data_2WG0
# 
_entry.id   2WG0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WG0         
PDBE  EBI-39475    
WWPDB D_1290039475 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 2VQ6 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH 2-PAM' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 2J3Q unspecified 'TORPEDO ACETYLCHOLINESTERASE COMPLEXED WITH FLUOROPHORE THIOFLAVIN T' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 2J4F unspecified 'TORPEDO ACETYLCHOLINESTERASE - HG HEAVY-ATOM DERIVATIVE' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJC unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 150K
;
PDB 2VJB unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET D AT 100K
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJD unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET C AT 150K
;
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 2VT6 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 9400000 GY' 
PDB 2W9I unspecified 'ACHE IN COMPLEX WITH METHYLENE BLUE' 
PDB 2VT7 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 800000 GY' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2W6C unspecified 'ACHE IN COMPLEX WITH A BIS-(-)-NOR- MEPTAZINOL DERIVATIVE' 
PDB 2VJA unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 100K
;
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 2V96 unspecified 
'STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AT 100K' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2VA9 unspecified 
;STRUCTURE OF NATIVE TCACHE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE DURING THE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 2V98 unspecified 
;STRUCTURE OF THE COMPLEX OF TCACHE WITH 1 -(2-NITROPHENYL)-2,2,2-TRIFLUOROETHYL- ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE, DURING HTE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN-II' 
PDB 2V97 unspecified 
;STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE
;
PDB 2WFZ unspecified 'NON-AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN' 
PDB 2WG1 unspecified 'TERNARY COMPLEX OF THE AGED CONJUGATE OF TORPEDO CALIFORNICA ACEYLCHOLINESTERASE WITH SOMAN AND 2-PAM' 
PDB 2WG2 unspecified 'NON-AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN (ALTERNATIVE REINEMENT)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WG0 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sanson, B.'       1  
'Nachon, F.'       2  
'Colletier, J.P.'  3  
'Froment, M.T.'    4  
'Toker, L.'        5  
'Greenblatt, H.M.' 6  
'Sussman, J.L.'    7  
'Ashani, Y.'       8  
'Masson, P.'       9  
'Silman, I.'       10 
'Weik, M.'         11 
# 
_citation.id                        primary 
_citation.title                     
;Crystallographic Snapshots of Nonaged and Aged Conjugates of Soman with Acetylcholinesterase, and of a Ternary Complex of the Aged Conjugate with Pralidoxime.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            52 
_citation.page_first                7593 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19642642 
_citation.pdbx_database_id_DOI      10.1021/JM900433T 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sanson, B.'       1  ? 
primary 'Nachon, F.'       2  ? 
primary 'Colletier, J.P.'  3  ? 
primary 'Froment, M.T.'    4  ? 
primary 'Toker, L.'        5  ? 
primary 'Greenblatt, H.M.' 6  ? 
primary 'Sussman, J.L.'    7  ? 
primary 'Ashani, Y.'       8  ? 
primary 'Masson, P.'       9  ? 
primary 'Silman, I.'       10 ? 
primary 'Weik, M.'         11 ? 
# 
_cell.entry_id           2WG0 
_cell.length_a           111.610 
_cell.length_b           111.610 
_cell.length_c           136.840 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WG0 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat ACETYLCHOLINESTERASE                                                                      60736.516 1   3.1.1.7 
? 'RESIDUES 22-558' ? 
2  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ?       
? ?                 ? 
3  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   2   ?       
? ?                 ? 
4  non-polymer syn 'CHLORIDE ION'                                                                            35.453    1   ?       
? ?                 ? 
5  non-polymer syn 'METHYLPHOSPHONIC ACID ESTER GROUP'                                                       96.022    1   ?       
? ?                 ? 
6  non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                                    195.237   1   ?       
? ?                 ? 
7  non-polymer syn 'TETRAETHYLENE GLYCOL'                                                                    194.226   1   ?       
? ?                 ? 
8  non-polymer syn 'TRIETHYLENE GLYCOL'                                                                      150.173   4   ?       
? ?                 ? 
9  non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                   106.120   10  ?       
? ?                 ? 
10 water       nat water                                                                                     18.015    620 ?       
? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2WG0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CL  non-polymer                  . 'CHLORIDE ION'                           ? 'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GB  non-polymer                  . 'METHYLPHOSPHONIC ACID ESTER GROUP'      ? 'C H5 O3 P'      96.022  
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MES non-polymer                  . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'   ? 'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                  ? 'C4 H10 O3'      106.120 
PG4 non-polymer                  . 'TETRAETHYLENE GLYCOL'                   ? 'C8 H18 O5'      194.226 
PGE non-polymer                  . 'TRIETHYLENE GLYCOL'                     ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2WG0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;ACHE WAS CRYSTALLIZED IN 34% PEG200, 150 MM MES, PH 6, 4 DEG. C. THE CRYSTAL WAS SOAKED FOR 2 HOURS IN 1.3 MM SOMAN AT PH 6, 4 DEG C., THEN FLASH-COOLED IN LN2.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2007-02-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WG0 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             45.60 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   50212 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.00 
_reflns.B_iso_Wilson_estimate        27.2 
_reflns.pdbx_redundancy              5.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.30 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.49 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.25 
_reflns_shell.pdbx_redundancy        5.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WG0 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     47754 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.34 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.38 
_refine.ls_R_factor_obs                          0.17964 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17718 
_refine.ls_R_factor_R_free                       0.22892 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2459 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.949 
_refine.correlation_coeff_Fo_to_Fc_free          0.910 
_refine.B_iso_mean                               25.416 
_refine.aniso_B[1][1]                            1.46 
_refine.aniso_B[2][2]                            1.46 
_refine.aniso_B[3][3]                            -2.19 
_refine.aniso_B[1][2]                            0.73 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1EA5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.172 
_refine.pdbx_overall_ESU_R_Free                  0.168 
_refine.overall_SU_ML                            0.118 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.787 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4244 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         196 
_refine_hist.number_atoms_solvent             620 
_refine_hist.number_atoms_total               5060 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        48.34 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 4616 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.506  1.988  ? 6229 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.287  5.000  ? 549  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.240 24.047 ? 215  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.745 15.000 ? 732  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.880 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.095  0.200  ? 647  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 3488 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.719  1.500  ? 2674 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.349  2.000  ? 4331 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.110  3.000  ? 1942 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.390  4.500  ? 1889 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.number_reflns_R_work             3513 
_refine_ls_shell.R_factor_R_work                  0.270 
_refine_ls_shell.percent_reflns_obs               99.89 
_refine_ls_shell.R_factor_R_free                  0.327 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             169 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2WG0 
_struct.title                     
'AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN (OBTAINED BY IN CRYSTALLO AGING)' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WG0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SOMAN, AGING, SYNAPSE, MEMBRANE, HYDROLASE, CELL MEMBRANE, DISULFIDE BOND, SERINE ESTERASE, NEUROTRANSMITTER CLEAVAGE, CONFORMATIONAL FLEXIBILITY, NEUROTRANSMITTER DEGRADATION, ALPHA/BETA HYDROLASE, ALTERNATIVE SPLICING, ORGANOPHOSPHATE, SYNAPSE MEMBRANE, ALZHEIMER DISEASE, GPI-ANCHOR, LIPOPROTEIN, GLYCOPROTEIN, CELL JUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 8  ? 
K N N 8  ? 
L N N 8  ? 
M N N 9  ? 
N N N 9  ? 
O N N 9  ? 
P N N 9  ? 
Q N N 9  ? 
R N N 9  ? 
S N N 9  ? 
T N N 9  ? 
U N N 9  ? 
V N N 9  ? 
W N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 SER A 237 ? LEU A 252 ? SER A 237 LEU A 252 1 ? 16 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? TYR A 375 ? ASN A 364 TYR A 375 1 ? 12 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf2 disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf3 disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.025 ? ?               
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 59  A NAG 2538 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale2 covale one  ? A SER 200 OG  ? ? ? 1_555 F GB  .   P1 ? ? A SER 200 A GB  2540 1_555 ? ? ? ? ? ? ? 1.621 ? ?               
covale3 covale one  ? A ASN 416 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 416 B NAG 1    1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale4 covale one  ? A ASN 457 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 457 A NAG 2536 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale5 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2    1_555 ? ? ? ? ? ? ? 1.440 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AB 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
AB 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N ALA A 222 ? N ALA A 222 O GLN A 318 ? O GLN A 318 
AB 8  9  N ILE A 319 ? N ILE A 319 O GLY A 417 ? O GLY A 417 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
# 
_database_PDB_matrix.entry_id          2WG0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WG0 
_atom_sites.fract_transf_matrix[1][1]   0.008960 
_atom_sites.fract_transf_matrix[1][2]   0.005173 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010346 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007308 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1  4   ? -12.603 87.608 34.003 1.00 36.35 ? 4    SER A N   1 
ATOM   2    C  CA  . SER A 1  4   ? -12.198 87.899 35.410 1.00 36.43 ? 4    SER A CA  1 
ATOM   3    C  C   . SER A 1  4   ? -11.062 86.989 35.877 1.00 35.56 ? 4    SER A C   1 
ATOM   4    O  O   . SER A 1  4   ? -11.079 85.770 35.651 1.00 35.47 ? 4    SER A O   1 
ATOM   5    C  CB  . SER A 1  4   ? -13.396 87.762 36.351 1.00 37.09 ? 4    SER A CB  1 
ATOM   6    O  OG  . SER A 1  4   ? -12.995 87.907 37.704 1.00 38.44 ? 4    SER A OG  1 
ATOM   7    N  N   . GLU A 1  5   ? -10.072 87.582 36.528 1.00 34.31 ? 5    GLU A N   1 
ATOM   8    C  CA  . GLU A 1  5   ? -8.935  86.816 37.040 1.00 33.36 ? 5    GLU A CA  1 
ATOM   9    C  C   . GLU A 1  5   ? -9.317  85.779 38.110 1.00 32.26 ? 5    GLU A C   1 
ATOM   10   O  O   . GLU A 1  5   ? -8.687  84.736 38.225 1.00 31.50 ? 5    GLU A O   1 
ATOM   11   C  CB  . GLU A 1  5   ? -7.910  87.760 37.625 1.00 33.67 ? 5    GLU A CB  1 
ATOM   12   C  CG  . GLU A 1  5   ? -6.519  87.150 37.828 1.00 35.87 ? 5    GLU A CG  1 
ATOM   13   C  CD  . GLU A 1  5   ? -5.492  88.222 38.005 1.00 38.00 ? 5    GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1  5   ? -5.915  89.389 38.128 1.00 40.61 ? 5    GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1  5   ? -4.279  87.924 38.013 1.00 39.59 ? 5    GLU A OE2 1 
ATOM   16   N  N   . LEU A 1  6   ? -10.344 86.080 38.891 1.00 30.96 ? 6    LEU A N   1 
ATOM   17   C  CA  . LEU A 1  6   ? -10.721 85.237 40.004 1.00 29.84 ? 6    LEU A CA  1 
ATOM   18   C  C   . LEU A 1  6   ? -11.741 84.185 39.606 1.00 29.11 ? 6    LEU A C   1 
ATOM   19   O  O   . LEU A 1  6   ? -12.220 83.423 40.451 1.00 29.23 ? 6    LEU A O   1 
ATOM   20   C  CB  . LEU A 1  6   ? -11.263 86.092 41.163 1.00 29.32 ? 6    LEU A CB  1 
ATOM   21   C  CG  . LEU A 1  6   ? -10.361 87.159 41.779 1.00 28.80 ? 6    LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1  6   ? -11.159 88.011 42.781 1.00 27.76 ? 6    LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1  6   ? -9.107  86.579 42.435 1.00 27.26 ? 6    LEU A CD2 1 
ATOM   24   N  N   . LEU A 1  7   ? -12.080 84.135 38.328 1.00 28.35 ? 7    LEU A N   1 
ATOM   25   C  CA  . LEU A 1  7   ? -13.039 83.143 37.864 1.00 28.34 ? 7    LEU A CA  1 
ATOM   26   C  C   . LEU A 1  7   ? -12.326 82.142 36.950 1.00 27.63 ? 7    LEU A C   1 
ATOM   27   O  O   . LEU A 1  7   ? -11.594 82.536 36.025 1.00 26.70 ? 7    LEU A O   1 
ATOM   28   C  CB  . LEU A 1  7   ? -14.230 83.824 37.184 1.00 28.82 ? 7    LEU A CB  1 
ATOM   29   C  CG  . LEU A 1  7   ? -15.406 82.993 36.643 1.00 31.78 ? 7    LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1  7   ? -15.993 81.952 37.645 1.00 31.05 ? 7    LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1  7   ? -16.514 83.943 36.125 1.00 34.19 ? 7    LEU A CD2 1 
ATOM   32   N  N   . VAL A 1  8   ? -12.492 80.854 37.251 1.00 26.56 ? 8    VAL A N   1 
ATOM   33   C  CA  . VAL A 1  8   ? -11.844 79.803 36.468 1.00 26.01 ? 8    VAL A CA  1 
ATOM   34   C  C   . VAL A 1  8   ? -12.850 78.704 36.171 1.00 25.96 ? 8    VAL A C   1 
ATOM   35   O  O   . VAL A 1  8   ? -13.583 78.272 37.060 1.00 25.99 ? 8    VAL A O   1 
ATOM   36   C  CB  . VAL A 1  8   ? -10.607 79.211 37.198 1.00 26.19 ? 8    VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1  8   ? -10.022 78.064 36.421 1.00 25.00 ? 8    VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1  8   ? -9.536  80.280 37.440 1.00 25.42 ? 8    VAL A CG2 1 
ATOM   39   N  N   . ASN A 1  9   ? -12.896 78.271 34.914 1.00 26.01 ? 9    ASN A N   1 
ATOM   40   C  CA  . ASN A 1  9   ? -13.780 77.186 34.517 1.00 26.10 ? 9    ASN A CA  1 
ATOM   41   C  C   . ASN A 1  9   ? -12.941 75.926 34.422 1.00 25.50 ? 9    ASN A C   1 
ATOM   42   O  O   . ASN A 1  9   ? -12.057 75.833 33.579 1.00 27.03 ? 9    ASN A O   1 
ATOM   43   C  CB  . ASN A 1  9   ? -14.514 77.493 33.188 1.00 26.37 ? 9    ASN A CB  1 
ATOM   44   C  CG  . ASN A 1  9   ? -15.661 76.476 32.873 1.00 29.07 ? 9    ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1  9   ? -16.208 75.796 33.777 1.00 31.74 ? 9    ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1  9   ? -16.033 76.385 31.588 1.00 28.74 ? 9    ASN A ND2 1 
ATOM   47   N  N   . THR A 1  10  ? -13.197 74.980 35.320 1.00 24.44 ? 10   THR A N   1 
ATOM   48   C  CA  . THR A 1  10  ? -12.472 73.721 35.366 1.00 22.62 ? 10   THR A CA  1 
ATOM   49   C  C   . THR A 1  10  ? -13.404 72.680 34.802 1.00 22.93 ? 10   THR A C   1 
ATOM   50   O  O   . THR A 1  10  ? -14.564 72.971 34.556 1.00 22.86 ? 10   THR A O   1 
ATOM   51   C  CB  . THR A 1  10  ? -12.121 73.293 36.822 1.00 21.95 ? 10   THR A CB  1 
ATOM   52   O  OG1 . THR A 1  10  ? -13.285 72.773 37.466 1.00 18.27 ? 10   THR A OG1 1 
ATOM   53   C  CG2 . THR A 1  10  ? -11.585 74.441 37.620 1.00 19.85 ? 10   THR A CG2 1 
ATOM   54   N  N   . LYS A 1  11  ? -12.909 71.457 34.670 1.00 22.83 ? 11   LYS A N   1 
ATOM   55   C  CA  . LYS A 1  11  ? -13.696 70.357 34.176 1.00 23.43 ? 11   LYS A CA  1 
ATOM   56   C  C   . LYS A 1  11  ? -14.777 69.930 35.158 1.00 24.14 ? 11   LYS A C   1 
ATOM   57   O  O   . LYS A 1  11  ? -15.709 69.194 34.790 1.00 24.76 ? 11   LYS A O   1 
ATOM   58   C  CB  . LYS A 1  11  ? -12.771 69.188 33.835 1.00 23.06 ? 11   LYS A CB  1 
ATOM   59   C  CG  . LYS A 1  11  ? -11.759 69.535 32.726 1.00 23.05 ? 11   LYS A CG  1 
ATOM   60   C  CD  . LYS A 1  11  ? -10.597 68.529 32.742 1.00 23.58 ? 11   LYS A CD  1 
ATOM   61   C  CE  . LYS A 1  11  ? -9.733  68.638 31.487 1.00 23.78 ? 11   LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1  11  ? -8.601  67.642 31.520 1.00 24.76 ? 11   LYS A NZ  1 
ATOM   63   N  N   . SER A 1  12  ? -14.651 70.368 36.412 1.00 24.31 ? 12   SER A N   1 
ATOM   64   C  CA  . SER A 1  12  ? -15.627 70.023 37.451 1.00 24.93 ? 12   SER A CA  1 
ATOM   65   C  C   . SER A 1  12  ? -16.678 71.117 37.667 1.00 24.53 ? 12   SER A C   1 
ATOM   66   O  O   . SER A 1  12  ? -17.675 70.902 38.362 1.00 24.62 ? 12   SER A O   1 
ATOM   67   C  CB  . SER A 1  12  ? -14.915 69.716 38.769 1.00 24.41 ? 12   SER A CB  1 
ATOM   68   O  OG  . SER A 1  12  ? -14.204 68.510 38.651 1.00 28.07 ? 12   SER A OG  1 
ATOM   69   N  N   . GLY A 1  13  ? -16.437 72.282 37.074 1.00 24.11 ? 13   GLY A N   1 
ATOM   70   C  CA  . GLY A 1  13  ? -17.321 73.420 37.202 1.00 24.30 ? 13   GLY A CA  1 
ATOM   71   C  C   . GLY A 1  13  ? -16.501 74.676 37.349 1.00 24.67 ? 13   GLY A C   1 
ATOM   72   O  O   . GLY A 1  13  ? -15.253 74.613 37.396 1.00 23.79 ? 13   GLY A O   1 
ATOM   73   N  N   . LYS A 1  14  ? -17.194 75.813 37.447 1.00 24.81 ? 14   LYS A N   1 
ATOM   74   C  CA  . LYS A 1  14  ? -16.525 77.100 37.634 1.00 25.66 ? 14   LYS A CA  1 
ATOM   75   C  C   . LYS A 1  14  ? -16.197 77.339 39.107 1.00 25.57 ? 14   LYS A C   1 
ATOM   76   O  O   . LYS A 1  14  ? -16.970 76.956 39.991 1.00 25.34 ? 14   LYS A O   1 
ATOM   77   C  CB  . LYS A 1  14  ? -17.415 78.235 37.127 1.00 26.47 ? 14   LYS A CB  1 
ATOM   78   C  CG  . LYS A 1  14  ? -17.843 78.122 35.667 1.00 29.22 ? 14   LYS A CG  1 
ATOM   79   C  CD  . LYS A 1  14  ? -18.481 79.447 35.197 1.00 33.54 ? 14   LYS A CD  1 
ATOM   80   C  CE  . LYS A 1  14  ? -18.903 79.405 33.735 1.00 35.46 ? 14   LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1  14  ? -20.212 78.693 33.537 1.00 38.40 ? 14   LYS A NZ  1 
ATOM   82   N  N   . VAL A 1  15  ? -15.059 77.976 39.372 1.00 25.82 ? 15   VAL A N   1 
ATOM   83   C  CA  . VAL A 1  15  ? -14.711 78.364 40.737 1.00 26.20 ? 15   VAL A CA  1 
ATOM   84   C  C   . VAL A 1  15  ? -14.410 79.849 40.784 1.00 26.05 ? 15   VAL A C   1 
ATOM   85   O  O   . VAL A 1  15  ? -13.792 80.366 39.842 1.00 25.41 ? 15   VAL A O   1 
ATOM   86   C  CB  . VAL A 1  15  ? -13.459 77.593 41.278 1.00 26.23 ? 15   VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1  15  ? -13.775 76.140 41.527 1.00 27.28 ? 15   VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1  15  ? -12.310 77.692 40.311 1.00 26.85 ? 15   VAL A CG2 1 
ATOM   89   N  N   . MET A 1  16  ? -14.834 80.515 41.869 1.00 25.92 ? 16   MET A N   1 
ATOM   90   C  CA  A MET A 1  16  ? -14.472 81.923 42.102 0.50 25.96 ? 16   MET A CA  1 
ATOM   91   C  CA  B MET A 1  16  ? -14.468 81.916 42.105 0.50 25.77 ? 16   MET A CA  1 
ATOM   92   C  C   . MET A 1  16  ? -13.511 82.061 43.277 1.00 25.47 ? 16   MET A C   1 
ATOM   93   O  O   . MET A 1  16  ? -13.803 81.637 44.396 1.00 25.43 ? 16   MET A O   1 
ATOM   94   C  CB  A MET A 1  16  ? -15.707 82.824 42.323 0.50 26.24 ? 16   MET A CB  1 
ATOM   95   C  CB  B MET A 1  16  ? -15.701 82.792 42.355 0.50 25.90 ? 16   MET A CB  1 
ATOM   96   C  CG  A MET A 1  16  ? -15.399 84.344 42.241 0.50 27.34 ? 16   MET A CG  1 
ATOM   97   C  CG  B MET A 1  16  ? -15.364 84.263 42.644 0.50 26.13 ? 16   MET A CG  1 
ATOM   98   S  SD  A MET A 1  16  ? -16.769 85.494 42.609 0.50 31.25 ? 16   MET A SD  1 
ATOM   99   S  SD  B MET A 1  16  ? -15.097 85.269 41.171 0.50 28.36 ? 16   MET A SD  1 
ATOM   100  C  CE  A MET A 1  16  ? -17.857 85.211 41.215 0.50 30.76 ? 16   MET A CE  1 
ATOM   101  C  CE  B MET A 1  16  ? -16.646 84.998 40.322 0.50 26.63 ? 16   MET A CE  1 
ATOM   102  N  N   . GLY A 1  17  ? -12.378 82.671 43.021 1.00 25.10 ? 17   GLY A N   1 
ATOM   103  C  CA  . GLY A 1  17  ? -11.418 82.856 44.063 1.00 26.50 ? 17   GLY A CA  1 
ATOM   104  C  C   . GLY A 1  17  ? -11.546 84.194 44.732 1.00 27.52 ? 17   GLY A C   1 
ATOM   105  O  O   . GLY A 1  17  ? -12.624 84.811 44.737 1.00 27.59 ? 17   GLY A O   1 
ATOM   106  N  N   . THR A 1  18  ? -10.416 84.630 45.282 1.00 28.33 ? 18   THR A N   1 
ATOM   107  C  CA  . THR A 1  18  ? -10.301 85.883 45.990 1.00 29.26 ? 18   THR A CA  1 
ATOM   108  C  C   . THR A 1  18  ? -8.904  86.455 45.877 1.00 29.76 ? 18   THR A C   1 
ATOM   109  O  O   . THR A 1  18  ? -7.929  85.720 45.830 1.00 30.26 ? 18   THR A O   1 
ATOM   110  C  CB  . THR A 1  18  ? -10.674 85.729 47.470 1.00 29.41 ? 18   THR A CB  1 
ATOM   111  O  OG1 . THR A 1  18  ? -10.499 86.994 48.098 1.00 30.72 ? 18   THR A OG1 1 
ATOM   112  C  CG2 . THR A 1  18  ? -9.784  84.699 48.174 1.00 29.91 ? 18   THR A CG2 1 
ATOM   113  N  N   . ARG A 1  19  ? -8.817  87.776 45.824 1.00 30.90 ? 19   ARG A N   1 
ATOM   114  C  CA  . ARG A 1  19  ? -7.537  88.474 45.723 1.00 31.81 ? 19   ARG A CA  1 
ATOM   115  C  C   . ARG A 1  19  ? -6.990  88.599 47.131 1.00 31.41 ? 19   ARG A C   1 
ATOM   116  O  O   . ARG A 1  19  ? -7.701  89.007 48.047 1.00 31.52 ? 19   ARG A O   1 
ATOM   117  C  CB  . ARG A 1  19  ? -7.730  89.857 45.089 1.00 32.31 ? 19   ARG A CB  1 
ATOM   118  C  CG  . ARG A 1  19  ? -6.446  90.570 44.712 1.00 34.89 ? 19   ARG A CG  1 
ATOM   119  C  CD  . ARG A 1  19  ? -6.687  91.478 43.492 1.00 40.11 ? 19   ARG A CD  1 
ATOM   120  N  NE  . ARG A 1  19  ? -5.524  92.303 43.149 1.00 43.07 ? 19   ARG A NE  1 
ATOM   121  C  CZ  . ARG A 1  19  ? -4.507  91.916 42.376 1.00 45.48 ? 19   ARG A CZ  1 
ATOM   122  N  NH1 . ARG A 1  19  ? -4.481  90.693 41.853 1.00 46.32 ? 19   ARG A NH1 1 
ATOM   123  N  NH2 . ARG A 1  19  ? -3.496  92.751 42.145 1.00 46.59 ? 19   ARG A NH2 1 
ATOM   124  N  N   . VAL A 1  20  ? -5.747  88.193 47.333 1.00 30.97 ? 20   VAL A N   1 
ATOM   125  C  CA  . VAL A 1  20  ? -5.214  88.250 48.680 1.00 30.60 ? 20   VAL A CA  1 
ATOM   126  C  C   . VAL A 1  20  ? -3.942  89.044 48.685 1.00 30.19 ? 20   VAL A C   1 
ATOM   127  O  O   . VAL A 1  20  ? -3.147  88.949 47.752 1.00 29.99 ? 20   VAL A O   1 
ATOM   128  C  CB  . VAL A 1  20  ? -5.023  86.851 49.355 1.00 30.42 ? 20   VAL A CB  1 
ATOM   129  C  CG1 . VAL A 1  20  ? -6.275  86.001 49.201 1.00 30.78 ? 20   VAL A CG1 1 
ATOM   130  C  CG2 . VAL A 1  20  ? -3.801  86.155 48.809 1.00 30.85 ? 20   VAL A CG2 1 
ATOM   131  N  N   . PRO A 1  21  ? -3.770  89.871 49.723 1.00 30.35 ? 21   PRO A N   1 
ATOM   132  C  CA  . PRO A 1  21  ? -2.537  90.640 49.873 1.00 30.46 ? 21   PRO A CA  1 
ATOM   133  C  C   . PRO A 1  21  ? -1.375  89.718 50.216 1.00 30.60 ? 21   PRO A C   1 
ATOM   134  O  O   . PRO A 1  21  ? -1.563  88.718 50.914 1.00 30.23 ? 21   PRO A O   1 
ATOM   135  C  CB  . PRO A 1  21  ? -2.838  91.567 51.070 1.00 30.68 ? 21   PRO A CB  1 
ATOM   136  C  CG  . PRO A 1  21  ? -3.946  90.892 51.834 1.00 30.58 ? 21   PRO A CG  1 
ATOM   137  C  CD  . PRO A 1  21  ? -4.740  90.117 50.811 1.00 30.35 ? 21   PRO A CD  1 
ATOM   138  N  N   . VAL A 1  22  ? -0.190  90.060 49.731 1.00 30.85 ? 22   VAL A N   1 
ATOM   139  C  CA  . VAL A 1  22  ? 1.023   89.347 50.071 1.00 31.39 ? 22   VAL A CA  1 
ATOM   140  C  C   . VAL A 1  22  ? 2.178   90.316 49.837 1.00 32.00 ? 22   VAL A C   1 
ATOM   141  O  O   . VAL A 1  22  ? 2.301   90.862 48.737 1.00 32.16 ? 22   VAL A O   1 
ATOM   142  C  CB  . VAL A 1  22  ? 1.176   88.035 49.227 1.00 31.52 ? 22   VAL A CB  1 
ATOM   143  C  CG1 . VAL A 1  22  ? 0.911   88.291 47.727 1.00 31.27 ? 22   VAL A CG1 1 
ATOM   144  C  CG2 . VAL A 1  22  ? 2.534   87.408 49.429 1.00 29.98 ? 22   VAL A CG2 1 
ATOM   145  N  N   . LEU A 1  23  ? 2.988   90.547 50.875 1.00 32.84 ? 23   LEU A N   1 
ATOM   146  C  CA  . LEU A 1  23  ? 4.174   91.435 50.814 1.00 34.02 ? 23   LEU A CA  1 
ATOM   147  C  C   . LEU A 1  23  ? 4.045   92.671 49.883 1.00 34.91 ? 23   LEU A C   1 
ATOM   148  O  O   . LEU A 1  23  ? 4.863   92.875 48.967 1.00 35.25 ? 23   LEU A O   1 
ATOM   149  C  CB  . LEU A 1  23  ? 5.407   90.621 50.416 1.00 33.94 ? 23   LEU A CB  1 
ATOM   150  C  CG  . LEU A 1  23  ? 5.715   89.398 51.278 1.00 34.44 ? 23   LEU A CG  1 
ATOM   151  C  CD1 . LEU A 1  23  ? 6.637   88.488 50.525 1.00 35.01 ? 23   LEU A CD1 1 
ATOM   152  C  CD2 . LEU A 1  23  ? 6.335   89.829 52.597 1.00 33.75 ? 23   LEU A CD2 1 
ATOM   153  N  N   . SER A 1  24  ? 3.003   93.470 50.114 1.00 35.78 ? 24   SER A N   1 
ATOM   154  C  CA  . SER A 1  24  ? 2.728   94.709 49.348 1.00 36.37 ? 24   SER A CA  1 
ATOM   155  C  C   . SER A 1  24  ? 2.117   94.540 47.962 1.00 35.98 ? 24   SER A C   1 
ATOM   156  O  O   . SER A 1  24  ? 1.688   95.520 47.360 1.00 37.11 ? 24   SER A O   1 
ATOM   157  C  CB  . SER A 1  24  ? 3.957   95.628 49.285 1.00 36.72 ? 24   SER A CB  1 
ATOM   158  O  OG  . SER A 1  24  ? 4.310   96.027 50.608 1.00 38.02 ? 24   SER A OG  1 
ATOM   159  N  N   . SER A 1  25  ? 2.062   93.310 47.464 1.00 35.28 ? 25   SER A N   1 
ATOM   160  C  CA  . SER A 1  25  ? 1.384   93.020 46.201 1.00 33.70 ? 25   SER A CA  1 
ATOM   161  C  C   . SER A 1  25  ? 0.144   92.172 46.478 1.00 32.47 ? 25   SER A C   1 
ATOM   162  O  O   . SER A 1  25  ? -0.378  92.215 47.599 1.00 31.88 ? 25   SER A O   1 
ATOM   163  C  CB  . SER A 1  25  ? 2.341   92.355 45.226 1.00 33.74 ? 25   SER A CB  1 
ATOM   164  O  OG  . SER A 1  25  ? 1.777   92.311 43.933 1.00 34.34 ? 25   SER A OG  1 
ATOM   165  N  N   . HIS A 1  26  ? -0.350  91.447 45.470 1.00 31.67 ? 26   HIS A N   1 
ATOM   166  C  CA  . HIS A 1  26  ? -1.530  90.588 45.615 1.00 31.57 ? 26   HIS A CA  1 
ATOM   167  C  C   . HIS A 1  26  ? -1.439  89.411 44.674 1.00 31.38 ? 26   HIS A C   1 
ATOM   168  O  O   . HIS A 1  26  ? -0.802  89.499 43.624 1.00 31.87 ? 26   HIS A O   1 
ATOM   169  C  CB  . HIS A 1  26  ? -2.825  91.303 45.233 1.00 32.58 ? 26   HIS A CB  1 
ATOM   170  C  CG  . HIS A 1  26  ? -3.097  92.555 46.005 1.00 36.47 ? 26   HIS A CG  1 
ATOM   171  N  ND1 . HIS A 1  26  ? -2.614  93.787 45.614 1.00 39.53 ? 26   HIS A ND1 1 
ATOM   172  C  CD2 . HIS A 1  26  ? -3.811  92.769 47.136 1.00 39.35 ? 26   HIS A CD2 1 
ATOM   173  C  CE1 . HIS A 1  26  ? -3.004  94.704 46.484 1.00 42.11 ? 26   HIS A CE1 1 
ATOM   174  N  NE2 . HIS A 1  26  ? -3.737  94.113 47.413 1.00 41.71 ? 26   HIS A NE2 1 
ATOM   175  N  N   . ILE A 1  27  ? -2.114  88.318 45.021 1.00 29.78 ? 27   ILE A N   1 
ATOM   176  C  CA  . ILE A 1  27  ? -2.276  87.222 44.094 1.00 28.82 ? 27   ILE A CA  1 
ATOM   177  C  C   . ILE A 1  27  ? -3.673  86.663 44.260 1.00 28.05 ? 27   ILE A C   1 
ATOM   178  O  O   . ILE A 1  27  ? -4.439  87.177 45.079 1.00 28.13 ? 27   ILE A O   1 
ATOM   179  C  CB  . ILE A 1  27  ? -1.207  86.141 44.251 1.00 28.44 ? 27   ILE A CB  1 
ATOM   180  C  CG1 . ILE A 1  27  ? -1.237  85.528 45.636 1.00 28.61 ? 27   ILE A CG1 1 
ATOM   181  C  CG2 . ILE A 1  27  ? 0.168   86.717 43.987 1.00 29.32 ? 27   ILE A CG2 1 
ATOM   182  C  CD1 . ILE A 1  27  ? -0.172  84.463 45.768 1.00 30.38 ? 27   ILE A CD1 1 
ATOM   183  N  N   . SER A 1  28  ? -4.009  85.645 43.472 1.00 26.64 ? 28   SER A N   1 
ATOM   184  C  CA  . SER A 1  28  ? -5.330  85.031 43.562 1.00 26.00 ? 28   SER A CA  1 
ATOM   185  C  C   . SER A 1  28  ? -5.242  83.774 44.418 1.00 25.41 ? 28   SER A C   1 
ATOM   186  O  O   . SER A 1  28  ? -4.231  83.080 44.388 1.00 25.22 ? 28   SER A O   1 
ATOM   187  C  CB  . SER A 1  28  ? -5.883  84.680 42.171 1.00 26.30 ? 28   SER A CB  1 
ATOM   188  O  OG  . SER A 1  28  ? -5.549  85.650 41.176 1.00 26.30 ? 28   SER A OG  1 
ATOM   189  N  N   . ALA A 1  29  ? -6.294  83.503 45.188 1.00 24.63 ? 29   ALA A N   1 
ATOM   190  C  CA  . ALA A 1  29  ? -6.397  82.283 45.966 1.00 23.58 ? 29   ALA A CA  1 
ATOM   191  C  C   . ALA A 1  29  ? -7.726  81.622 45.681 1.00 23.21 ? 29   ALA A C   1 
ATOM   192  O  O   . ALA A 1  29  ? -8.787  82.279 45.644 1.00 23.23 ? 29   ALA A O   1 
ATOM   193  C  CB  . ALA A 1  29  ? -6.273  82.575 47.443 1.00 23.94 ? 29   ALA A CB  1 
ATOM   194  N  N   . PHE A 1  30  ? -7.672  80.318 45.473 1.00 21.64 ? 30   PHE A N   1 
ATOM   195  C  CA  . PHE A 1  30  ? -8.872  79.561 45.231 1.00 20.69 ? 30   PHE A CA  1 
ATOM   196  C  C   . PHE A 1  30  ? -8.890  78.522 46.339 1.00 20.49 ? 30   PHE A C   1 
ATOM   197  O  O   . PHE A 1  30  ? -8.237  77.487 46.238 1.00 20.43 ? 30   PHE A O   1 
ATOM   198  C  CB  . PHE A 1  30  ? -8.825  78.924 43.826 1.00 19.85 ? 30   PHE A CB  1 
ATOM   199  C  CG  . PHE A 1  30  ? -8.777  79.936 42.697 1.00 19.33 ? 30   PHE A CG  1 
ATOM   200  C  CD1 . PHE A 1  30  ? -7.562  80.506 42.308 1.00 17.57 ? 30   PHE A CD1 1 
ATOM   201  C  CD2 . PHE A 1  30  ? -9.958  80.327 42.031 1.00 17.25 ? 30   PHE A CD2 1 
ATOM   202  C  CE1 . PHE A 1  30  ? -7.495  81.443 41.282 1.00 17.75 ? 30   PHE A CE1 1 
ATOM   203  C  CE2 . PHE A 1  30  ? -9.912  81.247 40.988 1.00 17.36 ? 30   PHE A CE2 1 
ATOM   204  C  CZ  . PHE A 1  30  ? -8.663  81.820 40.612 1.00 17.57 ? 30   PHE A CZ  1 
ATOM   205  N  N   . LEU A 1  31  ? -9.604  78.818 47.413 1.00 19.75 ? 31   LEU A N   1 
ATOM   206  C  CA  . LEU A 1  31  ? -9.513  78.019 48.619 1.00 19.50 ? 31   LEU A CA  1 
ATOM   207  C  C   . LEU A 1  31  ? -10.702 77.128 48.726 1.00 19.99 ? 31   LEU A C   1 
ATOM   208  O  O   . LEU A 1  31  ? -11.810 77.541 48.380 1.00 20.48 ? 31   LEU A O   1 
ATOM   209  C  CB  . LEU A 1  31  ? -9.454  78.931 49.846 1.00 19.03 ? 31   LEU A CB  1 
ATOM   210  C  CG  . LEU A 1  31  ? -8.389  80.025 49.782 1.00 19.67 ? 31   LEU A CG  1 
ATOM   211  C  CD1 . LEU A 1  31  ? -8.483  80.940 51.037 1.00 18.53 ? 31   LEU A CD1 1 
ATOM   212  C  CD2 . LEU A 1  31  ? -6.956  79.427 49.577 1.00 15.75 ? 31   LEU A CD2 1 
ATOM   213  N  N   . GLY A 1  32  ? -10.486 75.906 49.209 1.00 20.31 ? 32   GLY A N   1 
ATOM   214  C  CA  . GLY A 1  32  ? -11.577 74.956 49.441 1.00 20.52 ? 32   GLY A CA  1 
ATOM   215  C  C   . GLY A 1  32  ? -12.287 74.448 48.189 1.00 20.74 ? 32   GLY A C   1 
ATOM   216  O  O   . GLY A 1  32  ? -13.509 74.288 48.189 1.00 20.71 ? 32   GLY A O   1 
ATOM   217  N  N   . ILE A 1  33  ? -11.529 74.173 47.127 1.00 20.53 ? 33   ILE A N   1 
ATOM   218  C  CA  . ILE A 1  33  ? -12.101 73.486 45.966 1.00 20.29 ? 33   ILE A CA  1 
ATOM   219  C  C   . ILE A 1  33  ? -12.262 72.002 46.280 1.00 19.75 ? 33   ILE A C   1 
ATOM   220  O  O   . ILE A 1  33  ? -11.296 71.358 46.683 1.00 20.60 ? 33   ILE A O   1 
ATOM   221  C  CB  . ILE A 1  33  ? -11.236 73.643 44.688 1.00 20.51 ? 33   ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1  33  ? -11.012 75.139 44.371 1.00 21.14 ? 33   ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1  33  ? -11.929 72.934 43.526 1.00 20.45 ? 33   ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1  33  ? -9.923  75.401 43.339 1.00 20.80 ? 33   ILE A CD1 1 
ATOM   225  N  N   . PRO A 1  34  ? -13.475 71.455 46.092 1.00 18.88 ? 34   PRO A N   1 
ATOM   226  C  CA  . PRO A 1  34  ? -13.728 70.040 46.285 1.00 17.90 ? 34   PRO A CA  1 
ATOM   227  C  C   . PRO A 1  34  ? -13.112 69.170 45.191 1.00 17.91 ? 34   PRO A C   1 
ATOM   228  O  O   . PRO A 1  34  ? -13.297 69.450 44.008 1.00 17.52 ? 34   PRO A O   1 
ATOM   229  C  CB  . PRO A 1  34  ? -15.265 69.967 46.217 1.00 18.74 ? 34   PRO A CB  1 
ATOM   230  C  CG  . PRO A 1  34  ? -15.649 71.158 45.351 1.00 17.84 ? 34   PRO A CG  1 
ATOM   231  C  CD  . PRO A 1  34  ? -14.720 72.204 45.799 1.00 18.25 ? 34   PRO A CD  1 
ATOM   232  N  N   . PHE A 1  35  ? -12.387 68.115 45.572 1.00 17.87 ? 35   PHE A N   1 
ATOM   233  C  CA  . PHE A 1  35  ? -11.877 67.143 44.575 1.00 18.02 ? 35   PHE A CA  1 
ATOM   234  C  C   . PHE A 1  35  ? -12.473 65.739 44.713 1.00 17.77 ? 35   PHE A C   1 
ATOM   235  O  O   . PHE A 1  35  ? -12.185 64.878 43.889 1.00 18.00 ? 35   PHE A O   1 
ATOM   236  C  CB  . PHE A 1  35  ? -10.344 67.050 44.581 1.00 17.68 ? 35   PHE A CB  1 
ATOM   237  C  CG  . PHE A 1  35  ? -9.765  66.539 45.890 1.00 18.02 ? 35   PHE A CG  1 
ATOM   238  C  CD1 . PHE A 1  35  ? -9.663  65.177 46.144 1.00 18.41 ? 35   PHE A CD1 1 
ATOM   239  C  CD2 . PHE A 1  35  ? -9.325  67.425 46.854 1.00 14.94 ? 35   PHE A CD2 1 
ATOM   240  C  CE1 . PHE A 1  35  ? -9.110  64.717 47.346 1.00 20.54 ? 35   PHE A CE1 1 
ATOM   241  C  CE2 . PHE A 1  35  ? -8.791  66.967 48.055 1.00 17.53 ? 35   PHE A CE2 1 
ATOM   242  C  CZ  . PHE A 1  35  ? -8.673  65.626 48.300 1.00 17.59 ? 35   PHE A CZ  1 
ATOM   243  N  N   . ALA A 1  36  ? -13.279 65.510 45.748 1.00 17.86 ? 36   ALA A N   1 
ATOM   244  C  CA  . ALA A 1  36  ? -13.934 64.212 45.971 1.00 19.05 ? 36   ALA A CA  1 
ATOM   245  C  C   . ALA A 1  36  ? -15.353 64.390 46.500 1.00 20.27 ? 36   ALA A C   1 
ATOM   246  O  O   . ALA A 1  36  ? -15.694 65.443 47.023 1.00 20.85 ? 36   ALA A O   1 
ATOM   247  C  CB  . ALA A 1  36  ? -13.115 63.327 46.961 1.00 18.35 ? 36   ALA A CB  1 
ATOM   248  N  N   . GLU A 1  37  ? -16.188 63.367 46.371 1.00 21.64 ? 37   GLU A N   1 
ATOM   249  C  CA  . GLU A 1  37  ? -17.435 63.364 47.107 1.00 23.20 ? 37   GLU A CA  1 
ATOM   250  C  C   . GLU A 1  37  ? -17.096 63.315 48.600 1.00 24.07 ? 37   GLU A C   1 
ATOM   251  O  O   . GLU A 1  37  ? -16.139 62.635 48.974 1.00 23.57 ? 37   GLU A O   1 
ATOM   252  C  CB  . GLU A 1  37  ? -18.257 62.138 46.716 1.00 23.64 ? 37   GLU A CB  1 
ATOM   253  C  CG  . GLU A 1  37  ? -18.904 62.258 45.348 1.00 25.08 ? 37   GLU A CG  1 
ATOM   254  C  CD  . GLU A 1  37  ? -19.844 63.431 45.295 1.00 28.55 ? 37   GLU A CD  1 
ATOM   255  O  OE1 . GLU A 1  37  ? -20.862 63.365 46.016 1.00 30.26 ? 37   GLU A OE1 1 
ATOM   256  O  OE2 . GLU A 1  37  ? -19.557 64.418 44.572 1.00 27.72 ? 37   GLU A OE2 1 
ATOM   257  N  N   . PRO A 1  38  ? -17.866 64.035 49.455 1.00 24.83 ? 38   PRO A N   1 
ATOM   258  C  CA  . PRO A 1  38  ? -17.629 63.928 50.900 1.00 24.90 ? 38   PRO A CA  1 
ATOM   259  C  C   . PRO A 1  38  ? -17.630 62.470 51.386 1.00 25.18 ? 38   PRO A C   1 
ATOM   260  O  O   . PRO A 1  38  ? -18.607 61.751 51.179 1.00 25.27 ? 38   PRO A O   1 
ATOM   261  C  CB  . PRO A 1  38  ? -18.804 64.711 51.495 1.00 24.61 ? 38   PRO A CB  1 
ATOM   262  C  CG  . PRO A 1  38  ? -19.045 65.776 50.475 1.00 24.76 ? 38   PRO A CG  1 
ATOM   263  C  CD  . PRO A 1  38  ? -18.899 65.053 49.155 1.00 24.52 ? 38   PRO A CD  1 
ATOM   264  N  N   . PRO A 1  39  ? -16.534 62.026 52.034 1.00 25.46 ? 39   PRO A N   1 
ATOM   265  C  CA  . PRO A 1  39  ? -16.454 60.607 52.391 1.00 25.76 ? 39   PRO A CA  1 
ATOM   266  C  C   . PRO A 1  39  ? -17.253 60.261 53.657 1.00 26.38 ? 39   PRO A C   1 
ATOM   267  O  O   . PRO A 1  39  ? -16.701 59.738 54.627 1.00 26.34 ? 39   PRO A O   1 
ATOM   268  C  CB  . PRO A 1  39  ? -14.957 60.392 52.579 1.00 26.18 ? 39   PRO A CB  1 
ATOM   269  C  CG  . PRO A 1  39  ? -14.445 61.720 52.960 1.00 26.15 ? 39   PRO A CG  1 
ATOM   270  C  CD  . PRO A 1  39  ? -15.257 62.722 52.240 1.00 24.77 ? 39   PRO A CD  1 
ATOM   271  N  N   . VAL A 1  40  ? -18.554 60.551 53.632 1.00 26.31 ? 40   VAL A N   1 
ATOM   272  C  CA  . VAL A 1  40  ? -19.373 60.519 54.843 1.00 26.00 ? 40   VAL A CA  1 
ATOM   273  C  C   . VAL A 1  40  ? -20.317 59.332 54.844 1.00 25.81 ? 40   VAL A C   1 
ATOM   274  O  O   . VAL A 1  40  ? -20.557 58.752 53.791 1.00 26.03 ? 40   VAL A O   1 
ATOM   275  C  CB  . VAL A 1  40  ? -20.163 61.850 55.030 1.00 26.29 ? 40   VAL A CB  1 
ATOM   276  C  CG1 . VAL A 1  40  ? -19.191 63.028 55.144 1.00 26.43 ? 40   VAL A CG1 1 
ATOM   277  C  CG2 . VAL A 1  40  ? -21.129 62.074 53.884 1.00 25.54 ? 40   VAL A CG2 1 
ATOM   278  N  N   . GLY A 1  41  ? -20.805 58.952 56.027 1.00 25.16 ? 41   GLY A N   1 
ATOM   279  C  CA  . GLY A 1  41  ? -21.827 57.927 56.174 1.00 25.47 ? 41   GLY A CA  1 
ATOM   280  C  C   . GLY A 1  41  ? -21.314 56.563 55.791 1.00 26.19 ? 41   GLY A C   1 
ATOM   281  O  O   . GLY A 1  41  ? -20.285 56.108 56.310 1.00 26.47 ? 41   GLY A O   1 
ATOM   282  N  N   . ASN A 1  42  ? -22.016 55.915 54.863 1.00 26.84 ? 42   ASN A N   1 
ATOM   283  C  CA  . ASN A 1  42  ? -21.617 54.607 54.332 1.00 27.09 ? 42   ASN A CA  1 
ATOM   284  C  C   . ASN A 1  42  ? -20.341 54.672 53.535 1.00 27.42 ? 42   ASN A C   1 
ATOM   285  O  O   . ASN A 1  42  ? -19.806 53.638 53.123 1.00 27.50 ? 42   ASN A O   1 
ATOM   286  C  CB  . ASN A 1  42  ? -22.703 54.018 53.427 1.00 27.82 ? 42   ASN A CB  1 
ATOM   287  C  CG  . ASN A 1  42  ? -23.737 53.253 54.198 0.50 28.27 ? 42   ASN A CG  1 
ATOM   288  O  OD1 . ASN A 1  42  ? -24.308 53.764 55.161 0.50 28.95 ? 42   ASN A OD1 1 
ATOM   289  N  ND2 . ASN A 1  42  ? -23.986 52.011 53.784 0.50 28.73 ? 42   ASN A ND2 1 
ATOM   290  N  N   . MET A 1  43  ? -19.868 55.881 53.273 1.00 27.70 ? 43   MET A N   1 
ATOM   291  C  CA  . MET A 1  43  ? -18.609 56.025 52.562 1.00 28.00 ? 43   MET A CA  1 
ATOM   292  C  C   . MET A 1  43  ? -17.414 56.104 53.511 1.00 27.08 ? 43   MET A C   1 
ATOM   293  O  O   . MET A 1  43  ? -16.260 56.063 53.059 1.00 27.07 ? 43   MET A O   1 
ATOM   294  C  CB  . MET A 1  43  ? -18.657 57.231 51.630 1.00 29.03 ? 43   MET A CB  1 
ATOM   295  C  CG  . MET A 1  43  ? -19.630 57.083 50.481 1.00 31.85 ? 43   MET A CG  1 
ATOM   296  S  SD  . MET A 1  43  ? -19.409 58.467 49.345 1.00 40.93 ? 43   MET A SD  1 
ATOM   297  C  CE  . MET A 1  43  ? -17.772 58.120 48.673 1.00 39.65 ? 43   MET A CE  1 
ATOM   298  N  N   . ARG A 1  44  ? -17.680 56.220 54.816 1.00 26.15 ? 44   ARG A N   1 
ATOM   299  C  CA  . ARG A 1  44  ? -16.578 56.261 55.800 1.00 25.29 ? 44   ARG A CA  1 
ATOM   300  C  C   . ARG A 1  44  ? -15.729 55.033 55.576 1.00 25.05 ? 44   ARG A C   1 
ATOM   301  O  O   . ARG A 1  44  ? -16.274 53.944 55.437 1.00 25.71 ? 44   ARG A O   1 
ATOM   302  C  CB  . ARG A 1  44  ? -17.089 56.280 57.248 1.00 24.88 ? 44   ARG A CB  1 
ATOM   303  C  CG  . ARG A 1  44  ? -15.966 56.411 58.274 1.00 23.21 ? 44   ARG A CG  1 
ATOM   304  C  CD  . ARG A 1  44  ? -16.453 56.364 59.682 1.00 18.17 ? 44   ARG A CD  1 
ATOM   305  N  NE  . ARG A 1  44  ? -17.006 57.627 60.123 1.00 16.84 ? 44   ARG A NE  1 
ATOM   306  C  CZ  . ARG A 1  44  ? -17.681 57.771 61.252 1.00 15.24 ? 44   ARG A CZ  1 
ATOM   307  N  NH1 . ARG A 1  44  ? -17.886 56.726 62.047 1.00 17.92 ? 44   ARG A NH1 1 
ATOM   308  N  NH2 . ARG A 1  44  ? -18.134 58.953 61.592 1.00 17.78 ? 44   ARG A NH2 1 
ATOM   309  N  N   . PHE A 1  45  ? -14.411 55.220 55.512 1.00 24.20 ? 45   PHE A N   1 
ATOM   310  C  CA  . PHE A 1  45  ? -13.415 54.141 55.323 1.00 24.52 ? 45   PHE A CA  1 
ATOM   311  C  C   . PHE A 1  45  ? -13.231 53.673 53.870 1.00 24.50 ? 45   PHE A C   1 
ATOM   312  O  O   . PHE A 1  45  ? -12.266 52.932 53.569 1.00 24.26 ? 45   PHE A O   1 
ATOM   313  C  CB  . PHE A 1  45  ? -13.600 52.912 56.253 1.00 24.51 ? 45   PHE A CB  1 
ATOM   314  C  CG  . PHE A 1  45  ? -13.918 53.240 57.709 1.00 25.10 ? 45   PHE A CG  1 
ATOM   315  C  CD1 . PHE A 1  45  ? -13.081 54.036 58.474 1.00 25.33 ? 45   PHE A CD1 1 
ATOM   316  C  CD2 . PHE A 1  45  ? -15.049 52.672 58.328 1.00 26.32 ? 45   PHE A CD2 1 
ATOM   317  C  CE1 . PHE A 1  45  ? -13.389 54.314 59.837 1.00 26.13 ? 45   PHE A CE1 1 
ATOM   318  C  CE2 . PHE A 1  45  ? -15.366 52.936 59.684 1.00 26.76 ? 45   PHE A CE2 1 
ATOM   319  C  CZ  . PHE A 1  45  ? -14.531 53.763 60.437 1.00 25.80 ? 45   PHE A CZ  1 
ATOM   320  N  N   . ARG A 1  46  ? -14.133 54.112 52.986 1.00 24.47 ? 46   ARG A N   1 
ATOM   321  C  CA  . ARG A 1  46  ? -14.084 53.750 51.553 1.00 25.20 ? 46   ARG A CA  1 
ATOM   322  C  C   . ARG A 1  46  ? -13.098 54.569 50.714 1.00 24.26 ? 46   ARG A C   1 
ATOM   323  O  O   . ARG A 1  46  ? -12.755 55.705 51.060 1.00 22.41 ? 46   ARG A O   1 
ATOM   324  C  CB  . ARG A 1  46  ? -15.482 53.854 50.911 1.00 25.87 ? 46   ARG A CB  1 
ATOM   325  C  CG  . ARG A 1  46  ? -16.450 52.728 51.296 1.00 29.65 ? 46   ARG A CG  1 
ATOM   326  C  CD  . ARG A 1  46  ? -17.746 52.756 50.454 1.00 34.46 ? 46   ARG A CD  1 
ATOM   327  N  NE  . ARG A 1  46  ? -17.464 52.536 49.033 1.00 39.94 ? 46   ARG A NE  1 
ATOM   328  C  CZ  . ARG A 1  46  ? -17.482 51.349 48.416 1.00 42.92 ? 46   ARG A CZ  1 
ATOM   329  N  NH1 . ARG A 1  46  ? -17.803 50.246 49.079 1.00 44.33 ? 46   ARG A NH1 1 
ATOM   330  N  NH2 . ARG A 1  46  ? -17.195 51.262 47.114 1.00 43.98 ? 46   ARG A NH2 1 
ATOM   331  N  N   . ARG A 1  47  ? -12.666 53.985 49.594 1.00 24.31 ? 47   ARG A N   1 
ATOM   332  C  CA  . ARG A 1  47  ? -11.996 54.747 48.536 1.00 24.49 ? 47   ARG A CA  1 
ATOM   333  C  C   . ARG A 1  47  ? -12.739 56.038 48.263 1.00 22.79 ? 47   ARG A C   1 
ATOM   334  O  O   . ARG A 1  47  ? -13.958 56.077 48.319 1.00 22.29 ? 47   ARG A O   1 
ATOM   335  C  CB  . ARG A 1  47  ? -11.916 53.931 47.233 1.00 25.89 ? 47   ARG A CB  1 
ATOM   336  C  CG  . ARG A 1  47  ? -11.029 52.696 47.395 1.00 30.65 ? 47   ARG A CG  1 
ATOM   337  C  CD  . ARG A 1  47  ? -10.662 51.998 46.064 1.00 37.53 ? 47   ARG A CD  1 
ATOM   338  N  NE  . ARG A 1  47  ? -9.659  50.949 46.317 1.00 43.15 ? 47   ARG A NE  1 
ATOM   339  C  CZ  . ARG A 1  47  ? -9.908  49.793 46.948 1.00 45.50 ? 47   ARG A CZ  1 
ATOM   340  N  NH1 . ARG A 1  47  ? -11.138 49.506 47.404 1.00 44.42 ? 47   ARG A NH1 1 
ATOM   341  N  NH2 . ARG A 1  47  ? -8.928  48.912 47.120 1.00 46.64 ? 47   ARG A NH2 1 
ATOM   342  N  N   . PRO A 1  48  ? -12.005 57.113 47.982 1.00 22.27 ? 48   PRO A N   1 
ATOM   343  C  CA  . PRO A 1  48  ? -12.746 58.323 47.644 1.00 22.55 ? 48   PRO A CA  1 
ATOM   344  C  C   . PRO A 1  48  ? -13.435 58.184 46.279 1.00 23.01 ? 48   PRO A C   1 
ATOM   345  O  O   . PRO A 1  48  ? -12.995 57.393 45.447 1.00 21.81 ? 48   PRO A O   1 
ATOM   346  C  CB  . PRO A 1  48  ? -11.649 59.386 47.543 1.00 21.73 ? 48   PRO A CB  1 
ATOM   347  C  CG  . PRO A 1  48  ? -10.387 58.598 47.200 1.00 22.07 ? 48   PRO A CG  1 
ATOM   348  C  CD  . PRO A 1  48  ? -10.540 57.285 47.892 1.00 21.33 ? 48   PRO A CD  1 
ATOM   349  N  N   . GLU A 1  49  ? -14.482 58.976 46.059 1.00 24.31 ? 49   GLU A N   1 
ATOM   350  C  CA  . GLU A 1  49  ? -15.109 59.081 44.742 1.00 25.49 ? 49   GLU A CA  1 
ATOM   351  C  C   . GLU A 1  49  ? -14.837 60.450 44.175 1.00 24.99 ? 49   GLU A C   1 
ATOM   352  O  O   . GLU A 1  49  ? -14.792 61.427 44.916 1.00 24.74 ? 49   GLU A O   1 
ATOM   353  C  CB  . GLU A 1  49  ? -16.630 58.844 44.821 1.00 26.22 ? 49   GLU A CB  1 
ATOM   354  C  CG  . GLU A 1  49  ? -17.076 57.389 45.104 1.00 31.15 ? 49   GLU A CG  1 
ATOM   355  C  CD  . GLU A 1  49  ? -16.261 56.316 44.353 1.00 37.59 ? 49   GLU A CD  1 
ATOM   356  O  OE1 . GLU A 1  49  ? -15.969 56.503 43.140 1.00 39.78 ? 49   GLU A OE1 1 
ATOM   357  O  OE2 . GLU A 1  49  ? -15.913 55.271 44.978 1.00 40.24 ? 49   GLU A OE2 1 
ATOM   358  N  N   . PRO A 1  50  ? -14.659 60.542 42.848 1.00 25.31 ? 50   PRO A N   1 
ATOM   359  C  CA  . PRO A 1  50  ? -14.507 61.857 42.216 1.00 25.01 ? 50   PRO A CA  1 
ATOM   360  C  C   . PRO A 1  50  ? -15.683 62.769 42.554 1.00 25.01 ? 50   PRO A C   1 
ATOM   361  O  O   . PRO A 1  50  ? -16.818 62.298 42.648 1.00 24.72 ? 50   PRO A O   1 
ATOM   362  C  CB  . PRO A 1  50  ? -14.531 61.537 40.712 1.00 25.64 ? 50   PRO A CB  1 
ATOM   363  C  CG  . PRO A 1  50  ? -14.289 60.072 40.598 1.00 25.69 ? 50   PRO A CG  1 
ATOM   364  C  CD  . PRO A 1  50  ? -14.729 59.437 41.870 1.00 25.07 ? 50   PRO A CD  1 
ATOM   365  N  N   . LYS A 1  51  ? -15.422 64.055 42.748 1.00 25.14 ? 51   LYS A N   1 
ATOM   366  C  CA  . LYS A 1  51  ? -16.496 64.996 43.015 1.00 26.53 ? 51   LYS A CA  1 
ATOM   367  C  C   . LYS A 1  51  ? -17.407 65.060 41.763 1.00 26.79 ? 51   LYS A C   1 
ATOM   368  O  O   . LYS A 1  51  ? -16.906 65.104 40.630 1.00 26.37 ? 51   LYS A O   1 
ATOM   369  C  CB  . LYS A 1  51  ? -15.877 66.360 43.371 1.00 26.44 ? 51   LYS A CB  1 
ATOM   370  C  CG  . LYS A 1  51  ? -16.837 67.519 43.487 1.00 27.03 ? 51   LYS A CG  1 
ATOM   371  C  CD  . LYS A 1  51  ? -17.763 67.335 44.654 1.00 27.11 ? 51   LYS A CD  1 
ATOM   372  C  CE  . LYS A 1  51  ? -18.693 68.498 44.754 1.00 27.63 ? 51   LYS A CE  1 
ATOM   373  N  NZ  . LYS A 1  51  ? -19.362 68.418 46.077 1.00 31.10 ? 51   LYS A NZ  1 
ATOM   374  N  N   . LYS A 1  52  ? -18.723 65.001 41.944 1.00 27.50 ? 52   LYS A N   1 
ATOM   375  C  CA  . LYS A 1  52  ? -19.613 65.189 40.791 1.00 28.38 ? 52   LYS A CA  1 
ATOM   376  C  C   . LYS A 1  52  ? -19.589 66.669 40.405 1.00 27.86 ? 52   LYS A C   1 
ATOM   377  O  O   . LYS A 1  52  ? -19.709 67.538 41.283 1.00 28.21 ? 52   LYS A O   1 
ATOM   378  C  CB  . LYS A 1  52  ? -21.073 64.800 41.052 1.00 28.66 ? 52   LYS A CB  1 
ATOM   379  C  CG  . LYS A 1  52  ? -21.359 63.623 41.931 1.00 32.67 ? 52   LYS A CG  1 
ATOM   380  C  CD  . LYS A 1  52  ? -22.743 63.839 42.572 1.00 38.10 ? 52   LYS A CD  1 
ATOM   381  C  CE  . LYS A 1  52  ? -23.107 62.786 43.628 1.00 41.52 ? 52   LYS A CE  1 
ATOM   382  N  NZ  . LYS A 1  52  ? -23.334 61.433 42.992 1.00 44.25 ? 52   LYS A NZ  1 
ATOM   383  N  N   . PRO A 1  53  ? -19.465 66.962 39.096 1.00 27.60 ? 53   PRO A N   1 
ATOM   384  C  CA  . PRO A 1  53  ? -19.449 68.346 38.614 1.00 27.47 ? 53   PRO A CA  1 
ATOM   385  C  C   . PRO A 1  53  ? -20.660 69.153 39.099 1.00 27.45 ? 53   PRO A C   1 
ATOM   386  O  O   . PRO A 1  53  ? -21.738 68.598 39.290 1.00 27.65 ? 53   PRO A O   1 
ATOM   387  C  CB  . PRO A 1  53  ? -19.487 68.183 37.103 1.00 27.23 ? 53   PRO A CB  1 
ATOM   388  C  CG  . PRO A 1  53  ? -18.835 66.874 36.860 1.00 28.08 ? 53   PRO A CG  1 
ATOM   389  C  CD  . PRO A 1  53  ? -19.197 65.997 38.009 1.00 27.79 ? 53   PRO A CD  1 
ATOM   390  N  N   . TRP A 1  54  ? -20.470 70.446 39.322 1.00 27.54 ? 54   TRP A N   1 
ATOM   391  C  CA  . TRP A 1  54  ? -21.524 71.266 39.877 1.00 27.89 ? 54   TRP A CA  1 
ATOM   392  C  C   . TRP A 1  54  ? -21.918 72.291 38.826 1.00 29.21 ? 54   TRP A C   1 
ATOM   393  O  O   . TRP A 1  54  ? -21.099 72.687 37.988 1.00 29.15 ? 54   TRP A O   1 
ATOM   394  C  CB  . TRP A 1  54  ? -21.070 71.939 41.181 1.00 27.44 ? 54   TRP A CB  1 
ATOM   395  C  CG  . TRP A 1  54  ? -19.801 72.725 41.008 1.00 25.61 ? 54   TRP A CG  1 
ATOM   396  C  CD1 . TRP A 1  54  ? -19.690 74.009 40.579 1.00 24.53 ? 54   TRP A CD1 1 
ATOM   397  C  CD2 . TRP A 1  54  ? -18.465 72.259 41.234 1.00 24.42 ? 54   TRP A CD2 1 
ATOM   398  N  NE1 . TRP A 1  54  ? -18.357 74.379 40.510 1.00 25.05 ? 54   TRP A NE1 1 
ATOM   399  C  CE2 . TRP A 1  54  ? -17.592 73.318 40.921 1.00 24.44 ? 54   TRP A CE2 1 
ATOM   400  C  CE3 . TRP A 1  54  ? -17.922 71.045 41.663 1.00 23.92 ? 54   TRP A CE3 1 
ATOM   401  C  CZ2 . TRP A 1  54  ? -16.210 73.192 41.022 1.00 26.43 ? 54   TRP A CZ2 1 
ATOM   402  C  CZ3 . TRP A 1  54  ? -16.543 70.928 41.773 1.00 23.42 ? 54   TRP A CZ3 1 
ATOM   403  C  CH2 . TRP A 1  54  ? -15.706 71.985 41.455 1.00 23.16 ? 54   TRP A CH2 1 
ATOM   404  N  N   . SER A 1  55  ? -23.191 72.688 38.847 1.00 30.71 ? 55   SER A N   1 
ATOM   405  C  CA  . SER A 1  55  ? -23.650 73.837 38.066 1.00 31.85 ? 55   SER A CA  1 
ATOM   406  C  C   . SER A 1  55  ? -23.306 75.102 38.834 1.00 31.33 ? 55   SER A C   1 
ATOM   407  O  O   . SER A 1  55  ? -23.056 75.056 40.043 1.00 31.65 ? 55   SER A O   1 
ATOM   408  C  CB  . SER A 1  55  ? -25.159 73.766 37.849 1.00 32.13 ? 55   SER A CB  1 
ATOM   409  O  OG  . SER A 1  55  ? -25.453 72.923 36.745 1.00 36.28 ? 55   SER A OG  1 
ATOM   410  N  N   . GLY A 1  56  ? -23.292 76.235 38.156 1.00 30.79 ? 56   GLY A N   1 
ATOM   411  C  CA  . GLY A 1  56  ? -23.054 77.467 38.873 1.00 29.80 ? 56   GLY A CA  1 
ATOM   412  C  C   . GLY A 1  56  ? -21.612 77.637 39.287 1.00 29.28 ? 56   GLY A C   1 
ATOM   413  O  O   . GLY A 1  56  ? -20.736 76.952 38.787 1.00 28.83 ? 56   GLY A O   1 
ATOM   414  N  N   . VAL A 1  57  ? -21.379 78.581 40.194 1.00 29.10 ? 57   VAL A N   1 
ATOM   415  C  CA  . VAL A 1  57  ? -20.039 79.040 40.533 1.00 28.47 ? 57   VAL A CA  1 
ATOM   416  C  C   . VAL A 1  57  ? -19.732 78.598 41.959 1.00 28.69 ? 57   VAL A C   1 
ATOM   417  O  O   . VAL A 1  57  ? -20.513 78.860 42.873 1.00 28.09 ? 57   VAL A O   1 
ATOM   418  C  CB  . VAL A 1  57  ? -19.928 80.571 40.392 1.00 28.66 ? 57   VAL A CB  1 
ATOM   419  C  CG1 . VAL A 1  57  ? -18.566 81.058 40.856 1.00 27.44 ? 57   VAL A CG1 1 
ATOM   420  C  CG2 . VAL A 1  57  ? -20.182 81.000 38.923 1.00 27.47 ? 57   VAL A CG2 1 
ATOM   421  N  N   . TRP A 1  58  ? -18.626 77.870 42.130 1.00 28.91 ? 58   TRP A N   1 
ATOM   422  C  CA  . TRP A 1  58  ? -18.178 77.458 43.465 1.00 28.97 ? 58   TRP A CA  1 
ATOM   423  C  C   . TRP A 1  58  ? -17.468 78.633 44.114 1.00 28.94 ? 58   TRP A C   1 
ATOM   424  O  O   . TRP A 1  58  ? -16.475 79.142 43.563 1.00 28.18 ? 58   TRP A O   1 
ATOM   425  C  CB  . TRP A 1  58  ? -17.231 76.245 43.416 1.00 28.74 ? 58   TRP A CB  1 
ATOM   426  C  CG  . TRP A 1  58  ? -16.962 75.649 44.803 1.00 28.43 ? 58   TRP A CG  1 
ATOM   427  C  CD1 . TRP A 1  58  ? -16.020 76.064 45.712 1.00 26.41 ? 58   TRP A CD1 1 
ATOM   428  C  CD2 . TRP A 1  58  ? -17.662 74.558 45.425 1.00 26.38 ? 58   TRP A CD2 1 
ATOM   429  N  NE1 . TRP A 1  58  ? -16.100 75.304 46.854 1.00 26.26 ? 58   TRP A NE1 1 
ATOM   430  C  CE2 . TRP A 1  58  ? -17.098 74.377 46.709 1.00 25.92 ? 58   TRP A CE2 1 
ATOM   431  C  CE3 . TRP A 1  58  ? -18.720 73.735 45.030 1.00 27.85 ? 58   TRP A CE3 1 
ATOM   432  C  CZ2 . TRP A 1  58  ? -17.540 73.379 47.598 1.00 27.10 ? 58   TRP A CZ2 1 
ATOM   433  C  CZ3 . TRP A 1  58  ? -19.165 72.736 45.915 1.00 29.73 ? 58   TRP A CZ3 1 
ATOM   434  C  CH2 . TRP A 1  58  ? -18.572 72.573 47.187 1.00 27.82 ? 58   TRP A CH2 1 
ATOM   435  N  N   . ASN A 1  59  ? -17.986 79.058 45.274 1.00 29.35 ? 59   ASN A N   1 
ATOM   436  C  CA  . ASN A 1  59  ? -17.318 80.067 46.109 1.00 29.97 ? 59   ASN A CA  1 
ATOM   437  C  C   . ASN A 1  59  ? -16.025 79.488 46.700 1.00 29.01 ? 59   ASN A C   1 
ATOM   438  O  O   . ASN A 1  59  ? -16.090 78.633 47.570 1.00 29.32 ? 59   ASN A O   1 
ATOM   439  C  CB  . ASN A 1  59  ? -18.248 80.564 47.233 1.00 30.50 ? 59   ASN A CB  1 
ATOM   440  C  CG  . ASN A 1  59  ? -17.719 81.828 47.926 1.00 35.33 ? 59   ASN A CG  1 
ATOM   441  O  OD1 . ASN A 1  59  ? -16.538 82.177 47.794 1.00 31.64 ? 59   ASN A OD1 1 
ATOM   442  N  ND2 . ASN A 1  59  ? -18.602 82.517 48.683 1.00 42.14 ? 59   ASN A ND2 1 
ATOM   443  N  N   . ALA A 1  60  ? -14.870 79.943 46.213 1.00 28.05 ? 60   ALA A N   1 
ATOM   444  C  CA  . ALA A 1  60  ? -13.564 79.464 46.699 1.00 27.68 ? 60   ALA A CA  1 
ATOM   445  C  C   . ALA A 1  60  ? -12.785 80.601 47.358 1.00 27.09 ? 60   ALA A C   1 
ATOM   446  O  O   . ALA A 1  60  ? -11.575 80.773 47.149 1.00 26.19 ? 60   ALA A O   1 
ATOM   447  C  CB  . ALA A 1  60  ? -12.728 78.805 45.542 1.00 26.74 ? 60   ALA A CB  1 
ATOM   448  N  N   . SER A 1  61  ? -13.505 81.382 48.148 1.00 27.11 ? 61   SER A N   1 
ATOM   449  C  CA  . SER A 1  61  ? -12.938 82.551 48.820 1.00 27.47 ? 61   SER A CA  1 
ATOM   450  C  C   . SER A 1  61  ? -12.374 82.200 50.204 1.00 27.15 ? 61   SER A C   1 
ATOM   451  O  O   . SER A 1  61  ? -11.548 82.947 50.741 1.00 27.00 ? 61   SER A O   1 
ATOM   452  C  CB  . SER A 1  61  ? -14.006 83.648 48.943 1.00 27.27 ? 61   SER A CB  1 
ATOM   453  O  OG  . SER A 1  61  ? -15.115 83.115 49.639 1.00 28.98 ? 61   SER A OG  1 
ATOM   454  N  N   . THR A 1  62  ? -12.809 81.058 50.760 1.00 26.57 ? 62   THR A N   1 
ATOM   455  C  CA  . THR A 1  62  ? -12.466 80.677 52.143 1.00 26.47 ? 62   THR A CA  1 
ATOM   456  C  C   . THR A 1  62  ? -11.962 79.222 52.365 1.00 25.48 ? 62   THR A C   1 
ATOM   457  O  O   . THR A 1  62  ? -12.406 78.260 51.695 1.00 25.59 ? 62   THR A O   1 
ATOM   458  C  CB  . THR A 1  62  ? -13.646 80.947 53.110 1.00 26.82 ? 62   THR A CB  1 
ATOM   459  O  OG1 . THR A 1  62  ? -14.616 79.902 52.960 1.00 28.67 ? 62   THR A OG1 1 
ATOM   460  C  CG2 . THR A 1  62  ? -14.308 82.323 52.835 1.00 27.89 ? 62   THR A CG2 1 
ATOM   461  N  N   . TYR A 1  63  ? -11.058 79.069 53.337 1.00 23.76 ? 63   TYR A N   1 
ATOM   462  C  CA  . TYR A 1  63  ? -10.453 77.767 53.658 1.00 22.24 ? 63   TYR A CA  1 
ATOM   463  C  C   . TYR A 1  63  ? -11.545 76.738 53.980 1.00 21.43 ? 63   TYR A C   1 
ATOM   464  O  O   . TYR A 1  63  ? -12.579 77.097 54.503 1.00 22.28 ? 63   TYR A O   1 
ATOM   465  C  CB  . TYR A 1  63  ? -9.522  77.920 54.847 1.00 21.28 ? 63   TYR A CB  1 
ATOM   466  C  CG  . TYR A 1  63  ? -8.089  78.231 54.525 1.00 22.01 ? 63   TYR A CG  1 
ATOM   467  C  CD1 . TYR A 1  63  ? -7.471  77.694 53.395 1.00 20.38 ? 63   TYR A CD1 1 
ATOM   468  C  CD2 . TYR A 1  63  ? -7.316  79.043 55.385 1.00 21.59 ? 63   TYR A CD2 1 
ATOM   469  C  CE1 . TYR A 1  63  ? -6.135  77.948 53.126 1.00 21.28 ? 63   TYR A CE1 1 
ATOM   470  C  CE2 . TYR A 1  63  ? -5.968  79.310 55.116 1.00 19.33 ? 63   TYR A CE2 1 
ATOM   471  C  CZ  . TYR A 1  63  ? -5.387  78.754 53.997 1.00 21.98 ? 63   TYR A CZ  1 
ATOM   472  O  OH  . TYR A 1  63  ? -4.069  78.986 53.709 1.00 21.82 ? 63   TYR A OH  1 
ATOM   473  N  N   . PRO A 1  64  ? -11.328 75.459 53.648 1.00 20.49 ? 64   PRO A N   1 
ATOM   474  C  CA  . PRO A 1  64  ? -12.312 74.403 53.889 1.00 19.79 ? 64   PRO A CA  1 
ATOM   475  C  C   . PRO A 1  64  ? -12.269 73.863 55.341 1.00 19.86 ? 64   PRO A C   1 
ATOM   476  O  O   . PRO A 1  64  ? -11.396 74.234 56.091 1.00 20.20 ? 64   PRO A O   1 
ATOM   477  C  CB  . PRO A 1  64  ? -11.830 73.315 52.955 1.00 19.69 ? 64   PRO A CB  1 
ATOM   478  C  CG  . PRO A 1  64  ? -10.315 73.472 52.963 1.00 18.85 ? 64   PRO A CG  1 
ATOM   479  C  CD  . PRO A 1  64  ? -10.076 74.937 53.051 1.00 20.06 ? 64   PRO A CD  1 
ATOM   480  N  N   . ASN A 1  65  ? -13.187 72.990 55.720 1.00 19.76 ? 65   ASN A N   1 
ATOM   481  C  CA  . ASN A 1  65  ? -13.059 72.234 56.976 1.00 20.37 ? 65   ASN A CA  1 
ATOM   482  C  C   . ASN A 1  65  ? -11.735 71.436 57.001 1.00 20.26 ? 65   ASN A C   1 
ATOM   483  O  O   . ASN A 1  65  ? -11.159 71.168 55.946 1.00 20.29 ? 65   ASN A O   1 
ATOM   484  C  CB  . ASN A 1  65  ? -14.244 71.264 57.166 1.00 20.30 ? 65   ASN A CB  1 
ATOM   485  C  CG  . ASN A 1  65  ? -15.635 71.996 57.254 1.00 23.35 ? 65   ASN A CG  1 
ATOM   486  O  OD1 . ASN A 1  65  ? -16.616 71.551 56.643 1.00 25.89 ? 65   ASN A OD1 1 
ATOM   487  N  ND2 . ASN A 1  65  ? -15.700 73.097 58.006 1.00 23.19 ? 65   ASN A ND2 1 
ATOM   488  N  N   . ASN A 1  66  ? -11.237 71.111 58.199 1.00 19.51 ? 66   ASN A N   1 
ATOM   489  C  CA  . ASN A 1  66  ? -10.119 70.184 58.344 1.00 19.34 ? 66   ASN A CA  1 
ATOM   490  C  C   . ASN A 1  66  ? -10.712 68.800 58.616 1.00 19.07 ? 66   ASN A C   1 
ATOM   491  O  O   . ASN A 1  66  ? -11.844 68.693 59.105 1.00 18.77 ? 66   ASN A O   1 
ATOM   492  C  CB  . ASN A 1  66  ? -9.136  70.601 59.450 1.00 18.46 ? 66   ASN A CB  1 
ATOM   493  C  CG  . ASN A 1  66  ? -8.626  72.064 59.303 1.00 20.46 ? 66   ASN A CG  1 
ATOM   494  O  OD1 . ASN A 1  66  ? -8.587  72.807 60.290 1.00 20.38 ? 66   ASN A OD1 1 
ATOM   495  N  ND2 . ASN A 1  66  ? -8.230  72.465 58.087 1.00 19.60 ? 66   ASN A ND2 1 
ATOM   496  N  N   . CYS A 1  67  ? -9.961  67.756 58.291 1.00 18.27 ? 67   CYS A N   1 
ATOM   497  C  CA  . CYS A 1  67  ? -10.391 66.398 58.552 1.00 19.08 ? 67   CYS A CA  1 
ATOM   498  C  C   . CYS A 1  67  ? -10.459 66.125 60.042 1.00 19.92 ? 67   CYS A C   1 
ATOM   499  O  O   . CYS A 1  67  ? -9.732  66.743 60.820 1.00 19.90 ? 67   CYS A O   1 
ATOM   500  C  CB  . CYS A 1  67  ? -9.434  65.410 57.860 1.00 19.15 ? 67   CYS A CB  1 
ATOM   501  S  SG  . CYS A 1  67  ? -9.555  65.532 56.027 1.00 19.03 ? 67   CYS A SG  1 
ATOM   502  N  N   . GLN A 1  68  ? -11.356 65.217 60.432 1.00 20.28 ? 68   GLN A N   1 
ATOM   503  C  CA  . GLN A 1  68  ? -11.470 64.783 61.819 1.00 20.30 ? 68   GLN A CA  1 
ATOM   504  C  C   . GLN A 1  68  ? -10.151 64.188 62.305 1.00 20.24 ? 68   GLN A C   1 
ATOM   505  O  O   . GLN A 1  68  ? -9.579  63.301 61.645 1.00 19.88 ? 68   GLN A O   1 
ATOM   506  C  CB  . GLN A 1  68  ? -12.577 63.745 61.949 1.00 20.81 ? 68   GLN A CB  1 
ATOM   507  C  CG  . GLN A 1  68  ? -13.975 64.335 61.788 1.00 22.58 ? 68   GLN A CG  1 
ATOM   508  C  CD  . GLN A 1  68  ? -14.424 65.125 63.016 1.00 24.90 ? 68   GLN A CD  1 
ATOM   509  O  OE1 . GLN A 1  68  ? -15.496 65.716 63.017 1.00 26.62 ? 68   GLN A OE1 1 
ATOM   510  N  NE2 . GLN A 1  68  ? -13.607 65.135 64.054 1.00 21.92 ? 68   GLN A NE2 1 
ATOM   511  N  N   . GLN A 1  69  ? -9.669  64.679 63.447 1.00 19.34 ? 69   GLN A N   1 
ATOM   512  C  CA  . GLN A 1  69  ? -8.373  64.242 63.974 1.00 19.38 ? 69   GLN A CA  1 
ATOM   513  C  C   . GLN A 1  69  ? -8.212  64.475 65.481 1.00 19.65 ? 69   GLN A C   1 
ATOM   514  O  O   . GLN A 1  69  ? -8.826  65.372 66.069 1.00 17.89 ? 69   GLN A O   1 
ATOM   515  C  CB  . GLN A 1  69  ? -7.233  64.960 63.249 1.00 19.07 ? 69   GLN A CB  1 
ATOM   516  C  CG  . GLN A 1  69  ? -7.320  66.494 63.363 1.00 17.98 ? 69   GLN A CG  1 
ATOM   517  C  CD  . GLN A 1  69  ? -6.431  67.201 62.353 1.00 19.90 ? 69   GLN A CD  1 
ATOM   518  O  OE1 . GLN A 1  69  ? -5.233  67.465 62.614 1.00 17.74 ? 69   GLN A OE1 1 
ATOM   519  N  NE2 . GLN A 1  69  ? -7.008  67.500 61.164 1.00 18.47 ? 69   GLN A NE2 1 
ATOM   520  N  N   . TYR A 1  70  ? -7.345  63.672 66.084 1.00 20.41 ? 70   TYR A N   1 
ATOM   521  C  CA  . TYR A 1  70  ? -6.812  63.991 67.398 1.00 21.62 ? 70   TYR A CA  1 
ATOM   522  C  C   . TYR A 1  70  ? -6.318  65.442 67.432 1.00 22.07 ? 70   TYR A C   1 
ATOM   523  O  O   . TYR A 1  70  ? -5.659  65.886 66.479 1.00 22.51 ? 70   TYR A O   1 
ATOM   524  C  CB  . TYR A 1  70  ? -5.660  63.062 67.713 1.00 21.54 ? 70   TYR A CB  1 
ATOM   525  C  CG  . TYR A 1  70  ? -5.014  63.342 69.046 1.00 23.33 ? 70   TYR A CG  1 
ATOM   526  C  CD1 . TYR A 1  70  ? -5.581  62.868 70.253 1.00 22.07 ? 70   TYR A CD1 1 
ATOM   527  C  CD2 . TYR A 1  70  ? -3.827  64.077 69.103 1.00 23.63 ? 70   TYR A CD2 1 
ATOM   528  C  CE1 . TYR A 1  70  ? -4.958  63.135 71.484 1.00 26.29 ? 70   TYR A CE1 1 
ATOM   529  C  CE2 . TYR A 1  70  ? -3.202  64.352 70.312 1.00 25.51 ? 70   TYR A CE2 1 
ATOM   530  C  CZ  . TYR A 1  70  ? -3.761  63.890 71.495 1.00 27.84 ? 70   TYR A CZ  1 
ATOM   531  O  OH  . TYR A 1  70  ? -3.094  64.202 72.662 1.00 29.55 ? 70   TYR A OH  1 
ATOM   532  N  N   . VAL A 1  71  ? -6.635  66.166 68.517 1.00 21.98 ? 71   VAL A N   1 
ATOM   533  C  CA  . VAL A 1  71  ? -6.200  67.565 68.706 1.00 22.34 ? 71   VAL A CA  1 
ATOM   534  C  C   . VAL A 1  71  ? -5.246  67.635 69.906 1.00 23.40 ? 71   VAL A C   1 
ATOM   535  O  O   . VAL A 1  71  ? -5.581  67.173 71.000 1.00 24.36 ? 71   VAL A O   1 
ATOM   536  C  CB  . VAL A 1  71  ? -7.416  68.538 68.925 1.00 22.41 ? 71   VAL A CB  1 
ATOM   537  C  CG1 . VAL A 1  71  ? -6.951  69.978 69.210 1.00 20.71 ? 71   VAL A CG1 1 
ATOM   538  C  CG2 . VAL A 1  71  ? -8.337  68.554 67.706 1.00 22.58 ? 71   VAL A CG2 1 
ATOM   539  N  N   . ASP A 1  72  ? -4.058  68.188 69.693 1.00 23.64 ? 72   ASP A N   1 
ATOM   540  C  CA  . ASP A 1  72  ? -3.021  68.318 70.731 1.00 23.84 ? 72   ASP A CA  1 
ATOM   541  C  C   . ASP A 1  72  ? -3.441  69.356 71.760 1.00 24.38 ? 72   ASP A C   1 
ATOM   542  O  O   . ASP A 1  72  ? -3.526  70.517 71.444 1.00 24.87 ? 72   ASP A O   1 
ATOM   543  C  CB  . ASP A 1  72  ? -1.709  68.745 70.057 1.00 23.09 ? 72   ASP A CB  1 
ATOM   544  C  CG  . ASP A 1  72  ? -0.528  68.935 71.028 1.00 22.56 ? 72   ASP A CG  1 
ATOM   545  O  OD1 . ASP A 1  72  ? -0.613  68.700 72.240 1.00 22.29 ? 72   ASP A OD1 1 
ATOM   546  O  OD2 . ASP A 1  72  ? 0.541   69.318 70.544 1.00 20.39 ? 72   ASP A OD2 1 
ATOM   547  N  N   . GLU A 1  73  ? -3.706  68.931 72.991 1.00 25.52 ? 73   GLU A N   1 
ATOM   548  C  CA  . GLU A 1  73  ? -4.063  69.850 74.077 1.00 26.69 ? 73   GLU A CA  1 
ATOM   549  C  C   . GLU A 1  73  ? -2.991  69.797 75.152 1.00 27.03 ? 73   GLU A C   1 
ATOM   550  O  O   . GLU A 1  73  ? -3.221  70.193 76.299 1.00 27.47 ? 73   GLU A O   1 
ATOM   551  C  CB  . GLU A 1  73  ? -5.399  69.454 74.702 1.00 26.98 ? 73   GLU A CB  1 
ATOM   552  C  CG  . GLU A 1  73  ? -6.640  69.791 73.902 1.00 30.44 ? 73   GLU A CG  1 
ATOM   553  C  CD  . GLU A 1  73  ? -7.928  69.438 74.662 1.00 36.38 ? 73   GLU A CD  1 
ATOM   554  O  OE1 . GLU A 1  73  ? -7.933  69.370 75.915 1.00 38.74 ? 73   GLU A OE1 1 
ATOM   555  O  OE2 . GLU A 1  73  ? -8.961  69.231 74.003 1.00 40.31 ? 73   GLU A OE2 1 
ATOM   556  N  N   . GLN A 1  74  ? -1.814  69.311 74.780 1.00 27.00 ? 74   GLN A N   1 
ATOM   557  C  CA  . GLN A 1  74  ? -0.773  69.012 75.750 1.00 27.33 ? 74   GLN A CA  1 
ATOM   558  C  C   . GLN A 1  74  ? -0.235  70.286 76.405 1.00 27.08 ? 74   GLN A C   1 
ATOM   559  O  O   . GLN A 1  74  ? 0.270   70.219 77.514 1.00 28.01 ? 74   GLN A O   1 
ATOM   560  C  CB  . GLN A 1  74  ? 0.314   68.127 75.105 1.00 27.08 ? 74   GLN A CB  1 
ATOM   561  C  CG  . GLN A 1  74  ? 1.457   67.584 75.984 1.00 30.46 ? 74   GLN A CG  1 
ATOM   562  C  CD  . GLN A 1  74  ? 1.007   66.890 77.272 1.00 34.77 ? 74   GLN A CD  1 
ATOM   563  O  OE1 . GLN A 1  74  ? 0.547   65.745 77.270 1.00 34.14 ? 74   GLN A OE1 1 
ATOM   564  N  NE2 . GLN A 1  74  ? 1.170   67.590 78.390 1.00 36.38 ? 74   GLN A NE2 1 
ATOM   565  N  N   . PHE A 1  75  ? -0.390  71.437 75.733 1.00 25.98 ? 75   PHE A N   1 
ATOM   566  C  CA  . PHE A 1  75  ? 0.007   72.753 76.245 1.00 24.71 ? 75   PHE A CA  1 
ATOM   567  C  C   . PHE A 1  75  ? -1.007  73.833 75.800 1.00 25.25 ? 75   PHE A C   1 
ATOM   568  O  O   . PHE A 1  75  ? -0.762  74.565 74.838 1.00 24.60 ? 75   PHE A O   1 
ATOM   569  C  CB  . PHE A 1  75  ? 1.405   73.148 75.730 1.00 24.07 ? 75   PHE A CB  1 
ATOM   570  C  CG  . PHE A 1  75  ? 2.481   72.126 76.007 1.00 21.59 ? 75   PHE A CG  1 
ATOM   571  C  CD1 . PHE A 1  75  ? 3.006   71.973 77.291 1.00 19.22 ? 75   PHE A CD1 1 
ATOM   572  C  CD2 . PHE A 1  75  ? 2.983   71.324 74.973 1.00 20.33 ? 75   PHE A CD2 1 
ATOM   573  C  CE1 . PHE A 1  75  ? 3.987   71.022 77.547 1.00 19.07 ? 75   PHE A CE1 1 
ATOM   574  C  CE2 . PHE A 1  75  ? 3.964   70.369 75.214 1.00 17.90 ? 75   PHE A CE2 1 
ATOM   575  C  CZ  . PHE A 1  75  ? 4.472   70.212 76.508 1.00 18.73 ? 75   PHE A CZ  1 
ATOM   576  N  N   . PRO A 1  76  ? -2.156  73.929 76.486 1.00 25.82 ? 76   PRO A N   1 
ATOM   577  C  CA  . PRO A 1  76  ? -3.221  74.838 76.021 1.00 26.19 ? 76   PRO A CA  1 
ATOM   578  C  C   . PRO A 1  76  ? -2.766  76.299 75.946 1.00 26.72 ? 76   PRO A C   1 
ATOM   579  O  O   . PRO A 1  76  ? -2.104  76.802 76.861 1.00 26.54 ? 76   PRO A O   1 
ATOM   580  C  CB  . PRO A 1  76  ? -4.324  74.641 77.065 1.00 25.98 ? 76   PRO A CB  1 
ATOM   581  C  CG  . PRO A 1  76  ? -4.103  73.229 77.553 1.00 25.74 ? 76   PRO A CG  1 
ATOM   582  C  CD  . PRO A 1  76  ? -2.600  73.130 77.645 1.00 26.09 ? 76   PRO A CD  1 
ATOM   583  N  N   . GLY A 1  77  ? -3.079  76.945 74.826 1.00 27.17 ? 77   GLY A N   1 
ATOM   584  C  CA  . GLY A 1  77  ? -2.635  78.313 74.556 1.00 27.93 ? 77   GLY A CA  1 
ATOM   585  C  C   . GLY A 1  77  ? -1.169  78.495 74.152 1.00 28.26 ? 77   GLY A C   1 
ATOM   586  O  O   . GLY A 1  77  ? -0.711  79.625 73.908 1.00 29.71 ? 77   GLY A O   1 
ATOM   587  N  N   . PHE A 1  78  ? -0.402  77.414 74.104 1.00 26.90 ? 78   PHE A N   1 
ATOM   588  C  CA  . PHE A 1  78  ? 0.973   77.547 73.702 1.00 26.16 ? 78   PHE A CA  1 
ATOM   589  C  C   . PHE A 1  78  ? 0.985   77.572 72.177 1.00 25.78 ? 78   PHE A C   1 
ATOM   590  O  O   . PHE A 1  78  ? 0.375   76.720 71.548 1.00 25.66 ? 78   PHE A O   1 
ATOM   591  C  CB  . PHE A 1  78  ? 1.761   76.363 74.250 1.00 26.20 ? 78   PHE A CB  1 
ATOM   592  C  CG  . PHE A 1  78  ? 3.209   76.403 73.929 1.00 25.55 ? 78   PHE A CG  1 
ATOM   593  C  CD1 . PHE A 1  78  ? 3.994   77.500 74.322 1.00 24.50 ? 78   PHE A CD1 1 
ATOM   594  C  CD2 . PHE A 1  78  ? 3.807   75.333 73.264 1.00 21.27 ? 78   PHE A CD2 1 
ATOM   595  C  CE1 . PHE A 1  78  ? 5.353   77.523 74.024 1.00 22.98 ? 78   PHE A CE1 1 
ATOM   596  C  CE2 . PHE A 1  78  ? 5.131   75.350 72.964 1.00 21.07 ? 78   PHE A CE2 1 
ATOM   597  C  CZ  . PHE A 1  78  ? 5.924   76.451 73.349 1.00 23.21 ? 78   PHE A CZ  1 
ATOM   598  N  N   . SER A 1  79  ? 1.660   78.541 71.577 1.00 25.17 ? 79   SER A N   1 
ATOM   599  C  CA  . SER A 1  79  ? 1.595   78.681 70.118 1.00 25.57 ? 79   SER A CA  1 
ATOM   600  C  C   . SER A 1  79  ? 2.426   77.604 69.406 1.00 25.20 ? 79   SER A C   1 
ATOM   601  O  O   . SER A 1  79  ? 2.092   77.205 68.290 1.00 25.20 ? 79   SER A O   1 
ATOM   602  C  CB  . SER A 1  79  ? 2.000   80.078 69.658 1.00 24.92 ? 79   SER A CB  1 
ATOM   603  O  OG  . SER A 1  79  ? 3.357   80.327 70.021 1.00 27.13 ? 79   SER A OG  1 
ATOM   604  N  N   . GLY A 1  80  ? 3.478   77.121 70.070 1.00 24.79 ? 80   GLY A N   1 
ATOM   605  C  CA  . GLY A 1  80  ? 4.364   76.106 69.510 1.00 23.18 ? 80   GLY A CA  1 
ATOM   606  C  C   . GLY A 1  80  ? 3.649   74.834 69.106 1.00 23.04 ? 80   GLY A C   1 
ATOM   607  O  O   . GLY A 1  80  ? 4.034   74.174 68.127 1.00 22.45 ? 80   GLY A O   1 
ATOM   608  N  N   . SER A 1  81  ? 2.623   74.468 69.868 1.00 22.21 ? 81   SER A N   1 
ATOM   609  C  CA  . SER A 1  81  ? 1.883   73.245 69.596 1.00 22.13 ? 81   SER A CA  1 
ATOM   610  C  C   . SER A 1  81  ? 0.577   73.544 68.887 1.00 22.51 ? 81   SER A C   1 
ATOM   611  O  O   . SER A 1  81  ? 0.161   72.791 68.008 1.00 21.99 ? 81   SER A O   1 
ATOM   612  C  CB  . SER A 1  81  ? 1.619   72.476 70.886 1.00 21.84 ? 81   SER A CB  1 
ATOM   613  O  OG  . SER A 1  81  ? 1.114   73.335 71.899 1.00 21.54 ? 81   SER A OG  1 
ATOM   614  N  N   . GLU A 1  82  ? -0.072  74.643 69.275 1.00 22.78 ? 82   GLU A N   1 
ATOM   615  C  CA  . GLU A 1  82  ? -1.343  75.010 68.695 1.00 24.11 ? 82   GLU A CA  1 
ATOM   616  C  C   . GLU A 1  82  ? -1.298  75.409 67.220 1.00 23.37 ? 82   GLU A C   1 
ATOM   617  O  O   . GLU A 1  82  ? -2.302  75.257 66.533 1.00 23.20 ? 82   GLU A O   1 
ATOM   618  C  CB  . GLU A 1  82  ? -2.072  76.041 69.559 1.00 24.74 ? 82   GLU A CB  1 
ATOM   619  C  CG  . GLU A 1  82  ? -2.797  75.328 70.701 1.00 30.28 ? 82   GLU A CG  1 
ATOM   620  C  CD  . GLU A 1  82  ? -3.360  76.286 71.702 1.00 35.94 ? 82   GLU A CD  1 
ATOM   621  O  OE1 . GLU A 1  82  ? -3.145  77.498 71.497 1.00 37.25 ? 82   GLU A OE1 1 
ATOM   622  O  OE2 . GLU A 1  82  ? -4.012  75.831 72.681 1.00 37.60 ? 82   GLU A OE2 1 
ATOM   623  N  N   . MET A 1  83  ? -0.135  75.863 66.744 1.00 22.55 ? 83   MET A N   1 
ATOM   624  C  CA  . MET A 1  83  ? 0.040   76.227 65.348 1.00 22.64 ? 83   MET A CA  1 
ATOM   625  C  C   . MET A 1  83  ? -0.067  75.002 64.399 1.00 22.28 ? 83   MET A C   1 
ATOM   626  O  O   . MET A 1  83  ? -0.113  75.157 63.189 1.00 22.40 ? 83   MET A O   1 
ATOM   627  C  CB  . MET A 1  83  ? 1.361   76.975 65.141 1.00 22.06 ? 83   MET A CB  1 
ATOM   628  C  CG  . MET A 1  83  ? 2.605   76.103 65.240 1.00 24.30 ? 83   MET A CG  1 
ATOM   629  S  SD  . MET A 1  83  ? 4.111   76.864 64.637 1.00 29.21 ? 83   MET A SD  1 
ATOM   630  C  CE  . MET A 1  83  ? 4.018   76.440 62.910 1.00 29.84 ? 83   MET A CE  1 
ATOM   631  N  N   . TRP A 1  84  ? -0.111  73.800 64.976 1.00 22.25 ? 84   TRP A N   1 
ATOM   632  C  CA  . TRP A 1  84  ? -0.192  72.536 64.235 1.00 21.96 ? 84   TRP A CA  1 
ATOM   633  C  C   . TRP A 1  84  ? -1.580  71.935 64.277 1.00 21.61 ? 84   TRP A C   1 
ATOM   634  O  O   . TRP A 1  84  ? -1.883  71.014 63.520 1.00 22.39 ? 84   TRP A O   1 
ATOM   635  C  CB  . TRP A 1  84  ? 0.843   71.515 64.754 1.00 20.82 ? 84   TRP A CB  1 
ATOM   636  C  CG  . TRP A 1  84  ? 2.237   72.024 64.704 1.00 21.19 ? 84   TRP A CG  1 
ATOM   637  C  CD1 . TRP A 1  84  ? 3.004   72.432 65.766 1.00 22.96 ? 84   TRP A CD1 1 
ATOM   638  C  CD2 . TRP A 1  84  ? 3.044   72.223 63.534 1.00 20.17 ? 84   TRP A CD2 1 
ATOM   639  N  NE1 . TRP A 1  84  ? 4.245   72.851 65.326 1.00 21.97 ? 84   TRP A NE1 1 
ATOM   640  C  CE2 . TRP A 1  84  ? 4.294   72.726 63.963 1.00 21.69 ? 84   TRP A CE2 1 
ATOM   641  C  CE3 . TRP A 1  84  ? 2.834   72.016 62.165 1.00 19.40 ? 84   TRP A CE3 1 
ATOM   642  C  CZ2 . TRP A 1  84  ? 5.339   73.013 63.068 1.00 24.55 ? 84   TRP A CZ2 1 
ATOM   643  C  CZ3 . TRP A 1  84  ? 3.861   72.307 61.278 1.00 21.77 ? 84   TRP A CZ3 1 
ATOM   644  C  CH2 . TRP A 1  84  ? 5.104   72.800 61.733 1.00 24.28 ? 84   TRP A CH2 1 
ATOM   645  N  N   . ASN A 1  85  ? -2.406  72.445 65.177 1.00 21.51 ? 85   ASN A N   1 
ATOM   646  C  CA  . ASN A 1  85  ? -3.766  71.960 65.368 1.00 21.40 ? 85   ASN A CA  1 
ATOM   647  C  C   . ASN A 1  85  ? -4.673  72.510 64.294 1.00 20.68 ? 85   ASN A C   1 
ATOM   648  O  O   . ASN A 1  85  ? -4.409  73.590 63.769 1.00 20.52 ? 85   ASN A O   1 
ATOM   649  C  CB  . ASN A 1  85  ? -4.316  72.433 66.732 1.00 21.61 ? 85   ASN A CB  1 
ATOM   650  C  CG  . ASN A 1  85  ? -3.908  71.520 67.905 1.00 23.09 ? 85   ASN A CG  1 
ATOM   651  O  OD1 . ASN A 1  85  ? -3.515  70.357 67.720 1.00 25.01 ? 85   ASN A OD1 1 
ATOM   652  N  ND2 . ASN A 1  85  ? -4.022  72.052 69.121 1.00 23.07 ? 85   ASN A ND2 1 
ATOM   653  N  N   . PRO A 1  86  ? -5.773  71.806 64.002 1.00 20.15 ? 86   PRO A N   1 
ATOM   654  C  CA  . PRO A 1  86  ? -6.792  72.352 63.098 1.00 20.13 ? 86   PRO A CA  1 
ATOM   655  C  C   . PRO A 1  86  ? -7.190  73.786 63.481 1.00 20.58 ? 86   PRO A C   1 
ATOM   656  O  O   . PRO A 1  86  ? -7.506  74.029 64.638 1.00 20.66 ? 86   PRO A O   1 
ATOM   657  C  CB  . PRO A 1  86  ? -8.007  71.428 63.303 1.00 19.40 ? 86   PRO A CB  1 
ATOM   658  C  CG  . PRO A 1  86  ? -7.521  70.212 63.946 1.00 19.49 ? 86   PRO A CG  1 
ATOM   659  C  CD  . PRO A 1  86  ? -6.156  70.499 64.569 1.00 20.23 ? 86   PRO A CD  1 
ATOM   660  N  N   . ASN A 1  87  ? -7.176  74.707 62.514 1.00 20.52 ? 87   ASN A N   1 
ATOM   661  C  CA  . ASN A 1  87  ? -7.587  76.078 62.726 1.00 21.04 ? 87   ASN A CA  1 
ATOM   662  C  C   . ASN A 1  87  ? -8.926  76.339 62.042 1.00 22.15 ? 87   ASN A C   1 
ATOM   663  O  O   . ASN A 1  87  ? -9.352  77.490 61.901 1.00 22.17 ? 87   ASN A O   1 
ATOM   664  C  CB  . ASN A 1  87  ? -6.538  77.047 62.192 1.00 20.61 ? 87   ASN A CB  1 
ATOM   665  C  CG  . ASN A 1  87  ? -6.304  76.895 60.689 1.00 21.10 ? 87   ASN A CG  1 
ATOM   666  O  OD1 . ASN A 1  87  ? -6.676  75.887 60.080 1.00 18.38 ? 87   ASN A OD1 1 
ATOM   667  N  ND2 . ASN A 1  87  ? -5.686  77.910 60.084 1.00 20.21 ? 87   ASN A ND2 1 
ATOM   668  N  N   . ARG A 1  88  ? -9.568  75.258 61.601 1.00 22.78 ? 88   ARG A N   1 
ATOM   669  C  CA  A ARG A 1  88  ? -10.897 75.339 61.015 0.50 23.00 ? 88   ARG A CA  1 
ATOM   670  C  CA  B ARG A 1  88  ? -10.895 75.312 60.986 0.50 23.00 ? 88   ARG A CA  1 
ATOM   671  C  C   . ARG A 1  88  ? -11.759 74.297 61.712 1.00 23.39 ? 88   ARG A C   1 
ATOM   672  O  O   . ARG A 1  88  ? -11.240 73.448 62.425 1.00 24.08 ? 88   ARG A O   1 
ATOM   673  C  CB  A ARG A 1  88  ? -10.825 75.105 59.499 0.50 22.72 ? 88   ARG A CB  1 
ATOM   674  C  CB  B ARG A 1  88  ? -10.818 74.936 59.500 0.50 22.67 ? 88   ARG A CB  1 
ATOM   675  C  CG  A ARG A 1  88  ? -10.201 76.285 58.732 0.50 22.86 ? 88   ARG A CG  1 
ATOM   676  C  CG  B ARG A 1  88  ? -10.142 75.963 58.599 0.50 22.95 ? 88   ARG A CG  1 
ATOM   677  C  CD  A ARG A 1  88  ? -11.020 77.544 59.012 0.50 23.02 ? 88   ARG A CD  1 
ATOM   678  C  CD  B ARG A 1  88  ? -11.178 76.904 57.972 0.50 23.03 ? 88   ARG A CD  1 
ATOM   679  N  NE  A ARG A 1  88  ? -10.671 78.701 58.189 0.50 21.44 ? 88   ARG A NE  1 
ATOM   680  N  NE  B ARG A 1  88  ? -11.235 78.177 58.672 0.50 22.71 ? 88   ARG A NE  1 
ATOM   681  C  CZ  A ARG A 1  88  ? -9.763  79.611 58.524 0.50 19.62 ? 88   ARG A CZ  1 
ATOM   682  C  CZ  B ARG A 1  88  ? -11.818 79.272 58.208 0.50 21.03 ? 88   ARG A CZ  1 
ATOM   683  N  NH1 A ARG A 1  88  ? -9.074  79.510 59.660 0.50 17.37 ? 88   ARG A NH1 1 
ATOM   684  N  NH1 B ARG A 1  88  ? -12.414 79.264 57.026 0.50 20.45 ? 88   ARG A NH1 1 
ATOM   685  N  NH2 A ARG A 1  88  ? -9.540  80.622 57.709 0.50 20.48 ? 88   ARG A NH2 1 
ATOM   686  N  NH2 B ARG A 1  88  ? -11.792 80.375 58.940 0.50 20.92 ? 88   ARG A NH2 1 
ATOM   687  N  N   . GLU A 1  89  ? -13.068 74.368 61.517 1.00 23.17 ? 89   GLU A N   1 
ATOM   688  C  CA  . GLU A 1  89  ? -13.952 73.389 62.076 1.00 23.80 ? 89   GLU A CA  1 
ATOM   689  C  C   . GLU A 1  89  ? -13.542 72.013 61.523 1.00 23.22 ? 89   GLU A C   1 
ATOM   690  O  O   . GLU A 1  89  ? -13.221 71.886 60.348 1.00 23.73 ? 89   GLU A O   1 
ATOM   691  C  CB  . GLU A 1  89  ? -15.392 73.700 61.667 1.00 24.07 ? 89   GLU A CB  1 
ATOM   692  C  CG  . GLU A 1  89  ? -16.421 73.349 62.737 0.50 26.41 ? 89   GLU A CG  1 
ATOM   693  C  CD  . GLU A 1  89  ? -17.817 73.139 62.169 0.50 28.63 ? 89   GLU A CD  1 
ATOM   694  O  OE1 . GLU A 1  89  ? -18.243 73.950 61.317 0.50 28.10 ? 89   GLU A OE1 1 
ATOM   695  O  OE2 . GLU A 1  89  ? -18.486 72.159 62.578 0.50 29.57 ? 89   GLU A OE2 1 
ATOM   696  N  N   . MET A 1  90  ? -13.543 70.986 62.356 1.00 22.08 ? 90   MET A N   1 
ATOM   697  C  CA  . MET A 1  90  ? -13.285 69.653 61.851 1.00 21.66 ? 90   MET A CA  1 
ATOM   698  C  C   . MET A 1  90  ? -14.580 69.054 61.289 1.00 21.20 ? 90   MET A C   1 
ATOM   699  O  O   . MET A 1  90  ? -15.664 69.299 61.815 1.00 20.79 ? 90   MET A O   1 
ATOM   700  C  CB  . MET A 1  90  ? -12.665 68.766 62.925 1.00 21.02 ? 90   MET A CB  1 
ATOM   701  C  CG  . MET A 1  90  ? -11.219 69.075 63.257 1.00 21.92 ? 90   MET A CG  1 
ATOM   702  S  SD  . MET A 1  90  ? -10.574 67.872 64.448 1.00 22.41 ? 90   MET A SD  1 
ATOM   703  C  CE  . MET A 1  90  ? -11.646 68.161 65.876 1.00 17.61 ? 90   MET A CE  1 
ATOM   704  N  N   . SER A 1  91  ? -14.453 68.301 60.198 1.00 21.06 ? 91   SER A N   1 
ATOM   705  C  CA  . SER A 1  91  ? -15.578 67.630 59.575 1.00 21.11 ? 91   SER A CA  1 
ATOM   706  C  C   . SER A 1  91  ? -15.070 66.451 58.788 1.00 21.22 ? 91   SER A C   1 
ATOM   707  O  O   . SER A 1  91  ? -13.988 66.536 58.222 1.00 21.07 ? 91   SER A O   1 
ATOM   708  C  CB  . SER A 1  91  ? -16.268 68.568 58.599 1.00 20.75 ? 91   SER A CB  1 
ATOM   709  O  OG  . SER A 1  91  ? -17.416 67.940 58.087 1.00 21.61 ? 91   SER A OG  1 
ATOM   710  N  N   . GLU A 1  92  ? -15.852 65.375 58.715 1.00 21.07 ? 92   GLU A N   1 
ATOM   711  C  CA  . GLU A 1  92  ? -15.544 64.280 57.778 1.00 21.71 ? 92   GLU A CA  1 
ATOM   712  C  C   . GLU A 1  92  ? -15.654 64.762 56.317 1.00 21.86 ? 92   GLU A C   1 
ATOM   713  O  O   . GLU A 1  92  ? -15.137 64.131 55.385 1.00 22.73 ? 92   GLU A O   1 
ATOM   714  C  CB  . GLU A 1  92  ? -16.477 63.084 57.997 1.00 21.41 ? 92   GLU A CB  1 
ATOM   715  C  CG  . GLU A 1  92  ? -16.071 62.197 59.138 1.00 21.37 ? 92   GLU A CG  1 
ATOM   716  C  CD  . GLU A 1  92  ? -16.860 60.910 59.187 1.00 22.78 ? 92   GLU A CD  1 
ATOM   717  O  OE1 . GLU A 1  92  ? -17.955 60.928 59.750 1.00 26.47 ? 92   GLU A OE1 1 
ATOM   718  O  OE2 . GLU A 1  92  ? -16.403 59.874 58.672 1.00 22.40 ? 92   GLU A OE2 1 
ATOM   719  N  N   . ASP A 1  93  ? -16.346 65.874 56.119 1.00 21.32 ? 93   ASP A N   1 
ATOM   720  C  CA  . ASP A 1  93  ? -16.428 66.513 54.817 1.00 20.90 ? 93   ASP A CA  1 
ATOM   721  C  C   . ASP A 1  93  ? -15.234 67.461 54.676 1.00 20.02 ? 93   ASP A C   1 
ATOM   722  O  O   . ASP A 1  93  ? -15.346 68.646 54.957 1.00 20.11 ? 93   ASP A O   1 
ATOM   723  C  CB  . ASP A 1  93  ? -17.758 67.272 54.703 1.00 20.72 ? 93   ASP A CB  1 
ATOM   724  C  CG  . ASP A 1  93  ? -17.950 67.935 53.342 1.00 21.83 ? 93   ASP A CG  1 
ATOM   725  O  OD1 . ASP A 1  93  ? -17.058 67.846 52.470 1.00 24.37 ? 93   ASP A OD1 1 
ATOM   726  O  OD2 . ASP A 1  93  ? -18.997 68.575 53.144 1.00 23.25 ? 93   ASP A OD2 1 
ATOM   727  N  N   . CYS A 1  94  ? -14.108 66.926 54.212 1.00 19.08 ? 94   CYS A N   1 
ATOM   728  C  CA  . CYS A 1  94  ? -12.833 67.627 54.294 1.00 18.42 ? 94   CYS A CA  1 
ATOM   729  C  C   . CYS A 1  94  ? -11.924 67.421 53.088 1.00 18.10 ? 94   CYS A C   1 
ATOM   730  O  O   . CYS A 1  94  ? -10.727 67.833 53.117 1.00 16.85 ? 94   CYS A O   1 
ATOM   731  C  CB  . CYS A 1  94  ? -12.066 67.208 55.565 1.00 17.89 ? 94   CYS A CB  1 
ATOM   732  S  SG  . CYS A 1  94  ? -11.559 65.482 55.601 1.00 19.31 ? 94   CYS A SG  1 
ATOM   733  N  N   . LEU A 1  95  ? -12.470 66.822 52.025 1.00 17.49 ? 95   LEU A N   1 
ATOM   734  C  CA  . LEU A 1  95  ? -11.653 66.567 50.849 1.00 17.02 ? 95   LEU A CA  1 
ATOM   735  C  C   . LEU A 1  95  ? -11.655 67.751 49.856 1.00 17.02 ? 95   LEU A C   1 
ATOM   736  O  O   . LEU A 1  95  ? -12.425 67.781 48.875 1.00 17.41 ? 95   LEU A O   1 
ATOM   737  C  CB  . LEU A 1  95  ? -12.003 65.216 50.226 1.00 16.98 ? 95   LEU A CB  1 
ATOM   738  C  CG  . LEU A 1  95  ? -11.739 64.005 51.133 1.00 17.46 ? 95   LEU A CG  1 
ATOM   739  C  CD1 . LEU A 1  95  ? -12.021 62.702 50.411 1.00 14.78 ? 95   LEU A CD1 1 
ATOM   740  C  CD2 . LEU A 1  95  ? -10.286 64.028 51.666 1.00 16.25 ? 95   LEU A CD2 1 
ATOM   741  N  N   . TYR A 1  96  ? -10.771 68.716 50.136 1.00 17.03 ? 96   TYR A N   1 
ATOM   742  C  CA  . TYR A 1  96  ? -10.647 69.998 49.409 1.00 16.81 ? 96   TYR A CA  1 
ATOM   743  C  C   . TYR A 1  96  ? -9.188  70.339 49.116 1.00 16.61 ? 96   TYR A C   1 
ATOM   744  O  O   . TYR A 1  96  ? -8.288  69.789 49.756 1.00 17.09 ? 96   TYR A O   1 
ATOM   745  C  CB  . TYR A 1  96  ? -11.314 71.134 50.212 1.00 17.06 ? 96   TYR A CB  1 
ATOM   746  C  CG  . TYR A 1  96  ? -12.812 70.879 50.404 1.00 17.88 ? 96   TYR A CG  1 
ATOM   747  C  CD1 . TYR A 1  96  ? -13.259 70.022 51.414 1.00 18.22 ? 96   TYR A CD1 1 
ATOM   748  C  CD2 . TYR A 1  96  ? -13.767 71.468 49.560 1.00 17.14 ? 96   TYR A CD2 1 
ATOM   749  C  CE1 . TYR A 1  96  ? -14.611 69.743 51.590 1.00 18.84 ? 96   TYR A CE1 1 
ATOM   750  C  CE2 . TYR A 1  96  ? -15.141 71.202 49.725 1.00 18.86 ? 96   TYR A CE2 1 
ATOM   751  C  CZ  . TYR A 1  96  ? -15.541 70.328 50.742 1.00 20.54 ? 96   TYR A CZ  1 
ATOM   752  O  OH  . TYR A 1  96  ? -16.858 70.031 50.950 1.00 23.25 ? 96   TYR A OH  1 
ATOM   753  N  N   . LEU A 1  97  ? -8.945  71.191 48.123 1.00 15.72 ? 97   LEU A N   1 
ATOM   754  C  CA  . LEU A 1  97  ? -7.593  71.701 47.899 1.00 16.08 ? 97   LEU A CA  1 
ATOM   755  C  C   . LEU A 1  97  ? -7.637  73.221 47.748 1.00 15.68 ? 97   LEU A C   1 
ATOM   756  O  O   . LEU A 1  97  ? -8.699  73.802 47.525 1.00 15.60 ? 97   LEU A O   1 
ATOM   757  C  CB  . LEU A 1  97  ? -6.866  70.996 46.720 1.00 15.94 ? 97   LEU A CB  1 
ATOM   758  C  CG  . LEU A 1  97  ? -7.611  70.920 45.364 1.00 17.66 ? 97   LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1  97  ? -7.450  72.199 44.548 1.00 15.01 ? 97   LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1  97  ? -7.159  69.700 44.521 1.00 18.27 ? 97   LEU A CD2 1 
ATOM   761  N  N   . ASN A 1  98  ? -6.472  73.840 47.874 1.00 16.12 ? 98   ASN A N   1 
ATOM   762  C  CA  . ASN A 1  98  ? -6.313  75.285 47.843 1.00 16.68 ? 98   ASN A CA  1 
ATOM   763  C  C   . ASN A 1  98  ? -5.270  75.598 46.791 1.00 17.40 ? 98   ASN A C   1 
ATOM   764  O  O   . ASN A 1  98  ? -4.252  74.906 46.724 1.00 17.56 ? 98   ASN A O   1 
ATOM   765  C  CB  . ASN A 1  98  ? -5.830  75.789 49.219 1.00 16.32 ? 98   ASN A CB  1 
ATOM   766  C  CG  . ASN A 1  98  ? -6.629  75.216 50.340 1.00 15.61 ? 98   ASN A CG  1 
ATOM   767  O  OD1 . ASN A 1  98  ? -7.825  75.468 50.436 1.00 16.57 ? 98   ASN A OD1 1 
ATOM   768  N  ND2 . ASN A 1  98  ? -5.991  74.405 51.188 1.00 11.46 ? 98   ASN A ND2 1 
ATOM   769  N  N   . ILE A 1  99  ? -5.518  76.616 45.968 1.00 17.10 ? 99   ILE A N   1 
ATOM   770  C  CA  . ILE A 1  99  ? -4.549  76.994 44.964 1.00 17.89 ? 99   ILE A CA  1 
ATOM   771  C  C   . ILE A 1  99  ? -4.179  78.466 45.070 1.00 18.22 ? 99   ILE A C   1 
ATOM   772  O  O   . ILE A 1  99  ? -5.065  79.312 45.133 1.00 19.17 ? 99   ILE A O   1 
ATOM   773  C  CB  . ILE A 1  99  ? -5.045  76.730 43.518 1.00 17.75 ? 99   ILE A CB  1 
ATOM   774  C  CG1 . ILE A 1  99  ? -5.765  75.365 43.380 1.00 17.49 ? 99   ILE A CG1 1 
ATOM   775  C  CG2 . ILE A 1  99  ? -3.869  76.792 42.587 1.00 17.81 ? 99   ILE A CG2 1 
ATOM   776  C  CD1 . ILE A 1  99  ? -6.367  75.086 41.944 1.00 13.66 ? 99   ILE A CD1 1 
ATOM   777  N  N   . TRP A 1  100 ? -2.884  78.769 45.087 1.00 17.77 ? 100  TRP A N   1 
ATOM   778  C  CA  . TRP A 1  100 ? -2.421  80.156 45.026 1.00 18.80 ? 100  TRP A CA  1 
ATOM   779  C  C   . TRP A 1  100 ? -1.841  80.421 43.640 1.00 18.77 ? 100  TRP A C   1 
ATOM   780  O  O   . TRP A 1  100 ? -1.005  79.684 43.180 1.00 18.96 ? 100  TRP A O   1 
ATOM   781  C  CB  . TRP A 1  100 ? -1.409  80.488 46.134 1.00 18.68 ? 100  TRP A CB  1 
ATOM   782  C  CG  . TRP A 1  100 ? -2.046  80.545 47.514 1.00 20.19 ? 100  TRP A CG  1 
ATOM   783  C  CD1 . TRP A 1  100 ? -2.545  81.654 48.146 1.00 20.88 ? 100  TRP A CD1 1 
ATOM   784  C  CD2 . TRP A 1  100 ? -2.263  79.445 48.422 1.00 21.30 ? 100  TRP A CD2 1 
ATOM   785  N  NE1 . TRP A 1  100 ? -3.069  81.321 49.377 1.00 19.52 ? 100  TRP A NE1 1 
ATOM   786  C  CE2 . TRP A 1  100 ? -2.913  79.976 49.578 1.00 22.42 ? 100  TRP A CE2 1 
ATOM   787  C  CE3 . TRP A 1  100 ? -1.996  78.071 48.366 1.00 21.04 ? 100  TRP A CE3 1 
ATOM   788  C  CZ2 . TRP A 1  100 ? -3.268  79.182 50.680 1.00 22.44 ? 100  TRP A CZ2 1 
ATOM   789  C  CZ3 . TRP A 1  100 ? -2.360  77.267 49.475 1.00 22.75 ? 100  TRP A CZ3 1 
ATOM   790  C  CH2 . TRP A 1  100 ? -2.989  77.834 50.611 1.00 24.02 ? 100  TRP A CH2 1 
ATOM   791  N  N   . VAL A 1  101 ? -2.301  81.479 42.978 1.00 19.20 ? 101  VAL A N   1 
ATOM   792  C  CA  . VAL A 1  101 ? -1.991  81.708 41.572 1.00 19.34 ? 101  VAL A CA  1 
ATOM   793  C  C   . VAL A 1  101 ? -1.385  83.093 41.426 1.00 19.77 ? 101  VAL A C   1 
ATOM   794  O  O   . VAL A 1  101 ? -1.988  84.062 41.845 1.00 19.30 ? 101  VAL A O   1 
ATOM   795  C  CB  . VAL A 1  101 ? -3.272  81.608 40.702 1.00 19.13 ? 101  VAL A CB  1 
ATOM   796  C  CG1 . VAL A 1  101 ? -2.976  81.940 39.253 1.00 18.69 ? 101  VAL A CG1 1 
ATOM   797  C  CG2 . VAL A 1  101 ? -3.875  80.228 40.787 1.00 18.40 ? 101  VAL A CG2 1 
ATOM   798  N  N   . PRO A 1  102 ? -0.175  83.192 40.843 1.00 21.18 ? 102  PRO A N   1 
ATOM   799  C  CA  . PRO A 1  102 ? 0.340   84.563 40.650 1.00 22.10 ? 102  PRO A CA  1 
ATOM   800  C  C   . PRO A 1  102 ? -0.644  85.485 39.895 1.00 23.33 ? 102  PRO A C   1 
ATOM   801  O  O   . PRO A 1  102 ? -1.586  85.023 39.223 1.00 22.88 ? 102  PRO A O   1 
ATOM   802  C  CB  . PRO A 1  102 ? 1.651   84.366 39.884 1.00 21.58 ? 102  PRO A CB  1 
ATOM   803  C  CG  . PRO A 1  102 ? 2.080   82.918 40.227 1.00 22.21 ? 102  PRO A CG  1 
ATOM   804  C  CD  . PRO A 1  102 ? 0.783   82.150 40.409 1.00 20.82 ? 102  PRO A CD  1 
ATOM   805  N  N   . SER A 1  103 ? -0.470  86.785 40.100 1.00 24.65 ? 103  SER A N   1 
ATOM   806  C  CA  . SER A 1  103 ? -1.239  87.790 39.383 1.00 25.99 ? 103  SER A CA  1 
ATOM   807  C  C   . SER A 1  103 ? -0.258  88.649 38.649 1.00 26.75 ? 103  SER A C   1 
ATOM   808  O  O   . SER A 1  103 ? 0.659   89.180 39.264 1.00 27.45 ? 103  SER A O   1 
ATOM   809  C  CB  . SER A 1  103 ? -2.042  88.652 40.349 1.00 26.17 ? 103  SER A CB  1 
ATOM   810  O  OG  . SER A 1  103 ? -2.937  89.473 39.615 1.00 27.30 ? 103  SER A OG  1 
ATOM   811  N  N   . PRO A 1  104 ? -0.411  88.785 37.320 1.00 27.87 ? 104  PRO A N   1 
ATOM   812  C  CA  . PRO A 1  104 ? -1.474  88.218 36.466 1.00 28.04 ? 104  PRO A CA  1 
ATOM   813  C  C   . PRO A 1  104 ? -1.403  86.700 36.272 1.00 28.06 ? 104  PRO A C   1 
ATOM   814  O  O   . PRO A 1  104 ? -0.324  86.123 36.322 1.00 27.88 ? 104  PRO A O   1 
ATOM   815  C  CB  . PRO A 1  104 ? -1.290  88.953 35.134 1.00 27.82 ? 104  PRO A CB  1 
ATOM   816  C  CG  . PRO A 1  104 ? 0.157   89.478 35.157 1.00 28.09 ? 104  PRO A CG  1 
ATOM   817  C  CD  . PRO A 1  104 ? 0.483   89.719 36.590 1.00 27.58 ? 104  PRO A CD  1 
ATOM   818  N  N   . ARG A 1  105 ? -2.555  86.065 36.048 1.00 28.71 ? 105  ARG A N   1 
ATOM   819  C  CA  . ARG A 1  105 ? -2.609  84.605 35.840 1.00 28.68 ? 105  ARG A CA  1 
ATOM   820  C  C   . ARG A 1  105 ? -1.549  84.150 34.850 1.00 29.06 ? 105  ARG A C   1 
ATOM   821  O  O   . ARG A 1  105 ? -1.427  84.728 33.766 1.00 30.08 ? 105  ARG A O   1 
ATOM   822  C  CB  . ARG A 1  105 ? -3.993  84.155 35.361 1.00 28.59 ? 105  ARG A CB  1 
ATOM   823  C  CG  . ARG A 1  105 ? -4.209  82.639 35.492 1.00 28.06 ? 105  ARG A CG  1 
ATOM   824  C  CD  . ARG A 1  105 ? -5.523  82.189 34.899 1.00 24.77 ? 105  ARG A CD  1 
ATOM   825  N  NE  . ARG A 1  105 ? -6.678  82.730 35.606 1.00 26.04 ? 105  ARG A NE  1 
ATOM   826  C  CZ  . ARG A 1  105 ? -7.938  82.594 35.178 1.00 27.42 ? 105  ARG A CZ  1 
ATOM   827  N  NH1 . ARG A 1  105 ? -8.189  81.956 34.033 1.00 26.52 ? 105  ARG A NH1 1 
ATOM   828  N  NH2 . ARG A 1  105 ? -8.953  83.116 35.866 1.00 25.39 ? 105  ARG A NH2 1 
ATOM   829  N  N   . PRO A 1  106 ? -0.757  83.124 35.212 1.00 29.18 ? 106  PRO A N   1 
ATOM   830  C  CA  . PRO A 1  106 ? 0.248   82.718 34.245 1.00 28.68 ? 106  PRO A CA  1 
ATOM   831  C  C   . PRO A 1  106 ? -0.379  81.812 33.199 1.00 28.33 ? 106  PRO A C   1 
ATOM   832  O  O   . PRO A 1  106 ? -1.577  81.514 33.262 1.00 27.99 ? 106  PRO A O   1 
ATOM   833  C  CB  . PRO A 1  106 ? 1.278   81.946 35.098 1.00 29.03 ? 106  PRO A CB  1 
ATOM   834  C  CG  . PRO A 1  106 ? 0.870   82.214 36.551 1.00 29.51 ? 106  PRO A CG  1 
ATOM   835  C  CD  . PRO A 1  106 ? -0.611  82.396 36.483 1.00 28.60 ? 106  PRO A CD  1 
ATOM   836  N  N   . LYS A 1  107 ? 0.430   81.371 32.243 1.00 27.96 ? 107  LYS A N   1 
ATOM   837  C  CA  . LYS A 1  107 ? -0.086  80.566 31.152 1.00 27.94 ? 107  LYS A CA  1 
ATOM   838  C  C   . LYS A 1  107 ? 0.237   79.101 31.371 1.00 27.55 ? 107  LYS A C   1 
ATOM   839  O  O   . LYS A 1  107 ? -0.655  78.252 31.273 1.00 27.59 ? 107  LYS A O   1 
ATOM   840  C  CB  . LYS A 1  107 ? 0.432   81.054 29.792 1.00 27.79 ? 107  LYS A CB  1 
ATOM   841  C  CG  . LYS A 1  107 ? 0.158   82.521 29.513 1.00 29.89 ? 107  LYS A CG  1 
ATOM   842  C  CD  . LYS A 1  107 ? -1.320  82.870 29.692 1.00 30.23 ? 107  LYS A CD  1 
ATOM   843  C  CE  . LYS A 1  107 ? -1.518  84.360 29.504 1.00 32.86 ? 107  LYS A CE  1 
ATOM   844  N  NZ  . LYS A 1  107 ? -2.923  84.728 29.756 1.00 34.06 ? 107  LYS A NZ  1 
ATOM   845  N  N   . SER A 1  108 ? 1.498   78.804 31.673 1.00 26.84 ? 108  SER A N   1 
ATOM   846  C  CA  . SER A 1  108 ? 1.901   77.419 31.864 1.00 27.28 ? 108  SER A CA  1 
ATOM   847  C  C   . SER A 1  108 ? 3.100   77.320 32.813 1.00 26.89 ? 108  SER A C   1 
ATOM   848  O  O   . SER A 1  108 ? 4.200   76.903 32.421 1.00 28.08 ? 108  SER A O   1 
ATOM   849  C  CB  . SER A 1  108 ? 2.187   76.760 30.528 1.00 26.95 ? 108  SER A CB  1 
ATOM   850  O  OG  . SER A 1  108 ? 2.347   75.369 30.676 1.00 29.50 ? 108  SER A OG  1 
ATOM   851  N  N   . THR A 1  109 ? 2.860   77.692 34.065 1.00 25.32 ? 109  THR A N   1 
ATOM   852  C  CA  . THR A 1  109 ? 3.905   77.773 35.068 1.00 24.72 ? 109  THR A CA  1 
ATOM   853  C  C   . THR A 1  109 ? 4.113   76.476 35.919 1.00 23.57 ? 109  THR A C   1 
ATOM   854  O  O   . THR A 1  109 ? 3.201   75.656 36.087 1.00 22.87 ? 109  THR A O   1 
ATOM   855  C  CB  . THR A 1  109 ? 3.675   79.023 35.968 1.00 24.57 ? 109  THR A CB  1 
ATOM   856  O  OG1 . THR A 1  109 ? 4.909   79.424 36.548 1.00 26.85 ? 109  THR A OG1 1 
ATOM   857  C  CG2 . THR A 1  109 ? 2.688   78.746 37.106 1.00 23.82 ? 109  THR A CG2 1 
ATOM   858  N  N   . THR A 1  110 ? 5.329   76.308 36.425 1.00 23.05 ? 110  THR A N   1 
ATOM   859  C  CA  . THR A 1  110 ? 5.666   75.281 37.407 1.00 22.95 ? 110  THR A CA  1 
ATOM   860  C  C   . THR A 1  110 ? 4.618   75.197 38.544 1.00 22.22 ? 110  THR A C   1 
ATOM   861  O  O   . THR A 1  110 ? 4.162   76.229 39.077 1.00 21.97 ? 110  THR A O   1 
ATOM   862  C  CB  . THR A 1  110 ? 7.036   75.580 37.971 1.00 23.27 ? 110  THR A CB  1 
ATOM   863  O  OG1 . THR A 1  110 ? 7.983   75.442 36.913 1.00 25.78 ? 110  THR A OG1 1 
ATOM   864  C  CG2 . THR A 1  110 ? 7.426   74.608 39.102 1.00 24.78 ? 110  THR A CG2 1 
ATOM   865  N  N   . VAL A 1  111 ? 4.211   73.965 38.854 1.00 20.71 ? 111  VAL A N   1 
ATOM   866  C  CA  . VAL A 1  111 ? 3.209   73.676 39.893 1.00 19.44 ? 111  VAL A CA  1 
ATOM   867  C  C   . VAL A 1  111 ? 3.863   72.925 41.072 1.00 18.94 ? 111  VAL A C   1 
ATOM   868  O  O   . VAL A 1  111 ? 4.651   71.994 40.869 1.00 18.15 ? 111  VAL A O   1 
ATOM   869  C  CB  . VAL A 1  111 ? 2.057   72.828 39.306 1.00 19.39 ? 111  VAL A CB  1 
ATOM   870  C  CG1 . VAL A 1  111 ? 1.133   72.325 40.393 1.00 19.30 ? 111  VAL A CG1 1 
ATOM   871  C  CG2 . VAL A 1  111 ? 1.285   73.640 38.241 1.00 18.40 ? 111  VAL A CG2 1 
ATOM   872  N  N   . MET A 1  112 ? 3.536   73.335 42.293 1.00 18.13 ? 112  MET A N   1 
ATOM   873  C  CA  . MET A 1  112 ? 4.054   72.663 43.470 1.00 17.45 ? 112  MET A CA  1 
ATOM   874  C  C   . MET A 1  112 ? 2.855   72.254 44.290 1.00 17.50 ? 112  MET A C   1 
ATOM   875  O  O   . MET A 1  112 ? 1.974   73.080 44.547 1.00 18.27 ? 112  MET A O   1 
ATOM   876  C  CB  . MET A 1  112 ? 5.021   73.562 44.248 1.00 17.53 ? 112  MET A CB  1 
ATOM   877  C  CG  . MET A 1  112 ? 6.355   73.830 43.526 1.00 16.26 ? 112  MET A CG  1 
ATOM   878  S  SD  . MET A 1  112 ? 7.559   74.822 44.459 1.00 19.69 ? 112  MET A SD  1 
ATOM   879  C  CE  . MET A 1  112 ? 7.989   73.639 45.749 1.00 19.94 ? 112  MET A CE  1 
ATOM   880  N  N   . VAL A 1  113 ? 2.774   70.969 44.645 1.00 16.30 ? 113  VAL A N   1 
ATOM   881  C  CA  . VAL A 1  113 ? 1.653   70.471 45.437 1.00 15.28 ? 113  VAL A CA  1 
ATOM   882  C  C   . VAL A 1  113 ? 2.161   69.985 46.816 1.00 16.00 ? 113  VAL A C   1 
ATOM   883  O  O   . VAL A 1  113 ? 2.972   69.048 46.910 1.00 15.71 ? 113  VAL A O   1 
ATOM   884  C  CB  . VAL A 1  113 ? 0.884   69.313 44.745 1.00 15.31 ? 113  VAL A CB  1 
ATOM   885  C  CG1 . VAL A 1  113 ? -0.293  68.861 45.636 1.00 12.23 ? 113  VAL A CG1 1 
ATOM   886  C  CG2 . VAL A 1  113 ? 0.392   69.713 43.331 1.00 13.94 ? 113  VAL A CG2 1 
ATOM   887  N  N   . TRP A 1  114 ? 1.660   70.628 47.858 1.00 15.62 ? 114  TRP A N   1 
ATOM   888  C  CA  . TRP A 1  114 ? 2.034   70.369 49.240 1.00 15.02 ? 114  TRP A CA  1 
ATOM   889  C  C   . TRP A 1  114 ? 1.164   69.291 49.855 1.00 14.99 ? 114  TRP A C   1 
ATOM   890  O  O   . TRP A 1  114 ? -0.094  69.367 49.838 1.00 15.80 ? 114  TRP A O   1 
ATOM   891  C  CB  . TRP A 1  114 ? 1.929   71.655 50.063 1.00 14.87 ? 114  TRP A CB  1 
ATOM   892  C  CG  . TRP A 1  114 ? 2.224   71.475 51.562 1.00 16.11 ? 114  TRP A CG  1 
ATOM   893  C  CD1 . TRP A 1  114 ? 1.318   71.567 52.588 1.00 16.44 ? 114  TRP A CD1 1 
ATOM   894  C  CD2 . TRP A 1  114 ? 3.485   71.166 52.174 1.00 16.03 ? 114  TRP A CD2 1 
ATOM   895  N  NE1 . TRP A 1  114 ? 1.936   71.345 53.795 1.00 17.33 ? 114  TRP A NE1 1 
ATOM   896  C  CE2 . TRP A 1  114 ? 3.266   71.098 53.575 1.00 16.36 ? 114  TRP A CE2 1 
ATOM   897  C  CE3 . TRP A 1  114 ? 4.783   70.978 51.685 1.00 14.63 ? 114  TRP A CE3 1 
ATOM   898  C  CZ2 . TRP A 1  114 ? 4.292   70.844 54.483 1.00 13.97 ? 114  TRP A CZ2 1 
ATOM   899  C  CZ3 . TRP A 1  114 ? 5.803   70.718 52.590 1.00 16.01 ? 114  TRP A CZ3 1 
ATOM   900  C  CH2 . TRP A 1  114 ? 5.554   70.667 53.978 1.00 15.26 ? 114  TRP A CH2 1 
ATOM   901  N  N   . ILE A 1  115 ? 1.833   68.281 50.405 1.00 14.65 ? 115  ILE A N   1 
ATOM   902  C  CA  . ILE A 1  115 ? 1.144   67.286 51.206 1.00 14.64 ? 115  ILE A CA  1 
ATOM   903  C  C   . ILE A 1  115 ? 1.530   67.405 52.680 1.00 14.76 ? 115  ILE A C   1 
ATOM   904  O  O   . ILE A 1  115 ? 2.686   67.131 53.042 1.00 14.34 ? 115  ILE A O   1 
ATOM   905  C  CB  . ILE A 1  115 ? 1.485   65.857 50.723 1.00 14.64 ? 115  ILE A CB  1 
ATOM   906  C  CG1 . ILE A 1  115 ? 1.292   65.758 49.181 1.00 14.61 ? 115  ILE A CG1 1 
ATOM   907  C  CG2 . ILE A 1  115 ? 0.654   64.847 51.546 1.00 13.08 ? 115  ILE A CG2 1 
ATOM   908  C  CD1 . ILE A 1  115 ? 1.896   64.451 48.538 1.00 13.49 ? 115  ILE A CD1 1 
ATOM   909  N  N   . TYR A 1  116 ? 0.575   67.769 53.537 1.00 13.94 ? 116  TYR A N   1 
ATOM   910  C  CA  . TYR A 1  116 ? 0.904   67.918 54.979 1.00 14.39 ? 116  TYR A CA  1 
ATOM   911  C  C   . TYR A 1  116 ? 1.286   66.629 55.716 1.00 14.36 ? 116  TYR A C   1 
ATOM   912  O  O   . TYR A 1  116 ? 0.794   65.553 55.375 1.00 13.86 ? 116  TYR A O   1 
ATOM   913  C  CB  . TYR A 1  116 ? -0.198  68.650 55.761 1.00 14.10 ? 116  TYR A CB  1 
ATOM   914  C  CG  . TYR A 1  116 ? -1.579  68.021 55.717 1.00 13.89 ? 116  TYR A CG  1 
ATOM   915  C  CD1 . TYR A 1  116 ? -1.868  66.854 56.417 1.00 13.30 ? 116  TYR A CD1 1 
ATOM   916  C  CD2 . TYR A 1  116 ? -2.621  68.645 55.034 1.00 13.87 ? 116  TYR A CD2 1 
ATOM   917  C  CE1 . TYR A 1  116 ? -3.135  66.295 56.401 1.00 12.97 ? 116  TYR A CE1 1 
ATOM   918  C  CE2 . TYR A 1  116 ? -3.927  68.097 55.025 1.00 12.69 ? 116  TYR A CE2 1 
ATOM   919  C  CZ  . TYR A 1  116 ? -4.168  66.925 55.687 1.00 14.25 ? 116  TYR A CZ  1 
ATOM   920  O  OH  . TYR A 1  116 ? -5.444  66.367 55.656 1.00 11.65 ? 116  TYR A OH  1 
ATOM   921  N  N   . GLY A 1  117 ? 2.187   66.759 56.702 1.00 14.08 ? 117  GLY A N   1 
ATOM   922  C  CA  . GLY A 1  117 ? 2.477   65.687 57.644 1.00 13.24 ? 117  GLY A CA  1 
ATOM   923  C  C   . GLY A 1  117 ? 1.535   65.702 58.825 1.00 12.95 ? 117  GLY A C   1 
ATOM   924  O  O   . GLY A 1  117 ? 0.465   66.349 58.784 1.00 14.08 ? 117  GLY A O   1 
ATOM   925  N  N   . GLY A 1  118 ? 1.915   64.997 59.887 1.00 11.90 ? 118  GLY A N   1 
ATOM   926  C  CA  . GLY A 1  118 ? 1.043   64.852 61.061 1.00 11.30 ? 118  GLY A CA  1 
ATOM   927  C  C   . GLY A 1  118 ? 0.918   63.390 61.484 1.00 11.53 ? 118  GLY A C   1 
ATOM   928  O  O   . GLY A 1  118 ? -0.090  63.018 62.085 1.00 11.10 ? 118  GLY A O   1 
ATOM   929  N  N   . GLY A 1  119 ? 1.935   62.563 61.154 1.00 11.82 ? 119  GLY A N   1 
ATOM   930  C  CA  . GLY A 1  119 ? 1.966   61.146 61.543 1.00 12.14 ? 119  GLY A CA  1 
ATOM   931  C  C   . GLY A 1  119 ? 0.802   60.290 61.040 1.00 13.43 ? 119  GLY A C   1 
ATOM   932  O  O   . GLY A 1  119 ? 0.512   59.229 61.606 1.00 13.54 ? 119  GLY A O   1 
ATOM   933  N  N   . PHE A 1  120 ? 0.147   60.738 59.962 1.00 13.99 ? 120  PHE A N   1 
ATOM   934  C  CA  . PHE A 1  120 ? -1.102  60.131 59.411 1.00 14.02 ? 120  PHE A CA  1 
ATOM   935  C  C   . PHE A 1  120 ? -2.285  60.170 60.359 1.00 14.65 ? 120  PHE A C   1 
ATOM   936  O  O   . PHE A 1  120 ? -3.356  59.621 60.044 1.00 15.37 ? 120  PHE A O   1 
ATOM   937  C  CB  . PHE A 1  120 ? -0.918  58.703 58.865 1.00 13.29 ? 120  PHE A CB  1 
ATOM   938  C  CG  . PHE A 1  120 ? 0.110   58.586 57.773 1.00 12.42 ? 120  PHE A CG  1 
ATOM   939  C  CD1 . PHE A 1  120 ? -0.177  58.991 56.466 1.00 12.33 ? 120  PHE A CD1 1 
ATOM   940  C  CD2 . PHE A 1  120 ? 1.367   58.058 58.049 1.00 11.27 ? 120  PHE A CD2 1 
ATOM   941  C  CE1 . PHE A 1  120 ? 0.795   58.885 55.430 1.00 11.13 ? 120  PHE A CE1 1 
ATOM   942  C  CE2 . PHE A 1  120 ? 2.373   57.948 57.030 1.00 11.20 ? 120  PHE A CE2 1 
ATOM   943  C  CZ  . PHE A 1  120 ? 2.086   58.381 55.709 1.00 9.71  ? 120  PHE A CZ  1 
ATOM   944  N  N   . TYR A 1  121 ? -2.136  60.827 61.510 1.00 14.74 ? 121  TYR A N   1 
ATOM   945  C  CA  . TYR A 1  121 ? -3.273  60.871 62.438 1.00 14.36 ? 121  TYR A CA  1 
ATOM   946  C  C   . TYR A 1  121 ? -3.820  62.299 62.586 1.00 14.87 ? 121  TYR A C   1 
ATOM   947  O  O   . TYR A 1  121 ? -4.858  62.520 63.221 1.00 15.48 ? 121  TYR A O   1 
ATOM   948  C  CB  . TYR A 1  121 ? -2.892  60.281 63.806 1.00 13.51 ? 121  TYR A CB  1 
ATOM   949  C  CG  . TYR A 1  121 ? -1.925  61.134 64.600 1.00 13.67 ? 121  TYR A CG  1 
ATOM   950  C  CD1 . TYR A 1  121 ? -2.384  62.191 65.419 1.00 14.70 ? 121  TYR A CD1 1 
ATOM   951  C  CD2 . TYR A 1  121 ? -0.556  60.944 64.479 1.00 11.75 ? 121  TYR A CD2 1 
ATOM   952  C  CE1 . TYR A 1  121 ? -1.473  63.009 66.131 1.00 15.64 ? 121  TYR A CE1 1 
ATOM   953  C  CE2 . TYR A 1  121 ? 0.370   61.745 65.199 1.00 13.03 ? 121  TYR A CE2 1 
ATOM   954  C  CZ  . TYR A 1  121 ? -0.095  62.762 66.021 1.00 17.59 ? 121  TYR A CZ  1 
ATOM   955  O  OH  . TYR A 1  121 ? 0.836   63.544 66.727 1.00 21.52 ? 121  TYR A OH  1 
ATOM   956  N  N   . SER A 1  122 ? -3.095  63.266 62.033 1.00 14.41 ? 122  SER A N   1 
ATOM   957  C  CA  . SER A 1  122 ? -3.480  64.663 62.128 1.00 13.90 ? 122  SER A CA  1 
ATOM   958  C  C   . SER A 1  122 ? -2.926  65.362 60.922 1.00 14.16 ? 122  SER A C   1 
ATOM   959  O  O   . SER A 1  122 ? -2.260  64.729 60.116 1.00 13.40 ? 122  SER A O   1 
ATOM   960  C  CB  . SER A 1  122 ? -2.898  65.315 63.389 1.00 13.85 ? 122  SER A CB  1 
ATOM   961  O  OG  . SER A 1  122 ? -1.480  65.334 63.326 1.00 11.47 ? 122  SER A OG  1 
ATOM   962  N  N   . GLY A 1  123 ? -3.208  66.670 60.834 1.00 14.43 ? 123  GLY A N   1 
ATOM   963  C  CA  . GLY A 1  123 ? -2.678  67.558 59.804 1.00 14.79 ? 123  GLY A CA  1 
ATOM   964  C  C   . GLY A 1  123 ? -3.792  68.362 59.131 1.00 15.70 ? 123  GLY A C   1 
ATOM   965  O  O   . GLY A 1  123 ? -4.940  67.921 59.049 1.00 14.42 ? 123  GLY A O   1 
ATOM   966  N  N   . SER A 1  124 ? -3.438  69.541 58.629 1.00 16.18 ? 124  SER A N   1 
ATOM   967  C  CA  . SER A 1  124 ? -4.398  70.451 58.041 1.00 16.79 ? 124  SER A CA  1 
ATOM   968  C  C   . SER A 1  124 ? -3.743  71.186 56.926 1.00 17.07 ? 124  SER A C   1 
ATOM   969  O  O   . SER A 1  124 ? -2.557  71.572 57.027 1.00 17.66 ? 124  SER A O   1 
ATOM   970  C  CB  . SER A 1  124 ? -4.822  71.469 59.078 1.00 16.94 ? 124  SER A CB  1 
ATOM   971  O  OG  . SER A 1  124 ? -5.803  70.908 59.917 1.00 19.16 ? 124  SER A OG  1 
ATOM   972  N  N   . SER A 1  125 ? -4.488  71.420 55.861 1.00 17.40 ? 125  SER A N   1 
ATOM   973  C  CA  . SER A 1  125 ? -3.914  72.177 54.747 1.00 18.41 ? 125  SER A CA  1 
ATOM   974  C  C   . SER A 1  125 ? -3.979  73.700 54.987 1.00 18.64 ? 125  SER A C   1 
ATOM   975  O  O   . SER A 1  125 ? -3.375  74.469 54.245 1.00 18.82 ? 125  SER A O   1 
ATOM   976  C  CB  . SER A 1  125 ? -4.606  71.823 53.447 1.00 17.70 ? 125  SER A CB  1 
ATOM   977  O  OG  . SER A 1  125 ? -5.885  72.374 53.437 1.00 19.60 ? 125  SER A OG  1 
ATOM   978  N  N   . THR A 1  126 ? -4.683  74.106 56.043 1.00 19.02 ? 126  THR A N   1 
ATOM   979  C  CA  . THR A 1  126 ? -5.109  75.488 56.214 1.00 20.27 ? 126  THR A CA  1 
ATOM   980  C  C   . THR A 1  126 ? -4.257  76.226 57.246 1.00 20.35 ? 126  THR A C   1 
ATOM   981  O  O   . THR A 1  126 ? -4.522  77.381 57.561 1.00 19.89 ? 126  THR A O   1 
ATOM   982  C  CB  . THR A 1  126 ? -6.565  75.533 56.618 1.00 20.30 ? 126  THR A CB  1 
ATOM   983  O  OG1 . THR A 1  126 ? -6.709  74.845 57.865 1.00 20.72 ? 126  THR A OG1 1 
ATOM   984  C  CG2 . THR A 1  126 ? -7.427  74.809 55.572 1.00 21.25 ? 126  THR A CG2 1 
ATOM   985  N  N   . LEU A 1  127 ? -3.230  75.545 57.748 1.00 20.63 ? 127  LEU A N   1 
ATOM   986  C  CA  . LEU A 1  127 ? -2.336  76.098 58.767 1.00 21.93 ? 127  LEU A CA  1 
ATOM   987  C  C   . LEU A 1  127 ? -1.631  77.366 58.286 1.00 22.10 ? 127  LEU A C   1 
ATOM   988  O  O   . LEU A 1  127 ? -1.262  77.467 57.118 1.00 22.05 ? 127  LEU A O   1 
ATOM   989  C  CB  . LEU A 1  127 ? -1.277  75.057 59.184 1.00 21.44 ? 127  LEU A CB  1 
ATOM   990  C  CG  . LEU A 1  127 ? -1.642  73.713 59.828 1.00 22.14 ? 127  LEU A CG  1 
ATOM   991  C  CD1 . LEU A 1  127 ? -0.365  73.026 60.338 1.00 19.81 ? 127  LEU A CD1 1 
ATOM   992  C  CD2 . LEU A 1  127 ? -2.656  73.888 60.977 1.00 20.93 ? 127  LEU A CD2 1 
ATOM   993  N  N   . ASP A 1  128 ? -1.441  78.327 59.186 1.00 22.83 ? 128  ASP A N   1 
ATOM   994  C  CA  . ASP A 1  128 ? -0.730  79.585 58.856 1.00 23.42 ? 128  ASP A CA  1 
ATOM   995  C  C   . ASP A 1  128 ? 0.629   79.309 58.233 1.00 22.99 ? 128  ASP A C   1 
ATOM   996  O  O   . ASP A 1  128 ? 1.067   80.021 57.321 1.00 23.68 ? 128  ASP A O   1 
ATOM   997  C  CB  . ASP A 1  128 ? -0.506  80.459 60.110 1.00 24.02 ? 128  ASP A CB  1 
ATOM   998  C  CG  . ASP A 1  128 ? -1.793  81.042 60.684 1.00 26.26 ? 128  ASP A CG  1 
ATOM   999  O  OD1 . ASP A 1  128 ? -2.868  80.915 60.062 1.00 27.85 ? 128  ASP A OD1 1 
ATOM   1000 O  OD2 . ASP A 1  128 ? -1.714  81.637 61.786 1.00 31.91 ? 128  ASP A OD2 1 
ATOM   1001 N  N   . VAL A 1  129 ? 1.313   78.295 58.757 1.00 22.10 ? 129  VAL A N   1 
ATOM   1002 C  CA  . VAL A 1  129 ? 2.645   77.960 58.271 1.00 21.00 ? 129  VAL A CA  1 
ATOM   1003 C  C   . VAL A 1  129 ? 2.630   77.262 56.889 1.00 21.26 ? 129  VAL A C   1 
ATOM   1004 O  O   . VAL A 1  129 ? 3.694   77.107 56.268 1.00 20.60 ? 129  VAL A O   1 
ATOM   1005 C  CB  . VAL A 1  129 ? 3.429   77.148 59.329 1.00 20.62 ? 129  VAL A CB  1 
ATOM   1006 C  CG1 . VAL A 1  129 ? 3.215   75.670 59.191 1.00 19.60 ? 129  VAL A CG1 1 
ATOM   1007 C  CG2 . VAL A 1  129 ? 4.880   77.448 59.241 1.00 21.26 ? 129  VAL A CG2 1 
ATOM   1008 N  N   . TYR A 1  130 ? 1.446   76.825 56.425 1.00 20.66 ? 130  TYR A N   1 
ATOM   1009 C  CA  . TYR A 1  130 ? 1.317   76.218 55.070 1.00 21.05 ? 130  TYR A CA  1 
ATOM   1010 C  C   . TYR A 1  130 ? 0.741   77.166 54.027 1.00 21.87 ? 130  TYR A C   1 
ATOM   1011 O  O   . TYR A 1  130 ? 0.344   76.726 52.933 1.00 21.98 ? 130  TYR A O   1 
ATOM   1012 C  CB  . TYR A 1  130 ? 0.456   74.949 55.070 1.00 20.53 ? 130  TYR A CB  1 
ATOM   1013 C  CG  . TYR A 1  130 ? 0.959   73.821 55.943 1.00 19.44 ? 130  TYR A CG  1 
ATOM   1014 C  CD1 . TYR A 1  130 ? 2.328   73.680 56.243 1.00 18.03 ? 130  TYR A CD1 1 
ATOM   1015 C  CD2 . TYR A 1  130 ? 0.064   72.900 56.467 1.00 15.10 ? 130  TYR A CD2 1 
ATOM   1016 C  CE1 . TYR A 1  130 ? 2.771   72.628 57.046 1.00 17.91 ? 130  TYR A CE1 1 
ATOM   1017 C  CE2 . TYR A 1  130 ? 0.484   71.848 57.249 1.00 15.89 ? 130  TYR A CE2 1 
ATOM   1018 C  CZ  . TYR A 1  130 ? 1.826   71.716 57.551 1.00 17.52 ? 130  TYR A CZ  1 
ATOM   1019 O  OH  . TYR A 1  130 ? 2.212   70.674 58.342 1.00 16.14 ? 130  TYR A OH  1 
ATOM   1020 N  N   . ASN A 1  131 ? 0.691   78.457 54.354 1.00 22.97 ? 131  ASN A N   1 
ATOM   1021 C  CA  . ASN A 1  131 ? 0.081   79.448 53.462 1.00 23.43 ? 131  ASN A CA  1 
ATOM   1022 C  C   . ASN A 1  131 ? 0.905   79.629 52.222 1.00 22.56 ? 131  ASN A C   1 
ATOM   1023 O  O   . ASN A 1  131 ? 2.008   80.103 52.298 1.00 22.39 ? 131  ASN A O   1 
ATOM   1024 C  CB  . ASN A 1  131 ? -0.071  80.801 54.152 1.00 23.76 ? 131  ASN A CB  1 
ATOM   1025 C  CG  . ASN A 1  131 ? -0.938  81.765 53.353 1.00 25.86 ? 131  ASN A CG  1 
ATOM   1026 O  OD1 . ASN A 1  131 ? -0.853  81.851 52.115 1.00 27.89 ? 131  ASN A OD1 1 
ATOM   1027 N  ND2 . ASN A 1  131 ? -1.790  82.489 54.058 1.00 28.70 ? 131  ASN A ND2 1 
ATOM   1028 N  N   . GLY A 1  132 ? 0.336   79.293 51.073 1.00 22.94 ? 132  GLY A N   1 
ATOM   1029 C  CA  . GLY A 1  132 ? 1.127   79.216 49.850 1.00 23.01 ? 132  GLY A CA  1 
ATOM   1030 C  C   . GLY A 1  132 ? 1.403   80.511 49.124 1.00 23.48 ? 132  GLY A C   1 
ATOM   1031 O  O   . GLY A 1  132 ? 2.110   80.511 48.099 1.00 23.76 ? 132  GLY A O   1 
ATOM   1032 N  N   . LYS A 1  133 ? 0.877   81.618 49.651 1.00 23.44 ? 133  LYS A N   1 
ATOM   1033 C  CA  . LYS A 1  133 ? 0.989   82.909 48.960 1.00 23.54 ? 133  LYS A CA  1 
ATOM   1034 C  C   . LYS A 1  133 ? 2.427   83.416 48.803 1.00 23.44 ? 133  LYS A C   1 
ATOM   1035 O  O   . LYS A 1  133 ? 2.803   83.922 47.736 1.00 23.52 ? 133  LYS A O   1 
ATOM   1036 C  CB  . LYS A 1  133 ? 0.070   83.965 49.593 1.00 23.27 ? 133  LYS A CB  1 
ATOM   1037 C  CG  . LYS A 1  133 ? 0.526   84.523 50.926 1.00 22.50 ? 133  LYS A CG  1 
ATOM   1038 C  CD  . LYS A 1  133 ? -0.637  85.203 51.638 1.00 23.29 ? 133  LYS A CD  1 
ATOM   1039 C  CE  . LYS A 1  133 ? -0.127  86.312 52.529 1.00 24.81 ? 133  LYS A CE  1 
ATOM   1040 N  NZ  . LYS A 1  133 ? -1.220  86.955 53.313 1.00 27.84 ? 133  LYS A NZ  1 
ATOM   1041 N  N   . TYR A 1  134 ? 3.234   83.271 49.850 1.00 23.27 ? 134  TYR A N   1 
ATOM   1042 C  CA  . TYR A 1  134 ? 4.615   83.765 49.790 1.00 22.74 ? 134  TYR A CA  1 
ATOM   1043 C  C   . TYR A 1  134 ? 5.411   83.029 48.733 1.00 22.84 ? 134  TYR A C   1 
ATOM   1044 O  O   . TYR A 1  134 ? 6.216   83.634 48.024 1.00 23.55 ? 134  TYR A O   1 
ATOM   1045 C  CB  . TYR A 1  134 ? 5.287   83.679 51.166 1.00 22.49 ? 134  TYR A CB  1 
ATOM   1046 C  CG  . TYR A 1  134 ? 4.424   84.269 52.245 1.00 22.54 ? 134  TYR A CG  1 
ATOM   1047 C  CD1 . TYR A 1  134 ? 4.144   85.649 52.263 1.00 23.26 ? 134  TYR A CD1 1 
ATOM   1048 C  CD2 . TYR A 1  134 ? 3.828   83.454 53.213 1.00 23.04 ? 134  TYR A CD2 1 
ATOM   1049 C  CE1 . TYR A 1  134 ? 3.315   86.211 53.241 1.00 22.71 ? 134  TYR A CE1 1 
ATOM   1050 C  CE2 . TYR A 1  134 ? 3.012   83.999 54.208 1.00 23.72 ? 134  TYR A CE2 1 
ATOM   1051 C  CZ  . TYR A 1  134 ? 2.762   85.388 54.204 1.00 24.70 ? 134  TYR A CZ  1 
ATOM   1052 O  OH  . TYR A 1  134 ? 1.953   85.938 55.170 1.00 28.75 ? 134  TYR A OH  1 
ATOM   1053 N  N   . LEU A 1  135 ? 5.172   81.728 48.596 1.00 22.63 ? 135  LEU A N   1 
ATOM   1054 C  CA  . LEU A 1  135 ? 5.962   80.913 47.662 1.00 23.17 ? 135  LEU A CA  1 
ATOM   1055 C  C   . LEU A 1  135 ? 5.475   81.148 46.231 1.00 23.38 ? 135  LEU A C   1 
ATOM   1056 O  O   . LEU A 1  135 ? 6.267   81.330 45.308 1.00 24.33 ? 135  LEU A O   1 
ATOM   1057 C  CB  . LEU A 1  135 ? 5.873   79.440 48.054 1.00 22.63 ? 135  LEU A CB  1 
ATOM   1058 C  CG  . LEU A 1  135 ? 6.809   78.390 47.482 1.00 22.82 ? 135  LEU A CG  1 
ATOM   1059 C  CD1 . LEU A 1  135 ? 8.277   78.787 47.522 1.00 20.02 ? 135  LEU A CD1 1 
ATOM   1060 C  CD2 . LEU A 1  135 ? 6.563   77.112 48.290 1.00 22.92 ? 135  LEU A CD2 1 
ATOM   1061 N  N   . ALA A 1  136 ? 4.166   81.192 46.067 1.00 23.16 ? 136  ALA A N   1 
ATOM   1062 C  CA  . ALA A 1  136 ? 3.576   81.413 44.785 1.00 23.63 ? 136  ALA A CA  1 
ATOM   1063 C  C   . ALA A 1  136 ? 3.994   82.794 44.254 1.00 24.41 ? 136  ALA A C   1 
ATOM   1064 O  O   . ALA A 1  136 ? 4.400   82.931 43.091 1.00 23.71 ? 136  ALA A O   1 
ATOM   1065 C  CB  . ALA A 1  136 ? 2.046   81.297 44.895 1.00 23.39 ? 136  ALA A CB  1 
ATOM   1066 N  N   . TYR A 1  137 ? 3.912   83.798 45.125 1.00 24.94 ? 137  TYR A N   1 
ATOM   1067 C  CA  . TYR A 1  137 ? 4.208   85.161 44.739 1.00 25.75 ? 137  TYR A CA  1 
ATOM   1068 C  C   . TYR A 1  137 ? 5.697   85.344 44.439 1.00 25.59 ? 137  TYR A C   1 
ATOM   1069 O  O   . TYR A 1  137 ? 6.067   85.889 43.387 1.00 26.00 ? 137  TYR A O   1 
ATOM   1070 C  CB  . TYR A 1  137 ? 3.712   86.163 45.805 1.00 25.81 ? 137  TYR A CB  1 
ATOM   1071 C  CG  . TYR A 1  137 ? 4.236   87.554 45.585 1.00 27.45 ? 137  TYR A CG  1 
ATOM   1072 C  CD1 . TYR A 1  137 ? 3.707   88.369 44.576 1.00 30.27 ? 137  TYR A CD1 1 
ATOM   1073 C  CD2 . TYR A 1  137 ? 5.275   88.055 46.361 1.00 29.02 ? 137  TYR A CD2 1 
ATOM   1074 C  CE1 . TYR A 1  137 ? 4.193   89.657 44.354 1.00 31.85 ? 137  TYR A CE1 1 
ATOM   1075 C  CE2 . TYR A 1  137 ? 5.776   89.350 46.148 1.00 32.16 ? 137  TYR A CE2 1 
ATOM   1076 C  CZ  . TYR A 1  137 ? 5.224   90.134 45.142 1.00 32.82 ? 137  TYR A CZ  1 
ATOM   1077 O  OH  . TYR A 1  137 ? 5.718   91.382 44.925 1.00 36.89 ? 137  TYR A OH  1 
ATOM   1078 N  N   . THR A 1  138 ? 6.548   84.881 45.354 1.00 25.46 ? 138  THR A N   1 
ATOM   1079 C  CA  . THR A 1  138 ? 8.003   85.112 45.270 1.00 24.58 ? 138  THR A CA  1 
ATOM   1080 C  C   . THR A 1  138 ? 8.591   84.392 44.082 1.00 24.65 ? 138  THR A C   1 
ATOM   1081 O  O   . THR A 1  138 ? 9.384   84.971 43.354 1.00 24.07 ? 138  THR A O   1 
ATOM   1082 C  CB  . THR A 1  138 ? 8.720   84.663 46.544 1.00 24.43 ? 138  THR A CB  1 
ATOM   1083 O  OG1 . THR A 1  138 ? 8.167   85.382 47.647 1.00 25.02 ? 138  THR A OG1 1 
ATOM   1084 C  CG2 . THR A 1  138 ? 10.201  84.937 46.473 1.00 24.08 ? 138  THR A CG2 1 
ATOM   1085 N  N   . GLU A 1  139 ? 8.172   83.141 43.873 1.00 24.75 ? 139  GLU A N   1 
ATOM   1086 C  CA  . GLU A 1  139 ? 8.808   82.287 42.874 1.00 24.90 ? 139  GLU A CA  1 
ATOM   1087 C  C   . GLU A 1  139 ? 7.985   82.047 41.628 1.00 25.35 ? 139  GLU A C   1 
ATOM   1088 O  O   . GLU A 1  139 ? 8.403   81.278 40.772 1.00 27.09 ? 139  GLU A O   1 
ATOM   1089 C  CB  . GLU A 1  139 ? 9.202   80.935 43.482 1.00 24.69 ? 139  GLU A CB  1 
ATOM   1090 C  CG  . GLU A 1  139 ? 10.198  81.003 44.623 1.00 23.61 ? 139  GLU A CG  1 
ATOM   1091 C  CD  . GLU A 1  139 ? 11.529  81.527 44.198 1.00 25.75 ? 139  GLU A CD  1 
ATOM   1092 O  OE1 . GLU A 1  139 ? 12.007  81.168 43.107 1.00 27.43 ? 139  GLU A OE1 1 
ATOM   1093 O  OE2 . GLU A 1  139 ? 12.115  82.311 44.963 1.00 28.42 ? 139  GLU A OE2 1 
ATOM   1094 N  N   . GLU A 1  140 ? 6.817   82.671 41.519 1.00 25.31 ? 140  GLU A N   1 
ATOM   1095 C  CA  . GLU A 1  140 ? 5.995   82.574 40.308 1.00 25.24 ? 140  GLU A CA  1 
ATOM   1096 C  C   . GLU A 1  140 ? 5.633   81.108 40.037 1.00 24.50 ? 140  GLU A C   1 
ATOM   1097 O  O   . GLU A 1  140 ? 5.770   80.608 38.921 1.00 25.19 ? 140  GLU A O   1 
ATOM   1098 C  CB  . GLU A 1  140 ? 6.703   83.245 39.101 1.00 25.29 ? 140  GLU A CB  1 
ATOM   1099 C  CG  . GLU A 1  140 ? 7.589   84.450 39.521 0.50 26.91 ? 140  GLU A CG  1 
ATOM   1100 C  CD  . GLU A 1  140 ? 7.969   85.388 38.385 0.50 28.11 ? 140  GLU A CD  1 
ATOM   1101 O  OE1 . GLU A 1  140 ? 7.201   86.337 38.128 0.50 28.37 ? 140  GLU A OE1 1 
ATOM   1102 O  OE2 . GLU A 1  140 ? 9.047   85.195 37.775 0.50 27.33 ? 140  GLU A OE2 1 
ATOM   1103 N  N   . VAL A 1  141 ? 5.187   80.412 41.081 1.00 23.53 ? 141  VAL A N   1 
ATOM   1104 C  CA  . VAL A 1  141 ? 4.680   79.067 40.936 1.00 21.41 ? 141  VAL A CA  1 
ATOM   1105 C  C   . VAL A 1  141 ? 3.213   79.064 41.262 1.00 21.47 ? 141  VAL A C   1 
ATOM   1106 O  O   . VAL A 1  141 ? 2.735   79.926 41.994 1.00 20.58 ? 141  VAL A O   1 
ATOM   1107 C  CB  . VAL A 1  141 ? 5.449   78.061 41.823 1.00 21.99 ? 141  VAL A CB  1 
ATOM   1108 C  CG1 . VAL A 1  141 ? 6.913   77.968 41.367 1.00 19.56 ? 141  VAL A CG1 1 
ATOM   1109 C  CG2 . VAL A 1  141 ? 5.346   78.409 43.321 1.00 19.82 ? 141  VAL A CG2 1 
ATOM   1110 N  N   . VAL A 1  142 ? 2.488   78.107 40.689 1.00 21.15 ? 142  VAL A N   1 
ATOM   1111 C  CA  . VAL A 1  142 ? 1.129   77.822 41.138 1.00 20.82 ? 142  VAL A CA  1 
ATOM   1112 C  C   . VAL A 1  142 ? 1.266   76.858 42.303 1.00 20.72 ? 142  VAL A C   1 
ATOM   1113 O  O   . VAL A 1  142 ? 1.839   75.756 42.148 1.00 21.14 ? 142  VAL A O   1 
ATOM   1114 C  CB  . VAL A 1  142 ? 0.283   77.160 40.053 1.00 20.38 ? 142  VAL A CB  1 
ATOM   1115 C  CG1 . VAL A 1  142 ? -1.016  76.648 40.653 1.00 20.88 ? 142  VAL A CG1 1 
ATOM   1116 C  CG2 . VAL A 1  142 ? -0.032  78.150 38.947 1.00 20.98 ? 142  VAL A CG2 1 
ATOM   1117 N  N   . LEU A 1  143 ? 0.779   77.263 43.471 1.00 19.96 ? 143  LEU A N   1 
ATOM   1118 C  CA  . LEU A 1  143 ? 1.005   76.453 44.682 1.00 19.03 ? 143  LEU A CA  1 
ATOM   1119 C  C   . LEU A 1  143 ? -0.304  75.815 45.104 1.00 17.71 ? 143  LEU A C   1 
ATOM   1120 O  O   . LEU A 1  143 ? -1.293  76.515 45.306 1.00 17.52 ? 143  LEU A O   1 
ATOM   1121 C  CB  . LEU A 1  143 ? 1.668   77.286 45.805 1.00 19.99 ? 143  LEU A CB  1 
ATOM   1122 C  CG  . LEU A 1  143 ? 2.285   76.650 47.066 1.00 18.65 ? 143  LEU A CG  1 
ATOM   1123 C  CD1 . LEU A 1  143 ? 1.207   76.156 47.957 1.00 19.06 ? 143  LEU A CD1 1 
ATOM   1124 C  CD2 . LEU A 1  143 ? 3.212   75.511 46.755 1.00 20.37 ? 143  LEU A CD2 1 
ATOM   1125 N  N   . VAL A 1  144 ? -0.320  74.480 45.168 1.00 16.08 ? 144  VAL A N   1 
ATOM   1126 C  CA  . VAL A 1  144 ? -1.517  73.742 45.605 1.00 14.10 ? 144  VAL A CA  1 
ATOM   1127 C  C   . VAL A 1  144 ? -1.257  73.068 46.953 1.00 14.63 ? 144  VAL A C   1 
ATOM   1128 O  O   . VAL A 1  144 ? -0.201  72.418 47.156 1.00 14.42 ? 144  VAL A O   1 
ATOM   1129 C  CB  . VAL A 1  144 ? -1.900  72.637 44.587 1.00 14.79 ? 144  VAL A CB  1 
ATOM   1130 C  CG1 . VAL A 1  144 ? -3.150  71.827 45.063 1.00 12.21 ? 144  VAL A CG1 1 
ATOM   1131 C  CG2 . VAL A 1  144 ? -2.082  73.211 43.179 1.00 11.70 ? 144  VAL A CG2 1 
ATOM   1132 N  N   . SER A 1  145 ? -2.196  73.186 47.883 1.00 14.46 ? 145  SER A N   1 
ATOM   1133 C  CA  . SER A 1  145 ? -2.160  72.274 49.037 1.00 15.06 ? 145  SER A CA  1 
ATOM   1134 C  C   . SER A 1  145 ? -3.381  71.383 48.970 1.00 15.25 ? 145  SER A C   1 
ATOM   1135 O  O   . SER A 1  145 ? -4.495  71.872 48.800 1.00 15.61 ? 145  SER A O   1 
ATOM   1136 C  CB  . SER A 1  145 ? -2.088  73.022 50.373 1.00 15.12 ? 145  SER A CB  1 
ATOM   1137 O  OG  . SER A 1  145 ? -3.168  73.932 50.528 1.00 16.95 ? 145  SER A OG  1 
ATOM   1138 N  N   . LEU A 1  146 ? -3.174  70.071 49.093 1.00 14.82 ? 146  LEU A N   1 
ATOM   1139 C  CA  . LEU A 1  146 ? -4.293  69.146 49.136 1.00 14.25 ? 146  LEU A CA  1 
ATOM   1140 C  C   . LEU A 1  146 ? -4.645  68.766 50.578 1.00 14.64 ? 146  LEU A C   1 
ATOM   1141 O  O   . LEU A 1  146 ? -4.111  69.315 51.526 1.00 14.20 ? 146  LEU A O   1 
ATOM   1142 C  CB  . LEU A 1  146 ? -3.998  67.915 48.270 1.00 14.02 ? 146  LEU A CB  1 
ATOM   1143 C  CG  . LEU A 1  146 ? -2.703  67.102 48.482 1.00 13.27 ? 146  LEU A CG  1 
ATOM   1144 C  CD1 . LEU A 1  146 ? -2.688  66.342 49.856 1.00 11.58 ? 146  LEU A CD1 1 
ATOM   1145 C  CD2 . LEU A 1  146 ? -2.479  66.155 47.342 1.00 10.99 ? 146  LEU A CD2 1 
ATOM   1146 N  N   . SER A 1  147 ? -5.561  67.823 50.741 1.00 15.51 ? 147  SER A N   1 
ATOM   1147 C  CA  . SER A 1  147 ? -5.936  67.351 52.056 1.00 15.83 ? 147  SER A CA  1 
ATOM   1148 C  C   . SER A 1  147 ? -6.268  65.900 51.861 1.00 15.98 ? 147  SER A C   1 
ATOM   1149 O  O   . SER A 1  147 ? -6.460  65.454 50.722 1.00 16.39 ? 147  SER A O   1 
ATOM   1150 C  CB  . SER A 1  147 ? -7.145  68.103 52.590 1.00 15.82 ? 147  SER A CB  1 
ATOM   1151 O  OG  . SER A 1  147 ? -8.279  67.727 51.865 1.00 18.79 ? 147  SER A OG  1 
ATOM   1152 N  N   . TYR A 1  148 ? -6.287  65.154 52.960 1.00 15.59 ? 148  TYR A N   1 
ATOM   1153 C  CA  . TYR A 1  148 ? -6.559  63.735 52.917 1.00 14.80 ? 148  TYR A CA  1 
ATOM   1154 C  C   . TYR A 1  148 ? -6.995  63.282 54.308 1.00 15.26 ? 148  TYR A C   1 
ATOM   1155 O  O   . TYR A 1  148 ? -6.587  63.843 55.343 1.00 14.67 ? 148  TYR A O   1 
ATOM   1156 C  CB  . TYR A 1  148 ? -5.337  62.938 52.429 1.00 15.08 ? 148  TYR A CB  1 
ATOM   1157 C  CG  . TYR A 1  148 ? -4.085  63.097 53.271 1.00 16.28 ? 148  TYR A CG  1 
ATOM   1158 C  CD1 . TYR A 1  148 ? -3.229  64.199 53.101 1.00 14.47 ? 148  TYR A CD1 1 
ATOM   1159 C  CD2 . TYR A 1  148 ? -3.767  62.164 54.258 1.00 15.91 ? 148  TYR A CD2 1 
ATOM   1160 C  CE1 . TYR A 1  148 ? -2.102  64.349 53.882 1.00 12.12 ? 148  TYR A CE1 1 
ATOM   1161 C  CE2 . TYR A 1  148 ? -2.628  62.306 55.052 1.00 11.62 ? 148  TYR A CE2 1 
ATOM   1162 C  CZ  . TYR A 1  148 ? -1.810  63.393 54.863 1.00 14.18 ? 148  TYR A CZ  1 
ATOM   1163 O  OH  . TYR A 1  148 ? -0.688  63.515 55.674 1.00 13.31 ? 148  TYR A OH  1 
ATOM   1164 N  N   . ARG A 1  149 ? -7.826  62.258 54.324 1.00 14.95 ? 149  ARG A N   1 
ATOM   1165 C  CA  . ARG A 1  149 ? -8.303  61.695 55.568 1.00 15.57 ? 149  ARG A CA  1 
ATOM   1166 C  C   . ARG A 1  149 ? -7.156  61.144 56.391 1.00 14.79 ? 149  ARG A C   1 
ATOM   1167 O  O   . ARG A 1  149 ? -6.274  60.504 55.847 1.00 15.10 ? 149  ARG A O   1 
ATOM   1168 C  CB  . ARG A 1  149 ? -9.327  60.593 55.307 1.00 15.03 ? 149  ARG A CB  1 
ATOM   1169 C  CG  . ARG A 1  149 ? -10.697 61.132 54.987 1.00 16.49 ? 149  ARG A CG  1 
ATOM   1170 C  CD  . ARG A 1  149 ? -11.591 59.961 54.531 1.00 18.71 ? 149  ARG A CD  1 
ATOM   1171 N  NE  . ARG A 1  149 ? -11.214 59.554 53.184 1.00 16.21 ? 149  ARG A NE  1 
ATOM   1172 C  CZ  . ARG A 1  149 ? -11.737 58.532 52.536 1.00 17.34 ? 149  ARG A CZ  1 
ATOM   1173 N  NH1 . ARG A 1  149 ? -12.696 57.790 53.110 1.00 18.77 ? 149  ARG A NH1 1 
ATOM   1174 N  NH2 . ARG A 1  149 ? -11.313 58.269 51.305 1.00 15.23 ? 149  ARG A NH2 1 
ATOM   1175 N  N   . VAL A 1  150 ? -7.184  61.430 57.690 1.00 14.08 ? 150  VAL A N   1 
ATOM   1176 C  CA  . VAL A 1  150 ? -6.206  60.894 58.628 1.00 15.17 ? 150  VAL A CA  1 
ATOM   1177 C  C   . VAL A 1  150 ? -6.861  59.944 59.654 1.00 15.68 ? 150  VAL A C   1 
ATOM   1178 O  O   . VAL A 1  150 ? -8.113  59.768 59.691 1.00 15.31 ? 150  VAL A O   1 
ATOM   1179 C  CB  . VAL A 1  150 ? -5.408  62.041 59.370 1.00 14.59 ? 150  VAL A CB  1 
ATOM   1180 C  CG1 . VAL A 1  150 ? -4.469  62.713 58.425 1.00 14.09 ? 150  VAL A CG1 1 
ATOM   1181 C  CG2 . VAL A 1  150 ? -6.352  63.065 59.994 1.00 15.13 ? 150  VAL A CG2 1 
ATOM   1182 N  N   . GLY A 1  151 ? -6.024  59.339 60.502 1.00 15.80 ? 151  GLY A N   1 
ATOM   1183 C  CA  . GLY A 1  151 ? -6.538  58.508 61.594 1.00 15.78 ? 151  GLY A CA  1 
ATOM   1184 C  C   . GLY A 1  151 ? -7.265  57.319 61.023 1.00 15.87 ? 151  GLY A C   1 
ATOM   1185 O  O   . GLY A 1  151 ? -7.007  56.928 59.892 1.00 17.21 ? 151  GLY A O   1 
ATOM   1186 N  N   . ALA A 1  152 ? -8.206  56.753 61.765 1.00 16.26 ? 152  ALA A N   1 
ATOM   1187 C  CA  . ALA A 1  152 ? -8.909  55.570 61.273 1.00 16.40 ? 152  ALA A CA  1 
ATOM   1188 C  C   . ALA A 1  152 ? -9.675  55.905 60.014 1.00 16.74 ? 152  ALA A C   1 
ATOM   1189 O  O   . ALA A 1  152 ? -9.898  55.021 59.171 1.00 16.55 ? 152  ALA A O   1 
ATOM   1190 C  CB  . ALA A 1  152 ? -9.887  55.011 62.344 1.00 16.59 ? 152  ALA A CB  1 
ATOM   1191 N  N   . PHE A 1  153 ? -10.102 57.176 59.913 1.00 16.62 ? 153  PHE A N   1 
ATOM   1192 C  CA  . PHE A 1  153 ? -10.873 57.635 58.760 1.00 16.74 ? 153  PHE A CA  1 
ATOM   1193 C  C   . PHE A 1  153 ? -10.120 57.437 57.457 1.00 16.55 ? 153  PHE A C   1 
ATOM   1194 O  O   . PHE A 1  153 ? -10.734 57.131 56.431 1.00 16.52 ? 153  PHE A O   1 
ATOM   1195 C  CB  . PHE A 1  153 ? -11.323 59.084 58.907 1.00 16.63 ? 153  PHE A CB  1 
ATOM   1196 C  CG  . PHE A 1  153 ? -11.986 59.369 60.205 1.00 18.50 ? 153  PHE A CG  1 
ATOM   1197 C  CD1 . PHE A 1  153 ? -13.353 59.147 60.368 1.00 20.17 ? 153  PHE A CD1 1 
ATOM   1198 C  CD2 . PHE A 1  153 ? -11.246 59.889 61.279 1.00 19.55 ? 153  PHE A CD2 1 
ATOM   1199 C  CE1 . PHE A 1  153 ? -13.974 59.431 61.585 1.00 20.99 ? 153  PHE A CE1 1 
ATOM   1200 C  CE2 . PHE A 1  153 ? -11.843 60.173 62.501 1.00 19.19 ? 153  PHE A CE2 1 
ATOM   1201 C  CZ  . PHE A 1  153 ? -13.218 59.945 62.657 1.00 21.38 ? 153  PHE A CZ  1 
ATOM   1202 N  N   . GLY A 1  154 ? -8.794  57.597 57.491 1.00 16.95 ? 154  GLY A N   1 
ATOM   1203 C  CA  . GLY A 1  154 ? -7.994  57.482 56.279 1.00 16.08 ? 154  GLY A CA  1 
ATOM   1204 C  C   . GLY A 1  154 ? -7.261  56.155 56.187 1.00 16.63 ? 154  GLY A C   1 
ATOM   1205 O  O   . GLY A 1  154 ? -6.798  55.769 55.108 1.00 15.45 ? 154  GLY A O   1 
ATOM   1206 N  N   . PHE A 1  155 ? -7.127  55.454 57.322 1.00 16.45 ? 155  PHE A N   1 
ATOM   1207 C  CA  . PHE A 1  155 ? -6.192  54.359 57.358 1.00 15.95 ? 155  PHE A CA  1 
ATOM   1208 C  C   . PHE A 1  155 ? -6.609  53.065 58.037 1.00 16.55 ? 155  PHE A C   1 
ATOM   1209 O  O   . PHE A 1  155 ? -5.826  52.103 58.046 1.00 14.52 ? 155  PHE A O   1 
ATOM   1210 C  CB  . PHE A 1  155 ? -4.811  54.866 57.791 1.00 15.38 ? 155  PHE A CB  1 
ATOM   1211 C  CG  . PHE A 1  155 ? -4.253  55.858 56.843 1.00 15.33 ? 155  PHE A CG  1 
ATOM   1212 C  CD1 . PHE A 1  155 ? -3.774  55.442 55.591 1.00 16.13 ? 155  PHE A CD1 1 
ATOM   1213 C  CD2 . PHE A 1  155 ? -4.288  57.215 57.133 1.00 15.34 ? 155  PHE A CD2 1 
ATOM   1214 C  CE1 . PHE A 1  155 ? -3.282  56.352 54.677 1.00 15.38 ? 155  PHE A CE1 1 
ATOM   1215 C  CE2 . PHE A 1  155 ? -3.807  58.150 56.214 1.00 16.00 ? 155  PHE A CE2 1 
ATOM   1216 C  CZ  . PHE A 1  155 ? -3.283  57.719 54.993 1.00 13.52 ? 155  PHE A CZ  1 
ATOM   1217 N  N   . LEU A 1  156 ? -7.844  53.016 58.550 1.00 17.71 ? 156  LEU A N   1 
ATOM   1218 C  CA  . LEU A 1  156 ? -8.374  51.744 59.065 1.00 19.52 ? 156  LEU A CA  1 
ATOM   1219 C  C   . LEU A 1  156 ? -8.244  50.727 57.951 1.00 20.06 ? 156  LEU A C   1 
ATOM   1220 O  O   . LEU A 1  156 ? -8.672  50.993 56.844 1.00 20.07 ? 156  LEU A O   1 
ATOM   1221 C  CB  . LEU A 1  156 ? -9.849  51.835 59.468 1.00 19.75 ? 156  LEU A CB  1 
ATOM   1222 C  CG  . LEU A 1  156 ? -10.300 50.603 60.282 1.00 21.03 ? 156  LEU A CG  1 
ATOM   1223 C  CD1 . LEU A 1  156 ? -10.429 50.942 61.798 1.00 17.42 ? 156  LEU A CD1 1 
ATOM   1224 C  CD2 . LEU A 1  156 ? -11.625 50.085 59.734 1.00 20.08 ? 156  LEU A CD2 1 
ATOM   1225 N  N   . ALA A 1  157 ? -7.635  49.578 58.230 1.00 20.91 ? 157  ALA A N   1 
ATOM   1226 C  CA  . ALA A 1  157 ? -7.307  48.642 57.172 1.00 21.36 ? 157  ALA A CA  1 
ATOM   1227 C  C   . ALA A 1  157 ? -7.785  47.225 57.511 1.00 22.46 ? 157  ALA A C   1 
ATOM   1228 O  O   . ALA A 1  157 ? -7.257  46.600 58.426 1.00 21.83 ? 157  ALA A O   1 
ATOM   1229 C  CB  . ALA A 1  157 ? -5.831  48.653 56.934 1.00 21.30 ? 157  ALA A CB  1 
ATOM   1230 N  N   . LEU A 1  158 ? -8.806  46.743 56.790 1.00 23.05 ? 158  LEU A N   1 
ATOM   1231 C  CA  . LEU A 1  158 ? -9.209  45.337 56.864 1.00 23.66 ? 158  LEU A CA  1 
ATOM   1232 C  C   . LEU A 1  158 ? -9.064  44.735 55.472 1.00 24.41 ? 158  LEU A C   1 
ATOM   1233 O  O   . LEU A 1  158 ? -10.021 44.637 54.712 1.00 24.45 ? 158  LEU A O   1 
ATOM   1234 C  CB  . LEU A 1  158 ? -10.628 45.183 57.417 1.00 23.32 ? 158  LEU A CB  1 
ATOM   1235 C  CG  . LEU A 1  158 ? -10.790 45.620 58.886 1.00 23.70 ? 158  LEU A CG  1 
ATOM   1236 C  CD1 . LEU A 1  158 ? -12.195 46.153 59.160 1.00 20.15 ? 158  LEU A CD1 1 
ATOM   1237 C  CD2 . LEU A 1  158 ? -10.407 44.528 59.896 1.00 20.13 ? 158  LEU A CD2 1 
ATOM   1238 N  N   . HIS A 1  159 ? -7.833  44.376 55.135 1.00 25.68 ? 159  HIS A N   1 
ATOM   1239 C  CA  . HIS A 1  159 ? -7.497  43.779 53.849 1.00 27.11 ? 159  HIS A CA  1 
ATOM   1240 C  C   . HIS A 1  159 ? -8.396  42.594 53.512 1.00 28.73 ? 159  HIS A C   1 
ATOM   1241 O  O   . HIS A 1  159 ? -8.575  41.697 54.351 1.00 28.74 ? 159  HIS A O   1 
ATOM   1242 C  CB  . HIS A 1  159 ? -6.075  43.277 53.878 1.00 26.59 ? 159  HIS A CB  1 
ATOM   1243 C  CG  . HIS A 1  159 ? -5.562  42.868 52.534 1.00 27.36 ? 159  HIS A CG  1 
ATOM   1244 N  ND1 . HIS A 1  159 ? -5.475  43.747 51.474 1.00 25.33 ? 159  HIS A ND1 1 
ATOM   1245 C  CD2 . HIS A 1  159 ? -5.119  41.676 52.075 1.00 25.98 ? 159  HIS A CD2 1 
ATOM   1246 C  CE1 . HIS A 1  159 ? -4.992  43.117 50.422 1.00 26.33 ? 159  HIS A CE1 1 
ATOM   1247 N  NE2 . HIS A 1  159 ? -4.765  41.859 50.761 1.00 28.04 ? 159  HIS A NE2 1 
ATOM   1248 N  N   . GLY A 1  160 ? -8.938  42.597 52.286 1.00 30.19 ? 160  GLY A N   1 
ATOM   1249 C  CA  . GLY A 1  160 ? -9.934  41.611 51.840 1.00 31.39 ? 160  GLY A CA  1 
ATOM   1250 C  C   . GLY A 1  160 ? -11.302 42.255 51.756 1.00 32.71 ? 160  GLY A C   1 
ATOM   1251 O  O   . GLY A 1  160 ? -12.135 41.889 50.924 1.00 33.68 ? 160  GLY A O   1 
ATOM   1252 N  N   . SER A 1  161 ? -11.541 43.226 52.626 1.00 33.25 ? 161  SER A N   1 
ATOM   1253 C  CA  . SER A 1  161 ? -12.789 43.966 52.623 1.00 33.61 ? 161  SER A CA  1 
ATOM   1254 C  C   . SER A 1  161 ? -12.745 45.105 51.617 1.00 33.59 ? 161  SER A C   1 
ATOM   1255 O  O   . SER A 1  161 ? -11.712 45.752 51.454 1.00 34.45 ? 161  SER A O   1 
ATOM   1256 C  CB  . SER A 1  161 ? -13.056 44.535 54.007 1.00 33.49 ? 161  SER A CB  1 
ATOM   1257 O  OG  . SER A 1  161 ? -14.045 45.535 53.913 1.00 35.82 ? 161  SER A OG  1 
ATOM   1258 N  N   . GLN A 1  162 ? -13.856 45.368 50.939 1.00 33.06 ? 162  GLN A N   1 
ATOM   1259 C  CA  . GLN A 1  162 ? -13.865 46.485 49.995 1.00 32.60 ? 162  GLN A CA  1 
ATOM   1260 C  C   . GLN A 1  162 ? -14.446 47.751 50.617 1.00 31.39 ? 162  GLN A C   1 
ATOM   1261 O  O   . GLN A 1  162 ? -14.369 48.823 50.040 1.00 30.93 ? 162  GLN A O   1 
ATOM   1262 C  CB  . GLN A 1  162 ? -14.563 46.114 48.669 1.00 33.17 ? 162  GLN A CB  1 
ATOM   1263 C  CG  . GLN A 1  162 ? -13.674 45.317 47.677 1.00 35.15 ? 162  GLN A CG  1 
ATOM   1264 C  CD  . GLN A 1  162 ? -12.287 45.974 47.419 1.00 38.31 ? 162  GLN A CD  1 
ATOM   1265 O  OE1 . GLN A 1  162 ? -12.189 47.175 47.128 1.00 37.28 ? 162  GLN A OE1 1 
ATOM   1266 N  NE2 . GLN A 1  162 ? -11.220 45.170 47.525 1.00 37.22 ? 162  GLN A NE2 1 
ATOM   1267 N  N   . GLU A 1  163 ? -15.004 47.614 51.811 1.00 30.70 ? 163  GLU A N   1 
ATOM   1268 C  CA  . GLU A 1  163 ? -15.576 48.744 52.547 1.00 29.71 ? 163  GLU A CA  1 
ATOM   1269 C  C   . GLU A 1  163 ? -14.549 49.519 53.382 1.00 28.47 ? 163  GLU A C   1 
ATOM   1270 O  O   . GLU A 1  163 ? -14.769 50.701 53.663 1.00 29.23 ? 163  GLU A O   1 
ATOM   1271 C  CB  . GLU A 1  163 ? -16.697 48.255 53.461 1.00 30.70 ? 163  GLU A CB  1 
ATOM   1272 C  CG  . GLU A 1  163 ? -17.912 47.669 52.739 1.00 31.95 ? 163  GLU A CG  1 
ATOM   1273 C  CD  . GLU A 1  163 ? -18.528 48.641 51.762 1.00 34.08 ? 163  GLU A CD  1 
ATOM   1274 O  OE1 . GLU A 1  163 ? -18.732 49.830 52.104 1.00 32.47 ? 163  GLU A OE1 1 
ATOM   1275 O  OE2 . GLU A 1  163 ? -18.791 48.202 50.621 1.00 37.77 ? 163  GLU A OE2 1 
ATOM   1276 N  N   . ALA A 1  164 ? -13.463 48.849 53.779 1.00 26.63 ? 164  ALA A N   1 
ATOM   1277 C  CA  . ALA A 1  164 ? -12.328 49.433 54.534 1.00 25.61 ? 164  ALA A CA  1 
ATOM   1278 C  C   . ALA A 1  164 ? -10.994 48.783 54.111 1.00 24.64 ? 164  ALA A C   1 
ATOM   1279 O  O   . ALA A 1  164 ? -10.373 48.044 54.892 1.00 24.99 ? 164  ALA A O   1 
ATOM   1280 C  CB  . ALA A 1  164 ? -12.540 49.265 56.049 1.00 25.27 ? 164  ALA A CB  1 
ATOM   1281 N  N   . PRO A 1  165 ? -10.553 49.023 52.865 1.00 23.38 ? 165  PRO A N   1 
ATOM   1282 C  CA  . PRO A 1  165 ? -9.415  48.238 52.390 1.00 22.90 ? 165  PRO A CA  1 
ATOM   1283 C  C   . PRO A 1  165 ? -8.075  48.684 52.952 1.00 22.55 ? 165  PRO A C   1 
ATOM   1284 O  O   . PRO A 1  165 ? -7.073  47.968 52.801 1.00 23.04 ? 165  PRO A O   1 
ATOM   1285 C  CB  . PRO A 1  165 ? -9.433  48.498 50.879 1.00 23.12 ? 165  PRO A CB  1 
ATOM   1286 C  CG  . PRO A 1  165 ? -10.063 49.836 50.729 1.00 21.84 ? 165  PRO A CG  1 
ATOM   1287 C  CD  . PRO A 1  165 ? -10.993 50.024 51.878 1.00 22.97 ? 165  PRO A CD  1 
ATOM   1288 N  N   . GLY A 1  166 ? -8.058  49.857 53.578 1.00 21.28 ? 166  GLY A N   1 
ATOM   1289 C  CA  . GLY A 1  166 ? -6.816  50.526 53.942 1.00 20.35 ? 166  GLY A CA  1 
ATOM   1290 C  C   . GLY A 1  166 ? -6.418  51.555 52.885 1.00 20.23 ? 166  GLY A C   1 
ATOM   1291 O  O   . GLY A 1  166 ? -6.990  51.594 51.775 1.00 20.21 ? 166  GLY A O   1 
ATOM   1292 N  N   . ASN A 1  167 ? -5.438  52.384 53.235 1.00 19.08 ? 167  ASN A N   1 
ATOM   1293 C  CA  . ASN A 1  167 ? -4.782  53.297 52.307 1.00 18.35 ? 167  ASN A CA  1 
ATOM   1294 C  C   . ASN A 1  167 ? -5.649  54.414 51.716 1.00 17.53 ? 167  ASN A C   1 
ATOM   1295 O  O   . ASN A 1  167 ? -5.200  55.166 50.885 1.00 17.43 ? 167  ASN A O   1 
ATOM   1296 C  CB  . ASN A 1  167 ? -4.069  52.496 51.201 1.00 18.44 ? 167  ASN A CB  1 
ATOM   1297 C  CG  . ASN A 1  167 ? -2.895  51.731 51.727 1.00 18.92 ? 167  ASN A CG  1 
ATOM   1298 O  OD1 . ASN A 1  167 ? -2.331  52.097 52.756 1.00 18.83 ? 167  ASN A OD1 1 
ATOM   1299 N  ND2 . ASN A 1  167 ? -2.503  50.671 51.032 1.00 17.74 ? 167  ASN A ND2 1 
ATOM   1300 N  N   . VAL A 1  168 ? -6.881  54.552 52.160 1.00 17.33 ? 168  VAL A N   1 
ATOM   1301 C  CA  . VAL A 1  168 ? -7.788  55.459 51.454 1.00 17.04 ? 168  VAL A CA  1 
ATOM   1302 C  C   . VAL A 1  168 ? -7.364  56.909 51.543 1.00 16.33 ? 168  VAL A C   1 
ATOM   1303 O  O   . VAL A 1  168 ? -7.603  57.677 50.605 1.00 17.04 ? 168  VAL A O   1 
ATOM   1304 C  CB  . VAL A 1  168 ? -9.299  55.244 51.824 1.00 17.65 ? 168  VAL A CB  1 
ATOM   1305 C  CG1 . VAL A 1  168 ? -9.700  53.781 51.562 1.00 16.96 ? 168  VAL A CG1 1 
ATOM   1306 C  CG2 . VAL A 1  168 ? -9.592  55.624 53.270 1.00 17.92 ? 168  VAL A CG2 1 
ATOM   1307 N  N   . GLY A 1  169 ? -6.712  57.281 52.649 1.00 15.75 ? 169  GLY A N   1 
ATOM   1308 C  CA  . GLY A 1  169 ? -6.016  58.574 52.770 1.00 14.78 ? 169  GLY A CA  1 
ATOM   1309 C  C   . GLY A 1  169 ? -4.990  58.853 51.678 1.00 14.27 ? 169  GLY A C   1 
ATOM   1310 O  O   . GLY A 1  169 ? -4.878  59.995 51.192 1.00 15.39 ? 169  GLY A O   1 
ATOM   1311 N  N   . LEU A 1  170 ? -4.247  57.827 51.281 1.00 13.08 ? 170  LEU A N   1 
ATOM   1312 C  CA  . LEU A 1  170 ? -3.312  57.935 50.163 1.00 12.79 ? 170  LEU A CA  1 
ATOM   1313 C  C   . LEU A 1  170 ? -4.063  58.100 48.854 1.00 12.56 ? 170  LEU A C   1 
ATOM   1314 O  O   . LEU A 1  170 ? -3.608  58.819 47.967 1.00 12.61 ? 170  LEU A O   1 
ATOM   1315 C  CB  . LEU A 1  170 ? -2.382  56.708 50.075 1.00 11.58 ? 170  LEU A CB  1 
ATOM   1316 C  CG  . LEU A 1  170 ? -1.309  56.562 51.166 1.00 14.21 ? 170  LEU A CG  1 
ATOM   1317 C  CD1 . LEU A 1  170 ? -0.544  55.192 51.141 1.00 7.45  ? 170  LEU A CD1 1 
ATOM   1318 C  CD2 . LEU A 1  170 ? -0.308  57.700 51.040 1.00 11.55 ? 170  LEU A CD2 1 
ATOM   1319 N  N   . LEU A 1  171 ? -5.183  57.395 48.718 1.00 13.20 ? 171  LEU A N   1 
ATOM   1320 C  CA  . LEU A 1  171 ? -6.021  57.511 47.523 1.00 15.19 ? 171  LEU A CA  1 
ATOM   1321 C  C   . LEU A 1  171 ? -6.644  58.909 47.429 1.00 16.27 ? 171  LEU A C   1 
ATOM   1322 O  O   . LEU A 1  171 ? -6.796  59.417 46.316 1.00 16.74 ? 171  LEU A O   1 
ATOM   1323 C  CB  . LEU A 1  171 ? -7.123  56.432 47.501 1.00 14.88 ? 171  LEU A CB  1 
ATOM   1324 C  CG  . LEU A 1  171 ? -6.671  54.974 47.367 1.00 16.32 ? 171  LEU A CG  1 
ATOM   1325 C  CD1 . LEU A 1  171 ? -7.899  54.084 47.339 1.00 17.46 ? 171  LEU A CD1 1 
ATOM   1326 C  CD2 . LEU A 1  171 ? -5.786  54.727 46.103 1.00 15.13 ? 171  LEU A CD2 1 
ATOM   1327 N  N   . ASP A 1  172 ? -6.993  59.525 48.586 1.00 16.87 ? 172  ASP A N   1 
ATOM   1328 C  CA  . ASP A 1  172 ? -7.416  60.928 48.611 1.00 16.89 ? 172  ASP A CA  1 
ATOM   1329 C  C   . ASP A 1  172 ? -6.302  61.788 48.019 1.00 16.84 ? 172  ASP A C   1 
ATOM   1330 O  O   . ASP A 1  172 ? -6.534  62.692 47.198 1.00 17.23 ? 172  ASP A O   1 
ATOM   1331 C  CB  . ASP A 1  172 ? -7.739  61.440 50.027 1.00 16.37 ? 172  ASP A CB  1 
ATOM   1332 C  CG  . ASP A 1  172 ? -8.837  60.669 50.718 1.00 18.17 ? 172  ASP A CG  1 
ATOM   1333 O  OD1 . ASP A 1  172 ? -9.592  59.925 50.048 1.00 16.20 ? 172  ASP A OD1 1 
ATOM   1334 O  OD2 . ASP A 1  172 ? -8.947  60.814 51.965 1.00 19.25 ? 172  ASP A OD2 1 
ATOM   1335 N  N   . GLN A 1  173 ? -5.085  61.531 48.451 1.00 16.50 ? 173  GLN A N   1 
ATOM   1336 C  CA  . GLN A 1  173 ? -3.988  62.347 47.972 1.00 16.50 ? 173  GLN A CA  1 
ATOM   1337 C  C   . GLN A 1  173 ? -3.878  62.162 46.446 1.00 16.81 ? 173  GLN A C   1 
ATOM   1338 O  O   . GLN A 1  173 ? -3.671  63.132 45.704 1.00 16.96 ? 173  GLN A O   1 
ATOM   1339 C  CB  . GLN A 1  173 ? -2.668  61.948 48.639 1.00 16.27 ? 173  GLN A CB  1 
ATOM   1340 C  CG  . GLN A 1  173 ? -2.562  62.231 50.113 1.00 13.37 ? 173  GLN A CG  1 
ATOM   1341 C  CD  . GLN A 1  173 ? -1.247  61.714 50.705 1.00 11.15 ? 173  GLN A CD  1 
ATOM   1342 O  OE1 . GLN A 1  173 ? -0.330  61.348 49.980 1.00 9.82  ? 173  GLN A OE1 1 
ATOM   1343 N  NE2 . GLN A 1  173 ? -1.160  61.686 52.025 1.00 9.38  ? 173  GLN A NE2 1 
ATOM   1344 N  N   . ARG A 1  174 ? -4.010  60.914 45.998 1.00 15.93 ? 174  ARG A N   1 
ATOM   1345 C  CA  . ARG A 1  174 ? -3.866  60.604 44.602 1.00 16.32 ? 174  ARG A CA  1 
ATOM   1346 C  C   . ARG A 1  174 ? -4.988  61.303 43.796 1.00 17.14 ? 174  ARG A C   1 
ATOM   1347 O  O   . ARG A 1  174 ? -4.695  61.904 42.758 1.00 17.62 ? 174  ARG A O   1 
ATOM   1348 C  CB  . ARG A 1  174 ? -3.835  59.092 44.380 1.00 15.89 ? 174  ARG A CB  1 
ATOM   1349 C  CG  . ARG A 1  174 ? -3.793  58.666 42.892 1.00 15.71 ? 174  ARG A CG  1 
ATOM   1350 C  CD  . ARG A 1  174 ? -4.055  57.181 42.761 1.00 15.64 ? 174  ARG A CD  1 
ATOM   1351 N  NE  . ARG A 1  174 ? -2.889  56.390 43.168 1.00 13.68 ? 174  ARG A NE  1 
ATOM   1352 C  CZ  . ARG A 1  174 ? -2.891  55.068 43.309 1.00 15.38 ? 174  ARG A CZ  1 
ATOM   1353 N  NH1 . ARG A 1  174 ? -3.988  54.344 43.062 1.00 14.45 ? 174  ARG A NH1 1 
ATOM   1354 N  NH2 . ARG A 1  174 ? -1.777  54.460 43.671 1.00 15.81 ? 174  ARG A NH2 1 
ATOM   1355 N  N   . MET A 1  175 ? -6.235  61.256 44.298 1.00 17.50 ? 175  MET A N   1 
ATOM   1356 C  CA  . MET A 1  175 ? -7.389  61.924 43.654 1.00 17.96 ? 175  MET A CA  1 
ATOM   1357 C  C   . MET A 1  175 ? -7.172  63.422 43.475 1.00 18.02 ? 175  MET A C   1 
ATOM   1358 O  O   . MET A 1  175 ? -7.532  63.988 42.446 1.00 18.08 ? 175  MET A O   1 
ATOM   1359 C  CB  . MET A 1  175 ? -8.708  61.647 44.397 1.00 17.96 ? 175  MET A CB  1 
ATOM   1360 C  CG  . MET A 1  175 ? -9.993  62.073 43.594 1.00 19.42 ? 175  MET A CG  1 
ATOM   1361 S  SD  . MET A 1  175 ? -11.523 61.284 44.143 1.00 22.70 ? 175  MET A SD  1 
ATOM   1362 C  CE  . MET A 1  175 ? -11.338 59.702 43.359 1.00 17.40 ? 175  MET A CE  1 
ATOM   1363 N  N   . ALA A 1  176 ? -6.564  64.051 44.477 1.00 18.71 ? 176  ALA A N   1 
ATOM   1364 C  CA  . ALA A 1  176 ? -6.193  65.464 44.404 1.00 18.84 ? 176  ALA A CA  1 
ATOM   1365 C  C   . ALA A 1  176 ? -5.115  65.678 43.366 1.00 18.54 ? 176  ALA A C   1 
ATOM   1366 O  O   . ALA A 1  176 ? -5.194  66.627 42.625 1.00 18.69 ? 176  ALA A O   1 
ATOM   1367 C  CB  . ALA A 1  176 ? -5.752  66.001 45.764 1.00 18.42 ? 176  ALA A CB  1 
ATOM   1368 N  N   . LEU A 1  177 ? -4.115  64.794 43.298 1.00 18.93 ? 177  LEU A N   1 
ATOM   1369 C  CA  . LEU A 1  177 ? -3.082  64.898 42.252 1.00 18.09 ? 177  LEU A CA  1 
ATOM   1370 C  C   . LEU A 1  177 ? -3.693  64.670 40.867 1.00 17.88 ? 177  LEU A C   1 
ATOM   1371 O  O   . LEU A 1  177 ? -3.253  65.271 39.885 1.00 17.40 ? 177  LEU A O   1 
ATOM   1372 C  CB  . LEU A 1  177 ? -1.946  63.894 42.468 1.00 17.81 ? 177  LEU A CB  1 
ATOM   1373 C  CG  . LEU A 1  177 ? -1.051  63.982 43.719 1.00 18.21 ? 177  LEU A CG  1 
ATOM   1374 C  CD1 . LEU A 1  177 ? 0.061   62.892 43.662 1.00 18.05 ? 177  LEU A CD1 1 
ATOM   1375 C  CD2 . LEU A 1  177 ? -0.430  65.376 43.927 1.00 16.95 ? 177  LEU A CD2 1 
ATOM   1376 N  N   . GLN A 1  178 ? -4.677  63.776 40.799 1.00 17.42 ? 178  GLN A N   1 
ATOM   1377 C  CA  . GLN A 1  178 ? -5.376  63.515 39.558 1.00 17.78 ? 178  GLN A CA  1 
ATOM   1378 C  C   . GLN A 1  178 ? -6.071  64.810 39.091 1.00 17.23 ? 178  GLN A C   1 
ATOM   1379 O  O   . GLN A 1  178 ? -6.013  65.151 37.922 1.00 17.65 ? 178  GLN A O   1 
ATOM   1380 C  CB  . GLN A 1  178 ? -6.404  62.363 39.723 1.00 17.81 ? 178  GLN A CB  1 
ATOM   1381 C  CG  . GLN A 1  178 ? -7.151  61.966 38.413 1.00 18.68 ? 178  GLN A CG  1 
ATOM   1382 C  CD  . GLN A 1  178 ? -6.205  61.383 37.365 1.00 20.89 ? 178  GLN A CD  1 
ATOM   1383 O  OE1 . GLN A 1  178 ? -5.661  60.301 37.551 1.00 21.76 ? 178  GLN A OE1 1 
ATOM   1384 N  NE2 . GLN A 1  178 ? -5.983  62.117 36.270 1.00 22.13 ? 178  GLN A NE2 1 
ATOM   1385 N  N   . TRP A 1  179 ? -6.701  65.513 40.021 1.00 16.72 ? 179  TRP A N   1 
ATOM   1386 C  CA  . TRP A 1  179 ? -7.512  66.700 39.726 1.00 16.65 ? 179  TRP A CA  1 
ATOM   1387 C  C   . TRP A 1  179 ? -6.627  67.863 39.313 1.00 16.58 ? 179  TRP A C   1 
ATOM   1388 O  O   . TRP A 1  179 ? -6.962  68.604 38.405 1.00 16.45 ? 179  TRP A O   1 
ATOM   1389 C  CB  . TRP A 1  179 ? -8.355  67.057 40.952 1.00 16.32 ? 179  TRP A CB  1 
ATOM   1390 C  CG  . TRP A 1  179 ? -9.386  68.064 40.710 1.00 16.62 ? 179  TRP A CG  1 
ATOM   1391 C  CD1 . TRP A 1  179 ? -10.734 67.847 40.519 1.00 16.00 ? 179  TRP A CD1 1 
ATOM   1392 C  CD2 . TRP A 1  179 ? -9.192  69.484 40.639 1.00 15.20 ? 179  TRP A CD2 1 
ATOM   1393 N  NE1 . TRP A 1  179 ? -11.370 69.048 40.314 1.00 15.41 ? 179  TRP A NE1 1 
ATOM   1394 C  CE2 . TRP A 1  179 ? -10.449 70.064 40.388 1.00 13.74 ? 179  TRP A CE2 1 
ATOM   1395 C  CE3 . TRP A 1  179 ? -8.076  70.316 40.762 1.00 14.80 ? 179  TRP A CE3 1 
ATOM   1396 C  CZ2 . TRP A 1  179 ? -10.614 71.428 40.245 1.00 12.58 ? 179  TRP A CZ2 1 
ATOM   1397 C  CZ3 . TRP A 1  179 ? -8.249  71.674 40.618 1.00 15.29 ? 179  TRP A CZ3 1 
ATOM   1398 C  CH2 . TRP A 1  179 ? -9.508  72.214 40.367 1.00 14.03 ? 179  TRP A CH2 1 
ATOM   1399 N  N   . VAL A 1  180 ? -5.475  67.997 39.965 1.00 16.79 ? 180  VAL A N   1 
ATOM   1400 C  CA  . VAL A 1  180 ? -4.425  68.909 39.518 1.00 16.51 ? 180  VAL A CA  1 
ATOM   1401 C  C   . VAL A 1  180 ? -3.983  68.580 38.084 1.00 17.19 ? 180  VAL A C   1 
ATOM   1402 O  O   . VAL A 1  180 ? -3.921  69.451 37.220 1.00 17.20 ? 180  VAL A O   1 
ATOM   1403 C  CB  . VAL A 1  180 ? -3.210  68.851 40.478 1.00 16.30 ? 180  VAL A CB  1 
ATOM   1404 C  CG1 . VAL A 1  180 ? -2.054  69.693 39.974 1.00 14.86 ? 180  VAL A CG1 1 
ATOM   1405 C  CG2 . VAL A 1  180 ? -3.624  69.339 41.845 1.00 15.50 ? 180  VAL A CG2 1 
ATOM   1406 N  N   . HIS A 1  181 ? -3.697  67.313 37.835 1.00 16.83 ? 181  HIS A N   1 
ATOM   1407 C  CA  . HIS A 1  181 ? -3.255  66.898 36.529 1.00 17.30 ? 181  HIS A CA  1 
ATOM   1408 C  C   . HIS A 1  181 ? -4.288  67.281 35.481 1.00 16.85 ? 181  HIS A C   1 
ATOM   1409 O  O   . HIS A 1  181 ? -3.938  67.727 34.416 1.00 15.72 ? 181  HIS A O   1 
ATOM   1410 C  CB  . HIS A 1  181 ? -3.045  65.389 36.524 1.00 17.52 ? 181  HIS A CB  1 
ATOM   1411 C  CG  . HIS A 1  181 ? -2.781  64.830 35.169 1.00 20.67 ? 181  HIS A CG  1 
ATOM   1412 N  ND1 . HIS A 1  181 ? -1.510  64.754 34.638 1.00 21.46 ? 181  HIS A ND1 1 
ATOM   1413 C  CD2 . HIS A 1  181 ? -3.626  64.332 34.226 1.00 19.72 ? 181  HIS A CD2 1 
ATOM   1414 C  CE1 . HIS A 1  181 ? -1.582  64.209 33.432 1.00 23.19 ? 181  HIS A CE1 1 
ATOM   1415 N  NE2 . HIS A 1  181 ? -2.851  63.950 33.160 1.00 22.87 ? 181  HIS A NE2 1 
ATOM   1416 N  N   . ASP A 1  182 ? -5.560  67.088 35.814 1.00 16.85 ? 182  ASP A N   1 
ATOM   1417 C  CA  . ASP A 1  182 ? -6.651  67.313 34.901 1.00 18.23 ? 182  ASP A CA  1 
ATOM   1418 C  C   . ASP A 1  182 ? -7.044  68.796 34.756 1.00 19.30 ? 182  ASP A C   1 
ATOM   1419 O  O   . ASP A 1  182 ? -7.531  69.198 33.689 1.00 20.66 ? 182  ASP A O   1 
ATOM   1420 C  CB  . ASP A 1  182 ? -7.885  66.522 35.323 1.00 16.89 ? 182  ASP A CB  1 
ATOM   1421 C  CG  . ASP A 1  182 ? -7.703  65.015 35.190 1.00 18.46 ? 182  ASP A CG  1 
ATOM   1422 O  OD1 . ASP A 1  182 ? -6.759  64.533 34.518 1.00 18.52 ? 182  ASP A OD1 1 
ATOM   1423 O  OD2 . ASP A 1  182 ? -8.549  64.291 35.742 1.00 20.48 ? 182  ASP A OD2 1 
ATOM   1424 N  N   . ASN A 1  183 ? -6.841  69.604 35.796 1.00 18.63 ? 183  ASN A N   1 
ATOM   1425 C  CA  . ASN A 1  183 ? -7.431  70.943 35.803 1.00 18.17 ? 183  ASN A CA  1 
ATOM   1426 C  C   . ASN A 1  183 ? -6.482  72.079 36.038 1.00 18.21 ? 183  ASN A C   1 
ATOM   1427 O  O   . ASN A 1  183 ? -6.835  73.232 35.828 1.00 18.35 ? 183  ASN A O   1 
ATOM   1428 C  CB  . ASN A 1  183 ? -8.516  71.023 36.858 1.00 18.31 ? 183  ASN A CB  1 
ATOM   1429 C  CG  . ASN A 1  183 ? -9.698  70.168 36.531 1.00 18.77 ? 183  ASN A CG  1 
ATOM   1430 O  OD1 . ASN A 1  183 ? -10.565 70.553 35.735 1.00 16.92 ? 183  ASN A OD1 1 
ATOM   1431 N  ND2 . ASN A 1  183 ? -9.776  69.003 37.183 1.00 18.17 ? 183  ASN A ND2 1 
ATOM   1432 N  N   . ILE A 1  184 ? -5.270  71.793 36.480 1.00 18.25 ? 184  ILE A N   1 
ATOM   1433 C  CA  . ILE A 1  184 ? -4.398  72.897 36.832 1.00 18.29 ? 184  ILE A CA  1 
ATOM   1434 C  C   . ILE A 1  184 ? -4.116  73.837 35.657 1.00 18.66 ? 184  ILE A C   1 
ATOM   1435 O  O   . ILE A 1  184 ? -3.833  75.030 35.884 1.00 19.49 ? 184  ILE A O   1 
ATOM   1436 C  CB  . ILE A 1  184 ? -3.089  72.430 37.542 1.00 18.06 ? 184  ILE A CB  1 
ATOM   1437 C  CG1 . ILE A 1  184 ? -2.546  73.523 38.472 1.00 17.59 ? 184  ILE A CG1 1 
ATOM   1438 C  CG2 . ILE A 1  184 ? -2.060  71.929 36.536 1.00 18.98 ? 184  ILE A CG2 1 
ATOM   1439 C  CD1 . ILE A 1  184 ? -3.470  73.774 39.710 1.00 15.79 ? 184  ILE A CD1 1 
ATOM   1440 N  N   . GLN A 1  185 ? -4.161  73.321 34.421 1.00 18.36 ? 185  GLN A N   1 
ATOM   1441 C  CA  . GLN A 1  185 ? -3.918  74.153 33.234 1.00 18.09 ? 185  GLN A CA  1 
ATOM   1442 C  C   . GLN A 1  185 ? -4.814  75.413 33.206 1.00 18.35 ? 185  GLN A C   1 
ATOM   1443 O  O   . GLN A 1  185 ? -4.382  76.473 32.730 1.00 18.66 ? 185  GLN A O   1 
ATOM   1444 C  CB  . GLN A 1  185 ? -4.083  73.328 31.934 1.00 18.13 ? 185  GLN A CB  1 
ATOM   1445 C  CG  . GLN A 1  185 ? -5.490  73.013 31.583 1.00 19.08 ? 185  GLN A CG  1 
ATOM   1446 C  CD  . GLN A 1  185 ? -5.648  71.815 30.676 1.00 22.69 ? 185  GLN A CD  1 
ATOM   1447 O  OE1 . GLN A 1  185 ? -5.493  70.688 31.120 1.00 27.12 ? 185  GLN A OE1 1 
ATOM   1448 N  NE2 . GLN A 1  185 ? -6.007  72.044 29.410 1.00 22.18 ? 185  GLN A NE2 1 
ATOM   1449 N  N   . PHE A 1  186 ? -6.038  75.308 33.734 1.00 17.65 ? 186  PHE A N   1 
ATOM   1450 C  CA  . PHE A 1  186 ? -6.991  76.442 33.718 1.00 18.23 ? 186  PHE A CA  1 
ATOM   1451 C  C   . PHE A 1  186 ? -6.619  77.536 34.708 1.00 19.65 ? 186  PHE A C   1 
ATOM   1452 O  O   . PHE A 1  186 ? -7.100  78.679 34.600 1.00 19.11 ? 186  PHE A O   1 
ATOM   1453 C  CB  . PHE A 1  186 ? -8.432  75.965 33.927 1.00 17.49 ? 186  PHE A CB  1 
ATOM   1454 C  CG  . PHE A 1  186 ? -8.816  74.850 32.984 1.00 17.46 ? 186  PHE A CG  1 
ATOM   1455 C  CD1 . PHE A 1  186 ? -8.851  75.078 31.598 1.00 14.44 ? 186  PHE A CD1 1 
ATOM   1456 C  CD2 . PHE A 1  186 ? -9.039  73.564 33.461 1.00 14.50 ? 186  PHE A CD2 1 
ATOM   1457 C  CE1 . PHE A 1  186 ? -9.160  74.048 30.701 1.00 13.81 ? 186  PHE A CE1 1 
ATOM   1458 C  CE2 . PHE A 1  186 ? -9.369  72.552 32.588 1.00 17.50 ? 186  PHE A CE2 1 
ATOM   1459 C  CZ  . PHE A 1  186 ? -9.411  72.798 31.177 1.00 13.95 ? 186  PHE A CZ  1 
ATOM   1460 N  N   . PHE A 1  187 ? -5.736  77.187 35.644 1.00 19.94 ? 187  PHE A N   1 
ATOM   1461 C  CA  . PHE A 1  187 ? -5.265  78.136 36.654 1.00 20.68 ? 187  PHE A CA  1 
ATOM   1462 C  C   . PHE A 1  187 ? -3.916  78.643 36.203 1.00 21.00 ? 187  PHE A C   1 
ATOM   1463 O  O   . PHE A 1  187 ? -3.287  79.448 36.880 1.00 22.17 ? 187  PHE A O   1 
ATOM   1464 C  CB  . PHE A 1  187 ? -5.177  77.490 38.054 1.00 19.96 ? 187  PHE A CB  1 
ATOM   1465 C  CG  . PHE A 1  187 ? -6.495  77.014 38.576 1.00 20.05 ? 187  PHE A CG  1 
ATOM   1466 C  CD1 . PHE A 1  187 ? -6.955  75.738 38.273 1.00 17.52 ? 187  PHE A CD1 1 
ATOM   1467 C  CD2 . PHE A 1  187 ? -7.300  77.858 39.356 1.00 19.90 ? 187  PHE A CD2 1 
ATOM   1468 C  CE1 . PHE A 1  187 ? -8.187  75.305 38.730 1.00 18.85 ? 187  PHE A CE1 1 
ATOM   1469 C  CE2 . PHE A 1  187 ? -8.543  77.430 39.836 1.00 19.48 ? 187  PHE A CE2 1 
ATOM   1470 C  CZ  . PHE A 1  187 ? -9.002  76.156 39.514 1.00 17.58 ? 187  PHE A CZ  1 
ATOM   1471 N  N   . GLY A 1  188 ? -3.479  78.191 35.034 1.00 21.23 ? 188  GLY A N   1 
ATOM   1472 C  CA  . GLY A 1  188 ? -2.216  78.677 34.481 1.00 21.48 ? 188  GLY A CA  1 
ATOM   1473 C  C   . GLY A 1  188 ? -1.013  77.844 34.900 1.00 21.88 ? 188  GLY A C   1 
ATOM   1474 O  O   . GLY A 1  188 ? 0.133   78.247 34.715 1.00 21.71 ? 188  GLY A O   1 
ATOM   1475 N  N   . GLY A 1  189 ? -1.276  76.667 35.465 1.00 22.26 ? 189  GLY A N   1 
ATOM   1476 C  CA  . GLY A 1  189 ? -0.203  75.748 35.799 1.00 22.42 ? 189  GLY A CA  1 
ATOM   1477 C  C   . GLY A 1  189 ? 0.039   74.734 34.704 1.00 22.49 ? 189  GLY A C   1 
ATOM   1478 O  O   . GLY A 1  189 ? -0.856  74.384 33.938 1.00 22.91 ? 189  GLY A O   1 
ATOM   1479 N  N   . ASP A 1  190 ? 1.265   74.251 34.639 1.00 22.02 ? 190  ASP A N   1 
ATOM   1480 C  CA  . ASP A 1  190 ? 1.631   73.273 33.667 1.00 21.68 ? 190  ASP A CA  1 
ATOM   1481 C  C   . ASP A 1  190 ? 1.481   71.865 34.300 1.00 21.58 ? 190  ASP A C   1 
ATOM   1482 O  O   . ASP A 1  190 ? 2.294   71.461 35.139 1.00 21.79 ? 190  ASP A O   1 
ATOM   1483 C  CB  . ASP A 1  190 ? 3.064   73.590 33.218 1.00 21.57 ? 190  ASP A CB  1 
ATOM   1484 C  CG  . ASP A 1  190 ? 3.669   72.508 32.341 1.00 21.91 ? 190  ASP A CG  1 
ATOM   1485 O  OD1 . ASP A 1  190 ? 2.942   71.593 31.900 1.00 21.68 ? 190  ASP A OD1 1 
ATOM   1486 O  OD2 . ASP A 1  190 ? 4.898   72.564 32.129 1.00 21.56 ? 190  ASP A OD2 1 
ATOM   1487 N  N   . PRO A 1  191 ? 0.464   71.092 33.877 1.00 21.17 ? 191  PRO A N   1 
ATOM   1488 C  CA  . PRO A 1  191 ? 0.306   69.798 34.526 1.00 21.07 ? 191  PRO A CA  1 
ATOM   1489 C  C   . PRO A 1  191 ? 1.437   68.833 34.218 1.00 20.62 ? 191  PRO A C   1 
ATOM   1490 O  O   . PRO A 1  191 ? 1.470   67.759 34.775 1.00 21.09 ? 191  PRO A O   1 
ATOM   1491 C  CB  . PRO A 1  191 ? -1.018  69.280 33.968 1.00 20.38 ? 191  PRO A CB  1 
ATOM   1492 C  CG  . PRO A 1  191 ? -1.081  69.898 32.592 1.00 21.61 ? 191  PRO A CG  1 
ATOM   1493 C  CD  . PRO A 1  191 ? -0.340  71.199 32.650 1.00 21.40 ? 191  PRO A CD  1 
ATOM   1494 N  N   . LYS A 1  192 ? 2.356   69.204 33.341 1.00 21.10 ? 192  LYS A N   1 
ATOM   1495 C  CA  . LYS A 1  192 ? 3.514   68.334 33.053 1.00 21.38 ? 192  LYS A CA  1 
ATOM   1496 C  C   . LYS A 1  192 ? 4.737   68.690 33.886 1.00 20.12 ? 192  LYS A C   1 
ATOM   1497 O  O   . LYS A 1  192 ? 5.823   68.093 33.734 1.00 19.18 ? 192  LYS A O   1 
ATOM   1498 C  CB  . LYS A 1  192 ? 3.852   68.361 31.547 1.00 21.22 ? 192  LYS A CB  1 
ATOM   1499 C  CG  . LYS A 1  192 ? 2.688   67.798 30.690 1.00 26.66 ? 192  LYS A CG  1 
ATOM   1500 C  CD  . LYS A 1  192 ? 2.306   66.281 31.025 1.00 26.99 ? 192  LYS A CD  1 
ATOM   1501 C  CE  . LYS A 1  192 ? 1.022   65.885 30.276 1.00 30.78 ? 192  LYS A CE  1 
ATOM   1502 N  NZ  . LYS A 1  192 ? -0.246  66.669 30.643 1.00 27.51 ? 192  LYS A NZ  1 
ATOM   1503 N  N   . THR A 1  193 ? 4.565   69.683 34.744 1.00 19.66 ? 193  THR A N   1 
ATOM   1504 C  CA  . THR A 1  193 ? 5.654   70.117 35.631 1.00 20.25 ? 193  THR A CA  1 
ATOM   1505 C  C   . THR A 1  193 ? 5.111   70.329 37.046 1.00 19.60 ? 193  THR A C   1 
ATOM   1506 O  O   . THR A 1  193 ? 5.224   71.400 37.630 1.00 19.74 ? 193  THR A O   1 
ATOM   1507 C  CB  . THR A 1  193 ? 6.350   71.359 35.069 1.00 20.21 ? 193  THR A CB  1 
ATOM   1508 O  OG1 . THR A 1  193 ? 6.569   71.145 33.673 1.00 20.75 ? 193  THR A OG1 1 
ATOM   1509 C  CG2 . THR A 1  193 ? 7.696   71.573 35.736 1.00 20.49 ? 193  THR A CG2 1 
ATOM   1510 N  N   . VAL A 1  194 ? 4.483   69.289 37.573 1.00 19.08 ? 194  VAL A N   1 
ATOM   1511 C  CA  . VAL A 1  194 ? 4.005   69.308 38.945 1.00 18.24 ? 194  VAL A CA  1 
ATOM   1512 C  C   . VAL A 1  194 ? 5.048   68.670 39.881 1.00 18.04 ? 194  VAL A C   1 
ATOM   1513 O  O   . VAL A 1  194 ? 5.442   67.544 39.677 1.00 18.04 ? 194  VAL A O   1 
ATOM   1514 C  CB  . VAL A 1  194 ? 2.704   68.543 39.051 1.00 18.65 ? 194  VAL A CB  1 
ATOM   1515 C  CG1 . VAL A 1  194 ? 2.254   68.425 40.538 1.00 18.77 ? 194  VAL A CG1 1 
ATOM   1516 C  CG2 . VAL A 1  194 ? 1.578   69.188 38.140 1.00 18.95 ? 194  VAL A CG2 1 
ATOM   1517 N  N   . THR A 1  195 ? 5.494   69.409 40.891 1.00 17.56 ? 195  THR A N   1 
ATOM   1518 C  CA  . THR A 1  195 ? 6.257   68.837 41.992 1.00 16.16 ? 195  THR A CA  1 
ATOM   1519 C  C   . THR A 1  195 ? 5.378   68.565 43.221 1.00 16.12 ? 195  THR A C   1 
ATOM   1520 O  O   . THR A 1  195 ? 4.691   69.477 43.727 1.00 15.76 ? 195  THR A O   1 
ATOM   1521 C  CB  . THR A 1  195 ? 7.429   69.729 42.364 1.00 15.75 ? 195  THR A CB  1 
ATOM   1522 O  OG1 . THR A 1  195 ? 8.367   69.682 41.294 1.00 16.64 ? 195  THR A OG1 1 
ATOM   1523 C  CG2 . THR A 1  195 ? 8.142   69.247 43.660 1.00 13.82 ? 195  THR A CG2 1 
ATOM   1524 N  N   . ILE A 1  196 ? 5.367   67.306 43.668 1.00 15.08 ? 196  ILE A N   1 
ATOM   1525 C  CA  . ILE A 1  196 ? 4.785   66.982 44.975 1.00 14.26 ? 196  ILE A CA  1 
ATOM   1526 C  C   . ILE A 1  196 ? 5.851   67.147 46.064 1.00 14.58 ? 196  ILE A C   1 
ATOM   1527 O  O   . ILE A 1  196 ? 6.995   66.735 45.901 1.00 13.59 ? 196  ILE A O   1 
ATOM   1528 C  CB  . ILE A 1  196 ? 4.098   65.612 45.012 1.00 14.28 ? 196  ILE A CB  1 
ATOM   1529 C  CG1 . ILE A 1  196 ? 5.089   64.457 44.824 1.00 13.59 ? 196  ILE A CG1 1 
ATOM   1530 C  CG2 . ILE A 1  196 ? 3.050   65.551 43.952 1.00 12.67 ? 196  ILE A CG2 1 
ATOM   1531 C  CD1 . ILE A 1  196 ? 4.454   63.114 45.044 1.00 11.92 ? 196  ILE A CD1 1 
ATOM   1532 N  N   . PHE A 1  197 ? 5.495   67.847 47.137 1.00 15.40 ? 197  PHE A N   1 
ATOM   1533 C  CA  . PHE A 1  197 ? 6.412   68.035 48.266 1.00 15.45 ? 197  PHE A CA  1 
ATOM   1534 C  C   . PHE A 1  197 ? 5.643   67.963 49.577 1.00 15.15 ? 197  PHE A C   1 
ATOM   1535 O  O   . PHE A 1  197 ? 4.442   68.257 49.623 1.00 15.33 ? 197  PHE A O   1 
ATOM   1536 C  CB  . PHE A 1  197 ? 7.305   69.298 48.116 1.00 16.03 ? 197  PHE A CB  1 
ATOM   1537 C  CG  . PHE A 1  197 ? 6.619   70.626 48.385 1.00 15.91 ? 197  PHE A CG  1 
ATOM   1538 C  CD1 . PHE A 1  197 ? 5.447   70.970 47.754 1.00 15.22 ? 197  PHE A CD1 1 
ATOM   1539 C  CD2 . PHE A 1  197 ? 7.236   71.579 49.199 1.00 15.56 ? 197  PHE A CD2 1 
ATOM   1540 C  CE1 . PHE A 1  197 ? 4.868   72.194 47.970 1.00 14.93 ? 197  PHE A CE1 1 
ATOM   1541 C  CE2 . PHE A 1  197 ? 6.656   72.819 49.419 1.00 13.82 ? 197  PHE A CE2 1 
ATOM   1542 C  CZ  . PHE A 1  197 ? 5.458   73.114 48.817 1.00 15.84 ? 197  PHE A CZ  1 
ATOM   1543 N  N   . GLY A 1  198 ? 6.315   67.514 50.626 1.00 15.09 ? 198  GLY A N   1 
ATOM   1544 C  CA  . GLY A 1  198 ? 5.645   67.248 51.890 1.00 14.51 ? 198  GLY A CA  1 
ATOM   1545 C  C   . GLY A 1  198 ? 6.621   67.009 53.010 1.00 14.65 ? 198  GLY A C   1 
ATOM   1546 O  O   . GLY A 1  198 ? 7.792   66.682 52.773 1.00 14.86 ? 198  GLY A O   1 
ATOM   1547 N  N   . GLU A 1  199 ? 6.161   67.209 54.244 1.00 14.29 ? 199  GLU A N   1 
ATOM   1548 C  CA  . GLU A 1  199 ? 7.042   67.021 55.393 1.00 13.49 ? 199  GLU A CA  1 
ATOM   1549 C  C   . GLU A 1  199 ? 6.542   65.868 56.261 1.00 12.81 ? 199  GLU A C   1 
ATOM   1550 O  O   . GLU A 1  199 ? 5.345   65.734 56.481 1.00 13.13 ? 199  GLU A O   1 
ATOM   1551 C  CB  . GLU A 1  199 ? 7.198   68.343 56.169 1.00 13.58 ? 199  GLU A CB  1 
ATOM   1552 C  CG  . GLU A 1  199 ? 8.200   68.309 57.312 1.00 10.64 ? 199  GLU A CG  1 
ATOM   1553 C  CD  . GLU A 1  199 ? 7.573   67.902 58.660 1.00 12.98 ? 199  GLU A CD  1 
ATOM   1554 O  OE1 . GLU A 1  199 ? 6.323   67.783 58.761 1.00 13.53 ? 199  GLU A OE1 1 
ATOM   1555 O  OE2 . GLU A 1  199 ? 8.337   67.702 59.637 1.00 13.57 ? 199  GLU A OE2 1 
ATOM   1556 N  N   . SER A 1  200 ? 7.457   65.012 56.700 1.00 12.79 ? 200  SER A N   1 
ATOM   1557 C  CA  . SER A 1  200 ? 7.158   63.968 57.697 1.00 13.03 ? 200  SER A CA  1 
ATOM   1558 C  C   . SER A 1  200 ? 6.183   62.928 57.060 1.00 12.40 ? 200  SER A C   1 
ATOM   1559 O  O   . SER A 1  200 ? 6.482   62.407 55.995 1.00 12.60 ? 200  SER A O   1 
ATOM   1560 C  CB  . SER A 1  200 ? 6.664   64.619 59.013 1.00 13.18 ? 200  SER A CB  1 
ATOM   1561 O  OG  . SER A 1  200 ? 6.665   63.733 60.129 1.00 16.38 ? 200  SER A OG  1 
ATOM   1562 N  N   . ALA A 1  201 ? 5.033   62.638 57.656 1.00 11.64 ? 201  ALA A N   1 
ATOM   1563 C  CA  . ALA A 1  201 ? 4.039   61.803 56.966 1.00 11.62 ? 201  ALA A CA  1 
ATOM   1564 C  C   . ALA A 1  201 ? 3.782   62.242 55.505 1.00 12.53 ? 201  ALA A C   1 
ATOM   1565 O  O   . ALA A 1  201 ? 3.451   61.408 54.656 1.00 12.78 ? 201  ALA A O   1 
ATOM   1566 C  CB  . ALA A 1  201 ? 2.746   61.773 57.727 1.00 10.29 ? 201  ALA A CB  1 
ATOM   1567 N  N   . GLY A 1  202 ? 3.899   63.550 55.239 1.00 12.58 ? 202  GLY A N   1 
ATOM   1568 C  CA  . GLY A 1  202 ? 3.738   64.107 53.913 1.00 12.62 ? 202  GLY A CA  1 
ATOM   1569 C  C   . GLY A 1  202 ? 4.933   63.755 53.063 1.00 13.72 ? 202  GLY A C   1 
ATOM   1570 O  O   . GLY A 1  202 ? 4.770   63.519 51.871 1.00 14.12 ? 202  GLY A O   1 
ATOM   1571 N  N   . GLY A 1  203 ? 6.136   63.706 53.664 1.00 13.41 ? 203  GLY A N   1 
ATOM   1572 C  CA  . GLY A 1  203 ? 7.340   63.216 52.956 1.00 13.48 ? 203  GLY A CA  1 
ATOM   1573 C  C   . GLY A 1  203 ? 7.300   61.714 52.678 1.00 13.74 ? 203  GLY A C   1 
ATOM   1574 O  O   . GLY A 1  203 ? 7.658   61.244 51.570 1.00 14.30 ? 203  GLY A O   1 
ATOM   1575 N  N   . ALA A 1  204 ? 6.859   60.945 53.669 1.00 13.45 ? 204  ALA A N   1 
ATOM   1576 C  CA  . ALA A 1  204 ? 6.623   59.518 53.467 1.00 13.57 ? 204  ALA A CA  1 
ATOM   1577 C  C   . ALA A 1  204 ? 5.620   59.331 52.332 1.00 12.96 ? 204  ALA A C   1 
ATOM   1578 O  O   . ALA A 1  204 ? 5.830   58.515 51.450 1.00 11.64 ? 204  ALA A O   1 
ATOM   1579 C  CB  . ALA A 1  204 ? 6.120   58.843 54.742 1.00 13.01 ? 204  ALA A CB  1 
ATOM   1580 N  N   . SER A 1  205 ? 4.551   60.119 52.376 1.00 13.40 ? 205  SER A N   1 
ATOM   1581 C  CA  . SER A 1  205 ? 3.522   60.117 51.358 1.00 14.55 ? 205  SER A CA  1 
ATOM   1582 C  C   . SER A 1  205 ? 4.094   60.348 49.953 1.00 15.00 ? 205  SER A C   1 
ATOM   1583 O  O   . SER A 1  205 ? 3.810   59.572 49.036 1.00 15.31 ? 205  SER A O   1 
ATOM   1584 C  CB  . SER A 1  205 ? 2.456   61.182 51.672 1.00 15.24 ? 205  SER A CB  1 
ATOM   1585 O  OG  . SER A 1  205 ? 1.578   60.743 52.693 1.00 15.17 ? 205  SER A OG  1 
ATOM   1586 N  N   . VAL A 1  206 ? 4.914   61.400 49.810 1.00 15.48 ? 206  VAL A N   1 
ATOM   1587 C  CA  . VAL A 1  206 ? 5.572   61.716 48.561 1.00 15.31 ? 206  VAL A CA  1 
ATOM   1588 C  C   . VAL A 1  206 ? 6.310   60.494 48.025 1.00 16.06 ? 206  VAL A C   1 
ATOM   1589 O  O   . VAL A 1  206 ? 6.167   60.148 46.855 1.00 17.10 ? 206  VAL A O   1 
ATOM   1590 C  CB  . VAL A 1  206 ? 6.491   62.963 48.699 1.00 16.20 ? 206  VAL A CB  1 
ATOM   1591 C  CG1 . VAL A 1  206 ? 7.527   63.046 47.575 1.00 12.23 ? 206  VAL A CG1 1 
ATOM   1592 C  CG2 . VAL A 1  206 ? 5.635   64.244 48.780 1.00 14.15 ? 206  VAL A CG2 1 
ATOM   1593 N  N   . GLY A 1  207 ? 7.044   59.801 48.884 1.00 15.71 ? 207  GLY A N   1 
ATOM   1594 C  CA  . GLY A 1  207 ? 7.823   58.638 48.455 1.00 14.65 ? 207  GLY A CA  1 
ATOM   1595 C  C   . GLY A 1  207 ? 6.915   57.448 48.177 1.00 14.89 ? 207  GLY A C   1 
ATOM   1596 O  O   . GLY A 1  207 ? 7.240   56.554 47.369 1.00 14.51 ? 207  GLY A O   1 
ATOM   1597 N  N   . MET A 1  208 ? 5.766   57.426 48.845 1.00 13.88 ? 208  MET A N   1 
ATOM   1598 C  CA  . MET A 1  208 ? 4.802   56.392 48.550 1.00 13.36 ? 208  MET A CA  1 
ATOM   1599 C  C   . MET A 1  208 ? 4.207   56.548 47.139 1.00 13.56 ? 208  MET A C   1 
ATOM   1600 O  O   . MET A 1  208 ? 3.987   55.556 46.467 1.00 14.16 ? 208  MET A O   1 
ATOM   1601 C  CB  . MET A 1  208 ? 3.737   56.283 49.639 1.00 12.69 ? 208  MET A CB  1 
ATOM   1602 C  CG  . MET A 1  208 ? 4.332   55.772 50.984 1.00 12.75 ? 208  MET A CG  1 
ATOM   1603 S  SD  . MET A 1  208 ? 3.164   55.896 52.334 1.00 15.29 ? 208  MET A SD  1 
ATOM   1604 C  CE  . MET A 1  208 ? 3.948   54.772 53.478 1.00 15.52 ? 208  MET A CE  1 
ATOM   1605 N  N   . HIS A 1  209 ? 4.001   57.781 46.689 1.00 13.98 ? 209  HIS A N   1 
ATOM   1606 C  CA  . HIS A 1  209 ? 3.499   58.030 45.328 1.00 14.13 ? 209  HIS A CA  1 
ATOM   1607 C  C   . HIS A 1  209 ? 4.552   57.729 44.274 1.00 14.27 ? 209  HIS A C   1 
ATOM   1608 O  O   . HIS A 1  209 ? 4.226   57.268 43.160 1.00 14.56 ? 209  HIS A O   1 
ATOM   1609 C  CB  . HIS A 1  209 ? 2.973   59.471 45.202 1.00 13.80 ? 209  HIS A CB  1 
ATOM   1610 C  CG  . HIS A 1  209 ? 1.758   59.734 46.041 1.00 13.01 ? 209  HIS A CG  1 
ATOM   1611 N  ND1 . HIS A 1  209 ? 0.596   58.989 45.931 1.00 13.32 ? 209  HIS A ND1 1 
ATOM   1612 C  CD2 . HIS A 1  209 ? 1.521   60.665 47.006 1.00 13.40 ? 209  HIS A CD2 1 
ATOM   1613 C  CE1 . HIS A 1  209 ? -0.301  59.447 46.795 1.00 14.23 ? 209  HIS A CE1 1 
ATOM   1614 N  NE2 . HIS A 1  209 ? 0.244   60.454 47.473 1.00 14.09 ? 209  HIS A NE2 1 
ATOM   1615 N  N   . ILE A 1  210 ? 5.816   57.967 44.632 1.00 14.31 ? 210  ILE A N   1 
ATOM   1616 C  CA  . ILE A 1  210 ? 6.963   57.560 43.815 1.00 14.18 ? 210  ILE A CA  1 
ATOM   1617 C  C   . ILE A 1  210 ? 6.982   56.037 43.638 1.00 15.23 ? 210  ILE A C   1 
ATOM   1618 O  O   . ILE A 1  210 ? 7.278   55.562 42.546 1.00 16.55 ? 210  ILE A O   1 
ATOM   1619 C  CB  . ILE A 1  210 ? 8.269   58.038 44.417 1.00 13.67 ? 210  ILE A CB  1 
ATOM   1620 C  CG1 . ILE A 1  210 ? 8.371   59.560 44.306 1.00 13.21 ? 210  ILE A CG1 1 
ATOM   1621 C  CG2 . ILE A 1  210 ? 9.466   57.334 43.759 1.00 13.59 ? 210  ILE A CG2 1 
ATOM   1622 C  CD1 . ILE A 1  210 ? 9.579   60.140 44.986 1.00 12.79 ? 210  ILE A CD1 1 
ATOM   1623 N  N   . LEU A 1  211 ? 6.613   55.287 44.678 1.00 14.81 ? 211  LEU A N   1 
ATOM   1624 C  CA  . LEU A 1  211 ? 6.581   53.819 44.618 1.00 15.62 ? 211  LEU A CA  1 
ATOM   1625 C  C   . LEU A 1  211 ? 5.322   53.228 43.949 1.00 15.73 ? 211  LEU A C   1 
ATOM   1626 O  O   . LEU A 1  211 ? 5.409   52.329 43.117 1.00 16.10 ? 211  LEU A O   1 
ATOM   1627 C  CB  . LEU A 1  211 ? 6.715   53.214 46.026 1.00 14.95 ? 211  LEU A CB  1 
ATOM   1628 C  CG  . LEU A 1  211 ? 8.077   53.277 46.716 1.00 17.43 ? 211  LEU A CG  1 
ATOM   1629 C  CD1 . LEU A 1  211 ? 7.841   53.212 48.225 1.00 18.17 ? 211  LEU A CD1 1 
ATOM   1630 C  CD2 . LEU A 1  211 ? 8.952   52.110 46.278 1.00 17.87 ? 211  LEU A CD2 1 
ATOM   1631 N  N   . SER A 1  212 ? 4.150   53.711 44.324 1.00 16.36 ? 212  SER A N   1 
ATOM   1632 C  CA  . SER A 1  212 ? 2.901   53.106 43.841 1.00 16.85 ? 212  SER A CA  1 
ATOM   1633 C  C   . SER A 1  212 ? 2.723   53.356 42.343 1.00 17.35 ? 212  SER A C   1 
ATOM   1634 O  O   . SER A 1  212 ? 2.627   54.527 41.926 1.00 17.73 ? 212  SER A O   1 
ATOM   1635 C  CB  . SER A 1  212 ? 1.721   53.703 44.577 1.00 16.53 ? 212  SER A CB  1 
ATOM   1636 O  OG  . SER A 1  212 ? 0.529   53.038 44.236 1.00 15.70 ? 212  SER A OG  1 
ATOM   1637 N  N   . PRO A 1  213 ? 2.691   52.283 41.535 1.00 18.23 ? 213  PRO A N   1 
ATOM   1638 C  CA  . PRO A 1  213 ? 2.373   52.368 40.072 1.00 18.51 ? 213  PRO A CA  1 
ATOM   1639 C  C   . PRO A 1  213 ? 1.150   53.231 39.770 1.00 17.96 ? 213  PRO A C   1 
ATOM   1640 O  O   . PRO A 1  213 ? 1.171   53.997 38.821 1.00 18.97 ? 213  PRO A O   1 
ATOM   1641 C  CB  . PRO A 1  213 ? 2.105   50.910 39.684 1.00 18.15 ? 213  PRO A CB  1 
ATOM   1642 C  CG  . PRO A 1  213 ? 2.981   50.106 40.671 1.00 19.71 ? 213  PRO A CG  1 
ATOM   1643 C  CD  . PRO A 1  213 ? 2.989   50.892 41.960 1.00 18.93 ? 213  PRO A CD  1 
ATOM   1644 N  N   . GLY A 1  214 ? 0.126   53.173 40.619 1.00 17.87 ? 214  GLY A N   1 
ATOM   1645 C  CA  . GLY A 1  214 ? -1.089  53.959 40.400 1.00 17.11 ? 214  GLY A CA  1 
ATOM   1646 C  C   . GLY A 1  214 ? -0.958  55.476 40.552 1.00 16.99 ? 214  GLY A C   1 
ATOM   1647 O  O   . GLY A 1  214 ? -1.888  56.196 40.194 1.00 16.74 ? 214  GLY A O   1 
ATOM   1648 N  N   . SER A 1  215 ? 0.175   55.955 41.082 1.00 15.81 ? 215  SER A N   1 
ATOM   1649 C  CA  . SER A 1  215 ? 0.400   57.392 41.308 1.00 15.88 ? 215  SER A CA  1 
ATOM   1650 C  C   . SER A 1  215 ? 1.502   58.012 40.461 1.00 15.49 ? 215  SER A C   1 
ATOM   1651 O  O   . SER A 1  215 ? 1.529   59.228 40.317 1.00 15.25 ? 215  SER A O   1 
ATOM   1652 C  CB  . SER A 1  215 ? 0.812   57.658 42.780 1.00 15.45 ? 215  SER A CB  1 
ATOM   1653 O  OG  . SER A 1  215 ? -0.232  57.429 43.697 1.00 16.63 ? 215  SER A OG  1 
ATOM   1654 N  N   . ARG A 1  216 ? 2.443   57.193 39.982 1.00 15.95 ? 216  ARG A N   1 
ATOM   1655 C  CA  . ARG A 1  216 ? 3.677   57.667 39.322 1.00 17.33 ? 216  ARG A CA  1 
ATOM   1656 C  C   . ARG A 1  216 ? 3.473   58.688 38.205 1.00 17.62 ? 216  ARG A C   1 
ATOM   1657 O  O   . ARG A 1  216 ? 4.299   59.593 38.009 1.00 18.48 ? 216  ARG A O   1 
ATOM   1658 C  CB  . ARG A 1  216 ? 4.448   56.476 38.716 1.00 17.96 ? 216  ARG A CB  1 
ATOM   1659 C  CG  . ARG A 1  216 ? 4.980   55.471 39.715 1.00 18.66 ? 216  ARG A CG  1 
ATOM   1660 C  CD  . ARG A 1  216 ? 5.766   54.354 39.063 1.00 19.06 ? 216  ARG A CD  1 
ATOM   1661 N  NE  . ARG A 1  216 ? 5.960   53.263 40.008 1.00 19.44 ? 216  ARG A NE  1 
ATOM   1662 C  CZ  . ARG A 1  216 ? 6.501   52.082 39.722 1.00 21.09 ? 216  ARG A CZ  1 
ATOM   1663 N  NH1 . ARG A 1  216 ? 6.930   51.808 38.483 1.00 21.06 ? 216  ARG A NH1 1 
ATOM   1664 N  NH2 . ARG A 1  216 ? 6.625   51.169 40.690 1.00 17.30 ? 216  ARG A NH2 1 
ATOM   1665 N  N   . ASP A 1  217 ? 2.401   58.523 37.441 1.00 17.66 ? 217  ASP A N   1 
ATOM   1666 C  CA  . ASP A 1  217 ? 2.234   59.303 36.190 1.00 18.03 ? 217  ASP A CA  1 
ATOM   1667 C  C   . ASP A 1  217 ? 1.625   60.640 36.498 1.00 17.61 ? 217  ASP A C   1 
ATOM   1668 O  O   . ASP A 1  217 ? 1.553   61.460 35.625 1.00 17.64 ? 217  ASP A O   1 
ATOM   1669 C  CB  . ASP A 1  217 ? 1.290   58.594 35.198 1.00 17.82 ? 217  ASP A CB  1 
ATOM   1670 C  CG  . ASP A 1  217 ? 1.760   57.186 34.827 1.00 17.54 ? 217  ASP A CG  1 
ATOM   1671 O  OD1 . ASP A 1  217 ? 2.871   56.772 35.190 1.00 19.89 ? 217  ASP A OD1 1 
ATOM   1672 O  OD2 . ASP A 1  217 ? 1.010   56.489 34.138 1.00 20.19 ? 217  ASP A OD2 1 
ATOM   1673 N  N   . LEU A 1  218 ? 1.157   60.844 37.733 1.00 17.21 ? 218  LEU A N   1 
ATOM   1674 C  CA  . LEU A 1  218 ? 0.462   62.089 38.089 1.00 16.83 ? 218  LEU A CA  1 
ATOM   1675 C  C   . LEU A 1  218 ? 1.360   63.283 38.522 1.00 16.17 ? 218  LEU A C   1 
ATOM   1676 O  O   . LEU A 1  218 ? 0.843   64.335 38.866 1.00 17.09 ? 218  LEU A O   1 
ATOM   1677 C  CB  . LEU A 1  218 ? -0.668  61.828 39.104 1.00 16.56 ? 218  LEU A CB  1 
ATOM   1678 C  CG  . LEU A 1  218 ? -1.730  60.762 38.762 1.00 17.52 ? 218  LEU A CG  1 
ATOM   1679 C  CD1 . LEU A 1  218 ? -2.679  60.549 39.923 1.00 17.10 ? 218  LEU A CD1 1 
ATOM   1680 C  CD2 . LEU A 1  218 ? -2.464  61.145 37.520 1.00 16.48 ? 218  LEU A CD2 1 
ATOM   1681 N  N   . PHE A 1  219 ? 2.683   63.139 38.487 1.00 14.81 ? 219  PHE A N   1 
ATOM   1682 C  CA  . PHE A 1  219 ? 3.557   64.243 38.885 1.00 13.00 ? 219  PHE A CA  1 
ATOM   1683 C  C   . PHE A 1  219 ? 4.896   64.089 38.207 1.00 13.60 ? 219  PHE A C   1 
ATOM   1684 O  O   . PHE A 1  219 ? 5.205   63.005 37.699 1.00 13.46 ? 219  PHE A O   1 
ATOM   1685 C  CB  . PHE A 1  219 ? 3.704   64.290 40.432 1.00 13.48 ? 219  PHE A CB  1 
ATOM   1686 C  CG  . PHE A 1  219 ? 4.321   63.042 41.025 1.00 11.69 ? 219  PHE A CG  1 
ATOM   1687 C  CD1 . PHE A 1  219 ? 3.544   61.921 41.292 1.00 12.23 ? 219  PHE A CD1 1 
ATOM   1688 C  CD2 . PHE A 1  219 ? 5.682   62.993 41.313 1.00 11.95 ? 219  PHE A CD2 1 
ATOM   1689 C  CE1 . PHE A 1  219 ? 4.133   60.743 41.828 1.00 14.52 ? 219  PHE A CE1 1 
ATOM   1690 C  CE2 . PHE A 1  219 ? 6.267   61.839 41.866 1.00 11.80 ? 219  PHE A CE2 1 
ATOM   1691 C  CZ  . PHE A 1  219 ? 5.501   60.710 42.094 1.00 11.56 ? 219  PHE A CZ  1 
ATOM   1692 N  N   . ARG A 1  220 ? 5.722   65.141 38.221 1.00 13.65 ? 220  ARG A N   1 
ATOM   1693 C  CA  . ARG A 1  220 ? 6.993   65.111 37.506 1.00 15.01 ? 220  ARG A CA  1 
ATOM   1694 C  C   . ARG A 1  220 ? 8.183   64.813 38.412 1.00 15.77 ? 220  ARG A C   1 
ATOM   1695 O  O   . ARG A 1  220 ? 9.085   64.056 38.065 1.00 15.13 ? 220  ARG A O   1 
ATOM   1696 C  CB  . ARG A 1  220 ? 7.224   66.475 36.835 1.00 14.68 ? 220  ARG A CB  1 
ATOM   1697 C  CG  . ARG A 1  220 ? 8.585   66.679 36.172 1.00 17.80 ? 220  ARG A CG  1 
ATOM   1698 C  CD  . ARG A 1  220 ? 8.571   66.064 34.798 1.00 22.99 ? 220  ARG A CD  1 
ATOM   1699 N  NE  . ARG A 1  220 ? 9.667   66.477 33.928 1.00 25.85 ? 220  ARG A NE  1 
ATOM   1700 C  CZ  . ARG A 1  220 ? 9.544   67.339 32.913 1.00 28.02 ? 220  ARG A CZ  1 
ATOM   1701 N  NH1 . ARG A 1  220 ? 8.371   67.928 32.640 1.00 29.29 ? 220  ARG A NH1 1 
ATOM   1702 N  NH2 . ARG A 1  220 ? 10.599  67.610 32.161 1.00 27.15 ? 220  ARG A NH2 1 
ATOM   1703 N  N   . ARG A 1  221 ? 8.226   65.511 39.543 1.00 16.03 ? 221  ARG A N   1 
ATOM   1704 C  CA  . ARG A 1  221 ? 9.313   65.329 40.462 1.00 15.84 ? 221  ARG A CA  1 
ATOM   1705 C  C   . ARG A 1  221 ? 8.827   65.541 41.873 1.00 15.20 ? 221  ARG A C   1 
ATOM   1706 O  O   . ARG A 1  221 ? 7.657   65.886 42.096 1.00 14.61 ? 221  ARG A O   1 
ATOM   1707 C  CB  . ARG A 1  221 ? 10.512  66.210 40.100 1.00 16.54 ? 221  ARG A CB  1 
ATOM   1708 C  CG  . ARG A 1  221 ? 10.184  67.602 39.652 1.00 18.98 ? 221  ARG A CG  1 
ATOM   1709 C  CD  . ARG A 1  221 ? 11.456  68.338 39.237 1.00 19.62 ? 221  ARG A CD  1 
ATOM   1710 N  NE  . ARG A 1  221 ? 12.004  67.925 37.953 1.00 20.06 ? 221  ARG A NE  1 
ATOM   1711 C  CZ  . ARG A 1  221 ? 11.813  68.578 36.798 1.00 20.84 ? 221  ARG A CZ  1 
ATOM   1712 N  NH1 . ARG A 1  221 ? 11.069  69.672 36.747 1.00 20.53 ? 221  ARG A NH1 1 
ATOM   1713 N  NH2 . ARG A 1  221 ? 12.367  68.135 35.682 1.00 17.76 ? 221  ARG A NH2 1 
ATOM   1714 N  N   . ALA A 1  222 ? 9.732   65.322 42.821 1.00 15.19 ? 222  ALA A N   1 
ATOM   1715 C  CA  . ALA A 1  222 ? 9.355   65.147 44.220 1.00 15.62 ? 222  ALA A CA  1 
ATOM   1716 C  C   . ALA A 1  222 ? 10.369  65.722 45.206 1.00 15.73 ? 222  ALA A C   1 
ATOM   1717 O  O   . ALA A 1  222 ? 11.585  65.631 44.987 1.00 16.16 ? 222  ALA A O   1 
ATOM   1718 C  CB  . ALA A 1  222 ? 9.109   63.661 44.516 1.00 14.58 ? 222  ALA A CB  1 
ATOM   1719 N  N   . ILE A 1  223 ? 9.842   66.293 46.281 1.00 14.64 ? 223  ILE A N   1 
ATOM   1720 C  CA  . ILE A 1  223 ? 10.625  66.793 47.394 1.00 15.23 ? 223  ILE A CA  1 
ATOM   1721 C  C   . ILE A 1  223 ? 10.120  66.145 48.701 1.00 14.78 ? 223  ILE A C   1 
ATOM   1722 O  O   . ILE A 1  223 ? 8.912   66.198 49.008 1.00 15.18 ? 223  ILE A O   1 
ATOM   1723 C  CB  . ILE A 1  223 ? 10.496  68.329 47.510 1.00 15.75 ? 223  ILE A CB  1 
ATOM   1724 C  CG1 . ILE A 1  223 ? 11.054  69.031 46.252 1.00 15.73 ? 223  ILE A CG1 1 
ATOM   1725 C  CG2 . ILE A 1  223 ? 11.152  68.850 48.821 1.00 15.94 ? 223  ILE A CG2 1 
ATOM   1726 C  CD1 . ILE A 1  223 ? 10.852  70.582 46.269 1.00 12.74 ? 223  ILE A CD1 1 
ATOM   1727 N  N   . LEU A 1  224 ? 11.042  65.585 49.480 1.00 13.17 ? 224  LEU A N   1 
ATOM   1728 C  CA  . LEU A 1  224 ? 10.706  64.925 50.740 1.00 12.81 ? 224  LEU A CA  1 
ATOM   1729 C  C   . LEU A 1  224 ? 11.398  65.606 51.938 1.00 12.79 ? 224  LEU A C   1 
ATOM   1730 O  O   . LEU A 1  224 ? 12.635  65.623 52.026 1.00 12.53 ? 224  LEU A O   1 
ATOM   1731 C  CB  . LEU A 1  224 ? 11.082  63.430 50.677 1.00 12.29 ? 224  LEU A CB  1 
ATOM   1732 C  CG  . LEU A 1  224 ? 10.456  62.530 49.593 1.00 12.96 ? 224  LEU A CG  1 
ATOM   1733 C  CD1 . LEU A 1  224 ? 11.115  62.731 48.179 1.00 9.95  ? 224  LEU A CD1 1 
ATOM   1734 C  CD2 . LEU A 1  224 ? 10.541  61.065 50.035 1.00 10.51 ? 224  LEU A CD2 1 
ATOM   1735 N  N   . GLN A 1  225 ? 10.620  66.182 52.852 1.00 12.36 ? 225  GLN A N   1 
ATOM   1736 C  CA  . GLN A 1  225 ? 11.214  66.833 54.030 1.00 12.69 ? 225  GLN A CA  1 
ATOM   1737 C  C   . GLN A 1  225 ? 10.974  65.971 55.281 1.00 12.87 ? 225  GLN A C   1 
ATOM   1738 O  O   . GLN A 1  225 ? 9.836   65.724 55.676 1.00 12.66 ? 225  GLN A O   1 
ATOM   1739 C  CB  . GLN A 1  225 ? 10.645  68.251 54.204 1.00 12.65 ? 225  GLN A CB  1 
ATOM   1740 C  CG  . GLN A 1  225 ? 10.837  69.157 52.968 1.00 14.03 ? 225  GLN A CG  1 
ATOM   1741 C  CD  . GLN A 1  225 ? 9.953   70.414 52.984 1.00 14.41 ? 225  GLN A CD  1 
ATOM   1742 O  OE1 . GLN A 1  225 ? 9.678   70.995 51.940 1.00 14.93 ? 225  GLN A OE1 1 
ATOM   1743 N  NE2 . GLN A 1  225 ? 9.513   70.827 54.171 1.00 11.66 ? 225  GLN A NE2 1 
ATOM   1744 N  N   . SER A 1  226 ? 12.049  65.447 55.861 1.00 13.48 ? 226  SER A N   1 
ATOM   1745 C  CA  . SER A 1  226 ? 11.964  64.748 57.158 1.00 13.49 ? 226  SER A CA  1 
ATOM   1746 C  C   . SER A 1  226 ? 11.020  63.570 57.118 1.00 12.85 ? 226  SER A C   1 
ATOM   1747 O  O   . SER A 1  226 ? 10.256  63.326 58.046 1.00 12.78 ? 226  SER A O   1 
ATOM   1748 C  CB  . SER A 1  226 ? 11.558  65.740 58.283 1.00 13.42 ? 226  SER A CB  1 
ATOM   1749 O  OG  . SER A 1  226 ? 12.607  66.679 58.512 1.00 14.61 ? 226  SER A OG  1 
ATOM   1750 N  N   . GLY A 1  227 ? 11.047  62.826 56.037 1.00 13.02 ? 227  GLY A N   1 
ATOM   1751 C  CA  . GLY A 1  227 ? 10.226  61.634 55.999 1.00 12.40 ? 227  GLY A CA  1 
ATOM   1752 C  C   . GLY A 1  227 ? 10.463  60.888 54.731 1.00 13.38 ? 227  GLY A C   1 
ATOM   1753 O  O   . GLY A 1  227 ? 10.827  61.477 53.716 1.00 13.21 ? 227  GLY A O   1 
ATOM   1754 N  N   . SER A 1  228 ? 10.275  59.570 54.786 1.00 13.73 ? 228  SER A N   1 
ATOM   1755 C  CA  . SER A 1  228 ? 10.497  58.756 53.622 1.00 14.67 ? 228  SER A CA  1 
ATOM   1756 C  C   . SER A 1  228 ? 9.583   57.535 53.690 1.00 14.18 ? 228  SER A C   1 
ATOM   1757 O  O   . SER A 1  228 ? 9.056   57.213 54.757 1.00 15.32 ? 228  SER A O   1 
ATOM   1758 C  CB  . SER A 1  228 ? 11.998  58.436 53.415 1.00 14.23 ? 228  SER A CB  1 
ATOM   1759 O  OG  . SER A 1  228 ? 12.470  57.597 54.413 1.00 16.89 ? 228  SER A OG  1 
ATOM   1760 N  N   . PRO A 1  229 ? 9.341   56.885 52.545 1.00 13.31 ? 229  PRO A N   1 
ATOM   1761 C  CA  . PRO A 1  229 ? 8.251   55.903 52.577 1.00 12.98 ? 229  PRO A CA  1 
ATOM   1762 C  C   . PRO A 1  229 ? 8.561   54.695 53.475 1.00 13.23 ? 229  PRO A C   1 
ATOM   1763 O  O   . PRO A 1  229 ? 7.638   54.059 54.006 1.00 13.57 ? 229  PRO A O   1 
ATOM   1764 C  CB  . PRO A 1  229 ? 8.103   55.501 51.094 1.00 13.38 ? 229  PRO A CB  1 
ATOM   1765 C  CG  . PRO A 1  229 ? 9.422   55.819 50.469 1.00 11.43 ? 229  PRO A CG  1 
ATOM   1766 C  CD  . PRO A 1  229 ? 9.936   57.032 51.204 1.00 12.50 ? 229  PRO A CD  1 
ATOM   1767 N  N   . ASN A 1  230 ? 9.853   54.421 53.675 1.00 13.13 ? 230  ASN A N   1 
ATOM   1768 C  CA  . ASN A 1  230 ? 10.317  53.284 54.471 1.00 13.30 ? 230  ASN A CA  1 
ATOM   1769 C  C   . ASN A 1  230 ? 10.462  53.561 55.974 1.00 13.56 ? 230  ASN A C   1 
ATOM   1770 O  O   . ASN A 1  230 ? 10.953  52.699 56.701 1.00 14.41 ? 230  ASN A O   1 
ATOM   1771 C  CB  . ASN A 1  230 ? 11.658  52.764 53.931 1.00 12.18 ? 230  ASN A CB  1 
ATOM   1772 C  CG  . ASN A 1  230 ? 12.748  53.861 53.892 1.00 13.87 ? 230  ASN A CG  1 
ATOM   1773 O  OD1 . ASN A 1  230 ? 12.506  55.015 53.510 1.00 14.50 ? 230  ASN A OD1 1 
ATOM   1774 N  ND2 . ASN A 1  230 ? 13.939  53.497 54.294 1.00 12.31 ? 230  ASN A ND2 1 
ATOM   1775 N  N   . CYS A 1  231 ? 10.041  54.737 56.442 1.00 13.06 ? 231  CYS A N   1 
ATOM   1776 C  CA  . CYS A 1  231 ? 10.088  55.034 57.875 1.00 13.21 ? 231  CYS A CA  1 
ATOM   1777 C  C   . CYS A 1  231 ? 9.352   53.952 58.703 1.00 13.45 ? 231  CYS A C   1 
ATOM   1778 O  O   . CYS A 1  231 ? 8.283   53.465 58.294 1.00 14.75 ? 231  CYS A O   1 
ATOM   1779 C  CB  . CYS A 1  231 ? 9.479   56.403 58.151 1.00 12.97 ? 231  CYS A CB  1 
ATOM   1780 S  SG  . CYS A 1  231 ? 10.553  57.719 57.644 1.00 12.47 ? 231  CYS A SG  1 
ATOM   1781 N  N   . PRO A 1  232 ? 9.935   53.551 59.853 1.00 12.79 ? 232  PRO A N   1 
ATOM   1782 C  CA  . PRO A 1  232 ? 9.361   52.440 60.631 1.00 12.36 ? 232  PRO A CA  1 
ATOM   1783 C  C   . PRO A 1  232 ? 7.949   52.717 61.147 1.00 12.83 ? 232  PRO A C   1 
ATOM   1784 O  O   . PRO A 1  232 ? 7.234   51.774 61.485 1.00 12.62 ? 232  PRO A O   1 
ATOM   1785 C  CB  . PRO A 1  232 ? 10.322  52.314 61.812 1.00 12.09 ? 232  PRO A CB  1 
ATOM   1786 C  CG  . PRO A 1  232 ? 10.949  53.720 61.937 1.00 11.15 ? 232  PRO A CG  1 
ATOM   1787 C  CD  . PRO A 1  232 ? 11.148  54.102 60.496 1.00 11.70 ? 232  PRO A CD  1 
ATOM   1788 N  N   . TRP A 1  233 ? 7.571   53.998 61.231 1.00 12.41 ? 233  TRP A N   1 
ATOM   1789 C  CA  . TRP A 1  233 ? 6.244   54.430 61.684 1.00 12.36 ? 233  TRP A CA  1 
ATOM   1790 C  C   . TRP A 1  233 ? 5.211   54.637 60.548 1.00 12.65 ? 233  TRP A C   1 
ATOM   1791 O  O   . TRP A 1  233 ? 3.999   54.863 60.821 1.00 13.20 ? 233  TRP A O   1 
ATOM   1792 C  CB  . TRP A 1  233 ? 6.383   55.740 62.474 1.00 11.67 ? 233  TRP A CB  1 
ATOM   1793 C  CG  . TRP A 1  233 ? 7.157   56.764 61.744 1.00 13.18 ? 233  TRP A CG  1 
ATOM   1794 C  CD1 . TRP A 1  233 ? 8.521   57.005 61.847 1.00 12.67 ? 233  TRP A CD1 1 
ATOM   1795 C  CD2 . TRP A 1  233 ? 6.669   57.669 60.746 1.00 13.04 ? 233  TRP A CD2 1 
ATOM   1796 N  NE1 . TRP A 1  233 ? 8.880   58.027 61.006 1.00 13.70 ? 233  TRP A NE1 1 
ATOM   1797 C  CE2 . TRP A 1  233 ? 7.771   58.465 60.329 1.00 12.72 ? 233  TRP A CE2 1 
ATOM   1798 C  CE3 . TRP A 1  233 ? 5.408   57.917 60.191 1.00 14.81 ? 233  TRP A CE3 1 
ATOM   1799 C  CZ2 . TRP A 1  233 ? 7.658   59.464 59.354 1.00 11.40 ? 233  TRP A CZ2 1 
ATOM   1800 C  CZ3 . TRP A 1  233 ? 5.294   58.936 59.213 1.00 14.24 ? 233  TRP A CZ3 1 
ATOM   1801 C  CH2 . TRP A 1  233 ? 6.427   59.682 58.807 1.00 12.39 ? 233  TRP A CH2 1 
ATOM   1802 N  N   . ALA A 1  234 ? 5.662   54.561 59.297 1.00 12.01 ? 234  ALA A N   1 
ATOM   1803 C  CA  . ALA A 1  234 ? 4.850   55.000 58.162 1.00 12.84 ? 234  ALA A CA  1 
ATOM   1804 C  C   . ALA A 1  234 ? 3.986   53.926 57.520 1.00 13.09 ? 234  ALA A C   1 
ATOM   1805 O  O   . ALA A 1  234 ? 3.139   54.240 56.721 1.00 13.29 ? 234  ALA A O   1 
ATOM   1806 C  CB  . ALA A 1  234 ? 5.742   55.670 57.078 1.00 12.86 ? 234  ALA A CB  1 
ATOM   1807 N  N   . SER A 1  235 ? 4.211   52.655 57.844 1.00 14.04 ? 235  SER A N   1 
ATOM   1808 C  CA  . SER A 1  235 ? 3.354   51.603 57.324 1.00 13.98 ? 235  SER A CA  1 
ATOM   1809 C  C   . SER A 1  235 ? 3.343   50.442 58.287 1.00 14.87 ? 235  SER A C   1 
ATOM   1810 O  O   . SER A 1  235 ? 4.248   50.334 59.126 1.00 15.36 ? 235  SER A O   1 
ATOM   1811 C  CB  . SER A 1  235 ? 3.813   51.149 55.943 1.00 13.22 ? 235  SER A CB  1 
ATOM   1812 O  OG  . SER A 1  235 ? 5.053   50.486 56.014 1.00 11.45 ? 235  SER A OG  1 
ATOM   1813 N  N   . VAL A 1  236 ? 2.323   49.595 58.155 1.00 15.02 ? 236  VAL A N   1 
ATOM   1814 C  CA  . VAL A 1  236 ? 2.220   48.315 58.871 1.00 16.18 ? 236  VAL A CA  1 
ATOM   1815 C  C   . VAL A 1  236 ? 1.874   47.178 57.899 1.00 17.21 ? 236  VAL A C   1 
ATOM   1816 O  O   . VAL A 1  236 ? 1.364   47.426 56.792 1.00 17.90 ? 236  VAL A O   1 
ATOM   1817 C  CB  . VAL A 1  236 ? 1.118   48.365 59.997 1.00 16.17 ? 236  VAL A CB  1 
ATOM   1818 C  CG1 . VAL A 1  236 ? 1.478   49.352 61.100 1.00 15.71 ? 236  VAL A CG1 1 
ATOM   1819 C  CG2 . VAL A 1  236 ? -0.258  48.703 59.422 1.00 14.62 ? 236  VAL A CG2 1 
ATOM   1820 N  N   . SER A 1  237 ? 2.144   45.939 58.300 1.00 17.96 ? 237  SER A N   1 
ATOM   1821 C  CA  . SER A 1  237 ? 1.615   44.779 57.602 1.00 19.01 ? 237  SER A CA  1 
ATOM   1822 C  C   . SER A 1  237 ? 0.075   44.764 57.598 1.00 19.65 ? 237  SER A C   1 
ATOM   1823 O  O   . SER A 1  237 ? -0.595  45.498 58.345 1.00 20.45 ? 237  SER A O   1 
ATOM   1824 C  CB  . SER A 1  237 ? 2.136   43.470 58.223 1.00 19.27 ? 237  SER A CB  1 
ATOM   1825 O  OG  . SER A 1  237 ? 1.449   43.175 59.430 1.00 19.32 ? 237  SER A OG  1 
ATOM   1826 N  N   . VAL A 1  238 ? -0.480  43.925 56.735 1.00 19.59 ? 238  VAL A N   1 
ATOM   1827 C  CA  . VAL A 1  238 ? -1.932  43.811 56.581 1.00 19.71 ? 238  VAL A CA  1 
ATOM   1828 C  C   . VAL A 1  238 ? -2.545  43.078 57.787 1.00 19.05 ? 238  VAL A C   1 
ATOM   1829 O  O   . VAL A 1  238 ? -3.704  43.353 58.200 1.00 19.77 ? 238  VAL A O   1 
ATOM   1830 C  CB  . VAL A 1  238 ? -2.234  43.190 55.204 1.00 19.63 ? 238  VAL A CB  1 
ATOM   1831 C  CG1 . VAL A 1  238 ? -3.269  42.125 55.281 1.00 22.08 ? 238  VAL A CG1 1 
ATOM   1832 C  CG2 . VAL A 1  238 ? -2.594  44.284 54.204 1.00 20.73 ? 238  VAL A CG2 1 
ATOM   1833 N  N   . ALA A 1  239 ? -1.745  42.200 58.381 1.00 17.46 ? 239  ALA A N   1 
ATOM   1834 C  CA  . ALA A 1  239 ? -2.102  41.549 59.644 1.00 17.22 ? 239  ALA A CA  1 
ATOM   1835 C  C   . ALA A 1  239 ? -2.133  42.551 60.783 1.00 16.89 ? 239  ALA A C   1 
ATOM   1836 O  O   . ALA A 1  239 ? -3.079  42.556 61.573 1.00 16.49 ? 239  ALA A O   1 
ATOM   1837 C  CB  . ALA A 1  239 ? -1.122  40.408 59.959 1.00 16.44 ? 239  ALA A CB  1 
ATOM   1838 N  N   . GLU A 1  240 ? -1.119  43.432 60.862 1.00 16.83 ? 240  GLU A N   1 
ATOM   1839 C  CA  . GLU A 1  240 ? -1.103  44.409 61.964 1.00 16.80 ? 240  GLU A CA  1 
ATOM   1840 C  C   . GLU A 1  240 ? -2.240  45.417 61.856 1.00 16.82 ? 240  GLU A C   1 
ATOM   1841 O  O   . GLU A 1  240 ? -2.849  45.780 62.870 1.00 16.77 ? 240  GLU A O   1 
ATOM   1842 C  CB  . GLU A 1  240 ? 0.257   45.099 62.123 1.00 17.12 ? 240  GLU A CB  1 
ATOM   1843 C  CG  . GLU A 1  240 ? 0.272   46.220 63.195 1.00 16.71 ? 240  GLU A CG  1 
ATOM   1844 C  CD  . GLU A 1  240 ? 0.023   45.709 64.605 1.00 18.78 ? 240  GLU A CD  1 
ATOM   1845 O  OE1 . GLU A 1  240 ? -0.011  44.473 64.833 1.00 19.11 ? 240  GLU A OE1 1 
ATOM   1846 O  OE2 . GLU A 1  240 ? -0.141  46.550 65.504 1.00 21.47 ? 240  GLU A OE2 1 
ATOM   1847 N  N   . GLY A 1  241 ? -2.545  45.829 60.621 1.00 17.58 ? 241  GLY A N   1 
ATOM   1848 C  CA  . GLY A 1  241 ? -3.622  46.779 60.345 1.00 18.92 ? 241  GLY A CA  1 
ATOM   1849 C  C   . GLY A 1  241 ? -4.960  46.181 60.731 1.00 19.59 ? 241  GLY A C   1 
ATOM   1850 O  O   . GLY A 1  241 ? -5.799  46.844 61.344 1.00 19.87 ? 241  GLY A O   1 
ATOM   1851 N  N   . ARG A 1  242 ? -5.142  44.913 60.382 1.00 20.30 ? 242  ARG A N   1 
ATOM   1852 C  CA  . ARG A 1  242 ? -6.337  44.154 60.751 1.00 20.82 ? 242  ARG A CA  1 
ATOM   1853 C  C   . ARG A 1  242 ? -6.440  44.079 62.279 1.00 21.16 ? 242  ARG A C   1 
ATOM   1854 O  O   . ARG A 1  242 ? -7.500  44.344 62.846 1.00 21.30 ? 242  ARG A O   1 
ATOM   1855 C  CB  . ARG A 1  242 ? -6.274  42.741 60.114 1.00 20.69 ? 242  ARG A CB  1 
ATOM   1856 C  CG  . ARG A 1  242 ? -7.414  41.735 60.503 1.00 22.26 ? 242  ARG A CG  1 
ATOM   1857 C  CD  . ARG A 1  242 ? -7.577  40.575 59.440 1.00 21.88 ? 242  ARG A CD  1 
ATOM   1858 N  NE  . ARG A 1  242 ? -8.184  41.051 58.192 1.00 23.02 ? 242  ARG A NE  1 
ATOM   1859 C  CZ  . ARG A 1  242 ? -9.490  41.292 58.036 1.00 24.23 ? 242  ARG A CZ  1 
ATOM   1860 N  NH1 . ARG A 1  242 ? -10.347 41.090 59.031 1.00 23.22 ? 242  ARG A NH1 1 
ATOM   1861 N  NH2 . ARG A 1  242 ? -9.953  41.741 56.879 1.00 26.80 ? 242  ARG A NH2 1 
ATOM   1862 N  N   . ARG A 1  243 ? -5.342  43.703 62.935 1.00 21.48 ? 243  ARG A N   1 
ATOM   1863 C  CA  . ARG A 1  243 ? -5.325  43.557 64.395 1.00 21.81 ? 243  ARG A CA  1 
ATOM   1864 C  C   . ARG A 1  243 ? -5.722  44.864 65.072 1.00 21.61 ? 243  ARG A C   1 
ATOM   1865 O  O   . ARG A 1  243 ? -6.520  44.854 66.003 1.00 22.05 ? 243  ARG A O   1 
ATOM   1866 C  CB  . ARG A 1  243 ? -3.954  43.082 64.884 1.00 22.17 ? 243  ARG A CB  1 
ATOM   1867 C  CG  . ARG A 1  243 ? -3.934  42.606 66.335 1.00 23.40 ? 243  ARG A CG  1 
ATOM   1868 C  CD  . ARG A 1  243 ? -2.513  42.622 66.927 1.00 20.79 ? 243  ARG A CD  1 
ATOM   1869 N  NE  . ARG A 1  243 ? -1.922  43.965 66.948 1.00 21.48 ? 243  ARG A NE  1 
ATOM   1870 C  CZ  . ARG A 1  243 ? -2.274  44.963 67.770 1.00 22.35 ? 243  ARG A CZ  1 
ATOM   1871 N  NH1 . ARG A 1  243 ? -3.224  44.805 68.689 1.00 19.73 ? 243  ARG A NH1 1 
ATOM   1872 N  NH2 . ARG A 1  243 ? -1.643  46.134 67.686 1.00 22.37 ? 243  ARG A NH2 1 
ATOM   1873 N  N   . ARG A 1  244 ? -5.198  45.989 64.579 1.00 20.84 ? 244  ARG A N   1 
ATOM   1874 C  CA  . ARG A 1  244 ? -5.518  47.297 65.158 1.00 19.98 ? 244  ARG A CA  1 
ATOM   1875 C  C   . ARG A 1  244 ? -6.940  47.716 64.890 1.00 20.27 ? 244  ARG A C   1 
ATOM   1876 O  O   . ARG A 1  244 ? -7.538  48.357 65.737 1.00 20.28 ? 244  ARG A O   1 
ATOM   1877 C  CB  . ARG A 1  244 ? -4.569  48.393 64.646 1.00 20.31 ? 244  ARG A CB  1 
ATOM   1878 C  CG  . ARG A 1  244 ? -3.139  48.193 65.046 1.00 17.26 ? 244  ARG A CG  1 
ATOM   1879 C  CD  . ARG A 1  244 ? -2.308  49.307 64.531 1.00 16.48 ? 244  ARG A CD  1 
ATOM   1880 N  NE  . ARG A 1  244 ? -0.898  49.023 64.766 1.00 14.76 ? 244  ARG A NE  1 
ATOM   1881 C  CZ  . ARG A 1  244 ? 0.104   49.857 64.536 1.00 13.49 ? 244  ARG A CZ  1 
ATOM   1882 N  NH1 . ARG A 1  244 ? -0.113  51.098 64.099 1.00 10.73 ? 244  ARG A NH1 1 
ATOM   1883 N  NH2 . ARG A 1  244 ? 1.335   49.436 64.777 1.00 11.09 ? 244  ARG A NH2 1 
ATOM   1884 N  N   . ALA A 1  245 ? -7.475  47.365 63.714 1.00 20.21 ? 245  ALA A N   1 
ATOM   1885 C  CA  . ALA A 1  245 ? -8.862  47.662 63.376 1.00 21.02 ? 245  ALA A CA  1 
ATOM   1886 C  C   . ALA A 1  245 ? -9.818  46.941 64.316 1.00 21.66 ? 245  ALA A C   1 
ATOM   1887 O  O   . ALA A 1  245 ? -10.744 47.530 64.868 1.00 22.59 ? 245  ALA A O   1 
ATOM   1888 C  CB  . ALA A 1  245 ? -9.146  47.268 61.934 1.00 20.87 ? 245  ALA A CB  1 
ATOM   1889 N  N   . VAL A 1  246 ? -9.584  45.653 64.509 1.00 22.33 ? 246  VAL A N   1 
ATOM   1890 C  CA  . VAL A 1  246 ? -10.376 44.876 65.463 1.00 22.39 ? 246  VAL A CA  1 
ATOM   1891 C  C   . VAL A 1  246 ? -10.293 45.433 66.893 1.00 22.77 ? 246  VAL A C   1 
ATOM   1892 O  O   . VAL A 1  246 ? -11.308 45.519 67.583 1.00 22.83 ? 246  VAL A O   1 
ATOM   1893 C  CB  . VAL A 1  246 ? -9.921  43.405 65.492 1.00 22.61 ? 246  VAL A CB  1 
ATOM   1894 C  CG1 . VAL A 1  246 ? -10.743 42.622 66.542 1.00 22.86 ? 246  VAL A CG1 1 
ATOM   1895 C  CG2 . VAL A 1  246 ? -9.978  42.771 64.082 1.00 20.63 ? 246  VAL A CG2 1 
ATOM   1896 N  N   . GLU A 1  247 ? -9.080  45.791 67.331 1.00 22.47 ? 247  GLU A N   1 
ATOM   1897 C  CA  . GLU A 1  247 ? -8.868  46.403 68.649 1.00 22.46 ? 247  GLU A CA  1 
ATOM   1898 C  C   . GLU A 1  247 ? -9.635  47.706 68.813 1.00 22.31 ? 247  GLU A C   1 
ATOM   1899 O  O   . GLU A 1  247 ? -10.180 47.982 69.899 1.00 21.67 ? 247  GLU A O   1 
ATOM   1900 C  CB  . GLU A 1  247 ? -7.371  46.622 68.924 1.00 22.57 ? 247  GLU A CB  1 
ATOM   1901 C  CG  . GLU A 1  247 ? -7.024  46.954 70.389 1.00 24.71 ? 247  GLU A CG  1 
ATOM   1902 C  CD  . GLU A 1  247 ? -7.453  45.857 71.416 1.00 28.05 ? 247  GLU A CD  1 
ATOM   1903 O  OE1 . GLU A 1  247 ? -7.716  44.686 71.036 1.00 24.76 ? 247  GLU A OE1 1 
ATOM   1904 O  OE2 . GLU A 1  247 ? -7.536  46.207 72.615 1.00 29.71 ? 247  GLU A OE2 1 
ATOM   1905 N  N   . LEU A 1  248 ? -9.687  48.508 67.745 1.00 21.93 ? 248  LEU A N   1 
ATOM   1906 C  CA  . LEU A 1  248 ? -10.490 49.731 67.784 1.00 21.98 ? 248  LEU A CA  1 
ATOM   1907 C  C   . LEU A 1  248 ? -11.932 49.329 68.054 1.00 22.40 ? 248  LEU A C   1 
ATOM   1908 O  O   . LEU A 1  248 ? -12.571 49.879 68.948 1.00 22.70 ? 248  LEU A O   1 
ATOM   1909 C  CB  . LEU A 1  248 ? -10.385 50.534 66.478 1.00 21.37 ? 248  LEU A CB  1 
ATOM   1910 C  CG  . LEU A 1  248 ? -10.973 51.943 66.508 1.00 21.09 ? 248  LEU A CG  1 
ATOM   1911 C  CD1 . LEU A 1  248 ? -10.025 52.860 67.237 1.00 22.19 ? 248  LEU A CD1 1 
ATOM   1912 C  CD2 . LEU A 1  248 ? -11.220 52.484 65.094 1.00 21.42 ? 248  LEU A CD2 1 
ATOM   1913 N  N   . GLY A 1  249 ? -12.421 48.356 67.283 1.00 22.46 ? 249  GLY A N   1 
ATOM   1914 C  CA  . GLY A 1  249 ? -13.746 47.758 67.499 1.00 23.68 ? 249  GLY A CA  1 
ATOM   1915 C  C   . GLY A 1  249 ? -13.981 47.249 68.915 1.00 23.67 ? 249  GLY A C   1 
ATOM   1916 O  O   . GLY A 1  249 ? -15.040 47.456 69.498 1.00 22.69 ? 249  GLY A O   1 
ATOM   1917 N  N   . ARG A 1  250 ? -12.978 46.597 69.476 1.00 24.42 ? 250  ARG A N   1 
ATOM   1918 C  CA  . ARG A 1  250 ? -13.070 46.125 70.849 1.00 25.77 ? 250  ARG A CA  1 
ATOM   1919 C  C   . ARG A 1  250 ? -13.246 47.306 71.806 1.00 25.78 ? 250  ARG A C   1 
ATOM   1920 O  O   . ARG A 1  250 ? -14.092 47.258 72.698 1.00 26.51 ? 250  ARG A O   1 
ATOM   1921 C  CB  . ARG A 1  250 ? -11.861 45.252 71.199 1.00 25.90 ? 250  ARG A CB  1 
ATOM   1922 C  CG  . ARG A 1  250 ? -12.026 44.399 72.454 1.00 28.24 ? 250  ARG A CG  1 
ATOM   1923 C  CD  . ARG A 1  250 ? -10.839 43.470 72.607 1.00 31.20 ? 250  ARG A CD  1 
ATOM   1924 N  NE  . ARG A 1  250 ? -10.937 42.324 71.699 1.00 34.87 ? 250  ARG A NE  1 
ATOM   1925 C  CZ  . ARG A 1  250 ? -10.266 42.182 70.552 1.00 39.01 ? 250  ARG A CZ  1 
ATOM   1926 N  NH1 . ARG A 1  250 ? -9.413  43.121 70.113 1.00 41.25 ? 250  ARG A NH1 1 
ATOM   1927 N  NH2 . ARG A 1  250 ? -10.439 41.079 69.838 1.00 38.62 ? 250  ARG A NH2 1 
ATOM   1928 N  N   . ASN A 1  251 ? -12.504 48.393 71.574 1.00 25.64 ? 251  ASN A N   1 
ATOM   1929 C  CA  . ASN A 1  251 ? -12.613 49.602 72.400 1.00 24.83 ? 251  ASN A CA  1 
ATOM   1930 C  C   . ASN A 1  251 ? -13.978 50.293 72.370 1.00 25.76 ? 251  ASN A C   1 
ATOM   1931 O  O   . ASN A 1  251 ? -14.311 51.076 73.264 1.00 25.88 ? 251  ASN A O   1 
ATOM   1932 C  CB  . ASN A 1  251 ? -11.515 50.608 72.026 1.00 24.62 ? 251  ASN A CB  1 
ATOM   1933 C  CG  . ASN A 1  251 ? -10.156 50.286 72.676 1.00 21.87 ? 251  ASN A CG  1 
ATOM   1934 O  OD1 . ASN A 1  251 ? -9.744  50.944 73.624 1.00 23.18 ? 251  ASN A OD1 1 
ATOM   1935 N  ND2 . ASN A 1  251 ? -9.479  49.291 72.172 1.00 17.67 ? 251  ASN A ND2 1 
ATOM   1936 N  N   . LEU A 1  252 ? -14.757 50.018 71.328 1.00 26.67 ? 252  LEU A N   1 
ATOM   1937 C  CA  . LEU A 1  252 ? -16.019 50.706 71.119 1.00 27.39 ? 252  LEU A CA  1 
ATOM   1938 C  C   . LEU A 1  252 ? -17.184 49.731 71.269 1.00 28.46 ? 252  LEU A C   1 
ATOM   1939 O  O   . LEU A 1  252 ? -18.300 50.012 70.838 1.00 28.50 ? 252  LEU A O   1 
ATOM   1940 C  CB  . LEU A 1  252 ? -16.047 51.419 69.767 1.00 26.80 ? 252  LEU A CB  1 
ATOM   1941 C  CG  . LEU A 1  252 ? -15.099 52.612 69.614 1.00 26.53 ? 252  LEU A CG  1 
ATOM   1942 C  CD1 . LEU A 1  252 ? -14.932 52.942 68.155 1.00 24.47 ? 252  LEU A CD1 1 
ATOM   1943 C  CD2 . LEU A 1  252 ? -15.572 53.835 70.351 1.00 27.87 ? 252  LEU A CD2 1 
ATOM   1944 N  N   . ASN A 1  253 ? -16.901 48.609 71.927 1.00 29.80 ? 253  ASN A N   1 
ATOM   1945 C  CA  . ASN A 1  253 ? -17.876 47.570 72.219 1.00 31.54 ? 253  ASN A CA  1 
ATOM   1946 C  C   . ASN A 1  253 ? -18.576 47.072 70.953 1.00 31.58 ? 253  ASN A C   1 
ATOM   1947 O  O   . ASN A 1  253 ? -19.790 46.886 70.958 1.00 32.32 ? 253  ASN A O   1 
ATOM   1948 C  CB  . ASN A 1  253 ? -18.913 48.062 73.260 1.00 32.16 ? 253  ASN A CB  1 
ATOM   1949 C  CG  . ASN A 1  253 ? -18.294 48.980 74.346 1.00 35.38 ? 253  ASN A CG  1 
ATOM   1950 O  OD1 . ASN A 1  253 ? -18.663 50.165 74.465 1.00 38.72 ? 253  ASN A OD1 1 
ATOM   1951 N  ND2 . ASN A 1  253 ? -17.352 48.436 75.125 1.00 36.08 ? 253  ASN A ND2 1 
ATOM   1952 N  N   . CYS A 1  254 ? -17.821 46.883 69.870 1.00 31.65 ? 254  CYS A N   1 
ATOM   1953 C  CA  . CYS A 1  254 ? -18.405 46.446 68.591 1.00 31.42 ? 254  CYS A CA  1 
ATOM   1954 C  C   . CYS A 1  254 ? -18.563 44.964 68.522 1.00 31.83 ? 254  CYS A C   1 
ATOM   1955 O  O   . CYS A 1  254 ? -17.807 44.189 69.117 1.00 31.25 ? 254  CYS A O   1 
ATOM   1956 C  CB  . CYS A 1  254 ? -17.569 46.863 67.363 1.00 31.26 ? 254  CYS A CB  1 
ATOM   1957 S  SG  . CYS A 1  254 ? -17.584 48.631 66.947 1.00 31.33 ? 254  CYS A SG  1 
ATOM   1958 N  N   . ASN A 1  255 ? -19.548 44.580 67.725 1.00 32.92 ? 255  ASN A N   1 
ATOM   1959 C  CA  . ASN A 1  255 ? -19.663 43.231 67.261 1.00 33.34 ? 255  ASN A CA  1 
ATOM   1960 C  C   . ASN A 1  255 ? -18.456 42.905 66.401 1.00 33.39 ? 255  ASN A C   1 
ATOM   1961 O  O   . ASN A 1  255 ? -18.283 43.479 65.322 1.00 33.13 ? 255  ASN A O   1 
ATOM   1962 C  CB  . ASN A 1  255 ? -20.953 43.094 66.455 1.00 34.41 ? 255  ASN A CB  1 
ATOM   1963 C  CG  . ASN A 1  255 ? -21.257 41.656 66.084 1.00 35.65 ? 255  ASN A CG  1 
ATOM   1964 O  OD1 . ASN A 1  255 ? -20.394 40.925 65.586 1.00 36.67 ? 255  ASN A OD1 1 
ATOM   1965 N  ND2 . ASN A 1  255 ? -22.490 41.244 66.326 1.00 38.72 ? 255  ASN A ND2 1 
ATOM   1966 N  N   . LEU A 1  256 ? -17.646 41.955 66.860 1.00 33.41 ? 256  LEU A N   1 
ATOM   1967 C  CA  . LEU A 1  256 ? -16.423 41.583 66.147 1.00 33.73 ? 256  LEU A CA  1 
ATOM   1968 C  C   . LEU A 1  256 ? -16.508 40.311 65.303 1.00 34.54 ? 256  LEU A C   1 
ATOM   1969 O  O   . LEU A 1  256 ? -15.471 39.781 64.894 1.00 35.12 ? 256  LEU A O   1 
ATOM   1970 C  CB  . LEU A 1  256 ? -15.237 41.477 67.125 1.00 33.09 ? 256  LEU A CB  1 
ATOM   1971 C  CG  . LEU A 1  256 ? -14.900 42.712 67.972 1.00 32.07 ? 256  LEU A CG  1 
ATOM   1972 C  CD1 . LEU A 1  256 ? -13.764 42.418 68.968 1.00 28.74 ? 256  LEU A CD1 1 
ATOM   1973 C  CD2 . LEU A 1  256 ? -14.596 43.947 67.088 1.00 30.24 ? 256  LEU A CD2 1 
ATOM   1974 N  N   . ASN A 1  257 ? -17.714 39.827 65.013 1.00 35.37 ? 257  ASN A N   1 
ATOM   1975 C  CA  . ASN A 1  257 ? -17.857 38.540 64.308 1.00 36.07 ? 257  ASN A CA  1 
ATOM   1976 C  C   . ASN A 1  257 ? -17.413 38.518 62.846 1.00 35.35 ? 257  ASN A C   1 
ATOM   1977 O  O   . ASN A 1  257 ? -16.910 37.503 62.356 1.00 35.17 ? 257  ASN A O   1 
ATOM   1978 C  CB  . ASN A 1  257 ? -19.283 38.013 64.428 1.00 37.16 ? 257  ASN A CB  1 
ATOM   1979 C  CG  . ASN A 1  257 ? -19.540 37.317 65.767 1.00 40.15 ? 257  ASN A CG  1 
ATOM   1980 O  OD1 . ASN A 1  257 ? -20.672 36.914 66.050 1.00 44.43 ? 257  ASN A OD1 1 
ATOM   1981 N  ND2 . ASN A 1  257 ? -18.489 37.164 66.590 1.00 41.43 ? 257  ASN A ND2 1 
ATOM   1982 N  N   . SER A 1  258 ? -17.591 39.645 62.164 1.00 34.41 ? 258  SER A N   1 
ATOM   1983 C  CA  . SER A 1  258 ? -17.172 39.768 60.776 1.00 33.36 ? 258  SER A CA  1 
ATOM   1984 C  C   . SER A 1  258 ? -16.723 41.179 60.450 1.00 33.24 ? 258  SER A C   1 
ATOM   1985 O  O   . SER A 1  258 ? -17.124 42.163 61.114 1.00 32.59 ? 258  SER A O   1 
ATOM   1986 C  CB  . SER A 1  258 ? -18.327 39.424 59.845 1.00 32.85 ? 258  SER A CB  1 
ATOM   1987 O  OG  . SER A 1  258 ? -19.329 40.416 59.950 1.00 30.77 ? 258  SER A OG  1 
ATOM   1988 N  N   . ASP A 1  259 ? -15.945 41.269 59.376 1.00 32.83 ? 259  ASP A N   1 
ATOM   1989 C  CA  . ASP A 1  259 ? -15.567 42.554 58.826 1.00 32.98 ? 259  ASP A CA  1 
ATOM   1990 C  C   . ASP A 1  259 ? -16.805 43.413 58.652 1.00 32.98 ? 259  ASP A C   1 
ATOM   1991 O  O   . ASP A 1  259 ? -16.794 44.568 59.044 1.00 33.27 ? 259  ASP A O   1 
ATOM   1992 C  CB  . ASP A 1  259 ? -14.765 42.409 57.520 1.00 32.53 ? 259  ASP A CB  1 
ATOM   1993 C  CG  . ASP A 1  259 ? -13.371 41.827 57.749 1.00 32.45 ? 259  ASP A CG  1 
ATOM   1994 O  OD1 . ASP A 1  259 ? -13.011 41.552 58.920 1.00 31.57 ? 259  ASP A OD1 1 
ATOM   1995 O  OD2 . ASP A 1  259 ? -12.629 41.628 56.756 1.00 32.03 ? 259  ASP A OD2 1 
ATOM   1996 N  N   . GLU A 1  260 ? -17.891 42.836 58.136 1.00 33.24 ? 260  GLU A N   1 
ATOM   1997 C  CA  . GLU A 1  260 ? -19.119 43.612 57.881 1.00 33.41 ? 260  GLU A CA  1 
ATOM   1998 C  C   . GLU A 1  260 ? -19.706 44.116 59.177 1.00 32.35 ? 260  GLU A C   1 
ATOM   1999 O  O   . GLU A 1  260 ? -20.108 45.274 59.265 1.00 32.69 ? 260  GLU A O   1 
ATOM   2000 C  CB  . GLU A 1  260 ? -20.184 42.794 57.139 1.00 34.28 ? 260  GLU A CB  1 
ATOM   2001 C  CG  . GLU A 1  260 ? -19.777 42.263 55.756 1.00 38.78 ? 260  GLU A CG  1 
ATOM   2002 C  CD  . GLU A 1  260 ? -18.611 41.245 55.795 1.00 44.58 ? 260  GLU A CD  1 
ATOM   2003 O  OE1 . GLU A 1  260 ? -18.440 40.530 56.817 1.00 45.33 ? 260  GLU A OE1 1 
ATOM   2004 O  OE2 . GLU A 1  260 ? -17.861 41.168 54.785 1.00 47.88 ? 260  GLU A OE2 1 
ATOM   2005 N  N   . GLU A 1  261 ? -19.776 43.243 60.180 1.00 31.32 ? 261  GLU A N   1 
ATOM   2006 C  CA  A GLU A 1  261 ? -20.298 43.626 61.497 0.70 30.86 ? 261  GLU A CA  1 
ATOM   2007 C  CA  B GLU A 1  261 ? -20.305 43.641 61.479 0.30 30.26 ? 261  GLU A CA  1 
ATOM   2008 C  C   . GLU A 1  261 ? -19.416 44.715 62.116 1.00 29.83 ? 261  GLU A C   1 
ATOM   2009 O  O   . GLU A 1  261 ? -19.921 45.718 62.643 1.00 29.26 ? 261  GLU A O   1 
ATOM   2010 C  CB  A GLU A 1  261 ? -20.408 42.407 62.434 0.70 30.98 ? 261  GLU A CB  1 
ATOM   2011 C  CB  B GLU A 1  261 ? -20.500 42.417 62.384 0.30 30.12 ? 261  GLU A CB  1 
ATOM   2012 C  CG  A GLU A 1  261 ? -21.567 41.447 62.126 0.70 33.07 ? 261  GLU A CG  1 
ATOM   2013 C  CG  B GLU A 1  261 ? -21.806 41.670 62.099 0.30 29.44 ? 261  GLU A CG  1 
ATOM   2014 C  CD  A GLU A 1  261 ? -22.897 41.842 62.788 0.70 35.88 ? 261  GLU A CD  1 
ATOM   2015 C  CD  B GLU A 1  261 ? -21.688 40.166 62.254 0.30 27.84 ? 261  GLU A CD  1 
ATOM   2016 O  OE1 A GLU A 1  261 ? -23.072 43.014 63.206 0.70 36.47 ? 261  GLU A OE1 1 
ATOM   2017 O  OE1 B GLU A 1  261 ? -20.648 39.613 61.859 0.30 27.38 ? 261  GLU A OE1 1 
ATOM   2018 O  OE2 A GLU A 1  261 ? -23.782 40.964 62.891 0.70 36.86 ? 261  GLU A OE2 1 
ATOM   2019 O  OE2 B GLU A 1  261 ? -22.641 39.536 62.758 0.30 27.28 ? 261  GLU A OE2 1 
ATOM   2020 N  N   . LEU A 1  262 ? -18.092 44.531 62.023 1.00 28.79 ? 262  LEU A N   1 
ATOM   2021 C  CA  . LEU A 1  262 ? -17.145 45.513 62.580 1.00 27.14 ? 262  LEU A CA  1 
ATOM   2022 C  C   . LEU A 1  262 ? -17.255 46.866 61.874 1.00 26.86 ? 262  LEU A C   1 
ATOM   2023 O  O   . LEU A 1  262 ? -17.513 47.877 62.505 1.00 26.23 ? 262  LEU A O   1 
ATOM   2024 C  CB  . LEU A 1  262 ? -15.708 44.973 62.540 1.00 26.93 ? 262  LEU A CB  1 
ATOM   2025 C  CG  . LEU A 1  262 ? -14.541 45.855 63.010 1.00 25.36 ? 262  LEU A CG  1 
ATOM   2026 C  CD1 . LEU A 1  262 ? -14.800 46.486 64.354 1.00 22.10 ? 262  LEU A CD1 1 
ATOM   2027 C  CD2 . LEU A 1  262 ? -13.231 45.054 63.044 1.00 24.75 ? 262  LEU A CD2 1 
ATOM   2028 N  N   . ILE A 1  263 ? -17.081 46.871 60.559 1.00 26.75 ? 263  ILE A N   1 
ATOM   2029 C  CA  . ILE A 1  263 ? -17.149 48.105 59.787 1.00 27.26 ? 263  ILE A CA  1 
ATOM   2030 C  C   . ILE A 1  263 ? -18.495 48.827 60.002 1.00 27.69 ? 263  ILE A C   1 
ATOM   2031 O  O   . ILE A 1  263 ? -18.528 50.029 60.229 1.00 27.22 ? 263  ILE A O   1 
ATOM   2032 C  CB  . ILE A 1  263 ? -16.890 47.839 58.287 1.00 26.98 ? 263  ILE A CB  1 
ATOM   2033 C  CG1 . ILE A 1  263 ? -15.505 47.218 58.105 1.00 26.58 ? 263  ILE A CG1 1 
ATOM   2034 C  CG2 . ILE A 1  263 ? -17.061 49.114 57.486 1.00 27.64 ? 263  ILE A CG2 1 
ATOM   2035 C  CD1 . ILE A 1  263 ? -15.237 46.670 56.725 1.00 24.93 ? 263  ILE A CD1 1 
ATOM   2036 N  N   . HIS A 1  264 ? -19.594 48.079 59.955 1.00 28.73 ? 264  HIS A N   1 
ATOM   2037 C  CA  . HIS A 1  264 ? -20.916 48.641 60.223 1.00 29.82 ? 264  HIS A CA  1 
ATOM   2038 C  C   . HIS A 1  264 ? -20.972 49.363 61.576 1.00 29.59 ? 264  HIS A C   1 
ATOM   2039 O  O   . HIS A 1  264 ? -21.488 50.486 61.674 1.00 29.47 ? 264  HIS A O   1 
ATOM   2040 C  CB  . HIS A 1  264 ? -22.003 47.563 60.165 1.00 30.55 ? 264  HIS A CB  1 
ATOM   2041 C  CG  . HIS A 1  264 ? -23.336 48.055 60.641 1.00 34.45 ? 264  HIS A CG  1 
ATOM   2042 N  ND1 . HIS A 1  264 ? -24.181 48.800 59.843 1.00 38.45 ? 264  HIS A ND1 1 
ATOM   2043 C  CD2 . HIS A 1  264 ? -23.945 47.963 61.850 1.00 37.57 ? 264  HIS A CD2 1 
ATOM   2044 C  CE1 . HIS A 1  264 ? -25.261 49.132 60.534 1.00 40.42 ? 264  HIS A CE1 1 
ATOM   2045 N  NE2 . HIS A 1  264 ? -25.145 48.632 61.754 1.00 40.73 ? 264  HIS A NE2 1 
ATOM   2046 N  N   . CYS A 1  265 ? -20.458 48.707 62.617 1.00 29.61 ? 265  CYS A N   1 
ATOM   2047 C  CA  . CYS A 1  265 ? -20.422 49.305 63.956 1.00 29.75 ? 265  CYS A CA  1 
ATOM   2048 C  C   . CYS A 1  265 ? -19.605 50.598 63.981 1.00 29.21 ? 265  CYS A C   1 
ATOM   2049 O  O   . CYS A 1  265 ? -20.072 51.628 64.489 1.00 29.30 ? 265  CYS A O   1 
ATOM   2050 C  CB  . CYS A 1  265 ? -19.885 48.310 64.989 1.00 29.66 ? 265  CYS A CB  1 
ATOM   2051 S  SG  . CYS A 1  265 ? -19.552 49.086 66.609 1.00 32.31 ? 265  CYS A SG  1 
ATOM   2052 N  N   . LEU A 1  266 ? -18.399 50.538 63.415 1.00 28.74 ? 266  LEU A N   1 
ATOM   2053 C  CA  . LEU A 1  266 ? -17.507 51.712 63.359 1.00 28.41 ? 266  LEU A CA  1 
ATOM   2054 C  C   . LEU A 1  266 ? -18.112 52.842 62.532 1.00 28.67 ? 266  LEU A C   1 
ATOM   2055 O  O   . LEU A 1  266 ? -17.835 54.025 62.754 1.00 29.07 ? 266  LEU A O   1 
ATOM   2056 C  CB  . LEU A 1  266 ? -16.113 51.325 62.830 1.00 27.62 ? 266  LEU A CB  1 
ATOM   2057 C  CG  . LEU A 1  266 ? -15.245 50.348 63.641 1.00 25.44 ? 266  LEU A CG  1 
ATOM   2058 C  CD1 . LEU A 1  266 ? -13.964 50.084 62.884 1.00 23.11 ? 266  LEU A CD1 1 
ATOM   2059 C  CD2 . LEU A 1  266 ? -14.914 50.840 65.034 1.00 22.38 ? 266  LEU A CD2 1 
ATOM   2060 N  N   . ARG A 1  267 ? -18.962 52.478 61.583 1.00 29.13 ? 267  ARG A N   1 
ATOM   2061 C  CA  . ARG A 1  267 ? -19.600 53.481 60.762 1.00 29.85 ? 267  ARG A CA  1 
ATOM   2062 C  C   . ARG A 1  267 ? -20.719 54.174 61.506 1.00 29.93 ? 267  ARG A C   1 
ATOM   2063 O  O   . ARG A 1  267 ? -21.065 55.284 61.154 1.00 30.17 ? 267  ARG A O   1 
ATOM   2064 C  CB  . ARG A 1  267 ? -20.098 52.899 59.451 1.00 29.12 ? 267  ARG A CB  1 
ATOM   2065 C  CG  . ARG A 1  267 ? -19.072 52.966 58.373 1.00 29.51 ? 267  ARG A CG  1 
ATOM   2066 C  CD  . ARG A 1  267 ? -19.572 52.350 57.104 1.00 29.41 ? 267  ARG A CD  1 
ATOM   2067 N  NE  . ARG A 1  267 ? -18.511 52.275 56.109 1.00 32.86 ? 267  ARG A NE  1 
ATOM   2068 C  CZ  . ARG A 1  267 ? -18.560 51.514 55.015 1.00 34.25 ? 267  ARG A CZ  1 
ATOM   2069 N  NH1 . ARG A 1  267 ? -19.628 50.753 54.784 1.00 34.49 ? 267  ARG A NH1 1 
ATOM   2070 N  NH2 . ARG A 1  267 ? -17.547 51.507 54.155 1.00 32.22 ? 267  ARG A NH2 1 
ATOM   2071 N  N   . GLU A 1  268 ? -21.266 53.545 62.544 1.00 30.40 ? 268  GLU A N   1 
ATOM   2072 C  CA  . GLU A 1  268 ? -22.322 54.212 63.333 1.00 30.80 ? 268  GLU A CA  1 
ATOM   2073 C  C   . GLU A 1  268 ? -21.774 55.246 64.310 1.00 30.64 ? 268  GLU A C   1 
ATOM   2074 O  O   . GLU A 1  268 ? -22.517 56.099 64.764 1.00 32.03 ? 268  GLU A O   1 
ATOM   2075 C  CB  . GLU A 1  268 ? -23.206 53.210 64.095 1.00 31.13 ? 268  GLU A CB  1 
ATOM   2076 C  CG  . GLU A 1  268 ? -24.111 52.318 63.225 0.50 31.68 ? 268  GLU A CG  1 
ATOM   2077 C  CD  . GLU A 1  268 ? -25.038 53.088 62.275 0.50 32.79 ? 268  GLU A CD  1 
ATOM   2078 O  OE1 . GLU A 1  268 ? -25.383 54.255 62.544 0.50 31.87 ? 268  GLU A OE1 1 
ATOM   2079 O  OE2 . GLU A 1  268 ? -25.431 52.502 61.244 0.50 33.54 ? 268  GLU A OE2 1 
ATOM   2080 N  N   . LYS A 1  269 ? -20.487 55.171 64.646 1.00 30.20 ? 269  LYS A N   1 
ATOM   2081 C  CA  . LYS A 1  269 ? -19.921 56.031 65.707 1.00 29.32 ? 269  LYS A CA  1 
ATOM   2082 C  C   . LYS A 1  269 ? -19.652 57.453 65.276 1.00 28.23 ? 269  LYS A C   1 
ATOM   2083 O  O   . LYS A 1  269 ? -19.362 57.709 64.120 1.00 28.02 ? 269  LYS A O   1 
ATOM   2084 C  CB  . LYS A 1  269 ? -18.642 55.416 66.259 1.00 28.81 ? 269  LYS A CB  1 
ATOM   2085 C  CG  . LYS A 1  269 ? -18.805 53.991 66.703 1.00 29.80 ? 269  LYS A CG  1 
ATOM   2086 C  CD  . LYS A 1  269 ? -19.587 53.899 68.011 1.00 30.30 ? 269  LYS A CD  1 
ATOM   2087 C  CE  . LYS A 1  269 ? -19.963 52.454 68.310 1.00 31.69 ? 269  LYS A CE  1 
ATOM   2088 N  NZ  . LYS A 1  269 ? -20.497 52.310 69.706 1.00 33.11 ? 269  LYS A NZ  1 
ATOM   2089 N  N   . LYS A 1  270 ? -19.751 58.389 66.210 1.00 28.11 ? 270  LYS A N   1 
ATOM   2090 C  CA  . LYS A 1  270 ? -19.392 59.772 65.908 1.00 28.08 ? 270  LYS A CA  1 
ATOM   2091 C  C   . LYS A 1  270 ? -17.862 59.851 65.708 1.00 27.32 ? 270  LYS A C   1 
ATOM   2092 O  O   . LYS A 1  270 ? -17.128 59.011 66.230 1.00 26.06 ? 270  LYS A O   1 
ATOM   2093 C  CB  . LYS A 1  270 ? -19.871 60.726 67.003 1.00 28.61 ? 270  LYS A CB  1 
ATOM   2094 C  CG  . LYS A 1  270 ? -21.368 61.042 66.936 1.00 31.93 ? 270  LYS A CG  1 
ATOM   2095 C  CD  . LYS A 1  270 ? -21.924 61.420 68.299 1.00 37.74 ? 270  LYS A CD  1 
ATOM   2096 C  CE  . LYS A 1  270 ? -23.453 61.186 68.350 1.00 41.78 ? 270  LYS A CE  1 
ATOM   2097 N  NZ  . LYS A 1  270 ? -23.907 60.961 69.766 1.00 44.86 ? 270  LYS A NZ  1 
ATOM   2098 N  N   . PRO A 1  271 ? -17.392 60.835 64.919 1.00 26.89 ? 271  PRO A N   1 
ATOM   2099 C  CA  . PRO A 1  271 ? -15.966 60.927 64.692 1.00 26.48 ? 271  PRO A CA  1 
ATOM   2100 C  C   . PRO A 1  271 ? -15.191 60.882 65.994 1.00 25.78 ? 271  PRO A C   1 
ATOM   2101 O  O   . PRO A 1  271 ? -14.272 60.099 66.105 1.00 25.77 ? 271  PRO A O   1 
ATOM   2102 C  CB  . PRO A 1  271 ? -15.818 62.293 64.028 1.00 25.86 ? 271  PRO A CB  1 
ATOM   2103 C  CG  . PRO A 1  271 ? -17.050 62.438 63.259 1.00 26.81 ? 271  PRO A CG  1 
ATOM   2104 C  CD  . PRO A 1  271 ? -18.125 61.845 64.134 1.00 26.49 ? 271  PRO A CD  1 
ATOM   2105 N  N   . GLN A 1  272 ? -15.597 61.680 66.977 1.00 25.92 ? 272  GLN A N   1 
ATOM   2106 C  CA  . GLN A 1  272 ? -14.832 61.838 68.210 1.00 26.03 ? 272  GLN A CA  1 
ATOM   2107 C  C   . GLN A 1  272 ? -14.715 60.551 69.043 1.00 25.91 ? 272  GLN A C   1 
ATOM   2108 O  O   . GLN A 1  272 ? -13.773 60.398 69.814 1.00 25.60 ? 272  GLN A O   1 
ATOM   2109 C  CB  . GLN A 1  272 ? -15.366 63.023 69.033 1.00 26.07 ? 272  GLN A CB  1 
ATOM   2110 C  CG  . GLN A 1  272 ? -14.438 63.513 70.182 1.00 27.16 ? 272  GLN A CG  1 
ATOM   2111 C  CD  . GLN A 1  272 ? -13.000 63.778 69.738 1.00 28.07 ? 272  GLN A CD  1 
ATOM   2112 O  OE1 . GLN A 1  272 ? -12.756 64.537 68.793 1.00 26.96 ? 272  GLN A OE1 1 
ATOM   2113 N  NE2 . GLN A 1  272 ? -12.038 63.151 70.432 1.00 28.31 ? 272  GLN A NE2 1 
ATOM   2114 N  N   . GLU A 1  273 ? -15.664 59.630 68.873 1.00 25.19 ? 273  GLU A N   1 
ATOM   2115 C  CA  . GLU A 1  273 ? -15.632 58.334 69.558 1.00 24.98 ? 273  GLU A CA  1 
ATOM   2116 C  C   . GLU A 1  273 ? -14.494 57.487 69.055 1.00 23.69 ? 273  GLU A C   1 
ATOM   2117 O  O   . GLU A 1  273 ? -13.848 56.781 69.822 1.00 23.82 ? 273  GLU A O   1 
ATOM   2118 C  CB  . GLU A 1  273 ? -16.941 57.566 69.331 1.00 24.71 ? 273  GLU A CB  1 
ATOM   2119 C  CG  . GLU A 1  273 ? -18.144 58.242 69.949 1.00 28.96 ? 273  GLU A CG  1 
ATOM   2120 C  CD  . GLU A 1  273 ? -19.420 57.466 69.731 1.00 32.30 ? 273  GLU A CD  1 
ATOM   2121 O  OE1 . GLU A 1  273 ? -19.686 56.535 70.516 1.00 34.95 ? 273  GLU A OE1 1 
ATOM   2122 O  OE2 . GLU A 1  273 ? -20.150 57.784 68.774 1.00 33.02 ? 273  GLU A OE2 1 
ATOM   2123 N  N   . LEU A 1  274 ? -14.285 57.522 67.744 1.00 22.69 ? 274  LEU A N   1 
ATOM   2124 C  CA  . LEU A 1  274 ? -13.142 56.865 67.142 1.00 22.04 ? 274  LEU A CA  1 
ATOM   2125 C  C   . LEU A 1  274 ? -11.845 57.492 67.668 1.00 21.49 ? 274  LEU A C   1 
ATOM   2126 O  O   . LEU A 1  274 ? -10.918 56.775 68.029 1.00 21.49 ? 274  LEU A O   1 
ATOM   2127 C  CB  . LEU A 1  274 ? -13.229 56.940 65.607 1.00 21.91 ? 274  LEU A CB  1 
ATOM   2128 C  CG  . LEU A 1  274 ? -13.941 55.759 64.926 1.00 21.99 ? 274  LEU A CG  1 
ATOM   2129 C  CD1 . LEU A 1  274 ? -15.346 55.606 65.421 1.00 22.00 ? 274  LEU A CD1 1 
ATOM   2130 C  CD2 . LEU A 1  274 ? -13.955 55.865 63.411 1.00 24.76 ? 274  LEU A CD2 1 
ATOM   2131 N  N   . ILE A 1  275 ? -11.802 58.817 67.719 1.00 20.68 ? 275  ILE A N   1 
ATOM   2132 C  CA  . ILE A 1  275 ? -10.594 59.568 68.072 1.00 21.24 ? 275  ILE A CA  1 
ATOM   2133 C  C   . ILE A 1  275 ? -10.212 59.330 69.550 1.00 21.37 ? 275  ILE A C   1 
ATOM   2134 O  O   . ILE A 1  275 ? -9.048  59.129 69.868 1.00 20.92 ? 275  ILE A O   1 
ATOM   2135 C  CB  . ILE A 1  275 ? -10.777 61.073 67.759 1.00 20.74 ? 275  ILE A CB  1 
ATOM   2136 C  CG1 . ILE A 1  275 ? -10.827 61.267 66.240 1.00 20.85 ? 275  ILE A CG1 1 
ATOM   2137 C  CG2 . ILE A 1  275 ? -9.669  61.916 68.385 1.00 20.34 ? 275  ILE A CG2 1 
ATOM   2138 C  CD1 . ILE A 1  275 ? -11.353 62.620 65.782 1.00 18.74 ? 275  ILE A CD1 1 
ATOM   2139 N  N   . ASP A 1  276 ? -11.213 59.260 70.420 1.00 21.02 ? 276  ASP A N   1 
ATOM   2140 C  CA  . ASP A 1  276 ? -10.982 59.022 71.837 1.00 21.73 ? 276  ASP A CA  1 
ATOM   2141 C  C   . ASP A 1  276 ? -10.254 57.728 72.172 1.00 21.94 ? 276  ASP A C   1 
ATOM   2142 O  O   . ASP A 1  276 ? -9.561  57.676 73.189 1.00 23.64 ? 276  ASP A O   1 
ATOM   2143 C  CB  . ASP A 1  276 ? -12.310 59.009 72.576 1.00 22.16 ? 276  ASP A CB  1 
ATOM   2144 C  CG  . ASP A 1  276 ? -12.877 60.385 72.763 1.00 23.47 ? 276  ASP A CG  1 
ATOM   2145 O  OD1 . ASP A 1  276 ? -12.141 61.388 72.585 1.00 24.74 ? 276  ASP A OD1 1 
ATOM   2146 O  OD2 . ASP A 1  276 ? -14.078 60.451 73.089 1.00 28.97 ? 276  ASP A OD2 1 
ATOM   2147 N  N   . VAL A 1  277 ? -10.434 56.672 71.378 1.00 20.52 ? 277  VAL A N   1 
ATOM   2148 C  CA  . VAL A 1  277 ? -9.786  55.391 71.703 1.00 19.57 ? 277  VAL A CA  1 
ATOM   2149 C  C   . VAL A 1  277 ? -8.653  54.997 70.752 1.00 19.18 ? 277  VAL A C   1 
ATOM   2150 O  O   . VAL A 1  277 ? -8.046  53.934 70.922 1.00 19.32 ? 277  VAL A O   1 
ATOM   2151 C  CB  . VAL A 1  277 ? -10.784 54.217 71.763 1.00 18.98 ? 277  VAL A CB  1 
ATOM   2152 C  CG1 . VAL A 1  277 ? -11.847 54.501 72.793 1.00 19.89 ? 277  VAL A CG1 1 
ATOM   2153 C  CG2 . VAL A 1  277 ? -11.384 53.920 70.366 1.00 17.64 ? 277  VAL A CG2 1 
ATOM   2154 N  N   . GLU A 1  278 ? -8.393  55.858 69.764 1.00 18.60 ? 278  GLU A N   1 
ATOM   2155 C  CA  . GLU A 1  278 ? -7.434  55.624 68.682 1.00 18.08 ? 278  GLU A CA  1 
ATOM   2156 C  C   . GLU A 1  278 ? -6.054  55.202 69.182 1.00 18.00 ? 278  GLU A C   1 
ATOM   2157 O  O   . GLU A 1  278 ? -5.430  54.316 68.613 1.00 18.03 ? 278  GLU A O   1 
ATOM   2158 C  CB  . GLU A 1  278 ? -7.325  56.889 67.798 1.00 18.19 ? 278  GLU A CB  1 
ATOM   2159 C  CG  . GLU A 1  278 ? -6.102  56.934 66.885 1.00 18.70 ? 278  GLU A CG  1 
ATOM   2160 C  CD  . GLU A 1  278 ? -5.996  58.219 66.060 1.00 19.45 ? 278  GLU A CD  1 
ATOM   2161 O  OE1 . GLU A 1  278 ? -6.979  58.992 65.932 1.00 16.75 ? 278  GLU A OE1 1 
ATOM   2162 O  OE2 . GLU A 1  278 ? -4.900  58.440 65.526 1.00 19.57 ? 278  GLU A OE2 1 
ATOM   2163 N  N   . TRP A 1  279 ? -5.582  55.830 70.246 1.00 18.04 ? 279  TRP A N   1 
ATOM   2164 C  CA  . TRP A 1  279 ? -4.241  55.541 70.738 1.00 18.19 ? 279  TRP A CA  1 
ATOM   2165 C  C   . TRP A 1  279 ? -4.148  54.181 71.482 1.00 18.36 ? 279  TRP A C   1 
ATOM   2166 O  O   . TRP A 1  279 ? -3.056  53.667 71.687 1.00 19.11 ? 279  TRP A O   1 
ATOM   2167 C  CB  . TRP A 1  279 ? -3.716  56.709 71.575 1.00 17.93 ? 279  TRP A CB  1 
ATOM   2168 C  CG  . TRP A 1  279 ? -3.559  57.939 70.759 1.00 18.41 ? 279  TRP A CG  1 
ATOM   2169 C  CD1 . TRP A 1  279 ? -4.457  58.967 70.631 1.00 17.16 ? 279  TRP A CD1 1 
ATOM   2170 C  CD2 . TRP A 1  279 ? -2.441  58.270 69.917 1.00 18.93 ? 279  TRP A CD2 1 
ATOM   2171 N  NE1 . TRP A 1  279 ? -3.961  59.918 69.766 1.00 19.25 ? 279  TRP A NE1 1 
ATOM   2172 C  CE2 . TRP A 1  279 ? -2.728  59.513 69.314 1.00 20.49 ? 279  TRP A CE2 1 
ATOM   2173 C  CE3 . TRP A 1  279 ? -1.236  57.620 69.600 1.00 19.31 ? 279  TRP A CE3 1 
ATOM   2174 C  CZ2 . TRP A 1  279 ? -1.849  60.131 68.413 1.00 22.80 ? 279  TRP A CZ2 1 
ATOM   2175 C  CZ3 . TRP A 1  279 ? -0.348  58.242 68.717 1.00 21.94 ? 279  TRP A CZ3 1 
ATOM   2176 C  CH2 . TRP A 1  279 ? -0.663  59.486 68.134 1.00 21.72 ? 279  TRP A CH2 1 
ATOM   2177 N  N   . ASN A 1  280 ? -5.286  53.572 71.812 1.00 18.13 ? 280  ASN A N   1 
ATOM   2178 C  CA  . ASN A 1  280 ? -5.295  52.305 72.560 1.00 18.91 ? 280  ASN A CA  1 
ATOM   2179 C  C   . ASN A 1  280 ? -4.871  51.053 71.769 1.00 18.84 ? 280  ASN A C   1 
ATOM   2180 O  O   . ASN A 1  280 ? -4.676  49.970 72.352 1.00 19.30 ? 280  ASN A O   1 
ATOM   2181 C  CB  . ASN A 1  280 ? -6.661  52.081 73.235 1.00 19.20 ? 280  ASN A CB  1 
ATOM   2182 C  CG  . ASN A 1  280 ? -7.083  53.251 74.160 1.00 20.72 ? 280  ASN A CG  1 
ATOM   2183 O  OD1 . ASN A 1  280 ? -6.265  54.092 74.560 1.00 21.94 ? 280  ASN A OD1 1 
ATOM   2184 N  ND2 . ASN A 1  280 ? -8.368  53.297 74.496 1.00 19.04 ? 280  ASN A ND2 1 
ATOM   2185 N  N   . VAL A 1  281 ? -4.700  51.189 70.457 1.00 18.52 ? 281  VAL A N   1 
ATOM   2186 C  CA  . VAL A 1  281 ? -4.513  50.019 69.603 1.00 18.35 ? 281  VAL A CA  1 
ATOM   2187 C  C   . VAL A 1  281 ? -3.053  49.722 69.282 1.00 18.09 ? 281  VAL A C   1 
ATOM   2188 O  O   . VAL A 1  281 ? -2.742  48.693 68.693 1.00 18.26 ? 281  VAL A O   1 
ATOM   2189 C  CB  . VAL A 1  281 ? -5.396  50.107 68.291 1.00 19.77 ? 281  VAL A CB  1 
ATOM   2190 C  CG1 . VAL A 1  281 ? -6.860  50.364 68.653 1.00 17.66 ? 281  VAL A CG1 1 
ATOM   2191 C  CG2 . VAL A 1  281 ? -4.885  51.179 67.327 1.00 18.88 ? 281  VAL A CG2 1 
ATOM   2192 N  N   . LEU A 1  282 ? -2.156  50.603 69.701 1.00 17.39 ? 282  LEU A N   1 
ATOM   2193 C  CA  . LEU A 1  282 ? -0.738  50.429 69.447 1.00 18.19 ? 282  LEU A CA  1 
ATOM   2194 C  C   . LEU A 1  282 ? -0.265  49.168 70.162 1.00 18.80 ? 282  LEU A C   1 
ATOM   2195 O  O   . LEU A 1  282 ? -0.672  48.931 71.311 1.00 18.53 ? 282  LEU A O   1 
ATOM   2196 C  CB  . LEU A 1  282 ? 0.058   51.642 69.958 1.00 17.76 ? 282  LEU A CB  1 
ATOM   2197 C  CG  . LEU A 1  282 ? -0.068  52.916 69.127 1.00 16.35 ? 282  LEU A CG  1 
ATOM   2198 C  CD1 . LEU A 1  282 ? 0.785   54.007 69.767 1.00 15.44 ? 282  LEU A CD1 1 
ATOM   2199 C  CD2 . LEU A 1  282 ? 0.403   52.671 67.717 1.00 15.17 ? 282  LEU A CD2 1 
ATOM   2200 N  N   . PRO A 1  283 ? 0.576   48.358 69.495 1.00 19.10 ? 283  PRO A N   1 
ATOM   2201 C  CA  . PRO A 1  283 ? 0.956   47.065 70.071 1.00 19.47 ? 283  PRO A CA  1 
ATOM   2202 C  C   . PRO A 1  283 ? 1.923   47.224 71.239 1.00 20.41 ? 283  PRO A C   1 
ATOM   2203 O  O   . PRO A 1  283 ? 1.935   46.376 72.122 1.00 20.97 ? 283  PRO A O   1 
ATOM   2204 C  CB  . PRO A 1  283 ? 1.614   46.329 68.906 1.00 18.32 ? 283  PRO A CB  1 
ATOM   2205 C  CG  . PRO A 1  283 ? 2.082   47.397 68.004 1.00 19.07 ? 283  PRO A CG  1 
ATOM   2206 C  CD  . PRO A 1  283 ? 1.168   48.568 68.162 1.00 19.52 ? 283  PRO A CD  1 
ATOM   2207 N  N   . PHE A 1  284 ? 2.686   48.321 71.264 1.00 20.60 ? 284  PHE A N   1 
ATOM   2208 C  CA  . PHE A 1  284 ? 3.716   48.526 72.278 1.00 20.45 ? 284  PHE A CA  1 
ATOM   2209 C  C   . PHE A 1  284 ? 3.600   49.865 72.967 1.00 19.77 ? 284  PHE A C   1 
ATOM   2210 O  O   . PHE A 1  284 ? 2.930   50.780 72.479 1.00 19.49 ? 284  PHE A O   1 
ATOM   2211 C  CB  . PHE A 1  284 ? 5.111   48.444 71.654 1.00 20.58 ? 284  PHE A CB  1 
ATOM   2212 C  CG  . PHE A 1  284 ? 5.325   47.237 70.786 1.00 24.22 ? 284  PHE A CG  1 
ATOM   2213 C  CD1 . PHE A 1  284 ? 5.264   45.954 71.321 1.00 26.99 ? 284  PHE A CD1 1 
ATOM   2214 C  CD2 . PHE A 1  284 ? 5.601   47.387 69.431 1.00 27.11 ? 284  PHE A CD2 1 
ATOM   2215 C  CE1 . PHE A 1  284 ? 5.486   44.836 70.513 1.00 29.52 ? 284  PHE A CE1 1 
ATOM   2216 C  CE2 . PHE A 1  284 ? 5.831   46.282 68.602 1.00 27.19 ? 284  PHE A CE2 1 
ATOM   2217 C  CZ  . PHE A 1  284 ? 5.769   45.009 69.134 1.00 29.42 ? 284  PHE A CZ  1 
ATOM   2218 N  N   . ASP A 1  285 ? 4.290   49.969 74.106 1.00 19.02 ? 285  ASP A N   1 
ATOM   2219 C  CA  . ASP A 1  285 ? 4.530   51.238 74.766 1.00 17.95 ? 285  ASP A CA  1 
ATOM   2220 C  C   . ASP A 1  285 ? 5.605   51.914 73.930 1.00 17.41 ? 285  ASP A C   1 
ATOM   2221 O  O   . ASP A 1  285 ? 6.765   51.460 73.886 1.00 16.99 ? 285  ASP A O   1 
ATOM   2222 C  CB  . ASP A 1  285 ? 5.070   50.974 76.167 1.00 18.14 ? 285  ASP A CB  1 
ATOM   2223 C  CG  . ASP A 1  285 ? 5.053   52.208 77.056 1.00 18.96 ? 285  ASP A CG  1 
ATOM   2224 O  OD1 . ASP A 1  285 ? 4.540   53.289 76.641 1.00 16.47 ? 285  ASP A OD1 1 
ATOM   2225 O  OD2 . ASP A 1  285 ? 5.559   52.071 78.202 1.00 20.70 ? 285  ASP A OD2 1 
ATOM   2226 N  N   . SER A 1  286 ? 5.245   52.999 73.264 1.00 16.37 ? 286  SER A N   1 
ATOM   2227 C  CA  . SER A 1  286 ? 6.121   53.518 72.233 1.00 16.17 ? 286  SER A CA  1 
ATOM   2228 C  C   . SER A 1  286 ? 6.053   55.010 72.071 1.00 15.58 ? 286  SER A C   1 
ATOM   2229 O  O   . SER A 1  286 ? 5.066   55.645 72.446 1.00 16.83 ? 286  SER A O   1 
ATOM   2230 C  CB  . SER A 1  286 ? 5.778   52.839 70.890 1.00 15.29 ? 286  SER A CB  1 
ATOM   2231 O  OG  . SER A 1  286 ? 4.447   53.165 70.505 1.00 17.39 ? 286  SER A OG  1 
ATOM   2232 N  N   . ILE A 1  287 ? 7.104   55.577 71.505 1.00 14.51 ? 287  ILE A N   1 
ATOM   2233 C  CA  . ILE A 1  287 ? 6.976   56.899 70.963 1.00 14.69 ? 287  ILE A CA  1 
ATOM   2234 C  C   . ILE A 1  287 ? 7.232   56.823 69.466 1.00 14.13 ? 287  ILE A C   1 
ATOM   2235 O  O   . ILE A 1  287 ? 7.877   55.891 69.000 1.00 15.12 ? 287  ILE A O   1 
ATOM   2236 C  CB  . ILE A 1  287 ? 7.926   57.916 71.647 1.00 15.14 ? 287  ILE A CB  1 
ATOM   2237 C  CG1 . ILE A 1  287 ? 9.391   57.455 71.531 1.00 13.21 ? 287  ILE A CG1 1 
ATOM   2238 C  CG2 . ILE A 1  287 ? 7.451   58.216 73.086 1.00 14.26 ? 287  ILE A CG2 1 
ATOM   2239 C  CD1 . ILE A 1  287 ? 10.362  58.517 71.932 1.00 14.86 ? 287  ILE A CD1 1 
ATOM   2240 N  N   . PHE A 1  288 ? 6.763   57.818 68.734 1.00 13.35 ? 288  PHE A N   1 
ATOM   2241 C  CA  . PHE A 1  288 ? 6.931   57.877 67.271 1.00 13.71 ? 288  PHE A CA  1 
ATOM   2242 C  C   . PHE A 1  288 ? 6.268   56.677 66.584 1.00 13.41 ? 288  PHE A C   1 
ATOM   2243 O  O   . PHE A 1  288 ? 6.809   56.147 65.615 1.00 13.61 ? 288  PHE A O   1 
ATOM   2244 C  CB  . PHE A 1  288 ? 8.412   57.969 66.855 1.00 13.17 ? 288  PHE A CB  1 
ATOM   2245 C  CG  . PHE A 1  288 ? 8.668   58.970 65.751 1.00 14.47 ? 288  PHE A CG  1 
ATOM   2246 C  CD1 . PHE A 1  288 ? 7.884   58.968 64.582 1.00 13.04 ? 288  PHE A CD1 1 
ATOM   2247 C  CD2 . PHE A 1  288 ? 9.700   59.912 65.880 1.00 10.40 ? 288  PHE A CD2 1 
ATOM   2248 C  CE1 . PHE A 1  288 ? 8.098   59.893 63.574 1.00 13.97 ? 288  PHE A CE1 1 
ATOM   2249 C  CE2 . PHE A 1  288 ? 9.937   60.816 64.870 1.00 11.37 ? 288  PHE A CE2 1 
ATOM   2250 C  CZ  . PHE A 1  288 ? 9.124   60.818 63.707 1.00 12.41 ? 288  PHE A CZ  1 
ATOM   2251 N  N   . ARG A 1  289 ? 5.131   56.231 67.124 1.00 13.40 ? 289  ARG A N   1 
ATOM   2252 C  CA  . ARG A 1  289 ? 4.294   55.216 66.485 1.00 13.29 ? 289  ARG A CA  1 
ATOM   2253 C  C   . ARG A 1  289 ? 2.880   55.725 66.514 1.00 14.21 ? 289  ARG A C   1 
ATOM   2254 O  O   . ARG A 1  289 ? 2.423   56.263 67.519 1.00 13.99 ? 289  ARG A O   1 
ATOM   2255 C  CB  . ARG A 1  289 ? 4.388   53.847 67.173 1.00 12.84 ? 289  ARG A CB  1 
ATOM   2256 C  CG  . ARG A 1  289 ? 5.754   53.212 67.065 1.00 11.70 ? 289  ARG A CG  1 
ATOM   2257 C  CD  . ARG A 1  289 ? 6.192   52.917 65.620 1.00 11.26 ? 289  ARG A CD  1 
ATOM   2258 N  NE  . ARG A 1  289 ? 7.480   52.200 65.599 1.00 12.09 ? 289  ARG A NE  1 
ATOM   2259 C  CZ  . ARG A 1  289 ? 8.676   52.787 65.549 1.00 9.91  ? 289  ARG A CZ  1 
ATOM   2260 N  NH1 . ARG A 1  289 ? 8.760   54.100 65.489 1.00 12.01 ? 289  ARG A NH1 1 
ATOM   2261 N  NH2 . ARG A 1  289 ? 9.792   52.068 65.510 1.00 9.52  ? 289  ARG A NH2 1 
ATOM   2262 N  N   . PHE A 1  290 ? 2.214   55.564 65.373 1.00 14.42 ? 290  PHE A N   1 
ATOM   2263 C  CA  . PHE A 1  290 ? 0.880   56.067 65.145 1.00 14.39 ? 290  PHE A CA  1 
ATOM   2264 C  C   . PHE A 1  290 ? -0.049  54.891 64.772 1.00 14.52 ? 290  PHE A C   1 
ATOM   2265 O  O   . PHE A 1  290 ? 0.380   53.879 64.185 1.00 14.34 ? 290  PHE A O   1 
ATOM   2266 C  CB  . PHE A 1  290 ? 0.940   57.204 64.105 1.00 14.55 ? 290  PHE A CB  1 
ATOM   2267 C  CG  . PHE A 1  290 ? 2.118   58.127 64.312 1.00 14.88 ? 290  PHE A CG  1 
ATOM   2268 C  CD1 . PHE A 1  290 ? 2.251   58.859 65.491 1.00 14.95 ? 290  PHE A CD1 1 
ATOM   2269 C  CD2 . PHE A 1  290 ? 3.132   58.204 63.371 1.00 13.83 ? 290  PHE A CD2 1 
ATOM   2270 C  CE1 . PHE A 1  290 ? 3.389   59.683 65.704 1.00 15.65 ? 290  PHE A CE1 1 
ATOM   2271 C  CE2 . PHE A 1  290 ? 4.246   59.026 63.563 1.00 13.12 ? 290  PHE A CE2 1 
ATOM   2272 C  CZ  . PHE A 1  290 ? 4.381   59.763 64.731 1.00 13.65 ? 290  PHE A CZ  1 
ATOM   2273 N  N   . SER A 1  291 ? -1.302  54.992 65.171 1.00 14.06 ? 291  SER A N   1 
ATOM   2274 C  CA  . SER A 1  291 ? -2.167  53.818 65.130 1.00 14.62 ? 291  SER A CA  1 
ATOM   2275 C  C   . SER A 1  291 ? -2.589  53.461 63.699 1.00 15.10 ? 291  SER A C   1 
ATOM   2276 O  O   . SER A 1  291 ? -2.455  52.314 63.293 1.00 14.48 ? 291  SER A O   1 
ATOM   2277 C  CB  . SER A 1  291 ? -3.424  54.048 65.980 1.00 14.76 ? 291  SER A CB  1 
ATOM   2278 O  OG  . SER A 1  291 ? -3.085  54.059 67.353 1.00 16.28 ? 291  SER A OG  1 
ATOM   2279 N  N   . PHE A 1  292 ? -3.109  54.442 62.945 1.00 14.54 ? 292  PHE A N   1 
ATOM   2280 C  CA  . PHE A 1  292 ? -3.656  54.126 61.622 1.00 14.56 ? 292  PHE A CA  1 
ATOM   2281 C  C   . PHE A 1  292 ? -2.824  54.709 60.507 1.00 13.68 ? 292  PHE A C   1 
ATOM   2282 O  O   . PHE A 1  292 ? -2.800  55.918 60.283 1.00 12.73 ? 292  PHE A O   1 
ATOM   2283 C  CB  . PHE A 1  292 ? -5.159  54.472 61.515 1.00 14.80 ? 292  PHE A CB  1 
ATOM   2284 C  CG  . PHE A 1  292 ? -5.974  53.752 62.533 1.00 16.29 ? 292  PHE A CG  1 
ATOM   2285 C  CD1 . PHE A 1  292 ? -6.346  52.410 62.324 1.00 18.96 ? 292  PHE A CD1 1 
ATOM   2286 C  CD2 . PHE A 1  292 ? -6.317  54.371 63.736 1.00 14.72 ? 292  PHE A CD2 1 
ATOM   2287 C  CE1 . PHE A 1  292 ? -7.089  51.700 63.306 1.00 16.88 ? 292  PHE A CE1 1 
ATOM   2288 C  CE2 . PHE A 1  292 ? -7.017  53.682 64.713 1.00 13.87 ? 292  PHE A CE2 1 
ATOM   2289 C  CZ  . PHE A 1  292 ? -7.403  52.347 64.505 1.00 16.88 ? 292  PHE A CZ  1 
ATOM   2290 N  N   . VAL A 1  293 ? -2.096  53.828 59.835 1.00 13.73 ? 293  VAL A N   1 
ATOM   2291 C  CA  . VAL A 1  293 ? -1.116  54.277 58.872 1.00 14.36 ? 293  VAL A CA  1 
ATOM   2292 C  C   . VAL A 1  293 ? -1.267  53.493 57.560 1.00 14.87 ? 293  VAL A C   1 
ATOM   2293 O  O   . VAL A 1  293 ? -2.057  52.560 57.512 1.00 15.62 ? 293  VAL A O   1 
ATOM   2294 C  CB  . VAL A 1  293 ? 0.293   54.155 59.468 1.00 13.86 ? 293  VAL A CB  1 
ATOM   2295 C  CG1 . VAL A 1  293 ? 0.443   55.114 60.673 1.00 14.73 ? 293  VAL A CG1 1 
ATOM   2296 C  CG2 . VAL A 1  293 ? 0.630   52.703 59.831 1.00 12.69 ? 293  VAL A CG2 1 
ATOM   2297 N  N   . PRO A 1  294 ? -0.539  53.874 56.499 1.00 15.59 ? 294  PRO A N   1 
ATOM   2298 C  CA  . PRO A 1  294 ? -0.562  53.054 55.289 1.00 16.50 ? 294  PRO A CA  1 
ATOM   2299 C  C   . PRO A 1  294 ? -0.271  51.552 55.522 1.00 17.35 ? 294  PRO A C   1 
ATOM   2300 O  O   . PRO A 1  294 ? 0.460   51.199 56.431 1.00 17.54 ? 294  PRO A O   1 
ATOM   2301 C  CB  . PRO A 1  294 ? 0.515   53.708 54.416 1.00 15.18 ? 294  PRO A CB  1 
ATOM   2302 C  CG  . PRO A 1  294 ? 0.359   55.149 54.721 1.00 16.39 ? 294  PRO A CG  1 
ATOM   2303 C  CD  . PRO A 1  294 ? 0.078   55.190 56.232 1.00 16.40 ? 294  PRO A CD  1 
ATOM   2304 N  N   . VAL A 1  295 ? -0.869  50.695 54.702 1.00 18.23 ? 295  VAL A N   1 
ATOM   2305 C  CA  . VAL A 1  295 ? -0.748  49.255 54.857 1.00 19.60 ? 295  VAL A CA  1 
ATOM   2306 C  C   . VAL A 1  295 ? -0.176  48.667 53.582 1.00 20.50 ? 295  VAL A C   1 
ATOM   2307 O  O   . VAL A 1  295 ? -0.628  48.995 52.480 1.00 20.57 ? 295  VAL A O   1 
ATOM   2308 C  CB  . VAL A 1  295 ? -2.091  48.603 55.250 1.00 19.69 ? 295  VAL A CB  1 
ATOM   2309 C  CG1 . VAL A 1  295 ? -3.177  48.771 54.147 1.00 20.48 ? 295  VAL A CG1 1 
ATOM   2310 C  CG2 . VAL A 1  295 ? -1.891  47.177 55.569 1.00 21.50 ? 295  VAL A CG2 1 
ATOM   2311 N  N   . ILE A 1  296 ? 0.874   47.861 53.743 1.00 20.86 ? 296  ILE A N   1 
ATOM   2312 C  CA  . ILE A 1  296 ? 1.502   47.166 52.642 1.00 21.33 ? 296  ILE A CA  1 
ATOM   2313 C  C   . ILE A 1  296 ? 0.527   46.098 52.102 1.00 22.14 ? 296  ILE A C   1 
ATOM   2314 O  O   . ILE A 1  296 ? 0.479   44.965 52.606 1.00 21.78 ? 296  ILE A O   1 
ATOM   2315 C  CB  . ILE A 1  296 ? 2.848   46.550 53.092 1.00 21.54 ? 296  ILE A CB  1 
ATOM   2316 C  CG1 . ILE A 1  296 ? 3.717   47.626 53.781 1.00 20.56 ? 296  ILE A CG1 1 
ATOM   2317 C  CG2 . ILE A 1  296 ? 3.572   45.879 51.903 1.00 21.37 ? 296  ILE A CG2 1 
ATOM   2318 C  CD1 . ILE A 1  296 ? 3.855   48.964 52.963 1.00 18.58 ? 296  ILE A CD1 1 
ATOM   2319 N  N   . ASP A 1  297 ? -0.247  46.475 51.077 1.00 22.32 ? 297  ASP A N   1 
ATOM   2320 C  CA  . ASP A 1  297 ? -1.465  45.741 50.749 1.00 23.75 ? 297  ASP A CA  1 
ATOM   2321 C  C   . ASP A 1  297 ? -1.373  44.845 49.504 1.00 24.05 ? 297  ASP A C   1 
ATOM   2322 O  O   . ASP A 1  297 ? -2.236  43.993 49.297 1.00 24.62 ? 297  ASP A O   1 
ATOM   2323 C  CB  . ASP A 1  297 ? -2.647  46.701 50.604 1.00 23.53 ? 297  ASP A CB  1 
ATOM   2324 C  CG  . ASP A 1  297 ? -2.432  47.712 49.504 1.00 23.83 ? 297  ASP A CG  1 
ATOM   2325 O  OD1 . ASP A 1  297 ? -1.274  47.839 49.029 1.00 21.49 ? 297  ASP A OD1 1 
ATOM   2326 O  OD2 . ASP A 1  297 ? -3.424  48.375 49.124 1.00 26.12 ? 297  ASP A OD2 1 
ATOM   2327 N  N   . GLY A 1  298 ? -0.349  45.051 48.683 1.00 23.90 ? 298  GLY A N   1 
ATOM   2328 C  CA  . GLY A 1  298 ? -0.271  44.348 47.402 1.00 24.32 ? 298  GLY A CA  1 
ATOM   2329 C  C   . GLY A 1  298 ? -1.062  45.020 46.291 1.00 23.95 ? 298  GLY A C   1 
ATOM   2330 O  O   . GLY A 1  298 ? -1.123  44.510 45.194 1.00 24.58 ? 298  GLY A O   1 
ATOM   2331 N  N   . GLU A 1  299 ? -1.675  46.164 46.580 1.00 23.28 ? 299  GLU A N   1 
ATOM   2332 C  CA  . GLU A 1  299 ? -2.423  46.922 45.582 1.00 22.33 ? 299  GLU A CA  1 
ATOM   2333 C  C   . GLU A 1  299 ? -1.793  48.299 45.375 1.00 21.50 ? 299  GLU A C   1 
ATOM   2334 O  O   . GLU A 1  299 ? -1.158  48.527 44.345 1.00 21.02 ? 299  GLU A O   1 
ATOM   2335 C  CB  . GLU A 1  299 ? -3.900  46.996 45.959 1.00 22.80 ? 299  GLU A CB  1 
ATOM   2336 C  CG  . GLU A 1  299 ? -4.599  45.645 45.744 0.50 24.76 ? 299  GLU A CG  1 
ATOM   2337 C  CD  . GLU A 1  299 ? -5.465  45.221 46.908 0.50 26.50 ? 299  GLU A CD  1 
ATOM   2338 O  OE1 . GLU A 1  299 ? -6.267  46.053 47.397 0.50 28.32 ? 299  GLU A OE1 1 
ATOM   2339 O  OE2 . GLU A 1  299 ? -5.358  44.042 47.323 0.50 26.29 ? 299  GLU A OE2 1 
ATOM   2340 N  N   . PHE A 1  300 ? -1.943  49.197 46.354 1.00 20.12 ? 300  PHE A N   1 
ATOM   2341 C  CA  . PHE A 1  300 ? -1.232  50.452 46.346 1.00 18.85 ? 300  PHE A CA  1 
ATOM   2342 C  C   . PHE A 1  300 ? 0.303   50.197 46.296 1.00 19.24 ? 300  PHE A C   1 
ATOM   2343 O  O   . PHE A 1  300 ? 0.990   50.750 45.445 1.00 18.94 ? 300  PHE A O   1 
ATOM   2344 C  CB  . PHE A 1  300 ? -1.652  51.319 47.545 1.00 18.27 ? 300  PHE A CB  1 
ATOM   2345 C  CG  . PHE A 1  300 ? -1.243  52.775 47.421 1.00 17.30 ? 300  PHE A CG  1 
ATOM   2346 C  CD1 . PHE A 1  300 ? 0.085   53.180 47.671 1.00 16.32 ? 300  PHE A CD1 1 
ATOM   2347 C  CD2 . PHE A 1  300 ? -2.170  53.736 47.025 1.00 15.49 ? 300  PHE A CD2 1 
ATOM   2348 C  CE1 . PHE A 1  300 ? 0.466   54.506 47.535 1.00 14.68 ? 300  PHE A CE1 1 
ATOM   2349 C  CE2 . PHE A 1  300 ? -1.814  55.091 46.910 1.00 13.06 ? 300  PHE A CE2 1 
ATOM   2350 C  CZ  . PHE A 1  300 ? -0.489  55.475 47.149 1.00 15.75 ? 300  PHE A CZ  1 
ATOM   2351 N  N   . PHE A 1  301 ? 0.821   49.342 47.180 1.00 19.01 ? 301  PHE A N   1 
ATOM   2352 C  CA  . PHE A 1  301 ? 2.226   48.902 47.107 1.00 19.05 ? 301  PHE A CA  1 
ATOM   2353 C  C   . PHE A 1  301 ? 2.154   47.449 46.649 1.00 20.09 ? 301  PHE A C   1 
ATOM   2354 O  O   . PHE A 1  301 ? 1.536   46.628 47.352 1.00 20.64 ? 301  PHE A O   1 
ATOM   2355 C  CB  . PHE A 1  301 ? 2.901   48.985 48.490 1.00 18.95 ? 301  PHE A CB  1 
ATOM   2356 C  CG  . PHE A 1  301 ? 2.650   50.284 49.203 1.00 17.56 ? 301  PHE A CG  1 
ATOM   2357 C  CD1 . PHE A 1  301 ? 3.417   51.410 48.912 1.00 15.89 ? 301  PHE A CD1 1 
ATOM   2358 C  CD2 . PHE A 1  301 ? 1.614   50.410 50.097 1.00 15.92 ? 301  PHE A CD2 1 
ATOM   2359 C  CE1 . PHE A 1  301 ? 3.188   52.619 49.549 1.00 14.00 ? 301  PHE A CE1 1 
ATOM   2360 C  CE2 . PHE A 1  301 ? 1.373   51.657 50.745 1.00 17.65 ? 301  PHE A CE2 1 
ATOM   2361 C  CZ  . PHE A 1  301 ? 2.162   52.746 50.453 1.00 14.45 ? 301  PHE A CZ  1 
ATOM   2362 N  N   . PRO A 1  302 ? 2.726   47.126 45.458 1.00 19.96 ? 302  PRO A N   1 
ATOM   2363 C  CA  . PRO A 1  302 ? 2.534   45.777 44.904 1.00 20.39 ? 302  PRO A CA  1 
ATOM   2364 C  C   . PRO A 1  302 ? 3.282   44.717 45.708 1.00 20.67 ? 302  PRO A C   1 
ATOM   2365 O  O   . PRO A 1  302 ? 2.747   43.632 45.907 1.00 20.69 ? 302  PRO A O   1 
ATOM   2366 C  CB  . PRO A 1  302 ? 3.107   45.886 43.480 1.00 20.57 ? 302  PRO A CB  1 
ATOM   2367 C  CG  . PRO A 1  302 ? 3.248   47.379 43.226 1.00 19.93 ? 302  PRO A CG  1 
ATOM   2368 C  CD  . PRO A 1  302 ? 3.428   48.018 44.519 1.00 19.87 ? 302  PRO A CD  1 
ATOM   2369 N  N   . THR A 1  303 ? 4.507   45.034 46.147 1.00 20.47 ? 303  THR A N   1 
ATOM   2370 C  CA  . THR A 1  303 ? 5.296   44.146 47.011 1.00 20.31 ? 303  THR A CA  1 
ATOM   2371 C  C   . THR A 1  303 ? 5.869   44.985 48.181 1.00 19.93 ? 303  THR A C   1 
ATOM   2372 O  O   . THR A 1  303 ? 5.621   46.208 48.260 1.00 19.99 ? 303  THR A O   1 
ATOM   2373 C  CB  . THR A 1  303 ? 6.448   43.474 46.227 1.00 20.73 ? 303  THR A CB  1 
ATOM   2374 O  OG1 . THR A 1  303 ? 7.459   44.438 45.936 1.00 20.64 ? 303  THR A OG1 1 
ATOM   2375 C  CG2 . THR A 1  303 ? 5.961   42.878 44.901 1.00 22.50 ? 303  THR A CG2 1 
ATOM   2376 N  N   . SER A 1  304 ? 6.623   44.353 49.075 1.00 18.41 ? 304  SER A N   1 
ATOM   2377 C  CA  . SER A 1  304 ? 7.224   45.074 50.205 1.00 18.45 ? 304  SER A CA  1 
ATOM   2378 C  C   . SER A 1  304 ? 7.959   46.304 49.719 1.00 17.90 ? 304  SER A C   1 
ATOM   2379 O  O   . SER A 1  304 ? 8.423   46.332 48.575 1.00 17.58 ? 304  SER A O   1 
ATOM   2380 C  CB  . SER A 1  304 ? 8.199   44.192 50.975 1.00 17.62 ? 304  SER A CB  1 
ATOM   2381 O  OG  . SER A 1  304 ? 9.338   43.995 50.175 1.00 17.03 ? 304  SER A OG  1 
ATOM   2382 N  N   . LEU A 1  305 ? 8.057   47.317 50.580 1.00 18.22 ? 305  LEU A N   1 
ATOM   2383 C  CA  . LEU A 1  305 ? 8.757   48.560 50.191 1.00 18.68 ? 305  LEU A CA  1 
ATOM   2384 C  C   . LEU A 1  305 ? 10.222  48.263 49.858 1.00 18.86 ? 305  LEU A C   1 
ATOM   2385 O  O   . LEU A 1  305 ? 10.762  48.805 48.881 1.00 19.35 ? 305  LEU A O   1 
ATOM   2386 C  CB  . LEU A 1  305 ? 8.630   49.670 51.237 1.00 18.04 ? 305  LEU A CB  1 
ATOM   2387 C  CG  . LEU A 1  305 ? 7.212   50.041 51.688 1.00 18.89 ? 305  LEU A CG  1 
ATOM   2388 C  CD1 . LEU A 1  305 ? 7.241   51.099 52.757 1.00 16.95 ? 305  LEU A CD1 1 
ATOM   2389 C  CD2 . LEU A 1  305 ? 6.341   50.486 50.544 1.00 16.42 ? 305  LEU A CD2 1 
ATOM   2390 N  N   . GLU A 1  306 ? 10.848  47.378 50.636 1.00 18.64 ? 306  GLU A N   1 
ATOM   2391 C  CA  . GLU A 1  306 ? 12.273  47.034 50.419 1.00 18.11 ? 306  GLU A CA  1 
ATOM   2392 C  C   . GLU A 1  306 ? 12.543  46.302 49.092 1.00 17.24 ? 306  GLU A C   1 
ATOM   2393 O  O   . GLU A 1  306 ? 13.500  46.632 48.388 1.00 16.81 ? 306  GLU A O   1 
ATOM   2394 C  CB  . GLU A 1  306 ? 12.855  46.250 51.612 1.00 17.99 ? 306  GLU A CB  1 
ATOM   2395 C  CG  . GLU A 1  306 ? 14.375  45.965 51.520 1.00 19.48 ? 306  GLU A CG  1 
ATOM   2396 C  CD  . GLU A 1  306 ? 15.215  47.240 51.612 1.00 23.35 ? 306  GLU A CD  1 
ATOM   2397 O  OE1 . GLU A 1  306 ? 14.652  48.308 51.948 1.00 23.14 ? 306  GLU A OE1 1 
ATOM   2398 O  OE2 . GLU A 1  306 ? 16.434  47.183 51.348 1.00 21.59 ? 306  GLU A OE2 1 
ATOM   2399 N  N   . SER A 1  307 ? 11.740  45.302 48.738 1.00 16.88 ? 307  SER A N   1 
ATOM   2400 C  CA  . SER A 1  307 ? 11.967  44.685 47.421 1.00 17.10 ? 307  SER A CA  1 
ATOM   2401 C  C   . SER A 1  307 ? 11.735  45.692 46.284 1.00 17.10 ? 307  SER A C   1 
ATOM   2402 O  O   . SER A 1  307 ? 12.400  45.601 45.244 1.00 17.84 ? 307  SER A O   1 
ATOM   2403 C  CB  . SER A 1  307 ? 11.129  43.423 47.196 1.00 16.46 ? 307  SER A CB  1 
ATOM   2404 O  OG  . SER A 1  307 ? 9.778   43.695 47.425 1.00 17.99 ? 307  SER A OG  1 
ATOM   2405 N  N   . MET A 1  308 ? 10.806  46.633 46.476 1.00 17.04 ? 308  MET A N   1 
ATOM   2406 C  CA  . MET A 1  308 ? 10.509  47.646 45.459 1.00 17.30 ? 308  MET A CA  1 
ATOM   2407 C  C   . MET A 1  308 ? 11.694  48.555 45.290 1.00 18.09 ? 308  MET A C   1 
ATOM   2408 O  O   . MET A 1  308 ? 12.056  48.872 44.167 1.00 18.51 ? 308  MET A O   1 
ATOM   2409 C  CB  . MET A 1  308 ? 9.255   48.477 45.808 1.00 17.36 ? 308  MET A CB  1 
ATOM   2410 C  CG  . MET A 1  308 ? 7.943   47.754 45.647 1.00 15.01 ? 308  MET A CG  1 
ATOM   2411 S  SD  . MET A 1  308 ? 6.448   48.720 45.972 1.00 18.61 ? 308  MET A SD  1 
ATOM   2412 C  CE  . MET A 1  308 ? 6.347   49.772 44.494 1.00 18.79 ? 308  MET A CE  1 
ATOM   2413 N  N   . LEU A 1  309 ? 12.320  48.954 46.397 1.00 18.61 ? 309  LEU A N   1 
ATOM   2414 C  CA  . LEU A 1  309 ? 13.469  49.870 46.339 1.00 19.61 ? 309  LEU A CA  1 
ATOM   2415 C  C   . LEU A 1  309 ? 14.706  49.188 45.734 1.00 20.33 ? 309  LEU A C   1 
ATOM   2416 O  O   . LEU A 1  309 ? 15.516  49.829 45.044 1.00 19.99 ? 309  LEU A O   1 
ATOM   2417 C  CB  . LEU A 1  309 ? 13.819  50.440 47.728 1.00 19.28 ? 309  LEU A CB  1 
ATOM   2418 C  CG  . LEU A 1  309 ? 12.980  51.557 48.348 1.00 19.26 ? 309  LEU A CG  1 
ATOM   2419 C  CD1 . LEU A 1  309 ? 13.464  51.826 49.799 1.00 19.01 ? 309  LEU A CD1 1 
ATOM   2420 C  CD2 . LEU A 1  309 ? 12.982  52.840 47.525 1.00 13.95 ? 309  LEU A CD2 1 
ATOM   2421 N  N   . ASN A 1  310 ? 14.803  47.885 45.987 1.00 20.59 ? 310  ASN A N   1 
ATOM   2422 C  CA  A ASN A 1  310 ? 15.930  47.088 45.538 0.70 21.90 ? 310  ASN A CA  1 
ATOM   2423 C  CA  B ASN A 1  310 ? 15.923  47.039 45.541 0.30 20.85 ? 310  ASN A CA  1 
ATOM   2424 C  C   . ASN A 1  310 ? 15.871  46.743 44.053 1.00 21.58 ? 310  ASN A C   1 
ATOM   2425 O  O   . ASN A 1  310 ? 16.909  46.670 43.386 1.00 21.47 ? 310  ASN A O   1 
ATOM   2426 C  CB  A ASN A 1  310 ? 15.980  45.798 46.346 0.70 22.49 ? 310  ASN A CB  1 
ATOM   2427 C  CB  B ASN A 1  310 ? 15.908  45.684 46.264 0.30 20.53 ? 310  ASN A CB  1 
ATOM   2428 C  CG  A ASN A 1  310 ? 17.362  45.327 46.556 0.70 25.05 ? 310  ASN A CG  1 
ATOM   2429 C  CG  B ASN A 1  310 ? 16.414  45.761 47.682 0.30 19.09 ? 310  ASN A CG  1 
ATOM   2430 O  OD1 A ASN A 1  310 ? 18.167  46.020 47.177 0.70 27.54 ? 310  ASN A OD1 1 
ATOM   2431 O  OD1 B ASN A 1  310 ? 16.767  46.829 48.174 0.30 17.50 ? 310  ASN A OD1 1 
ATOM   2432 N  ND2 A ASN A 1  310 ? 17.673  44.137 46.040 0.70 27.87 ? 310  ASN A ND2 1 
ATOM   2433 N  ND2 B ASN A 1  310 ? 16.454  44.613 48.350 0.30 16.74 ? 310  ASN A ND2 1 
ATOM   2434 N  N   . SER A 1  311 ? 14.654  46.521 43.554 1.00 21.84 ? 311  SER A N   1 
ATOM   2435 C  CA  . SER A 1  311 ? 14.431  46.163 42.169 1.00 22.42 ? 311  SER A CA  1 
ATOM   2436 C  C   . SER A 1  311 ? 14.291  47.372 41.244 1.00 22.46 ? 311  SER A C   1 
ATOM   2437 O  O   . SER A 1  311 ? 14.280  47.207 40.026 1.00 23.79 ? 311  SER A O   1 
ATOM   2438 C  CB  . SER A 1  311 ? 13.198  45.281 42.042 1.00 22.73 ? 311  SER A CB  1 
ATOM   2439 O  OG  . SER A 1  311 ? 12.032  45.992 42.407 1.00 25.73 ? 311  SER A OG  1 
ATOM   2440 N  N   . GLY A 1  312 ? 14.190  48.574 41.806 1.00 21.93 ? 312  GLY A N   1 
ATOM   2441 C  CA  . GLY A 1  312 ? 13.963  49.795 41.025 1.00 19.84 ? 312  GLY A CA  1 
ATOM   2442 C  C   . GLY A 1  312 ? 12.508  49.912 40.615 1.00 19.39 ? 312  GLY A C   1 
ATOM   2443 O  O   . GLY A 1  312 ? 12.170  50.554 39.619 1.00 19.04 ? 312  GLY A O   1 
ATOM   2444 N  N   . ASN A 1  313 ? 11.632  49.289 41.381 1.00 18.11 ? 313  ASN A N   1 
ATOM   2445 C  CA  . ASN A 1  313 ? 10.243  49.317 41.039 1.00 17.86 ? 313  ASN A CA  1 
ATOM   2446 C  C   . ASN A 1  313 ? 9.639   50.577 41.629 1.00 18.19 ? 313  ASN A C   1 
ATOM   2447 O  O   . ASN A 1  313 ? 8.902   50.510 42.648 1.00 17.67 ? 313  ASN A O   1 
ATOM   2448 C  CB  . ASN A 1  313 ? 9.518   48.064 41.532 1.00 17.54 ? 313  ASN A CB  1 
ATOM   2449 C  CG  . ASN A 1  313 ? 8.083   48.003 41.049 1.00 19.48 ? 313  ASN A CG  1 
ATOM   2450 O  OD1 . ASN A 1  313 ? 7.672   48.810 40.221 1.00 21.76 ? 313  ASN A OD1 1 
ATOM   2451 N  ND2 . ASN A 1  313 ? 7.315   47.043 41.549 1.00 18.97 ? 313  ASN A ND2 1 
ATOM   2452 N  N   . PHE A 1  314 ? 9.954   51.710 40.977 1.00 17.62 ? 314  PHE A N   1 
ATOM   2453 C  CA  . PHE A 1  314 ? 9.445   53.022 41.354 1.00 17.10 ? 314  PHE A CA  1 
ATOM   2454 C  C   . PHE A 1  314 ? 9.680   54.081 40.270 1.00 16.80 ? 314  PHE A C   1 
ATOM   2455 O  O   . PHE A 1  314 ? 10.453  53.879 39.351 1.00 15.06 ? 314  PHE A O   1 
ATOM   2456 C  CB  . PHE A 1  314 ? 10.085  53.471 42.677 1.00 16.92 ? 314  PHE A CB  1 
ATOM   2457 C  CG  . PHE A 1  314 ? 11.611  53.394 42.699 1.00 16.49 ? 314  PHE A CG  1 
ATOM   2458 C  CD1 . PHE A 1  314 ? 12.389  54.378 42.093 1.00 15.15 ? 314  PHE A CD1 1 
ATOM   2459 C  CD2 . PHE A 1  314 ? 12.269  52.343 43.363 1.00 15.20 ? 314  PHE A CD2 1 
ATOM   2460 C  CE1 . PHE A 1  314 ? 13.786  54.308 42.132 1.00 11.89 ? 314  PHE A CE1 1 
ATOM   2461 C  CE2 . PHE A 1  314 ? 13.657  52.291 43.423 1.00 11.73 ? 314  PHE A CE2 1 
ATOM   2462 C  CZ  . PHE A 1  314 ? 14.407  53.273 42.794 1.00 12.20 ? 314  PHE A CZ  1 
ATOM   2463 N  N   . LYS A 1  315 ? 9.018   55.230 40.410 1.00 17.05 ? 315  LYS A N   1 
ATOM   2464 C  CA  . LYS A 1  315 ? 9.170   56.311 39.440 1.00 16.78 ? 315  LYS A CA  1 
ATOM   2465 C  C   . LYS A 1  315 ? 10.602  56.812 39.439 1.00 17.40 ? 315  LYS A C   1 
ATOM   2466 O  O   . LYS A 1  315 ? 11.154  57.128 40.498 1.00 16.85 ? 315  LYS A O   1 
ATOM   2467 C  CB  . LYS A 1  315 ? 8.211   57.458 39.768 1.00 16.68 ? 315  LYS A CB  1 
ATOM   2468 C  CG  . LYS A 1  315 ? 8.146   58.565 38.742 1.00 14.56 ? 315  LYS A CG  1 
ATOM   2469 C  CD  . LYS A 1  315 ? 7.332   59.758 39.275 1.00 13.47 ? 315  LYS A CD  1 
ATOM   2470 C  CE  . LYS A 1  315 ? 7.435   60.940 38.332 1.00 13.54 ? 315  LYS A CE  1 
ATOM   2471 N  NZ  . LYS A 1  315 ? 6.632   60.693 37.118 1.00 10.97 ? 315  LYS A NZ  1 
ATOM   2472 N  N   . LYS A 1  316 ? 11.188  56.912 38.249 1.00 17.56 ? 316  LYS A N   1 
ATOM   2473 C  CA  . LYS A 1  316 ? 12.553  57.380 38.106 1.00 18.73 ? 316  LYS A CA  1 
ATOM   2474 C  C   . LYS A 1  316 ? 12.554  58.808 37.622 1.00 18.64 ? 316  LYS A C   1 
ATOM   2475 O  O   . LYS A 1  316 ? 12.148  59.081 36.512 1.00 19.53 ? 316  LYS A O   1 
ATOM   2476 C  CB  . LYS A 1  316 ? 13.308  56.461 37.154 1.00 18.90 ? 316  LYS A CB  1 
ATOM   2477 C  CG  . LYS A 1  316 ? 13.645  55.181 37.900 1.00 23.10 ? 316  LYS A CG  1 
ATOM   2478 C  CD  . LYS A 1  316 ? 13.712  54.000 37.013 1.00 25.55 ? 316  LYS A CD  1 
ATOM   2479 C  CE  . LYS A 1  316 ? 13.329  52.792 37.821 1.00 28.42 ? 316  LYS A CE  1 
ATOM   2480 N  NZ  . LYS A 1  316 ? 12.543  51.795 37.021 1.00 31.65 ? 316  LYS A NZ  1 
ATOM   2481 N  N   . THR A 1  317 ? 12.989  59.727 38.474 1.00 18.21 ? 317  THR A N   1 
ATOM   2482 C  CA  . THR A 1  317 ? 12.932  61.152 38.172 1.00 16.73 ? 317  THR A CA  1 
ATOM   2483 C  C   . THR A 1  317 ? 13.946  61.802 39.106 1.00 16.77 ? 317  THR A C   1 
ATOM   2484 O  O   . THR A 1  317 ? 14.811  61.090 39.649 1.00 16.24 ? 317  THR A O   1 
ATOM   2485 C  CB  . THR A 1  317 ? 11.497  61.738 38.372 1.00 17.09 ? 317  THR A CB  1 
ATOM   2486 O  OG1 . THR A 1  317 ? 11.506  63.140 38.077 1.00 17.07 ? 317  THR A OG1 1 
ATOM   2487 C  CG2 . THR A 1  317 ? 10.999  61.517 39.827 1.00 15.67 ? 317  THR A CG2 1 
ATOM   2488 N  N   . GLN A 1  318 ? 13.854  63.127 39.286 1.00 15.56 ? 318  GLN A N   1 
ATOM   2489 C  CA  . GLN A 1  318 ? 14.735  63.823 40.207 1.00 15.69 ? 318  GLN A CA  1 
ATOM   2490 C  C   . GLN A 1  318 ? 14.027  63.989 41.539 1.00 15.69 ? 318  GLN A C   1 
ATOM   2491 O  O   . GLN A 1  318 ? 12.811  64.186 41.606 1.00 15.91 ? 318  GLN A O   1 
ATOM   2492 C  CB  . GLN A 1  318 ? 15.166  65.225 39.690 1.00 15.89 ? 318  GLN A CB  1 
ATOM   2493 C  CG  . GLN A 1  318 ? 15.743  65.268 38.273 1.00 16.44 ? 318  GLN A CG  1 
ATOM   2494 C  CD  . GLN A 1  318 ? 14.648  65.237 37.199 1.00 19.61 ? 318  GLN A CD  1 
ATOM   2495 O  OE1 . GLN A 1  318 ? 13.552  65.809 37.358 1.00 18.63 ? 318  GLN A OE1 1 
ATOM   2496 N  NE2 . GLN A 1  318 ? 14.921  64.520 36.118 1.00 22.51 ? 318  GLN A NE2 1 
ATOM   2497 N  N   . ILE A 1  319 ? 14.807  63.923 42.609 1.00 15.89 ? 319  ILE A N   1 
ATOM   2498 C  CA  . ILE A 1  319 ? 14.297  64.180 43.953 1.00 14.29 ? 319  ILE A CA  1 
ATOM   2499 C  C   . ILE A 1  319 ? 15.212  65.122 44.702 1.00 14.04 ? 319  ILE A C   1 
ATOM   2500 O  O   . ILE A 1  319 ? 16.448  65.135 44.509 1.00 12.93 ? 319  ILE A O   1 
ATOM   2501 C  CB  . ILE A 1  319 ? 14.106  62.873 44.773 1.00 13.55 ? 319  ILE A CB  1 
ATOM   2502 C  CG1 . ILE A 1  319 ? 15.426  62.114 44.918 1.00 12.95 ? 319  ILE A CG1 1 
ATOM   2503 C  CG2 . ILE A 1  319 ? 13.044  62.022 44.131 1.00 13.31 ? 319  ILE A CG2 1 
ATOM   2504 C  CD1 . ILE A 1  319 ? 15.388  60.932 45.971 1.00 6.96  ? 319  ILE A CD1 1 
ATOM   2505 N  N   . LEU A 1  320 ? 14.572  65.898 45.562 1.00 12.81 ? 320  LEU A N   1 
ATOM   2506 C  CA  . LEU A 1  320 ? 15.244  66.742 46.484 1.00 13.72 ? 320  LEU A CA  1 
ATOM   2507 C  C   . LEU A 1  320 ? 14.694  66.405 47.883 1.00 14.36 ? 320  LEU A C   1 
ATOM   2508 O  O   . LEU A 1  320 ? 13.476  66.296 48.076 1.00 14.36 ? 320  LEU A O   1 
ATOM   2509 C  CB  . LEU A 1  320 ? 15.028  68.205 46.096 1.00 12.42 ? 320  LEU A CB  1 
ATOM   2510 C  CG  . LEU A 1  320 ? 15.790  69.247 46.904 1.00 14.25 ? 320  LEU A CG  1 
ATOM   2511 C  CD1 . LEU A 1  320 ? 16.017  70.568 46.102 1.00 14.76 ? 320  LEU A CD1 1 
ATOM   2512 C  CD2 . LEU A 1  320 ? 15.063  69.532 48.219 1.00 13.44 ? 320  LEU A CD2 1 
ATOM   2513 N  N   . LEU A 1  321 ? 15.588  66.205 48.849 1.00 14.37 ? 321  LEU A N   1 
ATOM   2514 C  CA  . LEU A 1  321 ? 15.161  65.734 50.168 1.00 14.47 ? 321  LEU A CA  1 
ATOM   2515 C  C   . LEU A 1  321 ? 16.211  65.979 51.243 1.00 14.97 ? 321  LEU A C   1 
ATOM   2516 O  O   . LEU A 1  321 ? 17.383  66.273 50.952 1.00 16.19 ? 321  LEU A O   1 
ATOM   2517 C  CB  . LEU A 1  321 ? 14.770  64.235 50.132 1.00 13.66 ? 321  LEU A CB  1 
ATOM   2518 C  CG  . LEU A 1  321 ? 15.839  63.159 49.958 1.00 13.29 ? 321  LEU A CG  1 
ATOM   2519 C  CD1 . LEU A 1  321 ? 15.201  61.734 50.015 1.00 8.04  ? 321  LEU A CD1 1 
ATOM   2520 C  CD2 . LEU A 1  321 ? 16.650  63.348 48.677 1.00 11.43 ? 321  LEU A CD2 1 
ATOM   2521 N  N   . GLY A 1  322 ? 15.772  65.875 52.490 1.00 14.49 ? 322  GLY A N   1 
ATOM   2522 C  CA  . GLY A 1  322 ? 16.664  65.981 53.605 1.00 15.28 ? 322  GLY A CA  1 
ATOM   2523 C  C   . GLY A 1  322 ? 15.949  66.027 54.930 1.00 15.75 ? 322  GLY A C   1 
ATOM   2524 O  O   . GLY A 1  322 ? 14.761  65.693 55.045 1.00 15.60 ? 322  GLY A O   1 
ATOM   2525 N  N   . VAL A 1  323 ? 16.700  66.449 55.943 1.00 16.66 ? 323  VAL A N   1 
ATOM   2526 C  CA  . VAL A 1  323 ? 16.299  66.276 57.321 1.00 16.13 ? 323  VAL A CA  1 
ATOM   2527 C  C   . VAL A 1  323 ? 16.709  67.468 58.157 1.00 17.07 ? 323  VAL A C   1 
ATOM   2528 O  O   . VAL A 1  323 ? 17.505  68.318 57.713 1.00 17.84 ? 323  VAL A O   1 
ATOM   2529 C  CB  . VAL A 1  323 ? 16.889  64.960 57.933 1.00 15.59 ? 323  VAL A CB  1 
ATOM   2530 C  CG1 . VAL A 1  323 ? 16.528  63.719 57.101 1.00 14.22 ? 323  VAL A CG1 1 
ATOM   2531 C  CG2 . VAL A 1  323 ? 18.351  65.051 58.123 1.00 14.47 ? 323  VAL A CG2 1 
ATOM   2532 N  N   . ASN A 1  324 ? 16.154  67.529 59.367 1.00 16.96 ? 324  ASN A N   1 
ATOM   2533 C  CA  . ASN A 1  324 ? 16.563  68.507 60.374 1.00 17.35 ? 324  ASN A CA  1 
ATOM   2534 C  C   . ASN A 1  324 ? 17.503  67.891 61.410 1.00 17.13 ? 324  ASN A C   1 
ATOM   2535 O  O   . ASN A 1  324 ? 17.511  66.660 61.641 1.00 17.08 ? 324  ASN A O   1 
ATOM   2536 C  CB  . ASN A 1  324 ? 15.337  69.104 61.064 1.00 16.67 ? 324  ASN A CB  1 
ATOM   2537 C  CG  . ASN A 1  324 ? 14.426  69.853 60.093 1.00 17.57 ? 324  ASN A CG  1 
ATOM   2538 O  OD1 . ASN A 1  324 ? 14.761  70.025 58.918 1.00 16.19 ? 324  ASN A OD1 1 
ATOM   2539 N  ND2 . ASN A 1  324 ? 13.267  70.303 60.586 1.00 14.72 ? 324  ASN A ND2 1 
ATOM   2540 N  N   . LYS A 1  325 ? 18.289  68.750 62.049 1.00 16.82 ? 325  LYS A N   1 
ATOM   2541 C  CA  . LYS A 1  325 ? 19.290  68.280 62.987 1.00 16.88 ? 325  LYS A CA  1 
ATOM   2542 C  C   . LYS A 1  325 ? 18.675  67.483 64.143 1.00 16.22 ? 325  LYS A C   1 
ATOM   2543 O  O   . LYS A 1  325 ? 19.242  66.476 64.526 1.00 16.32 ? 325  LYS A O   1 
ATOM   2544 C  CB  . LYS A 1  325 ? 20.127  69.443 63.519 1.00 17.16 ? 325  LYS A CB  1 
ATOM   2545 C  CG  . LYS A 1  325 ? 21.303  69.019 64.362 1.00 18.17 ? 325  LYS A CG  1 
ATOM   2546 C  CD  . LYS A 1  325 ? 21.925  70.241 65.062 1.00 24.56 ? 325  LYS A CD  1 
ATOM   2547 C  CE  . LYS A 1  325 ? 23.128  69.835 65.919 1.00 28.53 ? 325  LYS A CE  1 
ATOM   2548 N  NZ  . LYS A 1  325 ? 22.852  68.634 66.787 1.00 32.40 ? 325  LYS A NZ  1 
ATOM   2549 N  N   . ASP A 1  326 ? 17.540  67.927 64.688 1.00 14.74 ? 326  ASP A N   1 
ATOM   2550 C  CA  . ASP A 1  326 ? 17.023  67.333 65.934 1.00 14.73 ? 326  ASP A CA  1 
ATOM   2551 C  C   . ASP A 1  326 ? 15.609  66.864 65.740 1.00 15.58 ? 326  ASP A C   1 
ATOM   2552 O  O   . ASP A 1  326 ? 14.649  67.428 66.322 1.00 16.62 ? 326  ASP A O   1 
ATOM   2553 C  CB  . ASP A 1  326 ? 17.126  68.322 67.107 1.00 14.05 ? 326  ASP A CB  1 
ATOM   2554 C  CG  . ASP A 1  326 ? 18.572  68.846 67.325 1.00 13.78 ? 326  ASP A CG  1 
ATOM   2555 O  OD1 . ASP A 1  326 ? 19.465  68.067 67.706 1.00 13.76 ? 326  ASP A OD1 1 
ATOM   2556 O  OD2 . ASP A 1  326 ? 18.816  70.047 67.100 1.00 11.80 ? 326  ASP A OD2 1 
ATOM   2557 N  N   . GLU A 1  327 ? 15.478  65.860 64.866 1.00 15.70 ? 327  GLU A N   1 
ATOM   2558 C  CA  . GLU A 1  327 ? 14.203  65.238 64.564 1.00 15.74 ? 327  GLU A CA  1 
ATOM   2559 C  C   . GLU A 1  327 ? 13.501  64.623 65.797 1.00 16.39 ? 327  GLU A C   1 
ATOM   2560 O  O   . GLU A 1  327 ? 12.279  64.640 65.879 1.00 17.30 ? 327  GLU A O   1 
ATOM   2561 C  CB  . GLU A 1  327 ? 14.341  64.190 63.445 1.00 15.44 ? 327  GLU A CB  1 
ATOM   2562 C  CG  . GLU A 1  327 ? 14.813  64.730 62.095 1.00 14.27 ? 327  GLU A CG  1 
ATOM   2563 C  CD  . GLU A 1  327 ? 13.769  65.466 61.286 1.00 15.04 ? 327  GLU A CD  1 
ATOM   2564 O  OE1 . GLU A 1  327 ? 12.607  65.644 61.719 1.00 17.43 ? 327  GLU A OE1 1 
ATOM   2565 O  OE2 . GLU A 1  327 ? 14.114  65.874 60.164 1.00 15.10 ? 327  GLU A OE2 1 
ATOM   2566 N  N   . GLY A 1  328 ? 14.241  64.089 66.759 1.00 16.52 ? 328  GLY A N   1 
ATOM   2567 C  CA  . GLY A 1  328 ? 13.568  63.327 67.806 1.00 16.12 ? 328  GLY A CA  1 
ATOM   2568 C  C   . GLY A 1  328 ? 12.981  64.070 69.006 1.00 16.32 ? 328  GLY A C   1 
ATOM   2569 O  O   . GLY A 1  328 ? 12.240  63.463 69.776 1.00 15.22 ? 328  GLY A O   1 
ATOM   2570 N  N   . SER A 1  329 ? 13.305  65.362 69.175 1.00 16.81 ? 329  SER A N   1 
ATOM   2571 C  CA  . SER A 1  329 ? 13.007  66.070 70.428 1.00 17.02 ? 329  SER A CA  1 
ATOM   2572 C  C   . SER A 1  329 ? 11.507  66.204 70.755 1.00 18.26 ? 329  SER A C   1 
ATOM   2573 O  O   . SER A 1  329 ? 11.099  66.072 71.925 1.00 17.55 ? 329  SER A O   1 
ATOM   2574 C  CB  . SER A 1  329 ? 13.745  67.419 70.507 1.00 17.77 ? 329  SER A CB  1 
ATOM   2575 O  OG  . SER A 1  329 ? 13.442  68.286 69.429 1.00 16.01 ? 329  SER A OG  1 
ATOM   2576 N  N   . PHE A 1  330 ? 10.674  66.401 69.733 1.00 18.79 ? 330  PHE A N   1 
ATOM   2577 C  CA  . PHE A 1  330 ? 9.228   66.577 69.936 1.00 19.53 ? 330  PHE A CA  1 
ATOM   2578 C  C   . PHE A 1  330 ? 8.637   65.346 70.612 1.00 19.32 ? 330  PHE A C   1 
ATOM   2579 O  O   . PHE A 1  330 ? 7.785   65.428 71.506 1.00 19.34 ? 330  PHE A O   1 
ATOM   2580 C  CB  . PHE A 1  330 ? 8.529   66.722 68.585 1.00 20.02 ? 330  PHE A CB  1 
ATOM   2581 C  CG  . PHE A 1  330 ? 7.742   67.943 68.456 1.00 24.15 ? 330  PHE A CG  1 
ATOM   2582 C  CD1 . PHE A 1  330 ? 6.756   68.246 69.372 1.00 27.72 ? 330  PHE A CD1 1 
ATOM   2583 C  CD2 . PHE A 1  330 ? 7.976   68.813 67.395 1.00 29.23 ? 330  PHE A CD2 1 
ATOM   2584 C  CE1 . PHE A 1  330 ? 6.011   69.413 69.261 1.00 31.01 ? 330  PHE A CE1 1 
ATOM   2585 C  CE2 . PHE A 1  330 ? 7.233   69.991 67.257 1.00 33.24 ? 330  PHE A CE2 1 
ATOM   2586 C  CZ  . PHE A 1  330 ? 6.244   70.294 68.201 1.00 33.67 ? 330  PHE A CZ  1 
ATOM   2587 N  N   . PHE A 1  331 ? 9.093   64.191 70.154 1.00 18.81 ? 331  PHE A N   1 
ATOM   2588 C  CA  . PHE A 1  331 ? 8.511   62.928 70.562 1.00 18.27 ? 331  PHE A CA  1 
ATOM   2589 C  C   . PHE A 1  331 ? 8.988   62.508 71.930 1.00 17.48 ? 331  PHE A C   1 
ATOM   2590 O  O   . PHE A 1  331 ? 8.281   61.817 72.647 1.00 18.64 ? 331  PHE A O   1 
ATOM   2591 C  CB  . PHE A 1  331 ? 8.775   61.869 69.493 1.00 18.20 ? 331  PHE A CB  1 
ATOM   2592 C  CG  . PHE A 1  331 ? 8.344   62.311 68.116 1.00 17.91 ? 331  PHE A CG  1 
ATOM   2593 C  CD1 . PHE A 1  331 ? 9.187   63.106 67.320 1.00 17.95 ? 331  PHE A CD1 1 
ATOM   2594 C  CD2 . PHE A 1  331 ? 7.089   62.017 67.654 1.00 16.77 ? 331  PHE A CD2 1 
ATOM   2595 C  CE1 . PHE A 1  331 ? 8.777   63.550 66.069 1.00 17.66 ? 331  PHE A CE1 1 
ATOM   2596 C  CE2 . PHE A 1  331 ? 6.677   62.456 66.401 1.00 18.19 ? 331  PHE A CE2 1 
ATOM   2597 C  CZ  . PHE A 1  331 ? 7.521   63.215 65.608 1.00 15.96 ? 331  PHE A CZ  1 
ATOM   2598 N  N   . LEU A 1  332 ? 10.179  62.940 72.301 1.00 16.56 ? 332  LEU A N   1 
ATOM   2599 C  CA  . LEU A 1  332 ? 10.654  62.722 73.648 1.00 15.57 ? 332  LEU A CA  1 
ATOM   2600 C  C   . LEU A 1  332 ? 9.954   63.683 74.601 1.00 15.69 ? 332  LEU A C   1 
ATOM   2601 O  O   . LEU A 1  332 ? 9.518   63.268 75.678 1.00 15.72 ? 332  LEU A O   1 
ATOM   2602 C  CB  . LEU A 1  332 ? 12.164  62.856 73.711 1.00 15.12 ? 332  LEU A CB  1 
ATOM   2603 C  CG  . LEU A 1  332 ? 12.902  61.769 72.931 1.00 15.57 ? 332  LEU A CG  1 
ATOM   2604 C  CD1 . LEU A 1  332 ? 14.280  62.291 72.553 1.00 14.81 ? 332  LEU A CD1 1 
ATOM   2605 C  CD2 . LEU A 1  332 ? 13.029  60.499 73.779 1.00 11.87 ? 332  LEU A CD2 1 
ATOM   2606 N  N   . LEU A 1  333 ? 9.802   64.954 74.201 1.00 15.69 ? 333  LEU A N   1 
ATOM   2607 C  CA  . LEU A 1  333 ? 9.076   65.910 75.030 1.00 15.97 ? 333  LEU A CA  1 
ATOM   2608 C  C   . LEU A 1  333 ? 7.734   65.326 75.428 1.00 16.90 ? 333  LEU A C   1 
ATOM   2609 O  O   . LEU A 1  333 ? 7.363   65.353 76.616 1.00 18.04 ? 333  LEU A O   1 
ATOM   2610 C  CB  . LEU A 1  333 ? 8.862   67.261 74.324 1.00 15.48 ? 333  LEU A CB  1 
ATOM   2611 C  CG  . LEU A 1  333 ? 7.882   68.171 75.045 1.00 15.02 ? 333  LEU A CG  1 
ATOM   2612 C  CD1 . LEU A 1  333 ? 8.364   68.440 76.499 1.00 12.29 ? 333  LEU A CD1 1 
ATOM   2613 C  CD2 . LEU A 1  333 ? 7.675   69.468 74.275 1.00 15.20 ? 333  LEU A CD2 1 
ATOM   2614 N  N   . TYR A 1  334 ? 7.021   64.786 74.445 1.00 17.03 ? 334  TYR A N   1 
ATOM   2615 C  CA  . TYR A 1  334 ? 5.654   64.293 74.654 1.00 18.09 ? 334  TYR A CA  1 
ATOM   2616 C  C   . TYR A 1  334 ? 5.503   62.912 75.332 1.00 19.61 ? 334  TYR A C   1 
ATOM   2617 O  O   . TYR A 1  334 ? 4.519   62.693 75.998 1.00 21.13 ? 334  TYR A O   1 
ATOM   2618 C  CB  . TYR A 1  334 ? 4.871   64.307 73.345 1.00 16.82 ? 334  TYR A CB  1 
ATOM   2619 C  CG  . TYR A 1  334 ? 4.307   65.647 72.971 1.00 15.84 ? 334  TYR A CG  1 
ATOM   2620 C  CD1 . TYR A 1  334 ? 5.137   66.721 72.673 1.00 12.97 ? 334  TYR A CD1 1 
ATOM   2621 C  CD2 . TYR A 1  334 ? 2.928   65.841 72.898 1.00 15.12 ? 334  TYR A CD2 1 
ATOM   2622 C  CE1 . TYR A 1  334 ? 4.612   67.971 72.312 1.00 13.00 ? 334  TYR A CE1 1 
ATOM   2623 C  CE2 . TYR A 1  334 ? 2.393   67.088 72.543 1.00 14.07 ? 334  TYR A CE2 1 
ATOM   2624 C  CZ  . TYR A 1  334 ? 3.245   68.150 72.255 1.00 14.30 ? 334  TYR A CZ  1 
ATOM   2625 O  OH  . TYR A 1  334 ? 2.717   69.377 71.882 1.00 14.23 ? 334  TYR A OH  1 
ATOM   2626 N  N   . GLY A 1  335 ? 6.446   61.996 75.199 1.00 20.49 ? 335  GLY A N   1 
ATOM   2627 C  CA  . GLY A 1  335 ? 6.238   60.691 75.811 1.00 22.06 ? 335  GLY A CA  1 
ATOM   2628 C  C   . GLY A 1  335 ? 7.369   60.063 76.621 1.00 23.37 ? 335  GLY A C   1 
ATOM   2629 O  O   . GLY A 1  335 ? 7.189   58.995 77.196 1.00 25.11 ? 335  GLY A O   1 
ATOM   2630 N  N   . ALA A 1  336 ? 8.539   60.682 76.682 1.00 22.25 ? 336  ALA A N   1 
ATOM   2631 C  CA  . ALA A 1  336 ? 9.636   59.985 77.309 1.00 22.24 ? 336  ALA A CA  1 
ATOM   2632 C  C   . ALA A 1  336 ? 9.774   60.492 78.740 1.00 22.21 ? 336  ALA A C   1 
ATOM   2633 O  O   . ALA A 1  336 ? 9.577   61.677 78.991 1.00 22.17 ? 336  ALA A O   1 
ATOM   2634 C  CB  . ALA A 1  336 ? 10.909  60.171 76.516 1.00 20.92 ? 336  ALA A CB  1 
ATOM   2635 N  N   . PRO A 1  337 ? 10.078  59.594 79.694 1.00 22.79 ? 337  PRO A N   1 
ATOM   2636 C  CA  . PRO A 1  337 ? 10.182  60.115 81.071 1.00 22.55 ? 337  PRO A CA  1 
ATOM   2637 C  C   . PRO A 1  337 ? 11.425  60.993 81.252 1.00 21.67 ? 337  PRO A C   1 
ATOM   2638 O  O   . PRO A 1  337 ? 12.479  60.738 80.670 1.00 21.30 ? 337  PRO A O   1 
ATOM   2639 C  CB  . PRO A 1  337 ? 10.223  58.853 81.941 1.00 22.51 ? 337  PRO A CB  1 
ATOM   2640 C  CG  . PRO A 1  337 ? 10.662  57.750 81.004 1.00 23.15 ? 337  PRO A CG  1 
ATOM   2641 C  CD  . PRO A 1  337 ? 10.335  58.142 79.599 1.00 22.23 ? 337  PRO A CD  1 
ATOM   2642 N  N   . GLY A 1  338 ? 11.254  62.078 81.990 1.00 21.54 ? 338  GLY A N   1 
ATOM   2643 C  CA  . GLY A 1  338 ? 12.349  63.010 82.243 1.00 21.05 ? 338  GLY A CA  1 
ATOM   2644 C  C   . GLY A 1  338 ? 12.400  64.271 81.382 1.00 20.25 ? 338  GLY A C   1 
ATOM   2645 O  O   . GLY A 1  338 ? 13.230  65.149 81.648 1.00 20.35 ? 338  GLY A O   1 
ATOM   2646 N  N   . PHE A 1  339 ? 11.545  64.349 80.355 1.00 18.97 ? 339  PHE A N   1 
ATOM   2647 C  CA  . PHE A 1  339 ? 11.518  65.478 79.424 1.00 17.85 ? 339  PHE A CA  1 
ATOM   2648 C  C   . PHE A 1  339 ? 10.325  66.343 79.790 1.00 18.21 ? 339  PHE A C   1 
ATOM   2649 O  O   . PHE A 1  339 ? 9.228   65.801 80.026 1.00 19.48 ? 339  PHE A O   1 
ATOM   2650 C  CB  . PHE A 1  339 ? 11.418  64.991 77.958 1.00 17.09 ? 339  PHE A CB  1 
ATOM   2651 C  CG  . PHE A 1  339 ? 12.640  64.203 77.468 1.00 16.37 ? 339  PHE A CG  1 
ATOM   2652 C  CD1 . PHE A 1  339 ? 12.711  62.811 77.614 1.00 13.44 ? 339  PHE A CD1 1 
ATOM   2653 C  CD2 . PHE A 1  339 ? 13.705  64.862 76.823 1.00 14.11 ? 339  PHE A CD2 1 
ATOM   2654 C  CE1 . PHE A 1  339 ? 13.849  62.082 77.134 1.00 14.11 ? 339  PHE A CE1 1 
ATOM   2655 C  CE2 . PHE A 1  339 ? 14.834  64.164 76.346 1.00 11.88 ? 339  PHE A CE2 1 
ATOM   2656 C  CZ  . PHE A 1  339 ? 14.916  62.765 76.516 1.00 13.28 ? 339  PHE A CZ  1 
ATOM   2657 N  N   . SER A 1  340 ? 10.537  67.658 79.867 1.00 18.29 ? 340  SER A N   1 
ATOM   2658 C  CA  . SER A 1  340 ? 9.503   68.646 80.165 1.00 19.30 ? 340  SER A CA  1 
ATOM   2659 C  C   . SER A 1  340 ? 9.757   69.847 79.296 1.00 19.41 ? 340  SER A C   1 
ATOM   2660 O  O   . SER A 1  340 ? 10.914  70.128 78.962 1.00 19.43 ? 340  SER A O   1 
ATOM   2661 C  CB  . SER A 1  340 ? 9.598   69.171 81.605 1.00 19.52 ? 340  SER A CB  1 
ATOM   2662 O  OG  . SER A 1  340 ? 9.842   68.146 82.537 1.00 23.78 ? 340  SER A OG  1 
ATOM   2663 N  N   . LYS A 1  341 ? 8.697   70.589 78.982 1.00 19.47 ? 341  LYS A N   1 
ATOM   2664 C  CA  . LYS A 1  341 ? 8.837   71.779 78.156 1.00 20.33 ? 341  LYS A CA  1 
ATOM   2665 C  C   . LYS A 1  341 ? 9.609   72.913 78.810 1.00 20.60 ? 341  LYS A C   1 
ATOM   2666 O  O   . LYS A 1  341 ? 10.336  73.662 78.113 1.00 21.03 ? 341  LYS A O   1 
ATOM   2667 C  CB  . LYS A 1  341 ? 7.479   72.314 77.718 1.00 20.71 ? 341  LYS A CB  1 
ATOM   2668 C  CG  . LYS A 1  341 ? 7.599   73.368 76.596 1.00 21.61 ? 341  LYS A CG  1 
ATOM   2669 C  CD  . LYS A 1  341 ? 6.226   73.813 76.048 1.00 22.55 ? 341  LYS A CD  1 
ATOM   2670 C  CE  . LYS A 1  341 ? 5.477   74.745 77.021 1.00 24.61 ? 341  LYS A CE  1 
ATOM   2671 N  NZ  . LYS A 1  341 ? 6.304   75.885 77.517 1.00 23.83 ? 341  LYS A NZ  1 
ATOM   2672 N  N   . ASP A 1  342 ? 9.421   73.093 80.119 1.00 19.62 ? 342  ASP A N   1 
ATOM   2673 C  CA  . ASP A 1  342 ? 10.016  74.264 80.804 1.00 19.14 ? 342  ASP A CA  1 
ATOM   2674 C  C   . ASP A 1  342 ? 11.264  73.933 81.611 1.00 18.35 ? 342  ASP A C   1 
ATOM   2675 O  O   . ASP A 1  342 ? 11.668  74.698 82.460 1.00 18.39 ? 342  ASP A O   1 
ATOM   2676 C  CB  . ASP A 1  342 ? 9.005   74.935 81.729 1.00 18.53 ? 342  ASP A CB  1 
ATOM   2677 C  CG  . ASP A 1  342 ? 7.737   75.343 81.018 1.00 18.96 ? 342  ASP A CG  1 
ATOM   2678 O  OD1 . ASP A 1  342 ? 7.727   75.444 79.764 1.00 19.65 ? 342  ASP A OD1 1 
ATOM   2679 O  OD2 . ASP A 1  342 ? 6.749   75.574 81.734 1.00 14.90 ? 342  ASP A OD2 1 
ATOM   2680 N  N   . SER A 1  343 ? 11.868  72.789 81.371 1.00 18.69 ? 343  SER A N   1 
ATOM   2681 C  CA  . SER A 1  343 ? 13.151  72.530 81.986 1.00 19.41 ? 343  SER A CA  1 
ATOM   2682 C  C   . SER A 1  343 ? 14.163  72.197 80.897 1.00 19.42 ? 343  SER A C   1 
ATOM   2683 O  O   . SER A 1  343 ? 13.789  71.954 79.762 1.00 20.11 ? 343  SER A O   1 
ATOM   2684 C  CB  . SER A 1  343 ? 13.038  71.406 82.999 1.00 19.32 ? 343  SER A CB  1 
ATOM   2685 O  OG  . SER A 1  343 ? 13.594  70.211 82.487 1.00 24.09 ? 343  SER A OG  1 
ATOM   2686 N  N   . GLU A 1  344 ? 15.436  72.175 81.259 1.00 18.63 ? 344  GLU A N   1 
ATOM   2687 C  CA  . GLU A 1  344 ? 16.495  71.747 80.375 1.00 18.93 ? 344  GLU A CA  1 
ATOM   2688 C  C   . GLU A 1  344 ? 16.465  70.230 80.074 1.00 19.25 ? 344  GLU A C   1 
ATOM   2689 O  O   . GLU A 1  344 ? 17.308  69.735 79.293 1.00 19.35 ? 344  GLU A O   1 
ATOM   2690 C  CB  . GLU A 1  344 ? 17.839  72.047 81.048 1.00 18.84 ? 344  GLU A CB  1 
ATOM   2691 C  CG  . GLU A 1  344 ? 18.363  73.438 80.908 0.50 19.85 ? 344  GLU A CG  1 
ATOM   2692 C  CD  . GLU A 1  344 ? 19.708  73.576 81.602 0.50 20.95 ? 344  GLU A CD  1 
ATOM   2693 O  OE1 . GLU A 1  344 ? 20.676  72.924 81.165 0.50 20.81 ? 344  GLU A OE1 1 
ATOM   2694 O  OE2 . GLU A 1  344 ? 19.787  74.317 82.602 0.50 21.83 ? 344  GLU A OE2 1 
ATOM   2695 N  N   . SER A 1  345 ? 15.557  69.487 80.721 1.00 18.93 ? 345  SER A N   1 
ATOM   2696 C  CA  . SER A 1  345 ? 15.447  68.028 80.527 1.00 19.66 ? 345  SER A CA  1 
ATOM   2697 C  C   . SER A 1  345 ? 16.790  67.261 80.541 1.00 20.06 ? 345  SER A C   1 
ATOM   2698 O  O   . SER A 1  345 ? 17.085  66.497 79.640 1.00 20.23 ? 345  SER A O   1 
ATOM   2699 C  CB  . SER A 1  345 ? 14.672  67.708 79.242 1.00 18.60 ? 345  SER A CB  1 
ATOM   2700 O  OG  . SER A 1  345 ? 13.374  68.281 79.290 1.00 21.13 ? 345  SER A OG  1 
ATOM   2701 N  N   . LYS A 1  346 ? 17.586  67.436 81.580 1.00 21.49 ? 346  LYS A N   1 
ATOM   2702 C  CA  . LYS A 1  346 ? 18.780  66.615 81.730 1.00 23.36 ? 346  LYS A CA  1 
ATOM   2703 C  C   . LYS A 1  346 ? 18.306  65.240 82.133 1.00 23.60 ? 346  LYS A C   1 
ATOM   2704 O  O   . LYS A 1  346 ? 17.428  65.106 82.982 1.00 24.52 ? 346  LYS A O   1 
ATOM   2705 C  CB  . LYS A 1  346 ? 19.749  67.202 82.748 1.00 23.33 ? 346  LYS A CB  1 
ATOM   2706 C  CG  . LYS A 1  346 ? 20.348  68.511 82.313 1.00 26.00 ? 346  LYS A CG  1 
ATOM   2707 C  CD  . LYS A 1  346 ? 21.116  69.128 83.460 1.00 32.30 ? 346  LYS A CD  1 
ATOM   2708 C  CE  . LYS A 1  346 ? 21.699  70.480 83.086 1.00 35.43 ? 346  LYS A CE  1 
ATOM   2709 N  NZ  . LYS A 1  346 ? 22.396  71.110 84.272 1.00 38.80 ? 346  LYS A NZ  1 
ATOM   2710 N  N   . ILE A 1  347 ? 18.844  64.224 81.479 1.00 24.29 ? 347  ILE A N   1 
ATOM   2711 C  CA  . ILE A 1  347 ? 18.263  62.886 81.539 1.00 24.82 ? 347  ILE A CA  1 
ATOM   2712 C  C   . ILE A 1  347 ? 19.166  61.941 82.339 1.00 25.62 ? 347  ILE A C   1 
ATOM   2713 O  O   . ILE A 1  347 ? 20.373  61.809 82.055 1.00 24.77 ? 347  ILE A O   1 
ATOM   2714 C  CB  . ILE A 1  347 ? 17.979  62.347 80.098 1.00 24.82 ? 347  ILE A CB  1 
ATOM   2715 C  CG1 . ILE A 1  347 ? 16.788  63.097 79.483 1.00 23.77 ? 347  ILE A CG1 1 
ATOM   2716 C  CG2 . ILE A 1  347 ? 17.724  60.846 80.093 1.00 24.06 ? 347  ILE A CG2 1 
ATOM   2717 C  CD1 . ILE A 1  347 ? 15.521  62.990 80.267 1.00 21.93 ? 347  ILE A CD1 1 
ATOM   2718 N  N   . SER A 1  348 ? 18.572  61.313 83.353 1.00 26.44 ? 348  SER A N   1 
ATOM   2719 C  CA  . SER A 1  348 ? 19.313  60.404 84.213 1.00 27.64 ? 348  SER A CA  1 
ATOM   2720 C  C   . SER A 1  348 ? 19.583  59.136 83.427 1.00 28.75 ? 348  SER A C   1 
ATOM   2721 O  O   . SER A 1  348 ? 18.959  58.904 82.389 1.00 28.85 ? 348  SER A O   1 
ATOM   2722 C  CB  . SER A 1  348 ? 18.500  60.070 85.450 1.00 26.77 ? 348  SER A CB  1 
ATOM   2723 O  OG  . SER A 1  348 ? 17.549  59.090 85.134 1.00 28.70 ? 348  SER A OG  1 
ATOM   2724 N  N   . ARG A 1  349 ? 20.530  58.334 83.915 1.00 29.34 ? 349  ARG A N   1 
ATOM   2725 C  CA  . ARG A 1  349 ? 20.812  57.035 83.360 1.00 29.91 ? 349  ARG A CA  1 
ATOM   2726 C  C   . ARG A 1  349 ? 19.543  56.185 83.266 1.00 30.10 ? 349  ARG A C   1 
ATOM   2727 O  O   . ARG A 1  349 ? 19.351  55.481 82.288 1.00 30.55 ? 349  ARG A O   1 
ATOM   2728 C  CB  . ARG A 1  349 ? 21.824  56.317 84.246 1.00 30.27 ? 349  ARG A CB  1 
ATOM   2729 C  CG  . ARG A 1  349 ? 22.583  55.254 83.529 1.00 31.44 ? 349  ARG A CG  1 
ATOM   2730 C  CD  . ARG A 1  349 ? 23.426  55.862 82.454 1.00 33.08 ? 349  ARG A CD  1 
ATOM   2731 N  NE  . ARG A 1  349 ? 23.426  54.999 81.290 1.00 32.62 ? 349  ARG A NE  1 
ATOM   2732 C  CZ  . ARG A 1  349 ? 23.648  55.409 80.045 1.00 31.35 ? 349  ARG A CZ  1 
ATOM   2733 N  NH1 . ARG A 1  349 ? 23.913  56.684 79.767 1.00 31.36 ? 349  ARG A NH1 1 
ATOM   2734 N  NH2 . ARG A 1  349 ? 23.612  54.519 79.077 1.00 30.37 ? 349  ARG A NH2 1 
ATOM   2735 N  N   . GLU A 1  350 ? 18.686  56.247 84.278 1.00 30.39 ? 350  GLU A N   1 
ATOM   2736 C  CA  . GLU A 1  350 ? 17.506  55.389 84.322 1.00 31.27 ? 350  GLU A CA  1 
ATOM   2737 C  C   . GLU A 1  350 ? 16.535  55.813 83.232 1.00 30.21 ? 350  GLU A C   1 
ATOM   2738 O  O   . GLU A 1  350 ? 15.927  54.965 82.563 1.00 30.17 ? 350  GLU A O   1 
ATOM   2739 C  CB  . GLU A 1  350 ? 16.803  55.454 85.686 1.00 32.19 ? 350  GLU A CB  1 
ATOM   2740 C  CG  . GLU A 1  350 ? 17.622  54.910 86.874 1.00 37.76 ? 350  GLU A CG  1 
ATOM   2741 C  CD  . GLU A 1  350 ? 18.808  55.810 87.235 1.00 44.56 ? 350  GLU A CD  1 
ATOM   2742 O  OE1 . GLU A 1  350 ? 18.578  56.999 87.596 1.00 45.73 ? 350  GLU A OE1 1 
ATOM   2743 O  OE2 . GLU A 1  350 ? 19.969  55.322 87.142 1.00 47.76 ? 350  GLU A OE2 1 
ATOM   2744 N  N   . ASP A 1  351 ? 16.397  57.130 83.066 1.00 28.30 ? 351  ASP A N   1 
ATOM   2745 C  CA  . ASP A 1  351 ? 15.486  57.703 82.094 1.00 26.69 ? 351  ASP A CA  1 
ATOM   2746 C  C   . ASP A 1  351 ? 15.959  57.532 80.669 1.00 25.52 ? 351  ASP A C   1 
ATOM   2747 O  O   . ASP A 1  351 ? 15.161  57.387 79.752 1.00 25.15 ? 351  ASP A O   1 
ATOM   2748 C  CB  . ASP A 1  351 ? 15.183  59.156 82.447 1.00 26.94 ? 351  ASP A CB  1 
ATOM   2749 C  CG  . ASP A 1  351 ? 14.152  59.262 83.553 1.00 26.64 ? 351  ASP A CG  1 
ATOM   2750 O  OD1 . ASP A 1  351 ? 13.674  58.197 84.016 1.00 27.87 ? 351  ASP A OD1 1 
ATOM   2751 O  OD2 . ASP A 1  351 ? 13.797  60.386 83.940 1.00 26.31 ? 351  ASP A OD2 1 
ATOM   2752 N  N   . PHE A 1  352 ? 17.267  57.507 80.493 1.00 24.93 ? 352  PHE A N   1 
ATOM   2753 C  CA  . PHE A 1  352 ? 17.839  57.151 79.214 1.00 24.58 ? 352  PHE A CA  1 
ATOM   2754 C  C   . PHE A 1  352 ? 17.402  55.741 78.828 1.00 24.66 ? 352  PHE A C   1 
ATOM   2755 O  O   . PHE A 1  352 ? 16.890  55.523 77.726 1.00 24.54 ? 352  PHE A O   1 
ATOM   2756 C  CB  . PHE A 1  352 ? 19.346  57.220 79.287 1.00 23.96 ? 352  PHE A CB  1 
ATOM   2757 C  CG  . PHE A 1  352 ? 20.017  57.014 77.970 1.00 23.01 ? 352  PHE A CG  1 
ATOM   2758 C  CD1 . PHE A 1  352 ? 20.176  58.082 77.080 1.00 19.40 ? 352  PHE A CD1 1 
ATOM   2759 C  CD2 . PHE A 1  352 ? 20.492  55.752 77.612 1.00 19.54 ? 352  PHE A CD2 1 
ATOM   2760 C  CE1 . PHE A 1  352 ? 20.797  57.887 75.861 1.00 19.62 ? 352  PHE A CE1 1 
ATOM   2761 C  CE2 . PHE A 1  352 ? 21.104  55.557 76.414 1.00 18.90 ? 352  PHE A CE2 1 
ATOM   2762 C  CZ  . PHE A 1  352 ? 21.271  56.618 75.526 1.00 19.36 ? 352  PHE A CZ  1 
ATOM   2763 N  N   . MET A 1  353 ? 17.605  54.815 79.764 1.00 24.91 ? 353  MET A N   1 
ATOM   2764 C  CA  A MET A 1  353 ? 17.252  53.416 79.558 0.50 25.18 ? 353  MET A CA  1 
ATOM   2765 C  CA  B MET A 1  353 ? 17.229  53.402 79.635 0.50 24.70 ? 353  MET A CA  1 
ATOM   2766 C  C   . MET A 1  353 ? 15.775  53.261 79.204 1.00 24.60 ? 353  MET A C   1 
ATOM   2767 O  O   . MET A 1  353 ? 15.461  52.604 78.220 1.00 24.97 ? 353  MET A O   1 
ATOM   2768 C  CB  A MET A 1  353 ? 17.634  52.567 80.776 0.50 25.73 ? 353  MET A CB  1 
ATOM   2769 C  CB  B MET A 1  353 ? 17.457  52.671 80.976 0.50 24.85 ? 353  MET A CB  1 
ATOM   2770 C  CG  A MET A 1  353 ? 19.084  52.742 81.210 0.50 27.37 ? 353  MET A CG  1 
ATOM   2771 C  CG  B MET A 1  353 ? 18.557  51.600 80.974 0.50 24.36 ? 353  MET A CG  1 
ATOM   2772 S  SD  A MET A 1  353 ? 20.332  51.970 80.157 0.50 32.41 ? 353  MET A SD  1 
ATOM   2773 S  SD  B MET A 1  353 ? 19.547  51.479 82.497 0.50 24.67 ? 353  MET A SD  1 
ATOM   2774 C  CE  A MET A 1  353 ? 20.453  50.358 80.957 0.50 28.83 ? 353  MET A CE  1 
ATOM   2775 C  CE  B MET A 1  353 ? 18.347  51.662 83.802 0.50 20.98 ? 353  MET A CE  1 
ATOM   2776 N  N   . SER A 1  354 ? 14.890  53.879 79.971 1.00 23.58 ? 354  SER A N   1 
ATOM   2777 C  CA  . SER A 1  354 ? 13.480  53.928 79.631 1.00 23.27 ? 354  SER A CA  1 
ATOM   2778 C  C   . SER A 1  354 ? 13.219  54.526 78.234 1.00 22.70 ? 354  SER A C   1 
ATOM   2779 O  O   . SER A 1  354 ? 12.307  54.088 77.518 1.00 22.02 ? 354  SER A O   1 
ATOM   2780 C  CB  . SER A 1  354 ? 12.759  54.801 80.637 1.00 23.15 ? 354  SER A CB  1 
ATOM   2781 O  OG  . SER A 1  354 ? 12.796  54.207 81.909 1.00 27.11 ? 354  SER A OG  1 
ATOM   2782 N  N   . GLY A 1  355 ? 14.012  55.536 77.865 1.00 21.64 ? 355  GLY A N   1 
ATOM   2783 C  CA  . GLY A 1  355 ? 13.832  56.225 76.590 1.00 20.61 ? 355  GLY A CA  1 
ATOM   2784 C  C   . GLY A 1  355 ? 14.095  55.283 75.448 1.00 19.29 ? 355  GLY A C   1 
ATOM   2785 O  O   . GLY A 1  355 ? 13.319  55.223 74.499 1.00 19.05 ? 355  GLY A O   1 
ATOM   2786 N  N   . VAL A 1  356 ? 15.187  54.530 75.559 1.00 18.95 ? 356  VAL A N   1 
ATOM   2787 C  CA  . VAL A 1  356 ? 15.582  53.569 74.533 1.00 18.73 ? 356  VAL A CA  1 
ATOM   2788 C  C   . VAL A 1  356 ? 14.463  52.570 74.264 1.00 20.08 ? 356  VAL A C   1 
ATOM   2789 O  O   . VAL A 1  356 ? 14.123  52.293 73.101 1.00 19.78 ? 356  VAL A O   1 
ATOM   2790 C  CB  . VAL A 1  356 ? 16.906  52.860 74.907 1.00 19.02 ? 356  VAL A CB  1 
ATOM   2791 C  CG1 . VAL A 1  356 ? 17.176  51.667 73.998 1.00 17.30 ? 356  VAL A CG1 1 
ATOM   2792 C  CG2 . VAL A 1  356 ? 18.046  53.864 74.852 1.00 15.27 ? 356  VAL A CG2 1 
ATOM   2793 N  N   . LYS A 1  357 ? 13.865  52.072 75.342 1.00 20.73 ? 357  LYS A N   1 
ATOM   2794 C  CA  . LYS A 1  357 ? 12.750  51.126 75.264 1.00 22.11 ? 357  LYS A CA  1 
ATOM   2795 C  C   . LYS A 1  357 ? 11.546  51.714 74.522 1.00 21.17 ? 357  LYS A C   1 
ATOM   2796 O  O   . LYS A 1  357 ? 10.950  51.045 73.682 1.00 22.53 ? 357  LYS A O   1 
ATOM   2797 C  CB  . LYS A 1  357 ? 12.338  50.707 76.681 1.00 22.00 ? 357  LYS A CB  1 
ATOM   2798 C  CG  . LYS A 1  357 ? 12.316  49.207 76.927 1.00 26.49 ? 357  LYS A CG  1 
ATOM   2799 C  CD  . LYS A 1  357 ? 10.997  48.589 76.488 1.00 31.21 ? 357  LYS A CD  1 
ATOM   2800 C  CE  . LYS A 1  357 ? 10.829  47.179 77.001 1.00 33.55 ? 357  LYS A CE  1 
ATOM   2801 N  NZ  . LYS A 1  357 ? 11.529  46.259 76.040 1.00 38.98 ? 357  LYS A NZ  1 
ATOM   2802 N  N   . LEU A 1  358 ? 11.183  52.955 74.835 1.00 20.59 ? 358  LEU A N   1 
ATOM   2803 C  CA  . LEU A 1  358 ? 10.116  53.647 74.114 1.00 20.14 ? 358  LEU A CA  1 
ATOM   2804 C  C   . LEU A 1  358 ? 10.454  53.877 72.633 1.00 20.20 ? 358  LEU A C   1 
ATOM   2805 O  O   . LEU A 1  358 ? 9.562   53.879 71.782 1.00 19.63 ? 358  LEU A O   1 
ATOM   2806 C  CB  . LEU A 1  358 ? 9.789   54.977 74.772 1.00 19.84 ? 358  LEU A CB  1 
ATOM   2807 C  CG  . LEU A 1  358 ? 9.234   54.915 76.201 1.00 20.88 ? 358  LEU A CG  1 
ATOM   2808 C  CD1 . LEU A 1  358 ? 9.087   56.313 76.792 1.00 15.55 ? 358  LEU A CD1 1 
ATOM   2809 C  CD2 . LEU A 1  358 ? 7.882   54.156 76.250 1.00 20.86 ? 358  LEU A CD2 1 
ATOM   2810 N  N   . SER A 1  359 ? 11.742  54.071 72.348 1.00 20.50 ? 359  SER A N   1 
ATOM   2811 C  CA  . SER A 1  359 ? 12.204  54.476 71.019 1.00 20.93 ? 359  SER A CA  1 
ATOM   2812 C  C   . SER A 1  359 ? 12.353  53.341 70.035 1.00 20.85 ? 359  SER A C   1 
ATOM   2813 O  O   . SER A 1  359 ? 12.189  53.554 68.833 1.00 20.63 ? 359  SER A O   1 
ATOM   2814 C  CB  . SER A 1  359 ? 13.534  55.192 71.124 1.00 20.41 ? 359  SER A CB  1 
ATOM   2815 O  OG  . SER A 1  359 ? 13.387  56.358 71.872 1.00 22.33 ? 359  SER A OG  1 
ATOM   2816 N  N   . VAL A 1  360 ? 12.674  52.151 70.544 1.00 21.18 ? 360  VAL A N   1 
ATOM   2817 C  CA  . VAL A 1  360 ? 12.858  50.974 69.727 1.00 21.81 ? 360  VAL A CA  1 
ATOM   2818 C  C   . VAL A 1  360 ? 11.932  49.838 70.222 1.00 23.21 ? 360  VAL A C   1 
ATOM   2819 O  O   . VAL A 1  360 ? 12.398  48.786 70.652 1.00 22.67 ? 360  VAL A O   1 
ATOM   2820 C  CB  . VAL A 1  360 ? 14.338  50.526 69.721 1.00 21.44 ? 360  VAL A CB  1 
ATOM   2821 C  CG1 . VAL A 1  360 ? 14.587  49.580 68.568 1.00 20.86 ? 360  VAL A CG1 1 
ATOM   2822 C  CG2 . VAL A 1  360 ? 15.259  51.731 69.601 1.00 21.87 ? 360  VAL A CG2 1 
ATOM   2823 N  N   . PRO A 1  361 ? 10.606  50.044 70.129 1.00 25.02 ? 361  PRO A N   1 
ATOM   2824 C  CA  . PRO A 1  361 ? 9.666   49.163 70.839 1.00 26.55 ? 361  PRO A CA  1 
ATOM   2825 C  C   . PRO A 1  361 ? 9.726   47.718 70.365 1.00 28.26 ? 361  PRO A C   1 
ATOM   2826 O  O   . PRO A 1  361 ? 9.462   46.795 71.137 1.00 29.09 ? 361  PRO A O   1 
ATOM   2827 C  CB  . PRO A 1  361 ? 8.303   49.787 70.514 1.00 26.63 ? 361  PRO A CB  1 
ATOM   2828 C  CG  . PRO A 1  361 ? 8.502   50.492 69.213 1.00 25.07 ? 361  PRO A CG  1 
ATOM   2829 C  CD  . PRO A 1  361 ? 9.894   51.048 69.310 1.00 24.74 ? 361  PRO A CD  1 
ATOM   2830 N  N   . HIS A 1  362 ? 10.106  47.520 69.111 1.00 30.04 ? 362  HIS A N   1 
ATOM   2831 C  CA  . HIS A 1  362 ? 10.256  46.175 68.556 1.00 32.38 ? 362  HIS A CA  1 
ATOM   2832 C  C   . HIS A 1  362 ? 11.562  45.436 68.925 1.00 32.70 ? 362  HIS A C   1 
ATOM   2833 O  O   . HIS A 1  362 ? 11.900  44.422 68.283 1.00 33.84 ? 362  HIS A O   1 
ATOM   2834 C  CB  . HIS A 1  362 ? 10.132  46.241 67.030 1.00 33.42 ? 362  HIS A CB  1 
ATOM   2835 C  CG  . HIS A 1  362 ? 11.185  47.089 66.381 1.00 35.36 ? 362  HIS A CG  1 
ATOM   2836 N  ND1 . HIS A 1  362 ? 11.132  48.468 66.377 1.00 37.82 ? 362  HIS A ND1 1 
ATOM   2837 C  CD2 . HIS A 1  362 ? 12.308  46.753 65.700 1.00 36.24 ? 362  HIS A CD2 1 
ATOM   2838 C  CE1 . HIS A 1  362 ? 12.184  48.945 65.728 1.00 38.00 ? 362  HIS A CE1 1 
ATOM   2839 N  NE2 . HIS A 1  362 ? 12.910  47.926 65.301 1.00 35.63 ? 362  HIS A NE2 1 
ATOM   2840 N  N   . ALA A 1  363 ? 12.293  45.915 69.943 1.00 32.17 ? 363  ALA A N   1 
ATOM   2841 C  CA  . ALA A 1  363 ? 13.626  45.366 70.227 1.00 30.68 ? 363  ALA A CA  1 
ATOM   2842 C  C   . ALA A 1  363 ? 13.655  44.396 71.384 1.00 29.72 ? 363  ALA A C   1 
ATOM   2843 O  O   . ALA A 1  363 ? 13.104  44.677 72.451 1.00 29.96 ? 363  ALA A O   1 
ATOM   2844 C  CB  . ALA A 1  363 ? 14.636  46.495 70.480 1.00 31.11 ? 363  ALA A CB  1 
ATOM   2845 N  N   . ASN A 1  364 ? 14.340  43.273 71.192 1.00 28.18 ? 364  ASN A N   1 
ATOM   2846 C  CA  . ASN A 1  364 ? 14.659  42.401 72.308 1.00 27.26 ? 364  ASN A CA  1 
ATOM   2847 C  C   . ASN A 1  364 ? 15.763  43.073 73.162 1.00 26.63 ? 364  ASN A C   1 
ATOM   2848 O  O   . ASN A 1  364 ? 16.276  44.148 72.786 1.00 26.87 ? 364  ASN A O   1 
ATOM   2849 C  CB  . ASN A 1  364 ? 15.046  41.004 71.796 1.00 26.99 ? 364  ASN A CB  1 
ATOM   2850 C  CG  . ASN A 1  364 ? 16.312  41.019 70.964 1.00 26.78 ? 364  ASN A CG  1 
ATOM   2851 O  OD1 . ASN A 1  364 ? 17.053  42.008 70.941 1.00 24.62 ? 364  ASN A OD1 1 
ATOM   2852 N  ND2 . ASN A 1  364 ? 16.562  39.930 70.269 1.00 25.58 ? 364  ASN A ND2 1 
ATOM   2853 N  N   . ASP A 1  365 ? 16.105  42.477 74.304 1.00 25.93 ? 365  ASP A N   1 
ATOM   2854 C  CA  . ASP A 1  365 ? 17.075  43.065 75.239 1.00 25.74 ? 365  ASP A CA  1 
ATOM   2855 C  C   . ASP A 1  365 ? 18.458  43.287 74.614 1.00 24.60 ? 365  ASP A C   1 
ATOM   2856 O  O   . ASP A 1  365 ? 19.100  44.319 74.865 1.00 23.87 ? 365  ASP A O   1 
ATOM   2857 C  CB  . ASP A 1  365 ? 17.256  42.189 76.488 1.00 27.41 ? 365  ASP A CB  1 
ATOM   2858 C  CG  . ASP A 1  365 ? 16.107  42.304 77.472 1.00 32.24 ? 365  ASP A CG  1 
ATOM   2859 O  OD1 . ASP A 1  365 ? 15.103  43.013 77.184 1.00 36.81 ? 365  ASP A OD1 1 
ATOM   2860 O  OD2 . ASP A 1  365 ? 16.206  41.665 78.551 1.00 37.91 ? 365  ASP A OD2 1 
ATOM   2861 N  N   . LEU A 1  366 ? 18.922  42.299 73.845 1.00 22.81 ? 366  LEU A N   1 
ATOM   2862 C  CA  . LEU A 1  366 ? 20.176  42.407 73.130 1.00 21.60 ? 366  LEU A CA  1 
ATOM   2863 C  C   . LEU A 1  366 ? 20.128  43.629 72.214 1.00 21.26 ? 366  LEU A C   1 
ATOM   2864 O  O   . LEU A 1  366 ? 21.073  44.444 72.183 1.00 20.59 ? 366  LEU A O   1 
ATOM   2865 C  CB  . LEU A 1  366 ? 20.441  41.145 72.316 1.00 21.92 ? 366  LEU A CB  1 
ATOM   2866 C  CG  . LEU A 1  366 ? 21.773  41.162 71.552 1.00 22.65 ? 366  LEU A CG  1 
ATOM   2867 C  CD1 . LEU A 1  366 ? 22.919  41.094 72.532 1.00 24.30 ? 366  LEU A CD1 1 
ATOM   2868 C  CD2 . LEU A 1  366 ? 21.848  40.056 70.552 1.00 22.11 ? 366  LEU A CD2 1 
ATOM   2869 N  N   . GLY A 1  367 ? 19.017  43.761 71.484 1.00 19.94 ? 367  GLY A N   1 
ATOM   2870 C  CA  . GLY A 1  367 ? 18.767  44.927 70.651 1.00 19.58 ? 367  GLY A CA  1 
ATOM   2871 C  C   . GLY A 1  367 ? 18.874  46.227 71.403 1.00 18.75 ? 367  GLY A C   1 
ATOM   2872 O  O   . GLY A 1  367 ? 19.584  47.122 70.971 1.00 19.55 ? 367  GLY A O   1 
ATOM   2873 N  N   . LEU A 1  368 ? 18.205  46.305 72.552 1.00 18.64 ? 368  LEU A N   1 
ATOM   2874 C  CA  . LEU A 1  368 ? 18.236  47.488 73.395 1.00 18.44 ? 368  LEU A CA  1 
ATOM   2875 C  C   . LEU A 1  368 ? 19.637  47.810 73.906 1.00 18.78 ? 368  LEU A C   1 
ATOM   2876 O  O   . LEU A 1  368 ? 20.016  48.998 73.981 1.00 19.44 ? 368  LEU A O   1 
ATOM   2877 C  CB  . LEU A 1  368 ? 17.260  47.385 74.567 1.00 17.92 ? 368  LEU A CB  1 
ATOM   2878 C  CG  . LEU A 1  368 ? 15.760  47.339 74.240 1.00 20.15 ? 368  LEU A CG  1 
ATOM   2879 C  CD1 . LEU A 1  368 ? 14.992  46.835 75.432 1.00 18.53 ? 368  LEU A CD1 1 
ATOM   2880 C  CD2 . LEU A 1  368 ? 15.203  48.711 73.760 1.00 20.93 ? 368  LEU A CD2 1 
ATOM   2881 N  N   . ASP A 1  369 ? 20.392  46.775 74.273 1.00 18.58 ? 369  ASP A N   1 
ATOM   2882 C  CA  . ASP A 1  369 ? 21.803  46.942 74.666 1.00 19.61 ? 369  ASP A CA  1 
ATOM   2883 C  C   . ASP A 1  369 ? 22.661  47.459 73.524 1.00 18.80 ? 369  ASP A C   1 
ATOM   2884 O  O   . ASP A 1  369 ? 23.542  48.300 73.758 1.00 19.28 ? 369  ASP A O   1 
ATOM   2885 C  CB  . ASP A 1  369 ? 22.422  45.631 75.187 1.00 20.23 ? 369  ASP A CB  1 
ATOM   2886 C  CG  . ASP A 1  369 ? 21.798  45.167 76.500 1.00 24.06 ? 369  ASP A CG  1 
ATOM   2887 O  OD1 . ASP A 1  369 ? 21.122  45.972 77.194 1.00 25.32 ? 369  ASP A OD1 1 
ATOM   2888 O  OD2 . ASP A 1  369 ? 21.971  43.973 76.827 1.00 29.52 ? 369  ASP A OD2 1 
ATOM   2889 N  N   . ALA A 1  370 ? 22.414  46.967 72.306 1.00 17.76 ? 370  ALA A N   1 
ATOM   2890 C  CA  . ALA A 1  370 ? 23.148  47.477 71.144 1.00 17.71 ? 370  ALA A CA  1 
ATOM   2891 C  C   . ALA A 1  370 ? 22.932  48.984 70.951 1.00 17.14 ? 370  ALA A C   1 
ATOM   2892 O  O   . ALA A 1  370 ? 23.888  49.734 70.820 1.00 17.33 ? 370  ALA A O   1 
ATOM   2893 C  CB  . ALA A 1  370 ? 22.816  46.698 69.896 1.00 17.89 ? 370  ALA A CB  1 
ATOM   2894 N  N   . VAL A 1  371 ? 21.691  49.436 71.034 1.00 17.43 ? 371  VAL A N   1 
ATOM   2895 C  CA  . VAL A 1  371 ? 21.382  50.865 70.895 1.00 17.39 ? 371  VAL A CA  1 
ATOM   2896 C  C   . VAL A 1  371 ? 22.035  51.666 72.019 1.00 18.23 ? 371  VAL A C   1 
ATOM   2897 O  O   . VAL A 1  371 ? 22.706  52.706 71.792 1.00 17.96 ? 371  VAL A O   1 
ATOM   2898 C  CB  . VAL A 1  371 ? 19.834  51.108 70.883 1.00 17.48 ? 371  VAL A CB  1 
ATOM   2899 C  CG1 . VAL A 1  371 ? 19.497  52.590 70.940 1.00 15.29 ? 371  VAL A CG1 1 
ATOM   2900 C  CG2 . VAL A 1  371 ? 19.190  50.449 69.649 1.00 18.12 ? 371  VAL A CG2 1 
ATOM   2901 N  N   . THR A 1  372 ? 21.878  51.160 73.235 1.00 18.79 ? 372  THR A N   1 
ATOM   2902 C  CA  . THR A 1  372 ? 22.414  51.862 74.403 1.00 19.63 ? 372  THR A CA  1 
ATOM   2903 C  C   . THR A 1  372 ? 23.906  52.058 74.256 1.00 20.09 ? 372  THR A C   1 
ATOM   2904 O  O   . THR A 1  372 ? 24.396  53.183 74.375 1.00 21.23 ? 372  THR A O   1 
ATOM   2905 C  CB  . THR A 1  372 ? 22.061  51.097 75.712 1.00 20.16 ? 372  THR A CB  1 
ATOM   2906 O  OG1 . THR A 1  372 ? 20.631  51.017 75.806 1.00 19.78 ? 372  THR A OG1 1 
ATOM   2907 C  CG2 . THR A 1  372 ? 22.647  51.799 76.950 1.00 17.62 ? 372  THR A CG2 1 
ATOM   2908 N  N   . LEU A 1  373 ? 24.624  50.981 73.955 1.00 19.99 ? 373  LEU A N   1 
ATOM   2909 C  CA  . LEU A 1  373 ? 26.065  51.062 73.746 1.00 20.15 ? 373  LEU A CA  1 
ATOM   2910 C  C   . LEU A 1  373 ? 26.453  52.041 72.640 1.00 20.64 ? 373  LEU A C   1 
ATOM   2911 O  O   . LEU A 1  373 ? 27.412  52.792 72.794 1.00 20.28 ? 373  LEU A O   1 
ATOM   2912 C  CB  . LEU A 1  373 ? 26.633  49.677 73.408 1.00 20.16 ? 373  LEU A CB  1 
ATOM   2913 C  CG  . LEU A 1  373 ? 28.118  49.567 73.090 1.00 20.86 ? 373  LEU A CG  1 
ATOM   2914 C  CD1 . LEU A 1  373 ? 28.948  50.145 74.229 1.00 23.16 ? 373  LEU A CD1 1 
ATOM   2915 C  CD2 . LEU A 1  373 ? 28.475  48.127 72.864 1.00 22.14 ? 373  LEU A CD2 1 
ATOM   2916 N  N   . GLN A 1  374 ? 25.694  52.037 71.536 1.00 20.56 ? 374  GLN A N   1 
ATOM   2917 C  CA  . GLN A 1  374 ? 26.044  52.833 70.365 1.00 20.06 ? 374  GLN A CA  1 
ATOM   2918 C  C   . GLN A 1  374 ? 25.946  54.332 70.648 1.00 19.90 ? 374  GLN A C   1 
ATOM   2919 O  O   . GLN A 1  374 ? 26.616  55.117 70.003 1.00 21.43 ? 374  GLN A O   1 
ATOM   2920 C  CB  . GLN A 1  374 ? 25.132  52.431 69.187 1.00 20.13 ? 374  GLN A CB  1 
ATOM   2921 C  CG  . GLN A 1  374 ? 25.503  53.015 67.833 1.00 21.57 ? 374  GLN A CG  1 
ATOM   2922 C  CD  . GLN A 1  374 ? 26.719  52.345 67.198 1.00 22.97 ? 374  GLN A CD  1 
ATOM   2923 O  OE1 . GLN A 1  374 ? 27.274  52.856 66.221 1.00 26.16 ? 374  GLN A OE1 1 
ATOM   2924 N  NE2 . GLN A 1  374 ? 27.150  51.212 67.759 1.00 22.70 ? 374  GLN A NE2 1 
ATOM   2925 N  N   . TYR A 1  375 ? 25.102  54.716 71.601 1.00 19.06 ? 375  TYR A N   1 
ATOM   2926 C  CA  . TYR A 1  375 ? 24.824  56.104 71.904 1.00 17.84 ? 375  TYR A CA  1 
ATOM   2927 C  C   . TYR A 1  375 ? 25.259  56.544 73.314 1.00 17.85 ? 375  TYR A C   1 
ATOM   2928 O  O   . TYR A 1  375 ? 24.891  57.631 73.763 1.00 17.47 ? 375  TYR A O   1 
ATOM   2929 C  CB  . TYR A 1  375 ? 23.324  56.360 71.715 1.00 17.28 ? 375  TYR A CB  1 
ATOM   2930 C  CG  . TYR A 1  375 ? 22.914  56.461 70.246 1.00 16.96 ? 375  TYR A CG  1 
ATOM   2931 C  CD1 . TYR A 1  375 ? 22.594  55.314 69.492 1.00 15.15 ? 375  TYR A CD1 1 
ATOM   2932 C  CD2 . TYR A 1  375 ? 22.891  57.682 69.606 1.00 15.10 ? 375  TYR A CD2 1 
ATOM   2933 C  CE1 . TYR A 1  375 ? 22.223  55.414 68.134 1.00 17.18 ? 375  TYR A CE1 1 
ATOM   2934 C  CE2 . TYR A 1  375 ? 22.515  57.797 68.248 1.00 16.30 ? 375  TYR A CE2 1 
ATOM   2935 C  CZ  . TYR A 1  375 ? 22.177  56.676 67.524 1.00 16.18 ? 375  TYR A CZ  1 
ATOM   2936 O  OH  . TYR A 1  375 ? 21.822  56.818 66.195 1.00 15.71 ? 375  TYR A OH  1 
ATOM   2937 N  N   . THR A 1  376 ? 26.029  55.722 74.013 1.00 16.93 ? 376  THR A N   1 
ATOM   2938 C  CA  . THR A 1  376 ? 26.470  56.087 75.360 1.00 17.61 ? 376  THR A CA  1 
ATOM   2939 C  C   . THR A 1  376 ? 27.957  56.369 75.357 1.00 18.74 ? 376  THR A C   1 
ATOM   2940 O  O   . THR A 1  376 ? 28.776  55.502 74.970 1.00 18.05 ? 376  THR A O   1 
ATOM   2941 C  CB  . THR A 1  376 ? 26.221  54.946 76.365 1.00 17.52 ? 376  THR A CB  1 
ATOM   2942 O  OG1 . THR A 1  376 ? 24.818  54.646 76.394 1.00 16.84 ? 376  THR A OG1 1 
ATOM   2943 C  CG2 . THR A 1  376 ? 26.711  55.316 77.787 1.00 17.03 ? 376  THR A CG2 1 
ATOM   2944 N  N   . ASP A 1  377 ? 28.307  57.569 75.805 1.00 19.61 ? 377  ASP A N   1 
ATOM   2945 C  CA  . ASP A 1  377 ? 29.694  57.884 76.134 1.00 20.91 ? 377  ASP A CA  1 
ATOM   2946 C  C   . ASP A 1  377 ? 30.076  57.284 77.504 1.00 22.18 ? 377  ASP A C   1 
ATOM   2947 O  O   . ASP A 1  377 ? 29.795  57.883 78.550 1.00 22.26 ? 377  ASP A O   1 
ATOM   2948 C  CB  . ASP A 1  377 ? 29.865  59.384 76.155 1.00 20.28 ? 377  ASP A CB  1 
ATOM   2949 C  CG  . ASP A 1  377 ? 31.273  59.792 76.510 1.00 22.13 ? 377  ASP A CG  1 
ATOM   2950 O  OD1 . ASP A 1  377 ? 32.082  58.874 76.799 1.00 20.12 ? 377  ASP A OD1 1 
ATOM   2951 O  OD2 . ASP A 1  377 ? 31.558  61.026 76.513 1.00 21.90 ? 377  ASP A OD2 1 
ATOM   2952 N  N   . TRP A 1  378 ? 30.704  56.108 77.501 1.00 23.12 ? 378  TRP A N   1 
ATOM   2953 C  CA  . TRP A 1  378 ? 31.070  55.428 78.755 1.00 24.58 ? 378  TRP A CA  1 
ATOM   2954 C  C   . TRP A 1  378 ? 32.181  56.067 79.606 1.00 25.06 ? 378  TRP A C   1 
ATOM   2955 O  O   . TRP A 1  378 ? 32.449  55.619 80.720 1.00 25.14 ? 378  TRP A O   1 
ATOM   2956 C  CB  . TRP A 1  378 ? 31.349  53.922 78.539 1.00 24.47 ? 378  TRP A CB  1 
ATOM   2957 C  CG  . TRP A 1  378 ? 30.104  53.167 78.291 1.00 26.75 ? 378  TRP A CG  1 
ATOM   2958 C  CD1 . TRP A 1  378 ? 29.687  52.634 77.112 1.00 25.87 ? 378  TRP A CD1 1 
ATOM   2959 C  CD2 . TRP A 1  378 ? 29.064  52.905 79.243 1.00 29.75 ? 378  TRP A CD2 1 
ATOM   2960 N  NE1 . TRP A 1  378 ? 28.465  52.041 77.271 1.00 26.48 ? 378  TRP A NE1 1 
ATOM   2961 C  CE2 . TRP A 1  378 ? 28.058  52.191 78.569 1.00 28.12 ? 378  TRP A CE2 1 
ATOM   2962 C  CE3 . TRP A 1  378 ? 28.896  53.203 80.611 1.00 32.88 ? 378  TRP A CE3 1 
ATOM   2963 C  CZ2 . TRP A 1  378 ? 26.892  51.763 79.201 1.00 31.17 ? 378  TRP A CZ2 1 
ATOM   2964 C  CZ3 . TRP A 1  378 ? 27.738  52.769 81.254 1.00 34.37 ? 378  TRP A CZ3 1 
ATOM   2965 C  CH2 . TRP A 1  378 ? 26.750  52.050 80.542 1.00 33.28 ? 378  TRP A CH2 1 
ATOM   2966 N  N   . MET A 1  379 ? 32.826  57.098 79.097 1.00 25.91 ? 379  MET A N   1 
ATOM   2967 C  CA  . MET A 1  379 ? 33.681  57.926 79.948 1.00 27.18 ? 379  MET A CA  1 
ATOM   2968 C  C   . MET A 1  379 ? 32.849  58.885 80.802 1.00 27.64 ? 379  MET A C   1 
ATOM   2969 O  O   . MET A 1  379 ? 33.380  59.502 81.720 1.00 28.27 ? 379  MET A O   1 
ATOM   2970 C  CB  . MET A 1  379 ? 34.636  58.767 79.112 1.00 26.87 ? 379  MET A CB  1 
ATOM   2971 C  CG  . MET A 1  379 ? 35.584  57.954 78.319 1.00 29.70 ? 379  MET A CG  1 
ATOM   2972 S  SD  . MET A 1  379 ? 36.827  58.919 77.452 1.00 36.66 ? 379  MET A SD  1 
ATOM   2973 C  CE  . MET A 1  379 ? 35.897  59.608 76.080 1.00 31.84 ? 379  MET A CE  1 
ATOM   2974 N  N   . ASP A 1  380 ? 31.555  59.014 80.504 1.00 27.78 ? 380  ASP A N   1 
ATOM   2975 C  CA  . ASP A 1  380 ? 30.761  60.130 81.037 1.00 27.52 ? 380  ASP A CA  1 
ATOM   2976 C  C   . ASP A 1  380 ? 29.276  59.782 81.015 1.00 27.81 ? 380  ASP A C   1 
ATOM   2977 O  O   . ASP A 1  380 ? 28.443  60.592 80.628 1.00 28.20 ? 380  ASP A O   1 
ATOM   2978 C  CB  . ASP A 1  380 ? 31.043  61.386 80.197 1.00 27.08 ? 380  ASP A CB  1 
ATOM   2979 C  CG  . ASP A 1  380 ? 30.607  62.684 80.877 1.00 26.82 ? 380  ASP A CG  1 
ATOM   2980 O  OD1 . ASP A 1  380 ? 30.235  62.662 82.069 1.00 25.14 ? 380  ASP A OD1 1 
ATOM   2981 O  OD2 . ASP A 1  380 ? 30.638  63.739 80.196 1.00 27.52 ? 380  ASP A OD2 1 
ATOM   2982 N  N   . ASP A 1  381 ? 28.947  58.571 81.454 1.00 28.73 ? 381  ASP A N   1 
ATOM   2983 C  CA  . ASP A 1  381 ? 27.610  58.008 81.260 1.00 29.50 ? 381  ASP A CA  1 
ATOM   2984 C  C   . ASP A 1  381 ? 26.537  58.650 82.125 1.00 29.74 ? 381  ASP A C   1 
ATOM   2985 O  O   . ASP A 1  381 ? 25.353  58.363 81.954 1.00 30.26 ? 381  ASP A O   1 
ATOM   2986 C  CB  . ASP A 1  381 ? 27.634  56.506 81.523 1.00 29.98 ? 381  ASP A CB  1 
ATOM   2987 C  CG  . ASP A 1  381 ? 28.193  56.168 82.901 1.00 31.69 ? 381  ASP A CG  1 
ATOM   2988 O  OD1 . ASP A 1  381 ? 29.330  56.595 83.218 1.00 32.19 ? 381  ASP A OD1 1 
ATOM   2989 O  OD2 . ASP A 1  381 ? 27.485  55.478 83.661 1.00 34.94 ? 381  ASP A OD2 1 
ATOM   2990 N  N   . ASN A 1  382 ? 26.940  59.497 83.065 1.00 29.59 ? 382  ASN A N   1 
ATOM   2991 C  CA  . ASN A 1  382 ? 25.968  60.201 83.892 1.00 29.85 ? 382  ASN A CA  1 
ATOM   2992 C  C   . ASN A 1  382 ? 25.778  61.663 83.538 1.00 29.27 ? 382  ASN A C   1 
ATOM   2993 O  O   . ASN A 1  382 ? 25.136  62.412 84.282 1.00 29.70 ? 382  ASN A O   1 
ATOM   2994 C  CB  . ASN A 1  382 ? 26.239  59.981 85.389 1.00 30.50 ? 382  ASN A CB  1 
ATOM   2995 C  CG  . ASN A 1  382 ? 25.626  58.684 85.868 1.00 33.25 ? 382  ASN A CG  1 
ATOM   2996 O  OD1 . ASN A 1  382 ? 26.329  57.777 86.317 1.00 37.42 ? 382  ASN A OD1 1 
ATOM   2997 N  ND2 . ASN A 1  382 ? 24.303  58.550 85.684 1.00 35.35 ? 382  ASN A ND2 1 
ATOM   2998 N  N   . ASN A 1  383 ? 26.310  62.051 82.379 1.00 27.69 ? 383  ASN A N   1 
ATOM   2999 C  CA  . ASN A 1  383 ? 26.152  63.398 81.871 1.00 26.16 ? 383  ASN A CA  1 
ATOM   3000 C  C   . ASN A 1  383 ? 24.719  63.581 81.346 1.00 24.67 ? 383  ASN A C   1 
ATOM   3001 O  O   . ASN A 1  383 ? 24.346  63.019 80.317 1.00 24.67 ? 383  ASN A O   1 
ATOM   3002 C  CB  . ASN A 1  383 ? 27.197  63.605 80.777 1.00 26.25 ? 383  ASN A CB  1 
ATOM   3003 C  CG  . ASN A 1  383 ? 27.200  65.004 80.219 1.00 26.49 ? 383  ASN A CG  1 
ATOM   3004 O  OD1 . ASN A 1  383 ? 26.146  65.625 79.993 1.00 25.13 ? 383  ASN A OD1 1 
ATOM   3005 N  ND2 . ASN A 1  383 ? 28.398  65.507 79.954 1.00 27.07 ? 383  ASN A ND2 1 
ATOM   3006 N  N   . GLY A 1  384 ? 23.929  64.358 82.071 1.00 22.66 ? 384  GLY A N   1 
ATOM   3007 C  CA  . GLY A 1  384 ? 22.530  64.604 81.758 1.00 21.00 ? 384  GLY A CA  1 
ATOM   3008 C  C   . GLY A 1  384 ? 22.226  65.212 80.405 1.00 20.50 ? 384  GLY A C   1 
ATOM   3009 O  O   . GLY A 1  384 ? 21.168  64.945 79.841 1.00 19.59 ? 384  GLY A O   1 
ATOM   3010 N  N   . ILE A 1  385 ? 23.149  66.034 79.904 1.00 20.49 ? 385  ILE A N   1 
ATOM   3011 C  CA  . ILE A 1  385 ? 23.043  66.647 78.585 1.00 20.89 ? 385  ILE A CA  1 
ATOM   3012 C  C   . ILE A 1  385 ? 23.320  65.609 77.514 1.00 20.78 ? 385  ILE A C   1 
ATOM   3013 O  O   . ILE A 1  385 ? 22.656  65.592 76.496 1.00 21.13 ? 385  ILE A O   1 
ATOM   3014 C  CB  . ILE A 1  385 ? 24.041  67.828 78.404 1.00 21.02 ? 385  ILE A CB  1 
ATOM   3015 C  CG1 . ILE A 1  385 ? 23.859  68.858 79.510 1.00 22.91 ? 385  ILE A CG1 1 
ATOM   3016 C  CG2 . ILE A 1  385 ? 23.899  68.507 77.018 1.00 19.72 ? 385  ILE A CG2 1 
ATOM   3017 C  CD1 . ILE A 1  385 ? 22.467  69.265 79.664 1.00 25.74 ? 385  ILE A CD1 1 
ATOM   3018 N  N   . LYS A 1  386 ? 24.312  64.751 77.753 1.00 20.84 ? 386  LYS A N   1 
ATOM   3019 C  CA  . LYS A 1  386 ? 24.672  63.703 76.803 1.00 20.41 ? 386  LYS A CA  1 
ATOM   3020 C  C   . LYS A 1  386 ? 23.586  62.649 76.671 1.00 19.49 ? 386  LYS A C   1 
ATOM   3021 O  O   . LYS A 1  386 ? 23.302  62.215 75.570 1.00 18.95 ? 386  LYS A O   1 
ATOM   3022 C  CB  . LYS A 1  386 ? 26.027  63.085 77.140 1.00 20.08 ? 386  LYS A CB  1 
ATOM   3023 C  CG  . LYS A 1  386 ? 27.210  64.008 76.726 1.00 23.40 ? 386  LYS A CG  1 
ATOM   3024 C  CD  . LYS A 1  386 ? 28.539  63.423 77.155 1.00 23.71 ? 386  LYS A CD  1 
ATOM   3025 C  CE  . LYS A 1  386 ? 29.705  64.046 76.420 1.00 24.56 ? 386  LYS A CE  1 
ATOM   3026 N  NZ  . LYS A 1  386 ? 30.939  63.777 77.243 1.00 24.69 ? 386  LYS A NZ  1 
ATOM   3027 N  N   . ASN A 1  387 ? 22.989  62.260 77.797 1.00 19.21 ? 387  ASN A N   1 
ATOM   3028 C  CA  . ASN A 1  387 ? 21.857  61.356 77.813 1.00 19.47 ? 387  ASN A CA  1 
ATOM   3029 C  C   . ASN A 1  387 ? 20.648  61.961 77.073 1.00 18.43 ? 387  ASN A C   1 
ATOM   3030 O  O   . ASN A 1  387 ? 20.031  61.296 76.278 1.00 18.34 ? 387  ASN A O   1 
ATOM   3031 C  CB  . ASN A 1  387 ? 21.486  60.981 79.256 1.00 19.54 ? 387  ASN A CB  1 
ATOM   3032 C  CG  . ASN A 1  387 ? 22.544  60.099 79.937 1.00 22.39 ? 387  ASN A CG  1 
ATOM   3033 O  OD1 . ASN A 1  387 ? 23.456  59.591 79.291 1.00 24.07 ? 387  ASN A OD1 1 
ATOM   3034 N  ND2 . ASN A 1  387 ? 22.426  59.934 81.256 1.00 23.30 ? 387  ASN A ND2 1 
ATOM   3035 N  N   . ARG A 1  388 ? 20.337  63.226 77.332 1.00 18.09 ? 388  ARG A N   1 
ATOM   3036 C  CA  . ARG A 1  388 ? 19.248  63.929 76.643 1.00 17.48 ? 388  ARG A CA  1 
ATOM   3037 C  C   . ARG A 1  388 ? 19.517  63.979 75.115 1.00 17.95 ? 388  ARG A C   1 
ATOM   3038 O  O   . ARG A 1  388 ? 18.690  63.525 74.307 1.00 17.01 ? 388  ARG A O   1 
ATOM   3039 C  CB  . ARG A 1  388 ? 19.063  65.322 77.257 1.00 18.13 ? 388  ARG A CB  1 
ATOM   3040 C  CG  . ARG A 1  388 ? 17.914  66.192 76.696 1.00 17.65 ? 388  ARG A CG  1 
ATOM   3041 C  CD  . ARG A 1  388 ? 18.513  67.346 75.951 1.00 20.02 ? 388  ARG A CD  1 
ATOM   3042 N  NE  . ARG A 1  388 ? 18.662  68.400 76.902 1.00 23.55 ? 388  ARG A NE  1 
ATOM   3043 C  CZ  . ARG A 1  388 ? 19.642  69.298 76.942 1.00 21.68 ? 388  ARG A CZ  1 
ATOM   3044 N  NH1 . ARG A 1  388 ? 20.605  69.348 76.032 1.00 17.34 ? 388  ARG A NH1 1 
ATOM   3045 N  NH2 . ARG A 1  388 ? 19.612  70.169 77.931 1.00 21.40 ? 388  ARG A NH2 1 
ATOM   3046 N  N   . ASP A 1  389 ? 20.695  64.470 74.731 1.00 16.89 ? 389  ASP A N   1 
ATOM   3047 C  CA  . ASP A 1  389 ? 21.037  64.575 73.325 1.00 16.88 ? 389  ASP A CA  1 
ATOM   3048 C  C   . ASP A 1  389 ? 21.162  63.219 72.606 1.00 16.76 ? 389  ASP A C   1 
ATOM   3049 O  O   . ASP A 1  389 ? 20.776  63.109 71.430 1.00 15.85 ? 389  ASP A O   1 
ATOM   3050 C  CB  . ASP A 1  389 ? 22.306  65.397 73.162 1.00 16.61 ? 389  ASP A CB  1 
ATOM   3051 C  CG  . ASP A 1  389 ? 22.116  66.839 73.571 1.00 17.02 ? 389  ASP A CG  1 
ATOM   3052 O  OD1 . ASP A 1  389 ? 20.960  67.295 73.714 1.00 12.91 ? 389  ASP A OD1 1 
ATOM   3053 O  OD2 . ASP A 1  389 ? 23.144  67.525 73.736 1.00 19.57 ? 389  ASP A OD2 1 
ATOM   3054 N  N   . GLY A 1  390 ? 21.674  62.212 73.323 1.00 16.42 ? 390  GLY A N   1 
ATOM   3055 C  CA  . GLY A 1  390 ? 21.782  60.822 72.831 1.00 16.38 ? 390  GLY A CA  1 
ATOM   3056 C  C   . GLY A 1  390 ? 20.419  60.236 72.490 1.00 16.74 ? 390  GLY A C   1 
ATOM   3057 O  O   . GLY A 1  390 ? 20.225  59.680 71.415 1.00 16.96 ? 390  GLY A O   1 
ATOM   3058 N  N   . LEU A 1  391 ? 19.461  60.413 73.393 1.00 16.40 ? 391  LEU A N   1 
ATOM   3059 C  CA  . LEU A 1  391 ? 18.090  60.053 73.148 1.00 16.42 ? 391  LEU A CA  1 
ATOM   3060 C  C   . LEU A 1  391 ? 17.461  60.807 71.969 1.00 15.97 ? 391  LEU A C   1 
ATOM   3061 O  O   . LEU A 1  391 ? 16.767  60.202 71.136 1.00 14.60 ? 391  LEU A O   1 
ATOM   3062 C  CB  . LEU A 1  391 ? 17.266  60.257 74.407 1.00 17.00 ? 391  LEU A CB  1 
ATOM   3063 C  CG  . LEU A 1  391 ? 16.947  58.985 75.197 1.00 19.60 ? 391  LEU A CG  1 
ATOM   3064 C  CD1 . LEU A 1  391 ? 15.958  59.296 76.356 1.00 20.18 ? 391  LEU A CD1 1 
ATOM   3065 C  CD2 . LEU A 1  391 ? 16.362  57.884 74.299 1.00 22.60 ? 391  LEU A CD2 1 
ATOM   3066 N  N   . ASP A 1  392 ? 17.690  62.117 71.917 1.00 14.79 ? 392  ASP A N   1 
ATOM   3067 C  CA  . ASP A 1  392 ? 17.281  62.911 70.796 1.00 15.27 ? 392  ASP A CA  1 
ATOM   3068 C  C   . ASP A 1  392 ? 17.805  62.297 69.490 1.00 14.69 ? 392  ASP A C   1 
ATOM   3069 O  O   . ASP A 1  392 ? 17.043  62.037 68.585 1.00 14.13 ? 392  ASP A O   1 
ATOM   3070 C  CB  . ASP A 1  392 ? 17.762  64.344 70.982 1.00 16.51 ? 392  ASP A CB  1 
ATOM   3071 C  CG  . ASP A 1  392 ? 16.984  65.344 70.141 1.00 20.29 ? 392  ASP A CG  1 
ATOM   3072 O  OD1 . ASP A 1  392 ? 16.356  64.936 69.142 1.00 24.76 ? 392  ASP A OD1 1 
ATOM   3073 O  OD2 . ASP A 1  392 ? 16.995  66.546 70.493 1.00 26.04 ? 392  ASP A OD2 1 
ATOM   3074 N  N   . ASP A 1  393 ? 19.099  62.016 69.414 1.00 14.75 ? 393  ASP A N   1 
ATOM   3075 C  CA  . ASP A 1  393 ? 19.671  61.352 68.250 1.00 13.96 ? 393  ASP A CA  1 
ATOM   3076 C  C   . ASP A 1  393 ? 19.099  59.974 67.976 1.00 14.02 ? 393  ASP A C   1 
ATOM   3077 O  O   . ASP A 1  393 ? 18.816  59.627 66.811 1.00 13.95 ? 393  ASP A O   1 
ATOM   3078 C  CB  . ASP A 1  393 ? 21.189  61.292 68.392 1.00 14.69 ? 393  ASP A CB  1 
ATOM   3079 C  CG  . ASP A 1  393 ? 21.825  62.648 68.161 1.00 16.34 ? 393  ASP A CG  1 
ATOM   3080 O  OD1 . ASP A 1  393 ? 21.146  63.546 67.632 1.00 20.58 ? 393  ASP A OD1 1 
ATOM   3081 O  OD2 . ASP A 1  393 ? 23.003  62.826 68.469 1.00 20.59 ? 393  ASP A OD2 1 
ATOM   3082 N  N   . ILE A 1  394 ? 18.898  59.184 69.031 1.00 12.73 ? 394  ILE A N   1 
ATOM   3083 C  CA  . ILE A 1  394 ? 18.306  57.875 68.835 1.00 11.97 ? 394  ILE A CA  1 
ATOM   3084 C  C   . ILE A 1  394 ? 16.983  57.973 68.099 1.00 11.93 ? 394  ILE A C   1 
ATOM   3085 O  O   . ILE A 1  394 ? 16.761  57.255 67.121 1.00 12.58 ? 394  ILE A O   1 
ATOM   3086 C  CB  . ILE A 1  394 ? 18.163  57.065 70.152 1.00 11.90 ? 394  ILE A CB  1 
ATOM   3087 C  CG1 . ILE A 1  394 ? 19.548  56.549 70.575 1.00 10.23 ? 394  ILE A CG1 1 
ATOM   3088 C  CG2 . ILE A 1  394 ? 17.144  55.874 69.984 1.00 9.74  ? 394  ILE A CG2 1 
ATOM   3089 C  CD1 . ILE A 1  394 ? 19.655  56.210 72.061 1.00 11.41 ? 394  ILE A CD1 1 
ATOM   3090 N  N   . VAL A 1  395 ? 16.116  58.870 68.550 1.00 11.34 ? 395  VAL A N   1 
ATOM   3091 C  CA  . VAL A 1  395 ? 14.786  58.932 68.030 1.00 11.04 ? 395  VAL A CA  1 
ATOM   3092 C  C   . VAL A 1  395 ? 14.816  59.456 66.568 1.00 10.94 ? 395  VAL A C   1 
ATOM   3093 O  O   . VAL A 1  395 ? 14.156  58.898 65.710 1.00 11.12 ? 395  VAL A O   1 
ATOM   3094 C  CB  . VAL A 1  395 ? 13.870  59.776 68.976 1.00 11.78 ? 395  VAL A CB  1 
ATOM   3095 C  CG1 . VAL A 1  395 ? 12.503  60.046 68.347 1.00 9.40  ? 395  VAL A CG1 1 
ATOM   3096 C  CG2 . VAL A 1  395 ? 13.721  59.065 70.351 1.00 11.52 ? 395  VAL A CG2 1 
ATOM   3097 N  N   . GLY A 1  396 ? 15.585  60.512 66.303 1.00 10.34 ? 396  GLY A N   1 
ATOM   3098 C  CA  . GLY A 1  396 ? 15.655  61.095 64.970 1.00 10.85 ? 396  GLY A CA  1 
ATOM   3099 C  C   . GLY A 1  396 ? 16.363  60.198 63.963 1.00 11.95 ? 396  GLY A C   1 
ATOM   3100 O  O   . GLY A 1  396 ? 15.870  60.028 62.843 1.00 12.59 ? 396  GLY A O   1 
ATOM   3101 N  N   . ASP A 1  397 ? 17.512  59.619 64.357 1.00 11.27 ? 397  ASP A N   1 
ATOM   3102 C  CA  . ASP A 1  397 ? 18.193  58.608 63.547 1.00 11.62 ? 397  ASP A CA  1 
ATOM   3103 C  C   . ASP A 1  397 ? 17.293  57.410 63.194 1.00 12.22 ? 397  ASP A C   1 
ATOM   3104 O  O   . ASP A 1  397 ? 17.189  57.052 62.032 1.00 13.03 ? 397  ASP A O   1 
ATOM   3105 C  CB  . ASP A 1  397 ? 19.465  58.101 64.213 1.00 10.96 ? 397  ASP A CB  1 
ATOM   3106 C  CG  . ASP A 1  397 ? 20.556  59.202 64.361 1.00 13.36 ? 397  ASP A CG  1 
ATOM   3107 O  OD1 . ASP A 1  397 ? 20.434  60.318 63.797 1.00 12.04 ? 397  ASP A OD1 1 
ATOM   3108 O  OD2 . ASP A 1  397 ? 21.574  58.929 65.028 1.00 16.13 ? 397  ASP A OD2 1 
ATOM   3109 N  N   . HIS A 1  398 ? 16.673  56.785 64.186 1.00 11.91 ? 398  HIS A N   1 
ATOM   3110 C  CA  . HIS A 1  398 ? 15.870  55.596 63.925 1.00 12.40 ? 398  HIS A CA  1 
ATOM   3111 C  C   . HIS A 1  398 ? 14.631  55.882 63.069 1.00 13.07 ? 398  HIS A C   1 
ATOM   3112 O  O   . HIS A 1  398 ? 14.337  55.108 62.171 1.00 13.97 ? 398  HIS A O   1 
ATOM   3113 C  CB  . HIS A 1  398 ? 15.468  54.889 65.235 1.00 11.51 ? 398  HIS A CB  1 
ATOM   3114 C  CG  . HIS A 1  398 ? 14.409  53.849 65.068 1.00 11.05 ? 398  HIS A CG  1 
ATOM   3115 N  ND1 . HIS A 1  398 ? 14.605  52.692 64.349 1.00 12.62 ? 398  HIS A ND1 1 
ATOM   3116 C  CD2 . HIS A 1  398 ? 13.143  53.783 65.541 1.00 11.23 ? 398  HIS A CD2 1 
ATOM   3117 C  CE1 . HIS A 1  398 ? 13.502  51.964 64.373 1.00 13.02 ? 398  HIS A CE1 1 
ATOM   3118 N  NE2 . HIS A 1  398 ? 12.605  52.596 65.107 1.00 13.28 ? 398  HIS A NE2 1 
ATOM   3119 N  N   . ASN A 1  399 ? 13.934  56.987 63.354 1.00 13.10 ? 399  ASN A N   1 
ATOM   3120 C  CA  . ASN A 1  399 ? 12.642  57.285 62.778 1.00 13.15 ? 399  ASN A CA  1 
ATOM   3121 C  C   . ASN A 1  399 ? 12.651  58.140 61.514 1.00 12.81 ? 399  ASN A C   1 
ATOM   3122 O  O   . ASN A 1  399 ? 11.730  58.050 60.709 1.00 12.80 ? 399  ASN A O   1 
ATOM   3123 C  CB  . ASN A 1  399 ? 11.766  57.953 63.838 1.00 13.33 ? 399  ASN A CB  1 
ATOM   3124 C  CG  . ASN A 1  399 ? 11.279  56.956 64.886 1.00 14.47 ? 399  ASN A CG  1 
ATOM   3125 O  OD1 . ASN A 1  399 ? 10.565  56.005 64.561 1.00 13.35 ? 399  ASN A OD1 1 
ATOM   3126 N  ND2 . ASN A 1  399 ? 11.683  57.158 66.146 1.00 12.04 ? 399  ASN A ND2 1 
ATOM   3127 N  N   . VAL A 1  400 ? 13.676  58.961 61.331 1.00 12.28 ? 400  VAL A N   1 
ATOM   3128 C  CA  . VAL A 1  400 ? 13.670  59.914 60.222 1.00 11.71 ? 400  VAL A CA  1 
ATOM   3129 C  C   . VAL A 1  400 ? 14.930  59.846 59.375 1.00 13.18 ? 400  VAL A C   1 
ATOM   3130 O  O   . VAL A 1  400 ? 14.860  59.588 58.178 1.00 13.58 ? 400  VAL A O   1 
ATOM   3131 C  CB  . VAL A 1  400 ? 13.444  61.360 60.738 1.00 12.31 ? 400  VAL A CB  1 
ATOM   3132 C  CG1 . VAL A 1  400 ? 13.551  62.360 59.608 1.00 9.61  ? 400  VAL A CG1 1 
ATOM   3133 C  CG2 . VAL A 1  400 ? 12.080  61.485 61.488 1.00 7.89  ? 400  VAL A CG2 1 
ATOM   3134 N  N   . ILE A 1  401 ? 16.101  60.050 59.985 1.00 14.33 ? 401  ILE A N   1 
ATOM   3135 C  CA  . ILE A 1  401 ? 17.322  60.255 59.207 1.00 13.81 ? 401  ILE A CA  1 
ATOM   3136 C  C   . ILE A 1  401 ? 17.827  58.976 58.556 1.00 14.56 ? 401  ILE A C   1 
ATOM   3137 O  O   . ILE A 1  401 ? 18.094  58.945 57.348 1.00 15.89 ? 401  ILE A O   1 
ATOM   3138 C  CB  . ILE A 1  401 ? 18.406  60.905 60.056 1.00 14.32 ? 401  ILE A CB  1 
ATOM   3139 C  CG1 . ILE A 1  401 ? 17.859  62.223 60.638 1.00 14.73 ? 401  ILE A CG1 1 
ATOM   3140 C  CG2 . ILE A 1  401 ? 19.694  61.071 59.242 1.00 13.43 ? 401  ILE A CG2 1 
ATOM   3141 C  CD1 . ILE A 1  401 ? 18.843  62.985 61.542 1.00 15.26 ? 401  ILE A CD1 1 
ATOM   3142 N  N   . CYS A 1  402 ? 17.941  57.900 59.314 1.00 14.48 ? 402  CYS A N   1 
ATOM   3143 C  CA  . CYS A 1  402 ? 18.494  56.680 58.717 1.00 13.91 ? 402  CYS A CA  1 
ATOM   3144 C  C   . CYS A 1  402 ? 17.559  55.977 57.742 1.00 13.21 ? 402  CYS A C   1 
ATOM   3145 O  O   . CYS A 1  402 ? 18.002  55.447 56.728 1.00 12.25 ? 402  CYS A O   1 
ATOM   3146 C  CB  . CYS A 1  402 ? 18.994  55.744 59.799 1.00 13.75 ? 402  CYS A CB  1 
ATOM   3147 S  SG  . CYS A 1  402 ? 20.395  56.501 60.642 1.00 15.78 ? 402  CYS A SG  1 
ATOM   3148 N  N   . PRO A 1  403 ? 16.249  55.994 58.015 1.00 13.13 ? 403  PRO A N   1 
ATOM   3149 C  CA  . PRO A 1  403 ? 15.418  55.481 56.930 1.00 12.24 ? 403  PRO A CA  1 
ATOM   3150 C  C   . PRO A 1  403 ? 15.503  56.365 55.683 1.00 12.49 ? 403  PRO A C   1 
ATOM   3151 O  O   . PRO A 1  403 ? 15.544  55.838 54.575 1.00 12.85 ? 403  PRO A O   1 
ATOM   3152 C  CB  . PRO A 1  403 ? 14.010  55.471 57.521 1.00 12.29 ? 403  PRO A CB  1 
ATOM   3153 C  CG  . PRO A 1  403 ? 14.197  55.502 59.023 1.00 12.32 ? 403  PRO A CG  1 
ATOM   3154 C  CD  . PRO A 1  403 ? 15.493  56.228 59.260 1.00 13.60 ? 403  PRO A CD  1 
ATOM   3155 N  N   . LEU A 1  404 ? 15.579  57.690 55.843 1.00 13.15 ? 404  LEU A N   1 
ATOM   3156 C  CA  . LEU A 1  404 ? 15.664  58.558 54.686 1.00 12.31 ? 404  LEU A CA  1 
ATOM   3157 C  C   . LEU A 1  404 ? 16.952  58.306 53.939 1.00 13.52 ? 404  LEU A C   1 
ATOM   3158 O  O   . LEU A 1  404 ? 16.945  58.291 52.687 1.00 13.14 ? 404  LEU A O   1 
ATOM   3159 C  CB  . LEU A 1  404 ? 15.513  60.011 55.049 1.00 12.12 ? 404  LEU A CB  1 
ATOM   3160 C  CG  . LEU A 1  404 ? 15.633  61.047 53.927 1.00 11.75 ? 404  LEU A CG  1 
ATOM   3161 C  CD1 . LEU A 1  404 ? 14.678  62.224 54.129 1.00 10.47 ? 404  LEU A CD1 1 
ATOM   3162 C  CD2 . LEU A 1  404 ? 17.109  61.546 53.792 1.00 12.30 ? 404  LEU A CD2 1 
ATOM   3163 N  N   . MET A 1  405 ? 18.041  58.091 54.687 1.00 13.23 ? 405  MET A N   1 
ATOM   3164 C  CA  . MET A 1  405 ? 19.336  57.758 54.076 1.00 13.89 ? 405  MET A CA  1 
ATOM   3165 C  C   . MET A 1  405 ? 19.325  56.385 53.356 1.00 14.39 ? 405  MET A C   1 
ATOM   3166 O  O   . MET A 1  405 ? 20.005  56.174 52.334 1.00 13.89 ? 405  MET A O   1 
ATOM   3167 C  CB  . MET A 1  405 ? 20.460  57.815 55.113 1.00 13.47 ? 405  MET A CB  1 
ATOM   3168 C  CG  . MET A 1  405 ? 20.731  59.212 55.635 1.00 13.94 ? 405  MET A CG  1 
ATOM   3169 S  SD  . MET A 1  405 ? 21.027  60.397 54.297 1.00 17.18 ? 405  MET A SD  1 
ATOM   3170 C  CE  . MET A 1  405 ? 22.430  59.642 53.465 1.00 11.91 ? 405  MET A CE  1 
ATOM   3171 N  N   . HIS A 1  406 ? 18.531  55.455 53.861 1.00 15.35 ? 406  HIS A N   1 
ATOM   3172 C  CA  . HIS A 1  406 ? 18.411  54.156 53.163 1.00 16.15 ? 406  HIS A CA  1 
ATOM   3173 C  C   . HIS A 1  406 ? 17.673  54.405 51.827 1.00 16.73 ? 406  HIS A C   1 
ATOM   3174 O  O   . HIS A 1  406 ? 18.122  53.967 50.764 1.00 16.71 ? 406  HIS A O   1 
ATOM   3175 C  CB  . HIS A 1  406 ? 17.667  53.142 54.013 1.00 15.63 ? 406  HIS A CB  1 
ATOM   3176 C  CG  . HIS A 1  406 ? 17.470  51.822 53.337 1.00 16.64 ? 406  HIS A CG  1 
ATOM   3177 N  ND1 . HIS A 1  406 ? 18.508  50.939 53.113 1.00 15.50 ? 406  HIS A ND1 1 
ATOM   3178 C  CD2 . HIS A 1  406 ? 16.346  51.219 52.868 1.00 14.90 ? 406  HIS A CD2 1 
ATOM   3179 C  CE1 . HIS A 1  406 ? 18.039  49.857 52.518 1.00 16.96 ? 406  HIS A CE1 1 
ATOM   3180 N  NE2 . HIS A 1  406 ? 16.730  49.999 52.364 1.00 18.96 ? 406  HIS A NE2 1 
ATOM   3181 N  N   . PHE A 1  407 ? 16.576  55.159 51.903 1.00 16.37 ? 407  PHE A N   1 
ATOM   3182 C  CA  . PHE A 1  407 ? 15.846  55.568 50.713 1.00 16.36 ? 407  PHE A CA  1 
ATOM   3183 C  C   . PHE A 1  407 ? 16.735  56.331 49.712 1.00 16.47 ? 407  PHE A C   1 
ATOM   3184 O  O   . PHE A 1  407 ? 16.736  55.981 48.533 1.00 16.72 ? 407  PHE A O   1 
ATOM   3185 C  CB  . PHE A 1  407 ? 14.601  56.408 51.081 1.00 15.63 ? 407  PHE A CB  1 
ATOM   3186 C  CG  . PHE A 1  407 ? 13.820  56.884 49.886 1.00 14.79 ? 407  PHE A CG  1 
ATOM   3187 C  CD1 . PHE A 1  407 ? 12.954  56.017 49.223 1.00 16.20 ? 407  PHE A CD1 1 
ATOM   3188 C  CD2 . PHE A 1  407 ? 13.947  58.191 49.428 1.00 15.11 ? 407  PHE A CD2 1 
ATOM   3189 C  CE1 . PHE A 1  407 ? 12.224  56.442 48.103 1.00 15.80 ? 407  PHE A CE1 1 
ATOM   3190 C  CE2 . PHE A 1  407 ? 13.253  58.635 48.313 1.00 15.04 ? 407  PHE A CE2 1 
ATOM   3191 C  CZ  . PHE A 1  407 ? 12.360  57.750 47.653 1.00 16.50 ? 407  PHE A CZ  1 
ATOM   3192 N  N   . VAL A 1  408 ? 17.474  57.359 50.150 1.00 16.98 ? 408  VAL A N   1 
ATOM   3193 C  CA  . VAL A 1  408 ? 18.279  58.135 49.192 1.00 18.06 ? 408  VAL A CA  1 
ATOM   3194 C  C   . VAL A 1  408 ? 19.280  57.212 48.514 1.00 17.66 ? 408  VAL A C   1 
ATOM   3195 O  O   . VAL A 1  408 ? 19.470  57.275 47.307 1.00 17.71 ? 408  VAL A O   1 
ATOM   3196 C  CB  . VAL A 1  408 ? 18.989  59.401 49.757 1.00 18.19 ? 408  VAL A CB  1 
ATOM   3197 C  CG1 . VAL A 1  408 ? 18.200  60.029 50.830 1.00 20.90 ? 408  VAL A CG1 1 
ATOM   3198 C  CG2 . VAL A 1  408 ? 20.366  59.096 50.330 1.00 21.12 ? 408  VAL A CG2 1 
ATOM   3199 N  N   . ASN A 1  409 ? 19.871  56.320 49.282 1.00 17.84 ? 409  ASN A N   1 
ATOM   3200 C  CA  . ASN A 1  409 ? 20.882  55.440 48.711 1.00 18.87 ? 409  ASN A CA  1 
ATOM   3201 C  C   . ASN A 1  409 ? 20.252  54.433 47.717 1.00 18.72 ? 409  ASN A C   1 
ATOM   3202 O  O   . ASN A 1  409 ? 20.774  54.234 46.624 1.00 18.70 ? 409  ASN A O   1 
ATOM   3203 C  CB  . ASN A 1  409 ? 21.773  54.832 49.809 1.00 18.20 ? 409  ASN A CB  1 
ATOM   3204 C  CG  . ASN A 1  409 ? 22.931  55.810 50.251 1.00 22.58 ? 409  ASN A CG  1 
ATOM   3205 O  OD1 . ASN A 1  409 ? 23.891  56.024 49.500 1.00 25.37 ? 409  ASN A OD1 1 
ATOM   3206 N  ND2 . ASN A 1  409 ? 22.818  56.409 51.451 1.00 21.12 ? 409  ASN A ND2 1 
ATOM   3207 N  N   . LYS A 1  410 ? 19.101  53.852 48.046 1.00 18.22 ? 410  LYS A N   1 
ATOM   3208 C  CA  . LYS A 1  410 ? 18.458  52.953 47.095 1.00 18.51 ? 410  LYS A CA  1 
ATOM   3209 C  C   . LYS A 1  410 ? 17.930  53.685 45.852 1.00 18.56 ? 410  LYS A C   1 
ATOM   3210 O  O   . LYS A 1  410 ? 18.043  53.175 44.748 1.00 18.36 ? 410  LYS A O   1 
ATOM   3211 C  CB  . LYS A 1  410 ? 17.327  52.188 47.757 1.00 19.09 ? 410  LYS A CB  1 
ATOM   3212 C  CG  . LYS A 1  410 ? 17.802  51.246 48.836 1.00 21.56 ? 410  LYS A CG  1 
ATOM   3213 C  CD  . LYS A 1  410 ? 18.557  50.086 48.220 1.00 23.64 ? 410  LYS A CD  1 
ATOM   3214 C  CE  . LYS A 1  410 ? 18.907  49.074 49.259 1.00 25.54 ? 410  LYS A CE  1 
ATOM   3215 N  NZ  . LYS A 1  410 ? 19.421  47.882 48.573 1.00 28.38 ? 410  LYS A NZ  1 
ATOM   3216 N  N   . TYR A 1  411 ? 17.350  54.873 46.057 1.00 18.46 ? 411  TYR A N   1 
ATOM   3217 C  CA  . TYR A 1  411 ? 16.741  55.653 44.994 1.00 18.28 ? 411  TYR A CA  1 
ATOM   3218 C  C   . TYR A 1  411 ? 17.790  56.084 43.974 1.00 18.77 ? 411  TYR A C   1 
ATOM   3219 O  O   . TYR A 1  411 ? 17.623  55.901 42.769 1.00 19.20 ? 411  TYR A O   1 
ATOM   3220 C  CB  . TYR A 1  411 ? 15.951  56.875 45.526 1.00 17.18 ? 411  TYR A CB  1 
ATOM   3221 C  CG  . TYR A 1  411 ? 15.138  57.462 44.416 1.00 16.02 ? 411  TYR A CG  1 
ATOM   3222 C  CD1 . TYR A 1  411 ? 13.839  56.996 44.172 1.00 16.08 ? 411  TYR A CD1 1 
ATOM   3223 C  CD2 . TYR A 1  411 ? 15.680  58.434 43.554 1.00 12.48 ? 411  TYR A CD2 1 
ATOM   3224 C  CE1 . TYR A 1  411 ? 13.088  57.486 43.114 1.00 12.48 ? 411  TYR A CE1 1 
ATOM   3225 C  CE2 . TYR A 1  411 ? 14.950  58.928 42.483 1.00 13.31 ? 411  TYR A CE2 1 
ATOM   3226 C  CZ  . TYR A 1  411 ? 13.648  58.441 42.267 1.00 13.59 ? 411  TYR A CZ  1 
ATOM   3227 O  OH  . TYR A 1  411 ? 12.890  58.901 41.222 1.00 13.65 ? 411  TYR A OH  1 
ATOM   3228 N  N   . THR A 1  412 ? 18.880  56.623 44.473 1.00 19.16 ? 412  THR A N   1 
ATOM   3229 C  CA  . THR A 1  412 ? 19.910  57.208 43.632 1.00 20.57 ? 412  THR A CA  1 
ATOM   3230 C  C   . THR A 1  412 ? 20.535  56.243 42.611 1.00 21.84 ? 412  THR A C   1 
ATOM   3231 O  O   . THR A 1  412 ? 20.937  56.676 41.527 1.00 21.99 ? 412  THR A O   1 
ATOM   3232 C  CB  . THR A 1  412 ? 20.948  57.887 44.523 1.00 20.16 ? 412  THR A CB  1 
ATOM   3233 O  OG1 . THR A 1  412 ? 20.311  59.013 45.137 1.00 19.14 ? 412  THR A OG1 1 
ATOM   3234 C  CG2 . THR A 1  412 ? 22.217  58.318 43.753 1.00 19.78 ? 412  THR A CG2 1 
ATOM   3235 N  N   . LYS A 1  413 ? 20.575  54.953 42.936 1.00 22.37 ? 413  LYS A N   1 
ATOM   3236 C  CA  . LYS A 1  413 ? 21.001  53.958 41.974 1.00 24.16 ? 413  LYS A CA  1 
ATOM   3237 C  C   . LYS A 1  413 ? 20.168  53.955 40.665 1.00 24.14 ? 413  LYS A C   1 
ATOM   3238 O  O   . LYS A 1  413 ? 20.724  53.680 39.620 1.00 23.99 ? 413  LYS A O   1 
ATOM   3239 C  CB  . LYS A 1  413 ? 20.999  52.554 42.598 1.00 24.75 ? 413  LYS A CB  1 
ATOM   3240 C  CG  . LYS A 1  413 ? 21.334  51.457 41.593 1.00 30.03 ? 413  LYS A CG  1 
ATOM   3241 C  CD  . LYS A 1  413 ? 21.598  50.088 42.261 1.00 35.79 ? 413  LYS A CD  1 
ATOM   3242 C  CE  . LYS A 1  413 ? 21.679  48.974 41.213 1.00 37.73 ? 413  LYS A CE  1 
ATOM   3243 N  NZ  . LYS A 1  413 ? 21.352  47.626 41.811 1.00 40.61 ? 413  LYS A NZ  1 
ATOM   3244 N  N   . PHE A 1  414 ? 18.858  54.241 40.721 1.00 23.61 ? 414  PHE A N   1 
ATOM   3245 C  CA  . PHE A 1  414 ? 17.989  54.153 39.525 1.00 22.94 ? 414  PHE A CA  1 
ATOM   3246 C  C   . PHE A 1  414 ? 17.465  55.516 39.064 1.00 22.76 ? 414  PHE A C   1 
ATOM   3247 O  O   . PHE A 1  414 ? 17.017  55.669 37.928 1.00 22.57 ? 414  PHE A O   1 
ATOM   3248 C  CB  . PHE A 1  414 ? 16.778  53.266 39.783 1.00 22.40 ? 414  PHE A CB  1 
ATOM   3249 C  CG  . PHE A 1  414 ? 17.088  51.819 39.934 1.00 24.00 ? 414  PHE A CG  1 
ATOM   3250 C  CD1 . PHE A 1  414 ? 17.093  50.975 38.828 1.00 24.57 ? 414  PHE A CD1 1 
ATOM   3251 C  CD2 . PHE A 1  414 ? 17.332  51.275 41.191 1.00 25.65 ? 414  PHE A CD2 1 
ATOM   3252 C  CE1 . PHE A 1  414 ? 17.363  49.631 38.968 1.00 25.87 ? 414  PHE A CE1 1 
ATOM   3253 C  CE2 . PHE A 1  414 ? 17.588  49.908 41.349 1.00 26.27 ? 414  PHE A CE2 1 
ATOM   3254 C  CZ  . PHE A 1  414 ? 17.612  49.092 40.243 1.00 28.10 ? 414  PHE A CZ  1 
ATOM   3255 N  N   . GLY A 1  415 ? 17.491  56.495 39.954 1.00 22.57 ? 415  GLY A N   1 
ATOM   3256 C  CA  . GLY A 1  415 ? 16.887  57.780 39.666 1.00 23.08 ? 415  GLY A CA  1 
ATOM   3257 C  C   . GLY A 1  415 ? 17.739  58.645 38.762 1.00 23.88 ? 415  GLY A C   1 
ATOM   3258 O  O   . GLY A 1  415 ? 18.848  58.278 38.354 1.00 23.66 ? 415  GLY A O   1 
ATOM   3259 N  N   . ASN A 1  416 ? 17.230  59.830 38.477 1.00 24.15 ? 416  ASN A N   1 
ATOM   3260 C  CA  . ASN A 1  416 ? 17.816  60.657 37.458 1.00 24.37 ? 416  ASN A CA  1 
ATOM   3261 C  C   . ASN A 1  416 ? 18.399  61.927 38.046 1.00 23.93 ? 416  ASN A C   1 
ATOM   3262 O  O   . ASN A 1  416 ? 18.695  62.857 37.316 1.00 24.06 ? 416  ASN A O   1 
ATOM   3263 C  CB  . ASN A 1  416 ? 16.756  60.922 36.378 1.00 25.76 ? 416  ASN A CB  1 
ATOM   3264 C  CG  . ASN A 1  416 ? 17.270  61.786 35.217 1.00 28.97 ? 416  ASN A CG  1 
ATOM   3265 O  OD1 . ASN A 1  416 ? 16.674  62.823 34.913 1.00 28.31 ? 416  ASN A OD1 1 
ATOM   3266 N  ND2 . ASN A 1  416 ? 18.358  61.362 34.567 1.00 31.43 ? 416  ASN A ND2 1 
ATOM   3267 N  N   . GLY A 1  417 ? 18.598  61.943 39.370 1.00 23.01 ? 417  GLY A N   1 
ATOM   3268 C  CA  . GLY A 1  417 ? 19.210  63.076 40.066 1.00 21.84 ? 417  GLY A CA  1 
ATOM   3269 C  C   . GLY A 1  417 ? 18.676  63.353 41.484 1.00 21.77 ? 417  GLY A C   1 
ATOM   3270 O  O   . GLY A 1  417 ? 17.459  63.540 41.668 1.00 21.08 ? 417  GLY A O   1 
ATOM   3271 N  N   . THR A 1  418 ? 19.595  63.429 42.458 1.00 19.82 ? 418  THR A N   1 
ATOM   3272 C  CA  . THR A 1  418 ? 19.272  63.519 43.874 1.00 18.82 ? 418  THR A CA  1 
ATOM   3273 C  C   . THR A 1  418 ? 19.999  64.700 44.479 1.00 18.62 ? 418  THR A C   1 
ATOM   3274 O  O   . THR A 1  418 ? 21.225  64.861 44.271 1.00 18.07 ? 418  THR A O   1 
ATOM   3275 C  CB  . THR A 1  418 ? 19.693  62.205 44.641 1.00 19.49 ? 418  THR A CB  1 
ATOM   3276 O  OG1 . THR A 1  418 ? 18.960  61.093 44.133 1.00 19.40 ? 418  THR A OG1 1 
ATOM   3277 C  CG2 . THR A 1  418 ? 19.415  62.280 46.141 1.00 19.32 ? 418  THR A CG2 1 
ATOM   3278 N  N   . TYR A 1  419 ? 19.249  65.516 45.225 1.00 17.89 ? 419  TYR A N   1 
ATOM   3279 C  CA  . TYR A 1  419 ? 19.823  66.575 46.051 1.00 18.08 ? 419  TYR A CA  1 
ATOM   3280 C  C   . TYR A 1  419 ? 19.452  66.420 47.527 1.00 17.42 ? 419  TYR A C   1 
ATOM   3281 O  O   . TYR A 1  419 ? 18.257  66.375 47.885 1.00 17.81 ? 419  TYR A O   1 
ATOM   3282 C  CB  . TYR A 1  419 ? 19.461  67.976 45.515 1.00 18.48 ? 419  TYR A CB  1 
ATOM   3283 C  CG  . TYR A 1  419 ? 19.899  68.170 44.074 1.00 21.04 ? 419  TYR A CG  1 
ATOM   3284 C  CD1 . TYR A 1  419 ? 19.052  67.795 43.010 1.00 17.76 ? 419  TYR A CD1 1 
ATOM   3285 C  CD2 . TYR A 1  419 ? 21.167  68.702 43.772 1.00 20.33 ? 419  TYR A CD2 1 
ATOM   3286 C  CE1 . TYR A 1  419 ? 19.436  67.943 41.713 1.00 20.33 ? 419  TYR A CE1 1 
ATOM   3287 C  CE2 . TYR A 1  419 ? 21.569  68.850 42.446 1.00 21.30 ? 419  TYR A CE2 1 
ATOM   3288 C  CZ  . TYR A 1  419 ? 20.704  68.466 41.423 1.00 21.59 ? 419  TYR A CZ  1 
ATOM   3289 O  OH  . TYR A 1  419 ? 21.082  68.593 40.095 1.00 21.95 ? 419  TYR A OH  1 
ATOM   3290 N  N   . LEU A 1  420 ? 20.480  66.342 48.375 1.00 17.01 ? 420  LEU A N   1 
ATOM   3291 C  CA  . LEU A 1  420 ? 20.306  66.087 49.810 1.00 15.92 ? 420  LEU A CA  1 
ATOM   3292 C  C   . LEU A 1  420 ? 20.713  67.274 50.691 1.00 16.70 ? 420  LEU A C   1 
ATOM   3293 O  O   . LEU A 1  420 ? 21.760  67.869 50.482 1.00 17.06 ? 420  LEU A O   1 
ATOM   3294 C  CB  . LEU A 1  420 ? 21.064  64.821 50.199 1.00 15.03 ? 420  LEU A CB  1 
ATOM   3295 C  CG  . LEU A 1  420 ? 20.970  64.286 51.633 1.00 13.67 ? 420  LEU A CG  1 
ATOM   3296 C  CD1 . LEU A 1  420 ? 19.571  63.758 51.901 1.00 12.93 ? 420  LEU A CD1 1 
ATOM   3297 C  CD2 . LEU A 1  420 ? 22.012  63.165 51.822 1.00 9.12  ? 420  LEU A CD2 1 
ATOM   3298 N  N   . TYR A 1  421 ? 19.869  67.631 51.662 1.00 16.82 ? 421  TYR A N   1 
ATOM   3299 C  CA  . TYR A 1  421 ? 20.188  68.712 52.583 1.00 16.57 ? 421  TYR A CA  1 
ATOM   3300 C  C   . TYR A 1  421 ? 20.168  68.287 54.054 1.00 17.01 ? 421  TYR A C   1 
ATOM   3301 O  O   . TYR A 1  421 ? 19.558  67.287 54.430 1.00 16.95 ? 421  TYR A O   1 
ATOM   3302 C  CB  . TYR A 1  421 ? 19.223  69.888 52.383 1.00 16.23 ? 421  TYR A CB  1 
ATOM   3303 C  CG  . TYR A 1  421 ? 17.788  69.645 52.849 1.00 16.70 ? 421  TYR A CG  1 
ATOM   3304 C  CD1 . TYR A 1  421 ? 17.424  69.814 54.197 1.00 17.43 ? 421  TYR A CD1 1 
ATOM   3305 C  CD2 . TYR A 1  421 ? 16.792  69.295 51.942 1.00 14.75 ? 421  TYR A CD2 1 
ATOM   3306 C  CE1 . TYR A 1  421 ? 16.086  69.619 54.625 1.00 16.50 ? 421  TYR A CE1 1 
ATOM   3307 C  CE2 . TYR A 1  421 ? 15.469  69.105 52.351 1.00 14.63 ? 421  TYR A CE2 1 
ATOM   3308 C  CZ  . TYR A 1  421 ? 15.128  69.247 53.692 1.00 14.82 ? 421  TYR A CZ  1 
ATOM   3309 O  OH  . TYR A 1  421 ? 13.836  69.047 54.086 1.00 13.06 ? 421  TYR A OH  1 
ATOM   3310 N  N   . PHE A 1  422 ? 20.830  69.073 54.884 1.00 17.38 ? 422  PHE A N   1 
ATOM   3311 C  CA  . PHE A 1  422 ? 20.799  68.872 56.328 1.00 18.15 ? 422  PHE A CA  1 
ATOM   3312 C  C   . PHE A 1  422 ? 20.474  70.235 56.870 1.00 17.98 ? 422  PHE A C   1 
ATOM   3313 O  O   . PHE A 1  422 ? 21.306  71.147 56.770 1.00 18.80 ? 422  PHE A O   1 
ATOM   3314 C  CB  . PHE A 1  422 ? 22.158  68.406 56.852 1.00 18.13 ? 422  PHE A CB  1 
ATOM   3315 C  CG  . PHE A 1  422 ? 22.187  68.090 58.328 1.00 18.82 ? 422  PHE A CG  1 
ATOM   3316 C  CD1 . PHE A 1  422 ? 21.516  66.977 58.832 1.00 20.75 ? 422  PHE A CD1 1 
ATOM   3317 C  CD2 . PHE A 1  422 ? 22.955  68.857 59.197 1.00 19.25 ? 422  PHE A CD2 1 
ATOM   3318 C  CE1 . PHE A 1  422 ? 21.566  66.633 60.205 1.00 20.85 ? 422  PHE A CE1 1 
ATOM   3319 C  CE2 . PHE A 1  422 ? 23.005  68.541 60.566 1.00 23.03 ? 422  PHE A CE2 1 
ATOM   3320 C  CZ  . PHE A 1  422 ? 22.303  67.404 61.071 1.00 22.39 ? 422  PHE A CZ  1 
ATOM   3321 N  N   . PHE A 1  423 ? 19.253  70.388 57.375 1.00 17.32 ? 423  PHE A N   1 
ATOM   3322 C  CA  . PHE A 1  423 ? 18.783  71.682 57.846 1.00 17.68 ? 423  PHE A CA  1 
ATOM   3323 C  C   . PHE A 1  423 ? 19.145  71.803 59.327 1.00 18.67 ? 423  PHE A C   1 
ATOM   3324 O  O   . PHE A 1  423 ? 18.617  71.064 60.167 1.00 18.63 ? 423  PHE A O   1 
ATOM   3325 C  CB  . PHE A 1  423 ? 17.271  71.803 57.610 1.00 17.16 ? 423  PHE A CB  1 
ATOM   3326 C  CG  . PHE A 1  423 ? 16.672  73.087 58.115 1.00 18.12 ? 423  PHE A CG  1 
ATOM   3327 C  CD1 . PHE A 1  423 ? 16.672  74.236 57.311 1.00 17.09 ? 423  PHE A CD1 1 
ATOM   3328 C  CD2 . PHE A 1  423 ? 16.116  73.156 59.393 1.00 16.06 ? 423  PHE A CD2 1 
ATOM   3329 C  CE1 . PHE A 1  423 ? 16.104  75.422 57.755 1.00 17.34 ? 423  PHE A CE1 1 
ATOM   3330 C  CE2 . PHE A 1  423 ? 15.559  74.355 59.855 1.00 18.15 ? 423  PHE A CE2 1 
ATOM   3331 C  CZ  . PHE A 1  423 ? 15.556  75.489 59.036 1.00 17.40 ? 423  PHE A CZ  1 
ATOM   3332 N  N   . ASN A 1  424 ? 20.061  72.717 59.658 1.00 19.79 ? 424  ASN A N   1 
ATOM   3333 C  CA  . ASN A 1  424 ? 20.495  72.846 61.040 1.00 20.44 ? 424  ASN A CA  1 
ATOM   3334 C  C   . ASN A 1  424 ? 20.514  74.280 61.534 1.00 20.98 ? 424  ASN A C   1 
ATOM   3335 O  O   . ASN A 1  424 ? 21.424  74.680 62.265 1.00 21.66 ? 424  ASN A O   1 
ATOM   3336 C  CB  . ASN A 1  424 ? 21.848  72.161 61.253 1.00 20.87 ? 424  ASN A CB  1 
ATOM   3337 C  CG  . ASN A 1  424 ? 22.989  72.844 60.497 1.00 21.75 ? 424  ASN A CG  1 
ATOM   3338 O  OD1 . ASN A 1  424 ? 22.761  73.756 59.701 1.00 18.33 ? 424  ASN A OD1 1 
ATOM   3339 N  ND2 . ASN A 1  424 ? 24.231  72.385 60.741 1.00 21.84 ? 424  ASN A ND2 1 
ATOM   3340 N  N   . HIS A 1  425 ? 19.519  75.061 61.134 1.00 20.58 ? 425  HIS A N   1 
ATOM   3341 C  CA  . HIS A 1  425 ? 19.369  76.383 61.700 1.00 20.38 ? 425  HIS A CA  1 
ATOM   3342 C  C   . HIS A 1  425 ? 18.162  76.456 62.629 1.00 20.96 ? 425  HIS A C   1 
ATOM   3343 O  O   . HIS A 1  425 ? 17.030  76.216 62.196 1.00 21.35 ? 425  HIS A O   1 
ATOM   3344 C  CB  . HIS A 1  425 ? 19.208  77.446 60.625 1.00 20.06 ? 425  HIS A CB  1 
ATOM   3345 C  CG  . HIS A 1  425 ? 18.897  78.796 61.190 1.00 19.39 ? 425  HIS A CG  1 
ATOM   3346 N  ND1 . HIS A 1  425 ? 19.864  79.607 61.748 1.00 19.45 ? 425  HIS A ND1 1 
ATOM   3347 C  CD2 . HIS A 1  425 ? 17.722  79.450 61.351 1.00 19.68 ? 425  HIS A CD2 1 
ATOM   3348 C  CE1 . HIS A 1  425 ? 19.304  80.723 62.189 1.00 18.83 ? 425  HIS A CE1 1 
ATOM   3349 N  NE2 . HIS A 1  425 ? 18.005  80.652 61.969 1.00 19.59 ? 425  HIS A NE2 1 
ATOM   3350 N  N   . ARG A 1  426 ? 18.394  76.809 63.890 1.00 21.06 ? 426  ARG A N   1 
ATOM   3351 C  CA  . ARG A 1  426 ? 17.297  77.021 64.817 1.00 21.56 ? 426  ARG A CA  1 
ATOM   3352 C  C   . ARG A 1  426 ? 16.725  78.448 64.686 1.00 21.78 ? 426  ARG A C   1 
ATOM   3353 O  O   . ARG A 1  426 ? 17.412  79.416 64.953 1.00 21.34 ? 426  ARG A O   1 
ATOM   3354 C  CB  . ARG A 1  426 ? 17.727  76.741 66.270 1.00 21.34 ? 426  ARG A CB  1 
ATOM   3355 C  CG  . ARG A 1  426 ? 16.568  76.928 67.248 1.00 21.40 ? 426  ARG A CG  1 
ATOM   3356 C  CD  . ARG A 1  426 ? 16.985  76.727 68.669 1.00 22.72 ? 426  ARG A CD  1 
ATOM   3357 N  NE  . ARG A 1  426 ? 15.987  77.247 69.609 1.00 22.26 ? 426  ARG A NE  1 
ATOM   3358 C  CZ  . ARG A 1  426 ? 15.147  76.487 70.307 1.00 22.08 ? 426  ARG A CZ  1 
ATOM   3359 N  NH1 . ARG A 1  426 ? 15.169  75.157 70.177 1.00 19.41 ? 426  ARG A NH1 1 
ATOM   3360 N  NH2 . ARG A 1  426 ? 14.299  77.057 71.156 1.00 22.45 ? 426  ARG A NH2 1 
ATOM   3361 N  N   . ALA A 1  427 ? 15.462  78.549 64.277 1.00 22.60 ? 427  ALA A N   1 
ATOM   3362 C  CA  . ALA A 1  427 ? 14.744  79.808 64.214 1.00 23.42 ? 427  ALA A CA  1 
ATOM   3363 C  C   . ALA A 1  427 ? 14.946  80.631 65.488 1.00 23.95 ? 427  ALA A C   1 
ATOM   3364 O  O   . ALA A 1  427 ? 14.774  80.114 66.593 1.00 24.04 ? 427  ALA A O   1 
ATOM   3365 C  CB  . ALA A 1  427 ? 13.231  79.549 63.974 1.00 23.80 ? 427  ALA A CB  1 
ATOM   3366 N  N   . SER A 1  428 ? 15.289  81.913 65.330 1.00 24.74 ? 428  SER A N   1 
ATOM   3367 C  CA  . SER A 1  428 ? 15.633  82.796 66.462 1.00 24.81 ? 428  SER A CA  1 
ATOM   3368 C  C   . SER A 1  428 ? 14.411  83.138 67.314 1.00 25.06 ? 428  SER A C   1 
ATOM   3369 O  O   . SER A 1  428 ? 14.545  83.597 68.450 1.00 25.00 ? 428  SER A O   1 
ATOM   3370 C  CB  . SER A 1  428 ? 16.302  84.088 65.967 1.00 24.80 ? 428  SER A CB  1 
ATOM   3371 O  OG  . SER A 1  428 ? 15.408  84.811 65.127 1.00 25.12 ? 428  SER A OG  1 
ATOM   3372 N  N   . ASN A 1  429 ? 13.223  82.909 66.763 1.00 25.54 ? 429  ASN A N   1 
ATOM   3373 C  CA  . ASN A 1  429 ? 11.971  83.235 67.450 1.00 25.61 ? 429  ASN A CA  1 
ATOM   3374 C  C   . ASN A 1  429 ? 11.166  82.009 67.919 1.00 25.47 ? 429  ASN A C   1 
ATOM   3375 O  O   . ASN A 1  429 ? 9.962   82.136 68.239 1.00 25.66 ? 429  ASN A O   1 
ATOM   3376 C  CB  . ASN A 1  429 ? 11.087  84.123 66.558 1.00 25.98 ? 429  ASN A CB  1 
ATOM   3377 C  CG  . ASN A 1  429 ? 10.743  83.461 65.203 1.00 28.03 ? 429  ASN A CG  1 
ATOM   3378 O  OD1 . ASN A 1  429 ? 11.093  82.300 64.964 1.00 29.84 ? 429  ASN A OD1 1 
ATOM   3379 N  ND2 . ASN A 1  429 ? 10.070  84.212 64.311 1.00 27.45 ? 429  ASN A ND2 1 
ATOM   3380 N  N   . LEU A 1  430 ? 11.808  80.838 67.946 1.00 24.31 ? 430  LEU A N   1 
ATOM   3381 C  CA  . LEU A 1  430 ? 11.150  79.612 68.408 1.00 24.21 ? 430  LEU A CA  1 
ATOM   3382 C  C   . LEU A 1  430 ? 10.634  79.745 69.833 1.00 23.54 ? 430  LEU A C   1 
ATOM   3383 O  O   . LEU A 1  430 ? 11.331  80.257 70.702 1.00 23.43 ? 430  LEU A O   1 
ATOM   3384 C  CB  . LEU A 1  430 ? 12.094  78.389 68.294 1.00 24.56 ? 430  LEU A CB  1 
ATOM   3385 C  CG  . LEU A 1  430 ? 11.717  77.396 67.183 1.00 26.22 ? 430  LEU A CG  1 
ATOM   3386 C  CD1 . LEU A 1  430 ? 12.877  76.551 66.706 1.00 29.27 ? 430  LEU A CD1 1 
ATOM   3387 C  CD2 . LEU A 1  430 ? 10.621  76.501 67.661 1.00 27.87 ? 430  LEU A CD2 1 
ATOM   3388 N  N   . VAL A 1  431 ? 9.416   79.283 70.082 1.00 23.35 ? 431  VAL A N   1 
ATOM   3389 C  CA  . VAL A 1  431 ? 8.880   79.374 71.427 1.00 23.47 ? 431  VAL A CA  1 
ATOM   3390 C  C   . VAL A 1  431 ? 9.158   78.110 72.255 1.00 22.91 ? 431  VAL A C   1 
ATOM   3391 O  O   . VAL A 1  431 ? 8.978   78.094 73.462 1.00 23.68 ? 431  VAL A O   1 
ATOM   3392 C  CB  . VAL A 1  431 ? 7.397   79.879 71.423 1.00 24.28 ? 431  VAL A CB  1 
ATOM   3393 C  CG1 . VAL A 1  431 ? 7.317   81.181 70.631 1.00 23.75 ? 431  VAL A CG1 1 
ATOM   3394 C  CG2 . VAL A 1  431 ? 6.430   78.844 70.806 1.00 25.70 ? 431  VAL A CG2 1 
ATOM   3395 N  N   . TRP A 1  432 ? 9.646   77.063 71.597 1.00 21.67 ? 432  TRP A N   1 
ATOM   3396 C  CA  . TRP A 1  432 ? 10.006  75.803 72.268 1.00 20.51 ? 432  TRP A CA  1 
ATOM   3397 C  C   . TRP A 1  432 ? 11.366  75.954 72.929 1.00 19.77 ? 432  TRP A C   1 
ATOM   3398 O  O   . TRP A 1  432 ? 12.167  76.762 72.474 1.00 19.57 ? 432  TRP A O   1 
ATOM   3399 C  CB  . TRP A 1  432 ? 10.070  74.653 71.252 1.00 19.80 ? 432  TRP A CB  1 
ATOM   3400 C  CG  . TRP A 1  432 ? 8.760   74.261 70.644 1.00 18.51 ? 432  TRP A CG  1 
ATOM   3401 C  CD1 . TRP A 1  432 ? 8.299   74.586 69.396 1.00 18.69 ? 432  TRP A CD1 1 
ATOM   3402 C  CD2 . TRP A 1  432 ? 7.736   73.484 71.258 1.00 18.43 ? 432  TRP A CD2 1 
ATOM   3403 N  NE1 . TRP A 1  432 ? 7.039   74.063 69.205 1.00 16.80 ? 432  TRP A NE1 1 
ATOM   3404 C  CE2 . TRP A 1  432 ? 6.683   73.364 70.327 1.00 17.70 ? 432  TRP A CE2 1 
ATOM   3405 C  CE3 . TRP A 1  432 ? 7.606   72.864 72.510 1.00 19.91 ? 432  TRP A CE3 1 
ATOM   3406 C  CZ2 . TRP A 1  432 ? 5.511   72.648 70.609 1.00 18.85 ? 432  TRP A CZ2 1 
ATOM   3407 C  CZ3 . TRP A 1  432 ? 6.444   72.157 72.788 1.00 19.40 ? 432  TRP A CZ3 1 
ATOM   3408 C  CH2 . TRP A 1  432 ? 5.420   72.038 71.834 1.00 20.11 ? 432  TRP A CH2 1 
ATOM   3409 N  N   . PRO A 1  433 ? 11.650  75.155 73.981 1.00 19.70 ? 433  PRO A N   1 
ATOM   3410 C  CA  . PRO A 1  433 ? 12.920  75.371 74.698 1.00 19.50 ? 433  PRO A CA  1 
ATOM   3411 C  C   . PRO A 1  433 ? 14.167  75.081 73.845 1.00 20.09 ? 433  PRO A C   1 
ATOM   3412 O  O   . PRO A 1  433 ? 14.092  74.446 72.790 1.00 20.10 ? 433  PRO A O   1 
ATOM   3413 C  CB  . PRO A 1  433 ? 12.820  74.403 75.875 1.00 19.13 ? 433  PRO A CB  1 
ATOM   3414 C  CG  . PRO A 1  433 ? 11.847  73.287 75.365 1.00 17.96 ? 433  PRO A CG  1 
ATOM   3415 C  CD  . PRO A 1  433 ? 10.848  74.061 74.590 1.00 19.41 ? 433  PRO A CD  1 
ATOM   3416 N  N   . GLU A 1  434 ? 15.316  75.532 74.319 1.00 21.14 ? 434  GLU A N   1 
ATOM   3417 C  CA  . GLU A 1  434 ? 16.581  75.361 73.600 1.00 21.61 ? 434  GLU A CA  1 
ATOM   3418 C  C   . GLU A 1  434 ? 16.994  73.891 73.461 1.00 20.26 ? 434  GLU A C   1 
ATOM   3419 O  O   . GLU A 1  434 ? 17.559  73.489 72.431 1.00 20.83 ? 434  GLU A O   1 
ATOM   3420 C  CB  . GLU A 1  434 ? 17.689  76.186 74.260 1.00 21.45 ? 434  GLU A CB  1 
ATOM   3421 C  CG  . GLU A 1  434 ? 17.482  77.686 74.178 1.00 28.20 ? 434  GLU A CG  1 
ATOM   3422 C  CD  . GLU A 1  434 ? 17.890  78.289 72.811 1.00 38.01 ? 434  GLU A CD  1 
ATOM   3423 O  OE1 . GLU A 1  434 ? 18.797  77.723 72.137 1.00 41.15 ? 434  GLU A OE1 1 
ATOM   3424 O  OE2 . GLU A 1  434 ? 17.319  79.343 72.407 1.00 41.45 ? 434  GLU A OE2 1 
ATOM   3425 N  N   . TRP A 1  435 ? 16.715  73.089 74.480 1.00 18.88 ? 435  TRP A N   1 
ATOM   3426 C  CA  . TRP A 1  435 ? 17.166  71.696 74.461 1.00 18.07 ? 435  TRP A CA  1 
ATOM   3427 C  C   . TRP A 1  435 ? 16.645  70.938 73.213 1.00 17.54 ? 435  TRP A C   1 
ATOM   3428 O  O   . TRP A 1  435 ? 17.289  70.007 72.739 1.00 17.06 ? 435  TRP A O   1 
ATOM   3429 C  CB  . TRP A 1  435 ? 16.860  70.962 75.784 1.00 17.81 ? 435  TRP A CB  1 
ATOM   3430 C  CG  . TRP A 1  435 ? 15.405  70.599 76.045 1.00 16.74 ? 435  TRP A CG  1 
ATOM   3431 C  CD1 . TRP A 1  435 ? 14.508  71.266 76.869 1.00 17.09 ? 435  TRP A CD1 1 
ATOM   3432 C  CD2 . TRP A 1  435 ? 14.698  69.460 75.530 1.00 16.65 ? 435  TRP A CD2 1 
ATOM   3433 N  NE1 . TRP A 1  435 ? 13.275  70.625 76.858 1.00 16.60 ? 435  TRP A NE1 1 
ATOM   3434 C  CE2 . TRP A 1  435 ? 13.366  69.513 76.053 1.00 17.18 ? 435  TRP A CE2 1 
ATOM   3435 C  CE3 . TRP A 1  435 ? 15.039  68.418 74.651 1.00 15.40 ? 435  TRP A CE3 1 
ATOM   3436 C  CZ2 . TRP A 1  435 ? 12.390  68.551 75.724 1.00 17.28 ? 435  TRP A CZ2 1 
ATOM   3437 C  CZ3 . TRP A 1  435 ? 14.055  67.456 74.335 1.00 16.18 ? 435  TRP A CZ3 1 
ATOM   3438 C  CH2 . TRP A 1  435 ? 12.753  67.537 74.870 1.00 15.08 ? 435  TRP A CH2 1 
ATOM   3439 N  N   . MET A 1  436 ? 15.508  71.385 72.680 1.00 16.66 ? 436  MET A N   1 
ATOM   3440 C  CA  . MET A 1  436 ? 14.879  70.737 71.533 1.00 16.33 ? 436  MET A CA  1 
ATOM   3441 C  C   . MET A 1  436 ? 15.597  71.001 70.211 1.00 15.73 ? 436  MET A C   1 
ATOM   3442 O  O   . MET A 1  436 ? 15.405  70.251 69.253 1.00 15.30 ? 436  MET A O   1 
ATOM   3443 C  CB  . MET A 1  436 ? 13.394  71.101 71.452 1.00 15.83 ? 436  MET A CB  1 
ATOM   3444 C  CG  . MET A 1  436 ? 12.635  70.555 72.603 1.00 15.54 ? 436  MET A CG  1 
ATOM   3445 S  SD  . MET A 1  436 ? 10.942  71.105 72.690 1.00 17.34 ? 436  MET A SD  1 
ATOM   3446 C  CE  . MET A 1  436 ? 10.120  69.924 71.576 1.00 13.40 ? 436  MET A CE  1 
ATOM   3447 N  N   . GLY A 1  437 ? 16.445  72.040 70.185 1.00 15.39 ? 437  GLY A N   1 
ATOM   3448 C  CA  . GLY A 1  437 ? 17.368  72.279 69.071 1.00 14.70 ? 437  GLY A CA  1 
ATOM   3449 C  C   . GLY A 1  437 ? 16.644  72.642 67.779 1.00 16.06 ? 437  GLY A C   1 
ATOM   3450 O  O   . GLY A 1  437 ? 15.711  73.476 67.778 1.00 16.07 ? 437  GLY A O   1 
ATOM   3451 N  N   . VAL A 1  438 ? 17.064  72.022 66.672 1.00 15.58 ? 438  VAL A N   1 
ATOM   3452 C  CA  . VAL A 1  438 ? 16.439  72.276 65.382 1.00 15.44 ? 438  VAL A CA  1 
ATOM   3453 C  C   . VAL A 1  438 ? 15.293  71.259 65.182 1.00 15.55 ? 438  VAL A C   1 
ATOM   3454 O  O   . VAL A 1  438 ? 15.476  70.136 64.685 1.00 15.31 ? 438  VAL A O   1 
ATOM   3455 C  CB  . VAL A 1  438 ? 17.472  72.235 64.243 1.00 15.64 ? 438  VAL A CB  1 
ATOM   3456 C  CG1 . VAL A 1  438 ? 16.847  72.746 62.961 1.00 15.65 ? 438  VAL A CG1 1 
ATOM   3457 C  CG2 . VAL A 1  438 ? 18.708  73.083 64.603 1.00 15.04 ? 438  VAL A CG2 1 
ATOM   3458 N  N   . ILE A 1  439 ? 14.112  71.691 65.585 1.00 15.03 ? 439  ILE A N   1 
ATOM   3459 C  CA  . ILE A 1  439 ? 12.990  70.824 65.789 1.00 15.63 ? 439  ILE A CA  1 
ATOM   3460 C  C   . ILE A 1  439 ? 12.353  70.331 64.479 1.00 15.67 ? 439  ILE A C   1 
ATOM   3461 O  O   . ILE A 1  439 ? 12.326  71.044 63.469 1.00 15.17 ? 439  ILE A O   1 
ATOM   3462 C  CB  . ILE A 1  439 ? 11.965  71.537 66.655 1.00 16.44 ? 439  ILE A CB  1 
ATOM   3463 C  CG1 . ILE A 1  439 ? 12.590  71.835 68.019 1.00 15.12 ? 439  ILE A CG1 1 
ATOM   3464 C  CG2 . ILE A 1  439 ? 10.682  70.703 66.837 1.00 16.31 ? 439  ILE A CG2 1 
ATOM   3465 C  CD1 . ILE A 1  439 ? 11.876  72.945 68.726 1.00 17.11 ? 439  ILE A CD1 1 
ATOM   3466 N  N   . HIS A 1  440 ? 11.930  69.073 64.529 1.00 15.25 ? 440  HIS A N   1 
ATOM   3467 C  CA  . HIS A 1  440 ? 11.090  68.430 63.552 1.00 16.16 ? 440  HIS A CA  1 
ATOM   3468 C  C   . HIS A 1  440 ? 10.011  69.407 63.140 1.00 16.52 ? 440  HIS A C   1 
ATOM   3469 O  O   . HIS A 1  440 ? 9.249   69.868 63.983 1.00 16.66 ? 440  HIS A O   1 
ATOM   3470 C  CB  . HIS A 1  440 ? 10.457  67.224 64.206 1.00 15.26 ? 440  HIS A CB  1 
ATOM   3471 C  CG  . HIS A 1  440 ? 9.549   66.442 63.314 1.00 17.04 ? 440  HIS A CG  1 
ATOM   3472 N  ND1 . HIS A 1  440 ? 10.009  65.708 62.233 1.00 15.91 ? 440  HIS A ND1 1 
ATOM   3473 C  CD2 . HIS A 1  440 ? 8.209   66.235 63.374 1.00 16.07 ? 440  HIS A CD2 1 
ATOM   3474 C  CE1 . HIS A 1  440 ? 8.987   65.089 61.666 1.00 16.14 ? 440  HIS A CE1 1 
ATOM   3475 N  NE2 . HIS A 1  440 ? 7.882   65.400 62.334 1.00 17.50 ? 440  HIS A NE2 1 
ATOM   3476 N  N   . GLY A 1  441 ? 9.995   69.759 61.859 1.00 16.70 ? 441  GLY A N   1 
ATOM   3477 C  CA  . GLY A 1  441 ? 8.949   70.607 61.305 1.00 17.89 ? 441  GLY A CA  1 
ATOM   3478 C  C   . GLY A 1  441 ? 9.254   72.088 61.235 1.00 18.63 ? 441  GLY A C   1 
ATOM   3479 O  O   . GLY A 1  441 ? 8.428   72.853 60.739 1.00 19.31 ? 441  GLY A O   1 
ATOM   3480 N  N   . TYR A 1  442 ? 10.433  72.496 61.712 1.00 18.64 ? 442  TYR A N   1 
ATOM   3481 C  CA  . TYR A 1  442 ? 10.761  73.922 61.809 1.00 18.68 ? 442  TYR A CA  1 
ATOM   3482 C  C   . TYR A 1  442 ? 11.614  74.434 60.644 1.00 19.13 ? 442  TYR A C   1 
ATOM   3483 O  O   . TYR A 1  442 ? 12.109  75.573 60.665 1.00 19.50 ? 442  TYR A O   1 
ATOM   3484 C  CB  . TYR A 1  442 ? 11.266  74.305 63.231 1.00 18.73 ? 442  TYR A CB  1 
ATOM   3485 C  CG  . TYR A 1  442 ? 10.074  74.461 64.133 1.00 17.60 ? 442  TYR A CG  1 
ATOM   3486 C  CD1 . TYR A 1  442 ? 9.507   73.345 64.754 1.00 18.86 ? 442  TYR A CD1 1 
ATOM   3487 C  CD2 . TYR A 1  442 ? 9.424   75.699 64.268 1.00 19.42 ? 442  TYR A CD2 1 
ATOM   3488 C  CE1 . TYR A 1  442 ? 8.348   73.445 65.536 1.00 16.09 ? 442  TYR A CE1 1 
ATOM   3489 C  CE2 . TYR A 1  442 ? 8.266   75.813 65.054 1.00 18.54 ? 442  TYR A CE2 1 
ATOM   3490 C  CZ  . TYR A 1  442 ? 7.737   74.670 65.673 1.00 18.74 ? 442  TYR A CZ  1 
ATOM   3491 O  OH  . TYR A 1  442 ? 6.599   74.746 66.434 1.00 19.91 ? 442  TYR A OH  1 
ATOM   3492 N  N   . GLU A 1  443 ? 11.738  73.594 59.610 1.00 18.49 ? 443  GLU A N   1 
ATOM   3493 C  CA  . GLU A 1  443 ? 12.162  74.060 58.300 1.00 17.51 ? 443  GLU A CA  1 
ATOM   3494 C  C   . GLU A 1  443 ? 10.966  74.477 57.434 1.00 18.02 ? 443  GLU A C   1 
ATOM   3495 O  O   . GLU A 1  443 ? 11.131  75.241 56.474 1.00 18.35 ? 443  GLU A O   1 
ATOM   3496 C  CB  . GLU A 1  443 ? 12.956  72.997 57.580 1.00 16.65 ? 443  GLU A CB  1 
ATOM   3497 C  CG  . GLU A 1  443 ? 12.117  72.045 56.704 1.00 16.28 ? 443  GLU A CG  1 
ATOM   3498 C  CD  . GLU A 1  443 ? 11.163  71.157 57.492 1.00 14.52 ? 443  GLU A CD  1 
ATOM   3499 O  OE1 . GLU A 1  443 ? 11.160  71.150 58.732 1.00 15.40 ? 443  GLU A OE1 1 
ATOM   3500 O  OE2 . GLU A 1  443 ? 10.384  70.461 56.870 1.00 17.92 ? 443  GLU A OE2 1 
ATOM   3501 N  N   . ILE A 1  444 ? 9.762   74.011 57.776 1.00 17.63 ? 444  ILE A N   1 
ATOM   3502 C  CA  . ILE A 1  444 ? 8.590   74.334 56.967 1.00 17.56 ? 444  ILE A CA  1 
ATOM   3503 C  C   . ILE A 1  444 ? 8.404   75.853 56.781 1.00 18.32 ? 444  ILE A C   1 
ATOM   3504 O  O   . ILE A 1  444 ? 8.200   76.343 55.659 1.00 18.70 ? 444  ILE A O   1 
ATOM   3505 C  CB  . ILE A 1  444 ? 7.269   73.688 57.523 1.00 17.39 ? 444  ILE A CB  1 
ATOM   3506 C  CG1 . ILE A 1  444 ? 7.400   72.161 57.636 1.00 15.16 ? 444  ILE A CG1 1 
ATOM   3507 C  CG2 . ILE A 1  444 ? 6.097   74.095 56.637 1.00 15.15 ? 444  ILE A CG2 1 
ATOM   3508 C  CD1 . ILE A 1  444 ? 6.109   71.456 58.110 1.00 16.61 ? 444  ILE A CD1 1 
ATOM   3509 N  N   . GLU A 1  445 ? 8.492   76.599 57.880 1.00 18.36 ? 445  GLU A N   1 
ATOM   3510 C  CA  . GLU A 1  445 ? 8.260   78.056 57.838 1.00 17.58 ? 445  GLU A CA  1 
ATOM   3511 C  C   . GLU A 1  445 ? 9.243   78.720 56.902 1.00 17.95 ? 445  GLU A C   1 
ATOM   3512 O  O   . GLU A 1  445 ? 8.923   79.767 56.322 1.00 18.17 ? 445  GLU A O   1 
ATOM   3513 C  CB  . GLU A 1  445 ? 8.323   78.688 59.246 1.00 17.32 ? 445  GLU A CB  1 
ATOM   3514 C  CG  . GLU A 1  445 ? 9.547   78.327 60.074 1.00 16.92 ? 445  GLU A CG  1 
ATOM   3515 C  CD  . GLU A 1  445 ? 9.290   78.459 61.577 1.00 19.85 ? 445  GLU A CD  1 
ATOM   3516 O  OE1 . GLU A 1  445 ? 8.290   77.895 62.053 1.00 21.14 ? 445  GLU A OE1 1 
ATOM   3517 O  OE2 . GLU A 1  445 ? 10.090  79.120 62.291 1.00 20.64 ? 445  GLU A OE2 1 
ATOM   3518 N  N   . PHE A 1  446 ? 10.429  78.120 56.756 1.00 16.99 ? 446  PHE A N   1 
ATOM   3519 C  CA  . PHE A 1  446 ? 11.402  78.657 55.851 1.00 17.59 ? 446  PHE A CA  1 
ATOM   3520 C  C   . PHE A 1  446 ? 11.065  78.311 54.391 1.00 18.23 ? 446  PHE A C   1 
ATOM   3521 O  O   . PHE A 1  446 ? 11.257  79.154 53.470 1.00 18.72 ? 446  PHE A O   1 
ATOM   3522 C  CB  . PHE A 1  446 ? 12.803  78.188 56.235 1.00 17.83 ? 446  PHE A CB  1 
ATOM   3523 C  CG  . PHE A 1  446 ? 13.334  78.859 57.480 1.00 18.58 ? 446  PHE A CG  1 
ATOM   3524 C  CD1 . PHE A 1  446 ? 13.017  78.364 58.751 1.00 18.76 ? 446  PHE A CD1 1 
ATOM   3525 C  CD2 . PHE A 1  446 ? 14.111  80.015 57.381 1.00 18.79 ? 446  PHE A CD2 1 
ATOM   3526 C  CE1 . PHE A 1  446 ? 13.493  78.988 59.900 1.00 19.68 ? 446  PHE A CE1 1 
ATOM   3527 C  CE2 . PHE A 1  446 ? 14.608  80.644 58.524 1.00 19.86 ? 446  PHE A CE2 1 
ATOM   3528 C  CZ  . PHE A 1  446 ? 14.289  80.139 59.787 1.00 20.34 ? 446  PHE A CZ  1 
ATOM   3529 N  N   . VAL A 1  447 ? 10.525  77.105 54.181 1.00 17.36 ? 447  VAL A N   1 
ATOM   3530 C  CA  . VAL A 1  447 ? 10.144  76.652 52.839 1.00 16.30 ? 447  VAL A CA  1 
ATOM   3531 C  C   . VAL A 1  447 ? 8.958   77.494 52.348 1.00 17.45 ? 447  VAL A C   1 
ATOM   3532 O  O   . VAL A 1  447 ? 8.923   77.912 51.162 1.00 17.50 ? 447  VAL A O   1 
ATOM   3533 C  CB  . VAL A 1  447 ? 9.857   75.141 52.811 1.00 16.44 ? 447  VAL A CB  1 
ATOM   3534 C  CG1 . VAL A 1  447 ? 9.077   74.737 51.549 1.00 13.71 ? 447  VAL A CG1 1 
ATOM   3535 C  CG2 . VAL A 1  447 ? 11.192  74.302 52.979 1.00 13.58 ? 447  VAL A CG2 1 
ATOM   3536 N  N   . PHE A 1  448 ? 8.022   77.783 53.258 1.00 17.23 ? 448  PHE A N   1 
ATOM   3537 C  CA  . PHE A 1  448 ? 6.878   78.641 52.920 1.00 18.29 ? 448  PHE A CA  1 
ATOM   3538 C  C   . PHE A 1  448 ? 7.097   80.154 52.990 1.00 18.88 ? 448  PHE A C   1 
ATOM   3539 O  O   . PHE A 1  448 ? 6.174   80.919 52.702 1.00 19.51 ? 448  PHE A O   1 
ATOM   3540 C  CB  . PHE A 1  448 ? 5.588   78.212 53.635 1.00 17.69 ? 448  PHE A CB  1 
ATOM   3541 C  CG  . PHE A 1  448 ? 5.024   76.908 53.107 1.00 17.90 ? 448  PHE A CG  1 
ATOM   3542 C  CD1 . PHE A 1  448 ? 5.601   75.686 53.462 1.00 16.21 ? 448  PHE A CD1 1 
ATOM   3543 C  CD2 . PHE A 1  448 ? 3.937   76.903 52.237 1.00 20.18 ? 448  PHE A CD2 1 
ATOM   3544 C  CE1 . PHE A 1  448 ? 5.114   74.499 52.954 1.00 18.17 ? 448  PHE A CE1 1 
ATOM   3545 C  CE2 . PHE A 1  448 ? 3.416   75.698 51.727 1.00 17.93 ? 448  PHE A CE2 1 
ATOM   3546 C  CZ  . PHE A 1  448 ? 4.006   74.501 52.088 1.00 18.35 ? 448  PHE A CZ  1 
ATOM   3547 N  N   . GLY A 1  449 ? 8.304   80.588 53.361 1.00 19.91 ? 449  GLY A N   1 
ATOM   3548 C  CA  . GLY A 1  449 ? 8.672   81.999 53.244 1.00 20.93 ? 449  GLY A CA  1 
ATOM   3549 C  C   . GLY A 1  449 ? 8.172   82.929 54.339 1.00 22.04 ? 449  GLY A C   1 
ATOM   3550 O  O   . GLY A 1  449 ? 8.147   84.148 54.139 1.00 22.08 ? 449  GLY A O   1 
ATOM   3551 N  N   . LEU A 1  450 ? 7.819   82.372 55.500 1.00 22.84 ? 450  LEU A N   1 
ATOM   3552 C  CA  . LEU A 1  450 ? 7.294   83.167 56.631 1.00 24.46 ? 450  LEU A CA  1 
ATOM   3553 C  C   . LEU A 1  450 ? 8.277   84.220 57.161 1.00 25.26 ? 450  LEU A C   1 
ATOM   3554 O  O   . LEU A 1  450 ? 7.829   85.270 57.598 1.00 26.08 ? 450  LEU A O   1 
ATOM   3555 C  CB  . LEU A 1  450 ? 6.766   82.304 57.791 1.00 23.51 ? 450  LEU A CB  1 
ATOM   3556 C  CG  . LEU A 1  450 ? 5.368   81.657 57.709 1.00 24.55 ? 450  LEU A CG  1 
ATOM   3557 C  CD1 . LEU A 1  450 ? 4.238   82.642 57.836 1.00 26.26 ? 450  LEU A CD1 1 
ATOM   3558 C  CD2 . LEU A 1  450 ? 5.179   80.886 56.409 1.00 25.73 ? 450  LEU A CD2 1 
ATOM   3559 N  N   . PRO A 1  451 ? 9.598   83.953 57.110 1.00 26.01 ? 451  PRO A N   1 
ATOM   3560 C  CA  . PRO A 1  451 ? 10.603  84.936 57.522 1.00 27.29 ? 451  PRO A CA  1 
ATOM   3561 C  C   . PRO A 1  451 ? 10.664  86.231 56.699 1.00 28.47 ? 451  PRO A C   1 
ATOM   3562 O  O   . PRO A 1  451 ? 11.419  87.136 57.055 1.00 28.95 ? 451  PRO A O   1 
ATOM   3563 C  CB  . PRO A 1  451 ? 11.927  84.165 57.365 1.00 26.70 ? 451  PRO A CB  1 
ATOM   3564 C  CG  . PRO A 1  451 ? 11.550  82.795 57.522 1.00 26.48 ? 451  PRO A CG  1 
ATOM   3565 C  CD  . PRO A 1  451 ? 10.242  82.664 56.816 1.00 26.15 ? 451  PRO A CD  1 
ATOM   3566 N  N   . LEU A 1  452 ? 9.897   86.302 55.614 1.00 29.63 ? 452  LEU A N   1 
ATOM   3567 C  CA  . LEU A 1  452 ? 9.823   87.490 54.785 1.00 30.82 ? 452  LEU A CA  1 
ATOM   3568 C  C   . LEU A 1  452 ? 8.753   88.429 55.346 1.00 31.70 ? 452  LEU A C   1 
ATOM   3569 O  O   . LEU A 1  452 ? 8.643   89.561 54.910 1.00 32.23 ? 452  LEU A O   1 
ATOM   3570 C  CB  . LEU A 1  452 ? 9.450   87.110 53.346 1.00 30.25 ? 452  LEU A CB  1 
ATOM   3571 C  CG  . LEU A 1  452 ? 10.491  86.631 52.341 1.00 30.86 ? 452  LEU A CG  1 
ATOM   3572 C  CD1 . LEU A 1  452 ? 11.063  85.243 52.667 1.00 29.56 ? 452  LEU A CD1 1 
ATOM   3573 C  CD2 . LEU A 1  452 ? 9.870   86.635 50.950 1.00 30.51 ? 452  LEU A CD2 1 
ATOM   3574 N  N   . VAL A 1  453 ? 7.944   87.931 56.275 1.00 32.60 ? 453  VAL A N   1 
ATOM   3575 C  CA  . VAL A 1  453 ? 6.929   88.720 56.942 1.00 33.64 ? 453  VAL A CA  1 
ATOM   3576 C  C   . VAL A 1  453 ? 7.539   89.340 58.214 1.00 34.89 ? 453  VAL A C   1 
ATOM   3577 O  O   . VAL A 1  453 ? 7.771   88.647 59.215 1.00 34.60 ? 453  VAL A O   1 
ATOM   3578 C  CB  . VAL A 1  453 ? 5.713   87.847 57.295 1.00 33.53 ? 453  VAL A CB  1 
ATOM   3579 C  CG1 . VAL A 1  453 ? 4.586   88.695 57.868 1.00 32.86 ? 453  VAL A CG1 1 
ATOM   3580 C  CG2 . VAL A 1  453 ? 5.232   87.085 56.066 1.00 33.61 ? 453  VAL A CG2 1 
ATOM   3581 N  N   . LYS A 1  454 ? 7.784   90.648 58.158 1.00 35.92 ? 454  LYS A N   1 
ATOM   3582 C  CA  A LYS A 1  454 ? 8.470   91.413 59.223 0.50 36.42 ? 454  LYS A CA  1 
ATOM   3583 C  CA  B LYS A 1  454 ? 8.500   91.339 59.224 0.50 36.49 ? 454  LYS A CA  1 
ATOM   3584 C  C   . LYS A 1  454 ? 7.785   91.279 60.580 1.00 36.90 ? 454  LYS A C   1 
ATOM   3585 O  O   . LYS A 1  454 ? 8.431   91.167 61.616 1.00 36.72 ? 454  LYS A O   1 
ATOM   3586 C  CB  A LYS A 1  454 ? 8.568   92.903 58.836 0.50 36.45 ? 454  LYS A CB  1 
ATOM   3587 C  CB  B LYS A 1  454 ? 8.833   92.764 58.773 0.50 36.62 ? 454  LYS A CB  1 
ATOM   3588 C  CG  A LYS A 1  454 ? 9.341   93.783 59.840 0.50 36.69 ? 454  LYS A CG  1 
ATOM   3589 C  CG  B LYS A 1  454 ? 9.897   92.744 57.672 0.50 37.11 ? 454  LYS A CG  1 
ATOM   3590 C  CD  A LYS A 1  454 ? 9.467   95.239 59.374 0.50 37.13 ? 454  LYS A CD  1 
ATOM   3591 C  CD  B LYS A 1  454 ? 9.867   93.933 56.736 0.50 38.09 ? 454  LYS A CD  1 
ATOM   3592 C  CE  A LYS A 1  454 ? 10.048  96.131 60.468 0.50 36.54 ? 454  LYS A CE  1 
ATOM   3593 C  CE  B LYS A 1  454 ? 10.735  93.620 55.525 0.50 38.50 ? 454  LYS A CE  1 
ATOM   3594 N  NZ  A LYS A 1  454 ? 9.960   97.577 60.117 0.50 36.99 ? 454  LYS A NZ  1 
ATOM   3595 N  NZ  B LYS A 1  454 ? 11.169  94.841 54.810 0.50 39.80 ? 454  LYS A NZ  1 
ATOM   3596 N  N   . GLU A 1  455 ? 6.458   91.286 60.562 1.00 37.99 ? 455  GLU A N   1 
ATOM   3597 C  CA  . GLU A 1  455 ? 5.664   91.229 61.785 1.00 39.39 ? 455  GLU A CA  1 
ATOM   3598 C  C   . GLU A 1  455 ? 5.801   89.910 62.566 1.00 39.44 ? 455  GLU A C   1 
ATOM   3599 O  O   . GLU A 1  455 ? 5.311   89.778 63.701 1.00 39.74 ? 455  GLU A O   1 
ATOM   3600 C  CB  . GLU A 1  455 ? 4.201   91.577 61.485 1.00 39.74 ? 455  GLU A CB  1 
ATOM   3601 C  CG  . GLU A 1  455 ? 4.032   92.766 60.489 1.00 43.84 ? 455  GLU A CG  1 
ATOM   3602 C  CD  . GLU A 1  455 ? 3.984   92.311 59.020 1.00 49.35 ? 455  GLU A CD  1 
ATOM   3603 O  OE1 . GLU A 1  455 ? 2.983   91.642 58.639 1.00 52.13 ? 455  GLU A OE1 1 
ATOM   3604 O  OE2 . GLU A 1  455 ? 4.936   92.612 58.249 1.00 50.54 ? 455  GLU A OE2 1 
ATOM   3605 N  N   . LEU A 1  456 ? 6.492   88.940 61.971 1.00 39.62 ? 456  LEU A N   1 
ATOM   3606 C  CA  . LEU A 1  456 ? 6.748   87.651 62.627 1.00 38.99 ? 456  LEU A CA  1 
ATOM   3607 C  C   . LEU A 1  456 ? 8.110   87.592 63.335 1.00 39.28 ? 456  LEU A C   1 
ATOM   3608 O  O   . LEU A 1  456 ? 8.375   86.653 64.085 1.00 39.45 ? 456  LEU A O   1 
ATOM   3609 C  CB  . LEU A 1  456 ? 6.585   86.489 61.643 1.00 38.63 ? 456  LEU A CB  1 
ATOM   3610 C  CG  . LEU A 1  456 ? 5.202   86.279 61.010 1.00 36.97 ? 456  LEU A CG  1 
ATOM   3611 C  CD1 . LEU A 1  456 ? 5.246   85.150 59.980 1.00 32.98 ? 456  LEU A CD1 1 
ATOM   3612 C  CD2 . LEU A 1  456 ? 4.146   86.014 62.072 1.00 35.32 ? 456  LEU A CD2 1 
ATOM   3613 N  N   . ASN A 1  457 ? 8.963   88.588 63.093 1.00 39.30 ? 457  ASN A N   1 
ATOM   3614 C  CA  . ASN A 1  457 ? 10.178  88.792 63.899 1.00 39.63 ? 457  ASN A CA  1 
ATOM   3615 C  C   . ASN A 1  457 ? 11.273  87.793 63.672 1.00 37.76 ? 457  ASN A C   1 
ATOM   3616 O  O   . ASN A 1  457 ? 11.840  87.318 64.644 1.00 37.99 ? 457  ASN A O   1 
ATOM   3617 C  CB  . ASN A 1  457 ? 9.868   88.763 65.413 1.00 40.91 ? 457  ASN A CB  1 
ATOM   3618 C  CG  . ASN A 1  457 ? 8.945   89.883 65.852 1.00 46.38 ? 457  ASN A CG  1 
ATOM   3619 O  OD1 . ASN A 1  457 ? 8.905   90.959 65.234 1.00 47.66 ? 457  ASN A OD1 1 
ATOM   3620 N  ND2 . ASN A 1  457 ? 8.192   89.635 66.933 1.00 55.05 ? 457  ASN A ND2 1 
ATOM   3621 N  N   . TYR A 1  458 ? 11.561  87.444 62.421 1.00 35.78 ? 458  TYR A N   1 
ATOM   3622 C  CA  . TYR A 1  458 ? 12.767  86.670 62.128 1.00 33.54 ? 458  TYR A CA  1 
ATOM   3623 C  C   . TYR A 1  458 ? 13.873  87.670 61.900 1.00 33.34 ? 458  TYR A C   1 
ATOM   3624 O  O   . TYR A 1  458 ? 13.635  88.877 61.854 1.00 33.29 ? 458  TYR A O   1 
ATOM   3625 C  CB  . TYR A 1  458 ? 12.608  85.783 60.890 1.00 32.86 ? 458  TYR A CB  1 
ATOM   3626 C  CG  . TYR A 1  458 ? 11.623  84.640 61.026 1.00 29.43 ? 458  TYR A CG  1 
ATOM   3627 C  CD1 . TYR A 1  458 ? 10.259  84.846 60.854 1.00 27.09 ? 458  TYR A CD1 1 
ATOM   3628 C  CD2 . TYR A 1  458 ? 12.054  83.341 61.307 1.00 27.33 ? 458  TYR A CD2 1 
ATOM   3629 C  CE1 . TYR A 1  458 ? 9.325   83.781 60.958 1.00 23.65 ? 458  TYR A CE1 1 
ATOM   3630 C  CE2 . TYR A 1  458 ? 11.123  82.271 61.420 1.00 25.25 ? 458  TYR A CE2 1 
ATOM   3631 C  CZ  . TYR A 1  458 ? 9.760   82.505 61.233 1.00 23.92 ? 458  TYR A CZ  1 
ATOM   3632 O  OH  . TYR A 1  458 ? 8.823   81.468 61.346 1.00 21.88 ? 458  TYR A OH  1 
ATOM   3633 N  N   . THR A 1  459 ? 15.089  87.179 61.749 1.00 33.06 ? 459  THR A N   1 
ATOM   3634 C  CA  . THR A 1  459 ? 16.210  88.060 61.485 1.00 32.95 ? 459  THR A CA  1 
ATOM   3635 C  C   . THR A 1  459 ? 16.321  88.280 59.979 1.00 33.22 ? 459  THR A C   1 
ATOM   3636 O  O   . THR A 1  459 ? 15.691  87.559 59.190 1.00 33.24 ? 459  THR A O   1 
ATOM   3637 C  CB  . THR A 1  459 ? 17.531  87.469 62.013 1.00 32.93 ? 459  THR A CB  1 
ATOM   3638 O  OG1 . THR A 1  459 ? 17.808  86.234 61.327 1.00 33.05 ? 459  THR A OG1 1 
ATOM   3639 C  CG2 . THR A 1  459 ? 17.450  87.225 63.528 1.00 32.45 ? 459  THR A CG2 1 
ATOM   3640 N  N   . ALA A 1  460 ? 17.128  89.270 59.598 1.00 32.57 ? 460  ALA A N   1 
ATOM   3641 C  CA  . ALA A 1  460 ? 17.492  89.520 58.217 1.00 32.05 ? 460  ALA A CA  1 
ATOM   3642 C  C   . ALA A 1  460 ? 18.072  88.256 57.601 1.00 31.64 ? 460  ALA A C   1 
ATOM   3643 O  O   . ALA A 1  460 ? 17.691  87.856 56.505 1.00 31.38 ? 460  ALA A O   1 
ATOM   3644 C  CB  . ALA A 1  460 ? 18.529  90.699 58.136 1.00 32.06 ? 460  ALA A CB  1 
ATOM   3645 N  N   . GLU A 1  461 ? 19.018  87.648 58.309 1.00 31.57 ? 461  GLU A N   1 
ATOM   3646 C  CA  . GLU A 1  461 ? 19.701  86.441 57.848 1.00 31.81 ? 461  GLU A CA  1 
ATOM   3647 C  C   . GLU A 1  461 ? 18.694  85.286 57.676 1.00 31.02 ? 461  GLU A C   1 
ATOM   3648 O  O   . GLU A 1  461 ? 18.845  84.440 56.791 1.00 30.82 ? 461  GLU A O   1 
ATOM   3649 C  CB  . GLU A 1  461 ? 20.821  86.050 58.822 1.00 32.18 ? 461  GLU A CB  1 
ATOM   3650 C  CG  . GLU A 1  461 ? 21.852  87.165 59.110 1.00 35.40 ? 461  GLU A CG  1 
ATOM   3651 C  CD  . GLU A 1  461 ? 21.412  88.158 60.215 1.00 39.76 ? 461  GLU A CD  1 
ATOM   3652 O  OE1 . GLU A 1  461 ? 20.212  88.232 60.570 1.00 42.03 ? 461  GLU A OE1 1 
ATOM   3653 O  OE2 . GLU A 1  461 ? 22.277  88.885 60.741 1.00 43.82 ? 461  GLU A OE2 1 
ATOM   3654 N  N   . GLU A 1  462 ? 17.644  85.284 58.494 1.00 29.96 ? 462  GLU A N   1 
ATOM   3655 C  CA  . GLU A 1  462 ? 16.617  84.277 58.351 1.00 29.45 ? 462  GLU A CA  1 
ATOM   3656 C  C   . GLU A 1  462 ? 15.764  84.504 57.117 1.00 29.45 ? 462  GLU A C   1 
ATOM   3657 O  O   . GLU A 1  462 ? 15.387  83.530 56.443 1.00 29.68 ? 462  GLU A O   1 
ATOM   3658 C  CB  . GLU A 1  462 ? 15.791  84.138 59.627 1.00 28.90 ? 462  GLU A CB  1 
ATOM   3659 C  CG  . GLU A 1  462 ? 16.577  83.368 60.668 1.00 28.67 ? 462  GLU A CG  1 
ATOM   3660 C  CD  . GLU A 1  462 ? 15.963  83.342 62.053 1.00 29.88 ? 462  GLU A CD  1 
ATOM   3661 O  OE1 . GLU A 1  462 ? 15.202  84.269 62.431 1.00 29.02 ? 462  GLU A OE1 1 
ATOM   3662 O  OE2 . GLU A 1  462 ? 16.277  82.366 62.776 1.00 30.62 ? 462  GLU A OE2 1 
ATOM   3663 N  N   . GLU A 1  463 ? 15.472  85.773 56.809 1.00 28.87 ? 463  GLU A N   1 
ATOM   3664 C  CA  . GLU A 1  463 ? 14.759  86.098 55.575 1.00 28.26 ? 463  GLU A CA  1 
ATOM   3665 C  C   . GLU A 1  463 ? 15.608  85.651 54.389 1.00 26.68 ? 463  GLU A C   1 
ATOM   3666 O  O   . GLU A 1  463 ? 15.131  84.941 53.499 1.00 26.56 ? 463  GLU A O   1 
ATOM   3667 C  CB  . GLU A 1  463 ? 14.397  87.582 55.470 1.00 28.36 ? 463  GLU A CB  1 
ATOM   3668 C  CG  . GLU A 1  463 ? 13.801  87.908 54.083 1.00 31.83 ? 463  GLU A CG  1 
ATOM   3669 C  CD  . GLU A 1  463 ? 13.438  89.375 53.869 1.00 35.72 ? 463  GLU A CD  1 
ATOM   3670 O  OE1 . GLU A 1  463 ? 13.745  90.215 54.737 1.00 38.90 ? 463  GLU A OE1 1 
ATOM   3671 O  OE2 . GLU A 1  463 ? 12.838  89.683 52.815 1.00 36.17 ? 463  GLU A OE2 1 
ATOM   3672 N  N   . ALA A 1  464 ? 16.877  86.040 54.401 1.00 25.07 ? 464  ALA A N   1 
ATOM   3673 C  CA  . ALA A 1  464 ? 17.810  85.619 53.363 1.00 23.82 ? 464  ALA A CA  1 
ATOM   3674 C  C   . ALA A 1  464 ? 17.851  84.073 53.183 1.00 22.61 ? 464  ALA A C   1 
ATOM   3675 O  O   . ALA A 1  464 ? 17.830  83.566 52.045 1.00 22.31 ? 464  ALA A O   1 
ATOM   3676 C  CB  . ALA A 1  464 ? 19.227  86.214 53.623 1.00 23.64 ? 464  ALA A CB  1 
ATOM   3677 N  N   . LEU A 1  465 ? 17.921  83.342 54.293 1.00 21.47 ? 465  LEU A N   1 
ATOM   3678 C  CA  . LEU A 1  465 ? 17.931  81.855 54.253 1.00 20.82 ? 465  LEU A CA  1 
ATOM   3679 C  C   . LEU A 1  465 ? 16.643  81.347 53.618 1.00 20.14 ? 465  LEU A C   1 
ATOM   3680 O  O   . LEU A 1  465 ? 16.686  80.562 52.688 1.00 19.10 ? 465  LEU A O   1 
ATOM   3681 C  CB  . LEU A 1  465 ? 18.077  81.266 55.654 1.00 20.72 ? 465  LEU A CB  1 
ATOM   3682 C  CG  . LEU A 1  465 ? 17.993  79.747 55.800 1.00 20.88 ? 465  LEU A CG  1 
ATOM   3683 C  CD1 . LEU A 1  465 ? 18.995  79.018 54.912 1.00 17.72 ? 465  LEU A CD1 1 
ATOM   3684 C  CD2 . LEU A 1  465 ? 18.175  79.354 57.265 1.00 21.83 ? 465  LEU A CD2 1 
ATOM   3685 N  N   . SER A 1  466 ? 15.510  81.852 54.104 1.00 19.82 ? 466  SER A N   1 
ATOM   3686 C  CA  . SER A 1  466 ? 14.203  81.557 53.522 1.00 20.73 ? 466  SER A CA  1 
ATOM   3687 C  C   . SER A 1  466 ? 14.098  81.808 52.003 1.00 21.83 ? 466  SER A C   1 
ATOM   3688 O  O   . SER A 1  466 ? 13.587  80.951 51.257 1.00 22.66 ? 466  SER A O   1 
ATOM   3689 C  CB  . SER A 1  466 ? 13.101  82.315 54.261 1.00 20.31 ? 466  SER A CB  1 
ATOM   3690 O  OG  . SER A 1  466 ? 11.825  81.910 53.808 1.00 19.85 ? 466  SER A OG  1 
ATOM   3691 N  N   . ARG A 1  467 ? 14.584  82.958 51.538 1.00 22.59 ? 467  ARG A N   1 
ATOM   3692 C  CA  . ARG A 1  467 ? 14.536  83.273 50.105 1.00 23.50 ? 467  ARG A CA  1 
ATOM   3693 C  C   . ARG A 1  467 ? 15.368  82.297 49.324 1.00 23.50 ? 467  ARG A C   1 
ATOM   3694 O  O   . ARG A 1  467 ? 15.020  81.957 48.215 1.00 23.80 ? 467  ARG A O   1 
ATOM   3695 C  CB  . ARG A 1  467 ? 15.010  84.699 49.807 1.00 23.27 ? 467  ARG A CB  1 
ATOM   3696 C  CG  . ARG A 1  467 ? 13.965  85.740 50.139 1.00 24.94 ? 467  ARG A CG  1 
ATOM   3697 C  CD  . ARG A 1  467 ? 14.469  87.187 49.957 1.00 25.16 ? 467  ARG A CD  1 
ATOM   3698 N  NE  . ARG A 1  467 ? 13.423  88.108 50.379 1.00 26.31 ? 467  ARG A NE  1 
ATOM   3699 C  CZ  . ARG A 1  467 ? 12.343  88.396 49.659 1.00 27.86 ? 467  ARG A CZ  1 
ATOM   3700 N  NH1 . ARG A 1  467 ? 12.181  87.849 48.451 1.00 25.07 ? 467  ARG A NH1 1 
ATOM   3701 N  NH2 . ARG A 1  467 ? 11.422  89.228 50.151 1.00 26.68 ? 467  ARG A NH2 1 
ATOM   3702 N  N   . ARG A 1  468 ? 16.476  81.866 49.911 1.00 23.90 ? 468  ARG A N   1 
ATOM   3703 C  CA  . ARG A 1  468 ? 17.380  80.934 49.258 1.00 24.10 ? 468  ARG A CA  1 
ATOM   3704 C  C   . ARG A 1  468 ? 16.758  79.538 49.159 1.00 23.89 ? 468  ARG A C   1 
ATOM   3705 O  O   . ARG A 1  468 ? 16.885  78.869 48.119 1.00 23.98 ? 468  ARG A O   1 
ATOM   3706 C  CB  . ARG A 1  468 ? 18.722  80.910 49.997 1.00 24.45 ? 468  ARG A CB  1 
ATOM   3707 C  CG  . ARG A 1  468 ? 19.806  80.108 49.287 1.00 27.51 ? 468  ARG A CG  1 
ATOM   3708 C  CD  . ARG A 1  468 ? 21.196  80.432 49.830 1.00 30.50 ? 468  ARG A CD  1 
ATOM   3709 N  NE  . ARG A 1  468 ? 21.282  80.207 51.266 1.00 33.43 ? 468  ARG A NE  1 
ATOM   3710 C  CZ  . ARG A 1  468 ? 21.823  79.128 51.835 1.00 35.72 ? 468  ARG A CZ  1 
ATOM   3711 N  NH1 . ARG A 1  468 ? 22.369  78.151 51.112 1.00 35.24 ? 468  ARG A NH1 1 
ATOM   3712 N  NH2 . ARG A 1  468 ? 21.835  79.037 53.151 1.00 37.45 ? 468  ARG A NH2 1 
ATOM   3713 N  N   . ILE A 1  469 ? 16.068  79.115 50.221 1.00 22.61 ? 469  ILE A N   1 
ATOM   3714 C  CA  . ILE A 1  469 ? 15.416  77.803 50.244 1.00 21.97 ? 469  ILE A CA  1 
ATOM   3715 C  C   . ILE A 1  469 ? 14.202  77.785 49.306 1.00 21.94 ? 469  ILE A C   1 
ATOM   3716 O  O   . ILE A 1  469 ? 13.990  76.829 48.559 1.00 22.96 ? 469  ILE A O   1 
ATOM   3717 C  CB  . ILE A 1  469 ? 14.987  77.411 51.698 1.00 22.02 ? 469  ILE A CB  1 
ATOM   3718 C  CG1 . ILE A 1  469 ? 16.216  77.146 52.558 1.00 20.83 ? 469  ILE A CG1 1 
ATOM   3719 C  CG2 . ILE A 1  469 ? 14.031  76.213 51.713 1.00 19.42 ? 469  ILE A CG2 1 
ATOM   3720 C  CD1 . ILE A 1  469 ? 15.907  76.961 54.014 1.00 18.22 ? 469  ILE A CD1 1 
ATOM   3721 N  N   . MET A 1  470 ? 13.395  78.831 49.346 1.00 22.03 ? 470  MET A N   1 
ATOM   3722 C  CA  . MET A 1  470 ? 12.270  78.945 48.409 1.00 22.19 ? 470  MET A CA  1 
ATOM   3723 C  C   . MET A 1  470 ? 12.745  78.862 46.956 1.00 21.83 ? 470  MET A C   1 
ATOM   3724 O  O   . MET A 1  470 ? 12.123  78.191 46.115 1.00 21.11 ? 470  MET A O   1 
ATOM   3725 C  CB  . MET A 1  470 ? 11.500  80.243 48.622 1.00 21.33 ? 470  MET A CB  1 
ATOM   3726 C  CG  . MET A 1  470 ? 10.691  80.211 49.874 1.00 22.86 ? 470  MET A CG  1 
ATOM   3727 S  SD  . MET A 1  470 ? 9.404   81.431 49.881 1.00 24.85 ? 470  MET A SD  1 
ATOM   3728 C  CE  . MET A 1  470 ? 10.464  82.864 49.980 1.00 19.65 ? 470  MET A CE  1 
ATOM   3729 N  N   . HIS A 1  471 ? 13.849  79.543 46.684 1.00 20.95 ? 471  HIS A N   1 
ATOM   3730 C  CA  . HIS A 1  471 ? 14.388  79.567 45.346 1.00 21.43 ? 471  HIS A CA  1 
ATOM   3731 C  C   . HIS A 1  471 ? 15.018  78.233 44.949 1.00 20.56 ? 471  HIS A C   1 
ATOM   3732 O  O   . HIS A 1  471 ? 14.873  77.804 43.807 1.00 19.62 ? 471  HIS A O   1 
ATOM   3733 C  CB  . HIS A 1  471 ? 15.358  80.737 45.120 1.00 21.87 ? 471  HIS A CB  1 
ATOM   3734 C  CG  . HIS A 1  471 ? 15.601  81.018 43.668 1.00 22.68 ? 471  HIS A CG  1 
ATOM   3735 N  ND1 . HIS A 1  471 ? 14.571  81.283 42.782 1.00 23.48 ? 471  HIS A ND1 1 
ATOM   3736 C  CD2 . HIS A 1  471 ? 16.744  81.033 42.938 1.00 21.14 ? 471  HIS A CD2 1 
ATOM   3737 C  CE1 . HIS A 1  471 ? 15.076  81.481 41.575 1.00 22.56 ? 471  HIS A CE1 1 
ATOM   3738 N  NE2 . HIS A 1  471 ? 16.390  81.322 41.640 1.00 21.74 ? 471  HIS A NE2 1 
ATOM   3739 N  N   . TYR A 1  472 ? 15.684  77.569 45.891 1.00 20.98 ? 472  TYR A N   1 
ATOM   3740 C  CA  . TYR A 1  472 ? 16.138  76.171 45.675 1.00 20.84 ? 472  TYR A CA  1 
ATOM   3741 C  C   . TYR A 1  472 ? 14.948  75.258 45.348 1.00 20.66 ? 472  TYR A C   1 
ATOM   3742 O  O   . TYR A 1  472 ? 14.969  74.524 44.337 1.00 20.25 ? 472  TYR A O   1 
ATOM   3743 C  CB  . TYR A 1  472 ? 16.802  75.594 46.913 1.00 21.30 ? 472  TYR A CB  1 
ATOM   3744 C  CG  . TYR A 1  472 ? 18.231  76.025 47.228 1.00 24.75 ? 472  TYR A CG  1 
ATOM   3745 C  CD1 . TYR A 1  472 ? 19.171  76.294 46.213 1.00 24.22 ? 472  TYR A CD1 1 
ATOM   3746 C  CD2 . TYR A 1  472 ? 18.657  76.080 48.560 1.00 25.13 ? 472  TYR A CD2 1 
ATOM   3747 C  CE1 . TYR A 1  472 ? 20.476  76.645 46.534 1.00 26.25 ? 472  TYR A CE1 1 
ATOM   3748 C  CE2 . TYR A 1  472 ? 19.941  76.436 48.889 1.00 28.06 ? 472  TYR A CE2 1 
ATOM   3749 C  CZ  . TYR A 1  472 ? 20.850  76.714 47.879 1.00 28.82 ? 472  TYR A CZ  1 
ATOM   3750 O  OH  . TYR A 1  472 ? 22.124  77.067 48.244 1.00 31.66 ? 472  TYR A OH  1 
ATOM   3751 N  N   . TRP A 1  473 ? 13.920  75.302 46.202 1.00 19.77 ? 473  TRP A N   1 
ATOM   3752 C  CA  . TRP A 1  473 ? 12.763  74.406 46.022 1.00 19.96 ? 473  TRP A CA  1 
ATOM   3753 C  C   . TRP A 1  473 ? 12.105  74.645 44.666 1.00 19.98 ? 473  TRP A C   1 
ATOM   3754 O  O   . TRP A 1  473 ? 11.809  73.695 43.942 1.00 20.12 ? 473  TRP A O   1 
ATOM   3755 C  CB  . TRP A 1  473 ? 11.721  74.596 47.126 1.00 18.77 ? 473  TRP A CB  1 
ATOM   3756 C  CG  . TRP A 1  473 ? 11.815  73.667 48.343 1.00 19.04 ? 473  TRP A CG  1 
ATOM   3757 C  CD1 . TRP A 1  473 ? 10.765  73.014 48.946 1.00 18.31 ? 473  TRP A CD1 1 
ATOM   3758 C  CD2 . TRP A 1  473 ? 12.984  73.316 49.106 1.00 17.67 ? 473  TRP A CD2 1 
ATOM   3759 N  NE1 . TRP A 1  473 ? 11.202  72.301 50.026 1.00 18.16 ? 473  TRP A NE1 1 
ATOM   3760 C  CE2 . TRP A 1  473 ? 12.557  72.469 50.154 1.00 17.22 ? 473  TRP A CE2 1 
ATOM   3761 C  CE3 . TRP A 1  473 ? 14.350  73.658 49.025 1.00 17.86 ? 473  TRP A CE3 1 
ATOM   3762 C  CZ2 . TRP A 1  473 ? 13.447  71.936 51.101 1.00 16.19 ? 473  TRP A CZ2 1 
ATOM   3763 C  CZ3 . TRP A 1  473 ? 15.231  73.130 49.968 1.00 17.32 ? 473  TRP A CZ3 1 
ATOM   3764 C  CH2 . TRP A 1  473 ? 14.773  72.275 50.988 1.00 17.52 ? 473  TRP A CH2 1 
ATOM   3765 N  N   . ALA A 1  474 ? 11.885  75.918 44.332 1.00 20.13 ? 474  ALA A N   1 
ATOM   3766 C  CA  . ALA A 1  474 ? 11.127  76.290 43.129 1.00 19.85 ? 474  ALA A CA  1 
ATOM   3767 C  C   . ALA A 1  474 ? 11.906  76.063 41.851 1.00 19.57 ? 474  ALA A C   1 
ATOM   3768 O  O   . ALA A 1  474 ? 11.338  75.663 40.866 1.00 21.24 ? 474  ALA A O   1 
ATOM   3769 C  CB  . ALA A 1  474 ? 10.650  77.720 43.219 1.00 19.88 ? 474  ALA A CB  1 
ATOM   3770 N  N   . THR A 1  475 ? 13.203  76.315 41.866 1.00 20.01 ? 475  THR A N   1 
ATOM   3771 C  CA  . THR A 1  475 ? 14.084  76.025 40.724 1.00 19.78 ? 475  THR A CA  1 
ATOM   3772 C  C   . THR A 1  475 ? 14.213  74.521 40.545 1.00 20.11 ? 475  THR A C   1 
ATOM   3773 O  O   . THR A 1  475 ? 14.293  74.016 39.398 1.00 19.84 ? 475  THR A O   1 
ATOM   3774 C  CB  . THR A 1  475 ? 15.474  76.592 40.949 1.00 19.12 ? 475  THR A CB  1 
ATOM   3775 O  OG1 . THR A 1  475 ? 15.346  77.982 41.256 1.00 19.67 ? 475  THR A OG1 1 
ATOM   3776 C  CG2 . THR A 1  475 ? 16.326  76.445 39.705 1.00 20.49 ? 475  THR A CG2 1 
ATOM   3777 N  N   . PHE A 1  476 ? 14.234  73.792 41.670 1.00 19.63 ? 476  PHE A N   1 
ATOM   3778 C  CA  . PHE A 1  476 ? 14.230  72.342 41.558 1.00 18.44 ? 476  PHE A CA  1 
ATOM   3779 C  C   . PHE A 1  476 ? 12.935  71.926 40.862 1.00 18.77 ? 476  PHE A C   1 
ATOM   3780 O  O   . PHE A 1  476 ? 12.950  71.092 39.972 1.00 18.23 ? 476  PHE A O   1 
ATOM   3781 C  CB  . PHE A 1  476 ? 14.325  71.622 42.902 1.00 17.93 ? 476  PHE A CB  1 
ATOM   3782 C  CG  . PHE A 1  476 ? 14.181  70.118 42.769 1.00 15.19 ? 476  PHE A CG  1 
ATOM   3783 C  CD1 . PHE A 1  476 ? 15.252  69.349 42.292 1.00 14.99 ? 476  PHE A CD1 1 
ATOM   3784 C  CD2 . PHE A 1  476 ? 12.980  69.501 43.047 1.00 11.69 ? 476  PHE A CD2 1 
ATOM   3785 C  CE1 . PHE A 1  476 ? 15.137  67.964 42.153 1.00 14.42 ? 476  PHE A CE1 1 
ATOM   3786 C  CE2 . PHE A 1  476 ? 12.809  68.097 42.890 1.00 11.32 ? 476  PHE A CE2 1 
ATOM   3787 C  CZ  . PHE A 1  476 ? 13.889  67.329 42.453 1.00 15.21 ? 476  PHE A CZ  1 
ATOM   3788 N  N   . ALA A 1  477 ? 11.814  72.502 41.279 1.00 19.51 ? 477  ALA A N   1 
ATOM   3789 C  CA  . ALA A 1  477 ? 10.540  72.057 40.745 1.00 20.93 ? 477  ALA A CA  1 
ATOM   3790 C  C   . ALA A 1  477 ? 10.472  72.400 39.251 1.00 21.67 ? 477  ALA A C   1 
ATOM   3791 O  O   . ALA A 1  477 ? 9.949   71.621 38.460 1.00 21.05 ? 477  ALA A O   1 
ATOM   3792 C  CB  . ALA A 1  477 ? 9.376   72.683 41.516 1.00 20.80 ? 477  ALA A CB  1 
ATOM   3793 N  N   . LYS A 1  478 ? 11.082  73.537 38.887 1.00 22.48 ? 478  LYS A N   1 
ATOM   3794 C  CA  A LYS A 1  478 ? 11.035  74.052 37.526 0.50 22.90 ? 478  LYS A CA  1 
ATOM   3795 C  CA  B LYS A 1  478 ? 11.014  74.036 37.520 0.50 22.74 ? 478  LYS A CA  1 
ATOM   3796 C  C   . LYS A 1  478 ? 11.900  73.214 36.593 1.00 22.90 ? 478  LYS A C   1 
ATOM   3797 O  O   . LYS A 1  478 ? 11.493  72.883 35.480 1.00 23.67 ? 478  LYS A O   1 
ATOM   3798 C  CB  A LYS A 1  478 ? 11.482  75.529 37.494 0.50 23.02 ? 478  LYS A CB  1 
ATOM   3799 C  CB  B LYS A 1  478 ? 11.395  75.528 37.466 0.50 22.83 ? 478  LYS A CB  1 
ATOM   3800 C  CG  A LYS A 1  478 ? 10.437  76.526 38.002 0.50 23.88 ? 478  LYS A CG  1 
ATOM   3801 C  CG  B LYS A 1  478 ? 11.201  76.212 36.104 0.50 22.80 ? 478  LYS A CG  1 
ATOM   3802 C  CD  A LYS A 1  478 ? 11.028  77.878 38.398 0.50 23.81 ? 478  LYS A CD  1 
ATOM   3803 C  CD  B LYS A 1  478 ? 11.930  77.574 36.067 0.50 23.52 ? 478  LYS A CD  1 
ATOM   3804 C  CE  A LYS A 1  478 ? 9.971   78.759 39.042 0.50 24.08 ? 478  LYS A CE  1 
ATOM   3805 C  CE  B LYS A 1  478 ? 12.127  78.051 34.637 0.50 24.63 ? 478  LYS A CE  1 
ATOM   3806 N  NZ  A LYS A 1  478 ? 8.991   79.328 38.060 0.50 24.95 ? 478  LYS A NZ  1 
ATOM   3807 N  NZ  B LYS A 1  478 ? 13.507  78.573 34.412 0.50 26.48 ? 478  LYS A NZ  1 
ATOM   3808 N  N   . THR A 1  479 ? 13.087  72.857 37.064 1.00 22.66 ? 479  THR A N   1 
ATOM   3809 C  CA  . THR A 1  479 ? 14.113  72.297 36.187 1.00 22.27 ? 479  THR A CA  1 
ATOM   3810 C  C   . THR A 1  479 ? 14.657  70.923 36.581 1.00 22.74 ? 479  THR A C   1 
ATOM   3811 O  O   . THR A 1  479 ? 15.400  70.310 35.804 1.00 22.50 ? 479  THR A O   1 
ATOM   3812 C  CB  . THR A 1  479 ? 15.351  73.227 36.181 1.00 22.49 ? 479  THR A CB  1 
ATOM   3813 O  OG1 . THR A 1  479 ? 15.954  73.187 37.474 1.00 21.91 ? 479  THR A OG1 1 
ATOM   3814 C  CG2 . THR A 1  479 ? 14.990  74.681 35.826 1.00 20.50 ? 479  THR A CG2 1 
ATOM   3815 N  N   . GLY A 1  480 ? 14.333  70.464 37.797 1.00 22.41 ? 480  GLY A N   1 
ATOM   3816 C  CA  . GLY A 1  480 ? 14.907  69.235 38.327 1.00 21.34 ? 480  GLY A CA  1 
ATOM   3817 C  C   . GLY A 1  480 ? 16.281  69.498 38.911 1.00 20.82 ? 480  GLY A C   1 
ATOM   3818 O  O   . GLY A 1  480 ? 17.007  68.546 39.220 1.00 20.68 ? 480  GLY A O   1 
ATOM   3819 N  N   . ASN A 1  481 ? 16.637  70.778 39.064 1.00 20.14 ? 481  ASN A N   1 
ATOM   3820 C  CA  . ASN A 1  481 ? 17.962  71.192 39.624 1.00 19.88 ? 481  ASN A CA  1 
ATOM   3821 C  C   . ASN A 1  481 ? 17.745  72.419 40.499 1.00 20.15 ? 481  ASN A C   1 
ATOM   3822 O  O   . ASN A 1  481 ? 17.223  73.441 40.008 1.00 19.63 ? 481  ASN A O   1 
ATOM   3823 C  CB  . ASN A 1  481 ? 18.966  71.513 38.497 1.00 20.29 ? 481  ASN A CB  1 
ATOM   3824 C  CG  . ASN A 1  481 ? 20.423  71.678 38.993 1.00 21.02 ? 481  ASN A CG  1 
ATOM   3825 O  OD1 . ASN A 1  481 ? 20.678  72.044 40.145 1.00 24.99 ? 481  ASN A OD1 1 
ATOM   3826 N  ND2 . ASN A 1  481 ? 21.379  71.411 38.112 1.00 17.87 ? 481  ASN A ND2 1 
ATOM   3827 N  N   . PRO A 1  482 ? 18.097  72.342 41.807 1.00 20.49 ? 482  PRO A N   1 
ATOM   3828 C  CA  . PRO A 1  482 ? 17.886  73.530 42.663 1.00 21.79 ? 482  PRO A CA  1 
ATOM   3829 C  C   . PRO A 1  482 ? 18.808  74.729 42.302 1.00 23.15 ? 482  PRO A C   1 
ATOM   3830 O  O   . PRO A 1  482 ? 18.539  75.859 42.724 1.00 22.75 ? 482  PRO A O   1 
ATOM   3831 C  CB  . PRO A 1  482 ? 18.241  73.011 44.056 1.00 21.24 ? 482  PRO A CB  1 
ATOM   3832 C  CG  . PRO A 1  482 ? 19.251  71.988 43.808 1.00 19.83 ? 482  PRO A CG  1 
ATOM   3833 C  CD  . PRO A 1  482 ? 18.785  71.281 42.551 1.00 20.22 ? 482  PRO A CD  1 
ATOM   3834 N  N   . ASN A 1  483 ? 19.878  74.466 41.548 1.00 24.99 ? 483  ASN A N   1 
ATOM   3835 C  CA  . ASN A 1  483 ? 20.824  75.510 41.125 1.00 28.13 ? 483  ASN A CA  1 
ATOM   3836 C  C   . ASN A 1  483 ? 20.387  76.300 39.878 1.00 31.06 ? 483  ASN A C   1 
ATOM   3837 O  O   . ASN A 1  483 ? 19.992  75.722 38.861 1.00 30.62 ? 483  ASN A O   1 
ATOM   3838 C  CB  . ASN A 1  483 ? 22.211  74.910 40.877 1.00 26.66 ? 483  ASN A CB  1 
ATOM   3839 C  CG  . ASN A 1  483 ? 22.760  74.195 42.098 1.00 24.59 ? 483  ASN A CG  1 
ATOM   3840 O  OD1 . ASN A 1  483 ? 23.002  74.812 43.134 1.00 21.65 ? 483  ASN A OD1 1 
ATOM   3841 N  ND2 . ASN A 1  483 ? 22.953  72.893 41.983 1.00 19.91 ? 483  ASN A ND2 1 
ATOM   3842 N  N   . GLU A 1  484 ? 20.447  77.627 39.985 1.00 35.52 ? 484  GLU A N   1 
ATOM   3843 C  CA  . GLU A 1  484 ? 20.398  78.522 38.824 1.00 39.39 ? 484  GLU A CA  1 
ATOM   3844 C  C   . GLU A 1  484 ? 21.552  78.185 37.874 1.00 41.84 ? 484  GLU A C   1 
ATOM   3845 O  O   . GLU A 1  484 ? 22.733  78.316 38.243 1.00 41.58 ? 484  GLU A O   1 
ATOM   3846 C  CB  . GLU A 1  484 ? 20.566  79.972 39.273 1.00 40.02 ? 484  GLU A CB  1 
ATOM   3847 C  CG  . GLU A 1  484 ? 19.380  80.610 39.964 1.00 42.87 ? 484  GLU A CG  1 
ATOM   3848 C  CD  . GLU A 1  484 ? 18.340  81.074 38.976 1.00 46.34 ? 484  GLU A CD  1 
ATOM   3849 O  OE1 . GLU A 1  484 ? 18.398  80.654 37.800 1.00 48.20 ? 484  GLU A OE1 1 
ATOM   3850 O  OE2 . GLU A 1  484 ? 17.456  81.853 39.374 1.00 48.18 ? 484  GLU A OE2 1 
ATOM   3851 N  N   . PRO A 1  485 ? 21.225  77.724 36.653 1.00 44.76 ? 485  PRO A N   1 
ATOM   3852 C  CA  . PRO A 1  485 ? 22.291  77.630 35.660 1.00 46.72 ? 485  PRO A CA  1 
ATOM   3853 C  C   . PRO A 1  485 ? 22.861  79.039 35.419 1.00 48.56 ? 485  PRO A C   1 
ATOM   3854 O  O   . PRO A 1  485 ? 22.100  80.037 35.467 1.00 48.28 ? 485  PRO A O   1 
ATOM   3855 C  CB  . PRO A 1  485 ? 21.561  77.119 34.410 1.00 46.96 ? 485  PRO A CB  1 
ATOM   3856 C  CG  . PRO A 1  485 ? 20.134  77.629 34.574 1.00 46.82 ? 485  PRO A CG  1 
ATOM   3857 C  CD  . PRO A 1  485 ? 19.891  77.467 36.065 1.00 45.41 ? 485  PRO A CD  1 
ATOM   3858 N  N   . HIS A 1  486 ? 24.177  79.108 35.185 1.00 50.31 ? 486  HIS A N   1 
ATOM   3859 C  CA  . HIS A 1  486 ? 24.893  80.377 34.947 1.00 52.49 ? 486  HIS A CA  1 
ATOM   3860 C  C   . HIS A 1  486 ? 24.552  81.396 36.057 1.00 52.80 ? 486  HIS A C   1 
ATOM   3861 O  O   . HIS A 1  486 ? 23.674  82.264 35.904 1.00 53.27 ? 486  HIS A O   1 
ATOM   3862 C  CB  . HIS A 1  486 ? 24.650  80.951 33.517 1.00 53.03 ? 486  HIS A CB  1 
ATOM   3863 C  CG  . HIS A 1  486 ? 24.457  79.909 32.443 1.00 55.42 ? 486  HIS A CG  1 
ATOM   3864 N  ND1 . HIS A 1  486 ? 25.205  78.750 32.368 1.00 58.30 ? 486  HIS A ND1 1 
ATOM   3865 C  CD2 . HIS A 1  486 ? 23.603  79.868 31.389 1.00 57.31 ? 486  HIS A CD2 1 
ATOM   3866 C  CE1 . HIS A 1  486 ? 24.812  78.035 31.326 1.00 58.69 ? 486  HIS A CE1 1 
ATOM   3867 N  NE2 . HIS A 1  486 ? 23.843  78.693 30.713 1.00 58.51 ? 486  HIS A NE2 1 
ATOM   3868 N  N   . SER A 1  487 ? 25.244  81.245 37.181 1.00 52.94 ? 487  SER A N   1 
ATOM   3869 C  CA  . SER A 1  487 ? 24.988  82.007 38.398 1.00 52.99 ? 487  SER A CA  1 
ATOM   3870 C  C   . SER A 1  487 ? 26.209  81.843 39.298 1.00 52.91 ? 487  SER A C   1 
ATOM   3871 O  O   . SER A 1  487 ? 26.777  80.750 39.391 1.00 53.00 ? 487  SER A O   1 
ATOM   3872 C  CB  . SER A 1  487 ? 23.709  81.505 39.083 1.00 52.97 ? 487  SER A CB  1 
ATOM   3873 O  OG  . SER A 1  487 ? 23.832  81.437 40.501 1.00 53.56 ? 487  SER A OG  1 
ATOM   3874 N  N   . GLN A 1  488 ? 26.604  82.930 39.955 1.00 52.85 ? 488  GLN A N   1 
ATOM   3875 C  CA  . GLN A 1  488 ? 27.860  82.981 40.732 1.00 52.89 ? 488  GLN A CA  1 
ATOM   3876 C  C   . GLN A 1  488 ? 27.772  82.334 42.128 1.00 51.72 ? 488  GLN A C   1 
ATOM   3877 O  O   . GLN A 1  488 ? 28.791  82.195 42.832 1.00 51.59 ? 488  GLN A O   1 
ATOM   3878 C  CB  . GLN A 1  488 ? 28.378  84.435 40.828 1.00 53.52 ? 488  GLN A CB  1 
ATOM   3879 C  CG  . GLN A 1  488 ? 28.703  85.096 39.459 1.00 56.03 ? 488  GLN A CG  1 
ATOM   3880 C  CD  . GLN A 1  488 ? 29.856  84.408 38.710 1.00 58.43 ? 488  GLN A CD  1 
ATOM   3881 O  OE1 . GLN A 1  488 ? 31.032  84.702 38.946 1.00 60.14 ? 488  GLN A OE1 1 
ATOM   3882 N  NE2 . GLN A 1  488 ? 29.516  83.504 37.795 1.00 59.05 ? 488  GLN A NE2 1 
ATOM   3883 N  N   . GLU A 1  489 ? 26.553  81.931 42.499 1.00 50.32 ? 489  GLU A N   1 
ATOM   3884 C  CA  . GLU A 1  489 ? 26.257  81.321 43.800 1.00 48.46 ? 489  GLU A CA  1 
ATOM   3885 C  C   . GLU A 1  489 ? 26.932  79.971 43.984 1.00 46.18 ? 489  GLU A C   1 
ATOM   3886 O  O   . GLU A 1  489 ? 27.156  79.231 43.025 1.00 45.84 ? 489  GLU A O   1 
ATOM   3887 C  CB  . GLU A 1  489 ? 24.735  81.191 43.993 1.00 49.30 ? 489  GLU A CB  1 
ATOM   3888 C  CG  . GLU A 1  489 ? 24.110  82.252 44.902 1.00 51.65 ? 489  GLU A CG  1 
ATOM   3889 C  CD  . GLU A 1  489 ? 24.536  83.661 44.533 1.00 55.89 ? 489  GLU A CD  1 
ATOM   3890 O  OE1 . GLU A 1  489 ? 24.176  84.102 43.421 1.00 58.21 ? 489  GLU A OE1 1 
ATOM   3891 O  OE2 . GLU A 1  489 ? 25.229  84.328 45.347 1.00 56.97 ? 489  GLU A OE2 1 
ATOM   3892 N  N   . SER A 1  490 ? 27.282  79.682 45.230 1.00 43.85 ? 490  SER A N   1 
ATOM   3893 C  CA  . SER A 1  490 ? 27.784  78.374 45.620 1.00 41.54 ? 490  SER A CA  1 
ATOM   3894 C  C   . SER A 1  490 ? 26.777  77.291 45.197 1.00 39.11 ? 490  SER A C   1 
ATOM   3895 O  O   . SER A 1  490 ? 25.550  77.480 45.365 1.00 38.92 ? 490  SER A O   1 
ATOM   3896 C  CB  . SER A 1  490 ? 27.999  78.348 47.126 1.00 41.79 ? 490  SER A CB  1 
ATOM   3897 O  OG  . SER A 1  490 ? 29.126  77.553 47.436 1.00 44.21 ? 490  SER A OG  1 
ATOM   3898 N  N   . LYS A 1  491 ? 27.295  76.189 44.642 1.00 36.33 ? 491  LYS A N   1 
ATOM   3899 C  CA  A LYS A 1  491 ? 26.449  75.183 44.009 0.50 35.30 ? 491  LYS A CA  1 
ATOM   3900 C  CA  B LYS A 1  491 ? 26.483  75.157 43.987 0.50 35.25 ? 491  LYS A CA  1 
ATOM   3901 C  C   . LYS A 1  491 ? 26.187  73.967 44.903 1.00 34.22 ? 491  LYS A C   1 
ATOM   3902 O  O   . LYS A 1  491 ? 27.118  73.397 45.503 1.00 34.01 ? 491  LYS A O   1 
ATOM   3903 C  CB  A LYS A 1  491 ? 27.026  74.749 42.653 0.50 35.63 ? 491  LYS A CB  1 
ATOM   3904 C  CB  B LYS A 1  491 ? 27.186  74.627 42.727 0.50 35.54 ? 491  LYS A CB  1 
ATOM   3905 C  CG  A LYS A 1  491 ? 27.134  75.873 41.623 0.50 36.44 ? 491  LYS A CG  1 
ATOM   3906 C  CG  B LYS A 1  491 ? 27.044  75.470 41.470 0.50 36.08 ? 491  LYS A CG  1 
ATOM   3907 C  CD  A LYS A 1  491 ? 25.770  76.474 41.320 0.50 37.49 ? 491  LYS A CD  1 
ATOM   3908 C  CD  B LYS A 1  491 ? 27.727  74.778 40.290 0.50 36.03 ? 491  LYS A CD  1 
ATOM   3909 C  CE  A LYS A 1  491 ? 25.879  77.621 40.340 0.50 37.96 ? 491  LYS A CE  1 
ATOM   3910 C  CE  B LYS A 1  491 ? 27.551  75.564 39.008 0.50 36.14 ? 491  LYS A CE  1 
ATOM   3911 N  NZ  A LYS A 1  491 ? 24.611  78.396 40.297 0.50 38.98 ? 491  LYS A NZ  1 
ATOM   3912 N  NZ  B LYS A 1  491 ? 28.271  74.915 37.882 0.50 36.69 ? 491  LYS A NZ  1 
ATOM   3913 N  N   . TRP A 1  492 ? 24.903  73.594 44.979 1.00 31.43 ? 492  TRP A N   1 
ATOM   3914 C  CA  . TRP A 1  492 ? 24.416  72.425 45.681 1.00 27.83 ? 492  TRP A CA  1 
ATOM   3915 C  C   . TRP A 1  492 ? 24.699  71.231 44.785 1.00 27.29 ? 492  TRP A C   1 
ATOM   3916 O  O   . TRP A 1  492 ? 23.979  71.014 43.804 1.00 27.13 ? 492  TRP A O   1 
ATOM   3917 C  CB  . TRP A 1  492 ? 22.907  72.564 45.894 1.00 27.05 ? 492  TRP A CB  1 
ATOM   3918 C  CG  . TRP A 1  492 ? 22.235  71.483 46.743 1.00 25.35 ? 492  TRP A CG  1 
ATOM   3919 C  CD1 . TRP A 1  492 ? 22.719  70.229 47.050 1.00 23.20 ? 492  TRP A CD1 1 
ATOM   3920 C  CD2 . TRP A 1  492 ? 20.933  71.563 47.347 1.00 22.69 ? 492  TRP A CD2 1 
ATOM   3921 N  NE1 . TRP A 1  492 ? 21.809  69.547 47.827 1.00 22.67 ? 492  TRP A NE1 1 
ATOM   3922 C  CE2 . TRP A 1  492 ? 20.706  70.338 48.020 1.00 22.35 ? 492  TRP A CE2 1 
ATOM   3923 C  CE3 . TRP A 1  492 ? 19.942  72.562 47.395 1.00 21.59 ? 492  TRP A CE3 1 
ATOM   3924 C  CZ2 . TRP A 1  492 ? 19.515  70.077 48.731 1.00 21.84 ? 492  TRP A CZ2 1 
ATOM   3925 C  CZ3 . TRP A 1  492 ? 18.763  72.310 48.109 1.00 21.03 ? 492  TRP A CZ3 1 
ATOM   3926 C  CH2 . TRP A 1  492 ? 18.564  71.075 48.771 1.00 21.77 ? 492  TRP A CH2 1 
ATOM   3927 N  N   . PRO A 1  493 ? 25.749  70.445 45.101 1.00 26.21 ? 493  PRO A N   1 
ATOM   3928 C  CA  . PRO A 1  493 ? 26.133  69.307 44.255 1.00 25.24 ? 493  PRO A CA  1 
ATOM   3929 C  C   . PRO A 1  493 ? 25.116  68.184 44.256 1.00 24.75 ? 493  PRO A C   1 
ATOM   3930 O  O   . PRO A 1  493 ? 24.454  67.941 45.260 1.00 25.66 ? 493  PRO A O   1 
ATOM   3931 C  CB  . PRO A 1  493 ? 27.412  68.799 44.921 1.00 24.87 ? 493  PRO A CB  1 
ATOM   3932 C  CG  . PRO A 1  493 ? 27.217  69.168 46.370 1.00 25.24 ? 493  PRO A CG  1 
ATOM   3933 C  CD  . PRO A 1  493 ? 26.578  70.521 46.320 1.00 26.11 ? 493  PRO A CD  1 
ATOM   3934 N  N   . LEU A 1  494 ? 25.001  67.506 43.128 1.00 24.09 ? 494  LEU A N   1 
ATOM   3935 C  CA  . LEU A 1  494 ? 24.285  66.256 43.034 1.00 23.21 ? 494  LEU A CA  1 
ATOM   3936 C  C   . LEU A 1  494 ? 24.786  65.248 44.096 1.00 23.20 ? 494  LEU A C   1 
ATOM   3937 O  O   . LEU A 1  494 ? 25.990  65.198 44.434 1.00 22.81 ? 494  LEU A O   1 
ATOM   3938 C  CB  . LEU A 1  494 ? 24.470  65.704 41.618 1.00 22.18 ? 494  LEU A CB  1 
ATOM   3939 C  CG  . LEU A 1  494 ? 23.402  65.001 40.761 1.00 23.51 ? 494  LEU A CG  1 
ATOM   3940 C  CD1 . LEU A 1  494 ? 21.984  65.476 40.910 1.00 18.93 ? 494  LEU A CD1 1 
ATOM   3941 C  CD2 . LEU A 1  494 ? 23.811  65.161 39.296 1.00 22.99 ? 494  LEU A CD2 1 
ATOM   3942 N  N   . PHE A 1  495 ? 23.843  64.483 44.649 1.00 23.20 ? 495  PHE A N   1 
ATOM   3943 C  CA  . PHE A 1  495 ? 24.159  63.367 45.529 1.00 22.54 ? 495  PHE A CA  1 
ATOM   3944 C  C   . PHE A 1  495 ? 24.387  62.167 44.620 1.00 22.96 ? 495  PHE A C   1 
ATOM   3945 O  O   . PHE A 1  495 ? 23.516  61.802 43.846 1.00 22.04 ? 495  PHE A O   1 
ATOM   3946 C  CB  . PHE A 1  495 ? 23.000  63.077 46.499 1.00 21.93 ? 495  PHE A CB  1 
ATOM   3947 C  CG  . PHE A 1  495 ? 23.172  61.793 47.300 1.00 20.69 ? 495  PHE A CG  1 
ATOM   3948 C  CD1 . PHE A 1  495 ? 22.944  60.545 46.713 1.00 17.95 ? 495  PHE A CD1 1 
ATOM   3949 C  CD2 . PHE A 1  495 ? 23.549  61.835 48.637 1.00 18.40 ? 495  PHE A CD2 1 
ATOM   3950 C  CE1 . PHE A 1  495 ? 23.122  59.365 47.440 1.00 20.43 ? 495  PHE A CE1 1 
ATOM   3951 C  CE2 . PHE A 1  495 ? 23.713  60.658 49.380 1.00 18.67 ? 495  PHE A CE2 1 
ATOM   3952 C  CZ  . PHE A 1  495 ? 23.513  59.428 48.791 1.00 18.92 ? 495  PHE A CZ  1 
ATOM   3953 N  N   . THR A 1  496 ? 25.552  61.544 44.732 1.00 23.88 ? 496  THR A N   1 
ATOM   3954 C  CA  . THR A 1  496 ? 25.873  60.392 43.893 1.00 25.15 ? 496  THR A CA  1 
ATOM   3955 C  C   . THR A 1  496 ? 26.119  59.135 44.742 1.00 26.52 ? 496  THR A C   1 
ATOM   3956 O  O   . THR A 1  496 ? 26.508  59.219 45.902 1.00 26.56 ? 496  THR A O   1 
ATOM   3957 C  CB  . THR A 1  496 ? 27.085  60.676 42.985 1.00 24.71 ? 496  THR A CB  1 
ATOM   3958 O  OG1 . THR A 1  496 ? 28.234  60.983 43.792 1.00 24.91 ? 496  THR A OG1 1 
ATOM   3959 C  CG2 . THR A 1  496 ? 26.785  61.841 42.034 1.00 22.36 ? 496  THR A CG2 1 
ATOM   3960 N  N   . THR A 1  497 ? 25.858  57.973 44.166 1.00 28.26 ? 497  THR A N   1 
ATOM   3961 C  CA  . THR A 1  497 ? 26.114  56.710 44.854 1.00 29.76 ? 497  THR A CA  1 
ATOM   3962 C  C   . THR A 1  497 ? 27.522  56.703 45.458 1.00 29.73 ? 497  THR A C   1 
ATOM   3963 O  O   . THR A 1  497 ? 27.739  56.276 46.605 1.00 29.99 ? 497  THR A O   1 
ATOM   3964 C  CB  . THR A 1  497 ? 25.934  55.522 43.883 1.00 29.58 ? 497  THR A CB  1 
ATOM   3965 O  OG1 . THR A 1  497 ? 24.534  55.338 43.638 1.00 32.98 ? 497  THR A OG1 1 
ATOM   3966 C  CG2 . THR A 1  497 ? 26.490  54.241 44.475 1.00 30.30 ? 497  THR A CG2 1 
ATOM   3967 N  N   . LYS A 1  498 ? 28.478  57.208 44.691 1.00 29.65 ? 498  LYS A N   1 
ATOM   3968 C  CA  . LYS A 1  498 ? 29.861  57.139 45.103 1.00 29.08 ? 498  LYS A CA  1 
ATOM   3969 C  C   . LYS A 1  498 ? 30.213  58.198 46.143 1.00 28.62 ? 498  LYS A C   1 
ATOM   3970 O  O   . LYS A 1  498 ? 30.730  57.872 47.211 1.00 27.98 ? 498  LYS A O   1 
ATOM   3971 C  CB  . LYS A 1  498 ? 30.798  57.217 43.901 1.00 29.10 ? 498  LYS A CB  1 
ATOM   3972 C  CG  . LYS A 1  498 ? 32.258  57.182 44.326 1.00 31.80 ? 498  LYS A CG  1 
ATOM   3973 C  CD  . LYS A 1  498 ? 33.180  56.921 43.184 1.00 36.42 ? 498  LYS A CD  1 
ATOM   3974 C  CE  . LYS A 1  498 ? 34.525  57.582 43.451 1.00 39.75 ? 498  LYS A CE  1 
ATOM   3975 N  NZ  . LYS A 1  498 ? 35.177  57.881 42.146 1.00 42.39 ? 498  LYS A NZ  1 
ATOM   3976 N  N   . GLU A 1  499 ? 29.937  59.457 45.835 1.00 28.14 ? 499  GLU A N   1 
ATOM   3977 C  CA  . GLU A 1  499 ? 30.455  60.535 46.662 1.00 28.28 ? 499  GLU A CA  1 
ATOM   3978 C  C   . GLU A 1  499 ? 29.514  60.941 47.790 1.00 26.92 ? 499  GLU A C   1 
ATOM   3979 O  O   . GLU A 1  499 ? 29.967  61.475 48.807 1.00 26.86 ? 499  GLU A O   1 
ATOM   3980 C  CB  . GLU A 1  499 ? 30.813  61.750 45.806 1.00 29.44 ? 499  GLU A CB  1 
ATOM   3981 C  CG  . GLU A 1  499 ? 31.543  61.403 44.512 1.00 33.96 ? 499  GLU A CG  1 
ATOM   3982 C  CD  . GLU A 1  499 ? 32.945  61.919 44.467 1.00 41.89 ? 499  GLU A CD  1 
ATOM   3983 O  OE1 . GLU A 1  499 ? 33.136  63.117 44.122 1.00 45.33 ? 499  GLU A OE1 1 
ATOM   3984 O  OE2 . GLU A 1  499 ? 33.869  61.117 44.755 1.00 46.85 ? 499  GLU A OE2 1 
ATOM   3985 N  N   . GLN A 1  500 ? 28.212  60.724 47.598 1.00 25.53 ? 500  GLN A N   1 
ATOM   3986 C  CA  . GLN A 1  500 ? 27.213  60.903 48.673 1.00 24.24 ? 500  GLN A CA  1 
ATOM   3987 C  C   . GLN A 1  500 ? 27.187  62.317 49.302 1.00 23.32 ? 500  GLN A C   1 
ATOM   3988 O  O   . GLN A 1  500 ? 27.080  62.479 50.527 1.00 22.31 ? 500  GLN A O   1 
ATOM   3989 C  CB  . GLN A 1  500 ? 27.393  59.796 49.729 1.00 24.09 ? 500  GLN A CB  1 
ATOM   3990 C  CG  . GLN A 1  500 ? 26.977  58.426 49.191 1.00 25.14 ? 500  GLN A CG  1 
ATOM   3991 C  CD  . GLN A 1  500 ? 27.473  57.287 50.032 1.00 26.40 ? 500  GLN A CD  1 
ATOM   3992 O  OE1 . GLN A 1  500 ? 27.278  57.268 51.240 1.00 27.77 ? 500  GLN A OE1 1 
ATOM   3993 N  NE2 . GLN A 1  500 ? 28.141  56.330 49.398 1.00 27.02 ? 500  GLN A NE2 1 
ATOM   3994 N  N   . LYS A 1  501 ? 27.273  63.339 48.455 1.00 22.12 ? 501  LYS A N   1 
ATOM   3995 C  CA  . LYS A 1  501 ? 27.389  64.703 48.964 1.00 21.91 ? 501  LYS A CA  1 
ATOM   3996 C  C   . LYS A 1  501 ? 26.045  65.298 49.370 1.00 21.24 ? 501  LYS A C   1 
ATOM   3997 O  O   . LYS A 1  501 ? 25.007  64.959 48.791 1.00 21.37 ? 501  LYS A O   1 
ATOM   3998 C  CB  . LYS A 1  501 ? 28.042  65.616 47.943 1.00 22.13 ? 501  LYS A CB  1 
ATOM   3999 C  CG  . LYS A 1  501 ? 29.461  65.297 47.640 1.00 24.40 ? 501  LYS A CG  1 
ATOM   4000 C  CD  . LYS A 1  501 ? 29.895  66.110 46.424 1.00 28.55 ? 501  LYS A CD  1 
ATOM   4001 C  CE  . LYS A 1  501 ? 31.312  65.725 45.983 1.00 30.17 ? 501  LYS A CE  1 
ATOM   4002 N  NZ  . LYS A 1  501 ? 31.806  66.748 45.014 1.00 31.50 ? 501  LYS A NZ  1 
ATOM   4003 N  N   . PHE A 1  502 ? 26.082  66.170 50.370 1.00 19.52 ? 502  PHE A N   1 
ATOM   4004 C  CA  . PHE A 1  502 ? 24.932  66.960 50.738 1.00 19.76 ? 502  PHE A CA  1 
ATOM   4005 C  C   . PHE A 1  502 ? 25.392  68.328 51.209 1.00 19.95 ? 502  PHE A C   1 
ATOM   4006 O  O   . PHE A 1  502 ? 26.572  68.567 51.379 1.00 19.45 ? 502  PHE A O   1 
ATOM   4007 C  CB  . PHE A 1  502 ? 24.097  66.288 51.843 1.00 19.30 ? 502  PHE A CB  1 
ATOM   4008 C  CG  . PHE A 1  502 ? 24.808  66.156 53.167 1.00 17.25 ? 502  PHE A CG  1 
ATOM   4009 C  CD1 . PHE A 1  502 ? 25.673  65.096 53.392 1.00 15.30 ? 502  PHE A CD1 1 
ATOM   4010 C  CD2 . PHE A 1  502 ? 24.578  67.080 54.191 1.00 15.82 ? 502  PHE A CD2 1 
ATOM   4011 C  CE1 . PHE A 1  502 ? 26.331  64.963 54.606 1.00 16.38 ? 502  PHE A CE1 1 
ATOM   4012 C  CE2 . PHE A 1  502 ? 25.220  66.961 55.416 1.00 15.71 ? 502  PHE A CE2 1 
ATOM   4013 C  CZ  . PHE A 1  502 ? 26.086  65.879 55.636 1.00 15.79 ? 502  PHE A CZ  1 
ATOM   4014 N  N   . ILE A 1  503 ? 24.441  69.212 51.424 1.00 20.31 ? 503  ILE A N   1 
ATOM   4015 C  CA  . ILE A 1  503 ? 24.766  70.513 51.932 1.00 21.56 ? 503  ILE A CA  1 
ATOM   4016 C  C   . ILE A 1  503 ? 24.096  70.724 53.278 1.00 22.29 ? 503  ILE A C   1 
ATOM   4017 O  O   . ILE A 1  503 ? 23.087  70.082 53.590 1.00 21.97 ? 503  ILE A O   1 
ATOM   4018 C  CB  . ILE A 1  503 ? 24.340  71.626 50.936 1.00 21.13 ? 503  ILE A CB  1 
ATOM   4019 C  CG1 . ILE A 1  503 ? 22.818  71.658 50.729 1.00 21.88 ? 503  ILE A CG1 1 
ATOM   4020 C  CG2 . ILE A 1  503 ? 25.048  71.433 49.597 1.00 21.16 ? 503  ILE A CG2 1 
ATOM   4021 C  CD1 . ILE A 1  503 ? 22.281  73.036 50.252 1.00 21.73 ? 503  ILE A CD1 1 
ATOM   4022 N  N   . ASP A 1  504 ? 24.670  71.613 54.077 1.00 23.40 ? 504  ASP A N   1 
ATOM   4023 C  CA  . ASP A 1  504 ? 23.946  72.161 55.200 1.00 25.16 ? 504  ASP A CA  1 
ATOM   4024 C  C   . ASP A 1  504 ? 23.021  73.278 54.684 1.00 24.93 ? 504  ASP A C   1 
ATOM   4025 O  O   . ASP A 1  504 ? 23.342  73.987 53.724 1.00 25.84 ? 504  ASP A O   1 
ATOM   4026 C  CB  . ASP A 1  504 ? 24.891  72.707 56.270 1.00 26.06 ? 504  ASP A CB  1 
ATOM   4027 C  CG  . ASP A 1  504 ? 25.830  71.640 56.869 1.00 29.37 ? 504  ASP A CG  1 
ATOM   4028 O  OD1 . ASP A 1  504 ? 25.464  70.444 57.008 1.00 29.96 ? 504  ASP A OD1 1 
ATOM   4029 O  OD2 . ASP A 1  504 ? 26.964  72.027 57.236 1.00 32.73 ? 504  ASP A OD2 1 
ATOM   4030 N  N   . LEU A 1  505 ? 21.855  73.396 55.298 1.00 24.10 ? 505  LEU A N   1 
ATOM   4031 C  CA  . LEU A 1  505 ? 20.976  74.512 55.062 1.00 23.07 ? 505  LEU A CA  1 
ATOM   4032 C  C   . LEU A 1  505 ? 20.903  75.317 56.337 1.00 23.65 ? 505  LEU A C   1 
ATOM   4033 O  O   . LEU A 1  505 ? 20.285  74.887 57.320 1.00 22.36 ? 505  LEU A O   1 
ATOM   4034 C  CB  . LEU A 1  505 ? 19.579  74.052 54.662 1.00 22.09 ? 505  LEU A CB  1 
ATOM   4035 C  CG  . LEU A 1  505 ? 19.388  73.693 53.203 1.00 20.78 ? 505  LEU A CG  1 
ATOM   4036 C  CD1 . LEU A 1  505 ? 17.937  73.225 53.012 1.00 18.17 ? 505  LEU A CD1 1 
ATOM   4037 C  CD2 . LEU A 1  505 ? 19.764  74.907 52.265 1.00 17.92 ? 505  LEU A CD2 1 
ATOM   4038 N  N   . ASN A 1  506 ? 21.543  76.486 56.314 1.00 23.79 ? 506  ASN A N   1 
ATOM   4039 C  CA  . ASN A 1  506 ? 21.516  77.379 57.449 1.00 24.88 ? 506  ASN A CA  1 
ATOM   4040 C  C   . ASN A 1  506 ? 22.014  78.762 57.030 1.00 25.99 ? 506  ASN A C   1 
ATOM   4041 O  O   . ASN A 1  506 ? 22.171  79.038 55.849 1.00 25.42 ? 506  ASN A O   1 
ATOM   4042 C  CB  . ASN A 1  506 ? 22.367  76.802 58.577 1.00 24.15 ? 506  ASN A CB  1 
ATOM   4043 C  CG  . ASN A 1  506 ? 23.814  76.638 58.174 1.00 24.29 ? 506  ASN A CG  1 
ATOM   4044 O  OD1 . ASN A 1  506 ? 24.405  77.554 57.619 1.00 24.77 ? 506  ASN A OD1 1 
ATOM   4045 N  ND2 . ASN A 1  506 ? 24.397  75.472 58.453 1.00 23.85 ? 506  ASN A ND2 1 
ATOM   4046 N  N   . THR A 1  507 ? 22.290  79.620 57.996 1.00 28.18 ? 507  THR A N   1 
ATOM   4047 C  CA  . THR A 1  507 ? 22.528  81.032 57.691 1.00 30.09 ? 507  THR A CA  1 
ATOM   4048 C  C   . THR A 1  507 ? 23.990  81.325 57.366 1.00 31.78 ? 507  THR A C   1 
ATOM   4049 O  O   . THR A 1  507 ? 24.317  82.411 56.922 1.00 32.90 ? 507  THR A O   1 
ATOM   4050 C  CB  . THR A 1  507 ? 21.992  81.939 58.789 1.00 29.72 ? 507  THR A CB  1 
ATOM   4051 O  OG1 . THR A 1  507 ? 22.572  81.561 60.043 1.00 29.51 ? 507  THR A OG1 1 
ATOM   4052 C  CG2 . THR A 1  507 ? 20.462  81.828 58.860 1.00 28.38 ? 507  THR A CG2 1 
ATOM   4053 N  N   . GLU A 1  508 ? 24.849  80.331 57.529 1.00 33.99 ? 508  GLU A N   1 
ATOM   4054 C  CA  . GLU A 1  508 ? 26.269  80.474 57.228 1.00 36.27 ? 508  GLU A CA  1 
ATOM   4055 C  C   . GLU A 1  508 ? 26.505  80.176 55.756 1.00 36.98 ? 508  GLU A C   1 
ATOM   4056 O  O   . GLU A 1  508 ? 25.595  79.697 55.073 1.00 37.58 ? 508  GLU A O   1 
ATOM   4057 C  CB  . GLU A 1  508 ? 27.080  79.504 58.083 1.00 36.89 ? 508  GLU A CB  1 
ATOM   4058 C  CG  . GLU A 1  508 ? 27.050  79.819 59.569 1.00 41.65 ? 508  GLU A CG  1 
ATOM   4059 C  CD  . GLU A 1  508 ? 27.109  78.542 60.402 1.00 48.40 ? 508  GLU A CD  1 
ATOM   4060 O  OE1 . GLU A 1  508 ? 26.052  77.878 60.525 1.00 50.26 ? 508  GLU A OE1 1 
ATOM   4061 O  OE2 . GLU A 1  508 ? 28.203  78.196 60.924 1.00 50.72 ? 508  GLU A OE2 1 
ATOM   4062 N  N   . PRO A 1  509 ? 27.715  80.472 55.247 1.00 37.50 ? 509  PRO A N   1 
ATOM   4063 C  CA  . PRO A 1  509 ? 28.016  80.116 53.868 1.00 37.92 ? 509  PRO A CA  1 
ATOM   4064 C  C   . PRO A 1  509 ? 27.998  78.601 53.632 1.00 38.10 ? 509  PRO A C   1 
ATOM   4065 O  O   . PRO A 1  509 ? 28.392  77.826 54.494 1.00 38.26 ? 509  PRO A O   1 
ATOM   4066 C  CB  . PRO A 1  509 ? 29.422  80.701 53.659 1.00 38.12 ? 509  PRO A CB  1 
ATOM   4067 C  CG  . PRO A 1  509 ? 29.480  81.849 54.616 1.00 37.79 ? 509  PRO A CG  1 
ATOM   4068 C  CD  . PRO A 1  509 ? 28.780  81.312 55.832 1.00 37.52 ? 509  PRO A CD  1 
ATOM   4069 N  N   . MET A 1  510 ? 27.539  78.190 52.456 1.00 38.50 ? 510  MET A N   1 
ATOM   4070 C  CA  . MET A 1  510 ? 27.254  76.787 52.191 1.00 38.10 ? 510  MET A CA  1 
ATOM   4071 C  C   . MET A 1  510 ? 28.492  75.910 52.373 1.00 37.49 ? 510  MET A C   1 
ATOM   4072 O  O   . MET A 1  510 ? 29.593  76.259 51.942 1.00 38.00 ? 510  MET A O   1 
ATOM   4073 C  CB  . MET A 1  510 ? 26.649  76.617 50.798 1.00 38.63 ? 510  MET A CB  1 
ATOM   4074 C  CG  . MET A 1  510 ? 26.471  75.146 50.344 1.00 39.90 ? 510  MET A CG  1 
ATOM   4075 S  SD  . MET A 1  510 ? 26.245  74.976 48.557 1.00 41.67 ? 510  MET A SD  1 
ATOM   4076 C  CE  . MET A 1  510 ? 24.704  75.853 48.348 1.00 40.29 ? 510  MET A CE  1 
ATOM   4077 N  N   . LYS A 1  511 ? 28.293  74.784 53.053 1.00 35.97 ? 511  LYS A N   1 
ATOM   4078 C  CA  . LYS A 1  511 ? 29.319  73.780 53.238 1.00 34.44 ? 511  LYS A CA  1 
ATOM   4079 C  C   . LYS A 1  511 ? 28.802  72.457 52.673 1.00 32.84 ? 511  LYS A C   1 
ATOM   4080 O  O   . LYS A 1  511 ? 27.646  72.061 52.914 1.00 32.81 ? 511  LYS A O   1 
ATOM   4081 C  CB  . LYS A 1  511 ? 29.635  73.610 54.721 1.00 34.59 ? 511  LYS A CB  1 
ATOM   4082 C  CG  . LYS A 1  511 ? 30.742  74.481 55.236 1.00 37.95 ? 511  LYS A CG  1 
ATOM   4083 C  CD  . LYS A 1  511 ? 32.114  73.807 55.049 1.00 42.61 ? 511  LYS A CD  1 
ATOM   4084 C  CE  . LYS A 1  511 ? 33.186  74.487 55.918 1.00 45.77 ? 511  LYS A CE  1 
ATOM   4085 N  NZ  . LYS A 1  511 ? 32.676  74.821 57.311 1.00 45.18 ? 511  LYS A NZ  1 
ATOM   4086 N  N   . VAL A 1  512 ? 29.661  71.785 51.925 1.00 30.33 ? 512  VAL A N   1 
ATOM   4087 C  CA  . VAL A 1  512 ? 29.375  70.469 51.390 1.00 28.53 ? 512  VAL A CA  1 
ATOM   4088 C  C   . VAL A 1  512 ? 29.993  69.423 52.314 1.00 27.38 ? 512  VAL A C   1 
ATOM   4089 O  O   . VAL A 1  512 ? 31.136  69.582 52.752 1.00 26.51 ? 512  VAL A O   1 
ATOM   4090 C  CB  . VAL A 1  512 ? 29.955  70.335 49.954 1.00 28.37 ? 512  VAL A CB  1 
ATOM   4091 C  CG1 . VAL A 1  512 ? 29.964  68.875 49.472 1.00 25.98 ? 512  VAL A CG1 1 
ATOM   4092 C  CG2 . VAL A 1  512 ? 29.176  71.253 48.995 1.00 28.52 ? 512  VAL A CG2 1 
ATOM   4093 N  N   . HIS A 1  513 ? 29.231  68.364 52.607 1.00 25.98 ? 513  HIS A N   1 
ATOM   4094 C  CA  . HIS A 1  513 ? 29.725  67.221 53.391 1.00 24.15 ? 513  HIS A CA  1 
ATOM   4095 C  C   . HIS A 1  513 ? 29.403  65.939 52.670 1.00 23.70 ? 513  HIS A C   1 
ATOM   4096 O  O   . HIS A 1  513 ? 28.662  65.946 51.691 1.00 23.00 ? 513  HIS A O   1 
ATOM   4097 C  CB  . HIS A 1  513 ? 29.085  67.171 54.782 1.00 23.97 ? 513  HIS A CB  1 
ATOM   4098 C  CG  . HIS A 1  513 ? 29.100  68.478 55.514 1.00 23.37 ? 513  HIS A CG  1 
ATOM   4099 N  ND1 . HIS A 1  513 ? 30.241  69.000 56.086 1.00 23.87 ? 513  HIS A ND1 1 
ATOM   4100 C  CD2 . HIS A 1  513 ? 28.104  69.353 55.792 1.00 23.65 ? 513  HIS A CD2 1 
ATOM   4101 C  CE1 . HIS A 1  513 ? 29.950  70.145 56.680 1.00 23.95 ? 513  HIS A CE1 1 
ATOM   4102 N  NE2 . HIS A 1  513 ? 28.661  70.386 56.506 1.00 25.53 ? 513  HIS A NE2 1 
ATOM   4103 N  N   . GLN A 1  514 ? 29.951  64.829 53.164 1.00 23.21 ? 514  GLN A N   1 
ATOM   4104 C  CA  . GLN A 1  514 ? 29.659  63.528 52.596 1.00 22.68 ? 514  GLN A CA  1 
ATOM   4105 C  C   . GLN A 1  514 ? 29.184  62.555 53.656 1.00 21.59 ? 514  GLN A C   1 
ATOM   4106 O  O   . GLN A 1  514 ? 29.518  62.695 54.824 1.00 21.51 ? 514  GLN A O   1 
ATOM   4107 C  CB  . GLN A 1  514 ? 30.892  62.987 51.910 1.00 23.41 ? 514  GLN A CB  1 
ATOM   4108 C  CG  . GLN A 1  514 ? 31.255  63.836 50.732 1.00 26.30 ? 514  GLN A CG  1 
ATOM   4109 C  CD  . GLN A 1  514 ? 32.578  63.473 50.140 1.00 28.10 ? 514  GLN A CD  1 
ATOM   4110 O  OE1 . GLN A 1  514 ? 33.610  63.988 50.564 1.00 32.49 ? 514  GLN A OE1 1 
ATOM   4111 N  NE2 . GLN A 1  514 ? 32.566  62.589 49.155 1.00 29.42 ? 514  GLN A NE2 1 
ATOM   4112 N  N   . ARG A 1  515 ? 28.366  61.602 53.223 1.00 20.90 ? 515  ARG A N   1 
ATOM   4113 C  CA  . ARG A 1  515 ? 27.916  60.457 54.031 1.00 20.08 ? 515  ARG A CA  1 
ATOM   4114 C  C   . ARG A 1  515 ? 27.206  60.871 55.327 1.00 18.87 ? 515  ARG A C   1 
ATOM   4115 O  O   . ARG A 1  515 ? 27.672  60.615 56.419 1.00 17.81 ? 515  ARG A O   1 
ATOM   4116 C  CB  . ARG A 1  515 ? 29.078  59.480 54.282 1.00 20.85 ? 515  ARG A CB  1 
ATOM   4117 C  CG  . ARG A 1  515 ? 29.840  59.056 53.023 1.00 21.43 ? 515  ARG A CG  1 
ATOM   4118 C  CD  . ARG A 1  515 ? 30.841  57.934 53.333 1.00 25.79 ? 515  ARG A CD  1 
ATOM   4119 N  NE  . ARG A 1  515 ? 31.195  57.143 52.161 1.00 27.48 ? 515  ARG A NE  1 
ATOM   4120 C  CZ  . ARG A 1  515 ? 31.954  56.047 52.184 1.00 31.25 ? 515  ARG A CZ  1 
ATOM   4121 N  NH1 . ARG A 1  515 ? 32.465  55.577 53.332 1.00 30.54 ? 515  ARG A NH1 1 
ATOM   4122 N  NH2 . ARG A 1  515 ? 32.196  55.408 51.044 1.00 29.88 ? 515  ARG A NH2 1 
ATOM   4123 N  N   . LEU A 1  516 ? 26.078  61.548 55.154 1.00 18.20 ? 516  LEU A N   1 
ATOM   4124 C  CA  . LEU A 1  516 ? 25.224  62.018 56.233 1.00 18.07 ? 516  LEU A CA  1 
ATOM   4125 C  C   . LEU A 1  516 ? 24.979  60.958 57.308 1.00 18.06 ? 516  LEU A C   1 
ATOM   4126 O  O   . LEU A 1  516 ? 24.367  59.933 57.035 1.00 18.48 ? 516  LEU A O   1 
ATOM   4127 C  CB  . LEU A 1  516 ? 23.907  62.509 55.636 1.00 17.55 ? 516  LEU A CB  1 
ATOM   4128 C  CG  . LEU A 1  516 ? 22.856  63.195 56.512 1.00 18.31 ? 516  LEU A CG  1 
ATOM   4129 C  CD1 . LEU A 1  516 ? 23.489  64.011 57.556 1.00 20.82 ? 516  LEU A CD1 1 
ATOM   4130 C  CD2 . LEU A 1  516 ? 22.016  64.094 55.621 1.00 17.94 ? 516  LEU A CD2 1 
ATOM   4131 N  N   . ARG A 1  517 ? 25.472  61.214 58.525 1.00 17.91 ? 517  ARG A N   1 
ATOM   4132 C  CA  . ARG A 1  517 ? 25.280  60.310 59.686 1.00 17.61 ? 517  ARG A CA  1 
ATOM   4133 C  C   . ARG A 1  517 ? 25.551  58.861 59.368 1.00 16.87 ? 517  ARG A C   1 
ATOM   4134 O  O   . ARG A 1  517 ? 24.882  57.962 59.889 1.00 16.53 ? 517  ARG A O   1 
ATOM   4135 C  CB  . ARG A 1  517 ? 23.887  60.523 60.341 1.00 17.72 ? 517  ARG A CB  1 
ATOM   4136 C  CG  . ARG A 1  517 ? 23.940  61.880 61.104 1.00 21.10 ? 517  ARG A CG  1 
ATOM   4137 C  CD  . ARG A 1  517 ? 22.744  62.257 61.957 1.00 21.70 ? 517  ARG A CD  1 
ATOM   4138 N  NE  . ARG A 1  517 ? 22.703  61.565 63.233 1.00 24.04 ? 517  ARG A NE  1 
ATOM   4139 C  CZ  . ARG A 1  517 ? 23.519  61.788 64.270 1.00 26.66 ? 517  ARG A CZ  1 
ATOM   4140 N  NH1 . ARG A 1  517 ? 24.511  62.676 64.180 1.00 26.01 ? 517  ARG A NH1 1 
ATOM   4141 N  NH2 . ARG A 1  517 ? 23.350  61.093 65.401 1.00 24.03 ? 517  ARG A NH2 1 
ATOM   4142 N  N   . VAL A 1  518 ? 26.541  58.632 58.503 1.00 16.22 ? 518  VAL A N   1 
ATOM   4143 C  CA  . VAL A 1  518 ? 26.863  57.266 58.079 1.00 15.84 ? 518  VAL A CA  1 
ATOM   4144 C  C   . VAL A 1  518 ? 27.097  56.284 59.254 1.00 15.99 ? 518  VAL A C   1 
ATOM   4145 O  O   . VAL A 1  518 ? 26.597  55.166 59.212 1.00 16.15 ? 518  VAL A O   1 
ATOM   4146 C  CB  . VAL A 1  518 ? 27.998  57.220 57.011 1.00 15.05 ? 518  VAL A CB  1 
ATOM   4147 C  CG1 . VAL A 1  518 ? 29.358  57.639 57.598 1.00 14.85 ? 518  VAL A CG1 1 
ATOM   4148 C  CG2 . VAL A 1  518 ? 28.048  55.839 56.311 1.00 13.14 ? 518  VAL A CG2 1 
ATOM   4149 N  N   . GLN A 1  519 ? 27.823  56.697 60.295 1.00 16.08 ? 519  GLN A N   1 
ATOM   4150 C  CA  . GLN A 1  519 ? 28.163  55.769 61.381 1.00 17.51 ? 519  GLN A CA  1 
ATOM   4151 C  C   . GLN A 1  519 ? 26.896  55.212 62.014 1.00 17.08 ? 519  GLN A C   1 
ATOM   4152 O  O   . GLN A 1  519 ? 26.697  54.017 62.064 1.00 16.85 ? 519  GLN A O   1 
ATOM   4153 C  CB  . GLN A 1  519 ? 29.064  56.431 62.462 1.00 17.81 ? 519  GLN A CB  1 
ATOM   4154 C  CG  . GLN A 1  519 ? 29.846  55.414 63.284 1.00 19.62 ? 519  GLN A CG  1 
ATOM   4155 C  CD  . GLN A 1  519 ? 30.913  54.679 62.444 1.00 23.90 ? 519  GLN A CD  1 
ATOM   4156 O  OE1 . GLN A 1  519 ? 31.468  55.242 61.488 1.00 23.84 ? 519  GLN A OE1 1 
ATOM   4157 N  NE2 . GLN A 1  519 ? 31.184  53.422 62.789 1.00 22.96 ? 519  GLN A NE2 1 
ATOM   4158 N  N   . MET A 1  520 ? 26.035  56.117 62.462 1.00 17.34 ? 520  MET A N   1 
ATOM   4159 C  CA  . MET A 1  520 ? 24.758  55.769 63.030 1.00 17.75 ? 520  MET A CA  1 
ATOM   4160 C  C   . MET A 1  520 ? 23.836  55.029 62.064 1.00 17.30 ? 520  MET A C   1 
ATOM   4161 O  O   . MET A 1  520 ? 23.139  54.073 62.479 1.00 18.17 ? 520  MET A O   1 
ATOM   4162 C  CB  . MET A 1  520 ? 24.090  57.016 63.609 1.00 18.52 ? 520  MET A CB  1 
ATOM   4163 C  CG  . MET A 1  520 ? 24.833  57.617 64.825 1.00 22.62 ? 520  MET A CG  1 
ATOM   4164 S  SD  . MET A 1  520 ? 25.452  56.342 65.990 1.00 33.33 ? 520  MET A SD  1 
ATOM   4165 C  CE  . MET A 1  520 ? 26.044  57.372 67.358 1.00 32.50 ? 520  MET A CE  1 
ATOM   4166 N  N   . CYS A 1  521 ? 23.823  55.423 60.790 1.00 16.13 ? 521  CYS A N   1 
ATOM   4167 C  CA  . CYS A 1  521 ? 22.915  54.757 59.838 1.00 16.20 ? 521  CYS A CA  1 
ATOM   4168 C  C   . CYS A 1  521 ? 23.378  53.364 59.428 1.00 15.14 ? 521  CYS A C   1 
ATOM   4169 O  O   . CYS A 1  521 ? 22.542  52.520 59.148 1.00 14.48 ? 521  CYS A O   1 
ATOM   4170 C  CB  . CYS A 1  521 ? 22.547  55.632 58.644 1.00 15.38 ? 521  CYS A CB  1 
ATOM   4171 S  SG  . CYS A 1  521 ? 21.641  57.130 59.175 1.00 18.99 ? 521  CYS A SG  1 
ATOM   4172 N  N   . VAL A 1  522 ? 24.681  53.089 59.456 1.00 14.83 ? 522  VAL A N   1 
ATOM   4173 C  CA  . VAL A 1  522 ? 25.094  51.681 59.266 1.00 15.71 ? 522  VAL A CA  1 
ATOM   4174 C  C   . VAL A 1  522 ? 24.503  50.841 60.409 1.00 15.69 ? 522  VAL A C   1 
ATOM   4175 O  O   . VAL A 1  522 ? 23.936  49.773 60.184 1.00 16.02 ? 522  VAL A O   1 
ATOM   4176 C  CB  . VAL A 1  522 ? 26.631  51.470 59.178 1.00 16.88 ? 522  VAL A CB  1 
ATOM   4177 C  CG1 . VAL A 1  522 ? 26.994  49.929 59.243 1.00 16.90 ? 522  VAL A CG1 1 
ATOM   4178 C  CG2 . VAL A 1  522 ? 27.184  52.088 57.911 1.00 16.71 ? 522  VAL A CG2 1 
ATOM   4179 N  N   . PHE A 1  523 ? 24.567  51.369 61.628 1.00 15.21 ? 523  PHE A N   1 
ATOM   4180 C  CA  . PHE A 1  523 ? 23.957  50.692 62.766 1.00 14.73 ? 523  PHE A CA  1 
ATOM   4181 C  C   . PHE A 1  523 ? 22.461  50.414 62.560 1.00 14.27 ? 523  PHE A C   1 
ATOM   4182 O  O   . PHE A 1  523 ? 22.033  49.267 62.619 1.00 14.59 ? 523  PHE A O   1 
ATOM   4183 C  CB  . PHE A 1  523 ? 24.211  51.450 64.077 1.00 13.85 ? 523  PHE A CB  1 
ATOM   4184 C  CG  . PHE A 1  523 ? 23.450  50.888 65.238 1.00 14.60 ? 523  PHE A CG  1 
ATOM   4185 C  CD1 . PHE A 1  523 ? 23.977  49.813 65.992 1.00 14.41 ? 523  PHE A CD1 1 
ATOM   4186 C  CD2 . PHE A 1  523 ? 22.181  51.375 65.547 1.00 10.77 ? 523  PHE A CD2 1 
ATOM   4187 C  CE1 . PHE A 1  523 ? 23.279  49.276 67.060 1.00 13.24 ? 523  PHE A CE1 1 
ATOM   4188 C  CE2 . PHE A 1  523 ? 21.479  50.852 66.605 1.00 13.26 ? 523  PHE A CE2 1 
ATOM   4189 C  CZ  . PHE A 1  523 ? 22.021  49.795 67.379 1.00 15.56 ? 523  PHE A CZ  1 
ATOM   4190 N  N   . TRP A 1  524 ? 21.690  51.455 62.288 1.00 13.94 ? 524  TRP A N   1 
ATOM   4191 C  CA  . TRP A 1  524 ? 20.243  51.339 62.135 1.00 14.33 ? 524  TRP A CA  1 
ATOM   4192 C  C   . TRP A 1  524 ? 19.808  50.572 60.898 1.00 15.13 ? 524  TRP A C   1 
ATOM   4193 O  O   . TRP A 1  524 ? 18.854  49.821 60.984 1.00 14.89 ? 524  TRP A O   1 
ATOM   4194 C  CB  . TRP A 1  524 ? 19.551  52.705 62.153 1.00 14.16 ? 524  TRP A CB  1 
ATOM   4195 C  CG  . TRP A 1  524 ? 19.577  53.366 63.508 1.00 15.31 ? 524  TRP A CG  1 
ATOM   4196 C  CD1 . TRP A 1  524 ? 20.335  54.441 63.884 1.00 14.90 ? 524  TRP A CD1 1 
ATOM   4197 C  CD2 . TRP A 1  524 ? 18.838  52.965 64.679 1.00 14.92 ? 524  TRP A CD2 1 
ATOM   4198 N  NE1 . TRP A 1  524 ? 20.101  54.749 65.193 1.00 14.42 ? 524  TRP A NE1 1 
ATOM   4199 C  CE2 . TRP A 1  524 ? 19.193  53.853 65.713 1.00 15.57 ? 524  TRP A CE2 1 
ATOM   4200 C  CE3 . TRP A 1  524 ? 17.926  51.940 64.950 1.00 13.08 ? 524  TRP A CE3 1 
ATOM   4201 C  CZ2 . TRP A 1  524 ? 18.644  53.764 66.999 1.00 12.76 ? 524  TRP A CZ2 1 
ATOM   4202 C  CZ3 . TRP A 1  524 ? 17.387  51.852 66.220 1.00 15.04 ? 524  TRP A CZ3 1 
ATOM   4203 C  CH2 . TRP A 1  524 ? 17.759  52.753 67.233 1.00 15.64 ? 524  TRP A CH2 1 
ATOM   4204 N  N   . ASN A 1  525 ? 20.505  50.736 59.768 1.00 16.15 ? 525  ASN A N   1 
ATOM   4205 C  CA  . ASN A 1  525 ? 20.054  50.129 58.492 1.00 17.49 ? 525  ASN A CA  1 
ATOM   4206 C  C   . ASN A 1  525 ? 20.644  48.750 58.201 1.00 18.99 ? 525  ASN A C   1 
ATOM   4207 O  O   . ASN A 1  525 ? 20.063  47.961 57.467 1.00 19.42 ? 525  ASN A O   1 
ATOM   4208 C  CB  . ASN A 1  525 ? 20.323  51.070 57.310 1.00 16.46 ? 525  ASN A CB  1 
ATOM   4209 C  CG  . ASN A 1  525 ? 19.578  52.367 57.444 1.00 16.61 ? 525  ASN A CG  1 
ATOM   4210 O  OD1 . ASN A 1  525 ? 18.588  52.420 58.153 1.00 22.20 ? 525  ASN A OD1 1 
ATOM   4211 N  ND2 . ASN A 1  525 ? 20.035  53.421 56.781 1.00 12.82 ? 525  ASN A ND2 1 
ATOM   4212 N  N   . GLN A 1  526 ? 21.816  48.470 58.751 1.00 19.70 ? 526  GLN A N   1 
ATOM   4213 C  CA  A GLN A 1  526 ? 22.498  47.208 58.468 0.50 20.03 ? 526  GLN A CA  1 
ATOM   4214 C  CA  B GLN A 1  526 ? 22.468  47.212 58.464 0.50 19.88 ? 526  GLN A CA  1 
ATOM   4215 C  C   . GLN A 1  526 ? 22.612  46.357 59.716 1.00 19.99 ? 526  GLN A C   1 
ATOM   4216 O  O   . GLN A 1  526 ? 22.059  45.261 59.776 1.00 20.83 ? 526  GLN A O   1 
ATOM   4217 C  CB  A GLN A 1  526 ? 23.885  47.444 57.848 0.50 19.92 ? 526  GLN A CB  1 
ATOM   4218 C  CB  B GLN A 1  526 ? 23.801  47.455 57.749 0.50 19.73 ? 526  GLN A CB  1 
ATOM   4219 C  CG  A GLN A 1  526 ? 23.902  48.537 56.793 0.50 21.60 ? 526  GLN A CG  1 
ATOM   4220 C  CG  B GLN A 1  526 ? 23.694  47.424 56.210 0.50 20.56 ? 526  GLN A CG  1 
ATOM   4221 C  CD  A GLN A 1  526 ? 24.878  48.276 55.656 0.50 22.53 ? 526  GLN A CD  1 
ATOM   4222 C  CD  B GLN A 1  526 ? 23.009  48.649 55.572 0.50 21.24 ? 526  GLN A CD  1 
ATOM   4223 O  OE1 A GLN A 1  526 ? 26.085  48.406 55.817 0.50 22.48 ? 526  GLN A OE1 1 
ATOM   4224 O  OE1 B GLN A 1  526 ? 23.268  49.809 55.934 0.50 21.57 ? 526  GLN A OE1 1 
ATOM   4225 N  NE2 A GLN A 1  526 ? 24.342  47.919 54.484 0.50 25.21 ? 526  GLN A NE2 1 
ATOM   4226 N  NE2 B GLN A 1  526 ? 22.172  48.388 54.579 0.50 19.94 ? 526  GLN A NE2 1 
ATOM   4227 N  N   . PHE A 1  527 ? 23.304  46.865 60.739 1.00 19.71 ? 527  PHE A N   1 
ATOM   4228 C  CA  . PHE A 1  527 ? 23.599  46.008 61.884 1.00 19.46 ? 527  PHE A CA  1 
ATOM   4229 C  C   . PHE A 1  527 ? 22.416  45.643 62.787 1.00 19.32 ? 527  PHE A C   1 
ATOM   4230 O  O   . PHE A 1  527 ? 22.150  44.453 63.031 1.00 19.32 ? 527  PHE A O   1 
ATOM   4231 C  CB  . PHE A 1  527 ? 24.794  46.520 62.699 1.00 19.13 ? 527  PHE A CB  1 
ATOM   4232 C  CG  . PHE A 1  527 ? 25.071  45.692 63.918 1.00 17.90 ? 527  PHE A CG  1 
ATOM   4233 C  CD1 . PHE A 1  527 ? 25.723  44.468 63.804 1.00 17.59 ? 527  PHE A CD1 1 
ATOM   4234 C  CD2 . PHE A 1  527 ? 24.668  46.129 65.187 1.00 17.02 ? 527  PHE A CD2 1 
ATOM   4235 C  CE1 . PHE A 1  527 ? 25.988  43.686 64.940 1.00 15.78 ? 527  PHE A CE1 1 
ATOM   4236 C  CE2 . PHE A 1  527 ? 24.929  45.363 66.333 1.00 18.50 ? 527  PHE A CE2 1 
ATOM   4237 C  CZ  . PHE A 1  527 ? 25.596  44.138 66.204 1.00 17.43 ? 527  PHE A CZ  1 
ATOM   4238 N  N   . LEU A 1  528 ? 21.700  46.640 63.285 1.00 19.14 ? 528  LEU A N   1 
ATOM   4239 C  CA  . LEU A 1  528 ? 20.578  46.344 64.175 1.00 19.83 ? 528  LEU A CA  1 
ATOM   4240 C  C   . LEU A 1  528 ? 19.514  45.429 63.520 1.00 20.38 ? 528  LEU A C   1 
ATOM   4241 O  O   . LEU A 1  528 ? 19.110  44.457 64.133 1.00 20.15 ? 528  LEU A O   1 
ATOM   4242 C  CB  . LEU A 1  528 ? 19.963  47.612 64.792 1.00 19.28 ? 528  LEU A CB  1 
ATOM   4243 C  CG  . LEU A 1  528 ? 18.792  47.314 65.749 1.00 19.30 ? 528  LEU A CG  1 
ATOM   4244 C  CD1 . LEU A 1  528 ? 19.255  46.496 66.964 1.00 16.81 ? 528  LEU A CD1 1 
ATOM   4245 C  CD2 . LEU A 1  528 ? 18.012  48.622 66.193 1.00 17.08 ? 528  LEU A CD2 1 
ATOM   4246 N  N   . PRO A 1  529 ? 19.088  45.705 62.269 1.00 21.38 ? 529  PRO A N   1 
ATOM   4247 C  CA  . PRO A 1  529 ? 18.124  44.758 61.661 1.00 22.48 ? 529  PRO A CA  1 
ATOM   4248 C  C   . PRO A 1  529 ? 18.642  43.304 61.606 1.00 23.08 ? 529  PRO A C   1 
ATOM   4249 O  O   . PRO A 1  529 ? 17.903  42.361 61.902 1.00 23.45 ? 529  PRO A O   1 
ATOM   4250 C  CB  . PRO A 1  529 ? 17.904  45.342 60.243 1.00 22.27 ? 529  PRO A CB  1 
ATOM   4251 C  CG  . PRO A 1  529 ? 18.223  46.789 60.390 1.00 21.72 ? 529  PRO A CG  1 
ATOM   4252 C  CD  . PRO A 1  529 ? 19.412  46.795 61.331 1.00 20.92 ? 529  PRO A CD  1 
ATOM   4253 N  N   . LYS A 1  530 ? 19.914  43.124 61.296 1.00 23.70 ? 530  LYS A N   1 
ATOM   4254 C  CA  . LYS A 1  530 ? 20.477  41.785 61.262 1.00 24.59 ? 530  LYS A CA  1 
ATOM   4255 C  C   . LYS A 1  530 ? 20.509  41.180 62.681 1.00 25.49 ? 530  LYS A C   1 
ATOM   4256 O  O   . LYS A 1  530 ? 20.287  39.967 62.860 1.00 25.53 ? 530  LYS A O   1 
ATOM   4257 C  CB  . LYS A 1  530 ? 21.861  41.809 60.614 1.00 24.74 ? 530  LYS A CB  1 
ATOM   4258 C  CG  . LYS A 1  530 ? 22.602  40.483 60.662 1.00 27.34 ? 530  LYS A CG  1 
ATOM   4259 C  CD  . LYS A 1  530 ? 23.831  40.490 59.755 1.00 30.71 ? 530  LYS A CD  1 
ATOM   4260 C  CE  . LYS A 1  530 ? 24.363  39.058 59.558 1.00 33.61 ? 530  LYS A CE  1 
ATOM   4261 N  NZ  . LYS A 1  530 ? 25.660  39.029 58.819 1.00 34.52 ? 530  LYS A NZ  1 
ATOM   4262 N  N   . LEU A 1  531 ? 20.750  42.021 63.690 1.00 25.75 ? 531  LEU A N   1 
ATOM   4263 C  CA  . LEU A 1  531 ? 20.731  41.554 65.074 1.00 25.68 ? 531  LEU A CA  1 
ATOM   4264 C  C   . LEU A 1  531 ? 19.360  41.051 65.466 1.00 26.36 ? 531  LEU A C   1 
ATOM   4265 O  O   . LEU A 1  531 ? 19.225  39.947 65.999 1.00 25.59 ? 531  LEU A O   1 
ATOM   4266 C  CB  . LEU A 1  531 ? 21.204  42.652 66.040 1.00 25.31 ? 531  LEU A CB  1 
ATOM   4267 C  CG  . LEU A 1  531 ? 21.403  42.265 67.513 1.00 24.48 ? 531  LEU A CG  1 
ATOM   4268 C  CD1 . LEU A 1  531 ? 22.460  43.125 68.167 1.00 24.11 ? 531  LEU A CD1 1 
ATOM   4269 C  CD2 . LEU A 1  531 ? 20.092  42.382 68.251 1.00 23.24 ? 531  LEU A CD2 1 
ATOM   4270 N  N   . LEU A 1  532 ? 18.341  41.867 65.219 1.00 27.77 ? 532  LEU A N   1 
ATOM   4271 C  CA  . LEU A 1  532 ? 16.973  41.519 65.632 1.00 29.55 ? 532  LEU A CA  1 
ATOM   4272 C  C   . LEU A 1  532 ? 16.435  40.304 64.877 1.00 31.43 ? 532  LEU A C   1 
ATOM   4273 O  O   . LEU A 1  532 ? 15.705  39.517 65.439 1.00 31.47 ? 532  LEU A O   1 
ATOM   4274 C  CB  . LEU A 1  532 ? 16.018  42.703 65.488 1.00 28.86 ? 532  LEU A CB  1 
ATOM   4275 C  CG  . LEU A 1  532 ? 16.276  43.936 66.348 1.00 27.13 ? 532  LEU A CG  1 
ATOM   4276 C  CD1 . LEU A 1  532 ? 15.236  44.949 65.965 1.00 27.24 ? 532  LEU A CD1 1 
ATOM   4277 C  CD2 . LEU A 1  532 ? 16.257  43.671 67.865 1.00 23.96 ? 532  LEU A CD2 1 
ATOM   4278 N  N   . ASN A 1  533 ? 16.822  40.145 63.616 1.00 34.33 ? 533  ASN A N   1 
ATOM   4279 C  CA  . ASN A 1  533 ? 16.435  38.971 62.840 1.00 37.33 ? 533  ASN A CA  1 
ATOM   4280 C  C   . ASN A 1  533 ? 17.085  37.658 63.342 1.00 39.12 ? 533  ASN A C   1 
ATOM   4281 O  O   . ASN A 1  533 ? 16.470  36.587 63.298 1.00 39.57 ? 533  ASN A O   1 
ATOM   4282 C  CB  . ASN A 1  533 ? 16.770  39.187 61.359 1.00 37.34 ? 533  ASN A CB  1 
ATOM   4283 C  CG  . ASN A 1  533 ? 16.309  38.030 60.473 1.00 39.33 ? 533  ASN A CG  1 
ATOM   4284 O  OD1 . ASN A 1  533 ? 17.122  37.365 59.830 1.00 40.60 ? 533  ASN A OD1 1 
ATOM   4285 N  ND2 . ASN A 1  533 ? 14.993  37.785 60.441 1.00 42.64 ? 533  ASN A ND2 1 
ATOM   4286 N  N   . ALA A 1  534 ? 18.328  37.739 63.802 1.00 40.79 ? 534  ALA A N   1 
ATOM   4287 C  CA  . ALA A 1  534 ? 19.073  36.537 64.147 1.00 42.38 ? 534  ALA A CA  1 
ATOM   4288 C  C   . ALA A 1  534 ? 18.690  36.039 65.539 1.00 43.93 ? 534  ALA A C   1 
ATOM   4289 O  O   . ALA A 1  534 ? 18.707  34.837 65.783 1.00 44.68 ? 534  ALA A O   1 
ATOM   4290 C  CB  . ALA A 1  534 ? 20.562  36.770 64.033 1.00 41.58 ? 534  ALA A CB  1 
ATOM   4291 N  N   . THR A 1  535 ? 18.311  36.965 66.427 1.00 45.49 ? 535  THR A N   1 
ATOM   4292 C  CA  . THR A 1  535 ? 17.981  36.660 67.835 1.00 46.33 ? 535  THR A CA  1 
ATOM   4293 C  C   . THR A 1  535 ? 16.489  36.432 68.052 1.00 46.86 ? 535  THR A C   1 
ATOM   4294 O  O   . THR A 1  535 ? 15.675  36.787 67.202 1.00 47.62 ? 535  THR A O   1 
ATOM   4295 C  CB  . THR A 1  535 ? 18.451  37.787 68.810 1.00 46.43 ? 535  THR A CB  1 
ATOM   4296 O  OG1 . THR A 1  535 ? 18.218  39.074 68.230 1.00 46.24 ? 535  THR A OG1 1 
ATOM   4297 C  CG2 . THR A 1  535 ? 19.909  37.676 69.091 1.00 46.63 ? 535  THR A CG2 1 
HETATM 4298 C  C1  . NAG B 2  .   ? 18.915  62.095 33.445 1.00 36.88 ? 1    NAG B C1  1 
HETATM 4299 C  C2  . NAG B 2  .   ? 20.427  61.885 33.556 1.00 40.02 ? 1    NAG B C2  1 
HETATM 4300 C  C3  . NAG B 2  .   ? 21.201  62.250 32.290 1.00 42.54 ? 1    NAG B C3  1 
HETATM 4301 C  C4  . NAG B 2  .   ? 20.521  61.737 31.015 1.00 45.52 ? 1    NAG B C4  1 
HETATM 4302 C  C5  . NAG B 2  .   ? 19.008  61.945 31.020 1.00 43.40 ? 1    NAG B C5  1 
HETATM 4303 C  C6  . NAG B 2  .   ? 18.426  61.126 29.857 1.00 42.92 ? 1    NAG B C6  1 
HETATM 4304 C  C7  . NAG B 2  .   ? 21.315  62.029 35.801 1.00 38.21 ? 1    NAG B C7  1 
HETATM 4305 C  C8  . NAG B 2  .   ? 21.919  62.927 36.843 1.00 36.26 ? 1    NAG B C8  1 
HETATM 4306 N  N2  . NAG B 2  .   ? 21.003  62.636 34.657 1.00 38.12 ? 1    NAG B N2  1 
HETATM 4307 O  O3  . NAG B 2  .   ? 22.496  61.682 32.411 1.00 42.87 ? 1    NAG B O3  1 
HETATM 4308 O  O4  . NAG B 2  .   ? 21.045  62.419 29.901 1.00 51.40 ? 1    NAG B O4  1 
HETATM 4309 O  O5  . NAG B 2  .   ? 18.440  61.509 32.248 1.00 40.45 ? 1    NAG B O5  1 
HETATM 4310 O  O6  . NAG B 2  .   ? 17.070  60.769 30.033 1.00 43.13 ? 1    NAG B O6  1 
HETATM 4311 O  O7  . NAG B 2  .   ? 21.128  60.814 36.007 1.00 37.47 ? 1    NAG B O7  1 
HETATM 4312 C  C1  . NAG B 2  .   ? 21.678  61.522 28.969 1.00 55.89 ? 2    NAG B C1  1 
HETATM 4313 C  C2  . NAG B 2  .   ? 21.655  62.193 27.592 1.00 57.43 ? 2    NAG B C2  1 
HETATM 4314 C  C3  . NAG B 2  .   ? 22.383  61.346 26.537 1.00 59.08 ? 2    NAG B C3  1 
HETATM 4315 C  C4  . NAG B 2  .   ? 23.708  60.741 27.020 1.00 59.46 ? 2    NAG B C4  1 
HETATM 4316 C  C5  . NAG B 2  .   ? 23.640  60.250 28.483 1.00 59.26 ? 2    NAG B C5  1 
HETATM 4317 C  C6  . NAG B 2  .   ? 25.028  59.996 29.061 1.00 59.78 ? 2    NAG B C6  1 
HETATM 4318 C  C7  . NAG B 2  .   ? 19.742  63.689 27.222 1.00 57.43 ? 2    NAG B C7  1 
HETATM 4319 C  C8  . NAG B 2  .   ? 18.307  63.840 26.783 1.00 56.48 ? 2    NAG B C8  1 
HETATM 4320 N  N2  . NAG B 2  .   ? 20.274  62.459 27.189 1.00 57.55 ? 2    NAG B N2  1 
HETATM 4321 O  O3  . NAG B 2  .   ? 22.660  62.154 25.410 1.00 59.97 ? 2    NAG B O3  1 
HETATM 4322 O  O4  . NAG B 2  .   ? 24.107  59.713 26.118 1.00 60.59 ? 2    NAG B O4  1 
HETATM 4323 O  O5  . NAG B 2  .   ? 23.008  61.203 29.332 1.00 57.77 ? 2    NAG B O5  1 
HETATM 4324 O  O6  . NAG B 2  .   ? 25.595  61.230 29.453 1.00 60.76 ? 2    NAG B O6  1 
HETATM 4325 O  O7  . NAG B 2  .   ? 20.376  64.680 27.598 1.00 57.05 ? 2    NAG B O7  1 
HETATM 4326 C  C1  . NAG C 3  .   ? 7.248   90.579 67.499 1.00 65.75 ? 2536 NAG A C1  1 
HETATM 4327 C  C2  . NAG C 3  .   ? 6.320   89.718 68.369 1.00 70.10 ? 2536 NAG A C2  1 
HETATM 4328 C  C3  . NAG C 3  .   ? 5.558   90.491 69.447 1.00 71.33 ? 2536 NAG A C3  1 
HETATM 4329 C  C4  . NAG C 3  .   ? 6.335   91.680 70.030 1.00 72.12 ? 2536 NAG A C4  1 
HETATM 4330 C  C5  . NAG C 3  .   ? 6.938   92.524 68.881 1.00 71.79 ? 2536 NAG A C5  1 
HETATM 4331 C  C6  . NAG C 3  .   ? 7.589   93.869 69.275 1.00 72.58 ? 2536 NAG A C6  1 
HETATM 4332 C  C7  . NAG C 3  .   ? 5.082   87.867 67.276 1.00 72.87 ? 2536 NAG A C7  1 
HETATM 4333 C  C8  . NAG C 3  .   ? 5.894   86.833 68.017 1.00 73.04 ? 2536 NAG A C8  1 
HETATM 4334 N  N2  . NAG C 3  .   ? 5.321   89.164 67.478 1.00 71.36 ? 2536 NAG A N2  1 
HETATM 4335 O  O3  . NAG C 3  .   ? 5.132   89.601 70.462 1.00 71.43 ? 2536 NAG A O3  1 
HETATM 4336 O  O4  . NAG C 3  .   ? 5.428   92.428 70.816 1.00 73.01 ? 2536 NAG A O4  1 
HETATM 4337 O  O5  . NAG C 3  .   ? 7.846   91.702 68.158 1.00 69.21 ? 2536 NAG A O5  1 
HETATM 4338 O  O6  . NAG C 3  .   ? 8.846   93.752 69.918 1.00 73.38 ? 2536 NAG A O6  1 
HETATM 4339 O  O7  . NAG C 3  .   ? 4.210   87.515 66.485 1.00 73.52 ? 2536 NAG A O7  1 
HETATM 4340 C  C1  . NAG D 3  .   ? -18.231 83.738 49.379 1.00 49.57 ? 2538 NAG A C1  1 
HETATM 4341 C  C2  . NAG D 3  .   ? -19.305 84.818 49.192 1.00 55.42 ? 2538 NAG A C2  1 
HETATM 4342 C  C3  . NAG D 3  .   ? -18.793 86.141 49.776 1.00 56.43 ? 2538 NAG A C3  1 
HETATM 4343 C  C4  . NAG D 3  .   ? -18.639 85.951 51.283 1.00 56.17 ? 2538 NAG A C4  1 
HETATM 4344 C  C5  . NAG D 3  .   ? -17.664 84.775 51.545 1.00 53.67 ? 2538 NAG A C5  1 
HETATM 4345 C  C6  . NAG D 3  .   ? -17.559 84.439 53.044 1.00 52.58 ? 2538 NAG A C6  1 
HETATM 4346 C  C7  . NAG D 3  .   ? -19.331 85.436 46.719 1.00 57.57 ? 2538 NAG A C7  1 
HETATM 4347 C  C8  . NAG D 3  .   ? -17.912 85.960 46.632 1.00 57.48 ? 2538 NAG A C8  1 
HETATM 4348 N  N2  . NAG D 3  .   ? -19.863 84.948 47.846 1.00 55.37 ? 2538 NAG A N2  1 
HETATM 4349 O  O3  . NAG D 3  .   ? -19.669 87.211 49.487 1.00 58.60 ? 2538 NAG A O3  1 
HETATM 4350 O  O4  . NAG D 3  .   ? -18.265 87.196 51.871 1.00 57.44 ? 2538 NAG A O4  1 
HETATM 4351 O  O5  . NAG D 3  .   ? -17.994 83.596 50.781 1.00 51.73 ? 2538 NAG A O5  1 
HETATM 4352 O  O6  . NAG D 3  .   ? -18.589 83.581 53.495 1.00 51.60 ? 2538 NAG A O6  1 
HETATM 4353 O  O7  . NAG D 3  .   ? -20.032 85.456 45.709 1.00 58.71 ? 2538 NAG A O7  1 
HETATM 4354 CL CL  . CL  E 4  .   ? 1.132   89.418 54.220 1.00 53.59 ? 2539 CL  A CL  1 
HETATM 4355 P  P1  . GB  F 5  .   ? 5.375   63.610 61.103 1.00 19.32 ? 2540 GB  A P1  1 
HETATM 4356 O  O1  . GB  F 5  .   ? 5.309   64.693 62.155 1.00 22.76 ? 2540 GB  A O1  1 
HETATM 4357 O  O2  . GB  F 5  .   ? 4.173   63.483 60.199 1.00 19.69 ? 2540 GB  A O2  1 
HETATM 4358 C  C1  . GB  F 5  .   ? 5.565   62.023 61.939 1.00 21.36 ? 2540 GB  A C1  1 
HETATM 4359 O  O1  . MES G 6  .   ? 0.174   49.146 76.474 0.90 43.81 ? 2541 MES A O1  1 
HETATM 4360 C  C2  . MES G 6  .   ? 1.020   48.353 75.670 0.90 42.03 ? 2541 MES A C2  1 
HETATM 4361 C  C3  . MES G 6  .   ? 0.157   47.991 74.483 0.90 43.42 ? 2541 MES A C3  1 
HETATM 4362 N  N4  . MES G 6  .   ? -1.261  48.315 74.768 0.90 46.13 ? 2541 MES A N4  1 
HETATM 4363 C  C5  . MES G 6  .   ? -1.779  47.828 76.055 0.90 45.09 ? 2541 MES A C5  1 
HETATM 4364 C  C6  . MES G 6  .   ? -0.892  48.411 77.128 0.90 45.11 ? 2541 MES A C6  1 
HETATM 4365 C  C7  . MES G 6  .   ? -2.152  47.825 73.714 0.90 48.38 ? 2541 MES A C7  1 
HETATM 4366 C  C8  . MES G 6  .   ? -1.849  46.371 73.340 0.90 50.05 ? 2541 MES A C8  1 
HETATM 4367 S  S   . MES G 6  .   ? -3.132  45.692 72.220 0.90 52.12 ? 2541 MES A S   1 
HETATM 4368 O  O1S . MES G 6  .   ? -4.191  45.039 73.073 0.90 51.28 ? 2541 MES A O1S 1 
HETATM 4369 O  O2S . MES G 6  .   ? -2.479  44.649 71.350 0.90 54.07 ? 2541 MES A O2S 1 
HETATM 4370 O  O3S . MES G 6  .   ? -3.723  46.772 71.362 0.90 48.61 ? 2541 MES A O3S 1 
HETATM 4371 O  O1  . PG4 H 7  .   ? -4.310  60.600 74.415 1.00 48.84 ? 2542 PG4 A O1  1 
HETATM 4372 C  C1  . PG4 H 7  .   ? -3.653  59.309 74.419 1.00 47.31 ? 2542 PG4 A C1  1 
HETATM 4373 C  C2  . PG4 H 7  .   ? -2.113  59.437 74.319 1.00 45.29 ? 2542 PG4 A C2  1 
HETATM 4374 O  O2  . PG4 H 7  .   ? -1.723  60.552 73.462 1.00 45.05 ? 2542 PG4 A O2  1 
HETATM 4375 C  C3  . PG4 H 7  .   ? -0.523  60.357 72.695 1.00 43.43 ? 2542 PG4 A C3  1 
HETATM 4376 C  C4  . PG4 H 7  .   ? -0.516  61.420 71.621 1.00 42.81 ? 2542 PG4 A C4  1 
HETATM 4377 O  O3  . PG4 H 7  .   ? 0.841   61.890 71.517 1.00 45.65 ? 2542 PG4 A O3  1 
HETATM 4378 C  C5  . PG4 H 7  .   ? 1.250   62.341 70.173 1.00 44.47 ? 2542 PG4 A C5  1 
HETATM 4379 C  C6  . PG4 H 7  .   ? 2.748   62.037 70.015 1.00 45.56 ? 2542 PG4 A C6  1 
HETATM 4380 O  O4  . PG4 H 7  .   ? 3.565   62.931 69.169 1.00 47.87 ? 2542 PG4 A O4  1 
HETATM 4381 C  C7  . PG4 H 7  .   ? 3.677   64.316 69.620 1.00 47.14 ? 2542 PG4 A C7  1 
HETATM 4382 C  C8  . PG4 H 7  .   ? 4.700   65.177 68.844 1.00 49.00 ? 2542 PG4 A C8  1 
HETATM 4383 O  O5  . PG4 H 7  .   ? 4.181   66.496 68.566 1.00 48.83 ? 2542 PG4 A O5  1 
HETATM 4384 C  C1  . PGE I 8  .   ? -0.816  39.732 52.409 1.00 56.82 ? 2543 PGE A C1  1 
HETATM 4385 O  O1  . PGE I 8  .   ? -1.734  38.666 52.698 1.00 58.40 ? 2543 PGE A O1  1 
HETATM 4386 C  C2  . PGE I 8  .   ? -1.311  40.530 51.188 1.00 55.97 ? 2543 PGE A C2  1 
HETATM 4387 O  O2  . PGE I 8  .   ? -0.450  41.643 50.812 1.00 54.93 ? 2543 PGE A O2  1 
HETATM 4388 C  C3  . PGE I 8  .   ? 0.879   41.224 50.466 1.00 51.84 ? 2543 PGE A C3  1 
HETATM 4389 C  C4  . PGE I 8  .   ? 1.787   42.419 50.349 1.00 49.79 ? 2543 PGE A C4  1 
HETATM 4390 O  O4  . PGE I 8  .   ? 5.498   40.693 51.656 1.00 51.81 ? 2543 PGE A O4  1 
HETATM 4391 C  C6  . PGE I 8  .   ? 4.271   40.884 52.362 1.00 50.85 ? 2543 PGE A C6  1 
HETATM 4392 C  C5  . PGE I 8  .   ? 3.624   42.168 51.844 1.00 49.15 ? 2543 PGE A C5  1 
HETATM 4393 O  O3  . PGE I 8  .   ? 3.166   42.006 50.484 1.00 49.83 ? 2543 PGE A O3  1 
HETATM 4394 C  C1  . PGE J 8  .   ? -9.858  81.913 29.762 1.00 50.15 ? 2544 PGE A C1  1 
HETATM 4395 O  O1  . PGE J 8  .   ? -11.233 82.204 29.955 1.00 48.15 ? 2544 PGE A O1  1 
HETATM 4396 C  C2  . PGE J 8  .   ? -9.043  83.172 30.047 1.00 52.73 ? 2544 PGE A C2  1 
HETATM 4397 O  O2  . PGE J 8  .   ? -7.740  82.767 30.524 1.00 54.98 ? 2544 PGE A O2  1 
HETATM 4398 C  C3  . PGE J 8  .   ? -6.686  83.716 30.196 1.00 55.94 ? 2544 PGE A C3  1 
HETATM 4399 C  C4  . PGE J 8  .   ? -6.248  84.538 31.393 1.00 57.61 ? 2544 PGE A C4  1 
HETATM 4400 O  O4  . PGE J 8  .   ? -9.041  87.671 33.225 1.00 59.77 ? 2544 PGE A O4  1 
HETATM 4401 C  C6  . PGE J 8  .   ? -9.156  86.293 32.832 1.00 59.91 ? 2544 PGE A C6  1 
HETATM 4402 C  C5  . PGE J 8  .   ? -7.779  85.623 32.894 1.00 59.37 ? 2544 PGE A C5  1 
HETATM 4403 O  O3  . PGE J 8  .   ? -7.222  85.590 31.563 1.00 59.57 ? 2544 PGE A O3  1 
HETATM 4404 C  C1  . PGE K 8  .   ? 32.157  70.726 46.562 1.00 69.63 ? 2545 PGE A C1  1 
HETATM 4405 O  O1  . PGE K 8  .   ? 31.542  69.706 45.762 1.00 67.82 ? 2545 PGE A O1  1 
HETATM 4406 C  C2  . PGE K 8  .   ? 33.353  70.158 47.346 1.00 70.69 ? 2545 PGE A C2  1 
HETATM 4407 O  O2  . PGE K 8  .   ? 33.015  68.858 47.901 1.00 71.21 ? 2545 PGE A O2  1 
HETATM 4408 C  C3  . PGE K 8  .   ? 33.787  68.512 49.084 1.00 70.16 ? 2545 PGE A C3  1 
HETATM 4409 C  C4  . PGE K 8  .   ? 33.836  66.983 49.148 1.00 69.01 ? 2545 PGE A C4  1 
HETATM 4410 O  O4  . PGE K 8  .   ? 34.777  65.010 45.019 1.00 62.31 ? 2545 PGE A O4  1 
HETATM 4411 C  C6  . PGE K 8  .   ? 35.277  65.069 46.358 1.00 64.67 ? 2545 PGE A C6  1 
HETATM 4412 C  C5  . PGE K 8  .   ? 34.834  66.392 46.994 1.00 66.70 ? 2545 PGE A C5  1 
HETATM 4413 O  O3  . PGE K 8  .   ? 34.978  66.409 48.446 1.00 68.02 ? 2545 PGE A O3  1 
HETATM 4414 C  C1  . PGE L 8  .   ? -19.748 71.151 29.740 1.00 72.01 ? 2546 PGE A C1  1 
HETATM 4415 O  O1  . PGE L 8  .   ? -19.810 70.643 28.405 1.00 72.29 ? 2546 PGE A O1  1 
HETATM 4416 C  C2  . PGE L 8  .   ? -18.306 71.581 30.060 1.00 70.94 ? 2546 PGE A C2  1 
HETATM 4417 O  O2  . PGE L 8  .   ? -18.209 72.138 31.398 1.00 70.03 ? 2546 PGE A O2  1 
HETATM 4418 C  C3  . PGE L 8  .   ? -17.914 71.114 32.382 1.00 67.29 ? 2546 PGE A C3  1 
HETATM 4419 C  C4  . PGE L 8  .   ? -18.251 71.627 33.778 1.00 65.32 ? 2546 PGE A C4  1 
HETATM 4420 O  O4  . PGE L 8  .   ? -22.181 70.096 34.373 1.00 62.84 ? 2546 PGE A O4  1 
HETATM 4421 C  C6  . PGE L 8  .   ? -21.526 70.895 35.353 1.00 62.32 ? 2546 PGE A C6  1 
HETATM 4422 C  C5  . PGE L 8  .   ? -20.405 71.703 34.707 1.00 62.80 ? 2546 PGE A C5  1 
HETATM 4423 O  O3  . PGE L 8  .   ? -19.303 70.849 34.374 1.00 63.55 ? 2546 PGE A O3  1 
HETATM 4424 C  C1  . PEG M 9  .   ? 14.453  86.228 45.952 1.00 50.65 ? 2547 PEG A C1  1 
HETATM 4425 O  O1  . PEG M 9  .   ? 13.390  86.110 46.913 1.00 47.80 ? 2547 PEG A O1  1 
HETATM 4426 C  C2  . PEG M 9  .   ? 15.795  86.551 46.635 1.00 50.48 ? 2547 PEG A C2  1 
HETATM 4427 O  O2  . PEG M 9  .   ? 16.869  85.803 46.015 1.00 52.85 ? 2547 PEG A O2  1 
HETATM 4428 C  C3  . PEG M 9  .   ? 17.896  85.386 46.979 1.00 54.38 ? 2547 PEG A C3  1 
HETATM 4429 C  C4  . PEG M 9  .   ? 17.944  83.878 47.328 1.00 53.22 ? 2547 PEG A C4  1 
HETATM 4430 O  O4  . PEG M 9  .   ? 18.672  83.110 46.335 1.00 54.59 ? 2547 PEG A O4  1 
HETATM 4431 C  C1  . PEG N 9  .   ? -13.024 41.015 63.532 1.00 59.34 ? 2548 PEG A C1  1 
HETATM 4432 O  O1  . PEG N 9  .   ? -12.583 39.769 64.106 1.00 59.11 ? 2548 PEG A O1  1 
HETATM 4433 C  C2  . PEG N 9  .   ? -13.583 40.815 62.115 1.00 59.24 ? 2548 PEG A C2  1 
HETATM 4434 O  O2  . PEG N 9  .   ? -12.879 39.800 61.375 1.00 59.93 ? 2548 PEG A O2  1 
HETATM 4435 C  C3  . PEG N 9  .   ? -13.598 38.534 61.390 1.00 60.24 ? 2548 PEG A C3  1 
HETATM 4436 C  C4  . PEG N 9  .   ? -12.678 37.355 61.717 1.00 61.04 ? 2548 PEG A C4  1 
HETATM 4437 O  O4  . PEG N 9  .   ? -13.271 36.547 62.742 1.00 62.28 ? 2548 PEG A O4  1 
HETATM 4438 C  C1  . PEG O 9  .   ? 3.856   68.419 62.088 1.00 41.75 ? 2549 PEG A C1  1 
HETATM 4439 O  O1  . PEG O 9  .   ? 3.735   67.230 61.326 1.00 40.34 ? 2549 PEG A O1  1 
HETATM 4440 C  C2  . PEG O 9  .   ? 5.309   68.525 62.518 1.00 41.74 ? 2549 PEG A C2  1 
HETATM 4441 O  O2  . PEG O 9  .   ? 5.482   69.301 63.700 1.00 44.97 ? 2549 PEG A O2  1 
HETATM 4442 C  C3  . PEG O 9  .   ? 5.199   68.587 64.934 1.00 46.33 ? 2549 PEG A C3  1 
HETATM 4443 C  C4  . PEG O 9  .   ? 4.003   69.129 65.760 1.00 46.57 ? 2549 PEG A C4  1 
HETATM 4444 O  O4  . PEG O 9  .   ? 3.356   68.088 66.531 1.00 45.02 ? 2549 PEG A O4  1 
HETATM 4445 C  C1  . PEG P 9  .   ? -5.460  80.211 31.913 1.00 49.98 ? 2550 PEG A C1  1 
HETATM 4446 O  O1  . PEG P 9  .   ? -4.409  80.340 30.942 1.00 48.85 ? 2550 PEG A O1  1 
HETATM 4447 C  C2  . PEG P 9  .   ? -6.647  79.423 31.353 1.00 51.18 ? 2550 PEG A C2  1 
HETATM 4448 O  O2  . PEG P 9  .   ? -7.871  79.930 31.906 1.00 51.55 ? 2550 PEG A O2  1 
HETATM 4449 C  C3  . PEG P 9  .   ? -9.035  79.070 31.683 1.00 51.65 ? 2550 PEG A C3  1 
HETATM 4450 C  C4  . PEG P 9  .   ? -9.945  79.263 32.924 1.00 51.59 ? 2550 PEG A C4  1 
HETATM 4451 O  O4  . PEG P 9  .   ? -11.306 79.648 32.617 1.00 50.16 ? 2550 PEG A O4  1 
HETATM 4452 C  C1  . PEG Q 9  .   ? 21.716  52.626 54.419 1.00 34.96 ? 2551 PEG A C1  1 
HETATM 4453 O  O1  . PEG Q 9  .   ? 21.172  51.805 53.383 1.00 32.00 ? 2551 PEG A O1  1 
HETATM 4454 C  C2  . PEG Q 9  .   ? 22.198  54.025 53.970 1.00 34.56 ? 2551 PEG A C2  1 
HETATM 4455 O  O2  . PEG Q 9  .   ? 23.038  54.536 55.060 1.00 33.50 ? 2551 PEG A O2  1 
HETATM 4456 C  C3  . PEG Q 9  .   ? 23.908  55.610 54.553 1.00 36.09 ? 2551 PEG A C3  1 
HETATM 4457 C  C4  . PEG Q 9  .   ? 23.948  56.996 55.282 1.00 37.03 ? 2551 PEG A C4  1 
HETATM 4458 O  O4  . PEG Q 9  .   ? 25.086  57.878 54.895 1.00 34.94 ? 2551 PEG A O4  1 
HETATM 4459 C  C1  . PEG R 9  .   ? -6.258  83.227 55.806 1.00 58.77 ? 2552 PEG A C1  1 
HETATM 4460 O  O1  . PEG R 9  .   ? -7.510  82.611 55.432 1.00 60.77 ? 2552 PEG A O1  1 
HETATM 4461 C  C2  . PEG R 9  .   ? -5.269  83.096 54.652 1.00 56.60 ? 2552 PEG A C2  1 
HETATM 4462 O  O2  . PEG R 9  .   ? -5.973  83.388 53.411 1.00 54.16 ? 2552 PEG A O2  1 
HETATM 4463 C  C3  . PEG R 9  .   ? -5.432  82.567 52.377 1.00 52.10 ? 2552 PEG A C3  1 
HETATM 4464 C  C4  . PEG R 9  .   ? -4.709  83.435 51.348 1.00 50.20 ? 2552 PEG A C4  1 
HETATM 4465 O  O4  . PEG R 9  .   ? -3.314  83.124 51.343 1.00 48.15 ? 2552 PEG A O4  1 
HETATM 4466 C  C1  . PEG S 9  .   ? 28.638  59.432 70.929 1.00 62.17 ? 2553 PEG A C1  1 
HETATM 4467 O  O1  . PEG S 9  .   ? 29.049  59.239 69.567 1.00 63.09 ? 2553 PEG A O1  1 
HETATM 4468 C  C2  . PEG S 9  .   ? 28.602  58.091 71.678 1.00 60.99 ? 2553 PEG A C2  1 
HETATM 4469 O  O2  . PEG S 9  .   ? 29.794  57.297 71.497 1.00 60.54 ? 2553 PEG A O2  1 
HETATM 4470 C  C3  . PEG S 9  .   ? 30.712  57.531 72.565 1.00 61.07 ? 2553 PEG A C3  1 
HETATM 4471 C  C4  . PEG S 9  .   ? 32.099  57.940 72.052 1.00 62.40 ? 2553 PEG A C4  1 
HETATM 4472 O  O4  . PEG S 9  .   ? 32.740  58.802 73.009 1.00 62.38 ? 2553 PEG A O4  1 
HETATM 4473 C  C1  . PEG T 9  .   ? -22.669 73.454 45.349 1.00 62.53 ? 2554 PEG A C1  1 
HETATM 4474 O  O1  . PEG T 9  .   ? -23.547 72.900 44.362 1.00 63.21 ? 2554 PEG A O1  1 
HETATM 4475 C  C2  . PEG T 9  .   ? -22.386 74.935 45.065 1.00 61.47 ? 2554 PEG A C2  1 
HETATM 4476 O  O2  . PEG T 9  .   ? -22.238 75.233 43.653 1.00 60.86 ? 2554 PEG A O2  1 
HETATM 4477 C  C3  . PEG T 9  .   ? -23.430 75.766 43.047 1.00 61.96 ? 2554 PEG A C3  1 
HETATM 4478 C  C4  . PEG T 9  .   ? -24.130 76.838 43.889 1.00 63.64 ? 2554 PEG A C4  1 
HETATM 4479 O  O4  . PEG T 9  .   ? -23.302 78.005 43.943 1.00 64.50 ? 2554 PEG A O4  1 
HETATM 4480 C  C1  . PEG U 9  .   ? 4.315   81.097 66.739 1.00 64.98 ? 2555 PEG A C1  1 
HETATM 4481 O  O1  . PEG U 9  .   ? 3.640   80.552 65.583 1.00 65.27 ? 2555 PEG A O1  1 
HETATM 4482 C  C2  . PEG U 9  .   ? 5.082   79.986 67.487 1.00 62.59 ? 2555 PEG A C2  1 
HETATM 4483 O  O2  . PEG U 9  .   ? 5.749   79.091 66.574 1.00 61.29 ? 2555 PEG A O2  1 
HETATM 4484 C  C3  . PEG U 9  .   ? 6.233   77.927 67.210 1.00 57.34 ? 2555 PEG A C3  1 
HETATM 4485 C  C4  . PEG U 9  .   ? 7.604   78.249 67.781 1.00 56.68 ? 2555 PEG A C4  1 
HETATM 4486 O  O4  . PEG U 9  .   ? 8.275   79.185 66.954 1.00 54.23 ? 2555 PEG A O4  1 
HETATM 4487 C  C1  . PEG V 9  .   ? 20.248  69.113 70.908 1.00 42.17 ? 2556 PEG A C1  1 
HETATM 4488 O  O1  . PEG V 9  .   ? 21.536  68.891 70.329 1.00 44.76 ? 2556 PEG A O1  1 
HETATM 4489 C  C2  . PEG V 9  .   ? 20.051  70.596 71.189 1.00 42.05 ? 2556 PEG A C2  1 
HETATM 4490 O  O2  . PEG V 9  .   ? 21.292  71.194 71.469 1.00 41.87 ? 2556 PEG A O2  1 
HETATM 4491 C  C3  . PEG V 9  .   ? 21.075  72.476 72.079 1.00 42.40 ? 2556 PEG A C3  1 
HETATM 4492 C  C4  . PEG V 9  .   ? 21.939  73.446 71.265 1.00 43.79 ? 2556 PEG A C4  1 
HETATM 4493 O  O4  . PEG V 9  .   ? 23.304  72.981 71.234 1.00 44.32 ? 2556 PEG A O4  1 
HETATM 4494 O  O   . HOH W 10 .   ? 3.352   63.971 65.187 1.00 46.28 ? 1001 HOH A O   1 
HETATM 4495 O  O   . HOH W 10 .   ? 10.614  68.571 59.497 1.00 12.10 ? 1002 HOH A O   1 
HETATM 4496 O  O   . HOH W 10 .   ? -12.397 86.462 30.019 1.00 53.60 ? 1003 HOH A O   1 
HETATM 4497 O  O   . HOH W 10 .   ? -5.960  83.677 38.378 1.00 20.89 ? 1004 HOH A O   1 
HETATM 4498 O  O   . HOH W 10 .   ? -10.839 91.119 36.400 1.00 53.18 ? 1005 HOH A O   1 
HETATM 4499 O  O   . HOH W 10 .   ? -8.027  90.372 40.745 1.00 40.76 ? 1006 HOH A O   1 
HETATM 4500 O  O   . HOH W 10 .   ? -19.960 82.775 34.684 1.00 46.76 ? 1007 HOH A O   1 
HETATM 4501 O  O   . HOH W 10 .   ? -7.475  67.562 27.385 1.00 40.82 ? 1008 HOH A O   1 
HETATM 4502 O  O   . HOH W 10 .   ? -29.260 78.639 37.618 1.00 49.02 ? 1009 HOH A O   1 
HETATM 4503 O  O   . HOH W 10 .   ? -22.106 81.321 36.077 1.00 57.27 ? 1010 HOH A O   1 
HETATM 4504 O  O   . HOH W 10 .   ? -17.945 80.508 30.755 1.00 55.55 ? 1011 HOH A O   1 
HETATM 4505 O  O   . HOH W 10 .   ? -7.067  68.499 29.524 1.00 45.66 ? 1012 HOH A O   1 
HETATM 4506 O  O   . HOH W 10 .   ? -27.274 76.516 39.048 1.00 52.64 ? 1013 HOH A O   1 
HETATM 4507 O  O   . HOH W 10 .   ? -19.718 78.320 30.797 1.00 44.08 ? 1014 HOH A O   1 
HETATM 4508 O  O   . HOH W 10 .   ? -22.491 79.083 35.247 1.00 63.99 ? 1015 HOH A O   1 
HETATM 4509 O  O   . HOH W 10 .   ? -14.677 87.036 45.754 1.00 46.24 ? 1016 HOH A O   1 
HETATM 4510 O  O   . HOH W 10 .   ? -19.854 58.831 45.168 1.00 49.50 ? 1017 HOH A O   1 
HETATM 4511 O  O   . HOH W 10 .   ? -5.087  94.780 44.195 1.00 56.13 ? 1018 HOH A O   1 
HETATM 4512 O  O   . HOH W 10 .   ? -11.171 89.460 45.937 1.00 36.24 ? 1019 HOH A O   1 
HETATM 4513 O  O   . HOH W 10 .   ? -22.054 72.980 48.617 1.00 52.09 ? 1020 HOH A O   1 
HETATM 4514 O  O   . HOH W 10 .   ? -15.855 65.325 36.142 1.00 35.07 ? 1021 HOH A O   1 
HETATM 4515 O  O   . HOH W 10 .   ? -14.018 63.721 37.606 1.00 43.85 ? 1022 HOH A O   1 
HETATM 4516 O  O   . HOH W 10 .   ? 6.163   93.697 52.121 1.00 41.05 ? 1023 HOH A O   1 
HETATM 4517 O  O   . HOH W 10 .   ? 0.660   92.923 51.800 1.00 52.82 ? 1024 HOH A O   1 
HETATM 4518 O  O   . HOH W 10 .   ? -0.120  95.936 45.211 0.50 43.21 ? 1025 HOH A O   1 
HETATM 4519 O  O   . HOH W 10 .   ? 2.135   94.987 43.202 1.00 41.06 ? 1026 HOH A O   1 
HETATM 4520 O  O   . HOH W 10 .   ? 1.730   90.437 42.285 1.00 41.11 ? 1027 HOH A O   1 
HETATM 4521 O  O   . HOH W 10 .   ? -0.548  94.191 49.906 1.00 43.73 ? 1028 HOH A O   1 
HETATM 4522 O  O   . HOH W 10 .   ? -25.551 78.300 40.902 1.00 48.82 ? 1029 HOH A O   1 
HETATM 4523 O  O   . HOH W 10 .   ? -5.561  93.381 49.718 1.00 62.45 ? 1030 HOH A O   1 
HETATM 4524 O  O   . HOH W 10 .   ? -6.380  88.407 41.825 1.00 37.90 ? 1031 HOH A O   1 
HETATM 4525 O  O   . HOH W 10 .   ? -6.328  64.803 74.380 1.00 37.21 ? 1032 HOH A O   1 
HETATM 4526 O  O   . HOH W 10 .   ? -14.759 74.465 50.818 1.00 42.87 ? 1033 HOH A O   1 
HETATM 4527 O  O   . HOH W 10 .   ? -12.452 64.712 41.428 1.00 31.44 ? 1034 HOH A O   1 
HETATM 4528 O  O   . HOH W 10 .   ? -15.132 67.374 48.834 1.00 15.72 ? 1035 HOH A O   1 
HETATM 4529 O  O   . HOH W 10 .   ? -15.450 60.222 48.347 1.00 23.48 ? 1036 HOH A O   1 
HETATM 4530 O  O   . HOH W 10 .   ? -21.068 66.404 45.212 1.00 51.76 ? 1037 HOH A O   1 
HETATM 4531 O  O   . HOH W 10 .   ? -21.612 61.349 47.504 1.00 35.70 ? 1038 HOH A O   1 
HETATM 4532 O  O   . HOH W 10 .   ? -21.167 61.982 50.043 1.00 25.73 ? 1039 HOH A O   1 
HETATM 4533 O  O   . HOH W 10 .   ? -14.551 69.334 66.500 1.00 48.67 ? 1040 HOH A O   1 
HETATM 4534 O  O   . HOH W 10 .   ? -21.538 59.600 51.323 1.00 41.97 ? 1041 HOH A O   1 
HETATM 4535 O  O   . HOH W 10 .   ? -26.710 41.503 65.935 1.00 47.14 ? 1042 HOH A O   1 
HETATM 4536 O  O   . HOH W 10 .   ? -25.993 39.918 67.857 1.00 40.13 ? 1043 HOH A O   1 
HETATM 4537 O  O   . HOH W 10 .   ? -20.006 59.210 58.716 1.00 25.03 ? 1044 HOH A O   1 
HETATM 4538 O  O   . HOH W 10 .   ? -19.977 56.971 58.863 1.00 24.70 ? 1045 HOH A O   1 
HETATM 4539 O  O   . HOH W 10 .   ? -23.661 49.097 53.687 1.00 46.51 ? 1046 HOH A O   1 
HETATM 4540 O  O   . HOH W 10 .   ? -22.974 52.160 56.900 1.00 54.63 ? 1047 HOH A O   1 
HETATM 4541 O  O   . HOH W 10 .   ? -18.072 49.524 44.815 1.00 52.32 ? 1048 HOH A O   1 
HETATM 4542 O  O   . HOH W 10 .   ? -18.593 55.433 48.129 1.00 46.44 ? 1049 HOH A O   1 
HETATM 4543 O  O   . HOH W 10 .   ? 8.402   42.321 54.233 1.00 36.45 ? 1050 HOH A O   1 
HETATM 4544 O  O   . HOH W 10 .   ? -8.445  53.039 43.933 1.00 33.13 ? 1051 HOH A O   1 
HETATM 4545 O  O   . HOH W 10 .   ? -10.292 56.000 44.585 1.00 39.95 ? 1052 HOH A O   1 
HETATM 4546 O  O   . HOH W 10 .   ? -16.101 54.741 47.488 1.00 50.48 ? 1053 HOH A O   1 
HETATM 4547 O  O   . HOH W 10 .   ? -17.434 57.113 41.080 1.00 46.62 ? 1054 HOH A O   1 
HETATM 4548 O  O   . HOH W 10 .   ? -18.413 60.262 41.894 1.00 48.70 ? 1055 HOH A O   1 
HETATM 4549 O  O   . HOH W 10 .   ? -21.709 70.141 46.776 1.00 56.02 ? 1056 HOH A O   1 
HETATM 4550 O  O   . HOH W 10 .   ? -16.749 62.795 37.946 1.00 33.55 ? 1057 HOH A O   1 
HETATM 4551 O  O   . HOH W 10 .   ? -17.896 68.514 48.436 1.00 22.28 ? 1058 HOH A O   1 
HETATM 4552 O  O   . HOH W 10 .   ? 1.622   83.433 60.453 1.00 46.23 ? 1059 HOH A O   1 
HETATM 4553 O  O   . HOH W 10 .   ? -0.173  80.317 66.429 1.00 50.86 ? 1060 HOH A O   1 
HETATM 4554 O  O   . HOH W 10 .   ? 18.121  62.915 88.579 1.00 43.76 ? 1061 HOH A O   1 
HETATM 4555 O  O   . HOH W 10 .   ? 35.268  55.038 71.345 1.00 36.77 ? 1062 HOH A O   1 
HETATM 4556 O  O   . HOH W 10 .   ? -24.672 71.953 40.902 1.00 37.76 ? 1063 HOH A O   1 
HETATM 4557 O  O   . HOH W 10 .   ? 12.528  88.278 40.714 1.00 44.09 ? 1064 HOH A O   1 
HETATM 4558 O  O   . HOH W 10 .   ? -20.154 75.016 37.119 1.00 22.87 ? 1065 HOH A O   1 
HETATM 4559 O  O   . HOH W 10 .   ? -23.624 80.001 41.188 1.00 41.00 ? 1066 HOH A O   1 
HETATM 4560 O  O   . HOH W 10 .   ? -20.727 81.424 44.484 1.00 42.03 ? 1067 HOH A O   1 
HETATM 4561 O  O   . HOH W 10 .   ? -15.649 83.688 46.045 1.00 53.37 ? 1068 HOH A O   1 
HETATM 4562 O  O   . HOH W 10 .   ? -21.372 82.181 47.382 1.00 50.85 ? 1069 HOH A O   1 
HETATM 4563 O  O   . HOH W 10 .   ? -20.447 80.099 49.502 1.00 56.09 ? 1070 HOH A O   1 
HETATM 4564 O  O   . HOH W 10 .   ? -19.910 76.937 47.098 1.00 42.11 ? 1071 HOH A O   1 
HETATM 4565 O  O   . HOH W 10 .   ? -18.164 78.293 50.314 1.00 41.91 ? 1072 HOH A O   1 
HETATM 4566 O  O   . HOH W 10 .   ? -15.340 77.055 52.511 1.00 37.92 ? 1073 HOH A O   1 
HETATM 4567 O  O   . HOH W 10 .   ? -10.249 81.301 54.900 1.00 29.69 ? 1074 HOH A O   1 
HETATM 4568 O  O   . HOH W 10 .   ? -2.989  79.709 56.001 1.00 36.43 ? 1075 HOH A O   1 
HETATM 4569 O  O   . HOH W 10 .   ? -19.351 45.448 54.710 1.00 64.08 ? 1076 HOH A O   1 
HETATM 4570 O  O   . HOH W 10 .   ? -19.358 72.186 56.581 1.00 47.15 ? 1077 HOH A O   1 
HETATM 4571 O  O   . HOH W 10 .   ? -15.026 72.617 53.694 1.00 30.89 ? 1078 HOH A O   1 
HETATM 4572 O  O   . HOH W 10 .   ? -14.412 75.661 57.705 1.00 54.72 ? 1079 HOH A O   1 
HETATM 4573 O  O   . HOH W 10 .   ? -9.627  70.121 54.224 1.00 18.86 ? 1080 HOH A O   1 
HETATM 4574 O  O   . HOH W 10 .   ? -7.750  59.229 41.646 1.00 13.48 ? 1081 HOH A O   1 
HETATM 4575 O  O   . HOH W 10 .   ? 17.228  89.256 47.782 1.00 49.67 ? 1082 HOH A O   1 
HETATM 4576 O  O   . HOH W 10 .   ? -12.257 63.055 58.702 1.00 21.45 ? 1083 HOH A O   1 
HETATM 4577 O  O   . HOH W 10 .   ? -14.368 65.678 66.571 1.00 32.72 ? 1084 HOH A O   1 
HETATM 4578 O  O   . HOH W 10 .   ? -9.476  62.185 59.153 1.00 16.03 ? 1085 HOH A O   1 
HETATM 4579 O  O   . HOH W 10 .   ? -8.850  60.963 63.031 1.00 18.16 ? 1086 HOH A O   1 
HETATM 4580 O  O   . HOH W 10 .   ? -10.353 65.844 68.274 1.00 20.63 ? 1087 HOH A O   1 
HETATM 4581 O  O   . HOH W 10 .   ? -12.000 62.381 34.776 1.00 34.86 ? 1088 HOH A O   1 
HETATM 4582 O  O   . HOH W 10 .   ? -3.450  66.448 73.781 1.00 41.60 ? 1089 HOH A O   1 
HETATM 4583 O  O   . HOH W 10 .   ? -3.943  68.110 65.787 1.00 51.23 ? 1090 HOH A O   1 
HETATM 4584 O  O   . HOH W 10 .   ? -0.575  64.580 72.326 1.00 40.81 ? 1091 HOH A O   1 
HETATM 4585 O  O   . HOH W 10 .   ? -8.660  65.095 70.518 1.00 26.20 ? 1092 HOH A O   1 
HETATM 4586 O  O   . HOH W 10 .   ? 0.343   70.028 68.026 1.00 19.46 ? 1093 HOH A O   1 
HETATM 4587 O  O   . HOH W 10 .   ? -3.431  68.806 78.512 1.00 31.38 ? 1094 HOH A O   1 
HETATM 4588 O  O   . HOH W 10 .   ? 2.064   81.038 73.207 1.00 33.89 ? 1095 HOH A O   1 
HETATM 4589 O  O   . HOH W 10 .   ? -1.152  72.036 72.884 1.00 22.43 ? 1096 HOH A O   1 
HETATM 4590 O  O   . HOH W 10 .   ? -2.129  79.944 70.585 1.00 31.13 ? 1097 HOH A O   1 
HETATM 4591 O  O   . HOH W 10 .   ? -3.716  73.059 73.049 1.00 31.24 ? 1098 HOH A O   1 
HETATM 4592 O  O   . HOH W 10 .   ? 0.436   77.384 61.644 1.00 18.39 ? 1099 HOH A O   1 
HETATM 4593 O  O   . HOH W 10 .   ? -0.142  69.482 62.002 1.00 17.19 ? 1100 HOH A O   1 
HETATM 4594 O  O   . HOH W 10 .   ? -3.867  69.948 61.932 1.00 14.18 ? 1101 HOH A O   1 
HETATM 4595 O  O   . HOH W 10 .   ? -3.415  75.984 64.152 1.00 33.63 ? 1102 HOH A O   1 
HETATM 4596 O  O   . HOH W 10 .   ? -5.616  74.810 69.147 1.00 36.57 ? 1103 HOH A O   1 
HETATM 4597 O  O   . HOH W 10 .   ? -1.080  68.287 66.314 1.00 25.18 ? 1104 HOH A O   1 
HETATM 4598 O  O   . HOH W 10 .   ? -5.908  76.315 66.022 1.00 44.91 ? 1105 HOH A O   1 
HETATM 4599 O  O   . HOH W 10 .   ? -7.925  72.702 67.032 1.00 23.88 ? 1106 HOH A O   1 
HETATM 4600 O  O   . HOH W 10 .   ? 10.749  49.168 54.095 1.00 31.74 ? 1107 HOH A O   1 
HETATM 4601 O  O   . HOH W 10 .   ? 4.656   47.798 62.818 1.00 23.28 ? 1108 HOH A O   1 
HETATM 4602 O  O   . HOH W 10 .   ? 9.316   48.741 61.822 1.00 46.15 ? 1109 HOH A O   1 
HETATM 4603 O  O   . HOH W 10 .   ? -11.519 72.293 65.075 1.00 27.93 ? 1110 HOH A O   1 
HETATM 4604 O  O   . HOH W 10 .   ? -6.999  81.159 58.331 1.00 31.13 ? 1111 HOH A O   1 
HETATM 4605 O  O   . HOH W 10 .   ? 3.732   44.077 62.768 1.00 28.11 ? 1112 HOH A O   1 
HETATM 4606 O  O   . HOH W 10 .   ? 4.260   43.708 55.205 1.00 21.58 ? 1113 HOH A O   1 
HETATM 4607 O  O   . HOH W 10 .   ? 1.390   40.536 54.235 1.00 32.07 ? 1114 HOH A O   1 
HETATM 4608 O  O   . HOH W 10 .   ? -7.071  40.421 63.817 1.00 47.10 ? 1115 HOH A O   1 
HETATM 4609 O  O   . HOH W 10 .   ? -1.590  40.148 64.103 1.00 44.67 ? 1116 HOH A O   1 
HETATM 4610 O  O   . HOH W 10 .   ? 4.037   44.906 65.296 1.00 40.87 ? 1117 HOH A O   1 
HETATM 4611 O  O   . HOH W 10 .   ? -4.309  39.329 57.673 1.00 27.71 ? 1118 HOH A O   1 
HETATM 4612 O  O   . HOH W 10 .   ? -6.961  40.283 66.348 1.00 41.18 ? 1119 HOH A O   1 
HETATM 4613 O  O   . HOH W 10 .   ? -18.551 73.411 59.050 1.00 44.67 ? 1120 HOH A O   1 
HETATM 4614 O  O   . HOH W 10 .   ? -14.218 76.846 60.095 1.00 45.76 ? 1121 HOH A O   1 
HETATM 4615 O  O   . HOH W 10 .   ? -18.300 69.888 61.510 1.00 53.40 ? 1122 HOH A O   1 
HETATM 4616 O  O   . HOH W 10 .   ? -16.811 68.409 64.885 1.00 45.50 ? 1123 HOH A O   1 
HETATM 4617 O  O   . HOH W 10 .   ? -14.189 71.423 65.075 1.00 32.19 ? 1124 HOH A O   1 
HETATM 4618 O  O   . HOH W 10 .   ? -13.339 62.184 56.418 1.00 15.37 ? 1125 HOH A O   1 
HETATM 4619 O  O   . HOH W 10 .   ? -14.675 59.807 56.694 1.00 20.19 ? 1126 HOH A O   1 
HETATM 4620 O  O   . HOH W 10 .   ? -17.701 65.319 60.768 1.00 28.06 ? 1127 HOH A O   1 
HETATM 4621 O  O   . HOH W 10 .   ? -19.174 62.935 60.372 1.00 37.26 ? 1128 HOH A O   1 
HETATM 4622 O  O   . HOH W 10 .   ? -22.934 48.482 67.341 1.00 48.64 ? 1129 HOH A O   1 
HETATM 4623 O  O   . HOH W 10 .   ? -19.995 41.664 72.924 1.00 56.06 ? 1130 HOH A O   1 
HETATM 4624 O  O   . HOH W 10 .   ? -19.620 69.126 50.492 1.00 41.47 ? 1131 HOH A O   1 
HETATM 4625 O  O   . HOH W 10 .   ? -20.168 70.569 54.746 1.00 46.63 ? 1132 HOH A O   1 
HETATM 4626 O  O   . HOH W 10 .   ? -15.195 66.450 51.320 1.00 19.36 ? 1133 HOH A O   1 
HETATM 4627 O  O   . HOH W 10 .   ? -11.277 37.954 54.242 1.00 40.69 ? 1134 HOH A O   1 
HETATM 4628 O  O   . HOH W 10 .   ? -26.241 38.966 65.443 1.00 43.12 ? 1135 HOH A O   1 
HETATM 4629 O  O   . HOH W 10 .   ? -18.223 72.384 51.007 1.00 47.75 ? 1136 HOH A O   1 
HETATM 4630 O  O   . HOH W 10 .   ? -21.271 60.930 62.708 1.00 43.20 ? 1137 HOH A O   1 
HETATM 4631 O  O   . HOH W 10 .   ? -27.593 51.933 57.441 1.00 49.51 ? 1138 HOH A O   1 
HETATM 4632 O  O   . HOH W 10 .   ? -24.130 56.349 59.029 1.00 39.49 ? 1139 HOH A O   1 
HETATM 4633 O  O   . HOH W 10 .   ? -26.615 51.563 72.511 1.00 46.14 ? 1140 HOH A O   1 
HETATM 4634 O  O   . HOH W 10 .   ? -19.336 55.704 74.937 1.00 50.69 ? 1141 HOH A O   1 
HETATM 4635 O  O   . HOH W 10 .   ? -4.135  85.325 39.038 1.00 20.53 ? 1142 HOH A O   1 
HETATM 4636 O  O   . HOH W 10 .   ? 1.938   87.500 41.492 1.00 36.42 ? 1143 HOH A O   1 
HETATM 4637 O  O   . HOH W 10 .   ? -1.636  91.678 38.320 1.00 52.25 ? 1144 HOH A O   1 
HETATM 4638 O  O   . HOH W 10 .   ? 1.925   86.420 36.684 1.00 32.19 ? 1145 HOH A O   1 
HETATM 4639 O  O   . HOH W 10 .   ? -4.951  87.414 34.598 1.00 27.69 ? 1146 HOH A O   1 
HETATM 4640 O  O   . HOH W 10 .   ? -2.963  86.393 32.467 1.00 43.82 ? 1147 HOH A O   1 
HETATM 4641 O  O   . HOH W 10 .   ? 0.749   86.161 32.558 1.00 34.23 ? 1148 HOH A O   1 
HETATM 4642 O  O   . HOH W 10 .   ? -10.687 82.605 32.941 1.00 34.06 ? 1149 HOH A O   1 
HETATM 4643 O  O   . HOH W 10 .   ? -3.626  82.725 32.011 1.00 59.90 ? 1150 HOH A O   1 
HETATM 4644 O  O   . HOH W 10 .   ? -3.099  77.711 30.780 1.00 32.44 ? 1151 HOH A O   1 
HETATM 4645 O  O   . HOH W 10 .   ? 3.421   80.678 32.051 1.00 36.10 ? 1152 HOH A O   1 
HETATM 4646 O  O   . HOH W 10 .   ? 8.659   77.921 34.819 1.00 54.89 ? 1153 HOH A O   1 
HETATM 4647 O  O   . HOH W 10 .   ? 10.773  43.684 53.936 1.00 36.19 ? 1154 HOH A O   1 
HETATM 4648 O  O   . HOH W 10 .   ? 5.965   44.221 53.598 1.00 20.34 ? 1155 HOH A O   1 
HETATM 4649 O  O   . HOH W 10 .   ? 21.183  44.646 49.744 1.00 49.84 ? 1156 HOH A O   1 
HETATM 4650 O  O   . HOH W 10 .   ? -1.449  69.533 52.165 1.00 11.55 ? 1157 HOH A O   1 
HETATM 4651 O  O   . HOH W 10 .   ? 1.660   46.618 39.680 1.00 38.85 ? 1158 HOH A O   1 
HETATM 4652 O  O   . HOH W 10 .   ? 20.025  74.380 68.382 1.00 35.43 ? 1159 HOH A O   1 
HETATM 4653 O  O   . HOH W 10 .   ? -11.819 89.988 38.780 1.00 61.11 ? 1160 HOH A O   1 
HETATM 4654 O  O   . HOH W 10 .   ? -0.489  65.989 67.751 1.00 28.48 ? 1161 HOH A O   1 
HETATM 4655 O  O   . HOH W 10 .   ? -0.018  67.461 63.820 1.00 13.10 ? 1162 HOH A O   1 
HETATM 4656 O  O   . HOH W 10 .   ? -0.599  63.258 58.580 1.00 12.01 ? 1163 HOH A O   1 
HETATM 4657 O  O   . HOH W 10 .   ? -7.174  67.849 57.415 1.00 13.40 ? 1164 HOH A O   1 
HETATM 4658 O  O   . HOH W 10 .   ? -7.271  70.510 55.935 1.00 13.30 ? 1165 HOH A O   1 
HETATM 4659 O  O   . HOH W 10 .   ? -8.054  71.307 52.314 1.00 23.15 ? 1166 HOH A O   1 
HETATM 4660 O  O   . HOH W 10 .   ? -1.852  75.369 52.379 1.00 22.26 ? 1167 HOH A O   1 
HETATM 4661 O  O   . HOH W 10 .   ? 2.138   76.289 78.000 1.00 48.48 ? 1168 HOH A O   1 
HETATM 4662 O  O   . HOH W 10 .   ? 17.921  71.743 84.682 1.00 41.23 ? 1169 HOH A O   1 
HETATM 4663 O  O   . HOH W 10 .   ? -2.473  77.837 61.910 1.00 23.37 ? 1170 HOH A O   1 
HETATM 4664 O  O   . HOH W 10 .   ? -5.203  83.295 59.552 1.00 48.13 ? 1171 HOH A O   1 
HETATM 4665 O  O   . HOH W 10 .   ? 0.080   82.522 57.408 1.00 31.69 ? 1172 HOH A O   1 
HETATM 4666 O  O   . HOH W 10 .   ? 0.187   80.671 63.742 1.00 54.27 ? 1173 HOH A O   1 
HETATM 4667 O  O   . HOH W 10 .   ? -4.587  80.008 61.921 1.00 46.60 ? 1174 HOH A O   1 
HETATM 4668 O  O   . HOH W 10 .   ? 15.818  62.459 87.341 1.00 49.49 ? 1175 HOH A O   1 
HETATM 4669 O  O   . HOH W 10 .   ? 17.821  50.077 82.763 0.50 19.02 ? 1176 HOH A O   1 
HETATM 4670 O  O   . HOH W 10 .   ? 0.143   69.303 59.192 1.00 18.19 ? 1177 HOH A O   1 
HETATM 4671 O  O   . HOH W 10 .   ? 3.841   68.892 57.528 1.00 17.58 ? 1178 HOH A O   1 
HETATM 4672 O  O   . HOH W 10 .   ? 4.174   80.452 50.857 1.00 18.23 ? 1179 HOH A O   1 
HETATM 4673 O  O   . HOH W 10 .   ? -3.087  82.834 57.102 1.00 63.75 ? 1180 HOH A O   1 
HETATM 4674 O  O   . HOH W 10 .   ? 14.666  45.502 62.127 1.00 31.32 ? 1181 HOH A O   1 
HETATM 4675 O  O   . HOH W 10 .   ? -3.417  85.420 53.722 1.00 38.28 ? 1182 HOH A O   1 
HETATM 4676 O  O   . HOH W 10 .   ? 10.873  87.133 43.791 1.00 48.70 ? 1183 HOH A O   1 
HETATM 4677 O  O   . HOH W 10 .   ? 27.428  61.103 73.890 1.00 36.90 ? 1184 HOH A O   1 
HETATM 4678 O  O   . HOH W 10 .   ? 36.046  56.636 74.427 1.00 24.60 ? 1185 HOH A O   1 
HETATM 4679 O  O   . HOH W 10 .   ? 11.248  80.430 40.664 1.00 42.80 ? 1186 HOH A O   1 
HETATM 4680 O  O   . HOH W 10 .   ? 12.570  83.976 41.108 1.00 40.81 ? 1187 HOH A O   1 
HETATM 4681 O  O   . HOH W 10 .   ? 13.454  84.249 43.397 1.00 36.85 ? 1188 HOH A O   1 
HETATM 4682 O  O   . HOH W 10 .   ? 12.944  83.478 47.234 1.00 20.72 ? 1189 HOH A O   1 
HETATM 4683 O  O   . HOH W 10 .   ? 19.388  63.871 85.843 1.00 36.46 ? 1190 HOH A O   1 
HETATM 4684 O  O   . HOH W 10 .   ? 9.581   87.234 40.423 1.00 63.27 ? 1191 HOH A O   1 
HETATM 4685 O  O   . HOH W 10 .   ? 9.635   87.609 37.567 0.50 31.94 ? 1192 HOH A O   1 
HETATM 4686 O  O   . HOH W 10 .   ? 10.844  83.386 39.374 1.00 54.96 ? 1193 HOH A O   1 
HETATM 4687 O  O   . HOH W 10 .   ? 7.147   88.891 39.862 1.00 56.45 ? 1194 HOH A O   1 
HETATM 4688 O  O   . HOH W 10 .   ? 27.383  67.897 75.743 1.00 30.40 ? 1195 HOH A O   1 
HETATM 4689 O  O   . HOH W 10 .   ? 31.223  67.505 78.028 1.00 40.19 ? 1196 HOH A O   1 
HETATM 4690 O  O   . HOH W 10 .   ? 23.519  72.617 77.723 1.00 49.90 ? 1197 HOH A O   1 
HETATM 4691 O  O   . HOH W 10 .   ? 20.834  73.637 75.019 1.00 32.57 ? 1198 HOH A O   1 
HETATM 4692 O  O   . HOH W 10 .   ? 19.139  74.257 77.367 1.00 35.27 ? 1199 HOH A O   1 
HETATM 4693 O  O   . HOH W 10 .   ? 22.106  51.609 48.952 1.00 42.59 ? 1200 HOH A O   1 
HETATM 4694 O  O   . HOH W 10 .   ? 19.482  54.687 33.745 1.00 48.20 ? 1201 HOH A O   1 
HETATM 4695 O  O   . HOH W 10 .   ? 21.480  56.769 35.105 1.00 37.69 ? 1202 HOH A O   1 
HETATM 4696 O  O   . HOH W 10 .   ? 23.532  58.052 35.478 1.00 49.97 ? 1203 HOH A O   1 
HETATM 4697 O  O   . HOH W 10 .   ? 17.576  66.011 30.076 1.00 46.28 ? 1204 HOH A O   1 
HETATM 4698 O  O   . HOH W 10 .   ? 19.657  66.085 32.008 1.00 36.63 ? 1205 HOH A O   1 
HETATM 4699 O  O   . HOH W 10 .   ? -13.277 57.712 56.077 1.00 12.03 ? 1206 HOH A O   1 
HETATM 4700 O  O   . HOH W 10 .   ? 23.721  68.652 36.659 1.00 35.85 ? 1207 HOH A O   1 
HETATM 4701 O  O   . HOH W 10 .   ? -3.630  50.983 59.101 1.00 13.89 ? 1208 HOH A O   1 
HETATM 4702 O  O   . HOH W 10 .   ? -4.245  51.838 55.838 1.00 20.10 ? 1209 HOH A O   1 
HETATM 4703 O  O   . HOH W 10 .   ? 24.924  72.471 64.963 1.00 41.79 ? 1210 HOH A O   1 
HETATM 4704 O  O   . HOH W 10 .   ? 25.029  68.028 63.565 1.00 30.09 ? 1211 HOH A O   1 
HETATM 4705 O  O   . HOH W 10 .   ? 26.620  74.509 62.740 1.00 45.54 ? 1212 HOH A O   1 
HETATM 4706 O  O   . HOH W 10 .   ? 19.395  83.653 64.797 1.00 39.28 ? 1213 HOH A O   1 
HETATM 4707 O  O   . HOH W 10 .   ? -6.213  46.109 51.340 1.00 40.57 ? 1214 HOH A O   1 
HETATM 4708 O  O   . HOH W 10 .   ? -3.514  40.704 48.555 1.00 54.12 ? 1215 HOH A O   1 
HETATM 4709 O  O   . HOH W 10 .   ? -9.102  44.856 50.756 1.00 24.16 ? 1216 HOH A O   1 
HETATM 4710 O  O   . HOH W 10 .   ? 17.925  78.555 77.573 1.00 39.28 ? 1217 HOH A O   1 
HETATM 4711 O  O   . HOH W 10 .   ? -16.342 44.519 54.258 1.00 38.81 ? 1218 HOH A O   1 
HETATM 4712 O  O   . HOH W 10 .   ? -13.438 51.204 49.028 1.00 24.03 ? 1219 HOH A O   1 
HETATM 4713 O  O   . HOH W 10 .   ? -6.400  50.730 49.035 1.00 33.74 ? 1220 HOH A O   1 
HETATM 4714 O  O   . HOH W 10 .   ? -9.779  51.912 54.383 1.00 24.21 ? 1221 HOH A O   1 
HETATM 4715 O  O   . HOH W 10 .   ? 20.606  89.832 54.158 1.00 44.23 ? 1222 HOH A O   1 
HETATM 4716 O  O   . HOH W 10 .   ? -7.702  57.813 44.191 1.00 36.04 ? 1223 HOH A O   1 
HETATM 4717 O  O   . HOH W 10 .   ? 18.526  87.379 50.042 1.00 32.75 ? 1224 HOH A O   1 
HETATM 4718 O  O   . HOH W 10 .   ? -6.541  54.871 42.241 1.00 40.11 ? 1225 HOH A O   1 
HETATM 4719 O  O   . HOH W 10 .   ? -3.582  51.511 43.920 1.00 32.63 ? 1226 HOH A O   1 
HETATM 4720 O  O   . HOH W 10 .   ? -9.725  63.510 40.086 1.00 42.06 ? 1227 HOH A O   1 
HETATM 4721 O  O   . HOH W 10 .   ? -5.912  58.450 39.687 1.00 23.03 ? 1228 HOH A O   1 
HETATM 4722 O  O   . HOH W 10 .   ? -3.881  60.878 34.029 1.00 26.86 ? 1229 HOH A O   1 
HETATM 4723 O  O   . HOH W 10 .   ? -4.830  57.931 36.279 1.00 30.93 ? 1230 HOH A O   1 
HETATM 4724 O  O   . HOH W 10 .   ? 28.320  64.478 39.829 1.00 37.31 ? 1231 HOH A O   1 
HETATM 4725 O  O   . HOH W 10 .   ? 27.680  70.964 41.688 1.00 52.25 ? 1232 HOH A O   1 
HETATM 4726 O  O   . HOH W 10 .   ? 24.124  60.684 39.689 1.00 21.87 ? 1233 HOH A O   1 
HETATM 4727 O  O   . HOH W 10 .   ? -9.953  65.137 37.773 1.00 20.58 ? 1234 HOH A O   1 
HETATM 4728 O  O   . HOH W 10 .   ? -6.694  64.916 32.166 1.00 28.48 ? 1235 HOH A O   1 
HETATM 4729 O  O   . HOH W 10 .   ? -9.253  61.955 35.548 1.00 33.79 ? 1236 HOH A O   1 
HETATM 4730 O  O   . HOH W 10 .   ? 29.903  58.570 40.936 1.00 33.77 ? 1237 HOH A O   1 
HETATM 4731 O  O   . HOH W 10 .   ? 28.255  53.899 41.408 1.00 41.84 ? 1238 HOH A O   1 
HETATM 4732 O  O   . HOH W 10 .   ? -11.794 66.978 36.777 1.00 18.32 ? 1239 HOH A O   1 
HETATM 4733 O  O   . HOH W 10 .   ? 25.336  66.034 59.678 1.00 30.09 ? 1240 HOH A O   1 
HETATM 4734 O  O   . HOH W 10 .   ? -4.246  70.505 33.578 1.00 20.29 ? 1241 HOH A O   1 
HETATM 4735 O  O   . HOH W 10 .   ? 28.120  82.962 51.059 1.00 36.43 ? 1242 HOH A O   1 
HETATM 4736 O  O   . HOH W 10 .   ? -0.689  74.555 31.113 1.00 35.95 ? 1243 HOH A O   1 
HETATM 4737 O  O   . HOH W 10 .   ? 27.266  59.833 65.137 1.00 36.69 ? 1244 HOH A O   1 
HETATM 4738 O  O   . HOH W 10 .   ? 6.208   74.935 32.800 1.00 34.28 ? 1245 HOH A O   1 
HETATM 4739 O  O   . HOH W 10 .   ? 0.065   66.221 36.301 1.00 19.30 ? 1246 HOH A O   1 
HETATM 4740 O  O   . HOH W 10 .   ? 3.673   66.849 36.197 1.00 24.45 ? 1247 HOH A O   1 
HETATM 4741 O  O   . HOH W 10 .   ? -0.955  64.508 28.842 1.00 39.78 ? 1248 HOH A O   1 
HETATM 4742 O  O   . HOH W 10 .   ? -2.588  66.996 31.974 1.00 39.17 ? 1249 HOH A O   1 
HETATM 4743 O  O   . HOH W 10 .   ? 16.382  46.328 55.225 1.00 49.00 ? 1250 HOH A O   1 
HETATM 4744 O  O   . HOH W 10 .   ? 9.180   71.211 32.538 1.00 36.56 ? 1251 HOH A O   1 
HETATM 4745 O  O   . HOH W 10 .   ? 17.447  32.572 68.959 1.00 47.13 ? 1252 HOH A O   1 
HETATM 4746 O  O   . HOH W 10 .   ? -14.772 87.028 32.775 1.00 43.69 ? 1253 HOH A O   1 
HETATM 4747 O  O   . HOH W 10 .   ? -1.058  50.996 42.174 1.00 38.23 ? 1254 HOH A O   1 
HETATM 4748 O  O   . HOH W 10 .   ? -4.389  56.148 38.923 1.00 47.00 ? 1255 HOH A O   1 
HETATM 4749 O  O   . HOH W 10 .   ? 9.278   50.547 36.912 1.00 32.02 ? 1256 HOH A O   1 
HETATM 4750 O  O   . HOH W 10 .   ? 0.202   56.915 37.740 1.00 19.84 ? 1257 HOH A O   1 
HETATM 4751 O  O   . HOH W 10 .   ? 2.701   54.182 36.209 1.00 17.32 ? 1258 HOH A O   1 
HETATM 4752 O  O   . HOH W 10 .   ? -1.034  60.837 33.670 1.00 29.45 ? 1259 HOH A O   1 
HETATM 4753 O  O   . HOH W 10 .   ? 5.795   57.764 35.341 1.00 29.37 ? 1260 HOH A O   1 
HETATM 4754 O  O   . HOH W 10 .   ? 1.751   64.081 35.067 1.00 22.97 ? 1261 HOH A O   1 
HETATM 4755 O  O   . HOH W 10 .   ? -0.526  66.295 39.512 1.00 18.85 ? 1262 HOH A O   1 
HETATM 4756 O  O   . HOH W 10 .   ? 4.408   64.467 35.038 1.00 17.34 ? 1263 HOH A O   1 
HETATM 4757 O  O   . HOH W 10 .   ? 9.292   62.276 35.362 1.00 35.03 ? 1264 HOH A O   1 
HETATM 4758 O  O   . HOH W 10 .   ? 12.292  68.773 29.753 1.00 41.98 ? 1265 HOH A O   1 
HETATM 4759 O  O   . HOH W 10 .   ? 12.858  65.801 33.730 1.00 52.57 ? 1266 HOH A O   1 
HETATM 4760 O  O   . HOH W 10 .   ? 11.390  70.143 33.757 1.00 32.42 ? 1267 HOH A O   1 
HETATM 4761 O  O   . HOH W 10 .   ? 12.767  51.328 58.757 1.00 47.43 ? 1268 HOH A O   1 
HETATM 4762 O  O   . HOH W 10 .   ? 9.274   49.662 56.586 1.00 37.20 ? 1269 HOH A O   1 
HETATM 4763 O  O   . HOH W 10 .   ? 14.305  51.009 55.645 1.00 19.81 ? 1270 HOH A O   1 
HETATM 4764 O  O   . HOH W 10 .   ? 7.264   52.249 56.113 1.00 9.63  ? 1271 HOH A O   1 
HETATM 4765 O  O   . HOH W 10 .   ? 4.900   50.527 61.866 1.00 16.07 ? 1272 HOH A O   1 
HETATM 4766 O  O   . HOH W 10 .   ? 3.011   53.973 63.178 1.00 14.40 ? 1273 HOH A O   1 
HETATM 4767 O  O   . HOH W 10 .   ? 6.498   48.243 55.626 1.00 12.18 ? 1274 HOH A O   1 
HETATM 4768 O  O   . HOH W 10 .   ? 7.133   48.418 58.907 1.00 33.86 ? 1275 HOH A O   1 
HETATM 4769 O  O   . HOH W 10 .   ? 5.311   45.718 57.097 1.00 41.35 ? 1276 HOH A O   1 
HETATM 4770 O  O   . HOH W 10 .   ? 3.458   45.910 60.933 1.00 15.11 ? 1277 HOH A O   1 
HETATM 4771 O  O   . HOH W 10 .   ? 2.192   41.417 61.743 1.00 55.41 ? 1278 HOH A O   1 
HETATM 4772 O  O   . HOH W 10 .   ? 2.594   39.957 59.002 1.00 34.47 ? 1279 HOH A O   1 
HETATM 4773 O  O   . HOH W 10 .   ? -5.604  44.913 57.040 1.00 21.77 ? 1280 HOH A O   1 
HETATM 4774 O  O   . HOH W 10 .   ? 0.527   40.571 56.925 1.00 24.92 ? 1281 HOH A O   1 
HETATM 4775 O  O   . HOH W 10 .   ? -4.312  40.251 62.210 1.00 18.57 ? 1282 HOH A O   1 
HETATM 4776 O  O   . HOH W 10 .   ? 0.170   41.802 63.785 1.00 26.55 ? 1283 HOH A O   1 
HETATM 4777 O  O   . HOH W 10 .   ? 1.867   43.582 66.773 1.00 32.18 ? 1284 HOH A O   1 
HETATM 4778 O  O   . HOH W 10 .   ? -6.321  49.361 60.914 1.00 19.83 ? 1285 HOH A O   1 
HETATM 4779 O  O   . HOH W 10 .   ? -5.823  40.932 56.479 1.00 34.24 ? 1286 HOH A O   1 
HETATM 4780 O  O   . HOH W 10 .   ? -5.173  42.688 69.669 1.00 38.50 ? 1287 HOH A O   1 
HETATM 4781 O  O   . HOH W 10 .   ? -7.191  42.596 67.338 1.00 24.09 ? 1288 HOH A O   1 
HETATM 4782 O  O   . HOH W 10 .   ? 3.619   47.427 64.999 1.00 18.61 ? 1289 HOH A O   1 
HETATM 4783 O  O   . HOH W 10 .   ? 4.421   49.874 66.507 1.00 18.18 ? 1290 HOH A O   1 
HETATM 4784 O  O   . HOH W 10 .   ? 3.581   51.285 64.042 1.00 18.24 ? 1291 HOH A O   1 
HETATM 4785 O  O   . HOH W 10 .   ? -6.902  48.727 73.842 1.00 34.19 ? 1292 HOH A O   1 
HETATM 4786 O  O   . HOH W 10 .   ? -9.530  41.184 74.979 1.00 39.66 ? 1293 HOH A O   1 
HETATM 4787 O  O   . HOH W 10 .   ? -18.702 52.679 72.135 1.00 34.42 ? 1294 HOH A O   1 
HETATM 4788 O  O   . HOH W 10 .   ? -21.946 44.875 72.075 1.00 42.80 ? 1295 HOH A O   1 
HETATM 4789 O  O   . HOH W 10 .   ? -15.980 44.261 71.371 1.00 48.61 ? 1296 HOH A O   1 
HETATM 4790 O  O   . HOH W 10 .   ? -21.807 46.316 66.818 1.00 29.71 ? 1297 HOH A O   1 
HETATM 4791 O  O   . HOH W 10 .   ? -17.349 39.776 69.163 1.00 43.12 ? 1298 HOH A O   1 
HETATM 4792 O  O   . HOH W 10 .   ? -13.244 40.351 53.857 1.00 37.66 ? 1299 HOH A O   1 
HETATM 4793 O  O   . HOH W 10 .   ? -14.909 38.881 57.816 1.00 42.56 ? 1300 HOH A O   1 
HETATM 4794 O  O   . HOH W 10 .   ? -12.487 38.844 56.359 1.00 49.57 ? 1301 HOH A O   1 
HETATM 4795 O  O   . HOH W 10 .   ? -20.990 47.192 56.930 1.00 55.65 ? 1302 HOH A O   1 
HETATM 4796 O  O   . HOH W 10 .   ? -15.352 41.836 54.070 1.00 45.13 ? 1303 HOH A O   1 
HETATM 4797 O  O   . HOH W 10 .   ? -23.774 38.277 65.380 1.00 55.44 ? 1304 HOH A O   1 
HETATM 4798 O  O   . HOH W 10 .   ? -22.410 45.938 63.820 1.00 34.96 ? 1305 HOH A O   1 
HETATM 4799 O  O   . HOH W 10 .   ? -24.149 49.488 64.484 1.00 60.54 ? 1306 HOH A O   1 
HETATM 4800 O  O   . HOH W 10 .   ? -22.333 58.608 62.337 1.00 52.92 ? 1307 HOH A O   1 
HETATM 4801 O  O   . HOH W 10 .   ? -27.246 56.777 62.002 1.00 46.91 ? 1308 HOH A O   1 
HETATM 4802 O  O   . HOH W 10 .   ? -23.470 51.713 59.922 1.00 35.62 ? 1309 HOH A O   1 
HETATM 4803 O  O   . HOH W 10 .   ? -26.632 54.401 58.630 1.00 53.41 ? 1310 HOH A O   1 
HETATM 4804 O  O   . HOH W 10 .   ? -21.114 49.616 70.077 1.00 43.89 ? 1311 HOH A O   1 
HETATM 4805 O  O   . HOH W 10 .   ? -25.355 51.986 70.077 1.00 50.11 ? 1312 HOH A O   1 
HETATM 4806 O  O   . HOH W 10 .   ? -17.509 63.586 66.832 1.00 36.46 ? 1313 HOH A O   1 
HETATM 4807 O  O   . HOH W 10 .   ? -9.074  62.847 71.808 1.00 25.22 ? 1314 HOH A O   1 
HETATM 4808 O  O   . HOH W 10 .   ? -15.337 56.576 72.387 1.00 34.31 ? 1315 HOH A O   1 
HETATM 4809 O  O   . HOH W 10 .   ? -17.799 55.543 72.495 1.00 49.72 ? 1316 HOH A O   1 
HETATM 4810 O  O   . HOH W 10 .   ? -7.261  60.513 71.802 1.00 43.98 ? 1317 HOH A O   1 
HETATM 4811 O  O   . HOH W 10 .   ? -10.756 62.868 74.121 1.00 35.89 ? 1318 HOH A O   1 
HETATM 4812 O  O   . HOH W 10 .   ? -8.991  58.260 64.155 1.00 18.30 ? 1319 HOH A O   1 
HETATM 4813 O  O   . HOH W 10 .   ? -2.479  57.583 66.313 1.00 21.10 ? 1320 HOH A O   1 
HETATM 4814 O  O   . HOH W 10 .   ? -6.636  61.305 64.924 1.00 14.29 ? 1321 HOH A O   1 
HETATM 4815 O  O   . HOH W 10 .   ? -3.803  57.214 63.410 1.00 12.87 ? 1322 HOH A O   1 
HETATM 4816 O  O   . HOH W 10 .   ? -6.558  56.739 72.876 1.00 35.92 ? 1323 HOH A O   1 
HETATM 4817 O  O   . HOH W 10 .   ? -1.192  54.876 73.478 1.00 41.20 ? 1324 HOH A O   1 
HETATM 4818 O  O   . HOH W 10 .   ? 1.113   43.797 71.541 1.00 40.20 ? 1325 HOH A O   1 
HETATM 4819 O  O   . HOH W 10 .   ? 0.608   52.512 73.854 1.00 32.68 ? 1326 HOH A O   1 
HETATM 4820 O  O   . HOH W 10 .   ? 6.312   49.450 79.114 1.00 33.37 ? 1327 HOH A O   1 
HETATM 4821 O  O   . HOH W 10 .   ? 3.532   54.761 74.893 1.00 49.23 ? 1328 HOH A O   1 
HETATM 4822 O  O   . HOH W 10 .   ? 5.690   47.206 75.166 1.00 28.15 ? 1329 HOH A O   1 
HETATM 4823 O  O   . HOH W 10 .   ? 8.613   49.663 74.652 1.00 43.91 ? 1330 HOH A O   1 
HETATM 4824 O  O   . HOH W 10 .   ? 4.217   55.706 77.752 1.00 17.69 ? 1331 HOH A O   1 
HETATM 4825 O  O   . HOH W 10 .   ? 8.636   50.443 77.715 1.00 37.84 ? 1332 HOH A O   1 
HETATM 4826 O  O   . HOH W 10 .   ? 5.067   53.991 79.857 1.00 34.57 ? 1333 HOH A O   1 
HETATM 4827 O  O   . HOH W 10 .   ? 3.899   55.929 69.954 1.00 14.90 ? 1334 HOH A O   1 
HETATM 4828 O  O   . HOH W 10 .   ? 3.459   58.190 73.885 1.00 43.76 ? 1335 HOH A O   1 
HETATM 4829 O  O   . HOH W 10 .   ? 3.541   50.502 69.240 1.00 16.46 ? 1336 HOH A O   1 
HETATM 4830 O  O   . HOH W 10 .   ? 5.053   59.672 69.592 1.00 21.24 ? 1337 HOH A O   1 
HETATM 4831 O  O   . HOH W 10 .   ? 7.226   49.070 66.027 1.00 32.37 ? 1338 HOH A O   1 
HETATM 4832 O  O   . HOH W 10 .   ? -3.639  50.114 61.418 1.00 19.45 ? 1339 HOH A O   1 
HETATM 4833 O  O   . HOH W 10 .   ? -1.694  57.383 62.077 1.00 14.53 ? 1340 HOH A O   1 
HETATM 4834 O  O   . HOH W 10 .   ? 1.298   43.221 54.458 1.00 24.86 ? 1341 HOH A O   1 
HETATM 4835 O  O   . HOH W 10 .   ? -1.016  40.899 45.224 1.00 44.05 ? 1342 HOH A O   1 
HETATM 4836 O  O   . HOH W 10 .   ? -3.452  42.538 46.521 1.00 61.22 ? 1343 HOH A O   1 
HETATM 4837 O  O   . HOH W 10 .   ? -5.056  51.053 46.211 1.00 39.03 ? 1344 HOH A O   1 
HETATM 4838 O  O   . HOH W 10 .   ? 2.821   41.510 47.387 1.00 32.62 ? 1345 HOH A O   1 
HETATM 4839 O  O   . HOH W 10 .   ? 8.915   44.774 43.456 1.00 37.53 ? 1346 HOH A O   1 
HETATM 4840 O  O   . HOH W 10 .   ? 10.941  42.039 51.193 1.00 31.46 ? 1347 HOH A O   1 
HETATM 4841 O  O   . HOH W 10 .   ? 7.172   41.466 49.161 1.00 26.27 ? 1348 HOH A O   1 
HETATM 4842 O  O   . HOH W 10 .   ? 7.209   46.597 53.526 1.00 19.19 ? 1349 HOH A O   1 
HETATM 4843 O  O   . HOH W 10 .   ? 9.861   46.627 53.363 1.00 18.17 ? 1350 HOH A O   1 
HETATM 4844 O  O   . HOH W 10 .   ? 13.263  49.832 53.411 1.00 19.42 ? 1351 HOH A O   1 
HETATM 4845 O  O   . HOH W 10 .   ? 9.683   40.453 46.313 1.00 51.70 ? 1352 HOH A O   1 
HETATM 4846 O  O   . HOH W 10 .   ? 13.670  42.893 44.902 1.00 29.72 ? 1353 HOH A O   1 
HETATM 4847 O  O   . HOH W 10 .   ? 13.503  42.367 49.955 1.00 44.17 ? 1354 HOH A O   1 
HETATM 4848 O  O   . HOH W 10 .   ? 18.022  50.399 44.710 1.00 24.64 ? 1355 HOH A O   1 
HETATM 4849 O  O   . HOH W 10 .   ? 20.661  44.692 46.576 1.00 54.34 ? 1356 HOH A O   1 
HETATM 4850 O  O   . HOH W 10 .   ? 17.576  44.830 50.534 1.00 49.04 ? 1357 HOH A O   1 
HETATM 4851 O  O   . HOH W 10 .   ? 14.619  42.666 47.714 1.00 45.66 ? 1358 HOH A O   1 
HETATM 4852 O  O   . HOH W 10 .   ? 11.936  47.359 37.338 1.00 49.49 ? 1359 HOH A O   1 
HETATM 4853 O  O   . HOH W 10 .   ? 5.085   46.331 40.130 1.00 29.28 ? 1360 HOH A O   1 
HETATM 4854 O  O   . HOH W 10 .   ? 9.815   46.869 38.458 1.00 49.25 ? 1361 HOH A O   1 
HETATM 4855 O  O   . HOH W 10 .   ? 8.916   59.573 35.581 1.00 49.94 ? 1362 HOH A O   1 
HETATM 4856 O  O   . HOH W 10 .   ? 6.480   62.387 35.035 1.00 16.22 ? 1363 HOH A O   1 
HETATM 4857 O  O   . HOH W 10 .   ? 14.359  49.050 37.064 1.00 48.43 ? 1364 HOH A O   1 
HETATM 4858 O  O   . HOH W 10 .   ? 12.948  52.312 34.347 1.00 38.46 ? 1365 HOH A O   1 
HETATM 4859 O  O   . HOH W 10 .   ? 9.735   56.048 35.960 1.00 18.82 ? 1366 HOH A O   1 
HETATM 4860 O  O   . HOH W 10 .   ? 11.368  64.297 35.298 1.00 42.84 ? 1367 HOH A O   1 
HETATM 4861 O  O   . HOH W 10 .   ? 13.401  62.604 33.987 1.00 37.11 ? 1368 HOH A O   1 
HETATM 4862 O  O   . HOH W 10 .   ? 21.154  65.035 63.805 1.00 25.85 ? 1369 HOH A O   1 
HETATM 4863 O  O   . HOH W 10 .   ? 11.937  67.196 67.093 1.00 21.44 ? 1370 HOH A O   1 
HETATM 4864 O  O   . HOH W 10 .   ? 21.034  71.219 68.045 1.00 28.25 ? 1371 HOH A O   1 
HETATM 4865 O  O   . HOH W 10 .   ? 5.632   61.211 71.735 1.00 24.20 ? 1372 HOH A O   1 
HETATM 4866 O  O   . HOH W 10 .   ? 6.149   66.765 78.621 1.00 31.53 ? 1373 HOH A O   1 
HETATM 4867 O  O   . HOH W 10 .   ? 2.273   63.882 76.343 1.00 30.56 ? 1374 HOH A O   1 
HETATM 4868 O  O   . HOH W 10 .   ? 4.532   57.477 75.826 1.00 15.09 ? 1375 HOH A O   1 
HETATM 4869 O  O   . HOH W 10 .   ? 7.572   63.313 78.635 1.00 14.83 ? 1376 HOH A O   1 
HETATM 4870 O  O   . HOH W 10 .   ? 13.171  59.212 78.664 1.00 28.98 ? 1377 HOH A O   1 
HETATM 4871 O  O   . HOH W 10 .   ? 7.302   66.111 81.788 1.00 33.86 ? 1378 HOH A O   1 
HETATM 4872 O  O   . HOH W 10 .   ? 11.965  67.226 83.018 1.00 22.15 ? 1379 HOH A O   1 
HETATM 4873 O  O   . HOH W 10 .   ? 8.387   76.572 75.798 1.00 15.89 ? 1380 HOH A O   1 
HETATM 4874 O  O   . HOH W 10 .   ? 10.356  76.320 77.881 1.00 40.23 ? 1381 HOH A O   1 
HETATM 4875 O  O   . HOH W 10 .   ? 4.543   77.653 78.199 1.00 22.19 ? 1382 HOH A O   1 
HETATM 4876 O  O   . HOH W 10 .   ? 5.113   77.490 80.835 1.00 28.74 ? 1383 HOH A O   1 
HETATM 4877 O  O   . HOH W 10 .   ? 11.458  77.246 83.558 1.00 34.69 ? 1384 HOH A O   1 
HETATM 4878 O  O   . HOH W 10 .   ? 13.964  75.350 79.027 1.00 45.70 ? 1385 HOH A O   1 
HETATM 4879 O  O   . HOH W 10 .   ? 18.858  76.452 80.798 1.00 49.95 ? 1386 HOH A O   1 
HETATM 4880 O  O   . HOH W 10 .   ? 22.958  73.390 82.542 1.00 56.41 ? 1387 HOH A O   1 
HETATM 4881 O  O   . HOH W 10 .   ? 15.790  72.633 84.244 1.00 45.82 ? 1388 HOH A O   1 
HETATM 4882 O  O   . HOH W 10 .   ? 17.673  76.618 83.544 1.00 43.48 ? 1389 HOH A O   1 
HETATM 4883 O  O   . HOH W 10 .   ? 14.917  65.027 83.777 1.00 20.68 ? 1390 HOH A O   1 
HETATM 4884 O  O   . HOH W 10 .   ? 16.652  68.985 84.054 1.00 34.30 ? 1391 HOH A O   1 
HETATM 4885 O  O   . HOH W 10 .   ? 15.472  59.808 86.952 1.00 31.52 ? 1392 HOH A O   1 
HETATM 4886 O  O   . HOH W 10 .   ? 23.226  51.951 80.583 1.00 54.81 ? 1393 HOH A O   1 
HETATM 4887 O  O   . HOH W 10 .   ? 17.566  58.830 89.982 1.00 51.46 ? 1394 HOH A O   1 
HETATM 4888 O  O   . HOH W 10 .   ? 15.215  51.785 83.551 1.00 49.26 ? 1395 HOH A O   1 
HETATM 4889 O  O   . HOH W 10 .   ? 15.692  62.254 84.166 1.00 23.42 ? 1396 HOH A O   1 
HETATM 4890 O  O   . HOH W 10 .   ? 12.247  61.146 85.420 1.00 35.23 ? 1397 HOH A O   1 
HETATM 4891 O  O   . HOH W 10 .   ? 16.453  50.221 77.766 1.00 29.87 ? 1398 HOH A O   1 
HETATM 4892 O  O   . HOH W 10 .   ? 9.588   53.955 82.902 1.00 52.98 ? 1399 HOH A O   1 
HETATM 4893 O  O   . HOH W 10 .   ? 10.294  52.376 78.622 1.00 39.34 ? 1400 HOH A O   1 
HETATM 4894 O  O   . HOH W 10 .   ? 11.982  56.074 83.703 1.00 41.45 ? 1401 HOH A O   1 
HETATM 4895 O  O   . HOH W 10 .   ? 11.749  47.271 73.431 1.00 45.79 ? 1402 HOH A O   1 
HETATM 4896 O  O   . HOH W 10 .   ? 12.720  44.886 77.798 1.00 41.48 ? 1403 HOH A O   1 
HETATM 4897 O  O   . HOH W 10 .   ? 10.602  55.668 68.202 1.00 9.27  ? 1404 HOH A O   1 
HETATM 4898 O  O   . HOH W 10 .   ? 8.728   44.410 70.463 1.00 58.61 ? 1405 HOH A O   1 
HETATM 4899 O  O   . HOH W 10 .   ? 11.938  48.899 61.979 1.00 44.07 ? 1406 HOH A O   1 
HETATM 4900 O  O   . HOH W 10 .   ? 14.792  48.573 63.684 1.00 39.15 ? 1407 HOH A O   1 
HETATM 4901 O  O   . HOH W 10 .   ? 18.379  44.375 78.920 1.00 46.16 ? 1408 HOH A O   1 
HETATM 4902 O  O   . HOH W 10 .   ? 13.279  43.878 75.186 1.00 46.44 ? 1409 HOH A O   1 
HETATM 4903 O  O   . HOH W 10 .   ? 14.275  39.996 75.095 1.00 35.63 ? 1410 HOH A O   1 
HETATM 4904 O  O   . HOH W 10 .   ? 18.072  39.700 74.158 1.00 36.25 ? 1411 HOH A O   1 
HETATM 4905 O  O   . HOH W 10 .   ? 24.576  48.342 76.437 1.00 25.02 ? 1412 HOH A O   1 
HETATM 4906 O  O   . HOH W 10 .   ? 22.969  48.466 78.250 1.00 32.68 ? 1413 HOH A O   1 
HETATM 4907 O  O   . HOH W 10 .   ? 24.737  43.557 77.175 1.00 40.57 ? 1414 HOH A O   1 
HETATM 4908 O  O   . HOH W 10 .   ? 19.163  50.218 77.966 1.00 38.96 ? 1415 HOH A O   1 
HETATM 4909 O  O   . HOH W 10 .   ? 26.630  48.685 68.996 1.00 39.01 ? 1416 HOH A O   1 
HETATM 4910 O  O   . HOH W 10 .   ? 30.025  52.361 65.433 1.00 26.36 ? 1417 HOH A O   1 
HETATM 4911 O  O   . HOH W 10 .   ? 29.478  54.577 69.223 1.00 40.47 ? 1418 HOH A O   1 
HETATM 4912 O  O   . HOH W 10 .   ? 29.128  49.945 67.232 1.00 45.57 ? 1419 HOH A O   1 
HETATM 4913 O  O   . HOH W 10 .   ? 26.445  59.686 76.515 1.00 37.66 ? 1420 HOH A O   1 
HETATM 4914 O  O   . HOH W 10 .   ? 33.641  57.057 75.596 1.00 25.38 ? 1421 HOH A O   1 
HETATM 4915 O  O   . HOH W 10 .   ? 34.100  61.776 77.075 1.00 28.11 ? 1422 HOH A O   1 
HETATM 4916 O  O   . HOH W 10 .   ? 30.021  61.354 73.364 1.00 44.92 ? 1423 HOH A O   1 
HETATM 4917 O  O   . HOH W 10 .   ? 35.889  58.704 82.753 1.00 40.47 ? 1424 HOH A O   1 
HETATM 4918 O  O   . HOH W 10 .   ? 28.915  64.719 83.786 1.00 37.75 ? 1425 HOH A O   1 
HETATM 4919 O  O   . HOH W 10 .   ? 26.321  60.457 79.046 1.00 35.81 ? 1426 HOH A O   1 
HETATM 4920 O  O   . HOH W 10 .   ? 29.165  60.981 83.871 1.00 31.16 ? 1427 HOH A O   1 
HETATM 4921 O  O   . HOH W 10 .   ? 25.454  53.853 84.310 1.00 42.47 ? 1428 HOH A O   1 
HETATM 4922 O  O   . HOH W 10 .   ? 30.314  58.965 84.330 1.00 37.57 ? 1429 HOH A O   1 
HETATM 4923 O  O   . HOH W 10 .   ? 29.085  54.965 85.836 1.00 40.06 ? 1430 HOH A O   1 
HETATM 4924 O  O   . HOH W 10 .   ? 22.411  62.457 85.553 1.00 55.73 ? 1431 HOH A O   1 
HETATM 4925 O  O   . HOH W 10 .   ? 24.291  55.290 86.256 1.00 53.48 ? 1432 HOH A O   1 
HETATM 4926 O  O   . HOH W 10 .   ? 24.610  63.622 87.359 1.00 50.92 ? 1433 HOH A O   1 
HETATM 4927 O  O   . HOH W 10 .   ? 21.651  59.298 86.506 1.00 41.71 ? 1434 HOH A O   1 
HETATM 4928 O  O   . HOH W 10 .   ? 28.213  67.825 78.460 1.00 42.90 ? 1435 HOH A O   1 
HETATM 4929 O  O   . HOH W 10 .   ? 25.623  67.856 82.403 1.00 37.29 ? 1436 HOH A O   1 
HETATM 4930 O  O   . HOH W 10 .   ? 24.428  66.507 84.329 1.00 33.86 ? 1437 HOH A O   1 
HETATM 4931 O  O   . HOH W 10 .   ? 25.042  62.049 73.480 1.00 30.07 ? 1438 HOH A O   1 
HETATM 4932 O  O   . HOH W 10 .   ? 32.815  65.914 76.055 1.00 42.88 ? 1439 HOH A O   1 
HETATM 4933 O  O   . HOH W 10 .   ? 24.031  58.062 76.954 1.00 51.55 ? 1440 HOH A O   1 
HETATM 4934 O  O   . HOH W 10 .   ? 20.839  72.350 78.434 1.00 25.36 ? 1441 HOH A O   1 
HETATM 4935 O  O   . HOH W 10 .   ? 22.518  71.789 75.696 1.00 32.56 ? 1442 HOH A O   1 
HETATM 4936 O  O   . HOH W 10 .   ? 18.359  67.389 72.864 1.00 18.64 ? 1443 HOH A O   1 
HETATM 4937 O  O   . HOH W 10 .   ? 25.359  66.474 74.177 1.00 27.41 ? 1444 HOH A O   1 
HETATM 4938 O  O   . HOH W 10 .   ? 23.373  70.017 73.753 1.00 32.12 ? 1445 HOH A O   1 
HETATM 4939 O  O   . HOH W 10 .   ? 18.965  65.269 68.227 1.00 36.00 ? 1446 HOH A O   1 
HETATM 4940 O  O   . HOH W 10 .   ? 17.362  63.871 66.319 1.00 27.10 ? 1447 HOH A O   1 
HETATM 4941 O  O   . HOH W 10 .   ? 24.853  60.509 68.429 1.00 38.45 ? 1448 HOH A O   1 
HETATM 4942 O  O   . HOH W 10 .   ? 25.118  64.246 67.039 1.00 38.89 ? 1449 HOH A O   1 
HETATM 4943 O  O   . HOH W 10 .   ? 19.994  62.836 64.857 1.00 13.53 ? 1450 HOH A O   1 
HETATM 4944 O  O   . HOH W 10 .   ? 15.704  52.902 61.323 1.00 18.19 ? 1451 HOH A O   1 
HETATM 4945 O  O   . HOH W 10 .   ? 12.710  59.512 56.879 1.00 32.82 ? 1452 HOH A O   1 
HETATM 4946 O  O   . HOH W 10 .   ? 25.429  54.877 47.994 1.00 35.09 ? 1453 HOH A O   1 
HETATM 4947 O  O   . HOH W 10 .   ? 19.982  48.686 45.449 1.00 41.56 ? 1454 HOH A O   1 
HETATM 4948 O  O   . HOH W 10 .   ? 22.287  49.043 48.198 1.00 35.47 ? 1455 HOH A O   1 
HETATM 4949 O  O   . HOH W 10 .   ? 19.871  46.513 51.218 1.00 48.50 ? 1456 HOH A O   1 
HETATM 4950 O  O   . HOH W 10 .   ? 20.676  59.515 40.847 1.00 26.24 ? 1457 HOH A O   1 
HETATM 4951 O  O   . HOH W 10 .   ? 23.185  56.093 38.844 1.00 39.95 ? 1458 HOH A O   1 
HETATM 4952 O  O   . HOH W 10 .   ? 23.219  47.891 44.045 1.00 53.22 ? 1459 HOH A O   1 
HETATM 4953 O  O   . HOH W 10 .   ? 16.732  57.397 35.829 1.00 23.48 ? 1460 HOH A O   1 
HETATM 4954 O  O   . HOH W 10 .   ? 17.781  53.884 35.846 1.00 35.05 ? 1461 HOH A O   1 
HETATM 4955 O  O   . HOH W 10 .   ? 20.136  55.162 36.332 1.00 27.60 ? 1462 HOH A O   1 
HETATM 4956 O  O   . HOH W 10 .   ? 21.203  57.188 37.722 1.00 56.02 ? 1463 HOH A O   1 
HETATM 4957 O  O   . HOH W 10 .   ? 18.848  58.236 35.008 1.00 20.48 ? 1464 HOH A O   1 
HETATM 4958 O  O   . HOH W 10 .   ? 19.145  65.367 36.747 1.00 38.06 ? 1465 HOH A O   1 
HETATM 4959 O  O   . HOH W 10 .   ? 17.358  65.269 32.676 1.00 41.11 ? 1466 HOH A O   1 
HETATM 4960 O  O   . HOH W 10 .   ? 18.138  60.003 41.486 1.00 17.41 ? 1467 HOH A O   1 
HETATM 4961 O  O   . HOH W 10 .   ? 23.772  69.529 39.711 1.00 33.10 ? 1468 HOH A O   1 
HETATM 4962 O  O   . HOH W 10 .   ? 19.493  67.501 38.149 1.00 29.85 ? 1469 HOH A O   1 
HETATM 4963 O  O   . HOH W 10 .   ? 13.582  68.579 56.767 1.00 10.62 ? 1470 HOH A O   1 
HETATM 4964 O  O   . HOH W 10 .   ? 27.353  73.165 60.390 1.00 37.00 ? 1471 HOH A O   1 
HETATM 4965 O  O   . HOH W 10 .   ? 24.797  70.332 62.840 1.00 27.53 ? 1472 HOH A O   1 
HETATM 4966 O  O   . HOH W 10 .   ? 22.434  73.620 65.150 1.00 35.02 ? 1473 HOH A O   1 
HETATM 4967 O  O   . HOH W 10 .   ? 22.292  79.043 61.025 1.00 27.70 ? 1474 HOH A O   1 
HETATM 4968 O  O   . HOH W 10 .   ? 19.385  80.864 65.596 1.00 43.65 ? 1475 HOH A O   1 
HETATM 4969 O  O   . HOH W 10 .   ? 16.108  79.847 69.226 1.00 25.98 ? 1476 HOH A O   1 
HETATM 4970 O  O   . HOH W 10 .   ? 21.029  77.803 64.543 1.00 35.94 ? 1477 HOH A O   1 
HETATM 4971 O  O   . HOH W 10 .   ? 14.392  76.441 62.962 1.00 21.04 ? 1478 HOH A O   1 
HETATM 4972 O  O   . HOH W 10 .   ? 13.948  86.677 65.809 1.00 44.24 ? 1479 HOH A O   1 
HETATM 4973 O  O   . HOH W 10 .   ? 14.169  80.758 70.778 1.00 41.52 ? 1480 HOH A O   1 
HETATM 4974 O  O   . HOH W 10 .   ? 11.541  83.105 71.510 1.00 52.34 ? 1481 HOH A O   1 
HETATM 4975 O  O   . HOH W 10 .   ? 7.753   80.549 74.985 1.00 42.69 ? 1482 HOH A O   1 
HETATM 4976 O  O   . HOH W 10 .   ? 12.948  79.527 74.378 1.00 30.37 ? 1483 HOH A O   1 
HETATM 4977 O  O   . HOH W 10 .   ? 14.864  77.393 76.363 1.00 31.71 ? 1484 HOH A O   1 
HETATM 4978 O  O   . HOH W 10 .   ? 20.687  76.926 74.305 1.00 49.18 ? 1485 HOH A O   1 
HETATM 4979 O  O   . HOH W 10 .   ? 19.210  75.090 70.850 1.00 29.79 ? 1486 HOH A O   1 
HETATM 4980 O  O   . HOH W 10 .   ? 16.482  73.964 77.229 1.00 18.47 ? 1487 HOH A O   1 
HETATM 4981 O  O   . HOH W 10 .   ? 7.971   75.452 60.467 1.00 17.10 ? 1488 HOH A O   1 
HETATM 4982 O  O   . HOH W 10 .   ? 9.930   79.891 64.774 1.00 21.71 ? 1489 HOH A O   1 
HETATM 4983 O  O   . HOH W 10 .   ? 6.561   79.114 63.820 1.00 43.62 ? 1490 HOH A O   1 
HETATM 4984 O  O   . HOH W 10 .   ? 10.381  88.394 60.081 1.00 29.17 ? 1491 HOH A O   1 
HETATM 4985 O  O   . HOH W 10 .   ? 6.927   92.110 55.811 1.00 54.71 ? 1492 HOH A O   1 
HETATM 4986 O  O   . HOH W 10 .   ? 8.278   94.197 63.349 1.00 42.42 ? 1493 HOH A O   1 
HETATM 4987 O  O   . HOH W 10 .   ? 3.013   90.849 55.408 1.00 60.48 ? 1494 HOH A O   1 
HETATM 4988 O  O   . HOH W 10 .   ? 6.279   84.065 64.718 1.00 43.40 ? 1495 HOH A O   1 
HETATM 4989 O  O   . HOH W 10 .   ? 7.703   93.169 65.320 1.00 52.31 ? 1496 HOH A O   1 
HETATM 4990 O  O   . HOH W 10 .   ? 14.345  90.586 64.661 1.00 41.23 ? 1497 HOH A O   1 
HETATM 4991 O  O   . HOH W 10 .   ? 19.636  84.527 62.302 1.00 22.93 ? 1498 HOH A O   1 
HETATM 4992 O  O   . HOH W 10 .   ? 17.401  89.298 54.461 1.00 43.50 ? 1499 HOH A O   1 
HETATM 4993 O  O   . HOH W 10 .   ? 18.615  90.890 61.697 1.00 41.24 ? 1500 HOH A O   1 
HETATM 4994 O  O   . HOH W 10 .   ? 21.117  83.819 55.679 1.00 37.12 ? 1501 HOH A O   1 
HETATM 4995 O  O   . HOH W 10 .   ? 10.103  90.954 52.651 1.00 41.45 ? 1502 HOH A O   1 
HETATM 4996 O  O   . HOH W 10 .   ? 15.250  90.834 50.902 1.00 48.42 ? 1503 HOH A O   1 
HETATM 4997 O  O   . HOH W 10 .   ? 18.866  84.901 50.145 1.00 18.41 ? 1504 HOH A O   1 
HETATM 4998 O  O   . HOH W 10 .   ? 16.442  88.580 52.061 1.00 30.22 ? 1505 HOH A O   1 
HETATM 4999 O  O   . HOH W 10 .   ? 9.321   88.135 47.748 1.00 35.80 ? 1506 HOH A O   1 
HETATM 5000 O  O   . HOH W 10 .   ? 8.832   90.660 49.233 1.00 42.61 ? 1507 HOH A O   1 
HETATM 5001 O  O   . HOH W 10 .   ? 10.908  89.345 45.597 1.00 41.94 ? 1508 HOH A O   1 
HETATM 5002 O  O   . HOH W 10 .   ? 23.560  77.022 53.887 1.00 43.17 ? 1509 HOH A O   1 
HETATM 5003 O  O   . HOH W 10 .   ? 18.451  79.741 46.010 1.00 20.28 ? 1510 HOH A O   1 
HETATM 5004 O  O   . HOH W 10 .   ? 21.181  82.042 53.260 1.00 35.96 ? 1511 HOH A O   1 
HETATM 5005 O  O   . HOH W 10 .   ? 13.192  79.219 39.380 1.00 55.70 ? 1512 HOH A O   1 
HETATM 5006 O  O   . HOH W 10 .   ? 7.754   70.400 38.821 1.00 23.73 ? 1513 HOH A O   1 
HETATM 5007 O  O   . HOH W 10 .   ? 10.615  74.482 33.262 1.00 47.28 ? 1514 HOH A O   1 
HETATM 5008 O  O   . HOH W 10 .   ? 10.122  81.116 36.697 1.00 43.24 ? 1515 HOH A O   1 
HETATM 5009 O  O   . HOH W 10 .   ? 18.102  74.777 37.088 1.00 20.66 ? 1516 HOH A O   1 
HETATM 5010 O  O   . HOH W 10 .   ? 15.049  71.350 33.086 1.00 39.78 ? 1517 HOH A O   1 
HETATM 5011 O  O   . HOH W 10 .   ? 19.835  69.962 35.654 1.00 33.53 ? 1518 HOH A O   1 
HETATM 5012 O  O   . HOH W 10 .   ? 18.713  78.376 43.356 1.00 34.91 ? 1519 HOH A O   1 
HETATM 5013 O  O   . HOH W 10 .   ? 22.899  77.509 43.532 1.00 29.04 ? 1520 HOH A O   1 
HETATM 5014 O  O   . HOH W 10 .   ? 24.837  73.081 38.921 1.00 43.67 ? 1521 HOH A O   1 
HETATM 5015 O  O   . HOH W 10 .   ? 14.582  83.426 38.834 1.00 53.41 ? 1522 HOH A O   1 
HETATM 5016 O  O   . HOH W 10 .   ? 23.429  75.454 37.180 1.00 36.78 ? 1523 HOH A O   1 
HETATM 5017 O  O   . HOH W 10 .   ? 16.678  77.908 36.265 1.00 54.43 ? 1524 HOH A O   1 
HETATM 5018 O  O   . HOH W 10 .   ? 21.879  78.969 41.895 1.00 42.26 ? 1525 HOH A O   1 
HETATM 5019 O  O   . HOH W 10 .   ? 20.681  77.326 31.260 1.00 48.42 ? 1526 HOH A O   1 
HETATM 5020 O  O   . HOH W 10 .   ? 25.508  77.389 36.068 1.00 49.95 ? 1527 HOH A O   1 
HETATM 5021 O  O   . HOH W 10 .   ? 27.012  79.213 37.257 1.00 66.10 ? 1528 HOH A O   1 
HETATM 5022 O  O   . HOH W 10 .   ? 23.638  78.515 46.490 1.00 32.84 ? 1529 HOH A O   1 
HETATM 5023 O  O   . HOH W 10 .   ? 29.975  73.626 46.041 1.00 40.90 ? 1530 HOH A O   1 
HETATM 5024 O  O   . HOH W 10 .   ? 30.044  76.376 44.973 1.00 45.92 ? 1531 HOH A O   1 
HETATM 5025 O  O   . HOH W 10 .   ? 23.176  66.849 47.552 1.00 17.47 ? 1532 HOH A O   1 
HETATM 5026 O  O   . HOH W 10 .   ? 26.438  68.219 41.052 1.00 37.19 ? 1533 HOH A O   1 
HETATM 5027 O  O   . HOH W 10 .   ? 28.040  65.697 42.570 1.00 27.43 ? 1534 HOH A O   1 
HETATM 5028 O  O   . HOH W 10 .   ? 22.220  61.566 41.601 1.00 14.90 ? 1535 HOH A O   1 
HETATM 5029 O  O   . HOH W 10 .   ? 27.686  63.117 45.518 1.00 14.70 ? 1536 HOH A O   1 
HETATM 5030 O  O   . HOH W 10 .   ? 30.299  60.912 42.112 1.00 30.08 ? 1537 HOH A O   1 
HETATM 5031 O  O   . HOH W 10 .   ? 29.870  53.623 47.343 1.00 37.72 ? 1538 HOH A O   1 
HETATM 5032 O  O   . HOH W 10 .   ? 24.641  53.653 41.353 1.00 38.91 ? 1539 HOH A O   1 
HETATM 5033 O  O   . HOH W 10 .   ? 25.177  58.243 40.875 1.00 26.81 ? 1540 HOH A O   1 
HETATM 5034 O  O   . HOH W 10 .   ? 31.173  58.836 49.796 1.00 31.70 ? 1541 HOH A O   1 
HETATM 5035 O  O   . HOH W 10 .   ? 31.458  55.937 48.409 1.00 52.53 ? 1542 HOH A O   1 
HETATM 5036 O  O   . HOH W 10 .   ? 28.034  57.316 41.828 1.00 34.95 ? 1543 HOH A O   1 
HETATM 5037 O  O   . HOH W 10 .   ? 35.338  61.564 46.988 1.00 56.19 ? 1544 HOH A O   1 
HETATM 5038 O  O   . HOH W 10 .   ? 30.103  64.063 43.138 1.00 66.92 ? 1545 HOH A O   1 
HETATM 5039 O  O   . HOH W 10 .   ? 25.216  58.634 52.146 1.00 17.86 ? 1546 HOH A O   1 
HETATM 5040 O  O   . HOH W 10 .   ? 26.138  54.124 52.682 1.00 41.75 ? 1547 HOH A O   1 
HETATM 5041 O  O   . HOH W 10 .   ? 28.349  53.427 50.806 1.00 39.21 ? 1548 HOH A O   1 
HETATM 5042 O  O   . HOH W 10 .   ? 33.552  68.634 43.472 1.00 56.51 ? 1549 HOH A O   1 
HETATM 5043 O  O   . HOH W 10 .   ? 30.157  67.309 42.796 1.00 46.26 ? 1550 HOH A O   1 
HETATM 5044 O  O   . HOH W 10 .   ? 27.376  74.624 57.611 1.00 36.81 ? 1551 HOH A O   1 
HETATM 5045 O  O   . HOH W 10 .   ? 26.637  68.445 59.014 1.00 38.81 ? 1552 HOH A O   1 
HETATM 5046 O  O   . HOH W 10 .   ? 25.882  76.339 55.779 1.00 39.87 ? 1553 HOH A O   1 
HETATM 5047 O  O   . HOH W 10 .   ? 21.969  83.979 61.946 1.00 42.67 ? 1554 HOH A O   1 
HETATM 5048 O  O   . HOH W 10 .   ? 24.277  76.427 62.338 1.00 55.41 ? 1555 HOH A O   1 
HETATM 5049 O  O   . HOH W 10 .   ? 30.171  78.143 56.207 1.00 47.35 ? 1556 HOH A O   1 
HETATM 5050 O  O   . HOH W 10 .   ? 27.718  80.029 49.879 1.00 52.77 ? 1557 HOH A O   1 
HETATM 5051 O  O   . HOH W 10 .   ? 31.950  65.330 55.024 1.00 35.46 ? 1558 HOH A O   1 
HETATM 5052 O  O   . HOH W 10 .   ? 33.777  65.904 52.741 1.00 47.43 ? 1559 HOH A O   1 
HETATM 5053 O  O   . HOH W 10 .   ? 28.839  64.669 57.287 1.00 52.21 ? 1560 HOH A O   1 
HETATM 5054 O  O   . HOH W 10 .   ? 32.177  62.297 55.680 1.00 41.12 ? 1561 HOH A O   1 
HETATM 5055 O  O   . HOH W 10 .   ? 29.858  61.228 58.027 1.00 34.01 ? 1562 HOH A O   1 
HETATM 5056 O  O   . HOH W 10 .   ? 25.080  61.286 52.444 1.00 18.71 ? 1563 HOH A O   1 
HETATM 5057 O  O   . HOH W 10 .   ? 26.517  61.655 67.054 1.00 53.18 ? 1564 HOH A O   1 
HETATM 5058 O  O   . HOH W 10 .   ? 26.739  63.869 58.992 1.00 16.26 ? 1565 HOH A O   1 
HETATM 5059 O  O   . HOH W 10 .   ? 28.881  59.324 61.073 1.00 22.90 ? 1566 HOH A O   1 
HETATM 5060 O  O   . HOH W 10 .   ? 26.636  59.101 62.579 1.00 20.29 ? 1567 HOH A O   1 
HETATM 5061 O  O   . HOH W 10 .   ? 16.173  50.276 62.335 1.00 27.23 ? 1568 HOH A O   1 
HETATM 5062 O  O   . HOH W 10 .   ? 16.094  52.654 58.770 1.00 20.00 ? 1569 HOH A O   1 
HETATM 5063 O  O   . HOH W 10 .   ? 16.470  50.389 56.807 1.00 37.79 ? 1570 HOH A O   1 
HETATM 5064 O  O   . HOH W 10 .   ? 17.814  48.444 55.710 1.00 62.76 ? 1571 HOH A O   1 
HETATM 5065 O  O   . HOH W 10 .   ? 20.950  43.958 57.701 1.00 37.82 ? 1572 HOH A O   1 
HETATM 5066 O  O   . HOH W 10 .   ? 27.150  46.580 57.196 1.00 35.37 ? 1573 HOH A O   1 
HETATM 5067 O  O   . HOH W 10 .   ? 28.459  49.681 54.960 1.00 36.10 ? 1574 HOH A O   1 
HETATM 5068 O  O   . HOH W 10 .   ? 24.103  52.273 55.796 1.00 46.83 ? 1575 HOH A O   1 
HETATM 5069 O  O   . HOH W 10 .   ? 26.455  45.518 59.857 1.00 25.53 ? 1576 HOH A O   1 
HETATM 5070 O  O   . HOH W 10 .   ? 15.038  42.747 61.821 1.00 31.40 ? 1577 HOH A O   1 
HETATM 5071 O  O   . HOH W 10 .   ? 24.248  39.644 56.138 1.00 54.18 ? 1578 HOH A O   1 
HETATM 5072 O  O   . HOH W 10 .   ? 19.932  38.085 60.567 1.00 51.52 ? 1579 HOH A O   1 
HETATM 5073 O  O   . HOH W 10 .   ? 27.958  40.092 57.080 1.00 38.33 ? 1580 HOH A O   1 
HETATM 5074 O  O   . HOH W 10 .   ? 13.256  40.835 63.241 1.00 50.27 ? 1581 HOH A O   1 
HETATM 5075 O  O   . HOH W 10 .   ? 15.847  35.580 58.631 1.00 55.67 ? 1582 HOH A O   1 
HETATM 5076 O  O   . HOH W 10 .   ? 17.064  32.529 66.348 1.00 39.55 ? 1583 HOH A O   1 
HETATM 5077 O  O   . HOH W 10 .   ? 15.071  33.594 67.775 1.00 61.34 ? 1584 HOH A O   1 
HETATM 5078 O  O   . HOH W 10 .   ? 3.009   89.563 73.216 1.00 48.24 ? 1585 HOH A O   1 
HETATM 5079 O  O   . HOH W 10 .   ? 2.759   93.691 71.001 1.00 49.87 ? 1586 HOH A O   1 
HETATM 5080 O  O   . HOH W 10 .   ? 4.712   91.570 73.197 1.00 53.87 ? 1587 HOH A O   1 
HETATM 5081 O  O   . HOH W 10 .   ? 21.875  59.683 38.287 1.00 31.83 ? 1588 HOH A O   1 
HETATM 5082 O  O   . HOH W 10 .   ? 20.064  58.309 32.695 1.00 40.41 ? 1589 HOH A O   1 
HETATM 5083 O  O   . HOH W 10 .   ? 16.135  59.513 32.466 1.00 43.28 ? 1590 HOH A O   1 
HETATM 5084 O  O   . HOH W 10 .   ? 16.963  58.080 29.608 1.00 48.39 ? 1591 HOH A O   1 
HETATM 5085 O  O   . HOH W 10 .   ? 24.836  61.613 34.295 1.00 49.19 ? 1592 HOH A O   1 
HETATM 5086 O  O   . HOH W 10 .   ? 22.900  58.677 33.008 1.00 46.80 ? 1593 HOH A O   1 
HETATM 5087 O  O   . HOH W 10 .   ? -18.641 83.351 43.948 1.00 47.00 ? 1594 HOH A O   1 
HETATM 5088 O  O   . HOH W 10 .   ? -19.198 81.655 54.823 1.00 46.56 ? 1595 HOH A O   1 
HETATM 5089 O  O   . HOH W 10 .   ? -18.284 87.319 54.482 1.00 39.06 ? 1596 HOH A O   1 
HETATM 5090 O  O   . HOH W 10 .   ? -16.139 88.331 52.642 1.00 43.39 ? 1597 HOH A O   1 
HETATM 5091 O  O   . HOH W 10 .   ? -1.704  51.091 73.358 1.00 57.38 ? 1598 HOH A O   1 
HETATM 5092 O  O   . HOH W 10 .   ? -0.288  42.971 69.719 1.00 35.03 ? 1599 HOH A O   1 
HETATM 5093 O  O   . HOH W 10 .   ? -4.726  47.094 75.625 1.00 50.75 ? 1600 HOH A O   1 
HETATM 5094 O  O   . HOH W 10 .   ? 25.714  63.928 35.274 1.00 49.77 ? 1601 HOH A O   1 
HETATM 5095 O  O   . HOH W 10 .   ? -6.036  62.200 74.564 1.00 42.53 ? 1602 HOH A O   1 
HETATM 5096 O  O   . HOH W 10 .   ? 0.951   38.272 49.712 1.00 52.33 ? 1603 HOH A O   1 
HETATM 5097 O  O   . HOH W 10 .   ? -23.399 71.655 28.688 1.00 53.76 ? 1604 HOH A O   1 
HETATM 5098 O  O   . HOH W 10 .   ? 0.334   40.359 47.544 1.00 54.32 ? 1605 HOH A O   1 
HETATM 5099 O  O   . HOH W 10 .   ? 30.985  73.740 41.609 1.00 52.24 ? 1606 HOH A O   1 
HETATM 5100 O  O   . HOH W 10 .   ? -24.239 71.667 31.229 1.00 41.05 ? 1607 HOH A O   1 
HETATM 5101 O  O   . HOH W 10 .   ? 33.188  71.279 43.098 1.00 49.33 ? 1608 HOH A O   1 
HETATM 5102 O  O   . HOH W 10 .   ? 29.800  71.653 43.846 1.00 47.80 ? 1609 HOH A O   1 
HETATM 5103 O  O   . HOH W 10 .   ? -24.607 69.861 33.423 1.00 50.73 ? 1610 HOH A O   1 
HETATM 5104 O  O   . HOH W 10 .   ? -10.368 39.750 61.598 1.00 31.37 ? 1611 HOH A O   1 
HETATM 5105 O  O   . HOH W 10 .   ? 3.053   66.571 64.384 1.00 49.15 ? 1612 HOH A O   1 
HETATM 5106 O  O   . HOH W 10 .   ? 5.468   66.004 65.520 1.00 33.54 ? 1613 HOH A O   1 
HETATM 5107 O  O   . HOH W 10 .   ? -8.843  84.215 53.202 1.00 38.82 ? 1614 HOH A O   1 
HETATM 5108 O  O   . HOH W 10 .   ? 6.606   81.727 64.613 1.00 45.70 ? 1615 HOH A O   1 
HETATM 5109 O  O   . HOH W 10 .   ? 2.228   79.246 62.742 1.00 40.11 ? 1616 HOH A O   1 
HETATM 5110 O  O   . HOH W 10 .   ? 24.067  70.264 69.689 1.00 49.61 ? 1617 HOH A O   1 
HETATM 5111 O  O   . HOH W 10 .   ? 21.457  66.150 70.001 1.00 53.54 ? 1618 HOH A O   1 
HETATM 5112 O  O   . HOH W 10 .   ? 24.381  74.478 73.214 1.00 47.05 ? 1619 HOH A O   1 
HETATM 5113 O  O   . HOH W 10 .   ? 21.653  66.815 28.327 1.00 55.34 ? 1620 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3  NAG 1   2536 2536 NAG NAG A . 
D 3  NAG 1   2538 2538 NAG NAG A . 
E 4  CL  1   2539 2539 CL  CL  A . 
F 5  GB  1   2540 2540 GB  GB  A . 
G 6  MES 1   2541 2541 MES MES A . 
H 7  PG4 1   2542 2542 PG4 PG4 A . 
I 8  PGE 1   2543 2543 PGE PGE A . 
J 8  PGE 1   2544 2544 PGE PGE A . 
K 8  PGE 1   2545 2545 PGE PGE A . 
L 8  PGE 1   2546 2546 PGE PGE A . 
M 9  PEG 1   2547 2547 PEG PEG A . 
N 9  PEG 1   2548 2548 PEG PEG A . 
O 9  PEG 1   2549 2549 PEG PEG A . 
P 9  PEG 1   2550 2550 PEG PEG A . 
Q 9  PEG 1   2551 2551 PEG PEG A . 
R 9  PEG 1   2552 2552 PEG PEG A . 
S 9  PEG 1   2553 2553 PEG PEG A . 
T 9  PEG 1   2554 2554 PEG PEG A . 
U 9  PEG 1   2555 2555 PEG PEG A . 
V 9  PEG 1   2556 2556 PEG PEG A . 
W 10 HOH 1   1001 1001 HOH HOH A . 
W 10 HOH 2   1002 1002 HOH HOH A . 
W 10 HOH 3   1003 1003 HOH HOH A . 
W 10 HOH 4   1004 1004 HOH HOH A . 
W 10 HOH 5   1005 1005 HOH HOH A . 
W 10 HOH 6   1006 1006 HOH HOH A . 
W 10 HOH 7   1007 1007 HOH HOH A . 
W 10 HOH 8   1008 1008 HOH HOH A . 
W 10 HOH 9   1009 1009 HOH HOH A . 
W 10 HOH 10  1010 1010 HOH HOH A . 
W 10 HOH 11  1011 1011 HOH HOH A . 
W 10 HOH 12  1012 1012 HOH HOH A . 
W 10 HOH 13  1013 1013 HOH HOH A . 
W 10 HOH 14  1014 1014 HOH HOH A . 
W 10 HOH 15  1015 1015 HOH HOH A . 
W 10 HOH 16  1016 1016 HOH HOH A . 
W 10 HOH 17  1017 1017 HOH HOH A . 
W 10 HOH 18  1018 1018 HOH HOH A . 
W 10 HOH 19  1019 1019 HOH HOH A . 
W 10 HOH 20  1020 1020 HOH HOH A . 
W 10 HOH 21  1021 1021 HOH HOH A . 
W 10 HOH 22  1022 1022 HOH HOH A . 
W 10 HOH 23  1023 1023 HOH HOH A . 
W 10 HOH 24  1024 1024 HOH HOH A . 
W 10 HOH 25  1025 1025 HOH HOH A . 
W 10 HOH 26  1026 1026 HOH HOH A . 
W 10 HOH 27  1027 1027 HOH HOH A . 
W 10 HOH 28  1028 1028 HOH HOH A . 
W 10 HOH 29  1029 1029 HOH HOH A . 
W 10 HOH 30  1030 1030 HOH HOH A . 
W 10 HOH 31  1031 1031 HOH HOH A . 
W 10 HOH 32  1032 1032 HOH HOH A . 
W 10 HOH 33  1033 1033 HOH HOH A . 
W 10 HOH 34  1034 1034 HOH HOH A . 
W 10 HOH 35  1035 1035 HOH HOH A . 
W 10 HOH 36  1036 1036 HOH HOH A . 
W 10 HOH 37  1037 1037 HOH HOH A . 
W 10 HOH 38  1038 1038 HOH HOH A . 
W 10 HOH 39  1039 1039 HOH HOH A . 
W 10 HOH 40  1040 1040 HOH HOH A . 
W 10 HOH 41  1041 1041 HOH HOH A . 
W 10 HOH 42  1042 1042 HOH HOH A . 
W 10 HOH 43  1043 1043 HOH HOH A . 
W 10 HOH 44  1044 1044 HOH HOH A . 
W 10 HOH 45  1045 1045 HOH HOH A . 
W 10 HOH 46  1046 1046 HOH HOH A . 
W 10 HOH 47  1047 1047 HOH HOH A . 
W 10 HOH 48  1048 1048 HOH HOH A . 
W 10 HOH 49  1049 1049 HOH HOH A . 
W 10 HOH 50  1050 1050 HOH HOH A . 
W 10 HOH 51  1051 1051 HOH HOH A . 
W 10 HOH 52  1052 1052 HOH HOH A . 
W 10 HOH 53  1053 1053 HOH HOH A . 
W 10 HOH 54  1054 1054 HOH HOH A . 
W 10 HOH 55  1055 1055 HOH HOH A . 
W 10 HOH 56  1056 1056 HOH HOH A . 
W 10 HOH 57  1057 1057 HOH HOH A . 
W 10 HOH 58  1058 1058 HOH HOH A . 
W 10 HOH 59  1059 1059 HOH HOH A . 
W 10 HOH 60  1060 1060 HOH HOH A . 
W 10 HOH 61  1061 1061 HOH HOH A . 
W 10 HOH 62  1062 1062 HOH HOH A . 
W 10 HOH 63  1063 1063 HOH HOH A . 
W 10 HOH 64  1064 1064 HOH HOH A . 
W 10 HOH 65  1065 1065 HOH HOH A . 
W 10 HOH 66  1066 1066 HOH HOH A . 
W 10 HOH 67  1067 1067 HOH HOH A . 
W 10 HOH 68  1068 1068 HOH HOH A . 
W 10 HOH 69  1069 1069 HOH HOH A . 
W 10 HOH 70  1070 1070 HOH HOH A . 
W 10 HOH 71  1071 1071 HOH HOH A . 
W 10 HOH 72  1072 1072 HOH HOH A . 
W 10 HOH 73  1073 1073 HOH HOH A . 
W 10 HOH 74  1074 1074 HOH HOH A . 
W 10 HOH 75  1075 1075 HOH HOH A . 
W 10 HOH 76  1076 1076 HOH HOH A . 
W 10 HOH 77  1077 1077 HOH HOH A . 
W 10 HOH 78  1078 1078 HOH HOH A . 
W 10 HOH 79  1079 1079 HOH HOH A . 
W 10 HOH 80  1080 1080 HOH HOH A . 
W 10 HOH 81  1081 1081 HOH HOH A . 
W 10 HOH 82  1082 1082 HOH HOH A . 
W 10 HOH 83  1083 1083 HOH HOH A . 
W 10 HOH 84  1084 1084 HOH HOH A . 
W 10 HOH 85  1085 1085 HOH HOH A . 
W 10 HOH 86  1086 1086 HOH HOH A . 
W 10 HOH 87  1087 1087 HOH HOH A . 
W 10 HOH 88  1088 1088 HOH HOH A . 
W 10 HOH 89  1089 1089 HOH HOH A . 
W 10 HOH 90  1090 1090 HOH HOH A . 
W 10 HOH 91  1091 1091 HOH HOH A . 
W 10 HOH 92  1092 1092 HOH HOH A . 
W 10 HOH 93  1093 1093 HOH HOH A . 
W 10 HOH 94  1094 1094 HOH HOH A . 
W 10 HOH 95  1095 1095 HOH HOH A . 
W 10 HOH 96  1096 1096 HOH HOH A . 
W 10 HOH 97  1097 1097 HOH HOH A . 
W 10 HOH 98  1098 1098 HOH HOH A . 
W 10 HOH 99  1099 1099 HOH HOH A . 
W 10 HOH 100 1100 1100 HOH HOH A . 
W 10 HOH 101 1101 1101 HOH HOH A . 
W 10 HOH 102 1102 1102 HOH HOH A . 
W 10 HOH 103 1103 1103 HOH HOH A . 
W 10 HOH 104 1104 1104 HOH HOH A . 
W 10 HOH 105 1105 1105 HOH HOH A . 
W 10 HOH 106 1106 1106 HOH HOH A . 
W 10 HOH 107 1107 1107 HOH HOH A . 
W 10 HOH 108 1108 1108 HOH HOH A . 
W 10 HOH 109 1109 1109 HOH HOH A . 
W 10 HOH 110 1110 1110 HOH HOH A . 
W 10 HOH 111 1111 1111 HOH HOH A . 
W 10 HOH 112 1112 1112 HOH HOH A . 
W 10 HOH 113 1113 1113 HOH HOH A . 
W 10 HOH 114 1114 1114 HOH HOH A . 
W 10 HOH 115 1115 1115 HOH HOH A . 
W 10 HOH 116 1116 1116 HOH HOH A . 
W 10 HOH 117 1117 1117 HOH HOH A . 
W 10 HOH 118 1118 1118 HOH HOH A . 
W 10 HOH 119 1119 1119 HOH HOH A . 
W 10 HOH 120 1120 1120 HOH HOH A . 
W 10 HOH 121 1121 1121 HOH HOH A . 
W 10 HOH 122 1122 1122 HOH HOH A . 
W 10 HOH 123 1123 1123 HOH HOH A . 
W 10 HOH 124 1124 1124 HOH HOH A . 
W 10 HOH 125 1125 1125 HOH HOH A . 
W 10 HOH 126 1126 1126 HOH HOH A . 
W 10 HOH 127 1127 1127 HOH HOH A . 
W 10 HOH 128 1128 1128 HOH HOH A . 
W 10 HOH 129 1129 1129 HOH HOH A . 
W 10 HOH 130 1130 1130 HOH HOH A . 
W 10 HOH 131 1131 1131 HOH HOH A . 
W 10 HOH 132 1132 1132 HOH HOH A . 
W 10 HOH 133 1133 1133 HOH HOH A . 
W 10 HOH 134 1134 1134 HOH HOH A . 
W 10 HOH 135 1135 1135 HOH HOH A . 
W 10 HOH 136 1136 1136 HOH HOH A . 
W 10 HOH 137 1137 1137 HOH HOH A . 
W 10 HOH 138 1138 1138 HOH HOH A . 
W 10 HOH 139 1139 1139 HOH HOH A . 
W 10 HOH 140 1140 1140 HOH HOH A . 
W 10 HOH 141 1141 1141 HOH HOH A . 
W 10 HOH 142 1142 1142 HOH HOH A . 
W 10 HOH 143 1143 1143 HOH HOH A . 
W 10 HOH 144 1144 1144 HOH HOH A . 
W 10 HOH 145 1145 1145 HOH HOH A . 
W 10 HOH 146 1146 1146 HOH HOH A . 
W 10 HOH 147 1147 1147 HOH HOH A . 
W 10 HOH 148 1148 1148 HOH HOH A . 
W 10 HOH 149 1149 1149 HOH HOH A . 
W 10 HOH 150 1150 1150 HOH HOH A . 
W 10 HOH 151 1151 1151 HOH HOH A . 
W 10 HOH 152 1152 1152 HOH HOH A . 
W 10 HOH 153 1153 1153 HOH HOH A . 
W 10 HOH 154 1154 1154 HOH HOH A . 
W 10 HOH 155 1155 1155 HOH HOH A . 
W 10 HOH 156 1156 1156 HOH HOH A . 
W 10 HOH 157 1157 1157 HOH HOH A . 
W 10 HOH 158 1158 1158 HOH HOH A . 
W 10 HOH 159 1159 1159 HOH HOH A . 
W 10 HOH 160 1160 1160 HOH HOH A . 
W 10 HOH 161 1161 1161 HOH HOH A . 
W 10 HOH 162 1162 1162 HOH HOH A . 
W 10 HOH 163 1163 1163 HOH HOH A . 
W 10 HOH 164 1164 1164 HOH HOH A . 
W 10 HOH 165 1165 1165 HOH HOH A . 
W 10 HOH 166 1166 1166 HOH HOH A . 
W 10 HOH 167 1167 1167 HOH HOH A . 
W 10 HOH 168 1168 1168 HOH HOH A . 
W 10 HOH 169 1169 1169 HOH HOH A . 
W 10 HOH 170 1170 1170 HOH HOH A . 
W 10 HOH 171 1171 1171 HOH HOH A . 
W 10 HOH 172 1172 1172 HOH HOH A . 
W 10 HOH 173 1173 1173 HOH HOH A . 
W 10 HOH 174 1174 1174 HOH HOH A . 
W 10 HOH 175 1175 1175 HOH HOH A . 
W 10 HOH 176 1176 1176 HOH HOH A . 
W 10 HOH 177 1177 1177 HOH HOH A . 
W 10 HOH 178 1178 1178 HOH HOH A . 
W 10 HOH 179 1179 1179 HOH HOH A . 
W 10 HOH 180 1180 1180 HOH HOH A . 
W 10 HOH 181 1181 1181 HOH HOH A . 
W 10 HOH 182 1182 1182 HOH HOH A . 
W 10 HOH 183 1183 1183 HOH HOH A . 
W 10 HOH 184 1184 1184 HOH HOH A . 
W 10 HOH 185 1185 1185 HOH HOH A . 
W 10 HOH 186 1186 1186 HOH HOH A . 
W 10 HOH 187 1187 1187 HOH HOH A . 
W 10 HOH 188 1188 1188 HOH HOH A . 
W 10 HOH 189 1189 1189 HOH HOH A . 
W 10 HOH 190 1190 1190 HOH HOH A . 
W 10 HOH 191 1191 1191 HOH HOH A . 
W 10 HOH 192 1192 1192 HOH HOH A . 
W 10 HOH 193 1193 1193 HOH HOH A . 
W 10 HOH 194 1194 1194 HOH HOH A . 
W 10 HOH 195 1195 1195 HOH HOH A . 
W 10 HOH 196 1196 1196 HOH HOH A . 
W 10 HOH 197 1197 1197 HOH HOH A . 
W 10 HOH 198 1198 1198 HOH HOH A . 
W 10 HOH 199 1199 1199 HOH HOH A . 
W 10 HOH 200 1200 1200 HOH HOH A . 
W 10 HOH 201 1201 1201 HOH HOH A . 
W 10 HOH 202 1202 1202 HOH HOH A . 
W 10 HOH 203 1203 1203 HOH HOH A . 
W 10 HOH 204 1204 1204 HOH HOH A . 
W 10 HOH 205 1205 1205 HOH HOH A . 
W 10 HOH 206 1206 1206 HOH HOH A . 
W 10 HOH 207 1207 1207 HOH HOH A . 
W 10 HOH 208 1208 1208 HOH HOH A . 
W 10 HOH 209 1209 1209 HOH HOH A . 
W 10 HOH 210 1210 1210 HOH HOH A . 
W 10 HOH 211 1211 1211 HOH HOH A . 
W 10 HOH 212 1212 1212 HOH HOH A . 
W 10 HOH 213 1213 1213 HOH HOH A . 
W 10 HOH 214 1214 1214 HOH HOH A . 
W 10 HOH 215 1215 1215 HOH HOH A . 
W 10 HOH 216 1216 1216 HOH HOH A . 
W 10 HOH 217 1217 1217 HOH HOH A . 
W 10 HOH 218 1218 1218 HOH HOH A . 
W 10 HOH 219 1219 1219 HOH HOH A . 
W 10 HOH 220 1220 1220 HOH HOH A . 
W 10 HOH 221 1221 1221 HOH HOH A . 
W 10 HOH 222 1222 1222 HOH HOH A . 
W 10 HOH 223 1223 1223 HOH HOH A . 
W 10 HOH 224 1224 1224 HOH HOH A . 
W 10 HOH 225 1225 1225 HOH HOH A . 
W 10 HOH 226 1226 1226 HOH HOH A . 
W 10 HOH 227 1227 1227 HOH HOH A . 
W 10 HOH 228 1228 1228 HOH HOH A . 
W 10 HOH 229 1229 1229 HOH HOH A . 
W 10 HOH 230 1230 1230 HOH HOH A . 
W 10 HOH 231 1231 1231 HOH HOH A . 
W 10 HOH 232 1232 1232 HOH HOH A . 
W 10 HOH 233 1233 1233 HOH HOH A . 
W 10 HOH 234 1234 1234 HOH HOH A . 
W 10 HOH 235 1235 1235 HOH HOH A . 
W 10 HOH 236 1236 1236 HOH HOH A . 
W 10 HOH 237 1237 1237 HOH HOH A . 
W 10 HOH 238 1238 1238 HOH HOH A . 
W 10 HOH 239 1239 1239 HOH HOH A . 
W 10 HOH 240 1240 1240 HOH HOH A . 
W 10 HOH 241 1241 1241 HOH HOH A . 
W 10 HOH 242 1242 1242 HOH HOH A . 
W 10 HOH 243 1243 1243 HOH HOH A . 
W 10 HOH 244 1244 1244 HOH HOH A . 
W 10 HOH 245 1245 1245 HOH HOH A . 
W 10 HOH 246 1246 1246 HOH HOH A . 
W 10 HOH 247 1247 1247 HOH HOH A . 
W 10 HOH 248 1248 1248 HOH HOH A . 
W 10 HOH 249 1249 1249 HOH HOH A . 
W 10 HOH 250 1250 1250 HOH HOH A . 
W 10 HOH 251 1251 1251 HOH HOH A . 
W 10 HOH 252 1252 1252 HOH HOH A . 
W 10 HOH 253 1253 1253 HOH HOH A . 
W 10 HOH 254 1254 1254 HOH HOH A . 
W 10 HOH 255 1255 1255 HOH HOH A . 
W 10 HOH 256 1256 1256 HOH HOH A . 
W 10 HOH 257 1257 1257 HOH HOH A . 
W 10 HOH 258 1258 1258 HOH HOH A . 
W 10 HOH 259 1259 1259 HOH HOH A . 
W 10 HOH 260 1260 1260 HOH HOH A . 
W 10 HOH 261 1261 1261 HOH HOH A . 
W 10 HOH 262 1262 1262 HOH HOH A . 
W 10 HOH 263 1263 1263 HOH HOH A . 
W 10 HOH 264 1264 1264 HOH HOH A . 
W 10 HOH 265 1265 1265 HOH HOH A . 
W 10 HOH 266 1266 1266 HOH HOH A . 
W 10 HOH 267 1267 1267 HOH HOH A . 
W 10 HOH 268 1268 1268 HOH HOH A . 
W 10 HOH 269 1269 1269 HOH HOH A . 
W 10 HOH 270 1270 1270 HOH HOH A . 
W 10 HOH 271 1271 1271 HOH HOH A . 
W 10 HOH 272 1272 1272 HOH HOH A . 
W 10 HOH 273 1273 1273 HOH HOH A . 
W 10 HOH 274 1274 1274 HOH HOH A . 
W 10 HOH 275 1275 1275 HOH HOH A . 
W 10 HOH 276 1276 1276 HOH HOH A . 
W 10 HOH 277 1277 1277 HOH HOH A . 
W 10 HOH 278 1278 1278 HOH HOH A . 
W 10 HOH 279 1279 1279 HOH HOH A . 
W 10 HOH 280 1280 1280 HOH HOH A . 
W 10 HOH 281 1281 1281 HOH HOH A . 
W 10 HOH 282 1282 1282 HOH HOH A . 
W 10 HOH 283 1283 1283 HOH HOH A . 
W 10 HOH 284 1284 1284 HOH HOH A . 
W 10 HOH 285 1285 1285 HOH HOH A . 
W 10 HOH 286 1286 1286 HOH HOH A . 
W 10 HOH 287 1287 1287 HOH HOH A . 
W 10 HOH 288 1288 1288 HOH HOH A . 
W 10 HOH 289 1289 1289 HOH HOH A . 
W 10 HOH 290 1290 1290 HOH HOH A . 
W 10 HOH 291 1291 1291 HOH HOH A . 
W 10 HOH 292 1292 1292 HOH HOH A . 
W 10 HOH 293 1293 1293 HOH HOH A . 
W 10 HOH 294 1294 1294 HOH HOH A . 
W 10 HOH 295 1295 1295 HOH HOH A . 
W 10 HOH 296 1296 1296 HOH HOH A . 
W 10 HOH 297 1297 1297 HOH HOH A . 
W 10 HOH 298 1298 1298 HOH HOH A . 
W 10 HOH 299 1299 1299 HOH HOH A . 
W 10 HOH 300 1300 1300 HOH HOH A . 
W 10 HOH 301 1301 1301 HOH HOH A . 
W 10 HOH 302 1302 1302 HOH HOH A . 
W 10 HOH 303 1303 1303 HOH HOH A . 
W 10 HOH 304 1304 1304 HOH HOH A . 
W 10 HOH 305 1305 1305 HOH HOH A . 
W 10 HOH 306 1306 1306 HOH HOH A . 
W 10 HOH 307 1307 1307 HOH HOH A . 
W 10 HOH 308 1308 1308 HOH HOH A . 
W 10 HOH 309 1309 1309 HOH HOH A . 
W 10 HOH 310 1310 1310 HOH HOH A . 
W 10 HOH 311 1311 1311 HOH HOH A . 
W 10 HOH 312 1312 1312 HOH HOH A . 
W 10 HOH 313 1313 1313 HOH HOH A . 
W 10 HOH 314 1314 1314 HOH HOH A . 
W 10 HOH 315 1315 1315 HOH HOH A . 
W 10 HOH 316 1316 1316 HOH HOH A . 
W 10 HOH 317 1317 1317 HOH HOH A . 
W 10 HOH 318 1318 1318 HOH HOH A . 
W 10 HOH 319 1319 1319 HOH HOH A . 
W 10 HOH 320 1320 1320 HOH HOH A . 
W 10 HOH 321 1321 1321 HOH HOH A . 
W 10 HOH 322 1322 1322 HOH HOH A . 
W 10 HOH 323 1323 1323 HOH HOH A . 
W 10 HOH 324 1324 1324 HOH HOH A . 
W 10 HOH 325 1325 1325 HOH HOH A . 
W 10 HOH 326 1326 1326 HOH HOH A . 
W 10 HOH 327 1327 1327 HOH HOH A . 
W 10 HOH 328 1328 1328 HOH HOH A . 
W 10 HOH 329 1329 1329 HOH HOH A . 
W 10 HOH 330 1330 1330 HOH HOH A . 
W 10 HOH 331 1331 1331 HOH HOH A . 
W 10 HOH 332 1332 1332 HOH HOH A . 
W 10 HOH 333 1333 1333 HOH HOH A . 
W 10 HOH 334 1334 1334 HOH HOH A . 
W 10 HOH 335 1335 1335 HOH HOH A . 
W 10 HOH 336 1336 1336 HOH HOH A . 
W 10 HOH 337 1337 1337 HOH HOH A . 
W 10 HOH 338 1338 1338 HOH HOH A . 
W 10 HOH 339 1339 1339 HOH HOH A . 
W 10 HOH 340 1340 1340 HOH HOH A . 
W 10 HOH 341 1341 1341 HOH HOH A . 
W 10 HOH 342 1342 1342 HOH HOH A . 
W 10 HOH 343 1343 1343 HOH HOH A . 
W 10 HOH 344 1344 1344 HOH HOH A . 
W 10 HOH 345 1345 1345 HOH HOH A . 
W 10 HOH 346 1346 1346 HOH HOH A . 
W 10 HOH 347 1347 1347 HOH HOH A . 
W 10 HOH 348 1348 1348 HOH HOH A . 
W 10 HOH 349 1349 1349 HOH HOH A . 
W 10 HOH 350 1350 1350 HOH HOH A . 
W 10 HOH 351 1351 1351 HOH HOH A . 
W 10 HOH 352 1352 1352 HOH HOH A . 
W 10 HOH 353 1353 1353 HOH HOH A . 
W 10 HOH 354 1354 1354 HOH HOH A . 
W 10 HOH 355 1355 1355 HOH HOH A . 
W 10 HOH 356 1356 1356 HOH HOH A . 
W 10 HOH 357 1357 1357 HOH HOH A . 
W 10 HOH 358 1358 1358 HOH HOH A . 
W 10 HOH 359 1359 1359 HOH HOH A . 
W 10 HOH 360 1360 1360 HOH HOH A . 
W 10 HOH 361 1361 1361 HOH HOH A . 
W 10 HOH 362 1362 1362 HOH HOH A . 
W 10 HOH 363 1363 1363 HOH HOH A . 
W 10 HOH 364 1364 1364 HOH HOH A . 
W 10 HOH 365 1365 1365 HOH HOH A . 
W 10 HOH 366 1366 1366 HOH HOH A . 
W 10 HOH 367 1367 1367 HOH HOH A . 
W 10 HOH 368 1368 1368 HOH HOH A . 
W 10 HOH 369 1369 1369 HOH HOH A . 
W 10 HOH 370 1370 1370 HOH HOH A . 
W 10 HOH 371 1371 1371 HOH HOH A . 
W 10 HOH 372 1372 1372 HOH HOH A . 
W 10 HOH 373 1373 1373 HOH HOH A . 
W 10 HOH 374 1374 1374 HOH HOH A . 
W 10 HOH 375 1375 1375 HOH HOH A . 
W 10 HOH 376 1376 1376 HOH HOH A . 
W 10 HOH 377 1377 1377 HOH HOH A . 
W 10 HOH 378 1378 1378 HOH HOH A . 
W 10 HOH 379 1379 1379 HOH HOH A . 
W 10 HOH 380 1380 1380 HOH HOH A . 
W 10 HOH 381 1381 1381 HOH HOH A . 
W 10 HOH 382 1382 1382 HOH HOH A . 
W 10 HOH 383 1383 1383 HOH HOH A . 
W 10 HOH 384 1384 1384 HOH HOH A . 
W 10 HOH 385 1385 1385 HOH HOH A . 
W 10 HOH 386 1386 1386 HOH HOH A . 
W 10 HOH 387 1387 1387 HOH HOH A . 
W 10 HOH 388 1388 1388 HOH HOH A . 
W 10 HOH 389 1389 1389 HOH HOH A . 
W 10 HOH 390 1390 1390 HOH HOH A . 
W 10 HOH 391 1391 1391 HOH HOH A . 
W 10 HOH 392 1392 1392 HOH HOH A . 
W 10 HOH 393 1393 1393 HOH HOH A . 
W 10 HOH 394 1394 1394 HOH HOH A . 
W 10 HOH 395 1395 1395 HOH HOH A . 
W 10 HOH 396 1396 1396 HOH HOH A . 
W 10 HOH 397 1397 1397 HOH HOH A . 
W 10 HOH 398 1398 1398 HOH HOH A . 
W 10 HOH 399 1399 1399 HOH HOH A . 
W 10 HOH 400 1400 1400 HOH HOH A . 
W 10 HOH 401 1401 1401 HOH HOH A . 
W 10 HOH 402 1402 1402 HOH HOH A . 
W 10 HOH 403 1403 1403 HOH HOH A . 
W 10 HOH 404 1404 1404 HOH HOH A . 
W 10 HOH 405 1405 1405 HOH HOH A . 
W 10 HOH 406 1406 1406 HOH HOH A . 
W 10 HOH 407 1407 1407 HOH HOH A . 
W 10 HOH 408 1408 1408 HOH HOH A . 
W 10 HOH 409 1409 1409 HOH HOH A . 
W 10 HOH 410 1410 1410 HOH HOH A . 
W 10 HOH 411 1411 1411 HOH HOH A . 
W 10 HOH 412 1412 1412 HOH HOH A . 
W 10 HOH 413 1413 1413 HOH HOH A . 
W 10 HOH 414 1414 1414 HOH HOH A . 
W 10 HOH 415 1415 1415 HOH HOH A . 
W 10 HOH 416 1416 1416 HOH HOH A . 
W 10 HOH 417 1417 1417 HOH HOH A . 
W 10 HOH 418 1418 1418 HOH HOH A . 
W 10 HOH 419 1419 1419 HOH HOH A . 
W 10 HOH 420 1420 1420 HOH HOH A . 
W 10 HOH 421 1421 1421 HOH HOH A . 
W 10 HOH 422 1422 1422 HOH HOH A . 
W 10 HOH 423 1423 1423 HOH HOH A . 
W 10 HOH 424 1424 1424 HOH HOH A . 
W 10 HOH 425 1425 1425 HOH HOH A . 
W 10 HOH 426 1426 1426 HOH HOH A . 
W 10 HOH 427 1427 1427 HOH HOH A . 
W 10 HOH 428 1428 1428 HOH HOH A . 
W 10 HOH 429 1429 1429 HOH HOH A . 
W 10 HOH 430 1430 1430 HOH HOH A . 
W 10 HOH 431 1431 1431 HOH HOH A . 
W 10 HOH 432 1432 1432 HOH HOH A . 
W 10 HOH 433 1433 1433 HOH HOH A . 
W 10 HOH 434 1434 1434 HOH HOH A . 
W 10 HOH 435 1435 1435 HOH HOH A . 
W 10 HOH 436 1436 1436 HOH HOH A . 
W 10 HOH 437 1437 1437 HOH HOH A . 
W 10 HOH 438 1438 1438 HOH HOH A . 
W 10 HOH 439 1439 1439 HOH HOH A . 
W 10 HOH 440 1440 1440 HOH HOH A . 
W 10 HOH 441 1441 1441 HOH HOH A . 
W 10 HOH 442 1442 1442 HOH HOH A . 
W 10 HOH 443 1443 1443 HOH HOH A . 
W 10 HOH 444 1444 1444 HOH HOH A . 
W 10 HOH 445 1445 1445 HOH HOH A . 
W 10 HOH 446 1446 1446 HOH HOH A . 
W 10 HOH 447 1447 1447 HOH HOH A . 
W 10 HOH 448 1448 1448 HOH HOH A . 
W 10 HOH 449 1449 1449 HOH HOH A . 
W 10 HOH 450 1450 1450 HOH HOH A . 
W 10 HOH 451 1451 1451 HOH HOH A . 
W 10 HOH 452 1452 1452 HOH HOH A . 
W 10 HOH 453 1453 1453 HOH HOH A . 
W 10 HOH 454 1454 1454 HOH HOH A . 
W 10 HOH 455 1455 1455 HOH HOH A . 
W 10 HOH 456 1456 1456 HOH HOH A . 
W 10 HOH 457 1457 1457 HOH HOH A . 
W 10 HOH 458 1458 1458 HOH HOH A . 
W 10 HOH 459 1459 1459 HOH HOH A . 
W 10 HOH 460 1460 1460 HOH HOH A . 
W 10 HOH 461 1461 1461 HOH HOH A . 
W 10 HOH 462 1462 1462 HOH HOH A . 
W 10 HOH 463 1463 1463 HOH HOH A . 
W 10 HOH 464 1464 1464 HOH HOH A . 
W 10 HOH 465 1465 1465 HOH HOH A . 
W 10 HOH 466 1466 1466 HOH HOH A . 
W 10 HOH 467 1467 1467 HOH HOH A . 
W 10 HOH 468 1468 1468 HOH HOH A . 
W 10 HOH 469 1469 1469 HOH HOH A . 
W 10 HOH 470 1470 1470 HOH HOH A . 
W 10 HOH 471 1471 1471 HOH HOH A . 
W 10 HOH 472 1472 1472 HOH HOH A . 
W 10 HOH 473 1473 1473 HOH HOH A . 
W 10 HOH 474 1474 1474 HOH HOH A . 
W 10 HOH 475 1475 1475 HOH HOH A . 
W 10 HOH 476 1476 1476 HOH HOH A . 
W 10 HOH 477 1477 1477 HOH HOH A . 
W 10 HOH 478 1478 1478 HOH HOH A . 
W 10 HOH 479 1479 1479 HOH HOH A . 
W 10 HOH 480 1480 1480 HOH HOH A . 
W 10 HOH 481 1481 1481 HOH HOH A . 
W 10 HOH 482 1482 1482 HOH HOH A . 
W 10 HOH 483 1483 1483 HOH HOH A . 
W 10 HOH 484 1484 1484 HOH HOH A . 
W 10 HOH 485 1485 1485 HOH HOH A . 
W 10 HOH 486 1486 1486 HOH HOH A . 
W 10 HOH 487 1487 1487 HOH HOH A . 
W 10 HOH 488 1488 1488 HOH HOH A . 
W 10 HOH 489 1489 1489 HOH HOH A . 
W 10 HOH 490 1490 1490 HOH HOH A . 
W 10 HOH 491 1491 1491 HOH HOH A . 
W 10 HOH 492 1492 1492 HOH HOH A . 
W 10 HOH 493 1493 1493 HOH HOH A . 
W 10 HOH 494 1494 1494 HOH HOH A . 
W 10 HOH 495 1495 1495 HOH HOH A . 
W 10 HOH 496 1496 1496 HOH HOH A . 
W 10 HOH 497 1497 1497 HOH HOH A . 
W 10 HOH 498 1498 1498 HOH HOH A . 
W 10 HOH 499 1499 1499 HOH HOH A . 
W 10 HOH 500 1500 1500 HOH HOH A . 
W 10 HOH 501 1501 1501 HOH HOH A . 
W 10 HOH 502 1502 1502 HOH HOH A . 
W 10 HOH 503 1503 1503 HOH HOH A . 
W 10 HOH 504 1504 1504 HOH HOH A . 
W 10 HOH 505 1505 1505 HOH HOH A . 
W 10 HOH 506 1506 1506 HOH HOH A . 
W 10 HOH 507 1507 1507 HOH HOH A . 
W 10 HOH 508 1508 1508 HOH HOH A . 
W 10 HOH 509 1509 1509 HOH HOH A . 
W 10 HOH 510 1510 1510 HOH HOH A . 
W 10 HOH 511 1511 1511 HOH HOH A . 
W 10 HOH 512 1512 1512 HOH HOH A . 
W 10 HOH 513 1513 1513 HOH HOH A . 
W 10 HOH 514 1514 1514 HOH HOH A . 
W 10 HOH 515 1515 1515 HOH HOH A . 
W 10 HOH 516 1516 1516 HOH HOH A . 
W 10 HOH 517 1517 1517 HOH HOH A . 
W 10 HOH 518 1518 1518 HOH HOH A . 
W 10 HOH 519 1519 1519 HOH HOH A . 
W 10 HOH 520 1520 1520 HOH HOH A . 
W 10 HOH 521 1521 1521 HOH HOH A . 
W 10 HOH 522 1522 1522 HOH HOH A . 
W 10 HOH 523 1523 1523 HOH HOH A . 
W 10 HOH 524 1524 1524 HOH HOH A . 
W 10 HOH 525 1525 1525 HOH HOH A . 
W 10 HOH 526 1526 1526 HOH HOH A . 
W 10 HOH 527 1527 1527 HOH HOH A . 
W 10 HOH 528 1528 1528 HOH HOH A . 
W 10 HOH 529 1529 1529 HOH HOH A . 
W 10 HOH 530 1530 1530 HOH HOH A . 
W 10 HOH 531 1531 1531 HOH HOH A . 
W 10 HOH 532 1532 1532 HOH HOH A . 
W 10 HOH 533 1533 1533 HOH HOH A . 
W 10 HOH 534 1534 1534 HOH HOH A . 
W 10 HOH 535 1535 1535 HOH HOH A . 
W 10 HOH 536 1536 1536 HOH HOH A . 
W 10 HOH 537 1537 1537 HOH HOH A . 
W 10 HOH 538 1538 1538 HOH HOH A . 
W 10 HOH 539 1539 1539 HOH HOH A . 
W 10 HOH 540 1540 1540 HOH HOH A . 
W 10 HOH 541 1541 1541 HOH HOH A . 
W 10 HOH 542 1542 1542 HOH HOH A . 
W 10 HOH 543 1543 1543 HOH HOH A . 
W 10 HOH 544 1544 1544 HOH HOH A . 
W 10 HOH 545 1545 1545 HOH HOH A . 
W 10 HOH 546 1546 1546 HOH HOH A . 
W 10 HOH 547 1547 1547 HOH HOH A . 
W 10 HOH 548 1548 1548 HOH HOH A . 
W 10 HOH 549 1549 1549 HOH HOH A . 
W 10 HOH 550 1550 1550 HOH HOH A . 
W 10 HOH 551 1551 1551 HOH HOH A . 
W 10 HOH 552 1552 1552 HOH HOH A . 
W 10 HOH 553 1553 1553 HOH HOH A . 
W 10 HOH 554 1554 1554 HOH HOH A . 
W 10 HOH 555 1555 1555 HOH HOH A . 
W 10 HOH 556 1556 1556 HOH HOH A . 
W 10 HOH 557 1557 1557 HOH HOH A . 
W 10 HOH 558 1558 1558 HOH HOH A . 
W 10 HOH 559 1559 1559 HOH HOH A . 
W 10 HOH 560 1560 1560 HOH HOH A . 
W 10 HOH 561 1561 1561 HOH HOH A . 
W 10 HOH 562 1562 1562 HOH HOH A . 
W 10 HOH 563 1563 1563 HOH HOH A . 
W 10 HOH 564 1564 1564 HOH HOH A . 
W 10 HOH 565 1565 1565 HOH HOH A . 
W 10 HOH 566 1566 1566 HOH HOH A . 
W 10 HOH 567 1567 1567 HOH HOH A . 
W 10 HOH 568 1568 1568 HOH HOH A . 
W 10 HOH 569 1569 1569 HOH HOH A . 
W 10 HOH 570 1570 1570 HOH HOH A . 
W 10 HOH 571 1571 1571 HOH HOH A . 
W 10 HOH 572 1572 1572 HOH HOH A . 
W 10 HOH 573 1573 1573 HOH HOH A . 
W 10 HOH 574 1574 1574 HOH HOH A . 
W 10 HOH 575 1575 1575 HOH HOH A . 
W 10 HOH 576 1576 1576 HOH HOH A . 
W 10 HOH 577 1577 1577 HOH HOH A . 
W 10 HOH 578 1578 1578 HOH HOH A . 
W 10 HOH 579 1579 1579 HOH HOH A . 
W 10 HOH 580 1580 1580 HOH HOH A . 
W 10 HOH 581 1581 1581 HOH HOH A . 
W 10 HOH 582 1582 1582 HOH HOH A . 
W 10 HOH 583 1583 1583 HOH HOH A . 
W 10 HOH 584 1584 1584 HOH HOH A . 
W 10 HOH 585 1585 1585 HOH HOH A . 
W 10 HOH 586 1586 1586 HOH HOH A . 
W 10 HOH 587 1587 1587 HOH HOH A . 
W 10 HOH 588 1588 1588 HOH HOH A . 
W 10 HOH 589 1589 1589 HOH HOH A . 
W 10 HOH 590 1590 1590 HOH HOH A . 
W 10 HOH 591 1591 1591 HOH HOH A . 
W 10 HOH 592 1592 1592 HOH HOH A . 
W 10 HOH 593 1593 1593 HOH HOH A . 
W 10 HOH 594 1594 1594 HOH HOH A . 
W 10 HOH 595 1595 1595 HOH HOH A . 
W 10 HOH 596 1596 1596 HOH HOH A . 
W 10 HOH 597 1597 1597 HOH HOH A . 
W 10 HOH 598 1598 1598 HOH HOH A . 
W 10 HOH 599 1599 1599 HOH HOH A . 
W 10 HOH 600 1600 1600 HOH HOH A . 
W 10 HOH 601 1601 1601 HOH HOH A . 
W 10 HOH 602 1602 1602 HOH HOH A . 
W 10 HOH 603 1603 1603 HOH HOH A . 
W 10 HOH 604 1604 1604 HOH HOH A . 
W 10 HOH 605 1605 1605 HOH HOH A . 
W 10 HOH 606 1606 1606 HOH HOH A . 
W 10 HOH 607 1607 1607 HOH HOH A . 
W 10 HOH 608 1608 1608 HOH HOH A . 
W 10 HOH 609 1609 1609 HOH HOH A . 
W 10 HOH 610 1610 1610 HOH HOH A . 
W 10 HOH 611 1611 1611 HOH HOH A . 
W 10 HOH 612 1612 1612 HOH HOH A . 
W 10 HOH 613 1613 1613 HOH HOH A . 
W 10 HOH 614 1614 1614 HOH HOH A . 
W 10 HOH 615 1615 1615 HOH HOH A . 
W 10 HOH 616 1616 1616 HOH HOH A . 
W 10 HOH 617 1617 1617 HOH HOH A . 
W 10 HOH 618 1618 1618 HOH HOH A . 
W 10 HOH 619 1619 1619 HOH HOH A . 
W 10 HOH 620 1620 1620 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 457 A ASN 457 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W 
1 2 A,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W   
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 136.8400000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-08-11 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-04-03 
5 'Structure model' 2 0 2020-07-29 
6 'Structure model' 2 1 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Derived calculations'      
5  4 'Structure model' 'Experimental preparation'  
6  4 'Structure model' Other                       
7  5 'Structure model' 'Atomic model'              
8  5 'Structure model' 'Data collection'           
9  5 'Structure model' 'Derived calculations'      
10 5 'Structure model' Other                       
11 5 'Structure model' 'Structure summary'         
12 6 'Structure model' 'Derived calculations'      
13 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' exptl_crystal_grow            
2  4 'Structure model' pdbx_database_proc            
3  4 'Structure model' pdbx_database_status          
4  4 'Structure model' struct_conn                   
5  5 'Structure model' atom_site                     
6  5 'Structure model' chem_comp                     
7  5 'Structure model' entity                        
8  5 'Structure model' pdbx_branch_scheme            
9  5 'Structure model' pdbx_chem_comp_identifier     
10 5 'Structure model' pdbx_database_status          
11 5 'Structure model' pdbx_entity_branch            
12 5 'Structure model' pdbx_entity_branch_descriptor 
13 5 'Structure model' pdbx_entity_branch_link       
14 5 'Structure model' pdbx_entity_branch_list       
15 5 'Structure model' pdbx_entity_nonpoly           
16 5 'Structure model' pdbx_nonpoly_scheme           
17 5 'Structure model' pdbx_struct_assembly_gen      
18 5 'Structure model' struct_asym                   
19 5 'Structure model' struct_conn                   
20 5 'Structure model' struct_site                   
21 5 'Structure model' struct_site_gen               
22 6 'Structure model' chem_comp                     
23 6 'Structure model' pdbx_struct_assembly          
24 6 'Structure model' pdbx_struct_assembly_gen      
25 6 'Structure model' pdbx_struct_oper_list         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_exptl_crystal_grow.temp'                    
2  4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
4  5 'Structure model' '_atom_site.B_iso_or_equiv'                   
5  5 'Structure model' '_atom_site.Cartn_x'                          
6  5 'Structure model' '_atom_site.Cartn_y'                          
7  5 'Structure model' '_atom_site.Cartn_z'                          
8  5 'Structure model' '_atom_site.auth_asym_id'                     
9  5 'Structure model' '_atom_site.auth_seq_id'                      
10 5 'Structure model' '_atom_site.label_asym_id'                    
11 5 'Structure model' '_atom_site.label_entity_id'                  
12 5 'Structure model' '_chem_comp.name'                             
13 5 'Structure model' '_chem_comp.type'                             
14 5 'Structure model' '_pdbx_database_status.status_code_sf'        
15 5 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
16 5 'Structure model' '_pdbx_entity_nonpoly.name'                   
17 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
18 5 'Structure model' '_struct_conn.pdbx_role'                      
19 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
20 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
21 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
22 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
23 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
24 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
25 6 'Structure model' '_chem_comp.pdbx_synonyms'                    
26 6 'Structure model' '_pdbx_struct_assembly.details'               
27 6 'Structure model' '_pdbx_struct_assembly.method_details'        
28 6 'Structure model' '_pdbx_struct_assembly.oligomeric_count'      
29 6 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0072 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
REFMAC phasing          .        ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              388 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              388 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              388 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.87 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.43 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 23  ? ? 34.02   55.04   
2  1 SER A 24  ? ? 77.38   -9.82   
3  1 SER A 25  ? ? -112.42 -158.37 
4  1 PHE A 45  ? ? 80.75   -11.15  
5  1 CYS A 94  ? ? -142.95 10.55   
6  1 SER A 108 ? ? -152.62 65.86   
7  1 SER A 200 ? ? 67.09   -125.23 
8  1 ILE A 296 ? ? -68.08  93.66   
9  1 GLU A 299 ? ? -117.77 -72.16  
10 1 ASP A 380 ? ? -158.28 45.16   
11 1 VAL A 400 ? ? -128.35 -58.00  
12 1 ASN A 457 ? ? 72.48   43.64   
13 1 HIS A 486 ? ? 50.63   81.56   
14 1 ASN A 506 ? ? -165.68 -167.55 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 1009 ? 6.46 . 
2 1 O ? A HOH 1140 ? 6.77 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 2537 n 
B 2 NAG 2 B NAG 2 A NAG 2557 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3  2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4  'CHLORIDE ION'                           CL  
5  'METHYLPHOSPHONIC ACID ESTER GROUP'      GB  
6  '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'   MES 
7  'TETRAETHYLENE GLYCOL'                   PG4 
8  'TRIETHYLENE GLYCOL'                     PGE 
9  'DI(HYDROXYETHYL)ETHER'                  PEG 
10 water                                    HOH 
#