 21.261  65.404 69.786 1.00 50.49 ? 839  HOH A O   1 
HETATM 4686 O  O   . HOH N 9 .   ? -15.458 65.911 51.891 1.00 20.67 ? 840  HOH A O   1 
HETATM 4687 O  O   . HOH N 9 .   ? -4.034  39.937 62.755 1.00 29.54 ? 841  HOH A O   1 
HETATM 4688 O  O   . HOH N 9 .   ? -14.932 38.602 58.585 1.00 41.23 ? 842  HOH A O   1 
HETATM 4689 O  O   . HOH N 9 .   ? 24.353  53.563 48.688 1.00 58.92 ? 843  HOH A O   1 
HETATM 4690 O  O   . HOH N 9 .   ? 12.599  59.815 57.256 1.00 41.04 ? 844  HOH A O   1 
HETATM 4691 O  O   . HOH N 9 .   ? 15.972  62.313 84.555 1.00 41.06 ? 845  HOH A O   1 
HETATM 4692 O  O   . HOH N 9 .   ? 16.614  57.415 36.262 1.00 35.85 ? 846  HOH A O   1 
HETATM 4693 O  O   . HOH N 9 .   ? -7.493  50.670 45.813 1.00 65.39 ? 847  HOH A O   1 
HETATM 4694 O  O   . HOH N 9 .   ? -13.405 57.367 56.489 1.00 22.43 ? 848  HOH A O   1 
HETATM 4695 O  O   . HOH N 9 .   ? -14.575 65.026 67.154 1.00 33.57 ? 849  HOH A O   1 
HETATM 4696 O  O   . HOH N 9 .   ? 18.959  84.966 62.793 1.00 38.11 ? 850  HOH A O   1 
HETATM 4697 O  O   . HOH N 9 .   ? 17.969  79.872 46.515 1.00 35.33 ? 851  HOH A O   1 
HETATM 4698 O  O   . HOH N 9 .   ? -6.248  49.031 61.216 1.00 22.55 ? 852  HOH A O   1 
HETATM 4699 O  O   . HOH N 9 .   ? 7.334   52.258 56.471 1.00 23.69 ? 853  HOH A O   1 
HETATM 4700 O  O   . HOH N 9 .   ? 35.298  61.531 42.914 1.00 67.62 ? 854  HOH A O   1 
HETATM 4701 O  O   . HOH N 9 .   ? 30.302  61.440 42.681 1.00 46.15 ? 855  HOH A O   1 
HETATM 4702 O  O   . HOH N 9 .   ? -4.524  67.624 65.852 1.00 38.24 ? 856  HOH A O   1 
HETATM 4703 O  O   . HOH N 9 .   ? -15.627 74.339 29.243 1.00 62.08 ? 857  HOH A O   1 
HETATM 4704 O  O   . HOH N 9 .   ? -6.793  61.118 65.268 1.00 21.77 ? 858  HOH A O   1 
HETATM 4705 O  O   . HOH N 9 .   ? -22.099 68.008 43.060 1.00 45.56 ? 859  HOH A O   1 
HETATM 4706 O  O   . HOH N 9 .   ? -9.753  69.758 54.662 1.00 21.12 ? 860  HOH A O   1 
HETATM 4707 O  O   . HOH N 9 .   ? -10.120 64.794 38.373 1.00 29.91 ? 861  HOH A O   1 
HETATM 4708 O  O   . HOH N 9 .   ? 28.152  49.350 54.997 1.00 53.99 ? 862  HOH A O   1 
HETATM 4709 O  O   . HOH N 9 .   ? -23.093 51.309 57.721 1.00 62.45 ? 863  HOH A O   1 
HETATM 4710 O  O   . HOH N 9 .   ? -1.313  74.448 31.476 1.00 32.17 ? 864  HOH A O   1 
HETATM 4711 O  O   . HOH N 9 .   ? 3.817   55.661 70.328 1.00 26.98 ? 865  HOH A O   1 
HETATM 4712 O  O   . HOH N 9 .   ? 20.992  65.231 63.762 1.00 27.84 ? 866  HOH A O   1 
HETATM 4713 O  O   . HOH N 9 .   ? 23.749  63.666 30.746 1.00 58.11 ? 867  HOH A O   1 
HETATM 4714 O  O   . HOH N 9 .   ? 5.634   74.715 32.993 1.00 54.87 ? 868  HOH A O   1 
HETATM 4715 O  O   . HOH N 9 .   ? 26.394  60.696 79.356 1.00 45.56 ? 869  HOH A O   1 
HETATM 4716 O  O   . HOH N 9 .   ? 15.065  42.486 62.040 1.00 42.72 ? 870  HOH A O   1 
HETATM 4717 O  O   . HOH N 9 .   ? -15.491 59.720 48.876 1.00 27.80 ? 871  HOH A O   1 
HETATM 4718 O  O   . HOH N 9 .   ? 29.776  78.981 57.063 1.00 56.56 ? 872  HOH A O   1 
HETATM 4719 O  O   . HOH N 9 .   ? -3.876  56.798 63.986 1.00 22.99 ? 873  HOH A O   1 
HETATM 4720 O  O   . HOH N 9 .   ? -15.967 58.497 73.570 1.00 37.82 ? 874  HOH A O   1 
HETATM 4721 O  O   . HOH N 9 .   ? -7.004  88.329 42.315 1.00 43.59 ? 875  HOH A O   1 
HETATM 4722 O  O   . HOH N 9 .   ? 2.924   41.159 47.654 1.00 58.79 ? 876  HOH A O   1 
HETATM 4723 O  O   . HOH N 9 .   ? -22.172 45.166 64.527 1.00 43.96 ? 877  HOH A O   1 
HETATM 4724 O  O   . HOH N 9 .   ? 8.725   71.339 32.711 1.00 36.96 ? 878  HOH A O   1 
HETATM 4725 O  O   . HOH N 9 .   ? -21.638 54.104 71.084 1.00 45.30 ? 879  HOH A O   1 
HETATM 4726 O  O   . HOH N 9 .   ? -7.330  67.671 57.896 1.00 20.81 ? 880  HOH A O   1 
HETATM 4727 O  O   . HOH N 9 .   ? 20.938  59.322 41.076 1.00 29.97 ? 881  HOH A O   1 
HETATM 4728 O  O   . HOH N 9 .   ? -4.517  65.921 74.147 1.00 54.19 ? 882  HOH A O   1 
HETATM 4729 O  O   . HOH N 9 .   ? -18.311 87.387 54.528 1.00 62.10 ? 883  HOH A O   1 
HETATM 4730 O  O   . HOH N 9 .   ? 9.574   80.065 65.346 1.00 31.83 ? 884  HOH A O   1 
HETATM 4731 O  O   . HOH N 9 .   ? -1.737  57.364 62.677 1.00 20.22 ? 885  HOH A O   1 
HETATM 4732 O  O   . HOH N 9 .   ? 2.995   53.828 63.661 1.00 19.64 ? 886  HOH A O   1 
HETATM 4733 O  O   . HOH N 9 .   ? 21.187  66.878 67.583 1.00 49.18 ? 887  HOH A O   1 
HETATM 4734 O  O   . HOH N 9 .   ? -0.148  82.432 57.892 1.00 39.51 ? 888  HOH A O   1 
HETATM 4735 O  O   . HOH N 9 .   ? 25.097  62.424 73.822 1.00 33.72 ? 889  HOH A O   1 
HETATM 4736 O  O   . HOH N 9 .   ? 29.800  76.583 44.865 1.00 66.01 ? 890  HOH A O   1 
HETATM 4737 O  O   . HOH N 9 .   ? 25.276  59.011 52.576 1.00 33.97 ? 891  HOH A O   1 
HETATM 4738 O  O   . HOH N 9 .   ? -15.320 56.131 72.745 1.00 28.38 ? 892  HOH A O   1 
HETATM 4739 O  O   . HOH N 9 .   ? 1.516   43.177 54.902 1.00 22.75 ? 893  HOH A O   1 
HETATM 4740 O  O   . HOH N 9 .   ? 23.011  67.047 47.869 1.00 25.55 ? 894  HOH A O   1 
HETATM 4741 O  O   . HOH N 9 .   ? 15.623  80.221 69.845 1.00 37.43 ? 895  HOH A O   1 
HETATM 4742 O  O   . HOH N 9 .   ? 7.559   75.399 34.509 1.00 49.80 ? 896  HOH A O   1 
HETATM 4743 O  O   . HOH N 9 .   ? 28.249  67.919 78.683 1.00 51.14 ? 897  HOH A O   1 
HETATM 4744 O  O   . HOH N 9 .   ? 26.606  55.521 53.061 1.00 42.36 ? 898  HOH A O   1 
HETATM 4745 O  O   . HOH N 9 .   ? 20.927  65.483 34.922 1.00 64.69 ? 899  HOH A O   1 
HETATM 4746 O  O   . HOH N 9 .   ? 25.012  43.794 77.181 1.00 39.39 ? 900  HOH A O   1 
HETATM 4747 O  O   . HOH N 9 .   ? -14.765 59.460 57.140 1.00 24.51 ? 901  HOH A O   1 
HETATM 4748 O  O   . HOH N 9 .   ? 22.043  79.896 61.473 1.00 36.46 ? 902  HOH A O   1 
HETATM 4749 O  O   . HOH N 9 .   ? -20.230 68.636 51.111 1.00 38.61 ? 903  HOH A O   1 
HETATM 4750 O  O   . HOH N 9 .   ? -6.022  58.384 40.236 1.00 32.07 ? 904  HOH A O   1 
HETATM 4751 O  O   . HOH N 9 .   ? 23.710  65.241 70.019 1.00 53.18 ? 905  HOH A O   1 
HETATM 4752 O  O   . HOH N 9 .   ? 3.654   68.743 57.928 1.00 17.72 ? 906  HOH A O   1 
HETATM 4753 O  O   . HOH N 9 .   ? 24.797  71.443 83.700 1.00 69.31 ? 907  HOH A O   1 
HETATM 4754 O  O   . HOH N 9 .   ? -9.849  51.622 54.980 1.00 25.01 ? 908  HOH A O   1 
HETATM 4755 O  O   . HOH N 9 .   ? -5.473  44.708 57.603 1.00 27.98 ? 909  HOH A O   1 
HETATM 4756 O  O   . HOH N 9 .   ? -6.820  42.405 68.064 1.00 28.27 ? 910  HOH A O   1 
HETATM 4757 O  O   . HOH N 9 .   ? -0.316  65.680 68.520 1.00 36.22 ? 911  HOH A O   1 
HETATM 4758 O  O   . HOH N 9 .   ? -13.497 50.954 49.512 1.00 30.84 ? 912  HOH A O   1 
HETATM 4759 O  O   . HOH N 9 .   ? -11.787 72.177 65.477 1.00 37.42 ? 913  HOH A O   1 
HETATM 4760 O  O   . HOH N 9 .   ? -9.756  61.834 59.749 1.00 20.99 ? 914  HOH A O   1 
HETATM 4761 O  O   . HOH N 9 .   ? 6.526   78.805 64.514 1.00 34.22 ? 915  HOH A O   1 
HETATM 4762 O  O   . HOH N 9 .   ? -16.364 66.612 33.738 1.00 44.28 ? 916  HOH A O   1 
HETATM 4763 O  O   . HOH N 9 .   ? -11.201 82.041 33.268 1.00 34.17 ? 917  HOH A O   1 
HETATM 4764 O  O   . HOH N 9 .   ? 20.231  62.842 65.314 1.00 25.37 ? 918  HOH A O   1 
HETATM 4765 O  O   . HOH N 9 .   ? -10.591 65.345 68.912 1.00 25.85 ? 919  HOH A O   1 
HETATM 4766 O  O   . HOH N 9 .   ? -1.294  71.799 73.438 1.00 31.95 ? 920  HOH A O   1 
HETATM 4767 O  O   . HOH N 9 .   ? 6.609   48.194 55.982 1.00 26.32 ? 921  HOH A O   1 
HETATM 4768 O  O   . HOH N 9 .   ? -18.627 59.918 42.115 1.00 40.62 ? 922  HOH A O   1 
HETATM 4769 O  O   . HOH N 9 .   ? 1.038   98.186 48.301 1.00 56.67 ? 923  HOH A O   1 
HETATM 4770 O  O   . HOH N 9 .   ? 3.518   54.703 75.186 1.00 48.07 ? 924  HOH A O   1 
HETATM 4771 O  O   . HOH N 9 .   ? -20.107 58.950 59.142 1.00 31.91 ? 925  HOH A O   1 
HETATM 4772 O  O   . HOH N 9 .   ? -6.538  65.222 32.227 1.00 47.58 ? 926  HOH A O   1 
HETATM 4773 O  O   . HOH N 9 .   ? 3.754   86.474 41.822 1.00 44.69 ? 927  HOH A O   1 
HETATM 4774 O  O   . HOH N 9 .   ? 10.121  76.509 78.199 1.00 31.52 ? 928  HOH A O   1 
HETATM 4775 O  O   . HOH N 9 .   ? 0.337   69.953 68.620 1.00 35.17 ? 929  HOH A O   1 
HETATM 4776 O  O   . HOH N 9 .   ? -3.888  72.753 73.422 1.00 42.99 ? 930  HOH A O   1 
HETATM 4777 O  O   . HOH N 9 .   ? 14.951  48.476 63.925 1.00 36.98 ? 931  HOH A O   1 
HETATM 4778 O  O   . HOH N 9 .   ? -18.031 56.851 41.574 1.00 62.76 ? 932  HOH A O   1 
HETATM 4779 O  O   . HOH N 9 .   ? 0.260   77.082 62.175 1.00 30.25 ? 933  HOH A O   1 
HETATM 4780 O  O   . HOH N 9 .   ? 26.480  59.463 77.077 1.00 34.47 ? 934  HOH A O   1 
HETATM 4781 O  O   . HOH N 9 .   ? -0.146  67.304 64.342 1.00 26.18 ? 935  HOH A O   1 
HETATM 4782 O  O   . HOH N 9 .   ? -12.956 83.782 34.133 1.00 36.61 ? 936  HOH A O   1 
HETATM 4783 O  O   . HOH N 9 .   ? -4.214  51.655 56.289 1.00 21.54 ? 937  HOH A O   1 
HETATM 4784 O  O   . HOH N 9 .   ? -14.917 77.488 50.363 1.00 43.10 ? 938  HOH A O   1 
HETATM 4785 O  O   . HOH N 9 .   ? 4.894   59.511 70.178 1.00 28.99 ? 939  HOH A O   1 
HETATM 4786 O  O   . HOH N 9 .   ? -17.608 39.684 69.467 1.00 49.07 ? 940  HOH A O   1 
HETATM 4787 O  O   . HOH N 9 .   ? 11.881  67.195 67.325 1.00 28.13 ? 941  HOH A O   1 
HETATM 4788 O  O   . HOH N 9 .   ? -0.618  63.018 58.978 1.00 17.65 ? 942  HOH A O   1 
HETATM 4789 O  O   . HOH N 9 .   ? 20.728  79.238 42.616 1.00 46.71 ? 943  HOH A O   1 
HETATM 4790 O  O   . HOH N 9 .   ? 27.671  63.718 46.068 1.00 29.02 ? 944  HOH A O   1 
HETATM 4791 O  O   . HOH N 9 .   ? 23.518  69.791 40.061 1.00 40.47 ? 945  HOH A O   1 
HETATM 4792 O  O   . HOH N 9 .   ? 10.166  81.093 37.155 1.00 58.00 ? 946  HOH A O   1 
HETATM 4793 O  O   . HOH N 9 .   ? 19.293  67.741 38.568 1.00 38.06 ? 947  HOH A O   1 
HETATM 4794 O  O   . HOH N 9 .   ? -16.073 83.203 46.519 1.00 56.32 ? 948  HOH A O   1 
HETATM 4795 O  O   . HOH N 9 .   ? -6.657  83.349 38.638 1.00 31.28 ? 949  HOH A O   1 
HETATM 4796 O  O   . HOH N 9 .   ? -7.080  50.299 49.678 1.00 36.80 ? 950  HOH A O   1 
HETATM 4797 O  O   . HOH N 9 .   ? 23.570  59.814 23.830 1.00 65.63 ? 951  HOH A O   1 
HETATM 4798 O  O   . HOH N 9 .   ? -16.207 43.942 54.731 1.00 41.47 ? 952  HOH A O   1 
HETATM 4799 O  O   . HOH N 9 .   ? -15.451 74.249 51.061 1.00 55.06 ? 953  HOH A O   1 
HETATM 4800 O  O   . HOH N 9 .   ? 30.014  52.069 71.742 1.00 34.44 ? 954  HOH A O   1 
HETATM 4801 O  O   . HOH N 9 .   ? 5.592   61.271 72.183 1.00 28.58 ? 955  HOH A O   1 
HETATM 4802 O  O   . HOH N 9 .   ? 4.995   88.281 67.709 1.00 60.84 ? 956  HOH A O   1 
HETATM 4803 O  O   . HOH N 9 .   ? -11.890 79.109 33.234 1.00 43.70 ? 957  HOH A O   1 
HETATM 4804 O  O   . HOH N 9 .   ? -1.612  69.392 52.709 1.00 20.28 ? 958  HOH A O   1 
HETATM 4805 O  O   . HOH N 9 .   ? -8.955  57.908 64.667 1.00 21.92 ? 959  HOH A O   1 
HETATM 4806 O  O   . HOH N 9 .   ? 16.167  73.385 84.171 1.00 44.83 ? 960  HOH A O   1 
HETATM 4807 O  O   . HOH N 9 .   ? -22.206 59.061 52.003 1.00 47.87 ? 961  HOH A O   1 
HETATM 4808 O  O   . HOH N 9 .   ? 12.962  51.842 58.905 1.00 53.79 ? 962  HOH A O   1 
HETATM 4809 O  O   . HOH N 9 .   ? -1.508  93.975 50.192 1.00 52.22 ? 963  HOH A O   1 
HETATM 4810 O  O   . HOH N 9 .   ? 29.399  74.348 46.545 1.00 59.28 ? 964  HOH A O   1 
HETATM 4811 O  O   . HOH N 9 .   ? 3.480   66.655 36.696 1.00 23.35 ? 965  HOH A O   1 
HETATM 4812 O  O   . HOH N 9 .   ? -1.520  50.488 73.785 1.00 49.08 ? 966  HOH A O   1 
HETATM 4813 O  O   . HOH N 9 .   ? -20.069 56.428 59.553 1.00 28.53 ? 967  HOH A O   1 
HETATM 4814 O  O   . HOH N 9 .   ? 8.550   88.272 48.084 1.00 33.97 ? 968  HOH A O   1 
HETATM 4815 O  O   . HOH N 9 .   ? -21.105 80.964 45.046 1.00 55.52 ? 969  HOH A O   1 
HETATM 4816 O  O   . HOH N 9 .   ? 31.625  65.942 55.722 1.00 41.62 ? 970  HOH A O   1 
HETATM 4817 O  O   . HOH N 9 .   ? -0.490  69.183 62.406 1.00 20.44 ? 971  HOH A O   1 
HETATM 4818 O  O   . HOH N 9 .   ? 0.940   90.177 42.656 1.00 50.19 ? 972  HOH A O   1 
HETATM 4819 O  O   . HOH N 9 .   ? 16.934  90.044 54.673 1.00 41.23 ? 973  HOH A O   1 
HETATM 4820 O  O   . HOH N 9 .   ? -3.998  85.259 54.001 1.00 41.61 ? 974  HOH A O   1 
HETATM 4821 O  O   . HOH N 9 .   ? 25.210  61.819 52.913 1.00 31.55 ? 975  HOH A O   1 
HETATM 4822 O  O   . HOH N 9 .   ? 17.801  69.680 36.009 1.00 62.62 ? 976  HOH A O   1 
HETATM 4823 O  O   . HOH N 9 .   ? -3.188  41.819 48.030 1.00 57.51 ? 977  HOH A O   1 
HETATM 4824 O  O   . HOH N 9 .   ? 8.422   47.362 74.145 1.00 35.15 ? 978  HOH A O   1 
HETATM 4825 O  O   . HOH N 9 .   ? -7.389  79.731 32.452 1.00 37.61 ? 979  HOH A O   1 
HETATM 4826 O  O   . HOH N 9 .   ? -1.785  94.987 44.633 1.00 48.50 ? 980  HOH A O   1 
HETATM 4827 O  O   . HOH N 9 .   ? 10.405  52.628 79.423 1.00 33.90 ? 981  HOH A O   1 
HETATM 4828 O  O   . HOH N 9 .   ? 7.266   77.787 35.915 1.00 48.60 ? 982  HOH A O   1 
HETATM 4829 O  O   . HOH N 9 .   ? 14.913  77.544 76.850 1.00 32.29 ? 983  HOH A O   1 
HETATM 4830 O  O   . HOH N 9 .   ? -10.819 81.049 55.480 1.00 32.26 ? 984  HOH A O   1 
HETATM 4831 O  O   . HOH N 9 .   ? 24.832  48.209 76.680 1.00 31.27 ? 985  HOH A O   1 
HETATM 4832 O  O   . HOH N 9 .   ? 11.112  77.229 84.276 1.00 52.11 ? 986  HOH A O   1 
HETATM 4833 O  O   . HOH N 9 .   ? 24.650  66.053 84.665 1.00 39.75 ? 987  HOH A O   1 
HETATM 4834 O  O   . HOH N 9 .   ? 7.420   75.535 60.936 1.00 25.40 ? 988  HOH A O   1 
HETATM 4835 O  O   . HOH N 9 .   ? 9.488   90.661 53.107 1.00 61.95 ? 989  HOH A O   1 
HETATM 4836 O  O   . HOH N 9 .   ? -2.280  57.299 66.791 1.00 26.72 ? 990  HOH A O   1 
HETATM 4837 O  O   . HOH N 9 .   ? -4.688  42.619 70.138 1.00 47.49 ? 991  HOH A O   1 
HETATM 4838 O  O   . HOH N 9 .   ? 18.412  60.139 41.948 1.00 25.69 ? 992  HOH A O   1 
HETATM 4839 O  O   . HOH N 9 .   ? -4.726  70.441 34.025 1.00 24.64 ? 993  HOH A O   1 
HETATM 4840 O  O   . HOH N 9 .   ? 6.064   91.885 55.837 1.00 56.47 ? 994  HOH A O   1 
HETATM 4841 O  O   . HOH N 9 .   ? 33.232  66.641 53.263 1.00 61.96 ? 995  HOH A O   1 
HETATM 4842 O  O   . HOH N 9 .   ? 8.218   76.769 76.186 1.00 34.41 ? 996  HOH A O   1 
HETATM 4843 O  O   . HOH N 9 .   ? 17.508  91.720 61.765 1.00 43.53 ? 997  HOH A O   1 
HETATM 4844 O  O   . HOH N 9 .   ? 2.081   43.359 67.369 1.00 50.39 ? 998  HOH A O   1 
HETATM 4845 O  O   . HOH N 9 .   ? 13.100  84.507 43.671 1.00 41.29 ? 999  HOH A O   1 
HETATM 4846 O  O   . HOH N 9 .   ? 31.607  73.962 51.807 1.00 41.38 ? 1000 HOH A O   1 
HETATM 4847 O  O   . HOH N 9 .   ? 9.756   56.290 36.322 1.00 24.46 ? 1001 HOH A O   1 
HETATM 4848 O  O   . HOH N 9 .   ? 0.308   41.588 64.318 1.00 33.26 ? 1002 HOH A O   1 
HETATM 4849 O  O   . HOH N 9 .   ? 16.701  32.465 65.927 1.00 58.09 ? 1003 HOH A O   1 
HETATM 4850 O  O   . HOH N 9 .   ? 20.937  72.284 78.985 1.00 36.53 ? 1004 HOH A O   1 
HETATM 4851 O  O   . HOH N 9 .   ? 16.026  59.387 32.425 1.00 60.39 ? 1005 HOH A O   1 
HETATM 4852 O  O   . HOH N 9 .   ? 7.507   49.202 66.498 1.00 27.50 ? 1006 HOH A O   1 
HETATM 4853 O  O   . HOH N 9 .   ? 16.912  69.086 84.304 1.00 33.74 ? 1007 HOH A O   1 
HETATM 4854 O  O   . HOH N 9 .   ? -4.111  82.930 52.031 1.00 32.51 ? 1008 HOH A O   1 
HETATM 4855 O  O   . HOH N 9 .   ? -20.755 46.253 57.412 1.00 43.13 ? 1009 HOH A O   1 
HETATM 4856 O  O   . HOH N 9 .   ? -13.560 61.752 56.908 1.00 23.71 ? 1010 HOH A O   1 
HETATM 4857 O  O   . HOH N 9 .   ? 20.616  56.432 38.668 1.00 52.85 ? 1011 HOH A O   1 
HETATM 4858 O  O   . HOH N 9 .   ? -15.193 85.829 46.363 1.00 63.83 ? 1012 HOH A O   1 
HETATM 4859 O  O   . HOH N 9 .   ? -9.270  79.267 64.493 1.00 51.50 ? 1013 HOH A O   1 
HETATM 4860 O  O   . HOH N 9 .   ? 12.981  86.127 47.188 1.00 28.33 ? 1014 HOH A O   1 
HETATM 4861 O  O   . HOH N 9 .   ? -26.275 61.488 70.251 1.00 68.10 ? 1015 HOH A O   1 
HETATM 4862 O  O   . HOH N 9 .   ? 1.273   87.569 41.868 1.00 39.02 ? 1016 HOH A O   1 
HETATM 4863 O  O   . HOH N 9 .   ? 20.135  37.995 61.168 1.00 46.98 ? 1017 HOH A O   1 
HETATM 4864 O  O   . HOH N 9 .   ? 7.571   58.763 35.334 1.00 64.89 ? 1018 HOH A O   1 
HETATM 4865 O  O   . HOH N 9 .   ? 18.419  78.856 43.838 1.00 46.00 ? 1019 HOH A O   1 
HETATM 4866 O  O   . HOH N 9 .   ? 13.879  68.485 85.093 1.00 48.48 ? 1020 HOH A O   1 
HETATM 4867 O  O   . HOH N 9 .   ? 6.431   62.442 35.304 1.00 28.93 ? 1021 HOH A O   1 
HETATM 4868 O  O   . HOH N 9 .   ? 8.590   45.032 43.726 1.00 43.94 ? 1022 HOH A O   1 
HETATM 4869 O  O   . HOH N 9 .   ? 12.050  47.284 73.678 1.00 36.20 ? 1023 HOH A O   1 
HETATM 4870 O  O   . HOH N 9 .   ? 22.362  72.179 76.420 1.00 48.86 ? 1024 HOH A O   1 
HETATM 4871 O  O   . HOH N 9 .   ? 14.122  76.506 64.191 1.00 31.71 ? 1025 HOH A O   1 
HETATM 4872 O  O   . HOH N 9 .   ? 7.506   80.369 75.133 1.00 47.55 ? 1026 HOH A O   1 
HETATM 4873 O  O   . HOH N 9 .   ? 33.261  65.490 76.489 1.00 63.04 ? 1027 HOH A O   1 
HETATM 4874 O  O   . HOH N 9 .   ? -15.025 76.379 52.581 1.00 42.42 ? 1028 HOH A O   1 
HETATM 4875 O  O   . HOH N 9 .   ? 25.994  68.819 41.245 1.00 48.70 ? 1029 HOH A O   1 
HETATM 4876 O  O   . HOH N 9 .   ? -14.462 71.054 65.598 1.00 26.96 ? 1030 HOH A O   1 
HETATM 4877 O  O   . HOH N 9 .   ? 27.057  63.559 59.688 1.00 31.70 ? 1031 HOH A O   1 
HETATM 4878 O  O   . HOH N 9 .   ? 0.218   56.406 38.243 1.00 29.67 ? 1032 HOH A O   1 
HETATM 4879 O  O   . HOH N 9 .   ? -7.787  57.584 44.642 1.00 25.18 ? 1033 HOH A O   1 
HETATM 4880 O  O   . HOH N 9 .   ? 14.240  79.837 39.337 1.00 47.85 ? 1034 HOH A O   1 
HETATM 4881 O  O   . HOH N 9 .   ? -17.978 68.047 48.989 1.00 26.78 ? 1035 HOH A O   1 
HETATM 4882 O  O   . HOH N 9 .   ? 36.438  59.199 82.579 1.00 51.65 ? 1036 HOH A O   1 
HETATM 4883 O  O   . HOH N 9 .   ? -18.495 54.330 47.973 0.60 51.69 ? 1037 HOH A O   1 
HETATM 4884 O  O   . HOH N 9 .   ? 11.308  64.510 35.639 1.00 43.22 ? 1038 HOH A O   1 
HETATM 4885 O  O   . HOH N 9 .   ? 12.864  44.159 75.211 1.00 46.26 ? 1039 HOH A O   1 
HETATM 4886 O  O   . HOH N 9 .   ? -15.813 43.481 71.835 1.00 33.85 ? 1040 HOH A O   1 
HETATM 4887 O  O   . HOH N 9 .   ? 23.750  56.279 40.961 1.00 55.08 ? 1041 HOH A O   1 
HETATM 4888 O  O   . HOH N 9 .   ? -21.118 80.570 49.947 1.00 57.94 ? 1042 HOH A O   1 
HETATM 4889 O  O   . HOH N 9 .   ? 24.788  71.104 63.060 1.00 36.99 ? 1043 HOH A O   1 
HETATM 4890 O  O   . HOH N 9 .   ? 7.535   71.957 82.519 1.00 25.07 ? 1044 HOH A O   1 
HETATM 4891 O  O   . HOH N 9 .   ? 18.841  58.747 35.449 1.00 33.97 ? 1045 HOH A O   1 
HETATM 4892 O  O   . HOH N 9 .   ? -24.531 56.562 54.274 1.00 45.51 ? 1046 HOH A O   1 
HETATM 4893 O  O   . HOH N 9 .   ? 7.598   80.470 37.648 1.00 63.31 ? 1047 HOH A O   1 
HETATM 4894 O  O   . HOH N 9 .   ? 0.564   88.586 55.469 1.00 45.95 ? 1048 HOH A O   1 
HETATM 4895 O  O   . HOH N 9 .   ? -21.682 45.570 67.314 1.00 36.66 ? 1049 HOH A O   1 
HETATM 4896 O  O   . HOH N 9 .   ? 0.341   85.656 32.894 1.00 52.29 ? 1050 HOH A O   1 
HETATM 4897 O  O   . HOH N 9 .   ? 3.777   47.448 65.473 1.00 26.56 ? 1051 HOH A O   1 
HETATM 4898 O  O   . HOH N 9 .   ? 9.402   63.743 84.333 1.00 64.94 ? 1052 HOH A O   1 
HETATM 4899 O  O   . HOH N 9 .   ? 2.103   80.892 73.404 1.00 44.76 ? 1053 HOH A O   1 
HETATM 4900 O  O   . HOH N 9 .   ? -5.659  44.181 47.329 1.00 63.14 ? 1054 HOH A O   1 
HETATM 4901 O  O   . HOH N 9 .   ? 16.233  50.501 62.742 1.00 31.09 ? 1055 HOH A O   1 
HETATM 4902 O  O   . HOH N 9 .   ? 21.445  52.041 53.928 1.00 43.70 ? 1056 HOH A O   1 
HETATM 4903 O  O   . HOH N 9 .   ? -0.375  45.053 42.811 1.00 61.68 ? 1057 HOH A O   1 
HETATM 4904 O  O   . HOH N 9 .   ? 9.977   46.631 53.810 1.00 24.38 ? 1058 HOH A O   1 
HETATM 4905 O  O   . HOH N 9 .   ? -12.255 62.715 59.156 1.00 23.62 ? 1059 HOH A O   1 
HETATM 4906 O  O   . HOH N 9 .   ? 31.777  66.573 80.705 1.00 54.59 ? 1060 HOH A O   1 
HETATM 4907 O  O   . HOH N 9 .   ? -20.118 68.802 57.701 1.00 57.88 ? 1061 HOH A O   1 
HETATM 4908 O  O   . HOH N 9 .   ? -23.652 63.781 45.517 1.00 68.76 ? 1062 HOH A O   1 
HETATM 4909 O  O   . HOH N 9 .   ? -10.708 62.966 74.874 1.00 57.23 ? 1063 HOH A O   1 
HETATM 4910 O  O   . HOH N 9 .   ? 7.454   46.683 53.788 1.00 23.25 ? 1064 HOH A O   1 
HETATM 4911 O  O   . HOH N 9 .   ? -12.204 66.657 37.265 1.00 31.09 ? 1065 HOH A O   1 
HETATM 4912 O  O   . HOH N 9 .   ? 28.180  57.578 42.421 1.00 43.73 ? 1066 HOH A O   1 
HETATM 4913 O  O   . HOH N 9 .   ? 25.059  83.490 61.036 1.00 54.51 ? 1067 HOH A O   1 
HETATM 4914 O  O   . HOH N 9 .   ? -15.433 83.350 29.889 1.00 58.23 ? 1068 HOH A O   1 
HETATM 4915 O  O   . HOH N 9 .   ? 25.501  60.087 68.087 1.00 57.86 ? 1069 HOH A O   1 
HETATM 4916 O  O   . HOH N 9 .   ? -3.579  49.919 62.150 1.00 29.26 ? 1070 HOH A O   1 
HETATM 4917 O  O   . HOH N 9 .   ? -13.175 42.299 75.686 1.00 56.60 ? 1071 HOH A O   1 
HETATM 4918 O  O   . HOH N 9 .   ? -18.292 45.138 50.382 1.00 61.84 ? 1072 HOH A O   1 
HETATM 4919 O  O   . HOH N 9 .   ? -6.962  57.517 72.460 1.00 40.25 ? 1073 HOH A O   1 
HETATM 4920 O  O   . HOH N 9 .   ? -19.955 82.650 34.919 1.00 64.56 ? 1074 HOH A O   1 
HETATM 4921 O  O   . HOH N 9 .   ? -14.780 76.206 60.666 1.00 44.79 ? 1075 HOH A O   1 
HETATM 4922 O  O   . HOH N 9 .   ? 14.815  52.804 84.394 1.00 49.71 ? 1076 HOH A O   1 
HETATM 4923 O  O   . HOH N 9 .   ? 25.167  54.509 56.819 1.00 42.41 ? 1077 HOH A O   1 
HETATM 4924 O  O   . HOH N 9 .   ? 20.884  67.775 70.629 1.00 51.20 ? 1078 HOH A O   1 
HETATM 4925 O  O   . HOH N 9 .   ? 5.936   47.283 75.241 1.00 32.80 ? 1079 HOH A O   1 
HETATM 4926 O  O   . HOH N 9 .   ? -10.078 39.381 62.384 1.00 42.24 ? 1080 HOH A O   1 
HETATM 4927 O  O   . HOH N 9 .   ? 14.292  51.073 56.012 1.00 32.56 ? 1081 HOH A O   1 
HETATM 4928 O  O   . HOH N 9 .   ? -16.085 87.705 53.092 1.00 69.66 ? 1082 HOH A O   1 
HETATM 4929 O  O   . HOH N 9 .   ? -5.317  87.326 35.073 1.00 46.72 ? 1083 HOH A O   1 
HETATM 4930 O  O   . HOH N 9 .   ? -14.348 76.038 57.622 1.00 54.95 ? 1084 HOH A O   1 
HETATM 4931 O  O   . HOH N 9 .   ? -15.608 86.366 33.533 1.00 70.07 ? 1085 HOH A O   1 
HETATM 4932 O  O   . HOH N 9 .   ? -5.451  40.785 57.333 1.00 40.35 ? 1086 HOH A O   1 
HETATM 4933 O  O   . HOH N 9 .   ? 20.331  69.903 36.075 1.00 52.65 ? 1087 HOH A O   1 
HETATM 4934 O  O   . HOH N 9 .   ? 11.050  70.226 34.292 1.00 39.18 ? 1088 HOH A O   1 
HETATM 4935 O  O   . HOH N 9 .   ? -0.537  50.695 42.858 1.00 36.24 ? 1089 HOH A O   1 
HETATM 4936 O  O   . HOH N 9 .   ? -0.810  54.893 73.740 1.00 49.96 ? 1090 HOH A O   1 
HETATM 4937 O  O   . HOH N 9 .   ? -2.638  77.565 62.496 1.00 31.68 ? 1091 HOH A O   1 
HETATM 4938 O  O   . HOH N 9 .   ? 8.715   50.857 78.374 1.00 38.94 ? 1092 HOH A O   1 
HETATM 4939 O  O   . HOH N 9 .   ? -3.407  66.859 32.190 1.00 51.87 ? 1093 HOH A O   1 
HETATM 4940 O  O   . HOH N 9 .   ? -3.503  39.527 49.616 1.00 69.11 ? 1094 HOH A O   1 
HETATM 4941 O  O   . HOH N 9 .   ? 18.789  32.258 67.349 1.00 62.92 ? 1095 HOH A O   1 
HETATM 4942 O  O   . HOH N 9 .   ? 28.360  64.820 57.764 1.00 42.83 ? 1096 HOH A O   1 
HETATM 4943 O  O   . HOH N 9 .   ? -3.214  51.490 44.126 1.00 27.08 ? 1097 HOH A O   1 
HETATM 4944 O  O   . HOH N 9 .   ? -15.368 57.353 50.719 1.00 44.52 ? 1098 HOH A O   1 
HETATM 4945 O  O   . HOH N 9 .   ? -21.769 60.490 47.945 1.00 41.91 ? 1099 HOH A O   1 
HETATM 4946 O  O   . HOH N 9 .   ? -10.702 85.530 30.865 1.00 57.93 ? 1100 HOH A O   1 
HETATM 4947 O  O   . HOH N 9 .   ? 13.365  74.673 66.240 1.00 33.04 ? 1101 HOH A O   1 
HETATM 4948 O  O   . HOH N 9 .   ? -8.841  64.742 70.931 1.00 33.40 ? 1102 HOH A O   1 
HETATM 4949 O  O   . HOH N 9 .   ? 30.200  62.400 74.414 1.00 57.95 ? 1103 HOH A O   1 
HETATM 4950 O  O   . HOH N 9 .   ? -5.318  79.934 62.730 1.00 39.81 ? 1104 HOH A O   1 
HETATM 4951 O  O   . HOH N 9 .   ? -13.072 40.375 62.231 1.00 49.05 ? 1105 HOH A O   1 
HETATM 4952 O  O   . HOH N 9 .   ? -11.326 41.033 48.645 1.00 55.31 ? 1106 HOH A O   1 
HETATM 4953 O  O   . HOH N 9 .   ? 17.784  39.469 74.009 1.00 28.86 ? 1107 HOH A O   1 
HETATM 4954 O  O   . HOH N 9 .   ? 4.915   46.438 40.646 1.00 33.62 ? 1108 HOH A O   1 
HETATM 4955 O  O   . HOH N 9 .   ? 0.932   52.141 74.285 1.00 47.01 ? 1109 HOH A O   1 
HETATM 4956 O  O   . HOH N 9 .   ? -21.920 69.723 47.194 1.00 57.32 ? 1110 HOH A O   1 
HETATM 4957 O  O   . HOH N 9 .   ? -9.882  62.502 33.799 1.00 60.75 ? 1111 HOH A O   1 
HETATM 4958 O  O   . HOH N 9 .   ? -18.036 74.581 60.098 1.00 63.49 ? 1112 HOH A O   1 
HETATM 4959 O  O   . HOH N 9 .   ? -23.471 51.304 60.371 1.00 48.66 ? 1113 HOH A O   1 
HETATM 4960 O  O   . HOH N 9 .   ? 3.578   51.281 64.439 1.00 20.47 ? 1114 HOH A O   1 
HETATM 4961 O  O   . HOH N 9 .   ? -18.053 64.812 61.395 1.00 29.11 ? 1115 HOH A O   1 
HETATM 4962 O  O   . HOH N 9 .   ? 7.242   41.380 49.421 1.00 41.30 ? 1116 HOH A O   1 
HETATM 4963 O  O   . HOH N 9 .   ? 7.978   79.045 67.726 1.00 38.02 ? 1117 HOH A O   1 
HETATM 4964 O  O   . HOH N 9 .   ? -24.201 79.832 41.817 1.00 42.08 ? 1118 HOH A O   1 
HETATM 4965 O  O   . HOH N 9 .   ? -22.976 55.797 69.211 1.00 55.91 ? 1119 HOH A O   1 
HETATM 4966 O  O   . HOH N 9 .   ? 23.820  77.382 55.207 1.00 45.58 ? 1120 HOH A O   1 
HETATM 4967 O  O   . HOH N 9 .   ? -15.647 72.293 54.265 1.00 33.94 ? 1121 HOH A O   1 
HETATM 4968 O  O   . HOH N 9 .   ? -7.401  60.295 72.438 1.00 52.95 ? 1122 HOH A O   1 
HETATM 4969 O  O   . HOH N 9 .   ? 19.846  48.511 45.551 1.00 48.67 ? 1123 HOH A O   1 
HETATM 4970 O  O   . HOH N 9 .   ? -21.118 59.240 63.135 1.00 45.47 ? 1124 HOH A O   1 
HETATM 4971 O  O   . HOH N 9 .   ? 14.043  43.207 45.459 1.00 47.25 ? 1125 HOH A O   1 
HETATM 4972 O  O   . HOH N 9 .   ? 17.792  63.980 65.986 1.00 32.17 ? 1126 HOH A O   1 
HETATM 4973 O  O   . HOH N 9 .   ? 16.258  74.298 77.715 1.00 27.58 ? 1127 HOH A O   1 
HETATM 4974 O  O   . HOH N 9 .   ? 23.343  51.794 80.667 1.00 62.63 ? 1128 HOH A O   1 
HETATM 4975 O  O   . HOH N 9 .   ? 12.582  65.692 33.697 1.00 45.17 ? 1129 HOH A O   1 
HETATM 4976 O  O   . HOH N 9 .   ? 3.639   99.043 50.596 1.00 55.02 ? 1130 HOH A O   1 
HETATM 4977 O  O   . HOH N 9 .   ? 1.474   40.526 54.543 1.00 33.02 ? 1131 HOH A O   1 
HETATM 4978 O  O   . HOH N 9 .   ? 0.717   40.067 47.929 1.00 61.27 ? 1132 HOH A O   1 
HETATM 4979 O  O   . HOH N 9 .   ? 21.241  59.271 87.772 1.00 50.35 ? 1133 HOH A O   1 
HETATM 4980 O  O   . HOH N 9 .   ? 21.155  77.805 65.008 1.00 37.92 ? 1134 HOH A O   1 
HETATM 4981 O  O   . HOH N 9 .   ? 10.132  84.583 40.633 1.00 52.43 ? 1135 HOH A O   1 
HETATM 4982 O  O   . HOH N 9 .   ? -2.123  92.034 39.202 1.00 63.41 ? 1136 HOH A O   1 
HETATM 4983 O  O   . HOH N 9 .   ? -12.020 89.058 46.511 1.00 38.73 ? 1137 HOH A O   1 
HETATM 4984 O  O   . HOH N 9 .   ? 25.167  58.414 42.000 1.00 46.94 ? 1138 HOH A O   1 
HETATM 4985 O  O   . HOH N 9 .   ? -11.134 40.704 75.493 1.00 73.96 ? 1139 HOH A O   1 
HETATM 4986 O  O   . HOH N 9 .   ? -7.628  70.047 56.484 1.00 22.33 ? 1140 HOH A O   1 
HETATM 4987 O  O   . HOH N 9 .   ? 26.138  64.275 67.129 1.00 58.94 ? 1141 HOH A O   1 
HETATM 4988 O  O   . HOH N 9 .   ? 26.495  59.072 63.063 1.00 26.76 ? 1142 HOH A O   1 
HETATM 4989 O  O   . HOH N 9 .   ? -3.192  46.587 71.707 1.00 35.94 ? 1143 HOH A O   1 
HETATM 4990 O  O   . HOH N 9 .   ? 15.081  42.593 48.019 1.00 55.49 ? 1144 HOH A O   1 
HETATM 4991 O  O   . HOH N 9 .   ? 19.853  74.387 68.250 1.00 32.80 ? 1145 HOH A O   1 
HETATM 4992 O  O   . HOH N 9 .   ? 14.014  49.313 37.833 1.00 53.16 ? 1146 HOH A O   1 
HETATM 4993 O  O   . HOH N 9 .   ? 30.282  61.889 58.293 1.00 44.03 ? 1147 HOH A O   1 
HETATM 4994 O  O   . HOH N 9 .   ? 8.845   50.050 37.552 1.00 40.86 ? 1148 HOH A O   1 
HETATM 4995 O  O   . HOH N 9 .   ? 12.542  52.626 35.093 1.00 53.82 ? 1149 HOH A O   1 
HETATM 4996 O  O   . HOH N 9 .   ? 23.061  52.840 55.735 1.00 51.39 ? 1150 HOH A O   1 
HETATM 4997 O  O   . HOH N 9 .   ? 3.714   45.776 61.366 1.00 21.85 ? 1151 HOH A O   1 
HETATM 4998 O  O   . HOH N 9 .   ? 14.150  40.138 75.281 1.00 43.02 ? 1152 HOH A O   1 
HETATM 4999 O  O   . HOH N 9 .   ? 28.997  59.436 61.301 1.00 31.36 ? 1153 HOH A O   1 
HETATM 5000 O  O   . HOH N 9 .   ? 3.614   50.384 69.642 1.00 23.59 ? 1154 HOH A O   1 
HETATM 5001 O  O   . HOH N 9 .   ? 8.806   78.367 80.000 1.00 52.45 ? 1155 HOH A O   1 
HETATM 5002 O  O   . HOH N 9 .   ? -17.728 63.554 67.207 1.00 39.69 ? 1156 HOH A O   1 
HETATM 5003 O  O   . HOH N 9 .   ? 9.231   62.365 35.846 1.00 39.25 ? 1157 HOH A O   1 
HETATM 5004 O  O   . HOH N 9 .   ? 0.766   40.344 57.472 1.00 28.38 ? 1158 HOH A O   1 
HETATM 5005 O  O   . HOH N 9 .   ? 8.684   44.718 77.215 1.00 54.28 ? 1159 HOH A O   1 
HETATM 5006 O  O   . HOH N 9 .   ? 1.814   89.706 54.178 1.00 34.19 ? 1160 HOH A O   1 
HETATM 5007 O  O   . HOH N 9 .   ? 18.170  45.546 78.227 1.00 59.19 ? 1161 HOH A O   1 
HETATM 5008 O  O   . HOH N 9 .   ? -8.807  60.379 63.627 1.00 18.85 ? 1162 HOH A O   1 
HETATM 5009 O  O   . HOH N 9 .   ? 11.487  58.621 86.827 1.00 62.82 ? 1163 HOH A O   1 
HETATM 5010 O  O   . HOH N 9 .   ? -16.908 62.941 38.706 1.00 60.89 ? 1164 HOH A O   1 
HETATM 5011 O  O   . HOH N 9 .   ? -7.060  55.062 42.597 1.00 38.74 ? 1165 HOH A O   1 
HETATM 5012 O  O   . HOH N 9 .   ? 15.873  37.914 57.178 1.00 78.32 ? 1166 HOH A O   1 
HETATM 5013 O  O   . HOH N 9 .   ? 23.956  72.684 39.155 1.00 40.03 ? 1167 HOH A O   1 
HETATM 5014 O  O   . HOH N 9 .   ? -18.719 52.388 72.641 1.00 41.73 ? 1168 HOH A O   1 
HETATM 5015 O  O   . HOH N 9 .   ? -23.402 58.486 64.172 1.00 64.13 ? 1169 HOH A O   1 
HETATM 5016 O  O   . HOH N 9 .   ? -5.831  74.512 69.576 1.00 63.92 ? 1170 HOH A O   1 
HETATM 5017 O  O   . HOH N 9 .   ? -19.759 67.394 60.952 1.00 59.69 ? 1171 HOH A O   1 
HETATM 5018 O  O   . HOH N 9 .   ? -10.137 63.244 40.902 1.00 41.26 ? 1172 HOH A O   1 
HETATM 5019 O  O   . HOH N 9 .   ? -18.747 70.865 65.042 1.00 64.93 ? 1173 HOH A O   1 
HETATM 5020 O  O   . HOH N 9 .   ? 24.728  80.598 51.694 1.00 61.14 ? 1174 HOH A O   1 
HETATM 5021 O  O   . HOH N 9 .   ? -20.500 70.910 35.807 1.00 50.23 ? 1175 HOH A O   1 
HETATM 5022 O  O   . HOH N 9 .   ? -23.506 52.308 68.192 1.00 66.86 ? 1176 HOH A O   1 
HETATM 5023 O  O   . HOH N 9 .   ? 24.906  67.812 82.751 1.00 62.24 ? 1177 HOH A O   1 
HETATM 5024 O  O   . HOH N 9 .   ? -21.901 81.220 36.189 1.00 68.62 ? 1178 HOH A O   1 
HETATM 5025 O  O   . HOH N 9 .   ? -17.035 68.303 65.307 1.00 48.07 ? 1179 HOH A O   1 
HETATM 5026 O  O   . HOH N 9 .   ? -4.199  54.433 39.106 1.00 41.54 ? 1180 HOH A O   1 
HETATM 5027 O  O   . HOH N 9 .   ? -11.707 38.263 57.226 1.00 53.83 ? 1181 HOH A O   1 
HETATM 5028 O  O   . HOH N 9 .   ? -12.078 39.360 64.545 1.00 53.44 ? 1182 HOH A O   1 
HETATM 5029 O  O   . HOH N 9 .   ? -21.454 48.782 57.456 1.00 58.26 ? 1183 HOH A O   1 
HETATM 5030 O  O   . HOH N 9 .   ? 4.099   64.407 35.391 1.00 32.87 ? 1184 HOH A O   1 
HETATM 5031 O  O   . HOH N 9 .   ? 23.980  48.138 44.367 1.00 65.18 ? 1185 HOH A O   1 
HETATM 5032 O  O   . HOH N 9 .   ? -4.085  88.906 55.101 1.00 54.78 ? 1186 HOH A O   1 
HETATM 5033 O  O   . HOH N 9 .   ? 22.931  48.203 78.442 1.00 40.88 ? 1187 HOH A O   1 
HETATM 5034 O  O   . HOH N 9 .   ? 26.587  48.286 69.283 1.00 48.71 ? 1188 HOH A O   1 
HETATM 5035 O  O   . HOH N 9 .   ? -5.873  76.231 66.410 1.00 44.42 ? 1189 HOH A O   1 
HETATM 5036 O  O   . HOH N 9 .   ? 11.605  46.241 39.147 1.00 61.38 ? 1190 HOH A O   1 
HETATM 5037 O  O   . HOH N 9 .   ? 8.254   90.710 49.100 1.00 46.44 ? 1191 HOH A O   1 
HETATM 5038 O  O   . HOH N 9 .   ? 7.731   88.057 42.933 1.00 62.99 ? 1192 HOH A O   1 
HETATM 5039 O  O   . HOH N 9 .   ? 25.311  83.942 54.631 1.00 56.00 ? 1193 HOH A O   1 
HETATM 5040 O  O   . HOH N 9 .   ? -4.975  50.782 46.089 1.00 46.08 ? 1194 HOH A O   1 
HETATM 5041 O  O   . HOH N 9 .   ? -0.325  90.543 53.456 1.00 70.58 ? 1195 HOH A O   1 
HETATM 5042 O  O   . HOH N 9 .   ? -11.032 51.938 77.126 1.00 43.67 ? 1196 HOH A O   1 
HETATM 5043 O  O   . HOH N 9 .   ? 14.240  90.579 64.783 1.00 58.80 ? 1197 HOH A O   1 
HETATM 5044 O  O   . HOH N 9 .   ? 4.344   49.768 66.961 1.00 23.69 ? 1198 HOH A O   1 
HETATM 5045 O  O   . HOH N 9 .   ? 29.077  53.603 50.795 1.00 75.50 ? 1199 HOH A O   1 
HETATM 5046 O  O   . HOH N 9 .   ? 3.177   64.219 64.951 1.00 74.94 ? 1200 HOH A O   1 
HETATM 5047 O  O   . HOH N 9 .   ? -10.104 86.748 51.840 1.00 58.28 ? 1201 HOH A O   1 
HETATM 5048 O  O   . HOH N 9 .   ? 0.585   71.078 29.470 1.00 45.01 ? 1202 HOH A O   1 
HETATM 5049 O  O   . HOH N 9 .   ? 9.056   43.111 67.211 1.00 58.68 ? 1203 HOH A O   1 
HETATM 5050 O  O   . HOH N 9 .   ? 3.510   60.920 73.801 1.00 41.99 ? 1204 HOH A O   1 
HETATM 5051 O  O   . HOH N 9 .   ? 5.470   82.015 62.935 1.00 58.17 ? 1205 HOH A O   1 
HETATM 5052 O  O   . HOH N 9 .   ? -2.706  37.959 54.615 1.00 56.29 ? 1206 HOH A O   1 
HETATM 5053 O  O   . HOH N 9 .   ? -1.911  79.720 70.522 1.00 51.54 ? 1207 HOH A O   1 
HETATM 5054 O  O   . HOH N 9 .   ? -9.031  62.449 72.450 1.00 36.33 ? 1208 HOH A O   1 
HETATM 5055 O  O   . HOH N 9 .   ? -18.257 72.866 51.674 1.00 55.32 ? 1209 HOH A O   1 
HETATM 5056 O  O   . HOH N 9 .   ? -23.961 55.386 59.968 1.00 59.81 ? 1210 HOH A O   1 
HETATM 5057 O  O   . HOH N 9 .   ? 30.954  70.296 46.234 1.00 47.56 ? 1211 HOH A O   1 
HETATM 5058 O  O   . HOH N 9 .   ? -12.997 75.921 65.245 1.00 62.56 ? 1212 HOH A O   1 
HETATM 5059 O  O   . HOH N 9 .   ? 18.436  41.794 58.710 1.00 57.87 ? 1213 HOH A O   1 
HETATM 5060 O  O   . HOH N 9 .   ? 21.980  52.200 49.354 1.00 54.50 ? 1214 HOH A O   1 
HETATM 5061 O  O   . HOH N 9 .   ? -22.135 80.316 47.458 1.00 62.46 ? 1215 HOH A O   1 
HETATM 5062 O  O   . HOH N 9 .   ? -10.549 50.142 43.812 1.00 51.01 ? 1216 HOH A O   1 
HETATM 5063 O  O   . HOH N 9 .   ? 1.829   56.285 72.793 1.00 48.35 ? 1217 HOH A O   1 
HETATM 5064 O  O   . HOH N 9 .   ? 6.809   73.872 30.436 1.00 64.24 ? 1218 HOH A O   1 
HETATM 5065 O  O   . HOH N 9 .   ? -9.756  55.940 45.116 1.00 33.59 ? 1219 HOH A O   1 
HETATM 5066 O  O   . HOH N 9 .   ? 0.470   42.716 69.884 1.00 49.39 ? 1220 HOH A O   1 
HETATM 5067 O  O   . HOH N 9 .   ? -21.656 65.735 54.554 1.00 57.03 ? 1221 HOH A O   1 
HETATM 5068 O  O   . HOH N 9 .   ? 5.166   46.025 57.188 1.00 43.13 ? 1222 HOH A O   1 
HETATM 5069 O  O   . HOH N 9 .   ? 0.514   90.310 58.149 1.00 68.76 ? 1223 HOH A O   1 
HETATM 5070 O  O   . HOH N 9 .   ? 29.573  53.548 47.560 1.00 67.53 ? 1224 HOH A O   1 
HETATM 5071 O  O   . HOH N 9 .   ? -3.623  84.580 57.401 1.00 56.92 ? 1225 HOH A O   1 
HETATM 5072 O  O   . HOH N 9 .   ? 20.751  82.618 53.734 1.00 44.70 ? 1226 HOH A O   1 
HETATM 5073 O  O   . HOH N 9 .   ? 29.144  54.842 53.056 1.00 60.87 ? 1227 HOH A O   1 
HETATM 5074 O  O   . HOH N 9 .   ? 14.049  71.795 33.057 1.00 60.85 ? 1228 HOH A O   1 
HETATM 5075 O  O   . HOH N 9 .   ? 17.378  84.228 47.822 1.00 44.81 ? 1229 HOH A O   1 
HETATM 5076 O  O   . HOH N 9 .   ? 12.447  83.722 41.202 1.00 54.45 ? 1230 HOH A O   1 
HETATM 5077 O  O   . HOH N 9 .   ? 7.479   48.685 59.378 1.00 48.77 ? 1231 HOH A O   1 
HETATM 5078 O  O   . HOH N 9 .   ? 9.410   49.608 57.217 1.00 47.57 ? 1232 HOH A O   1 
HETATM 5079 O  O   . HOH N 9 .   ? 23.888  90.427 62.519 1.00 62.58 ? 1233 HOH A O   1 
HETATM 5080 O  O   . HOH N 9 .   ? 11.799  86.899 44.505 1.00 47.30 ? 1234 HOH A O   1 
HETATM 5081 O  O   . HOH N 9 .   ? 15.021  91.125 50.983 1.00 55.71 ? 1235 HOH A O   1 
HETATM 5082 O  O   . HOH N 9 .   ? 20.863  87.938 64.473 1.00 64.70 ? 1236 HOH A O   1 
HETATM 5083 O  O   . HOH N 9 .   ? -1.333  63.909 28.979 1.00 59.92 ? 1237 HOH A O   1 
HETATM 5084 O  O   . HOH N 9 .   ? -24.521 38.403 68.476 1.00 60.46 ? 1238 HOH A O   1 
HETATM 5085 O  O   . HOH N 9 .   ? 18.529  52.061 85.888 0.50 59.38 ? 1239 HOH A O   1 
HETATM 5086 O  O   . HOH N 9 .   ? 11.603  51.175 81.231 1.00 45.52 ? 1240 HOH A O   1 
HETATM 5087 O  O   . HOH N 9 .   ? 30.884  72.332 59.826 1.00 66.70 ? 1241 HOH A O   1 
HETATM 5088 O  O   . HOH N 9 .   ? 16.196  88.885 52.134 1.00 35.71 ? 1242 HOH A O   1 
HETATM 5089 O  O   . HOH N 9 .   ? 16.112  40.628 58.523 1.00 69.63 ? 1243 HOH A O   1 
HETATM 5090 O  O   . HOH N 9 .   ? 19.029  39.428 76.341 1.00 76.73 ? 1244 HOH A O   1 
HETATM 5091 O  O   . HOH N 9 .   ? 33.475  67.646 49.033 1.00 62.57 ? 1245 HOH A O   1 
HETATM 5092 O  O   . HOH N 9 .   ? -18.676 70.975 34.130 1.00 56.15 ? 1246 HOH A O   1 
HETATM 5093 O  O   . HOH N 9 .   ? -13.233 37.898 62.611 1.00 56.80 ? 1247 HOH A O   1 
HETATM 5094 O  O   . HOH N 9 .   ? -7.807  58.945 42.198 1.00 27.13 ? 1248 HOH A O   1 
HETATM 5095 O  O   . HOH N 9 .   ? 3.944   70.023 29.198 1.00 54.02 ? 1249 HOH A O   1 
HETATM 5096 O  O   . HOH N 9 .   ? 21.628  75.225 66.312 1.00 69.66 ? 1250 HOH A O   1 
HETATM 5097 O  O   . HOH N 9 .   ? 17.512  66.646 35.358 1.00 53.40 ? 1251 HOH A O   1 
HETATM 5098 O  O   . HOH N 9 .   ? -0.939  68.088 67.058 1.00 40.32 ? 1252 HOH A O   1 
HETATM 5099 O  O   . HOH N 9 .   ? 20.845  89.030 56.180 1.00 51.01 ? 1253 HOH A O   1 
HETATM 5100 O  O   . HOH N 9 .   ? -6.601  40.163 64.224 1.00 49.65 ? 1254 HOH A O   1 
HETATM 5101 O  O   . HOH N 9 .   ? -19.059 82.775 45.050 1.00 48.96 ? 1255 HOH A O   1 
HETATM 5102 O  O   . HOH N 9 .   ? 26.559  45.751 60.204 1.00 32.60 ? 1256 HOH A O   1 
HETATM 5103 O  O   . HOH N 9 .   ? 25.215  51.874 53.039 1.00 58.94 ? 1257 HOH A O   1 
HETATM 5104 O  O   . HOH N 9 .   ? 10.724  48.124 37.843 1.00 59.12 ? 1258 HOH A O   1 
HETATM 5105 O  O   . HOH N 9 .   ? 14.939  34.056 67.925 1.00 65.02 ? 1259 HOH A O   1 
HETATM 5106 O  O   . HOH N 9 .   ? -20.152 41.848 71.612 1.00 63.13 ? 1260 HOH A O   1 
HETATM 5107 O  O   . HOH N 9 .   ? 3.506   91.310 55.722 1.00 61.32 ? 1261 HOH A O   1 
HETATM 5108 O  O   . HOH N 9 .   ? 5.321   78.794 67.501 1.00 59.02 ? 1262 HOH A O   1 
HETATM 5109 O  O   . HOH N 9 .   ? 16.659  77.497 36.667 1.00 49.61 ? 1263 HOH A O   1 
HETATM 5110 O  O   . HOH N 9 .   ? -3.715  39.065 58.208 1.00 41.98 ? 1264 HOH A O   1 
HETATM 5111 O  O   . HOH N 9 .   ? 20.372  73.732 75.316 1.00 55.21 ? 1265 HOH A O   1 
HETATM 5112 O  O   . HOH N 9 .   ? 17.239  71.427 84.883 1.00 57.33 ? 1266 HOH A O   1 
HETATM 5113 O  O   . HOH N 9 .   ? 27.019  60.814 74.761 1.00 51.66 ? 1267 HOH A O   1 
HETATM 5114 O  O   . HOH N 9 .   ? -1.324  39.893 64.612 1.00 51.53 ? 1268 HOH A O   1 
HETATM 5115 O  O   . HOH N 9 .   ? -9.039  90.130 41.339 1.00 56.10 ? 1269 HOH A O   1 
HETATM 5116 O  O   . HOH N 9 .   ? -11.569 67.454 70.156 1.00 42.36 ? 1270 HOH A O   1 
HETATM 5117 O  O   . HOH N 9 .   ? -7.444  49.307 76.861 1.00 45.61 ? 1271 HOH A O   1 
HETATM 5118 O  O   . HOH N 9 .   ? 14.350  75.544 79.429 1.00 46.60 ? 1272 HOH A O   1 
HETATM 5119 O  O   . HOH N 9 .   ? 20.400  55.110 36.527 1.00 53.63 ? 1273 HOH A O   1 
HETATM 5120 O  O   . HOH N 9 .   ? 11.953  87.279 68.790 1.00 57.48 ? 1274 HOH A O   1 
HETATM 5121 O  O   . HOH N 9 .   ? 19.134  74.095 77.670 1.00 48.33 ? 1275 HOH A O   1 
HETATM 5122 O  O   . HOH N 9 .   ? 16.234  48.872 57.208 1.00 49.84 ? 1276 HOH A O   1 
HETATM 5123 O  O   . HOH N 9 .   ? 24.082  56.049 55.141 1.00 46.40 ? 1277 HOH A O   1 
HETATM 5124 O  O   . HOH N 9 .   ? 10.780  48.895 54.720 1.00 42.95 ? 1278 HOH A O   1 
HETATM 5125 O  O   . HOH N 9 .   ? -5.628  82.821 55.547 1.00 60.49 ? 1279 HOH A O   1 
HETATM 5126 O  O   . HOH N 9 .   ? 27.548  59.840 65.371 1.00 49.46 ? 1280 HOH A O   1 
HETATM 5127 O  O   . HOH N 9 .   ? -20.800 59.676 72.819 1.00 57.26 ? 1281 HOH A O   1 
HETATM 5128 O  O   . HOH N 9 .   ? 18.527  73.976 35.329 1.00 39.56 ? 1282 HOH A O   1 
HETATM 5129 O  O   . HOH N 9 .   ? 2.798   39.584 59.033 1.00 53.24 ? 1283 HOH A O   1 
HETATM 5130 O  O   . HOH N 9 .   ? 24.983  68.484 63.919 1.00 45.45 ? 1284 HOH A O   1 
HETATM 5131 O  O   . HOH N 9 .   ? 5.874   88.925 41.451 1.00 72.72 ? 1285 HOH A O   1 
HETATM 5132 O  O   . HOH N 9 .   ? 32.656  70.023 47.977 1.00 54.40 ? 1286 HOH A O   1 
HETATM 5133 O  O   . HOH N 9 .   ? 23.551  78.057 62.550 1.00 68.74 ? 1287 HOH A O   1 
HETATM 5134 O  O   . HOH N 9 .   ? 19.610  90.127 54.271 1.00 52.31 ? 1288 HOH A O   1 
HETATM 5135 O  O   . HOH N 9 .   ? -1.421  38.396 57.245 1.00 38.83 ? 1289 HOH A O   1 
HETATM 5136 O  O   . HOH N 9 .   ? 18.119  81.062 69.071 1.00 60.60 ? 1290 HOH A O   1 
HETATM 5137 O  O   . HOH N 9 .   ? 29.757  59.570 41.062 1.00 61.15 ? 1291 HOH A O   1 
HETATM 5138 O  O   . HOH N 9 .   ? -23.204 78.916 36.234 1.00 62.15 ? 1292 HOH A O   1 
HETATM 5139 O  O   . HOH N 9 .   ? 4.135   44.952 66.046 1.00 35.73 ? 1293 HOH A O   1 
HETATM 5140 O  O   . HOH N 9 .   ? 24.837  76.082 62.994 1.00 53.68 ? 1294 HOH A O   1 
HETATM 5141 O  O   . HOH N 9 .   ? -19.792 77.231 24.451 1.00 52.19 ? 1295 HOH A O   1 
HETATM 5142 O  O   . HOH N 9 .   ? 5.070   41.406 57.111 1.00 39.97 ? 1296 HOH A O   1 
HETATM 5143 O  O   . HOH N 9 .   ? 5.908   81.531 67.502 1.00 72.28 ? 1297 HOH A O   1 
HETATM 5144 O  O   . HOH N 9 .   ? 5.818   43.369 41.889 1.00 63.04 ? 1298 HOH A O   1 
HETATM 5145 O  O   . HOH N 9 .   ? 23.241  66.255 64.445 1.00 37.62 ? 1299 HOH A O   1 
HETATM 5146 O  O   . HOH N 9 .   ? 6.317   44.233 54.028 1.00 26.74 ? 1300 HOH A O   1 
HETATM 5147 O  O   . HOH N 9 .   ? -26.043 60.400 47.142 1.00 63.50 ? 1301 HOH A O   1 
HETATM 5148 O  O   . HOH N 9 .   ? 19.277  65.818 32.883 1.00 59.25 ? 1302 HOH A O   1 
HETATM 5149 O  O   . HOH N 9 .   ? -14.090 78.106 62.083 1.00 52.14 ? 1303 HOH A O   1 
HETATM 5150 O  O   . HOH N 9 .   ? -18.112 67.391 32.089 1.00 58.51 ? 1304 HOH A O   1 
HETATM 5151 O  O   . HOH N 9 .   ? 14.780  46.029 62.576 1.00 49.61 ? 1305 HOH A O   1 
HETATM 5152 O  O   . HOH N 9 .   ? 14.405  74.564 85.962 1.00 59.46 ? 1306 HOH A O   1 
HETATM 5153 O  O   . HOH N 9 .   ? 3.947   44.008 63.436 1.00 40.19 ? 1307 HOH A O   1 
HETATM 5154 O  O   . HOH N 9 .   ? 8.996   88.877 45.217 1.00 63.47 ? 1308 HOH A O   1 
HETATM 5155 O  O   . HOH N 9 .   ? -19.224 55.755 75.269 1.00 46.48 ? 1309 HOH A O   1 
HETATM 5156 O  O   . HOH N 9 .   ? -18.765 61.182 71.611 1.00 68.48 ? 1310 HOH A O   1 
HETATM 5157 O  O   . HOH N 9 .   ? -27.720 60.363 45.124 1.00 72.63 ? 1311 HOH A O   1 
HETATM 5158 O  O   . HOH N 9 .   ? 28.947  54.754 42.372 1.00 60.49 ? 1312 HOH A O   1 
HETATM 5159 O  O   . HOH N 9 .   ? 4.319   43.679 55.678 1.00 29.17 ? 1313 HOH A O   1 
HETATM 5160 O  O   . HOH N 9 .   ? 23.953  61.346 40.201 1.00 37.94 ? 1314 HOH A O   1 
HETATM 5161 O  O   . HOH N 9 .   ? 5.262   40.073 48.392 1.00 61.59 ? 1315 HOH A O   1 
HETATM 5162 O  O   . HOH N 9 .   ? -17.028 63.367 73.243 1.00 53.77 ? 1316 HOH A O   1 
HETATM 5163 O  O   . HOH N 9 .   ? -24.598 36.554 66.549 1.00 71.68 ? 1317 HOH A O   1 
HETATM 5164 O  O   . HOH N 9 .   ? -10.465 71.568 67.504 1.00 43.05 ? 1318 HOH A O   1 
HETATM 5165 O  O   . HOH N 9 .   ? 15.670  47.658 36.500 1.00 64.67 ? 1319 HOH A O   1 
HETATM 5166 O  O   . HOH N 9 .   ? 8.908   53.037 83.636 1.00 57.01 ? 1320 HOH A O   1 
HETATM 5167 O  O   . HOH N 9 .   ? -21.338 61.682 62.822 1.00 55.03 ? 1321 HOH A O   1 
HETATM 5168 O  O   . HOH N 9 .   ? 14.399  78.603 37.086 1.00 58.04 ? 1322 HOH A O   1 
HETATM 5169 O  O   . HOH N 9 .   ? 14.204  35.834 56.931 1.00 60.70 ? 1323 HOH A O   1 
HETATM 5170 O  O   . HOH N 9 .   ? 1.661   79.355 63.344 1.00 37.79 ? 1324 HOH A O   1 
HETATM 5171 O  O   . HOH N 9 .   ? 28.511  52.368 54.686 1.00 60.99 ? 1325 HOH A O   1 
HETATM 5172 O  O   . HOH N 9 .   ? -8.622  53.159 44.091 1.00 48.55 ? 1326 HOH A O   1 
HETATM 5173 O  O   . HOH N 9 .   ? -21.434 63.144 58.914 1.00 55.75 ? 1327 HOH A O   1 
HETATM 5174 O  O   . HOH N 9 .   ? 8.393   42.248 54.540 1.00 39.79 ? 1328 HOH A O   1 
HETATM 5175 O  O   . HOH N 9 .   ? 30.951  59.382 62.991 1.00 39.07 ? 1329 HOH A O   1 
HETATM 5176 O  O   . HOH N 9 .   ? 8.714   54.524 80.880 1.00 45.05 ? 1330 HOH A O   1 
HETATM 5177 O  O   . HOH N 9 .   ? 5.083   47.729 63.115 1.00 25.60 ? 1331 HOH A O   1 
HETATM 5178 O  O   . HOH N 9 .   ? -12.779 48.872 43.431 1.00 55.40 ? 1332 HOH A O   1 
HETATM 5179 O  O   . HOH N 9 .   ? -22.687 63.421 51.180 1.00 49.37 ? 1333 HOH A O   1 
HETATM 5180 O  O   . HOH N 9 .   ? 20.490  49.481 80.364 0.50 47.83 ? 1334 HOH A O   1 
HETATM 5181 O  O   . HOH N 9 .   ? -4.137  38.195 60.679 1.00 47.90 ? 1335 HOH A O   1 
HETATM 5182 O  O   . HOH N 9 .   ? 7.519   47.434 64.900 1.00 38.76 ? 1336 HOH A O   1 
HETATM 5183 O  O   . HOH N 9 .   ? 23.488  88.215 64.010 1.00 70.92 ? 1337 HOH A O   1 
HETATM 5184 O  O   . HOH N 9 .   ? -6.701  40.105 66.864 1.00 44.51 ? 1338 HOH A O   1 
HETATM 5185 O  O   . HOH N 9 .   ? 1.324   43.286 41.666 1.00 61.64 ? 1339 HOH A O   1 
HETATM 5186 O  O   . HOH N 9 .   ? 17.868  87.885 50.591 1.00 42.02 ? 1340 HOH A O   1 
HETATM 5187 O  O   . HOH N 9 .   ? 29.558  67.246 74.834 1.00 48.17 ? 1341 HOH A O   1 
HETATM 5188 O  O   . HOH N 9 .   ? -17.720 58.472 75.624 1.00 50.35 ? 1342 HOH A O   1 
HETATM 5189 O  O   . HOH N 9 .   ? 27.478  67.938 76.111 1.00 42.17 ? 1343 HOH A O   1 
HETATM 5190 O  O   . HOH N 9 .   ? -21.518 65.231 57.250 1.00 68.01 ? 1344 HOH A O   1 
HETATM 5191 O  O   . HOH N 9 .   ? 15.581  86.189 46.891 1.00 49.12 ? 1345 HOH A O   1 
HETATM 5192 O  O   . HOH N 9 .   ? -6.904  79.726 65.325 1.00 50.29 ? 1346 HOH A O   1 
HETATM 5193 O  O   . HOH N 9 .   ? -26.575 38.130 65.880 1.00 56.73 ? 1347 HOH A O   1 
HETATM 5194 O  O   . HOH N 9 .   ? -6.134  83.757 53.247 1.00 52.67 ? 1348 HOH A O   1 
HETATM 5195 O  O   . HOH N 9 .   ? 5.209   81.470 74.407 1.00 57.25 ? 1349 HOH A O   1 
HETATM 5196 O  O   . HOH N 9 .   ? -10.879 60.652 39.237 1.00 51.75 ? 1350 HOH A O   1 
HETATM 5197 O  O   . HOH N 9 .   ? 4.540   80.367 65.467 1.00 59.73 ? 1351 HOH A O   1 
HETATM 5198 O  O   . HOH N 9 .   ? 27.628  64.796 40.103 1.00 49.64 ? 1352 HOH A O   1 
HETATM 5199 O  O   . HOH N 9 .   ? 18.074  50.411 83.563 0.50 39.55 ? 1353 HOH A O   1 
HETATM 5200 O  O   . HOH N 9 .   ? 7.170   44.506 66.011 1.00 47.54 ? 1354 HOH A O   1 
HETATM 5201 O  O   . HOH N 9 .   ? 14.675  46.878 59.448 1.00 67.24 ? 1355 HOH A O   1 
HETATM 5202 O  O   . HOH N 9 .   ? -20.170 84.055 42.452 1.00 62.85 ? 1356 HOH A O   1 
HETATM 5203 O  O   . HOH N 9 .   ? -4.005  38.915 67.630 1.00 55.32 ? 1357 HOH A O   1 
HETATM 5204 O  O   . HOH N 9 .   ? -11.638 70.065 69.564 1.00 43.16 ? 1358 HOH A O   1 
HETATM 5205 O  O   . HOH N 9 .   ? -2.139  91.789 57.636 1.00 65.65 ? 1359 HOH A O   1 
HETATM 5206 O  O   . HOH N 9 .   ? -4.843  92.679 57.349 1.00 62.95 ? 1360 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 GD8 1   605  2539 GD8 GD8 A . 
E 5 TRS 1   606  2540 TRS TRS A . 
F 5 TRS 1   607  2541 TRS TRS A . 
G 6 PG4 1   608  2542 PG4 PG4 A . 
H 6 PG4 1   609  2543 PG4 PG4 A . 
I 6 PG4 1   610  2544 PG4 PG4 A . 
J 6 PG4 1   611  2545 PG4 PG4 A . 
K 6 PG4 1   612  2546 PG4 PG4 A . 
L 7 PEG 1   613  2547 PEG PEG A . 
M 8 CL  1   614  2548 CL  CL  A . 
N 9 HOH 1   701  1450 HOH HOH A . 
N 9 HOH 2   702  1597 HOH HOH A . 
N 9 HOH 3   703  1171 HOH HOH A . 
N 9 HOH 4   704  1434 HOH HOH A . 
N 9 HOH 5   705  1201 HOH HOH A . 
N 9 HOH 6   706  1337 HOH HOH A . 
N 9 HOH 7   707  1294 HOH HOH A . 
N 9 HOH 8   708  1073 HOH HOH A . 
N 9 HOH 9   709  1405 HOH HOH A . 
N 9 HOH 10  710  1601 HOH HOH A . 
N 9 HOH 11  711  1026 HOH HOH A . 
N 9 HOH 12  712  1541 HOH HOH A . 
N 9 HOH 13  713  1587 HOH HOH A . 
N 9 HOH 14  714  1574 HOH HOH A . 
N 9 HOH 15  715  1404 HOH HOH A . 
N 9 HOH 16  716  1063 HOH HOH A . 
N 9 HOH 17  717  1644 HOH HOH A . 
N 9 HOH 18  718  1486 HOH HOH A . 
N 9 HOH 19  719  1111 HOH HOH A . 
N 9 HOH 20  720  1443 HOH HOH A . 
N 9 HOH 21  721  1208 HOH HOH A . 
N 9 HOH 22  722  1550 HOH HOH A . 
N 9 HOH 23  723  1033 HOH HOH A . 
N 9 HOH 24  724  1605 HOH HOH A . 
N 9 HOH 25  725  1475 HOH HOH A . 
N 9 HOH 26  726  1194 HOH HOH A . 
N 9 HOH 27  727  1298 HOH HOH A . 
N 9 HOH 28  728  1626 HOH HOH A . 
N 9 HOH 29  729  1585 HOH HOH A . 
N 9 HOH 30  730  1071 HOH HOH A . 
N 9 HOH 31  731  1467 HOH HOH A . 
N 9 HOH 32  732  1386 HOH HOH A . 
N 9 HOH 33  733  1399 HOH HOH A . 
N 9 HOH 34  734  1223 HOH HOH A . 
N 9 HOH 35  735  1457 HOH HOH A . 
N 9 HOH 36  736  1315 HOH HOH A . 
N 9 HOH 37  737  1250 HOH HOH A . 
N 9 HOH 38  738  1383 HOH HOH A . 
N 9 HOH 39  739  1643 HOH HOH A . 
N 9 HOH 40  740  1088 HOH HOH A . 
N 9 HOH 41  741  1618 HOH HOH A . 
N 9 HOH 42  742  1173 HOH HOH A . 
N 9 HOH 43  743  1619 HOH HOH A . 
N 9 HOH 44  744  1367 HOH HOH A . 
N 9 HOH 45  745  1583 HOH HOH A . 
N 9 HOH 46  746  1037 HOH HOH A . 
N 9 HOH 47  747  1499 HOH HOH A . 
N 9 HOH 48  748  1059 HOH HOH A . 
N 9 HOH 49  749  1355 HOH HOH A . 
N 9 HOH 50  750  1578 HOH HOH A . 
N 9 HOH 51  751  1151 HOH HOH A . 
N 9 HOH 52  752  1422 HOH HOH A . 
N 9 HOH 53  753  1278 HOH HOH A . 
N 9 HOH 54  754  1485 HOH HOH A . 
N 9 HOH 55  755  1126 HOH HOH A . 
N 9 HOH 56  756  1330 HOH HOH A . 
N 9 HOH 57  757  1660 HOH HOH A . 
N 9 HOH 58  758  1297 HOH HOH A . 
N 9 HOH 59  759  1504 HOH HOH A . 
N 9 HOH 60  760  1398 HOH HOH A . 
N 9 HOH 61  761  1415 HOH HOH A . 
N 9 HOH 62  762  1596 HOH HOH A . 
N 9 HOH 63  763  1195 HOH HOH A . 
N 9 HOH 64  764  1413 HOH HOH A . 
N 9 HOH 65  765  1345 HOH HOH A . 
N 9 HOH 66  766  1571 HOH HOH A . 
N 9 HOH 67  767  1310 HOH HOH A . 
N 9 HOH 68  768  1412 HOH HOH A . 
N 9 HOH 69  769  1649 HOH HOH A . 
N 9 HOH 70  770  1002 HOH HOH A . 
N 9 HOH 71  771  1496 HOH HOH A . 
N 9 HOH 72  772  1113 HOH HOH A . 
N 9 HOH 73  773  1615 HOH HOH A . 
N 9 HOH 74  774  1481 HOH HOH A . 
N 9 HOH 75  775  1384 HOH HOH A . 
N 9 HOH 76  776  1633 HOH HOH A . 
N 9 HOH 77  777  1333 HOH HOH A . 
N 9 HOH 78  778  1378 HOH HOH A . 
N 9 HOH 79  779  1158 HOH HOH A . 
N 9 HOH 80  780  1495 HOH HOH A . 
N 9 HOH 81  781  1039 HOH HOH A . 
N 9 HOH 82  782  1570 HOH HOH A . 
N 9 HOH 83  783  1631 HOH HOH A . 
N 9 HOH 84  784  1438 HOH HOH A . 
N 9 HOH 85  785  1456 HOH HOH A . 
N 9 HOH 86  786  1409 HOH HOH A . 
N 9 HOH 87  787  1515 HOH HOH A . 
N 9 HOH 88  788  1562 HOH HOH A . 
N 9 HOH 89  789  1179 HOH HOH A . 
N 9 HOH 90  790  1332 HOH HOH A . 
N 9 HOH 91  791  1247 HOH HOH A . 
N 9 HOH 92  792  1551 HOH HOH A . 
N 9 HOH 93  793  1087 HOH HOH A . 
N 9 HOH 94  794  1114 HOH HOH A . 
N 9 HOH 95  795  1560 HOH HOH A . 
N 9 HOH 96  796  1044 HOH HOH A . 
N 9 HOH 97  797  1632 HOH HOH A . 
N 9 HOH 98  798  1530 HOH HOH A . 
N 9 HOH 99  799  1452 HOH HOH A . 
N 9 HOH 100 800  1108 HOH HOH A . 
N 9 HOH 101 801  1637 HOH HOH A . 
N 9 HOH 102 802  1525 HOH HOH A . 
N 9 HOH 103 803  1478 HOH HOH A . 
N 9 HOH 104 804  1180 HOH HOH A . 
N 9 HOH 105 805  1580 HOH HOH A . 
N 9 HOH 106 806  1100 HOH HOH A . 
N 9 HOH 107 807  1193 HOH HOH A . 
N 9 HOH 108 808  1501 HOH HOH A . 
N 9 HOH 109 809  1533 HOH HOH A . 
N 9 HOH 110 810  1110 HOH HOH A . 
N 9 HOH 111 811  1620 HOH HOH A . 
N 9 HOH 112 812  1646 HOH HOH A . 
N 9 HOH 113 813  1112 HOH HOH A . 
N 9 HOH 114 814  1359 HOH HOH A . 
N 9 HOH 115 815  1563 HOH HOH A . 
N 9 HOH 116 816  1519 HOH HOH A . 
N 9 HOH 117 817  1461 HOH HOH A . 
N 9 HOH 118 818  1349 HOH HOH A . 
N 9 HOH 119 819  1129 HOH HOH A . 
N 9 HOH 120 820  1511 HOH HOH A . 
N 9 HOH 121 821  1288 HOH HOH A . 
N 9 HOH 122 822  1176 HOH HOH A . 
N 9 HOH 123 823  1433 HOH HOH A . 
N 9 HOH 124 824  1300 HOH HOH A . 
N 9 HOH 125 825  1445 HOH HOH A . 
N 9 HOH 126 826  1435 HOH HOH A . 
N 9 HOH 127 827  1538 HOH HOH A . 
N 9 HOH 128 828  1494 HOH HOH A . 
N 9 HOH 129 829  1372 HOH HOH A . 
N 9 HOH 130 830  1611 HOH HOH A . 
N 9 HOH 131 831  1050 HOH HOH A . 
N 9 HOH 132 832  1395 HOH HOH A . 
N 9 HOH 133 833  1657 HOH HOH A . 
N 9 HOH 134 834  1060 HOH HOH A . 
N 9 HOH 135 835  1659 HOH HOH A . 
N 9 HOH 136 836  1243 HOH HOH A . 
N 9 HOH 137 837  1453 HOH HOH A . 
N 9 HOH 138 838  1205 HOH HOH A . 
N 9 HOH 139 839  1497 HOH HOH A . 
N 9 HOH 140 840  1160 HOH HOH A . 
N 9 HOH 141 841  1317 HOH HOH A . 
N 9 HOH 142 842  1346 HOH HOH A . 
N 9 HOH 143 843  1505 HOH HOH A . 
N 9 HOH 144 844  1502 HOH HOH A . 
N 9 HOH 145 845  1454 HOH HOH A . 
N 9 HOH 146 846  1512 HOH HOH A . 
N 9 HOH 147 847  1069 HOH HOH A . 
N 9 HOH 148 848  1233 HOH HOH A . 
N 9 HOH 149 849  1363 HOH HOH A . 
N 9 HOH 150 850  1545 HOH HOH A . 
N 9 HOH 151 851  1557 HOH HOH A . 
N 9 HOH 152 852  1320 HOH HOH A . 
N 9 HOH 153 853  1306 HOH HOH A . 
N 9 HOH 154 854  1588 HOH HOH A . 
N 9 HOH 155 855  1581 HOH HOH A . 
N 9 HOH 156 856  1106 HOH HOH A . 
N 9 HOH 157 857  1651 HOH HOH A . 
N 9 HOH 158 858  1188 HOH HOH A . 
N 9 HOH 159 859  1083 HOH HOH A . 
N 9 HOH 160 860  1162 HOH HOH A . 
N 9 HOH 161 861  1274 HOH HOH A . 
N 9 HOH 162 862  1622 HOH HOH A . 
N 9 HOH 163 863  1062 HOH HOH A . 
N 9 HOH 164 864  1282 HOH HOH A . 
N 9 HOH 165 865  1390 HOH HOH A . 
N 9 HOH 166 866  1426 HOH HOH A . 
N 9 HOH 167 867  1635 HOH HOH A . 
N 9 HOH 168 868  1284 HOH HOH A . 
N 9 HOH 169 869  1483 HOH HOH A . 
N 9 HOH 170 870  1623 HOH HOH A . 
N 9 HOH 171 871  1042 HOH HOH A . 
N 9 HOH 172 872  1602 HOH HOH A . 
N 9 HOH 173 873  1374 HOH HOH A . 
N 9 HOH 174 874  1371 HOH HOH A . 
N 9 HOH 175 875  1020 HOH HOH A . 
N 9 HOH 176 876  1406 HOH HOH A . 
N 9 HOH 177 877  1351 HOH HOH A . 
N 9 HOH 178 878  1293 HOH HOH A . 
N 9 HOH 179 879  1365 HOH HOH A . 
N 9 HOH 180 880  1190 HOH HOH A . 
N 9 HOH 181 881  1507 HOH HOH A . 
N 9 HOH 182 882  1107 HOH HOH A . 
N 9 HOH 183 883  1640 HOH HOH A . 
N 9 HOH 184 884  1536 HOH HOH A . 
N 9 HOH 185 885  1394 HOH HOH A . 
N 9 HOH 186 886  1392 HOH HOH A . 
N 9 HOH 187 887  1428 HOH HOH A . 
N 9 HOH 188 888  1202 HOH HOH A . 
N 9 HOH 189 889  1490 HOH HOH A . 
N 9 HOH 190 890  1573 HOH HOH A . 
N 9 HOH 191 891  1593 HOH HOH A . 
N 9 HOH 192 892  1366 HOH HOH A . 
N 9 HOH 193 893  1396 HOH HOH A . 
N 9 HOH 194 894  1576 HOH HOH A . 
N 9 HOH 195 895  1522 HOH HOH A . 
N 9 HOH 196 896  1183 HOH HOH A . 
N 9 HOH 197 897  1487 HOH HOH A . 
N 9 HOH 198 898  1590 HOH HOH A . 
N 9 HOH 199 899  1636 HOH HOH A . 
N 9 HOH 200 900  1471 HOH HOH A . 
N 9 HOH 201 901  1155 HOH HOH A . 
N 9 HOH 202 902  1598 HOH HOH A . 
N 9 HOH 203 903  1159 HOH HOH A . 
N 9 HOH 204 904  1265 HOH HOH A . 
N 9 HOH 205 905  1498 HOH HOH A . 
N 9 HOH 206 906  1206 HOH HOH A . 
N 9 HOH 207 907  1446 HOH HOH A . 
N 9 HOH 208 908  1065 HOH HOH A . 
N 9 HOH 209 909  1239 HOH HOH A . 
N 9 HOH 210 910  1324 HOH HOH A . 
N 9 HOH 211 911  1187 HOH HOH A . 
N 9 HOH 212 912  1246 HOH HOH A . 
N 9 HOH 213 913  1141 HOH HOH A . 
N 9 HOH 214 914  1103 HOH HOH A . 
N 9 HOH 215 915  1534 HOH HOH A . 
N 9 HOH 216 916  1011 HOH HOH A . 
N 9 HOH 217 917  1647 HOH HOH A . 
N 9 HOH 218 918  1500 HOH HOH A . 
N 9 HOH 219 919  1105 HOH HOH A . 
N 9 HOH 220 920  1117 HOH HOH A . 
N 9 HOH 221 921  1312 HOH HOH A . 
N 9 HOH 222 922  1076 HOH HOH A . 
N 9 HOH 223 923  1027 HOH HOH A . 
N 9 HOH 224 924  1388 HOH HOH A . 
N 9 HOH 225 925  1057 HOH HOH A . 
N 9 HOH 226 926  1275 HOH HOH A . 
N 9 HOH 227 927  1217 HOH HOH A . 
N 9 HOH 228 928  1436 HOH HOH A . 
N 9 HOH 229 929  1118 HOH HOH A . 
N 9 HOH 230 930  1119 HOH HOH A . 
N 9 HOH 231 931  1464 HOH HOH A . 
N 9 HOH 232 932  1072 HOH HOH A . 
N 9 HOH 233 933  1121 HOH HOH A . 
N 9 HOH 234 934  1480 HOH HOH A . 
N 9 HOH 235 935  1189 HOH HOH A . 
N 9 HOH 236 936  1005 HOH HOH A . 
N 9 HOH 237 937  1236 HOH HOH A . 
N 9 HOH 238 938  1093 HOH HOH A . 
N 9 HOH 239 939  1389 HOH HOH A . 
N 9 HOH 240 940  1344 HOH HOH A . 
N 9 HOH 241 941  1427 HOH HOH A . 
N 9 HOH 242 942  1229 HOH HOH A . 
N 9 HOH 243 943  1572 HOH HOH A . 
N 9 HOH 244 944  1577 HOH HOH A . 
N 9 HOH 245 945  1518 HOH HOH A . 
N 9 HOH 246 946  1561 HOH HOH A . 
N 9 HOH 247 947  1566 HOH HOH A . 
N 9 HOH 248 948  1092 HOH HOH A . 
N 9 HOH 249 949  1003 HOH HOH A . 
N 9 HOH 250 950  1252 HOH HOH A . 
N 9 HOH 251 951  1634 HOH HOH A . 
N 9 HOH 252 952  1244 HOH HOH A . 
N 9 HOH 253 953  1035 HOH HOH A . 
N 9 HOH 254 954  1476 HOH HOH A . 
N 9 HOH 255 955  1431 HOH HOH A . 
N 9 HOH 256 956  1542 HOH HOH A . 
N 9 HOH 257 957  1007 HOH HOH A . 
N 9 HOH 258 958  1185 HOH HOH A . 
N 9 HOH 259 959  1375 HOH HOH A . 
N 9 HOH 260 960  1442 HOH HOH A . 
N 9 HOH 261 961  1054 HOH HOH A . 
N 9 HOH 262 962  1307 HOH HOH A . 
N 9 HOH 263 963  1029 HOH HOH A . 
N 9 HOH 264 964  1575 HOH HOH A . 
N 9 HOH 265 965  1289 HOH HOH A . 
N 9 HOH 266 966  1379 HOH HOH A . 
N 9 HOH 267 967  1056 HOH HOH A . 
N 9 HOH 268 968  1219 HOH HOH A . 
N 9 HOH 269 969  1089 HOH HOH A . 
N 9 HOH 270 970  1607 HOH HOH A . 
N 9 HOH 271 971  1122 HOH HOH A . 
N 9 HOH 272 972  1032 HOH HOH A . 
N 9 HOH 273 973  1546 HOH HOH A . 
N 9 HOH 274 974  1212 HOH HOH A . 
N 9 HOH 275 975  1589 HOH HOH A . 
N 9 HOH 276 976  1565 HOH HOH A . 
N 9 HOH 277 977  1397 HOH HOH A . 
N 9 HOH 278 978  1462 HOH HOH A . 
N 9 HOH 279 979  1280 HOH HOH A . 
N 9 HOH 280 980  1031 HOH HOH A . 
N 9 HOH 281 981  1458 HOH HOH A . 
N 9 HOH 282 982  1182 HOH HOH A . 
N 9 HOH 283 983  1529 HOH HOH A . 
N 9 HOH 284 984  1098 HOH HOH A . 
N 9 HOH 285 985  1472 HOH HOH A . 
N 9 HOH 286 986  1439 HOH HOH A . 
N 9 HOH 287 987  1489 HOH HOH A . 
N 9 HOH 288 988  1535 HOH HOH A . 
N 9 HOH 289 989  1537 HOH HOH A . 
N 9 HOH 290 990  1373 HOH HOH A . 
N 9 HOH 291 991  1326 HOH HOH A . 
N 9 HOH 292 992  1517 HOH HOH A . 
N 9 HOH 293 993  1277 HOH HOH A . 
N 9 HOH 294 994  1539 HOH HOH A . 
N 9 HOH 295 995  1608 HOH HOH A . 
N 9 HOH 296 996  1527 HOH HOH A . 
N 9 HOH 297 997  1547 HOH HOH A . 
N 9 HOH 298 998  1319 HOH HOH A . 
N 9 HOH 299 999  1221 HOH HOH A . 
N 9 HOH 300 1000 1604 HOH HOH A . 
N 9 HOH 301 1001 1424 HOH HOH A . 
N 9 HOH 302 1002 1318 HOH HOH A . 
N 9 HOH 303 1003 1629 HOH HOH A . 
N 9 HOH 304 1004 1492 HOH HOH A . 
N 9 HOH 305 1005 1638 HOH HOH A . 
N 9 HOH 306 1006 1391 HOH HOH A . 
N 9 HOH 307 1007 1444 HOH HOH A . 
N 9 HOH 308 1008 1209 HOH HOH A . 
N 9 HOH 309 1009 1350 HOH HOH A . 
N 9 HOH 310 1010 1156 HOH HOH A . 
N 9 HOH 311 1011 1513 HOH HOH A . 
N 9 HOH 312 1012 1017 HOH HOH A . 
N 9 HOH 313 1013 1133 HOH HOH A . 
N 9 HOH 314 1014 1552 HOH HOH A . 
N 9 HOH 315 1015 1360 HOH HOH A . 
N 9 HOH 316 1016 1170 HOH HOH A . 
N 9 HOH 317 1017 1624 HOH HOH A . 
N 9 HOH 318 1018 1421 HOH HOH A . 
N 9 HOH 319 1019 1569 HOH HOH A . 
N 9 HOH 320 1020 1441 HOH HOH A . 
N 9 HOH 321 1021 1420 HOH HOH A . 
N 9 HOH 322 1022 1407 HOH HOH A . 
N 9 HOH 323 1023 1465 HOH HOH A . 
N 9 HOH 324 1024 1493 HOH HOH A . 
N 9 HOH 325 1025 1524 HOH HOH A . 
N 9 HOH 326 1026 1528 HOH HOH A . 
N 9 HOH 327 1027 1491 HOH HOH A . 
N 9 HOH 328 1028 1096 HOH HOH A . 
N 9 HOH 329 1029 1579 HOH HOH A . 
N 9 HOH 330 1030 1150 HOH HOH A . 
N 9 HOH 331 1031 1656 HOH HOH A . 
N 9 HOH 332 1032 1299 HOH HOH A . 
N 9 HOH 333 1033 1257 HOH HOH A . 
N 9 HOH 334 1034 1559 HOH HOH A . 
N 9 HOH 335 1035 1077 HOH HOH A . 
N 9 HOH 336 1036 1482 HOH HOH A . 
N 9 HOH 337 1037 1066 HOH HOH A . 
N 9 HOH 338 1038 1304 HOH HOH A . 
N 9 HOH 339 1039 1466 HOH HOH A . 
N 9 HOH 340 1040 1338 HOH HOH A . 
N 9 HOH 341 1041 1508 HOH HOH A . 
N 9 HOH 342 1042 1094 HOH HOH A . 
N 9 HOH 343 1043 1520 HOH HOH A . 
N 9 HOH 344 1044 1440 HOH HOH A . 
N 9 HOH 345 1045 1514 HOH HOH A . 
N 9 HOH 346 1046 1061 HOH HOH A . 
N 9 HOH 347 1047 1226 HOH HOH A . 
N 9 HOH 348 1048 1214 HOH HOH A . 
N 9 HOH 349 1049 1340 HOH HOH A . 
N 9 HOH 350 1050 1174 HOH HOH A . 
N 9 HOH 351 1051 1327 HOH HOH A . 
N 9 HOH 352 1052 1645 HOH HOH A . 
N 9 HOH 353 1053 1115 HOH HOH A . 
N 9 HOH 354 1054 1401 HOH HOH A . 
N 9 HOH 355 1055 1617 HOH HOH A . 
N 9 HOH 356 1056 1503 HOH HOH A . 
N 9 HOH 357 1057 1400 HOH HOH A . 
N 9 HOH 358 1058 1411 HOH HOH A . 
N 9 HOH 359 1059 1102 HOH HOH A . 
N 9 HOH 360 1060 1484 HOH HOH A . 
N 9 HOH 361 1061 1153 HOH HOH A . 
N 9 HOH 362 1062 1045 HOH HOH A . 
N 9 HOH 363 1063 1369 HOH HOH A . 
N 9 HOH 364 1064 1410 HOH HOH A . 
N 9 HOH 365 1065 1276 HOH HOH A . 
N 9 HOH 366 1066 1586 HOH HOH A . 
N 9 HOH 367 1067 1600 HOH HOH A . 
N 9 HOH 368 1068 1648 HOH HOH A . 
N 9 HOH 369 1069 1612 HOH HOH A . 
N 9 HOH 370 1070 1393 HOH HOH A . 
N 9 HOH 371 1071 1331 HOH HOH A . 
N 9 HOH 372 1072 1248 HOH HOH A . 
N 9 HOH 373 1073 1377 HOH HOH A . 
N 9 HOH 374 1074 1015 HOH HOH A . 
N 9 HOH 375 1075 1145 HOH HOH A . 
N 9 HOH 376 1076 1451 HOH HOH A . 
N 9 HOH 377 1077 1613 HOH HOH A . 
N 9 HOH 378 1078 1429 HOH HOH A . 
N 9 HOH 379 1079 1385 HOH HOH A . 
N 9 HOH 380 1080 1321 HOH HOH A . 
N 9 HOH 381 1081 1308 HOH HOH A . 
N 9 HOH 382 1082 1639 HOH HOH A . 
N 9 HOH 383 1083 1172 HOH HOH A . 
N 9 HOH 384 1084 1099 HOH HOH A . 
N 9 HOH 385 1085 1642 HOH HOH A . 
N 9 HOH 386 1086 1322 HOH HOH A . 
N 9 HOH 387 1087 1568 HOH HOH A . 
N 9 HOH 388 1088 1305 HOH HOH A . 
N 9 HOH 389 1089 1402 HOH HOH A . 
N 9 HOH 390 1090 1376 HOH HOH A . 
N 9 HOH 391 1091 1200 HOH HOH A . 
N 9 HOH 392 1092 1382 HOH HOH A . 
N 9 HOH 393 1093 1271 HOH HOH A . 
N 9 HOH 394 1094 1241 HOH HOH A . 
N 9 HOH 395 1095 1630 HOH HOH A . 
N 9 HOH 396 1096 1606 HOH HOH A . 
N 9 HOH 397 1097 1259 HOH HOH A . 
N 9 HOH 398 1098 1067 HOH HOH A . 
N 9 HOH 399 1099 1043 HOH HOH A . 
N 9 HOH 400 1100 1650 HOH HOH A . 
N 9 HOH 401 1101 1532 HOH HOH A . 
N 9 HOH 402 1102 1109 HOH HOH A . 
N 9 HOH 403 1103 1479 HOH HOH A . 
N 9 HOH 404 1104 1134 HOH HOH A . 
N 9 HOH 405 1105 1347 HOH HOH A . 
N 9 HOH 406 1106 1242 HOH HOH A . 
N 9 HOH 407 1107 1470 HOH HOH A . 
N 9 HOH 408 1108 1419 HOH HOH A . 
N 9 HOH 409 1109 1380 HOH HOH A . 
N 9 HOH 410 1110 1078 HOH HOH A . 
N 9 HOH 411 1111 1273 HOH HOH A . 
N 9 HOH 412 1112 1147 HOH HOH A . 
N 9 HOH 413 1113 1352 HOH HOH A . 
N 9 HOH 414 1114 1329 HOH HOH A . 
N 9 HOH 415 1115 1157 HOH HOH A . 
N 9 HOH 416 1116 1408 HOH HOH A . 
N 9 HOH 417 1117 1526 HOH HOH A . 
N 9 HOH 418 1118 1090 HOH HOH A . 
N 9 HOH 419 1119 1364 HOH HOH A . 
N 9 HOH 420 1120 1595 HOH HOH A . 
N 9 HOH 421 1121 1101 HOH HOH A . 
N 9 HOH 422 1122 1368 HOH HOH A . 
N 9 HOH 423 1123 1509 HOH HOH A . 
N 9 HOH 424 1124 1358 HOH HOH A . 
N 9 HOH 425 1125 1414 HOH HOH A . 
N 9 HOH 426 1126 1430 HOH HOH A . 
N 9 HOH 427 1127 1531 HOH HOH A . 
N 9 HOH 428 1128 1447 HOH HOH A . 
N 9 HOH 429 1129 1303 HOH HOH A . 
N 9 HOH 430 1130 1028 HOH HOH A . 
N 9 HOH 431 1131 1652 HOH HOH A . 
N 9 HOH 432 1132 1654 HOH HOH A . 
N 9 HOH 433 1133 1449 HOH HOH A . 
N 9 HOH 434 1134 1523 HOH HOH A . 
N 9 HOH 435 1135 1227 HOH HOH A . 
N 9 HOH 436 1136 1169 HOH HOH A . 
N 9 HOH 437 1137 1021 HOH HOH A . 
N 9 HOH 438 1138 1582 HOH HOH A . 
N 9 HOH 439 1139 1334 HOH HOH A . 
N 9 HOH 440 1140 1196 HOH HOH A . 
N 9 HOH 441 1141 1658 HOH HOH A . 
N 9 HOH 442 1142 1616 HOH HOH A . 
N 9 HOH 443 1143 1323 HOH HOH A . 
N 9 HOH 444 1144 1416 HOH HOH A . 
N 9 HOH 445 1145 1425 HOH HOH A . 
N 9 HOH 446 1146 1418 HOH HOH A . 
N 9 HOH 447 1147 1610 HOH HOH A . 
N 9 HOH 448 1148 1296 HOH HOH A . 
N 9 HOH 449 1149 1423 HOH HOH A . 
N 9 HOH 450 1150 1621 HOH HOH A . 
N 9 HOH 451 1151 1314 HOH HOH A . 
N 9 HOH 452 1152 1468 HOH HOH A . 
N 9 HOH 453 1153 1614 HOH HOH A . 
N 9 HOH 454 1154 1381 HOH HOH A . 
N 9 HOH 455 1155 1437 HOH HOH A . 
N 9 HOH 456 1156 1362 HOH HOH A . 
N 9 HOH 457 1157 1302 HOH HOH A . 
N 9 HOH 458 1158 1316 HOH HOH A . 
N 9 HOH 459 1159 1460 HOH HOH A . 
N 9 HOH 460 1160 1025 HOH HOH A . 
N 9 HOH 461 1161 1474 HOH HOH A . 
N 9 HOH 462 1162 1104 HOH HOH A . 
N 9 HOH 463 1163 1455 HOH HOH A . 
N 9 HOH 464 1164 1079 HOH HOH A . 
N 9 HOH 465 1165 1260 HOH HOH A . 
N 9 HOH 466 1166 1627 HOH HOH A . 
N 9 HOH 467 1167 1567 HOH HOH A . 
N 9 HOH 468 1168 1336 HOH HOH A . 
N 9 HOH 469 1169 1356 HOH HOH A . 
N 9 HOH 470 1170 1127 HOH HOH A . 
N 9 HOH 471 1171 1154 HOH HOH A . 
N 9 HOH 472 1172 1263 HOH HOH A . 
N 9 HOH 473 1173 1144 HOH HOH A . 
N 9 HOH 474 1174 1603 HOH HOH A . 
N 9 HOH 475 1175 1086 HOH HOH A . 
N 9 HOH 476 1176 1357 HOH HOH A . 
N 9 HOH 477 1177 1488 HOH HOH A . 
N 9 HOH 478 1178 1014 HOH HOH A . 
N 9 HOH 479 1179 1152 HOH HOH A . 
N 9 HOH 480 1180 1295 HOH HOH A . 
N 9 HOH 481 1181 1348 HOH HOH A . 
N 9 HOH 482 1182 1343 HOH HOH A . 
N 9 HOH 483 1183 1354 HOH HOH A . 
N 9 HOH 484 1184 1301 HOH HOH A . 
N 9 HOH 485 1185 1510 HOH HOH A . 
N 9 HOH 486 1186 1213 HOH HOH A . 
N 9 HOH 487 1187 1473 HOH HOH A . 
N 9 HOH 488 1188 1477 HOH HOH A . 
N 9 HOH 489 1189 1128 HOH HOH A . 
N 9 HOH 490 1190 1417 HOH HOH A . 
N 9 HOH 491 1191 1553 HOH HOH A . 
N 9 HOH 492 1192 1216 HOH HOH A . 
N 9 HOH 493 1193 1599 HOH HOH A . 
N 9 HOH 494 1194 1403 HOH HOH A . 
N 9 HOH 495 1195 1023 HOH HOH A . 
N 9 HOH 496 1196 1335 HOH HOH A . 
N 9 HOH 497 1197 1543 HOH HOH A . 
N 9 HOH 498 1198 1328 HOH HOH A . 
N 9 HOH 499 1199 1592 HOH HOH A . 
N 9 HOH 500 1200 1001 HOH HOH A . 
N 9 HOH 501 1201 1018 HOH HOH A . 
N 9 HOH 502 1202 1287 HOH HOH A . 
N 9 HOH 503 1203 1463 HOH HOH A . 
N 9 HOH 504 1204 1432 HOH HOH A . 
N 9 HOH 505 1205 1544 HOH HOH A . 
N 9 HOH 506 1206 1653 HOH HOH A . 
N 9 HOH 507 1207 1120 HOH HOH A . 
N 9 HOH 508 1208 1370 HOH HOH A . 
N 9 HOH 509 1209 1164 HOH HOH A . 
N 9 HOH 510 1210 1353 HOH HOH A . 
N 9 HOH 511 1211 1594 HOH HOH A . 
N 9 HOH 512 1212 1146 HOH HOH A . 
N 9 HOH 513 1213 1625 HOH HOH A . 
N 9 HOH 514 1214 1506 HOH HOH A . 
N 9 HOH 515 1215 1641 HOH HOH A . 
N 9 HOH 516 1216 1068 HOH HOH A . 
N 9 HOH 517 1217 1387 HOH HOH A . 
N 9 HOH 518 1218 1285 HOH HOH A . 
N 9 HOH 519 1219 1070 HOH HOH A . 
N 9 HOH 520 1220 1325 HOH HOH A . 
N 9 HOH 521 1221 1161 HOH HOH A . 
N 9 HOH 522 1222 1313 HOH HOH A . 
N 9 HOH 523 1223 1540 HOH HOH A . 
N 9 HOH 524 1224 1584 HOH HOH A . 
N 9 HOH 525 1225 1207 HOH HOH A . 
N 9 HOH 526 1226 1558 HOH HOH A . 
N 9 HOH 527 1227 1591 HOH HOH A . 
N 9 HOH 528 1228 1564 HOH HOH A . 
N 9 HOH 529 1229 1556 HOH HOH A . 
N 9 HOH 530 1230 1222 HOH HOH A . 
N 9 HOH 531 1231 1311 HOH HOH A . 
N 9 HOH 532 1232 1309 HOH HOH A . 
N 9 HOH 533 1233 1548 HOH HOH A . 
N 9 HOH 534 1234 1220 HOH HOH A . 
N 9 HOH 535 1235 1555 HOH HOH A . 
N 9 HOH 536 1236 1549 HOH HOH A . 
N 9 HOH 537 1237 1290 HOH HOH A . 
N 9 HOH 538 1238 1341 HOH HOH A . 
N 9 HOH 539 1239 1448 HOH HOH A . 
N 9 HOH 540 1240 1459 HOH HOH A . 
N 9 HOH 541 1241 1655 HOH HOH A . 
N 9 HOH 542 1242 1554 HOH HOH A . 
N 9 HOH 543 1243 1628 HOH HOH A . 
N 9 HOH 544 1244 1469 HOH HOH A . 
N 9 HOH 545 1245 1609 HOH HOH A . 
N 9 HOH 546 1246 1010 HOH HOH A . 
N 9 HOH 547 1247 1342 HOH HOH A . 
N 9 HOH 548 1248 1264 HOH HOH A . 
N 9 HOH 549 1249 1286 HOH HOH A . 
N 9 HOH 550 1250 1521 HOH HOH A . 
N 9 HOH 551 1251 1516 HOH HOH A . 
N 9 HOH 552 1252 1038 HOH HOH A . 
N 9 HOH 553 1253 1097 HOH HOH A . 
N 9 HOH 554 1254 1135 HOH HOH A . 
N 9 HOH 555 1255 1030 HOH HOH A . 
N 9 HOH 556 1256 1211 HOH HOH A . 
N 9 HOH 557 1257 1283 HOH HOH A . 
N 9 HOH 558 1258 1116 HOH HOH A . 
N 9 HOH 559 1259 1292 HOH HOH A . 
N 9 HOH 560 1260 1339 HOH HOH A . 
N 9 HOH 561 1261 1012 HOH HOH A . 
N 9 HOH 562 1262 1237 HOH HOH A . 
N 9 HOH 563 1263 1261 HOH HOH A . 
N 9 HOH 564 1264 1140 HOH HOH A . 
N 9 HOH 565 1265 1224 HOH HOH A . 
N 9 HOH 566 1266 1191 HOH HOH A . 
N 9 HOH 567 1267 1215 HOH HOH A . 
N 9 HOH 568 1268 1136 HOH HOH A . 
N 9 HOH 569 1269 1009 HOH HOH A . 
N 9 HOH 570 1270 1034 HOH HOH A . 
N 9 HOH 571 1271 1004 HOH HOH A . 
N 9 HOH 572 1272 1240 HOH HOH A . 
N 9 HOH 573 1273 1230 HOH HOH A . 
N 9 HOH 574 1274 1251 HOH HOH A . 
N 9 HOH 575 1275 1225 HOH HOH A . 
N 9 HOH 576 1276 1124 HOH HOH A . 
N 9 HOH 577 1277 1228 HOH HOH A . 
N 9 HOH 578 1278 1123 HOH HOH A . 
N 9 HOH 579 1279 1075 HOH HOH A . 
N 9 HOH 580 1280 1279 HOH HOH A . 
N 9 HOH 581 1281 1361 HOH HOH A . 
N 9 HOH 582 1282 1262 HOH HOH A . 
N 9 HOH 583 1283 1131 HOH HOH A . 
N 9 HOH 584 1284 1232 HOH HOH A . 
N 9 HOH 585 1285 1080 HOH HOH A . 
N 9 HOH 586 1286 1272 HOH HOH A . 
N 9 HOH 587 1287 1234 HOH HOH A . 
N 9 HOH 588 1288 1253 HOH HOH A . 
N 9 HOH 589 1289 1138 HOH HOH A . 
N 9 HOH 590 1290 1235 HOH HOH A . 
N 9 HOH 591 1291 1268 HOH HOH A . 
N 9 HOH 592 1292 1008 HOH HOH A . 
N 9 HOH 593 1293 1139 HOH HOH A . 
N 9 HOH 594 1294 1091 HOH HOH A . 
N 9 HOH 595 1295 1143 HOH HOH A . 
N 9 HOH 596 1296 1048 HOH HOH A . 
N 9 HOH 597 1297 1238 HOH HOH A . 
N 9 HOH 598 1298 1184 HOH HOH A . 
N 9 HOH 599 1299 1186 HOH HOH A . 
N 9 HOH 600 1300 1178 HOH HOH A . 
N 9 HOH 601 1301 1084 HOH HOH A . 
N 9 HOH 602 1302 1231 HOH HOH A . 
N 9 HOH 603 1303 1051 HOH HOH A . 
N 9 HOH 604 1304 1006 HOH HOH A . 
N 9 HOH 605 1305 1203 HOH HOH A . 
N 9 HOH 606 1306 1192 HOH HOH A . 
N 9 HOH 607 1307 1130 HOH HOH A . 
N 9 HOH 608 1308 1081 HOH HOH A . 
N 9 HOH 609 1309 1163 HOH HOH A . 
N 9 HOH 610 1310 1058 HOH HOH A . 
N 9 HOH 611 1311 1085 HOH HOH A . 
N 9 HOH 612 1312 1269 HOH HOH A . 
N 9 HOH 613 1313 1132 HOH HOH A . 
N 9 HOH 614 1314 1267 HOH HOH A . 
N 9 HOH 615 1315 1177 HOH HOH A . 
N 9 HOH 616 1316 1165 HOH HOH A . 
N 9 HOH 617 1317 1149 HOH HOH A . 
N 9 HOH 618 1318 1046 HOH HOH A . 
N 9 HOH 619 1319 1181 HOH HOH A . 
N 9 HOH 620 1320 1024 HOH HOH A . 
N 9 HOH 621 1321 1052 HOH HOH A . 
N 9 HOH 622 1322 1258 HOH HOH A . 
N 9 HOH 623 1323 1291 HOH HOH A . 
N 9 HOH 624 1324 1040 HOH HOH A . 
N 9 HOH 625 1325 1270 HOH HOH A . 
N 9 HOH 626 1326 1022 HOH HOH A . 
N 9 HOH 627 1327 1053 HOH HOH A . 
N 9 HOH 628 1328 1064 HOH HOH A . 
N 9 HOH 629 1329 1281 HOH HOH A . 
N 9 HOH 630 1330 1167 HOH HOH A . 
N 9 HOH 631 1331 1125 HOH HOH A . 
N 9 HOH 632 1332 1197 HOH HOH A . 
N 9 HOH 633 1333 1019 HOH HOH A . 
N 9 HOH 634 1334 1210 HOH HOH A . 
N 9 HOH 635 1335 1137 HOH HOH A . 
N 9 HOH 636 1336 1168 HOH HOH A . 
N 9 HOH 637 1337 1254 HOH HOH A . 
N 9 HOH 638 1338 1142 HOH HOH A . 
N 9 HOH 639 1339 1175 HOH HOH A . 
N 9 HOH 640 1340 1255 HOH HOH A . 
N 9 HOH 641 1341 1082 HOH HOH A . 
N 9 HOH 642 1342 1166 HOH HOH A . 
N 9 HOH 643 1343 1218 HOH HOH A . 
N 9 HOH 644 1344 1055 HOH HOH A . 
N 9 HOH 645 1345 1256 HOH HOH A . 
N 9 HOH 646 1346 1047 HOH HOH A . 
N 9 HOH 647 1347 1148 HOH HOH A . 
N 9 HOH 648 1348 1074 HOH HOH A . 
N 9 HOH 649 1349 1036 HOH HOH A . 
N 9 HOH 650 1350 1199 HOH HOH A . 
N 9 HOH 651 1351 1245 HOH HOH A . 
N 9 HOH 652 1352 1266 HOH HOH A . 
N 9 HOH 653 1353 1198 HOH HOH A . 
N 9 HOH 654 1354 1204 HOH HOH A . 
N 9 HOH 655 1355 1041 HOH HOH A . 
N 9 HOH 656 1356 1013 HOH HOH A . 
N 9 HOH 657 1357 1049 HOH HOH A . 
N 9 HOH 658 1358 1016 HOH HOH A . 
N 9 HOH 659 1359 1249 HOH HOH A . 
N 9 HOH 660 1360 1095 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N 
1 2 A,D,E,F,G,H,I,J,K,L,M,N     
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.3800000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-08-11 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-04-03 
5 'Structure model' 2 0 2020-07-29 
6 'Structure model' 2 1 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Experimental preparation'  
5  4 'Structure model' Other                       
6  5 'Structure model' 'Atomic model'              
7  5 'Structure model' 'Data collection'           
8  5 'Structure model' 'Derived calculations'      
9  5 'Structure model' Other                       
10 5 'Structure model' 'Structure summary'         
11 6 'Structure model' 'Derived calculations'      
12 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' exptl_crystal_grow            
2  4 'Structure model' pdbx_database_proc            
3  4 'Structure model' pdbx_database_status          
4  5 'Structure model' atom_site                     
5  5 'Structure model' chem_comp                     
6  5 'Structure model' entity                        
7  5 'Structure model' pdbx_branch_scheme            
8  5 'Structure model' pdbx_chem_comp_identifier     
9  5 'Structure model' pdbx_database_status          
10 5 'Structure model' pdbx_entity_branch            
11 5 'Structure model' pdbx_entity_branch_descriptor 
12 5 'Structure model' pdbx_entity_branch_link       
13 5 'Structure model' pdbx_entity_branch_list       
14 5 'Structure model' pdbx_entity_nonpoly           
15 5 'Structure model' pdbx_nonpoly_scheme           
16 5 'Structure model' pdbx_struct_assembly_gen      
17 5 'Structure model' struct_asym                   
18 5 'Structure model' struct_conn                   
19 5 'Structure model' struct_site                   
20 5 'Structure model' struct_site_gen               
21 6 'Structure model' chem_comp                     
22 6 'Structure model' pdbx_struct_assembly          
23 6 'Structure model' pdbx_struct_assembly_gen      
24 6 'Structure model' pdbx_struct_oper_list         
25 6 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_exptl_crystal_grow.temp'                    
2  4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3  5 'Structure model' '_atom_site.B_iso_or_equiv'                   
4  5 'Structure model' '_atom_site.Cartn_x'                          
5  5 'Structure model' '_atom_site.Cartn_y'                          
6  5 'Structure model' '_atom_site.Cartn_z'                          
7  5 'Structure model' '_atom_site.auth_asym_id'                     
8  5 'Structure model' '_atom_site.auth_seq_id'                      
9  5 'Structure model' '_atom_site.label_asym_id'                    
10 5 'Structure model' '_atom_site.label_entity_id'                  
11 5 'Structure model' '_chem_comp.name'                             
12 5 'Structure model' '_chem_comp.type'                             
13 5 'Structure model' '_entity.formula_weight'                      
14 5 'Structure model' '_entity.pdbx_description'                    
15 5 'Structure model' '_entity.pdbx_number_of_molecules'            
16 5 'Structure model' '_entity.type'                                
17 5 'Structure model' '_pdbx_database_status.status_code_sf'        
18 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
19 5 'Structure model' '_struct_conn.pdbx_role'                      
20 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
21 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
22 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
23 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
24 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
25 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
26 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
27 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
28 6 'Structure model' '_chem_comp.pdbx_synonyms'                    
29 6 'Structure model' '_pdbx_struct_assembly.details'               
30 6 'Structure model' '_pdbx_struct_assembly.method_details'        
31 6 'Structure model' '_pdbx_struct_assembly.oligomeric_count'      
32 6 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
33 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0072 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
REFMAC phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id                 2WFZ 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       
;(1R)-1,2,2-TRIMETHYLPROPYL (S)-METHYLPHOSPHINATE (GD8): GD8
 IS COVALENTLY LINKED TO THE CATALYTIC SER200.
;
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    1048 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1160 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 45  ? ? 80.40   -13.15  
2  1 CYS A 94  ? ? -141.56 10.54   
3  1 SER A 108 ? ? -153.75 71.84   
4  1 ASN A 131 ? ? -59.53  109.46  
5  1 SER A 200 ? ? 61.40   -118.62 
6  1 GLU A 299 ? ? -126.92 -73.04  
7  1 GLU A 299 ? ? -127.71 -71.79  
8  1 ASP A 326 ? ? -119.53 74.17   
9  1 ASP A 380 ? ? -163.56 55.27   
10 1 VAL A 400 ? ? -126.40 -63.82  
11 1 HIS A 440 ? ? -39.58  113.45  
12 1 ARG A 515 ? ? 60.23   62.23   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       1360 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   7.37 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 2536 n 
B 2 NAG 2 B NAG 2 A NAG 2535 n 
C 3 NAG 1 C NAG 1 A NAG 2537 n 
C 3 FUC 2 C FUC 2 A FUC 2538 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                                              'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1'                WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'                   LINUCS                      PDB-CARE   ?     
4 3 LFucpa1-6DGlcpNAcb1-                                                 'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2/a6-b1' WURCS                       PDB2Glycan 1.1.0 
6 3 '[]{[(4+1)][b-D-GlcpNAc]{[(6+1)][a-L-Fucp]{}}}'                      LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 3 2 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
3 NAG 1 n 
3 FUC 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 '(1R)-1,2,2-TRIMETHYLPROPYL (S)-METHYLPHOSPHINATE' GD8 
5 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL           TRS 
6 'TETRAETHYLENE GLYCOL'                             PG4 
7 'DI(HYDROXYETHYL)ETHER'                            PEG 
8 'CHLORIDE ION'                                     CL  
9 water                                              HOH 
#