data_2WH6
# 
_entry.id   2WH6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WH6         
PDBE  EBI-36537    
WWPDB D_1290036537 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2VM6 unspecified 'HUMAN BCL-2A1 IN COMPLEX WITH BIM'                                                         
PDB 1Q59 unspecified 'SOLUTION STRUCTURE OF THE BHRF1 PROTEIN FROM EPSTEIN-BARRVIRUS, A HOMOLOG OF HUMAN BCL -2' 
PDB 2V6Q unspecified 'CRYSTAL STRUCTURE OF A BHRF-1 : BIM BH3 COMPLEX'                                           
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WH6 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-01 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kvansakul, M.' 1 ? 
'Huang, D.C.S.' 2 ? 
'Colman, P.M.'  3 ? 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for apoptosis inhibition by Epstein-Barr virus BHRF1.' 
_citation.journal_abbrev            'PLoS Pathog.' 
_citation.journal_volume            6 
_citation.page_first                e1001236 
_citation.page_last                 e1001236 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1553-7374 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21203485 
_citation.pdbx_database_id_DOI      10.1371/journal.ppat.1001236 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kvansakul, M.'  1 
primary 'Wei, A.H.'      2 
primary 'Fletcher, J.I.' 3 
primary 'Willis, S.N.'   4 
primary 'Chen, L.'       5 
primary 'Roberts, A.W.'  6 
primary 'Huang, D.C.'    7 
primary 'Colman, P.M.'   8 
# 
_cell.entry_id           2WH6 
_cell.length_a           62.747 
_cell.length_b           62.747 
_cell.length_c           92.383 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WH6 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'EARLY ANTIGEN PROTEIN R' 19848.367 1   ? ? 'BCL-2, RESIDUES 1-160' ? 
2 polymer     syn 'BCL-2-LIKE PROTEIN 11'   3274.691  1   ? ? 'BH3, RESIDUES 51-72'   ? 
3 non-polymer syn 'BROMIDE ION'             79.904    9   ? ? ?                       ? 
4 non-polymer syn GLYCEROL                  92.094    2   ? ? ?                       ? 
5 water       nat water                     18.015    115 ? ? ?                       ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'NUCLEAR ANTIGEN, EA-R, BHRF1'                            
2 'BCL2-L-11, BCL2-INTERACTING MEDIATOR OF CELL DEATH, BIM' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSHHHHHHSQDPMAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTE
TWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQ
GGWSTLIEDNIPG
;
;MGSHHHHHHSQDPMAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTE
TWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQ
GGWSTLIEDNIPG
;
A ? 
2 'polypeptide(L)' no no DMRPEIWIAQELRRIGDEFNAYYARR DMRPEIWIAQELRRIGDEFNAYYARR B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  GLN n 
1 12  ASP n 
1 13  PRO n 
1 14  MET n 
1 15  ALA n 
1 16  TYR n 
1 17  SER n 
1 18  THR n 
1 19  ARG n 
1 20  GLU n 
1 21  ILE n 
1 22  LEU n 
1 23  LEU n 
1 24  ALA n 
1 25  LEU n 
1 26  CYS n 
1 27  ILE n 
1 28  ARG n 
1 29  ASP n 
1 30  SER n 
1 31  ARG n 
1 32  VAL n 
1 33  HIS n 
1 34  GLY n 
1 35  ASN n 
1 36  GLY n 
1 37  THR n 
1 38  LEU n 
1 39  HIS n 
1 40  PRO n 
1 41  VAL n 
1 42  LEU n 
1 43  GLU n 
1 44  LEU n 
1 45  ALA n 
1 46  ALA n 
1 47  ARG n 
1 48  GLU n 
1 49  THR n 
1 50  PRO n 
1 51  LEU n 
1 52  ARG n 
1 53  LEU n 
1 54  SER n 
1 55  PRO n 
1 56  GLU n 
1 57  ASP n 
1 58  THR n 
1 59  VAL n 
1 60  VAL n 
1 61  LEU n 
1 62  ARG n 
1 63  TYR n 
1 64  HIS n 
1 65  VAL n 
1 66  LEU n 
1 67  LEU n 
1 68  GLU n 
1 69  GLU n 
1 70  ILE n 
1 71  ILE n 
1 72  GLU n 
1 73  ARG n 
1 74  ASN n 
1 75  SER n 
1 76  GLU n 
1 77  THR n 
1 78  PHE n 
1 79  THR n 
1 80  GLU n 
1 81  THR n 
1 82  TRP n 
1 83  ASN n 
1 84  ARG n 
1 85  PHE n 
1 86  ILE n 
1 87  THR n 
1 88  HIS n 
1 89  THR n 
1 90  GLU n 
1 91  HIS n 
1 92  VAL n 
1 93  ASP n 
1 94  LEU n 
1 95  ASP n 
1 96  PHE n 
1 97  ASN n 
1 98  SER n 
1 99  VAL n 
1 100 PHE n 
1 101 LEU n 
1 102 GLU n 
1 103 ILE n 
1 104 PHE n 
1 105 HIS n 
1 106 ARG n 
1 107 GLY n 
1 108 ASP n 
1 109 PRO n 
1 110 SER n 
1 111 LEU n 
1 112 GLY n 
1 113 ARG n 
1 114 ALA n 
1 115 LEU n 
1 116 ALA n 
1 117 TRP n 
1 118 MET n 
1 119 ALA n 
1 120 TRP n 
1 121 CYS n 
1 122 MET n 
1 123 HIS n 
1 124 ALA n 
1 125 CYS n 
1 126 ARG n 
1 127 THR n 
1 128 LEU n 
1 129 CYS n 
1 130 CYS n 
1 131 ASN n 
1 132 GLN n 
1 133 SER n 
1 134 THR n 
1 135 PRO n 
1 136 TYR n 
1 137 TYR n 
1 138 VAL n 
1 139 VAL n 
1 140 ASP n 
1 141 LEU n 
1 142 SER n 
1 143 VAL n 
1 144 ARG n 
1 145 GLY n 
1 146 MET n 
1 147 LEU n 
1 148 GLU n 
1 149 ALA n 
1 150 SER n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 ASP n 
1 155 GLY n 
1 156 TRP n 
1 157 ILE n 
1 158 HIS n 
1 159 GLN n 
1 160 GLN n 
1 161 GLY n 
1 162 GLY n 
1 163 TRP n 
1 164 SER n 
1 165 THR n 
1 166 LEU n 
1 167 ILE n 
1 168 GLU n 
1 169 ASP n 
1 170 ASN n 
1 171 ILE n 
1 172 PRO n 
1 173 GLY n 
2 1   ASP n 
2 2   MET n 
2 3   ARG n 
2 4   PRO n 
2 5   GLU n 
2 6   ILE n 
2 7   TRP n 
2 8   ILE n 
2 9   ALA n 
2 10  GLN n 
2 11  GLU n 
2 12  LEU n 
2 13  ARG n 
2 14  ARG n 
2 15  ILE n 
2 16  GLY n 
2 17  ASP n 
2 18  GLU n 
2 19  PHE n 
2 20  ASN n 
2 21  ALA n 
2 22  TYR n 
2 23  TYR n 
2 24  ALA n 
2 25  ARG n 
2 26  ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Epstein-barr virus strain ag876' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     82830 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PDUET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP EAR_EBV     1 ? ? P03182 ? 
2 UNP B2L11_HUMAN 2 ? ? O43521 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2WH6 A 14 ? 173 ? P03182 1  ? 160 ? 1  160 
2 2 2WH6 B 1  ? 26  ? O43521 51 ? 76  ? 51 76  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2WH6 MET A 1  ? UNP P03182 ? ? 'expression tag' -12 1  
1 2WH6 GLY A 2  ? UNP P03182 ? ? 'expression tag' -11 2  
1 2WH6 SER A 3  ? UNP P03182 ? ? 'expression tag' -10 3  
1 2WH6 HIS A 4  ? UNP P03182 ? ? 'expression tag' -9  4  
1 2WH6 HIS A 5  ? UNP P03182 ? ? 'expression tag' -8  5  
1 2WH6 HIS A 6  ? UNP P03182 ? ? 'expression tag' -7  6  
1 2WH6 HIS A 7  ? UNP P03182 ? ? 'expression tag' -6  7  
1 2WH6 HIS A 8  ? UNP P03182 ? ? 'expression tag' -5  8  
1 2WH6 HIS A 9  ? UNP P03182 ? ? 'expression tag' -4  9  
1 2WH6 SER A 10 ? UNP P03182 ? ? 'expression tag' -3  10 
1 2WH6 GLN A 11 ? UNP P03182 ? ? 'expression tag' -2  11 
1 2WH6 ASP A 12 ? UNP P03182 ? ? 'expression tag' -1  12 
1 2WH6 PRO A 13 ? UNP P03182 ? ? 'expression tag' 0   13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
BR  non-polymer         . 'BROMIDE ION'   ?                               'Br -1'          79.904  
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2WH6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M MALIC ACID PH 4 1.25 M NABR' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-09-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             0.987 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WH6 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   32170 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        40.00 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.55 
_reflns_shell.percent_possible_all   93.1 
_reflns_shell.Rmerge_I_obs           0.57 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.40 
_reflns_shell.pdbx_redundancy        6.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WH6 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     32170 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.205 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1705 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.953 
_refine.B_iso_mean                               27.02 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2V6Q' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.076 
_refine.pdbx_overall_ESU_R_Free                  0.070 
_refine.overall_SU_ML                            0.049 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.875 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1457 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             115 
_refine_hist.number_atoms_total               1593 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.015  0.021  ? 1504 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.685  1.942  ? 2046 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       11.678 5.000  ? 183  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       29.789 23.067 ? 75   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.402 15.000 ? 246  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.297 15.000 ? 14   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.115  0.200  ? 228  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 1145 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.253  0.200  ? 810  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.313  0.200  ? 1040 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.262  0.200  ? 91   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.201  0.200  ? 48   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.324  0.200  ? 18   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.430  2.000  ? 918  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.371  3.000  ? 1455 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.404  5.000  ? 670  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.668  6.000  ? 588  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.50 
_refine_ls_shell.d_res_low                        1.54 
_refine_ls_shell.number_reflns_R_work             2169 
_refine_ls_shell.R_factor_R_work                  0.2970 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3360 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             104 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2WH6 
_struct.title                     'Crystal structure of anti-apoptotic BHRF1 in complex with the Bim BH3 domain' 
_struct.pdbx_descriptor           'EARLY ANTIGEN PROTEIN R, BCL-2-LIKE PROTEIN 11' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WH6 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'MITOCHONDRION, EARLY PROTEIN, TRANSMEMBRANE, VIRAL PROTEIN, APOPTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 5 ? 
O N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 17  ? VAL A 32  ? SER A 4   VAL A 19  1 ? 16 
HELX_P HELX_P2  2  HIS A 39  ? THR A 49  ? HIS A 26  THR A 36  1 ? 11 
HELX_P HELX_P3  3  ASP A 57  ? ASN A 74  ? ASP A 44  ASN A 61  1 ? 18 
HELX_P HELX_P4  4  ASN A 74  ? THR A 89  ? ASN A 61  THR A 76  1 ? 16 
HELX_P HELX_P5  5  HIS A 91  ? HIS A 105 ? HIS A 78  HIS A 92  1 ? 15 
HELX_P HELX_P6  6  SER A 110 ? ASN A 131 ? SER A 97  ASN A 118 1 ? 22 
HELX_P HELX_P7  7  PRO A 135 ? GLU A 151 ? PRO A 122 GLU A 138 1 ? 17 
HELX_P HELX_P8  8  LEU A 153 ? GLN A 160 ? LEU A 140 GLN A 147 1 ? 8  
HELX_P HELX_P9  9  GLY A 161 ? ASN A 170 ? GLY A 148 ASN A 157 1 ? 10 
HELX_P HELX_P10 10 MET B 2   ? ASN B 20  ? MET B 52  ASN B 70  1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 1159'  
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 1160'  
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BR A 1161'  
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 1162'  
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 1163'  
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 1164'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BR A 1165'  
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 1166'  
AC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 1168' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 1169' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 VAL A 92  ? VAL A 79   . ? 1_555 ? 
2  AC1 2 BR  G .   ? BR  A 1163 . ? 5_555 ? 
3  AC2 2 SER A 54  ? SER A 41   . ? 1_555 ? 
4  AC2 2 ASN A 83  ? ASN A 70   . ? 4_455 ? 
5  AC3 1 SER A 75  ? SER A 62   . ? 1_555 ? 
6  AC4 2 TRP A 82  ? TRP A 69   . ? 1_555 ? 
7  AC4 2 LEU A 128 ? LEU A 115  . ? 1_555 ? 
8  AC5 3 TYR A 136 ? TYR A 123  . ? 1_555 ? 
9  AC5 3 TYR A 137 ? TYR A 124  . ? 1_555 ? 
10 AC5 3 BR  C .   ? BR  A 1159 . ? 5_555 ? 
11 AC6 2 ARG A 62  ? ARG A 49   . ? 1_555 ? 
12 AC6 2 GLU A 168 ? GLU A 155  . ? 1_555 ? 
13 AC7 4 ARG A 106 ? ARG A 93   . ? 1_555 ? 
14 AC7 4 ILE B 6   ? ILE B 56   . ? 1_555 ? 
15 AC7 4 GLN B 10  ? GLN B 60   . ? 1_555 ? 
16 AC7 4 ARG B 13  ? ARG B 63   . ? 1_555 ? 
17 AC8 2 ARG A 73  ? ARG A 60   . ? 1_555 ? 
18 AC8 2 ASN A 74  ? ASN A 61   . ? 1_555 ? 
19 AC9 7 ARG A 19  ? ARG A 6    . ? 1_555 ? 
20 AC9 7 THR A 49  ? THR A 36   . ? 1_555 ? 
21 AC9 7 ARG A 144 ? ARG A 131  . ? 5_555 ? 
22 AC9 7 ARG A 144 ? ARG A 131  . ? 1_555 ? 
23 AC9 7 GLU A 148 ? GLU A 135  . ? 1_555 ? 
24 AC9 7 HOH N .   ? HOH A 2081 . ? 1_555 ? 
25 AC9 7 HOH N .   ? HOH A 2081 . ? 5_555 ? 
26 BC1 6 ALA A 46  ? ALA A 33   . ? 4_565 ? 
27 BC1 6 LEU A 51  ? LEU A 38   . ? 4_565 ? 
28 BC1 6 SER A 75  ? SER A 62   . ? 1_555 ? 
29 BC1 6 GLU A 76  ? GLU A 63   . ? 1_555 ? 
30 BC1 6 THR A 79  ? THR A 66   . ? 1_555 ? 
31 BC1 6 HOH N .   ? HOH A 2043 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2WH6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WH6 
_atom_sites.fract_transf_matrix[1][1]   0.015937 
_atom_sites.fract_transf_matrix[1][2]   0.009201 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018402 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010825 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 15  ? -49.174 8.703   4.383   1.00   38.58 ? 2    ALA A N   1 
ATOM   2    C  CA  . ALA A 1 15  ? -48.928 7.915   5.606   1.00   37.58 ? 2    ALA A CA  1 
ATOM   3    C  C   . ALA A 1 15  ? -47.590 7.139   5.573   1.00   36.76 ? 2    ALA A C   1 
ATOM   4    O  O   . ALA A 1 15  ? -47.374 6.280   6.428   1.00   38.98 ? 2    ALA A O   1 
ATOM   5    C  CB  . ALA A 1 15  ? -50.103 6.975   5.894   1.00   39.21 ? 2    ALA A CB  1 
ATOM   6    N  N   . TYR A 1 16  ? -46.695 7.427   4.620   1.00   34.68 ? 3    TYR A N   1 
ATOM   7    C  CA  . TYR A 1 16  ? -45.303 6.931   4.760   1.00   32.65 ? 3    TYR A CA  1 
ATOM   8    C  C   . TYR A 1 16  ? -44.573 7.785   5.790   1.00   29.87 ? 3    TYR A C   1 
ATOM   9    O  O   . TYR A 1 16  ? -44.714 9.008   5.775   1.00   30.72 ? 3    TYR A O   1 
ATOM   10   C  CB  . TYR A 1 16  ? -44.542 6.974   3.441   1.00   34.35 ? 3    TYR A CB  1 
ATOM   11   C  CG  . TYR A 1 16  ? -45.149 6.084   2.388   1.00   39.03 ? 3    TYR A CG  1 
ATOM   12   C  CD1 . TYR A 1 16  ? -45.109 4.687   2.514   1.00   41.08 ? 3    TYR A CD1 1 
ATOM   13   C  CD2 . TYR A 1 16  ? -45.767 6.636   1.268   1.00   40.52 ? 3    TYR A CD2 1 
ATOM   14   C  CE1 . TYR A 1 16  ? -45.696 3.854   1.538   1.00   43.85 ? 3    TYR A CE1 1 
ATOM   15   C  CE2 . TYR A 1 16  ? -46.347 5.825   0.285   1.00   42.81 ? 3    TYR A CE2 1 
ATOM   16   C  CZ  . TYR A 1 16  ? -46.306 4.435   0.427   1.00   42.04 ? 3    TYR A CZ  1 
ATOM   17   O  OH  . TYR A 1 16  ? -46.880 3.637   -0.548  1.00   41.59 ? 3    TYR A OH  1 
ATOM   18   N  N   . SER A 1 17  ? -43.806 7.136   6.672   1.00   25.71 ? 4    SER A N   1 
ATOM   19   C  CA  . SER A 1 17  ? -43.081 7.832   7.739   1.00   22.63 ? 4    SER A CA  1 
ATOM   20   C  C   . SER A 1 17  ? -41.832 8.445   7.155   1.00   20.24 ? 4    SER A C   1 
ATOM   21   O  O   . SER A 1 17  ? -41.405 8.087   6.052   1.00   21.26 ? 4    SER A O   1 
ATOM   22   C  CB  . SER A 1 17  ? -42.687 6.879   8.843   1.00   21.86 ? 4    SER A CB  1 
ATOM   23   O  OG  . SER A 1 17  ? -41.674 5.983   8.399   1.00   22.42 ? 4    SER A OG  1 
ATOM   24   N  N   . THR A 1 18  ? -41.262 9.394   7.885   1.00   19.79 ? 5    THR A N   1 
ATOM   25   C  CA  . THR A 1 18  ? -39.996 10.062  7.481   1.00   19.78 ? 5    THR A CA  1 
ATOM   26   C  C   . THR A 1 18  ? -38.882 9.042   7.411   1.00   19.30 ? 5    THR A C   1 
ATOM   27   O  O   . THR A 1 18  ? -38.095 9.057   6.471   1.00   18.73 ? 5    THR A O   1 
ATOM   28   C  CB  . THR A 1 18  ? -39.613 11.192  8.443   1.00   21.18 ? 5    THR A CB  1 
ATOM   29   O  OG1 . THR A 1 18  ? -40.687 12.147  8.428   1.00   23.31 ? 5    THR A OG1 1 
ATOM   30   C  CG2 . THR A 1 18  ? -38.369 11.907  7.927   1.00   20.23 ? 5    THR A CG2 1 
ATOM   31   N  N   . ARG A 1 19  ? -38.873 8.103   8.346   1.00   19.30 ? 6    ARG A N   1 
ATOM   32   C  CA  . ARG A 1 19  ? -37.879 7.043   8.278   1.00   18.96 ? 6    ARG A CA  1 
ATOM   33   C  C   . ARG A 1 19  ? -38.008 6.257   6.950   1.00   16.96 ? 6    ARG A C   1 
ATOM   34   O  O   . ARG A 1 19  ? -37.012 5.948   6.285   1.00   18.01 ? 6    ARG A O   1 
ATOM   35   C  CB  . ARG A 1 19  ? -38.037 6.128   9.484   1.00   21.49 ? 6    ARG A CB  1 
ATOM   36   C  CG  . ARG A 1 19  ? -37.194 4.931   9.481   1.00   23.92 ? 6    ARG A CG  1 
ATOM   37   C  CD  . ARG A 1 19  ? -36.970 4.493   10.974  1.00   29.55 ? 6    ARG A CD  1 
ATOM   38   N  NE  . ARG A 1 19  ? -38.208 4.062   11.592  1.00   31.56 ? 6    ARG A NE  1 
ATOM   39   C  CZ  . ARG A 1 19  ? -38.274 3.045   12.457  1.00   33.47 ? 6    ARG A CZ  1 
ATOM   40   N  NH1 . ARG A 1 19  ? -39.447 2.685   12.983  1.00   33.51 ? 6    ARG A NH1 1 
ATOM   41   N  NH2 . ARG A 1 19  ? -37.166 2.361   12.765  1.00   31.02 ? 6    ARG A NH2 1 
ATOM   42   N  N   . GLU A 1 20  ? -39.243 5.889   6.560   1.00   18.09 ? 7    GLU A N   1 
ATOM   43   C  CA  . GLU A 1 20  ? -39.443 5.170   5.292   1.00   18.54 ? 7    GLU A CA  1 
ATOM   44   C  C   . GLU A 1 20  ? -38.967 6.006   4.113   1.00   17.59 ? 7    GLU A C   1 
ATOM   45   O  O   . GLU A 1 20  ? -38.278 5.499   3.223   1.00   20.10 ? 7    GLU A O   1 
ATOM   46   C  CB  . GLU A 1 20  ? -40.914 4.799   5.086   1.00   20.44 ? 7    GLU A CB  1 
ATOM   47   C  CG  . GLU A 1 20  ? -41.348 3.614   5.911   1.00   22.61 ? 7    GLU A CG  1 
ATOM   48   C  CD  . GLU A 1 20  ? -42.802 3.316   5.657   1.00   29.90 ? 7    GLU A CD  1 
ATOM   49   O  OE1 . GLU A 1 20  ? -43.665 4.084   6.161   1.00   30.26 ? 7    GLU A OE1 1 
ATOM   50   O  OE2 . GLU A 1 20  ? -43.078 2.367   4.899   1.00   32.65 ? 7    GLU A OE2 1 
ATOM   51   N  N   . ILE A 1 21  ? -39.343 7.293   4.089   1.00   17.43 ? 8    ILE A N   1 
ATOM   52   C  CA  A ILE A 1 21  ? -38.949 8.061   2.904   0.50   18.69 ? 8    ILE A CA  1 
ATOM   53   C  CA  B ILE A 1 21  ? -38.963 8.190   2.982   0.50   19.29 ? 8    ILE A CA  1 
ATOM   54   C  C   . ILE A 1 21  ? -37.443 8.297   2.868   1.00   17.44 ? 8    ILE A C   1 
ATOM   55   O  O   . ILE A 1 21  ? -36.849 8.161   1.796   1.00   17.87 ? 8    ILE A O   1 
ATOM   56   C  CB  A ILE A 1 21  ? -39.802 9.308   2.611   0.50   19.83 ? 8    ILE A CB  1 
ATOM   57   C  CB  B ILE A 1 21  ? -39.612 9.584   3.180   0.50   20.80 ? 8    ILE A CB  1 
ATOM   58   C  CG1 A ILE A 1 21  ? -39.556 9.757   1.154   0.50   19.44 ? 8    ILE A CG1 1 
ATOM   59   C  CG1 B ILE A 1 21  ? -41.135 9.476   2.974   0.50   20.84 ? 8    ILE A CG1 1 
ATOM   60   C  CG2 A ILE A 1 21  ? -39.533 10.406  3.652   0.50   19.61 ? 8    ILE A CG2 1 
ATOM   61   C  CG2 B ILE A 1 21  ? -38.980 10.652  2.267   0.50   22.20 ? 8    ILE A CG2 1 
ATOM   62   C  CD1 A ILE A 1 21  ? -40.494 10.838  0.640   0.50   17.70 ? 8    ILE A CD1 1 
ATOM   63   C  CD1 B ILE A 1 21  ? -41.590 9.365   1.501   0.50   25.39 ? 8    ILE A CD1 1 
ATOM   64   N  N   . LEU A 1 22  ? -36.818 8.582   4.020   1.00   17.89 ? 9    LEU A N   1 
ATOM   65   C  CA  . LEU A 1 22  ? -35.371 8.709   3.992   1.00   16.87 ? 9    LEU A CA  1 
ATOM   66   C  C   . LEU A 1 22  ? -34.674 7.429   3.579   1.00   16.69 ? 9    LEU A C   1 
ATOM   67   O  O   . LEU A 1 22  ? -33.711 7.464   2.792   1.00   17.74 ? 9    LEU A O   1 
ATOM   68   C  CB  . LEU A 1 22  ? -34.808 9.212   5.346   1.00   17.97 ? 9    LEU A CB  1 
ATOM   69   C  CG  . LEU A 1 22  ? -33.296 9.438   5.406   1.00   16.56 ? 9    LEU A CG  1 
ATOM   70   C  CD1 . LEU A 1 22  ? -32.863 10.486  4.342   1.00   17.98 ? 9    LEU A CD1 1 
ATOM   71   C  CD2 . LEU A 1 22  ? -32.935 9.999   6.754   1.00   17.87 ? 9    LEU A CD2 1 
ATOM   72   N  N   . LEU A 1 23  ? -35.155 6.302   4.094   1.00   16.28 ? 10   LEU A N   1 
ATOM   73   C  CA  . LEU A 1 23  ? -34.485 5.044   3.762   1.00   16.23 ? 10   LEU A CA  1 
ATOM   74   C  C   . LEU A 1 23  ? -34.674 4.743   2.248   1.00   16.89 ? 10   LEU A C   1 
ATOM   75   O  O   . LEU A 1 23  ? -33.716 4.308   1.587   1.00   17.29 ? 10   LEU A O   1 
ATOM   76   C  CB  . LEU A 1 23  ? -35.017 3.903   4.623   1.00   16.23 ? 10   LEU A CB  1 
ATOM   77   C  CG  . LEU A 1 23  ? -34.513 2.512   4.289   1.00   18.83 ? 10   LEU A CG  1 
ATOM   78   C  CD1 . LEU A 1 23  ? -32.983 2.431   4.351   1.00   18.96 ? 10   LEU A CD1 1 
ATOM   79   C  CD2 . LEU A 1 23  ? -35.197 1.607   5.299   1.00   21.99 ? 10   LEU A CD2 1 
ATOM   80   N  N   . ALA A 1 24  ? -35.874 4.991   1.715   1.00   16.74 ? 11   ALA A N   1 
ATOM   81   C  CA  . ALA A 1 24  ? -36.100 4.776   0.292   1.00   17.63 ? 11   ALA A CA  1 
ATOM   82   C  C   . ALA A 1 24  ? -35.172 5.679   -0.529  1.00   16.92 ? 11   ALA A C   1 
ATOM   83   O  O   . ALA A 1 24  ? -34.617 5.220   -1.544  1.00   18.40 ? 11   ALA A O   1 
ATOM   84   C  CB  . ALA A 1 24  ? -37.547 5.062   -0.054  1.00   17.78 ? 11   ALA A CB  1 
ATOM   85   N  N   . LEU A 1 25  ? -34.997 6.933   -0.093  1.00   16.77 ? 12   LEU A N   1 
ATOM   86   C  CA  . LEU A 1 25  ? -34.089 7.878   -0.807  1.00   16.35 ? 12   LEU A CA  1 
ATOM   87   C  C   . LEU A 1 25  ? -32.656 7.390   -0.796  1.00   17.97 ? 12   LEU A C   1 
ATOM   88   O  O   . LEU A 1 25  ? -31.912 7.470   -1.791  1.00   18.85 ? 12   LEU A O   1 
ATOM   89   C  CB  . LEU A 1 25  ? -34.174 9.250   -0.144  1.00   18.82 ? 12   LEU A CB  1 
ATOM   90   C  CG  . LEU A 1 25  ? -35.471 9.994   -0.499  1.00   18.08 ? 12   LEU A CG  1 
ATOM   91   C  CD1 . LEU A 1 25  ? -35.704 11.129  0.456   1.00   19.16 ? 12   LEU A CD1 1 
ATOM   92   C  CD2 . LEU A 1 25  ? -35.312 10.577  -1.915  1.00   20.27 ? 12   LEU A CD2 1 
ATOM   93   N  N   . CYS A 1 26  ? -32.225 6.869   0.354   1.00   15.70 ? 13   CYS A N   1 
ATOM   94   C  CA  . CYS A 1 26  ? -30.854 6.373   0.424   1.00   17.33 ? 13   CYS A CA  1 
ATOM   95   C  C   . CYS A 1 26  ? -30.642 5.148   -0.454  1.00   17.85 ? 13   CYS A C   1 
ATOM   96   O  O   . CYS A 1 26  ? -29.573 4.968   -1.026  1.00   18.37 ? 13   CYS A O   1 
ATOM   97   C  CB  . CYS A 1 26  ? -30.450 6.072   1.871   1.00   17.24 ? 13   CYS A CB  1 
ATOM   98   S  SG  . CYS A 1 26  ? -30.263 7.557   2.932   1.00   19.05 ? 13   CYS A SG  1 
ATOM   99   N  N   . ILE A 1 27  ? -31.623 4.266   -0.447  1.00   17.01 ? 14   ILE A N   1 
ATOM   100  C  CA  . ILE A 1 27  ? -31.506 3.116   -1.331  1.00   17.38 ? 14   ILE A CA  1 
ATOM   101  C  C   . ILE A 1 27  ? -31.496 3.516   -2.811  1.00   18.40 ? 14   ILE A C   1 
ATOM   102  O  O   . ILE A 1 27  ? -30.648 3.038   -3.569  1.00   19.85 ? 14   ILE A O   1 
ATOM   103  C  CB  . ILE A 1 27  ? -32.642 2.154   -1.022  1.00   16.84 ? 14   ILE A CB  1 
ATOM   104  C  CG1 . ILE A 1 27  ? -32.437 1.490   0.361   1.00   19.08 ? 14   ILE A CG1 1 
ATOM   105  C  CG2 . ILE A 1 27  ? -32.751 1.007   -2.139  1.00   19.04 ? 14   ILE A CG2 1 
ATOM   106  C  CD1 . ILE A 1 27  ? -33.762 0.896   0.966   1.00   20.83 ? 14   ILE A CD1 1 
ATOM   107  N  N   . ARG A 1 28  ? -32.444 4.339   -3.219  1.00   17.42 ? 15   ARG A N   1 
ATOM   108  C  CA  . ARG A 1 28  ? -32.416 4.852   -4.590  1.00   19.80 ? 15   ARG A CA  1 
ATOM   109  C  C   . ARG A 1 28  ? -31.048 5.483   -4.907  1.00   19.74 ? 15   ARG A C   1 
ATOM   110  O  O   . ARG A 1 28  ? -30.421 5.193   -5.963  1.00   21.14 ? 15   ARG A O   1 
ATOM   111  C  CB  . ARG A 1 28  ? -33.555 5.848   -4.795  1.00   19.47 ? 15   ARG A CB  1 
ATOM   112  C  CG  . ARG A 1 28  ? -33.525 6.572   -6.181  1.00   23.97 ? 15   ARG A CG  1 
ATOM   113  C  CD  . ARG A 1 28  ? -33.621 5.540   -7.306  1.00   25.94 ? 15   ARG A CD  1 
ATOM   114  N  NE  . ARG A 1 28  ? -33.510 6.212   -8.596  1.00   32.62 ? 15   ARG A NE  1 
ATOM   115  C  CZ  . ARG A 1 28  ? -33.704 5.627   -9.769  1.00   37.56 ? 15   ARG A CZ  1 
ATOM   116  N  NH1 . ARG A 1 28  ? -34.009 4.335   -9.827  1.00   35.06 ? 15   ARG A NH1 1 
ATOM   117  N  NH2 . ARG A 1 28  ? -33.592 6.357   -10.877 1.00   35.87 ? 15   ARG A NH2 1 
ATOM   118  N  N   . ASP A 1 29  ? -30.545 6.330   -3.988  1.00   18.34 ? 16   ASP A N   1 
ATOM   119  C  CA  . ASP A 1 29  ? -29.275 6.999   -4.232  1.00   18.79 ? 16   ASP A CA  1 
ATOM   120  C  C   . ASP A 1 29  ? -28.180 5.949   -4.448  1.00   22.07 ? 16   ASP A C   1 
ATOM   121  O  O   . ASP A 1 29  ? -27.344 6.121   -5.352  1.00   24.25 ? 16   ASP A O   1 
ATOM   122  C  CB  . ASP A 1 29  ? -28.936 7.945   -3.096  1.00   18.22 ? 16   ASP A CB  1 
ATOM   123  C  CG  . ASP A 1 29  ? -27.886 8.932   -3.484  1.00   21.34 ? 16   ASP A CG  1 
ATOM   124  O  OD1 . ASP A 1 29  ? -28.138 9.726   -4.418  1.00   22.91 ? 16   ASP A OD1 1 
ATOM   125  O  OD2 . ASP A 1 29  ? -26.841 8.930   -2.828  1.00   24.98 ? 16   ASP A OD2 1 
ATOM   126  N  N   . SER A 1 30  ? -28.192 4.853   -3.676  1.00   21.41 ? 17   SER A N   1 
ATOM   127  C  CA  . SER A 1 30  ? -27.235 3.749   -3.874  1.00   23.37 ? 17   SER A CA  1 
ATOM   128  C  C   . SER A 1 30  ? -27.416 3.060   -5.206  1.00   24.50 ? 17   SER A C   1 
ATOM   129  O  O   . SER A 1 30  ? -26.410 2.674   -5.831  1.00   27.17 ? 17   SER A O   1 
ATOM   130  C  CB  . SER A 1 30  ? -27.351 2.718   -2.755  1.00   24.72 ? 17   SER A CB  1 
ATOM   131  O  OG  . SER A 1 30  ? -26.761 3.234   -1.572  1.00   29.41 ? 17   SER A OG  1 
ATOM   132  N  N   . ARG A 1 31  ? -28.681 2.859   -5.607  1.00   24.83 ? 18   ARG A N   1 
ATOM   133  C  CA  . ARG A 1 31  ? -29.000 2.203   -6.882  1.00   25.18 ? 18   ARG A CA  1 
ATOM   134  C  C   . ARG A 1 31  ? -28.437 2.955   -8.064  1.00   26.41 ? 18   ARG A C   1 
ATOM   135  O  O   . ARG A 1 31  ? -28.200 2.351   -9.116  1.00   27.48 ? 18   ARG A O   1 
ATOM   136  C  CB  . ARG A 1 31  ? -30.518 2.015   -7.052  1.00   23.49 ? 18   ARG A CB  1 
ATOM   137  C  CG  . ARG A 1 31  ? -31.080 0.976   -6.104  1.00   25.83 ? 18   ARG A CG  1 
ATOM   138  C  CD  . ARG A 1 31  ? -30.622 -0.412  -6.461  1.00   26.45 ? 18   ARG A CD  1 
ATOM   139  N  NE  . ARG A 1 31  ? -31.304 -1.419  -5.639  1.00   25.08 ? 18   ARG A NE  1 
ATOM   140  C  CZ  . ARG A 1 31  ? -30.714 -2.502  -5.163  1.00   25.39 ? 18   ARG A CZ  1 
ATOM   141  N  NH1 . ARG A 1 31  ? -29.423 -2.724  -5.411  1.00   25.04 ? 18   ARG A NH1 1 
ATOM   142  N  NH2 . ARG A 1 31  ? -31.410 -3.347  -4.397  1.00   26.12 ? 18   ARG A NH2 1 
ATOM   143  N  N   . VAL A 1 32  ? -28.203 4.257   -7.876  1.00   25.63 ? 19   VAL A N   1 
ATOM   144  C  CA  . VAL A 1 32  ? -27.713 5.130   -8.970  1.00   29.05 ? 19   VAL A CA  1 
ATOM   145  C  C   . VAL A 1 32  ? -26.292 5.653   -8.792  1.00   31.77 ? 19   VAL A C   1 
ATOM   146  O  O   . VAL A 1 32  ? -25.854 6.520   -9.561  1.00   35.11 ? 19   VAL A O   1 
ATOM   147  C  CB  . VAL A 1 32  ? -28.717 6.273   -9.283  1.00   27.04 ? 19   VAL A CB  1 
ATOM   148  C  CG1 . VAL A 1 32  ? -30.073 5.712   -9.642  1.00   29.89 ? 19   VAL A CG1 1 
ATOM   149  C  CG2 . VAL A 1 32  ? -28.839 7.262   -8.138  1.00   29.50 ? 19   VAL A CG2 1 
ATOM   150  N  N   . HIS A 1 33  ? -25.566 5.150   -7.806  1.00   33.71 ? 20   HIS A N   1 
ATOM   151  C  CA  . HIS A 1 33  ? -24.148 5.478   -7.653  1.00   36.20 ? 20   HIS A CA  1 
ATOM   152  C  C   . HIS A 1 33  ? -23.327 4.188   -7.630  1.00   39.12 ? 20   HIS A C   1 
ATOM   153  O  O   . HIS A 1 33  ? -23.819 3.126   -7.214  1.00   39.30 ? 20   HIS A O   1 
ATOM   154  C  CB  . HIS A 1 33  ? -23.876 6.342   -6.402  1.00   35.54 ? 20   HIS A CB  1 
ATOM   155  C  CG  . HIS A 1 33  ? -24.453 7.722   -6.483  1.00   34.15 ? 20   HIS A CG  1 
ATOM   156  N  ND1 . HIS A 1 33  ? -23.694 8.833   -6.781  1.00   35.61 ? 20   HIS A ND1 1 
ATOM   157  C  CD2 . HIS A 1 33  ? -25.721 8.170   -6.329  1.00   27.58 ? 20   HIS A CD2 1 
ATOM   158  C  CE1 . HIS A 1 33  ? -24.472 9.902   -6.812  1.00   32.07 ? 20   HIS A CE1 1 
ATOM   159  N  NE2 . HIS A 1 33  ? -25.709 9.527   -6.547  1.00   33.74 ? 20   HIS A NE2 1 
ATOM   160  N  N   . GLY A 1 34  ? -22.089 4.282   -8.111  1.00   41.03 ? 21   GLY A N   1 
ATOM   161  C  CA  . GLY A 1 34  ? -21.166 3.145   -8.160  1.00   43.52 ? 21   GLY A CA  1 
ATOM   162  C  C   . GLY A 1 34  ? -21.752 1.893   -8.791  1.00   45.21 ? 21   GLY A C   1 
ATOM   163  O  O   . GLY A 1 34  ? -22.282 1.954   -9.910  1.00   46.20 ? 21   GLY A O   1 
ATOM   164  N  N   . ASN A 1 35  ? -21.679 0.772   -8.059  1.00   46.04 ? 22   ASN A N   1 
ATOM   165  C  CA  . ASN A 1 35  ? -22.113 -0.552  -8.552  1.00   46.53 ? 22   ASN A CA  1 
ATOM   166  C  C   . ASN A 1 35  ? -23.635 -0.693  -8.639  1.00   45.44 ? 22   ASN A C   1 
ATOM   167  O  O   . ASN A 1 35  ? -24.140 -1.661  -9.228  1.00   45.00 ? 22   ASN A O   1 
ATOM   168  C  CB  . ASN A 1 35  ? -21.589 -1.707  -7.660  1.00   47.90 ? 22   ASN A CB  1 
ATOM   169  C  CG  . ASN A 1 35  ? -20.247 -1.405  -6.985  1.00   50.30 ? 22   ASN A CG  1 
ATOM   170  O  OD1 . ASN A 1 35  ? -20.083 -1.667  -5.792  1.00   52.93 ? 22   ASN A OD1 1 
ATOM   171  N  ND2 . ASN A 1 35  ? -19.284 -0.879  -7.745  1.00   52.65 ? 22   ASN A ND2 1 
ATOM   172  N  N   . GLY A 1 36  ? -24.351 0.254   -8.023  1.00   43.04 ? 23   GLY A N   1 
ATOM   173  C  CA  . GLY A 1 36  ? -25.805 0.166   -7.843  1.00   41.25 ? 23   GLY A CA  1 
ATOM   174  C  C   . GLY A 1 36  ? -26.210 -0.873  -6.804  1.00   39.59 ? 23   GLY A C   1 
ATOM   175  O  O   . GLY A 1 36  ? -27.392 -1.226  -6.686  1.00   40.31 ? 23   GLY A O   1 
ATOM   176  N  N   . THR A 1 37  ? -25.220 -1.355  -6.053  1.00   37.48 ? 24   THR A N   1 
ATOM   177  C  CA  . THR A 1 37  ? -25.394 -2.411  -5.070  1.00   35.97 ? 24   THR A CA  1 
ATOM   178  C  C   . THR A 1 37  ? -25.736 -1.767  -3.733  1.00   33.27 ? 24   THR A C   1 
ATOM   179  O  O   . THR A 1 37  ? -25.372 -0.603  -3.477  1.00   33.14 ? 24   THR A O   1 
ATOM   180  C  CB  . THR A 1 37  ? -24.113 -3.280  -4.968  1.00   36.15 ? 24   THR A CB  1 
ATOM   181  O  OG1 . THR A 1 37  ? -23.846 -3.863  -6.248  1.00   39.44 ? 24   THR A OG1 1 
ATOM   182  C  CG2 . THR A 1 37  ? -24.264 -4.390  -3.956  1.00   38.89 ? 24   THR A CG2 1 
ATOM   183  N  N   . LEU A 1 38  ? -26.456 -2.520  -2.896  1.00   29.72 ? 25   LEU A N   1 
ATOM   184  C  CA  . LEU A 1 38  ? -26.856 -2.015  -1.588  1.00   26.82 ? 25   LEU A CA  1 
ATOM   185  C  C   . LEU A 1 38  ? -25.954 -2.500  -0.473  1.00   24.81 ? 25   LEU A C   1 
ATOM   186  O  O   . LEU A 1 38  ? -25.717 -3.696  -0.281  1.00   24.02 ? 25   LEU A O   1 
ATOM   187  C  CB  . LEU A 1 38  ? -28.302 -2.414  -1.239  1.00   28.27 ? 25   LEU A CB  1 
ATOM   188  C  CG  . LEU A 1 38  ? -29.496 -1.844  -2.006  1.00   27.30 ? 25   LEU A CG  1 
ATOM   189  C  CD1 . LEU A 1 38  ? -30.715 -2.087  -1.116  1.00   31.17 ? 25   LEU A CD1 1 
ATOM   190  C  CD2 . LEU A 1 38  ? -29.335 -0.340  -2.343  1.00   27.30 ? 25   LEU A CD2 1 
ATOM   191  N  N   . HIS A 1 39  ? -25.488 -1.556  0.331   1.00   23.41 ? 26   HIS A N   1 
ATOM   192  C  CA  . HIS A 1 39  ? -24.744 -1.927  1.498   1.00   21.93 ? 26   HIS A CA  1 
ATOM   193  C  C   . HIS A 1 39  ? -25.617 -2.814  2.401   1.00   21.21 ? 26   HIS A C   1 
ATOM   194  O  O   . HIS A 1 39  ? -26.802 -2.545  2.553   1.00   20.79 ? 26   HIS A O   1 
ATOM   195  C  CB  . HIS A 1 39  ? -24.318 -0.623  2.236   1.00   21.61 ? 26   HIS A CB  1 
ATOM   196  C  CG  . HIS A 1 39  ? -23.363 -0.872  3.354   1.00   21.61 ? 26   HIS A CG  1 
ATOM   197  N  ND1 . HIS A 1 39  ? -22.009 -0.606  3.258   1.00   27.57 ? 26   HIS A ND1 1 
ATOM   198  C  CD2 . HIS A 1 39  ? -23.561 -1.416  4.571   1.00   21.23 ? 26   HIS A CD2 1 
ATOM   199  C  CE1 . HIS A 1 39  ? -21.422 -0.990  4.378   1.00   19.56 ? 26   HIS A CE1 1 
ATOM   200  N  NE2 . HIS A 1 39  ? -22.338 -1.462  5.197   1.00   26.48 ? 26   HIS A NE2 1 
ATOM   201  N  N   . PRO A 1 40  ? -25.022 -3.852  3.035   1.00   22.31 ? 27   PRO A N   1 
ATOM   202  C  CA  . PRO A 1 40  ? -25.790 -4.703  3.975   1.00   21.55 ? 27   PRO A CA  1 
ATOM   203  C  C   . PRO A 1 40  ? -26.605 -3.939  5.011   1.00   19.60 ? 27   PRO A C   1 
ATOM   204  O  O   . PRO A 1 40  ? -27.656 -4.350  5.445   1.00   21.12 ? 27   PRO A O   1 
ATOM   205  C  CB  . PRO A 1 40  ? -24.707 -5.558  4.683   1.00   22.32 ? 27   PRO A CB  1 
ATOM   206  C  CG  . PRO A 1 40  ? -23.500 -5.406  3.901   1.00   26.30 ? 27   PRO A CG  1 
ATOM   207  C  CD  . PRO A 1 40  ? -23.644 -4.345  2.845   1.00   23.21 ? 27   PRO A CD  1 
ATOM   208  N  N   . VAL A 1 41  ? -26.098 -2.773  5.411   1.00   20.08 ? 28   VAL A N   1 
ATOM   209  C  CA  . VAL A 1 41  ? -26.807 -1.984  6.360   1.00   20.45 ? 28   VAL A CA  1 
ATOM   210  C  C   . VAL A 1 41  ? -28.188 -1.442  5.835   1.00   20.25 ? 28   VAL A C   1 
ATOM   211  O  O   . VAL A 1 41  ? -29.170 -1.314  6.576   1.00   19.23 ? 28   VAL A O   1 
ATOM   212  C  CB  . VAL A 1 41  ? -25.868 -0.800  6.726   1.00   21.21 ? 28   VAL A CB  1 
ATOM   213  C  CG1 . VAL A 1 41  ? -26.642 0.279   7.376   1.00   22.55 ? 28   VAL A CG1 1 
ATOM   214  C  CG2 . VAL A 1 41  ? -24.719 -1.298  7.620   1.00   23.15 ? 28   VAL A CG2 1 
ATOM   215  N  N   . LEU A 1 42  ? -28.219 -1.128  4.548   1.00   19.79 ? 29   LEU A N   1 
ATOM   216  C  CA  . LEU A 1 42  ? -29.461 -0.633  3.969   1.00   19.09 ? 29   LEU A CA  1 
ATOM   217  C  C   . LEU A 1 42  ? -30.470 -1.788  3.793   1.00   17.46 ? 29   LEU A C   1 
ATOM   218  O  O   . LEU A 1 42  ? -31.663 -1.582  3.945   1.00   18.30 ? 29   LEU A O   1 
ATOM   219  C  CB  . LEU A 1 42  ? -29.203 0.071   2.635   1.00   19.87 ? 29   LEU A CB  1 
ATOM   220  C  CG  . LEU A 1 42  ? -28.413 1.374   2.745   1.00   21.24 ? 29   LEU A CG  1 
ATOM   221  C  CD1 . LEU A 1 42  ? -28.107 1.847   1.345   1.00   23.25 ? 29   LEU A CD1 1 
ATOM   222  C  CD2 . LEU A 1 42  ? -29.275 2.385   3.497   1.00   20.49 ? 29   LEU A CD2 1 
ATOM   223  N  N   . GLU A 1 43  ? -29.950 -2.967  3.465   1.00   17.60 ? 30   GLU A N   1 
ATOM   224  C  CA  . GLU A 1 43  ? -30.787 -4.189  3.465   1.00   17.75 ? 30   GLU A CA  1 
ATOM   225  C  C   . GLU A 1 43  ? -31.403 -4.416  4.841   1.00   18.38 ? 30   GLU A C   1 
ATOM   226  O  O   . GLU A 1 43  ? -32.620 -4.659  4.973   1.00   17.53 ? 30   GLU A O   1 
ATOM   227  C  CB  . GLU A 1 43  ? -29.974 -5.408  3.066   1.00   17.95 ? 30   GLU A CB  1 
ATOM   228  C  CG  . GLU A 1 43  ? -29.222 -5.335  1.760   1.00   19.24 ? 30   GLU A CG  1 
ATOM   229  C  CD  . GLU A 1 43  ? -30.054 -5.597  0.497   1.00   19.00 ? 30   GLU A CD  1 
ATOM   230  O  OE1 . GLU A 1 43  ? -31.302 -5.687  0.589   1.00   21.78 ? 30   GLU A OE1 1 
ATOM   231  O  OE2 . GLU A 1 43  ? -29.410 -5.667  -0.574  1.00   19.84 ? 30   GLU A OE2 1 
ATOM   232  N  N   . LEU A 1 44  ? -30.563 -4.320  5.891   1.00   18.88 ? 31   LEU A N   1 
ATOM   233  C  CA  . LEU A 1 44  ? -31.013 -4.536  7.274   1.00   19.93 ? 31   LEU A CA  1 
ATOM   234  C  C   . LEU A 1 44  ? -32.076 -3.509  7.661   1.00   17.16 ? 31   LEU A C   1 
ATOM   235  O  O   . LEU A 1 44  ? -33.098 -3.830  8.233   1.00   17.86 ? 31   LEU A O   1 
ATOM   236  C  CB  . LEU A 1 44  ? -29.791 -4.470  8.254   1.00   21.94 ? 31   LEU A CB  1 
ATOM   237  C  CG  . LEU A 1 44  ? -30.114 -4.623  9.758   1.00   24.71 ? 31   LEU A CG  1 
ATOM   238  C  CD1 . LEU A 1 44  ? -28.826 -4.980  10.496  1.00   28.27 ? 31   LEU A CD1 1 
ATOM   239  C  CD2 . LEU A 1 44  ? -30.722 -3.355  10.378  1.00   24.99 ? 31   LEU A CD2 1 
ATOM   240  N  N   . ALA A 1 45  ? -31.800 -2.245  7.343   1.00   17.97 ? 32   ALA A N   1 
ATOM   241  C  CA  . ALA A 1 45  ? -32.724 -1.203  7.733   1.00   19.30 ? 32   ALA A CA  1 
ATOM   242  C  C   . ALA A 1 45  ? -34.079 -1.395  7.049   1.00   18.81 ? 32   ALA A C   1 
ATOM   243  O  O   . ALA A 1 45  ? -35.114 -1.134  7.625   1.00   19.38 ? 32   ALA A O   1 
ATOM   244  C  CB  . ALA A 1 45  ? -32.144 0.173   7.393   1.00   19.78 ? 32   ALA A CB  1 
ATOM   245  N  N   . ALA A 1 46  ? -34.046 -1.835  5.778   1.00   18.94 ? 33   ALA A N   1 
ATOM   246  C  CA  . ALA A 1 46  ? -35.312 -2.123  5.069   1.00   18.43 ? 33   ALA A CA  1 
ATOM   247  C  C   . ALA A 1 46  ? -36.106 -3.222  5.762   1.00   18.71 ? 33   ALA A C   1 
ATOM   248  O  O   . ALA A 1 46  ? -37.333 -3.139  5.897   1.00   19.38 ? 33   ALA A O   1 
ATOM   249  C  CB  . ALA A 1 46  ? -34.998 -2.550  3.613   1.00   19.41 ? 33   ALA A CB  1 
ATOM   250  N  N   . ARG A 1 47  ? -35.401 -4.272  6.201   1.00   17.32 ? 34   ARG A N   1 
ATOM   251  C  CA  . ARG A 1 47  ? -36.061 -5.385  6.874   1.00   19.76 ? 34   ARG A CA  1 
ATOM   252  C  C   . ARG A 1 47  ? -36.690 -4.933  8.190   1.00   20.39 ? 34   ARG A C   1 
ATOM   253  O  O   . ARG A 1 47  ? -37.816 -5.310  8.513   1.00   21.70 ? 34   ARG A O   1 
ATOM   254  C  CB  . ARG A 1 47  ? -35.065 -6.506  7.111   1.00   20.26 ? 34   ARG A CB  1 
ATOM   255  C  CG  . ARG A 1 47  ? -35.714 -7.743  7.643   1.00   24.45 ? 34   ARG A CG  1 
ATOM   256  C  CD  . ARG A 1 47  ? -34.701 -8.835  7.869   1.00   25.28 ? 34   ARG A CD  1 
ATOM   257  N  NE  . ARG A 1 47  ? -33.993 -8.579  9.129   1.00   36.77 ? 34   ARG A NE  1 
ATOM   258  C  CZ  . ARG A 1 47  ? -32.680 -8.378  9.201   1.00   38.84 ? 34   ARG A CZ  1 
ATOM   259  N  NH1 . ARG A 1 47  ? -31.967 -8.442  8.102   1.00   36.93 ? 34   ARG A NH1 1 
ATOM   260  N  NH2 . ARG A 1 47  ? -32.071 -8.130  10.359  1.00   38.79 ? 34   ARG A NH2 1 
ATOM   261  N  N   . GLU A 1 48  ? -35.944 -4.133  8.945   1.00   19.87 ? 35   GLU A N   1 
ATOM   262  C  CA  . GLU A 1 48  ? -36.304 -3.798  10.347  1.00   21.67 ? 35   GLU A CA  1 
ATOM   263  C  C   . GLU A 1 48  ? -37.237 -2.615  10.522  1.00   24.39 ? 35   GLU A C   1 
ATOM   264  O  O   . GLU A 1 48  ? -37.875 -2.485  11.569  1.00   26.34 ? 35   GLU A O   1 
ATOM   265  C  CB  . GLU A 1 48  ? -35.023 -3.570  11.154  1.00   21.83 ? 35   GLU A CB  1 
ATOM   266  C  CG  . GLU A 1 48  ? -34.208 -4.840  11.374  1.00   22.05 ? 35   GLU A CG  1 
ATOM   267  C  CD  . GLU A 1 48  ? -34.952 -5.870  12.216  1.00   24.69 ? 35   GLU A CD  1 
ATOM   268  O  OE1 . GLU A 1 48  ? -34.618 -7.064  12.141  1.00   26.24 ? 35   GLU A OE1 1 
ATOM   269  O  OE2 . GLU A 1 48  ? -35.923 -5.519  12.918  1.00   27.34 ? 35   GLU A OE2 1 
ATOM   270  N  N   . THR A 1 49  ? -37.326 -1.754  9.525   1.00   24.55 ? 36   THR A N   1 
ATOM   271  C  CA  . THR A 1 49  ? -38.134 -0.522  9.700   1.00   25.44 ? 36   THR A CA  1 
ATOM   272  C  C   . THR A 1 49  ? -39.571 -1.007  9.982   1.00   29.01 ? 36   THR A C   1 
ATOM   273  O  O   . THR A 1 49  ? -40.117 -0.572  10.988  1.00   30.24 ? 36   THR A O   1 
ATOM   274  C  CB  . THR A 1 49  ? -37.850 0.491   8.569   1.00   25.52 ? 36   THR A CB  1 
ATOM   275  O  OG1 . THR A 1 49  ? -36.482 0.910   8.692   1.00   24.88 ? 36   THR A OG1 1 
ATOM   276  C  CG2 . THR A 1 49  ? -38.750 1.701   8.662   1.00   30.21 ? 36   THR A CG2 1 
ATOM   277  N  N   . PRO A 1 50  ? -40.294 -1.472  8.965   1.00   28.46 ? 37   PRO A N   1 
ATOM   278  C  CA  . PRO A 1 50  ? -39.893 -2.239  7.805   1.00   27.89 ? 37   PRO A CA  1 
ATOM   279  C  C   . PRO A 1 50  ? -40.233 -1.219  6.730   1.00   28.48 ? 37   PRO A C   1 
ATOM   280  O  O   . PRO A 1 50  ? -41.136 -0.363  6.936   1.00   29.35 ? 37   PRO A O   1 
ATOM   281  C  CB  . PRO A 1 50  ? -40.881 -3.396  7.747   1.00   26.90 ? 37   PRO A CB  1 
ATOM   282  C  CG  . PRO A 1 50  ? -42.131 -2.918  8.518   1.00   30.06 ? 37   PRO A CG  1 
ATOM   283  C  CD  . PRO A 1 50  ? -41.730 -1.675  9.301   1.00   28.89 ? 37   PRO A CD  1 
ATOM   284  N  N   . LEU A 1 51  ? -39.524 -1.244  5.613   1.00   26.48 ? 38   LEU A N   1 
ATOM   285  C  CA  . LEU A 1 51  ? -39.788 -0.283  4.533   1.00   26.58 ? 38   LEU A CA  1 
ATOM   286  C  C   . LEU A 1 51  ? -40.960 -0.734  3.649   1.00   28.53 ? 38   LEU A C   1 
ATOM   287  O  O   . LEU A 1 51  ? -40.884 -1.818  3.057   1.00   29.89 ? 38   LEU A O   1 
ATOM   288  C  CB  . LEU A 1 51  ? -38.536 -0.153  3.683   1.00   27.66 ? 38   LEU A CB  1 
ATOM   289  C  CG  . LEU A 1 51  ? -38.646 0.746   2.449   1.00   25.86 ? 38   LEU A CG  1 
ATOM   290  C  CD1 . LEU A 1 51  ? -38.859 2.213   2.817   1.00   25.46 ? 38   LEU A CD1 1 
ATOM   291  C  CD2 . LEU A 1 51  ? -37.391 0.578   1.639   1.00   25.39 ? 38   LEU A CD2 1 
ATOM   292  N  N   . ARG A 1 52  ? -42.004 0.087   3.517   1.00   28.14 ? 39   ARG A N   1 
ATOM   293  C  CA  . ARG A 1 52  ? -43.150 -0.304  2.667   1.00   29.61 ? 39   ARG A CA  1 
ATOM   294  C  C   . ARG A 1 52  ? -43.240 0.569   1.423   1.00   29.23 ? 39   ARG A C   1 
ATOM   295  O  O   . ARG A 1 52  ? -44.159 0.432   0.627   1.00   31.24 ? 39   ARG A O   1 
ATOM   296  C  CB  . ARG A 1 52  ? -44.484 -0.319  3.441   1.00   31.64 ? 39   ARG A CB  1 
ATOM   297  C  CG  . ARG A 1 52  ? -44.368 -0.966  4.811   1.00   32.70 ? 39   ARG A CG  1 
ATOM   298  C  CD  . ARG A 1 52  ? -45.650 -1.527  5.383   1.00   45.43 ? 39   ARG A CD  1 
ATOM   299  N  NE  . ARG A 1 52  ? -45.315 -2.626  6.298   1.00   53.21 ? 39   ARG A NE  1 
ATOM   300  C  CZ  . ARG A 1 52  ? -46.055 -3.037  7.324   1.00   55.99 ? 39   ARG A CZ  1 
ATOM   301  N  NH1 . ARG A 1 52  ? -47.216 -2.449  7.602   1.00   57.67 ? 39   ARG A NH1 1 
ATOM   302  N  NH2 . ARG A 1 52  ? -45.628 -4.043  8.079   1.00   57.21 ? 39   ARG A NH2 1 
ATOM   303  N  N   . LEU A 1 53  ? -42.248 1.444   1.251   1.00   27.53 ? 40   LEU A N   1 
ATOM   304  C  CA  . LEU A 1 53  ? -42.183 2.352   0.110   1.00   26.37 ? 40   LEU A CA  1 
ATOM   305  C  C   . LEU A 1 53  ? -41.118 1.885   -0.883  1.00   25.21 ? 40   LEU A C   1 
ATOM   306  O  O   . LEU A 1 53  ? -39.973 1.609   -0.476  1.00   28.07 ? 40   LEU A O   1 
ATOM   307  C  CB  . LEU A 1 53  ? -41.838 3.757   0.640   1.00   24.54 ? 40   LEU A CB  1 
ATOM   308  C  CG  . LEU A 1 53  ? -41.671 4.928   -0.322  1.00   26.99 ? 40   LEU A CG  1 
ATOM   309  C  CD1 . LEU A 1 53  ? -42.877 5.245   -1.201  1.00   25.49 ? 40   LEU A CD1 1 
ATOM   310  C  CD2 . LEU A 1 53  ? -41.315 6.142   0.512   1.00   26.16 ? 40   LEU A CD2 1 
ATOM   311  N  N   . SER A 1 54  ? -41.453 1.843   -2.176  1.00   23.31 ? 41   SER A N   1 
ATOM   312  C  CA  . SER A 1 54  ? -40.485 1.496   -3.205  1.00   21.81 ? 41   SER A CA  1 
ATOM   313  C  C   . SER A 1 54  ? -39.477 2.647   -3.459  1.00   22.54 ? 41   SER A C   1 
ATOM   314  O  O   . SER A 1 54  ? -39.877 3.784   -3.673  1.00   22.89 ? 41   SER A O   1 
ATOM   315  C  CB  . SER A 1 54  ? -41.197 1.178   -4.528  1.00   20.49 ? 41   SER A CB  1 
ATOM   316  O  OG  . SER A 1 54  ? -40.290 1.043   -5.599  1.00   25.74 ? 41   SER A OG  1 
ATOM   317  N  N   . PRO A 1 55  ? -38.178 2.320   -3.563  1.00   24.95 ? 42   PRO A N   1 
ATOM   318  C  CA  . PRO A 1 55  ? -37.191 3.324   -3.986  1.00   25.67 ? 42   PRO A CA  1 
ATOM   319  C  C   . PRO A 1 55  ? -37.387 3.853   -5.422  1.00   26.43 ? 42   PRO A C   1 
ATOM   320  O  O   . PRO A 1 55  ? -36.829 4.917   -5.790  1.00   27.43 ? 42   PRO A O   1 
ATOM   321  C  CB  . PRO A 1 55  ? -35.847 2.612   -3.856  1.00   25.61 ? 42   PRO A CB  1 
ATOM   322  C  CG  . PRO A 1 55  ? -36.154 1.164   -3.760  1.00   31.18 ? 42   PRO A CG  1 
ATOM   323  C  CD  . PRO A 1 55  ? -37.593 0.992   -3.313  1.00   26.04 ? 42   PRO A CD  1 
ATOM   324  N  N   . GLU A 1 56  ? -38.168 3.104   -6.222  1.00   27.43 ? 43   GLU A N   1 
ATOM   325  C  CA  . GLU A 1 56  ? -38.503 3.539   -7.572  1.00   29.22 ? 43   GLU A CA  1 
ATOM   326  C  C   . GLU A 1 56  ? -39.863 4.219   -7.654  1.00   27.88 ? 43   GLU A C   1 
ATOM   327  O  O   . GLU A 1 56  ? -40.302 4.592   -8.737  1.00   28.40 ? 43   GLU A O   1 
ATOM   328  C  CB  . GLU A 1 56  ? -38.380 2.405   -8.602  1.00   30.61 ? 43   GLU A CB  1 
ATOM   329  C  CG  . GLU A 1 56  ? -36.983 2.308   -9.181  1.00   39.40 ? 43   GLU A CG  1 
ATOM   330  C  CD  . GLU A 1 56  ? -36.969 1.882   -10.652 1.00   47.68 ? 43   GLU A CD  1 
ATOM   331  O  OE1 . GLU A 1 56  ? -37.810 1.027   -11.042 1.00   50.40 ? 43   GLU A OE1 1 
ATOM   332  O  OE2 . GLU A 1 56  ? -36.113 2.404   -11.417 1.00   48.81 ? 43   GLU A OE2 1 
ATOM   333  N  N   . ASP A 1 57  ? -40.513 4.405   -6.509  1.00   26.38 ? 44   ASP A N   1 
ATOM   334  C  CA  . ASP A 1 57  ? -41.777 5.147   -6.459  1.00   25.73 ? 44   ASP A CA  1 
ATOM   335  C  C   . ASP A 1 57  ? -41.560 6.561   -6.929  1.00   26.08 ? 44   ASP A C   1 
ATOM   336  O  O   . ASP A 1 57  ? -40.535 7.172   -6.600  1.00   25.13 ? 44   ASP A O   1 
ATOM   337  C  CB  . ASP A 1 57  ? -42.299 5.165   -5.040  1.00   25.12 ? 44   ASP A CB  1 
ATOM   338  C  CG  . ASP A 1 57  ? -43.727 5.631   -4.950  1.00   30.47 ? 44   ASP A CG  1 
ATOM   339  O  OD1 . ASP A 1 57  ? -43.990 6.838   -5.129  1.00   31.44 ? 44   ASP A OD1 1 
ATOM   340  O  OD2 . ASP A 1 57  ? -44.611 4.777   -4.686  1.00   34.29 ? 44   ASP A OD2 1 
ATOM   341  N  N   . THR A 1 58  ? -42.501 7.108   -7.702  1.00   25.60 ? 45   THR A N   1 
ATOM   342  C  CA  . THR A 1 58  ? -42.317 8.466   -8.235  1.00   25.48 ? 45   THR A CA  1 
ATOM   343  C  C   . THR A 1 58  ? -42.043 9.508   -7.151  1.00   25.03 ? 45   THR A C   1 
ATOM   344  O  O   . THR A 1 58  ? -41.257 10.420  -7.386  1.00   25.46 ? 45   THR A O   1 
ATOM   345  C  CB  . THR A 1 58  ? -43.482 8.953   -9.159  1.00   26.91 ? 45   THR A CB  1 
ATOM   346  O  OG1 . THR A 1 58  ? -44.732 8.862   -8.467  1.00   28.98 ? 45   THR A OG1 1 
ATOM   347  C  CG2 . THR A 1 58  ? -43.544 8.129   -10.432 1.00   30.94 ? 45   THR A CG2 1 
ATOM   348  N  N   . VAL A 1 59  ? -42.671 9.364   -5.977  1.00   24.56 ? 46   VAL A N   1 
ATOM   349  C  CA  . VAL A 1 59  ? -42.453 10.338  -4.887  1.00   25.28 ? 46   VAL A CA  1 
ATOM   350  C  C   . VAL A 1 59  ? -40.986 10.310  -4.461  1.00   23.74 ? 46   VAL A C   1 
ATOM   351  O  O   . VAL A 1 59  ? -40.386 11.354  -4.231  1.00   22.03 ? 46   VAL A O   1 
ATOM   352  C  CB  . VAL A 1 59  ? -43.395 10.146  -3.657  1.00   24.92 ? 46   VAL A CB  1 
ATOM   353  C  CG1 . VAL A 1 59  ? -43.111 8.834   -2.922  1.00   30.40 ? 46   VAL A CG1 1 
ATOM   354  C  CG2 . VAL A 1 59  ? -43.250 11.295  -2.667  1.00   28.00 ? 46   VAL A CG2 1 
ATOM   355  N  N   . VAL A 1 60  ? -40.402 9.122   -4.427  1.00   21.98 ? 47   VAL A N   1 
ATOM   356  C  CA  . VAL A 1 60  ? -38.984 8.995   -4.080  1.00   21.25 ? 47   VAL A CA  1 
ATOM   357  C  C   . VAL A 1 60  ? -38.100 9.568   -5.181  1.00   21.53 ? 47   VAL A C   1 
ATOM   358  O  O   . VAL A 1 60  ? -37.140 10.278  -4.895  1.00   19.17 ? 47   VAL A O   1 
ATOM   359  C  CB  . VAL A 1 60  ? -38.599 7.535   -3.759  1.00   20.45 ? 47   VAL A CB  1 
ATOM   360  C  CG1 . VAL A 1 60  ? -37.052 7.356   -3.515  1.00   18.59 ? 47   VAL A CG1 1 
ATOM   361  C  CG2 . VAL A 1 60  ? -39.472 6.991   -2.579  1.00   21.51 ? 47   VAL A CG2 1 
ATOM   362  N  N   . LEU A 1 61  ? -38.410 9.302   -6.454  1.00   21.52 ? 48   LEU A N   1 
ATOM   363  C  CA  . LEU A 1 61  ? -37.575 9.880   -7.537  1.00   21.81 ? 48   LEU A CA  1 
ATOM   364  C  C   . LEU A 1 61  ? -37.627 11.398  -7.511  1.00   21.96 ? 48   LEU A C   1 
ATOM   365  O  O   . LEU A 1 61  ? -36.607 12.069  -7.734  1.00   21.13 ? 48   LEU A O   1 
ATOM   366  C  CB  . LEU A 1 61  ? -37.957 9.363   -8.927  1.00   23.02 ? 48   LEU A CB  1 
ATOM   367  C  CG  . LEU A 1 61  ? -37.999 7.836   -9.004  1.00   26.03 ? 48   LEU A CG  1 
ATOM   368  C  CD1 . LEU A 1 61  ? -38.575 7.398   -10.352 1.00   29.54 ? 48   LEU A CD1 1 
ATOM   369  C  CD2 . LEU A 1 61  ? -36.613 7.255   -8.782  1.00   31.43 ? 48   LEU A CD2 1 
ATOM   370  N  N   . ARG A 1 62  ? -38.811 11.944  -7.245  1.00   20.00 ? 49   ARG A N   1 
ATOM   371  C  CA  . ARG A 1 62  ? -38.960 13.375  -7.215  1.00   22.06 ? 49   ARG A CA  1 
ATOM   372  C  C   . ARG A 1 62  ? -38.206 14.017  -6.065  1.00   20.71 ? 49   ARG A C   1 
ATOM   373  O  O   . ARG A 1 62  ? -37.486 14.990  -6.278  1.00   21.49 ? 49   ARG A O   1 
ATOM   374  C  CB  . ARG A 1 62  ? -40.443 13.753  -7.234  1.00   23.21 ? 49   ARG A CB  1 
ATOM   375  C  CG  . ARG A 1 62  ? -41.061 13.426  -8.608  1.00   24.56 ? 49   ARG A CG  1 
ATOM   376  C  CD  . ARG A 1 62  ? -42.574 13.487  -8.583  1.00   28.25 ? 49   ARG A CD  1 
ATOM   377  N  NE  . ARG A 1 62  ? -43.029 14.849  -8.412  1.00   27.41 ? 49   ARG A NE  1 
ATOM   378  C  CZ  . ARG A 1 62  ? -44.315 15.193  -8.396  1.00   33.13 ? 49   ARG A CZ  1 
ATOM   379  N  NH1 . ARG A 1 62  ? -45.244 14.247  -8.512  1.00   34.24 ? 49   ARG A NH1 1 
ATOM   380  N  NH2 . ARG A 1 62  ? -44.666 16.473  -8.245  1.00   27.43 ? 49   ARG A NH2 1 
ATOM   381  N  N   . TYR A 1 63  ? -38.333 13.449  -4.862  1.00   20.14 ? 50   TYR A N   1 
ATOM   382  C  CA  . TYR A 1 63  ? -37.506 13.957  -3.763  1.00   18.52 ? 50   TYR A CA  1 
ATOM   383  C  C   . TYR A 1 63  ? -36.039 13.760  -4.004  1.00   18.24 ? 50   TYR A C   1 
ATOM   384  O  O   . TYR A 1 63  ? -35.269 14.596  -3.605  1.00   19.09 ? 50   TYR A O   1 
ATOM   385  C  CB  . TYR A 1 63  ? -37.868 13.290  -2.439  1.00   18.30 ? 50   TYR A CB  1 
ATOM   386  C  CG  . TYR A 1 63  ? -39.013 13.973  -1.767  1.00   16.90 ? 50   TYR A CG  1 
ATOM   387  C  CD1 . TYR A 1 63  ? -40.296 13.402  -1.769  1.00   20.59 ? 50   TYR A CD1 1 
ATOM   388  C  CD2 . TYR A 1 63  ? -38.845 15.198  -1.168  1.00   21.92 ? 50   TYR A CD2 1 
ATOM   389  C  CE1 . TYR A 1 63  ? -41.368 14.042  -1.147  1.00   22.10 ? 50   TYR A CE1 1 
ATOM   390  C  CE2 . TYR A 1 63  ? -39.908 15.857  -0.580  1.00   19.11 ? 50   TYR A CE2 1 
ATOM   391  C  CZ  . TYR A 1 63  ? -41.162 15.274  -0.575  1.00   23.97 ? 50   TYR A CZ  1 
ATOM   392  O  OH  . TYR A 1 63  ? -42.173 15.961  0.054   1.00   24.77 ? 50   TYR A OH  1 
ATOM   393  N  N   . HIS A 1 64  ? -35.669 12.652  -4.625  1.00   17.99 ? 51   HIS A N   1 
ATOM   394  C  CA  . HIS A 1 64  ? -34.259 12.426  -4.880  1.00   19.01 ? 51   HIS A CA  1 
ATOM   395  C  C   . HIS A 1 64  ? -33.628 13.535  -5.715  1.00   20.00 ? 51   HIS A C   1 
ATOM   396  O  O   . HIS A 1 64  ? -32.522 13.989  -5.412  1.00   20.70 ? 51   HIS A O   1 
ATOM   397  C  CB  . HIS A 1 64  ? -34.040 11.067  -5.490  1.00   18.29 ? 51   HIS A CB  1 
ATOM   398  C  CG  . HIS A 1 64  ? -32.597 10.721  -5.666  1.00   22.56 ? 51   HIS A CG  1 
ATOM   399  N  ND1 . HIS A 1 64  ? -31.953 10.810  -6.878  1.00   28.20 ? 51   HIS A ND1 1 
ATOM   400  C  CD2 . HIS A 1 64  ? -31.664 10.289  -4.781  1.00   20.36 ? 51   HIS A CD2 1 
ATOM   401  C  CE1 . HIS A 1 64  ? -30.688 10.448  -6.734  1.00   27.59 ? 51   HIS A CE1 1 
ATOM   402  N  NE2 . HIS A 1 64  ? -30.481 10.139  -5.467  1.00   22.42 ? 51   HIS A NE2 1 
ATOM   403  N  N   . VAL A 1 65  ? -34.336 13.987  -6.743  1.00   18.80 ? 52   VAL A N   1 
ATOM   404  C  CA  . VAL A 1 65  ? -33.836 15.144  -7.507  1.00   19.57 ? 52   VAL A CA  1 
ATOM   405  C  C   . VAL A 1 65  ? -33.742 16.411  -6.654  1.00   19.18 ? 52   VAL A C   1 
ATOM   406  O  O   . VAL A 1 65  ? -32.729 17.151  -6.740  1.00   20.51 ? 52   VAL A O   1 
ATOM   407  C  CB  . VAL A 1 65  ? -34.713 15.465  -8.737  1.00   19.85 ? 52   VAL A CB  1 
ATOM   408  C  CG1 . VAL A 1 65  ? -34.116 16.698  -9.472  1.00   21.00 ? 52   VAL A CG1 1 
ATOM   409  C  CG2 . VAL A 1 65  ? -34.792 14.255  -9.683  1.00   27.59 ? 52   VAL A CG2 1 
ATOM   410  N  N   . LEU A 1 66  ? -34.758 16.708  -5.838  1.00   19.35 ? 53   LEU A N   1 
ATOM   411  C  CA  . LEU A 1 66  ? -34.680 17.938  -5.011  1.00   20.00 ? 53   LEU A CA  1 
ATOM   412  C  C   . LEU A 1 66  ? -33.491 17.875  -4.048  1.00   20.47 ? 53   LEU A C   1 
ATOM   413  O  O   . LEU A 1 66  ? -32.765 18.840  -3.853  1.00   19.55 ? 53   LEU A O   1 
ATOM   414  C  CB  . LEU A 1 66  ? -35.930 18.155  -4.165  1.00   22.56 ? 53   LEU A CB  1 
ATOM   415  C  CG  . LEU A 1 66  ? -37.282 18.474  -4.770  1.00   28.78 ? 53   LEU A CG  1 
ATOM   416  C  CD1 . LEU A 1 66  ? -38.256 18.685  -3.631  1.00   33.26 ? 53   LEU A CD1 1 
ATOM   417  C  CD2 . LEU A 1 66  ? -37.199 19.730  -5.620  1.00   33.52 ? 53   LEU A CD2 1 
ATOM   418  N  N   . LEU A 1 67  ? -33.300 16.741  -3.395  1.00   18.75 ? 54   LEU A N   1 
ATOM   419  C  CA  . LEU A 1 67  ? -32.171 16.618  -2.470  1.00   17.77 ? 54   LEU A CA  1 
ATOM   420  C  C   . LEU A 1 67  ? -30.824 16.653  -3.195  1.00   18.86 ? 54   LEU A C   1 
ATOM   421  O  O   . LEU A 1 67  ? -29.879 17.213  -2.649  1.00   19.22 ? 54   LEU A O   1 
ATOM   422  C  CB  . LEU A 1 67  ? -32.296 15.303  -1.679  1.00   19.33 ? 54   LEU A CB  1 
ATOM   423  C  CG  . LEU A 1 67  ? -33.571 15.161  -0.850  1.00   20.68 ? 54   LEU A CG  1 
ATOM   424  C  CD1 . LEU A 1 67  ? -33.411 13.995  0.124   1.00   20.90 ? 54   LEU A CD1 1 
ATOM   425  C  CD2 . LEU A 1 67  ? -33.885 16.384  -0.069  1.00   19.49 ? 54   LEU A CD2 1 
ATOM   426  N  N   . GLU A 1 68  ? -30.722 16.051  -4.389  1.00   19.20 ? 55   GLU A N   1 
ATOM   427  C  CA  A GLU A 1 68  ? -29.458 16.143  -5.123  0.50   18.95 ? 55   GLU A CA  1 
ATOM   428  C  CA  B GLU A 1 68  ? -29.470 16.119  -5.173  0.50   20.36 ? 55   GLU A CA  1 
ATOM   429  C  C   . GLU A 1 68  ? -29.162 17.593  -5.500  1.00   20.18 ? 55   GLU A C   1 
ATOM   430  O  O   . GLU A 1 68  ? -28.017 18.012  -5.428  1.00   21.24 ? 55   GLU A O   1 
ATOM   431  C  CB  A GLU A 1 68  ? -29.436 15.238  -6.347  0.50   20.33 ? 55   GLU A CB  1 
ATOM   432  C  CB  B GLU A 1 68  ? -29.492 15.235  -6.453  0.50   21.37 ? 55   GLU A CB  1 
ATOM   433  C  CG  A GLU A 1 68  ? -28.212 15.365  -7.254  0.50   16.50 ? 55   GLU A CG  1 
ATOM   434  C  CG  B GLU A 1 68  ? -29.090 13.698  -6.255  0.50   23.73 ? 55   GLU A CG  1 
ATOM   435  C  CD  A GLU A 1 68  ? -26.854 15.024  -6.616  0.50   24.01 ? 55   GLU A CD  1 
ATOM   436  C  CD  B GLU A 1 68  ? -29.007 12.844  -7.580  0.50   22.61 ? 55   GLU A CD  1 
ATOM   437  O  OE1 A GLU A 1 68  ? -26.776 14.503  -5.482  0.50   25.81 ? 55   GLU A OE1 1 
ATOM   438  O  OE1 B GLU A 1 68  ? -30.000 12.975  -8.351  0.50   30.48 ? 55   GLU A OE1 1 
ATOM   439  O  OE2 A GLU A 1 68  ? -25.834 15.275  -7.287  0.50   21.84 ? 55   GLU A OE2 1 
ATOM   440  O  OE2 B GLU A 1 68  ? -28.012 12.013  -7.842  0.50   16.92 ? 55   GLU A OE2 1 
ATOM   441  N  N   . GLU A 1 69  ? -30.200 18.362  -5.829  1.00   19.01 ? 56   GLU A N   1 
ATOM   442  C  CA  . GLU A 1 69  ? -30.030 19.822  -6.111  1.00   21.47 ? 56   GLU A CA  1 
ATOM   443  C  C   . GLU A 1 69  ? -29.502 20.583  -4.900  1.00   21.16 ? 56   GLU A C   1 
ATOM   444  O  O   . GLU A 1 69  ? -28.592 21.401  -5.012  1.00   23.78 ? 56   GLU A O   1 
ATOM   445  C  CB  . GLU A 1 69  ? -31.340 20.442  -6.570  1.00   22.01 ? 56   GLU A CB  1 
ATOM   446  C  CG  . GLU A 1 69  ? -31.745 19.959  -7.937  1.00   22.22 ? 56   GLU A CG  1 
ATOM   447  C  CD  . GLU A 1 69  ? -33.141 20.323  -8.308  1.00   28.30 ? 56   GLU A CD  1 
ATOM   448  O  OE1 . GLU A 1 69  ? -33.919 20.815  -7.456  1.00   28.71 ? 56   GLU A OE1 1 
ATOM   449  O  OE2 . GLU A 1 69  ? -33.468 20.116  -9.503  1.00   25.27 ? 56   GLU A OE2 1 
ATOM   450  N  N   . ILE A 1 70  ? -30.058 20.289  -3.720  1.00   19.73 ? 57   ILE A N   1 
ATOM   451  C  CA  . ILE A 1 70  ? -29.549 20.883  -2.510  1.00   19.42 ? 57   ILE A CA  1 
ATOM   452  C  C   . ILE A 1 70  ? -28.108 20.468  -2.206  1.00   20.59 ? 57   ILE A C   1 
ATOM   453  O  O   . ILE A 1 70  ? -27.317 21.310  -1.813  1.00   20.45 ? 57   ILE A O   1 
ATOM   454  C  CB  . ILE A 1 70  ? -30.492 20.510  -1.297  1.00   19.50 ? 57   ILE A CB  1 
ATOM   455  C  CG1 . ILE A 1 70  ? -31.866 21.182  -1.521  1.00   20.69 ? 57   ILE A CG1 1 
ATOM   456  C  CG2 . ILE A 1 70  ? -29.879 20.929  0.002   1.00   19.90 ? 57   ILE A CG2 1 
ATOM   457  C  CD1 . ILE A 1 70  ? -33.003 20.645  -0.565  1.00   21.33 ? 57   ILE A CD1 1 
ATOM   458  N  N   . ILE A 1 71  ? -27.755 19.185  -2.339  1.00   19.11 ? 58   ILE A N   1 
ATOM   459  C  CA  . ILE A 1 71  ? -26.383 18.747  -2.165  1.00   19.93 ? 58   ILE A CA  1 
ATOM   460  C  C   . ILE A 1 71  ? -25.454 19.485  -3.108  1.00   20.15 ? 58   ILE A C   1 
ATOM   461  O  O   . ILE A 1 71  ? -24.438 19.986  -2.659  1.00   21.10 ? 58   ILE A O   1 
ATOM   462  C  CB  . ILE A 1 71  ? -26.265 17.212  -2.361  1.00   20.81 ? 58   ILE A CB  1 
ATOM   463  C  CG1 . ILE A 1 71  ? -27.062 16.473  -1.251  1.00   19.53 ? 58   ILE A CG1 1 
ATOM   464  C  CG2 . ILE A 1 71  ? -24.802 16.763  -2.374  1.00   21.83 ? 58   ILE A CG2 1 
ATOM   465  C  CD1 . ILE A 1 71  ? -27.210 14.986  -1.546  1.00   19.88 ? 58   ILE A CD1 1 
ATOM   466  N  N   . GLU A 1 72  ? -25.815 19.530  -4.386  1.00   19.45 ? 59   GLU A N   1 
ATOM   467  C  CA  . GLU A 1 72  ? -24.898 20.154  -5.376  1.00   19.35 ? 59   GLU A CA  1 
ATOM   468  C  C   . GLU A 1 72  ? -24.711 21.624  -5.067  1.00   21.22 ? 59   GLU A C   1 
ATOM   469  O  O   . GLU A 1 72  ? -23.558 22.122  -5.125  1.00   22.15 ? 59   GLU A O   1 
ATOM   470  C  CB  . GLU A 1 72  ? -25.406 19.890  -6.785  1.00   20.73 ? 59   GLU A CB  1 
ATOM   471  C  CG  . GLU A 1 72  ? -25.319 18.403  -7.167  1.00   21.18 ? 59   GLU A CG  1 
ATOM   472  C  CD  . GLU A 1 72  ? -25.645 18.156  -8.638  1.00   28.54 ? 59   GLU A CD  1 
ATOM   473  O  OE1 . GLU A 1 72  ? -25.773 19.140  -9.373  1.00   30.90 ? 59   GLU A OE1 1 
ATOM   474  O  OE2 . GLU A 1 72  ? -25.784 16.971  -9.034  1.00   31.66 ? 59   GLU A OE2 1 
ATOM   475  N  N   . ARG A 1 73  ? -25.792 22.334  -4.745  1.00   21.04 ? 60   ARG A N   1 
ATOM   476  C  CA  . ARG A 1 73  ? -25.681 23.788  -4.424  1.00   23.99 ? 60   ARG A CA  1 
ATOM   477  C  C   . ARG A 1 73  ? -24.818 24.067  -3.205  1.00   24.85 ? 60   ARG A C   1 
ATOM   478  O  O   . ARG A 1 73  ? -24.250 25.180  -3.059  1.00   24.14 ? 60   ARG A O   1 
ATOM   479  C  CB  . ARG A 1 73  ? -27.055 24.415  -4.195  1.00   24.81 ? 60   ARG A CB  1 
ATOM   480  C  CG  . ARG A 1 73  ? -27.797 24.799  -5.432  1.00   32.11 ? 60   ARG A CG  1 
ATOM   481  C  CD  . ARG A 1 73  ? -29.158 25.428  -5.053  1.00   35.39 ? 60   ARG A CD  1 
ATOM   482  N  NE  . ARG A 1 73  ? -30.303 24.516  -5.240  1.00   44.27 ? 60   ARG A NE  1 
ATOM   483  C  CZ  . ARG A 1 73  ? -31.287 24.325  -4.354  1.00   43.41 ? 60   ARG A CZ  1 
ATOM   484  N  NH1 . ARG A 1 73  ? -31.317 25.000  -3.215  1.00   43.21 ? 60   ARG A NH1 1 
ATOM   485  N  NH2 . ARG A 1 73  ? -32.266 23.483  -4.617  1.00   44.50 ? 60   ARG A NH2 1 
ATOM   486  N  N   . ASN A 1 74  ? -24.776 23.103  -2.273  1.00   20.99 ? 61   ASN A N   1 
ATOM   487  C  CA  . ASN A 1 74  ? -24.059 23.260  -1.030  1.00   21.73 ? 61   ASN A CA  1 
ATOM   488  C  C   . ASN A 1 74  ? -22.973 22.216  -0.882  1.00   20.45 ? 61   ASN A C   1 
ATOM   489  O  O   . ASN A 1 74  ? -22.651 21.771  0.223   1.00   21.60 ? 61   ASN A O   1 
ATOM   490  C  CB  . ASN A 1 74  ? -25.031 23.179  0.164   1.00   21.74 ? 61   ASN A CB  1 
ATOM   491  C  CG  . ASN A 1 74  ? -26.170 24.147  0.024   1.00   23.61 ? 61   ASN A CG  1 
ATOM   492  O  OD1 . ASN A 1 74  ? -27.263 23.794  -0.478  1.00   26.92 ? 61   ASN A OD1 1 
ATOM   493  N  ND2 . ASN A 1 74  ? -25.919 25.394  0.392   1.00   23.68 ? 61   ASN A ND2 1 
ATOM   494  N  N   . SER A 1 75  ? -22.403 21.851  -2.037  1.00   20.33 ? 62   SER A N   1 
ATOM   495  C  CA  . SER A 1 75  ? -21.480 20.726  -2.121  1.00   20.45 ? 62   SER A CA  1 
ATOM   496  C  C   . SER A 1 75  ? -20.384 20.747  -1.084  1.00   18.79 ? 62   SER A C   1 
ATOM   497  O  O   . SER A 1 75  ? -20.144 19.755  -0.367  1.00   20.98 ? 62   SER A O   1 
ATOM   498  C  CB  . SER A 1 75  ? -20.863 20.705  -3.530  1.00   22.68 ? 62   SER A CB  1 
ATOM   499  O  OG  . SER A 1 75  ? -20.003 19.592  -3.647  1.00   24.38 ? 62   SER A OG  1 
ATOM   500  N  N   . GLU A 1 76  ? -19.683 21.872  -0.991  1.00   17.83 ? 63   GLU A N   1 
ATOM   501  C  CA  . GLU A 1 76  ? -18.538 21.920  -0.096  1.00   17.53 ? 63   GLU A CA  1 
ATOM   502  C  C   . GLU A 1 76  ? -18.957 21.957  1.377   1.00   17.88 ? 63   GLU A C   1 
ATOM   503  O  O   . GLU A 1 76  ? -18.354 21.319  2.243   1.00   18.59 ? 63   GLU A O   1 
ATOM   504  C  CB  . GLU A 1 76  ? -17.653 23.153  -0.407  1.00   19.46 ? 63   GLU A CB  1 
ATOM   505  C  CG  . GLU A 1 76  ? -16.528 23.357  0.568   1.00   25.64 ? 63   GLU A CG  1 
ATOM   506  C  CD  . GLU A 1 76  ? -15.499 22.242  0.596   1.00   21.45 ? 63   GLU A CD  1 
ATOM   507  O  OE1 . GLU A 1 76  ? -15.458 21.403  -0.332  1.00   26.15 ? 63   GLU A OE1 1 
ATOM   508  O  OE2 . GLU A 1 76  ? -14.710 22.225  1.597   1.00   29.46 ? 63   GLU A OE2 1 
ATOM   509  N  N   . THR A 1 77  ? -20.016 22.690  1.662   1.00   18.18 ? 64   THR A N   1 
ATOM   510  C  CA  . THR A 1 77  ? -20.496 22.759  3.024   1.00   17.82 ? 64   THR A CA  1 
ATOM   511  C  C   . THR A 1 77  ? -20.967 21.360  3.490   1.00   17.61 ? 64   THR A C   1 
ATOM   512  O  O   . THR A 1 77  ? -20.704 20.982  4.634   1.00   19.09 ? 64   THR A O   1 
ATOM   513  C  CB  . THR A 1 77  ? -21.631 23.780  3.162   1.00   18.47 ? 64   THR A CB  1 
ATOM   514  O  OG1 . THR A 1 77  ? -21.078 25.106  2.872   1.00   20.34 ? 64   THR A OG1 1 
ATOM   515  C  CG2 . THR A 1 77  ? -22.209 23.771  4.617   1.00   19.31 ? 64   THR A CG2 1 
ATOM   516  N  N   . PHE A 1 78  ? -21.594 20.609  2.583   1.00   18.96 ? 65   PHE A N   1 
ATOM   517  C  CA  . PHE A 1 78  ? -21.967 19.223  2.966   1.00   19.01 ? 65   PHE A CA  1 
ATOM   518  C  C   . PHE A 1 78  ? -20.753 18.347  3.176   1.00   19.07 ? 65   PHE A C   1 
ATOM   519  O  O   . PHE A 1 78  ? -20.723 17.529  4.119   1.00   19.87 ? 65   PHE A O   1 
ATOM   520  C  CB  . PHE A 1 78  ? -22.893 18.641  1.909   1.00   20.08 ? 65   PHE A CB  1 
ATOM   521  C  CG  . PHE A 1 78  ? -24.326 19.012  2.113   1.00   18.50 ? 65   PHE A CG  1 
ATOM   522  C  CD1 . PHE A 1 78  ? -24.702 20.195  2.800   1.00   23.39 ? 65   PHE A CD1 1 
ATOM   523  C  CD2 . PHE A 1 78  ? -25.323 18.137  1.713   1.00   22.53 ? 65   PHE A CD2 1 
ATOM   524  C  CE1 . PHE A 1 78  ? -26.082 20.489  3.025   1.00   23.08 ? 65   PHE A CE1 1 
ATOM   525  C  CE2 . PHE A 1 78  ? -26.662 18.427  1.929   1.00   22.29 ? 65   PHE A CE2 1 
ATOM   526  C  CZ  . PHE A 1 78  ? -27.077 19.566  2.568   1.00   18.54 ? 65   PHE A CZ  1 
ATOM   527  N  N   . THR A 1 79  ? -19.758 18.451  2.300   1.00   19.24 ? 66   THR A N   1 
ATOM   528  C  CA  . THR A 1 79  ? -18.517 17.701  2.502   1.00   18.81 ? 66   THR A CA  1 
ATOM   529  C  C   . THR A 1 79  ? -17.855 18.045  3.838   1.00   20.52 ? 66   THR A C   1 
ATOM   530  O  O   . THR A 1 79  ? -17.454 17.168  4.603   1.00   19.79 ? 66   THR A O   1 
ATOM   531  C  CB  . THR A 1 79  ? -17.525 17.944  1.351   1.00   19.44 ? 66   THR A CB  1 
ATOM   532  O  OG1 . THR A 1 79  ? -18.140 17.436  0.168   1.00   22.87 ? 66   THR A OG1 1 
ATOM   533  C  CG2 . THR A 1 79  ? -16.214 17.221  1.618   1.00   20.33 ? 66   THR A CG2 1 
ATOM   534  N  N   . GLU A 1 80  ? -17.707 19.347  4.118   1.00   18.86 ? 67   GLU A N   1 
ATOM   535  C  CA  . GLU A 1 80  ? -17.038 19.784  5.324   1.00   20.62 ? 67   GLU A CA  1 
ATOM   536  C  C   . GLU A 1 80  ? -17.757 19.406  6.622   1.00   17.91 ? 67   GLU A C   1 
ATOM   537  O  O   . GLU A 1 80  ? -17.142 18.927  7.594   1.00   19.16 ? 67   GLU A O   1 
ATOM   538  C  CB  . GLU A 1 80  ? -16.858 21.323  5.302   1.00   22.93 ? 67   GLU A CB  1 
ATOM   539  C  CG  . GLU A 1 80  ? -15.602 21.846  4.687   1.00   28.67 ? 67   GLU A CG  1 
ATOM   540  C  CD  . GLU A 1 80  ? -15.449 23.363  4.943   1.00   24.46 ? 67   GLU A CD  1 
ATOM   541  O  OE1 . GLU A 1 80  ? -14.937 23.758  6.001   1.00   39.96 ? 67   GLU A OE1 1 
ATOM   542  O  OE2 . GLU A 1 80  ? -15.856 24.090  4.024   1.00   33.68 ? 67   GLU A OE2 1 
ATOM   543  N  N   . THR A 1 81  ? -19.070 19.657  6.625   1.00   18.13 ? 68   THR A N   1 
ATOM   544  C  CA  . THR A 1 81  ? -19.866 19.347  7.832   1.00   18.34 ? 68   THR A CA  1 
ATOM   545  C  C   . THR A 1 81  ? -19.838 17.833  8.104   1.00   18.36 ? 68   THR A C   1 
ATOM   546  O  O   . THR A 1 81  ? -19.684 17.411  9.255   1.00   17.66 ? 68   THR A O   1 
ATOM   547  C  CB  . THR A 1 81  ? -21.304 19.873  7.701   1.00   18.30 ? 68   THR A CB  1 
ATOM   548  O  OG1 . THR A 1 81  ? -21.864 19.430  6.487   1.00   18.77 ? 68   THR A OG1 1 
ATOM   549  C  CG2 . THR A 1 81  ? -21.332 21.433  7.809   1.00   18.26 ? 68   THR A CG2 1 
ATOM   550  N  N   . TRP A 1 82  ? -19.976 17.034  7.036   1.00   18.33 ? 69   TRP A N   1 
ATOM   551  C  CA  . TRP A 1 82  ? -19.953 15.574  7.267   1.00   17.82 ? 69   TRP A CA  1 
ATOM   552  C  C   . TRP A 1 82  ? -18.559 15.137  7.728   1.00   19.57 ? 69   TRP A C   1 
ATOM   553  O  O   . TRP A 1 82  ? -18.441 14.403  8.710   1.00   20.17 ? 69   TRP A O   1 
ATOM   554  C  CB  . TRP A 1 82  ? -20.395 14.826  6.009   1.00   18.32 ? 69   TRP A CB  1 
ATOM   555  C  CG  . TRP A 1 82  ? -20.246 13.376  6.254   1.00   19.82 ? 69   TRP A CG  1 
ATOM   556  C  CD1 . TRP A 1 82  ? -19.326 12.552  5.700   1.00   19.14 ? 69   TRP A CD1 1 
ATOM   557  C  CD2 . TRP A 1 82  ? -20.966 12.608  7.226   1.00   18.75 ? 69   TRP A CD2 1 
ATOM   558  N  NE1 . TRP A 1 82  ? -19.480 11.252  6.229   1.00   21.53 ? 69   TRP A NE1 1 
ATOM   559  C  CE2 . TRP A 1 82  ? -20.450 11.292  7.183   1.00   19.38 ? 69   TRP A CE2 1 
ATOM   560  C  CE3 . TRP A 1 82  ? -22.016 12.904  8.126   1.00   18.43 ? 69   TRP A CE3 1 
ATOM   561  C  CZ2 . TRP A 1 82  ? -20.968 10.259  8.008   1.00   18.51 ? 69   TRP A CZ2 1 
ATOM   562  C  CZ3 . TRP A 1 82  ? -22.514 11.902  8.947   1.00   17.97 ? 69   TRP A CZ3 1 
ATOM   563  C  CH2 . TRP A 1 82  ? -21.977 10.592  8.873   1.00   18.90 ? 69   TRP A CH2 1 
ATOM   564  N  N   . ASN A 1 83  ? -17.492 15.616  7.077   1.00   19.31 ? 70   ASN A N   1 
ATOM   565  C  CA  . ASN A 1 83  ? -16.171 15.208  7.512   1.00   20.90 ? 70   ASN A CA  1 
ATOM   566  C  C   . ASN A 1 83  ? -15.895 15.613  8.956   1.00   20.79 ? 70   ASN A C   1 
ATOM   567  O  O   . ASN A 1 83  ? -15.356 14.811  9.735   1.00   22.70 ? 70   ASN A O   1 
ATOM   568  C  CB  . ASN A 1 83  ? -15.065 15.705  6.544   1.00   21.24 ? 70   ASN A CB  1 
ATOM   569  C  CG  . ASN A 1 83  ? -15.108 14.949  5.199   1.00   27.56 ? 70   ASN A CG  1 
ATOM   570  O  OD1 . ASN A 1 83  ? -15.742 13.881  5.072   1.00   32.21 ? 70   ASN A OD1 1 
ATOM   571  N  ND2 . ASN A 1 83  ? -14.457 15.500  4.189   1.00   30.22 ? 70   ASN A ND2 1 
ATOM   572  N  N   . ARG A 1 84  ? -16.312 16.814  9.359   1.00   19.87 ? 71   ARG A N   1 
ATOM   573  C  CA  . ARG A 1 84  ? -16.075 17.242  10.747  1.00   20.61 ? 71   ARG A CA  1 
ATOM   574  C  C   . ARG A 1 84  ? -16.835 16.358  11.724  1.00   22.77 ? 71   ARG A C   1 
ATOM   575  O  O   . ARG A 1 84  ? -16.324 15.980  12.781  1.00   22.73 ? 71   ARG A O   1 
ATOM   576  C  CB  . ARG A 1 84  ? -16.431 18.735  10.937  1.00   21.88 ? 71   ARG A CB  1 
ATOM   577  C  CG  . ARG A 1 84  ? -16.300 19.229  12.374  1.00   29.77 ? 71   ARG A CG  1 
ATOM   578  C  CD  . ARG A 1 84  ? -15.477 20.489  12.540  1.00   37.79 ? 71   ARG A CD  1 
ATOM   579  N  NE  . ARG A 1 84  ? -15.222 20.661  13.977  1.00   36.71 ? 71   ARG A NE  1 
ATOM   580  C  CZ  . ARG A 1 84  ? -15.742 21.618  14.763  1.00   44.91 ? 71   ARG A CZ  1 
ATOM   581  N  NH1 . ARG A 1 84  ? -16.537 22.578  14.276  1.00   41.64 ? 71   ARG A NH1 1 
ATOM   582  N  NH2 . ARG A 1 84  ? -15.439 21.624  16.059  1.00   41.52 ? 71   ARG A NH2 1 
ATOM   583  N  N   . PHE A 1 85  ? -18.057 16.032  11.344  1.00   21.00 ? 72   PHE A N   1 
ATOM   584  C  CA  . PHE A 1 85  ? -18.941 15.230  12.205  1.00   18.90 ? 72   PHE A CA  1 
ATOM   585  C  C   . PHE A 1 85  ? -18.328 13.841  12.443  1.00   22.29 ? 72   PHE A C   1 
ATOM   586  O  O   . PHE A 1 85  ? -18.182 13.387  13.588  1.00   20.98 ? 72   PHE A O   1 
ATOM   587  C  CB  . PHE A 1 85  ? -20.301 15.043  11.505  1.00   20.53 ? 72   PHE A CB  1 
ATOM   588  C  CG  . PHE A 1 85  ? -21.298 14.185  12.300  1.00   20.24 ? 72   PHE A CG  1 
ATOM   589  C  CD1 . PHE A 1 85  ? -21.447 12.851  12.005  1.00   22.75 ? 72   PHE A CD1 1 
ATOM   590  C  CD2 . PHE A 1 85  ? -22.053 14.755  13.311  1.00   24.91 ? 72   PHE A CD2 1 
ATOM   591  C  CE1 . PHE A 1 85  ? -22.352 12.085  12.712  1.00   23.36 ? 72   PHE A CE1 1 
ATOM   592  C  CE2 . PHE A 1 85  ? -22.988 13.988  14.022  1.00   23.89 ? 72   PHE A CE2 1 
ATOM   593  C  CZ  . PHE A 1 85  ? -23.118 12.681  13.709  1.00   24.62 ? 72   PHE A CZ  1 
ATOM   594  N  N   . ILE A 1 86  ? -18.005 13.162  11.355  1.00   21.97 ? 73   ILE A N   1 
ATOM   595  C  CA  . ILE A 1 86  ? -17.641 11.753  11.425  1.00   24.07 ? 73   ILE A CA  1 
ATOM   596  C  C   . ILE A 1 86  ? -16.237 11.569  12.016  1.00   25.12 ? 73   ILE A C   1 
ATOM   597  O  O   . ILE A 1 86  ? -15.956 10.542  12.609  1.00   26.31 ? 73   ILE A O   1 
ATOM   598  C  CB  . ILE A 1 86  ? -17.859 11.014  10.050  1.00   23.71 ? 73   ILE A CB  1 
ATOM   599  C  CG1 . ILE A 1 86  ? -18.084 9.502   10.246  1.00   26.45 ? 73   ILE A CG1 1 
ATOM   600  C  CG2 . ILE A 1 86  ? -16.722 11.308  9.079   1.00   23.36 ? 73   ILE A CG2 1 
ATOM   601  C  CD1 . ILE A 1 86  ? -19.271 9.176   11.103  1.00   26.25 ? 73   ILE A CD1 1 
ATOM   602  N  N   . THR A 1 87  ? -15.381 12.581  11.903  1.00   23.56 ? 74   THR A N   1 
ATOM   603  C  CA  . THR A 1 87  ? -14.028 12.489  12.477  1.00   25.31 ? 74   THR A CA  1 
ATOM   604  C  C   . THR A 1 87  ? -13.975 12.952  13.925  1.00   26.64 ? 74   THR A C   1 
ATOM   605  O  O   . THR A 1 87  ? -12.943 12.792  14.577  1.00   28.67 ? 74   THR A O   1 
ATOM   606  C  CB  . THR A 1 87  ? -12.960 13.215  11.624  1.00   27.01 ? 74   THR A CB  1 
ATOM   607  O  OG1 . THR A 1 87  ? -13.222 14.623  11.595  1.00   26.42 ? 74   THR A OG1 1 
ATOM   608  C  CG2 . THR A 1 87  ? -12.933 12.660  10.220  1.00   29.46 ? 74   THR A CG2 1 
ATOM   609  N  N   . HIS A 1 88  ? -15.047 13.560  14.420  1.00   25.36 ? 75   HIS A N   1 
ATOM   610  C  CA  . HIS A 1 88  ? -15.096 13.983  15.814  1.00   26.24 ? 75   HIS A CA  1 
ATOM   611  C  C   . HIS A 1 88  ? -16.000 13.142  16.732  1.00   28.00 ? 75   HIS A C   1 
ATOM   612  O  O   . HIS A 1 88  ? -15.848 13.164  17.956  1.00   29.89 ? 75   HIS A O   1 
ATOM   613  C  CB  . HIS A 1 88  ? -15.453 15.458  15.911  1.00   27.93 ? 75   HIS A CB  1 
ATOM   614  C  CG  . HIS A 1 88  ? -14.347 16.370  15.468  1.00   28.64 ? 75   HIS A CG  1 
ATOM   615  N  ND1 . HIS A 1 88  ? -13.961 16.500  14.150  1.00   32.38 ? 75   HIS A ND1 1 
ATOM   616  C  CD2 . HIS A 1 88  ? -13.540 17.205  16.176  1.00   34.64 ? 75   HIS A CD2 1 
ATOM   617  C  CE1 . HIS A 1 88  ? -12.961 17.359  14.063  1.00   34.78 ? 75   HIS A CE1 1 
ATOM   618  N  NE2 . HIS A 1 88  ? -12.696 17.809  15.276  1.00   32.81 ? 75   HIS A NE2 1 
ATOM   619  N  N   . THR A 1 89  ? -16.907 12.359  16.157  1.00   26.30 ? 76   THR A N   1 
ATOM   620  C  CA  . THR A 1 89  ? -17.880 11.620  16.962  1.00   27.13 ? 76   THR A CA  1 
ATOM   621  C  C   . THR A 1 89  ? -17.250 10.409  17.633  1.00   26.90 ? 76   THR A C   1 
ATOM   622  O  O   . THR A 1 89  ? -16.449 9.707   17.013  1.00   28.14 ? 76   THR A O   1 
ATOM   623  C  CB  . THR A 1 89  ? -19.076 11.135  16.092  1.00   28.49 ? 76   THR A CB  1 
ATOM   624  O  OG1 . THR A 1 89  ? -20.061 10.523  16.950  1.00   28.96 ? 76   THR A OG1 1 
ATOM   625  C  CG2 . THR A 1 89  ? -18.603 10.114  15.060  1.00   27.72 ? 76   THR A CG2 1 
ATOM   626  N  N   . GLU A 1 90  ? -17.676 10.144  18.867  1.00   26.93 ? 77   GLU A N   1 
ATOM   627  C  CA  . GLU A 1 90  ? -17.318 8.928   19.620  1.00   28.20 ? 77   GLU A CA  1 
ATOM   628  C  C   . GLU A 1 90  ? -18.502 7.968   19.798  1.00   27.29 ? 77   GLU A C   1 
ATOM   629  O  O   . GLU A 1 90  ? -18.374 6.873   20.395  1.00   28.41 ? 77   GLU A O   1 
ATOM   630  C  CB  . GLU A 1 90  ? -16.735 9.319   20.981  1.00   29.57 ? 77   GLU A CB  1 
ATOM   631  C  CG  . GLU A 1 90  ? -15.461 10.156  20.822  1.00   37.38 ? 77   GLU A CG  1 
ATOM   632  C  CD  . GLU A 1 90  ? -14.738 10.375  22.127  1.00   46.46 ? 77   GLU A CD  1 
ATOM   633  O  OE1 . GLU A 1 90  ? -14.343 9.372   22.761  1.00   51.91 ? 77   GLU A OE1 1 
ATOM   634  O  OE2 . GLU A 1 90  ? -14.555 11.549  22.512  1.00   52.73 ? 77   GLU A OE2 1 
ATOM   635  N  N   . HIS A 1 91  ? -19.666 8.396   19.310  1.00   25.87 ? 78   HIS A N   1 
ATOM   636  C  CA  . HIS A 1 91  ? -20.896 7.587   19.342  1.00   25.44 ? 78   HIS A CA  1 
ATOM   637  C  C   . HIS A 1 91  ? -21.824 8.127   18.277  1.00   23.25 ? 78   HIS A C   1 
ATOM   638  O  O   . HIS A 1 91  ? -22.660 8.993   18.503  1.00   21.14 ? 78   HIS A O   1 
ATOM   639  C  CB  . HIS A 1 91  ? -21.560 7.578   20.702  1.00   28.01 ? 78   HIS A CB  1 
ATOM   640  C  CG  . HIS A 1 91  ? -21.303 8.800   21.510  1.00   33.91 ? 78   HIS A CG  1 
ATOM   641  N  ND1 . HIS A 1 91  ? -21.681 10.062  21.099  1.00   38.94 ? 78   HIS A ND1 1 
ATOM   642  C  CD2 . HIS A 1 91  ? -20.695 8.962   22.711  1.00   36.21 ? 78   HIS A CD2 1 
ATOM   643  C  CE1 . HIS A 1 91  ? -21.322 10.948  22.015  1.00   37.58 ? 78   HIS A CE1 1 
ATOM   644  N  NE2 . HIS A 1 91  ? -20.722 10.304  23.002  1.00   36.50 ? 78   HIS A NE2 1 
ATOM   645  N  N   . VAL A 1 92  ? -21.650 7.546   17.108  1.00   22.42 ? 79   VAL A N   1 
ATOM   646  C  CA  . VAL A 1 92  ? -22.176 8.100   15.883  1.00   22.78 ? 79   VAL A CA  1 
ATOM   647  C  C   . VAL A 1 92  ? -23.694 8.218   15.943  1.00   22.39 ? 79   VAL A C   1 
ATOM   648  O  O   . VAL A 1 92  ? -24.271 9.222   15.534  1.00   22.77 ? 79   VAL A O   1 
ATOM   649  C  CB  . VAL A 1 92  ? -21.819 7.180   14.693  1.00   25.18 ? 79   VAL A CB  1 
ATOM   650  C  CG1 . VAL A 1 92  ? -22.474 7.677   13.457  1.00   30.94 ? 79   VAL A CG1 1 
ATOM   651  C  CG2 . VAL A 1 92  ? -20.284 7.106   14.483  1.00   27.39 ? 79   VAL A CG2 1 
ATOM   652  N  N   . ASP A 1 93  ? -24.376 7.159   16.395  1.00   19.25 ? 80   ASP A N   1 
ATOM   653  C  CA  . ASP A 1 93  ? -25.820 7.243   16.322  1.00   18.68 ? 80   ASP A CA  1 
ATOM   654  C  C   . ASP A 1 93  ? -26.401 8.292   17.232  1.00   20.50 ? 80   ASP A C   1 
ATOM   655  O  O   . ASP A 1 93  ? -27.272 9.067   16.789  1.00   21.67 ? 80   ASP A O   1 
ATOM   656  C  CB  . ASP A 1 93  ? -26.502 5.865   16.512  1.00   17.39 ? 80   ASP A CB  1 
ATOM   657  C  CG  . ASP A 1 93  ? -25.992 5.059   17.703  1.00   19.01 ? 80   ASP A CG  1 
ATOM   658  O  OD1 . ASP A 1 93  ? -25.093 5.468   18.450  1.00   18.48 ? 80   ASP A OD1 1 
ATOM   659  O  OD2 . ASP A 1 93  ? -26.564 3.958   17.890  1.00   18.17 ? 80   ASP A OD2 1 
ATOM   660  N  N   . LEU A 1 94  ? -25.893 8.353   18.462  1.00   21.19 ? 81   LEU A N   1 
ATOM   661  C  CA  . LEU A 1 94  ? -26.354 9.391   19.400  1.00   22.09 ? 81   LEU A CA  1 
ATOM   662  C  C   . LEU A 1 94  ? -26.169 10.806  18.850  1.00   22.98 ? 81   LEU A C   1 
ATOM   663  O  O   . LEU A 1 94  ? -27.023 11.702  19.003  1.00   25.59 ? 81   LEU A O   1 
ATOM   664  C  CB  . LEU A 1 94  ? -25.549 9.296   20.706  1.00   22.67 ? 81   LEU A CB  1 
ATOM   665  C  CG  . LEU A 1 94  ? -25.673 7.985   21.473  1.00   27.31 ? 81   LEU A CG  1 
ATOM   666  C  CD1 . LEU A 1 94  ? -25.042 8.141   22.866  1.00   29.28 ? 81   LEU A CD1 1 
ATOM   667  C  CD2 . LEU A 1 94  ? -27.115 7.601   21.629  1.00   30.22 ? 81   LEU A CD2 1 
ATOM   668  N  N   . ASP A 1 95  ? -25.048 10.995  18.196  1.00   21.47 ? 82   ASP A N   1 
ATOM   669  C  CA  . ASP A 1 95  ? -24.658 12.364  17.767  1.00   23.64 ? 82   ASP A CA  1 
ATOM   670  C  C   . ASP A 1 95  ? -25.585 12.906  16.673  1.00   24.33 ? 82   ASP A C   1 
ATOM   671  O  O   . ASP A 1 95  ? -25.741 14.137  16.555  1.00   24.94 ? 82   ASP A O   1 
ATOM   672  C  CB  . ASP A 1 95  ? -23.187 12.383  17.400  1.00   23.12 ? 82   ASP A CB  1 
ATOM   673  C  CG  . ASP A 1 95  ? -22.276 12.274  18.654  1.00   27.93 ? 82   ASP A CG  1 
ATOM   674  O  OD1 . ASP A 1 95  ? -22.796 12.360  19.792  1.00   30.30 ? 82   ASP A OD1 1 
ATOM   675  O  OD2 . ASP A 1 95  ? -21.055 12.074  18.468  1.00   35.23 ? 82   ASP A OD2 1 
ATOM   676  N  N   . PHE A 1 96  ? -26.224 12.021  15.897  1.00   24.05 ? 83   PHE A N   1 
ATOM   677  C  CA  . PHE A 1 96  ? -27.178 12.443  14.858  1.00   23.70 ? 83   PHE A CA  1 
ATOM   678  C  C   . PHE A 1 96  ? -28.348 13.156  15.490  1.00   26.52 ? 83   PHE A C   1 
ATOM   679  O  O   . PHE A 1 96  ? -28.847 14.153  14.963  1.00   26.80 ? 83   PHE A O   1 
ATOM   680  C  CB  . PHE A 1 96  ? -27.682 11.248  14.021  1.00   22.90 ? 83   PHE A CB  1 
ATOM   681  C  CG  . PHE A 1 96  ? -26.902 10.997  12.762  1.00   21.92 ? 83   PHE A CG  1 
ATOM   682  C  CD1 . PHE A 1 96  ? -25.823 10.080  12.705  1.00   25.94 ? 83   PHE A CD1 1 
ATOM   683  C  CD2 . PHE A 1 96  ? -27.226 11.679  11.558  1.00   22.52 ? 83   PHE A CD2 1 
ATOM   684  C  CE1 . PHE A 1 96  ? -25.107 9.888   11.550  1.00   23.13 ? 83   PHE A CE1 1 
ATOM   685  C  CE2 . PHE A 1 96  ? -26.512 11.413  10.370  1.00   20.61 ? 83   PHE A CE2 1 
ATOM   686  C  CZ  . PHE A 1 96  ? -25.439 10.539  10.360  1.00   26.27 ? 83   PHE A CZ  1 
ATOM   687  N  N   . ASN A 1 97  ? -28.786 12.633  16.641  1.00   27.02 ? 84   ASN A N   1 
ATOM   688  C  CA  . ASN A 1 97  ? -29.862 13.215  17.375  1.00   31.03 ? 84   ASN A CA  1 
ATOM   689  C  C   . ASN A 1 97  ? -29.610 14.683  17.810  1.00   29.04 ? 84   ASN A C   1 
ATOM   690  O  O   . ASN A 1 97  ? -30.499 15.541  17.783  1.00   31.72 ? 84   ASN A O   1 
ATOM   691  C  CB  . ASN A 1 97  ? -30.034 12.308  18.588  1.00   33.52 ? 84   ASN A CB  1 
ATOM   692  C  CG  . ASN A 1 97  ? -31.444 11.961  18.861  1.00   35.67 ? 84   ASN A CG  1 
ATOM   693  O  OD1 . ASN A 1 97  ? -32.205 11.566  17.982  1.00   38.85 ? 84   ASN A OD1 1 
ATOM   694  N  ND2 . ASN A 1 97  ? -31.812 12.073  20.112  1.00   41.28 ? 84   ASN A ND2 1 
ATOM   695  N  N   . SER A 1 98  ? -28.375 14.993  18.212  1.00   31.75 ? 85   SER A N   1 
ATOM   696  C  CA  . SER A 1 98  ? -28.012 16.346  18.619  1.00   32.01 ? 85   SER A CA  1 
ATOM   697  C  C   . SER A 1 98  ? -28.108 17.386  17.469  1.00   29.80 ? 85   SER A C   1 
ATOM   698  O  O   . SER A 1 98  ? -28.632 18.499  17.623  1.00   33.02 ? 85   SER A O   1 
ATOM   699  C  CB  . SER A 1 98  ? -26.598 16.331  19.206  1.00   33.41 ? 85   SER A CB  1 
ATOM   700  O  OG  . SER A 1 98  ? -26.433 15.213  20.087  1.00   37.87 ? 85   SER A OG  1 
ATOM   701  N  N   . VAL A 1 99  ? -27.631 16.987  16.284  1.00   28.49 ? 86   VAL A N   1 
ATOM   702  C  CA  . VAL A 1 99  ? -27.750 17.820  15.101  1.00   26.24 ? 86   VAL A CA  1 
ATOM   703  C  C   . VAL A 1 99  ? -29.217 18.088  14.771  1.00   23.23 ? 86   VAL A C   1 
ATOM   704  O  O   . VAL A 1 99  ? -29.628 19.236  14.581  1.00   24.28 ? 86   VAL A O   1 
ATOM   705  C  CB  . VAL A 1 99  ? -27.063 17.137  13.909  1.00   25.16 ? 86   VAL A CB  1 
ATOM   706  C  CG1 . VAL A 1 99  ? -27.240 17.994  12.662  1.00   24.50 ? 86   VAL A CG1 1 
ATOM   707  C  CG2 . VAL A 1 99  ? -25.566 16.952  14.203  1.00   26.22 ? 86   VAL A CG2 1 
ATOM   708  N  N   . PHE A 1 100 ? -30.006 16.991  14.782  1.00   23.79 ? 87   PHE A N   1 
ATOM   709  C  CA  . PHE A 1 100 ? -31.411 17.081  14.502  1.00   23.18 ? 87   PHE A CA  1 
ATOM   710  C  C   . PHE A 1 100 ? -32.140 18.129  15.409  1.00   21.04 ? 87   PHE A C   1 
ATOM   711  O  O   . PHE A 1 100 ? -32.829 19.050  14.932  1.00   24.08 ? 87   PHE A O   1 
ATOM   712  C  CB  . PHE A 1 100 ? -32.087 15.703  14.557  1.00   20.80 ? 87   PHE A CB  1 
ATOM   713  C  CG  . PHE A 1 100 ? -33.536 15.770  14.240  1.00   23.20 ? 87   PHE A CG  1 
ATOM   714  C  CD1 . PHE A 1 100 ? -33.972 15.578  12.941  1.00   24.02 ? 87   PHE A CD1 1 
ATOM   715  C  CD2 . PHE A 1 100 ? -34.470 16.053  15.233  1.00   22.37 ? 87   PHE A CD2 1 
ATOM   716  C  CE1 . PHE A 1 100 ? -35.323 15.670  12.634  1.00   22.52 ? 87   PHE A CE1 1 
ATOM   717  C  CE2 . PHE A 1 100 ? -35.823 16.155  14.940  1.00   22.66 ? 87   PHE A CE2 1 
ATOM   718  C  CZ  . PHE A 1 100 ? -36.250 15.972  13.613  1.00   22.39 ? 87   PHE A CZ  1 
ATOM   719  N  N   . LEU A 1 101 ? -31.988 17.958  16.726  1.00   23.69 ? 88   LEU A N   1 
ATOM   720  C  CA  . LEU A 1 101 ? -32.705 18.860  17.640  1.00   24.28 ? 88   LEU A CA  1 
ATOM   721  C  C   . LEU A 1 101 ? -32.341 20.338  17.524  1.00   24.14 ? 88   LEU A C   1 
ATOM   722  O  O   . LEU A 1 101 ? -33.216 21.215  17.584  1.00   25.07 ? 88   LEU A O   1 
ATOM   723  C  CB  . LEU A 1 101 ? -32.537 18.392  19.084  1.00   24.69 ? 88   LEU A CB  1 
ATOM   724  C  CG  . LEU A 1 101 ? -33.144 17.032  19.426  1.00   24.13 ? 88   LEU A CG  1 
ATOM   725  C  CD1 . LEU A 1 101 ? -32.655 16.562  20.758  1.00   26.43 ? 88   LEU A CD1 1 
ATOM   726  C  CD2 . LEU A 1 101 ? -34.655 17.067  19.402  1.00   29.46 ? 88   LEU A CD2 1 
ATOM   727  N  N   . GLU A 1 102 ? -31.064 20.590  17.276  1.00   26.43 ? 89   GLU A N   1 
ATOM   728  C  CA  . GLU A 1 102 ? -30.595 21.946  17.037  1.00   27.67 ? 89   GLU A CA  1 
ATOM   729  C  C   . GLU A 1 102 ? -31.104 22.607  15.742  1.00   26.27 ? 89   GLU A C   1 
ATOM   730  O  O   . GLU A 1 102 ? -31.094 23.806  15.617  1.00   25.95 ? 89   GLU A O   1 
ATOM   731  C  CB  . GLU A 1 102 ? -29.059 22.013  17.092  1.00   30.34 ? 89   GLU A CB  1 
ATOM   732  C  CG  . GLU A 1 102 ? -28.491 21.887  18.504  1.00   30.95 ? 89   GLU A CG  1 
ATOM   733  C  CD  . GLU A 1 102 ? -28.815 23.073  19.437  1.00   29.97 ? 89   GLU A CD  1 
ATOM   734  O  OE1 . GLU A 1 102 ? -29.463 24.065  19.005  1.00   30.37 ? 89   GLU A OE1 1 
ATOM   735  O  OE2 . GLU A 1 102 ? -28.417 22.998  20.626  1.00   28.95 ? 89   GLU A OE2 1 
ATOM   736  N  N   . ILE A 1 103 ? -31.543 21.812  14.762  1.00   25.39 ? 90   ILE A N   1 
ATOM   737  C  CA  . ILE A 1 103 ? -32.127 22.369  13.556  1.00   25.91 ? 90   ILE A CA  1 
ATOM   738  C  C   . ILE A 1 103 ? -33.612 22.640  13.820  1.00   27.17 ? 90   ILE A C   1 
ATOM   739  O  O   . ILE A 1 103 ? -34.102 23.720  13.489  1.00   30.92 ? 90   ILE A O   1 
ATOM   740  C  CB  . ILE A 1 103 ? -31.951 21.366  12.340  1.00   25.62 ? 90   ILE A CB  1 
ATOM   741  C  CG1 . ILE A 1 103 ? -30.473 21.048  12.057  1.00   24.35 ? 90   ILE A CG1 1 
ATOM   742  C  CG2 . ILE A 1 103 ? -32.691 21.832  11.097  1.00   25.18 ? 90   ILE A CG2 1 
ATOM   743  C  CD1 . ILE A 1 103 ? -30.265 19.868  11.023  1.00   27.44 ? 90   ILE A CD1 1 
ATOM   744  N  N   . PHE A 1 104 ? -34.328 21.667  14.403  1.00   27.09 ? 91   PHE A N   1 
ATOM   745  C  CA  . PHE A 1 104 ? -35.807 21.677  14.411  1.00   27.63 ? 91   PHE A CA  1 
ATOM   746  C  C   . PHE A 1 104 ? -36.529 22.186  15.635  1.00   29.60 ? 91   PHE A C   1 
ATOM   747  O  O   . PHE A 1 104 ? -37.731 22.512  15.556  1.00   30.75 ? 91   PHE A O   1 
ATOM   748  C  CB  . PHE A 1 104 ? -36.372 20.319  14.031  1.00   27.70 ? 91   PHE A CB  1 
ATOM   749  C  CG  . PHE A 1 104 ? -36.039 19.957  12.637  1.00   24.90 ? 91   PHE A CG  1 
ATOM   750  C  CD1 . PHE A 1 104 ? -36.655 20.627  11.574  1.00   26.33 ? 91   PHE A CD1 1 
ATOM   751  C  CD2 . PHE A 1 104 ? -35.043 19.022  12.376  1.00   23.51 ? 91   PHE A CD2 1 
ATOM   752  C  CE1 . PHE A 1 104 ? -36.301 20.332  10.279  1.00   25.98 ? 91   PHE A CE1 1 
ATOM   753  C  CE2 . PHE A 1 104 ? -34.672 18.722  11.063  1.00   25.03 ? 91   PHE A CE2 1 
ATOM   754  C  CZ  . PHE A 1 104 ? -35.302 19.368  10.023  1.00   27.21 ? 91   PHE A CZ  1 
ATOM   755  N  N   . HIS A 1 105 ? -35.830 22.240  16.756  1.00   30.71 ? 92   HIS A N   1 
ATOM   756  C  CA  . HIS A 1 105 ? -36.409 22.895  17.930  1.00   32.25 ? 92   HIS A CA  1 
ATOM   757  C  C   . HIS A 1 105 ? -35.829 24.302  18.208  1.00   33.87 ? 92   HIS A C   1 
ATOM   758  O  O   . HIS A 1 105 ? -35.984 24.861  19.301  1.00   34.77 ? 92   HIS A O   1 
ATOM   759  C  CB  . HIS A 1 105 ? -36.317 21.984  19.141  1.00   33.22 ? 92   HIS A CB  1 
ATOM   760  C  CG  . HIS A 1 105 ? -37.190 20.766  19.043  1.00   33.61 ? 92   HIS A CG  1 
ATOM   761  N  ND1 . HIS A 1 105 ? -38.642 21.069  19.316  0.0000 37.90 ? 92   HIS A ND1 1 
ATOM   762  C  CD2 . HIS A 1 105 ? -37.449 19.927  18.009  1.00   38.92 ? 92   HIS A CD2 1 
ATOM   763  C  CE1 . HIS A 1 105 ? -39.267 19.948  18.999  0.0000 34.42 ? 92   HIS A CE1 1 
ATOM   764  N  NE2 . HIS A 1 105 ? -38.406 19.145  18.404  0.0000 28.42 ? 92   HIS A NE2 1 
ATOM   765  N  N   . ARG A 1 106 ? -35.206 24.880  17.192  1.00   35.27 ? 93   ARG A N   1 
ATOM   766  C  CA  . ARG A 1 106 ? -34.645 26.228  17.270  1.00   37.27 ? 93   ARG A CA  1 
ATOM   767  C  C   . ARG A 1 106 ? -35.437 27.161  16.342  1.00   39.84 ? 93   ARG A C   1 
ATOM   768  O  O   . ARG A 1 106 ? -34.908 27.673  15.345  1.00   40.52 ? 93   ARG A O   1 
ATOM   769  C  CB  . ARG A 1 106 ? -33.149 26.203  16.910  1.00   36.24 ? 93   ARG A CB  1 
ATOM   770  C  CG  . ARG A 1 106 ? -32.278 25.458  17.935  1.00   31.47 ? 93   ARG A CG  1 
ATOM   771  C  CD  . ARG A 1 106 ? -32.064 26.307  19.204  1.00   32.17 ? 93   ARG A CD  1 
ATOM   772  N  NE  . ARG A 1 106 ? -31.522 27.637  18.881  1.00   34.99 ? 93   ARG A NE  1 
ATOM   773  C  CZ  . ARG A 1 106 ? -30.223 27.924  18.741  1.00   34.25 ? 93   ARG A CZ  1 
ATOM   774  N  NH1 . ARG A 1 106 ? -29.291 26.976  18.916  1.00   31.72 ? 93   ARG A NH1 1 
ATOM   775  N  NH2 . ARG A 1 106 ? -29.856 29.174  18.434  1.00   32.10 ? 93   ARG A NH2 1 
ATOM   776  N  N   . GLY A 1 107 ? -36.699 27.398  16.707  1.00   42.24 ? 94   GLY A N   1 
ATOM   777  C  CA  . GLY A 1 107 ? -37.685 27.976  15.787  1.00   45.34 ? 94   GLY A CA  1 
ATOM   778  C  C   . GLY A 1 107 ? -38.574 26.880  15.208  1.00   47.45 ? 94   GLY A C   1 
ATOM   779  O  O   . GLY A 1 107 ? -38.249 25.689  15.310  1.00   48.89 ? 94   GLY A O   1 
ATOM   780  N  N   . ASP A 1 108 ? -39.702 27.256  14.606  1.00   48.73 ? 95   ASP A N   1 
ATOM   781  C  CA  . ASP A 1 108 ? -40.603 26.263  14.000  1.00   48.81 ? 95   ASP A CA  1 
ATOM   782  C  C   . ASP A 1 108 ? -39.901 25.481  12.855  1.00   48.36 ? 95   ASP A C   1 
ATOM   783  O  O   . ASP A 1 108 ? -38.995 26.016  12.198  1.00   49.23 ? 95   ASP A O   1 
ATOM   784  C  CB  . ASP A 1 108 ? -41.879 26.953  13.500  1.00   49.13 ? 95   ASP A CB  1 
ATOM   785  C  CG  . ASP A 1 108 ? -42.216 27.361  14.847  0.0000 48.28 ? 95   ASP A CG  1 
ATOM   786  O  OD1 . ASP A 1 108 ? -41.968 27.521  16.044  0.0000 50.57 ? 95   ASP A OD1 1 
ATOM   787  O  OD2 . ASP A 1 108 ? -43.369 27.522  14.426  0.0000 49.93 ? 95   ASP A OD2 1 
ATOM   788  N  N   . PRO A 1 109 ? -40.294 24.211  12.625  1.00   46.54 ? 96   PRO A N   1 
ATOM   789  C  CA  . PRO A 1 109 ? -39.737 23.537  11.451  1.00   45.26 ? 96   PRO A CA  1 
ATOM   790  C  C   . PRO A 1 109 ? -40.289 24.169  10.174  1.00   43.30 ? 96   PRO A C   1 
ATOM   791  O  O   . PRO A 1 109 ? -41.386 24.741  10.192  1.00   44.33 ? 96   PRO A O   1 
ATOM   792  C  CB  . PRO A 1 109 ? -40.242 22.096  11.593  1.00   45.19 ? 96   PRO A CB  1 
ATOM   793  C  CG  . PRO A 1 109 ? -40.726 21.973  13.015  1.00   45.09 ? 96   PRO A CG  1 
ATOM   794  C  CD  . PRO A 1 109 ? -41.211 23.337  13.375  1.00   46.75 ? 96   PRO A CD  1 
ATOM   795  N  N   . SER A 1 110 ? -39.522 24.092  9.091   1.00   39.60 ? 97   SER A N   1 
ATOM   796  C  CA  . SER A 1 110 ? -39.937 24.608  7.798   1.00   36.97 ? 97   SER A CA  1 
ATOM   797  C  C   . SER A 1 110 ? -39.569 23.590  6.729   1.00   35.17 ? 97   SER A C   1 
ATOM   798  O  O   . SER A 1 110 ? -38.765 22.681  6.973   1.00   34.19 ? 97   SER A O   1 
ATOM   799  C  CB  . SER A 1 110 ? -39.258 25.949  7.510   1.00   37.25 ? 97   SER A CB  1 
ATOM   800  O  OG  . SER A 1 110 ? -37.862 25.791  7.286   1.00   38.53 ? 97   SER A OG  1 
ATOM   801  N  N   . LEU A 1 111 ? -40.149 23.737  5.544   1.00   32.88 ? 98   LEU A N   1 
ATOM   802  C  CA  . LEU A 1 111 ? -39.871 22.830  4.443   1.00   31.00 ? 98   LEU A CA  1 
ATOM   803  C  C   . LEU A 1 111 ? -38.388 22.802  4.114   1.00   28.65 ? 98   LEU A C   1 
ATOM   804  O  O   . LEU A 1 111 ? -37.809 21.739  3.938   1.00   27.97 ? 98   LEU A O   1 
ATOM   805  C  CB  . LEU A 1 111 ? -40.663 23.223  3.194   1.00   32.77 ? 98   LEU A CB  1 
ATOM   806  C  CG  . LEU A 1 111 ? -40.390 22.384  1.941   1.00   32.97 ? 98   LEU A CG  1 
ATOM   807  C  CD1 . LEU A 1 111 ? -41.062 21.009  1.990   1.00   38.17 ? 98   LEU A CD1 1 
ATOM   808  C  CD2 . LEU A 1 111 ? -40.836 23.163  0.719   1.00   39.11 ? 98   LEU A CD2 1 
ATOM   809  N  N   . GLY A 1 112 ? -37.791 23.981  4.023   1.00   27.40 ? 99   GLY A N   1 
ATOM   810  C  CA  . GLY A 1 112 ? -36.385 24.123  3.699   1.00   23.33 ? 99   GLY A CA  1 
ATOM   811  C  C   . GLY A 1 112 ? -35.488 23.415  4.705   1.00   21.93 ? 99   GLY A C   1 
ATOM   812  O  O   . GLY A 1 112 ? -34.523 22.758  4.305   1.00   23.02 ? 99   GLY A O   1 
ATOM   813  N  N   . ARG A 1 113 ? -35.765 23.594  5.991   1.00   23.36 ? 100  ARG A N   1 
ATOM   814  C  CA  . ARG A 1 113 ? -34.935 22.966  6.991   1.00   22.28 ? 100  ARG A CA  1 
ATOM   815  C  C   . ARG A 1 113 ? -35.101 21.455  6.925   1.00   21.75 ? 100  ARG A C   1 
ATOM   816  O  O   . ARG A 1 113 ? -34.102 20.713  7.064   1.00   21.92 ? 100  ARG A O   1 
ATOM   817  C  CB  . ARG A 1 113 ? -35.232 23.486  8.391   1.00   23.93 ? 100  ARG A CB  1 
ATOM   818  C  CG  . ARG A 1 113 ? -34.683 24.889  8.619   1.00   27.50 ? 100  ARG A CG  1 
ATOM   819  C  CD  . ARG A 1 113 ? -34.949 25.315  10.043  1.00   29.55 ? 100  ARG A CD  1 
ATOM   820  N  NE  . ARG A 1 113 ? -34.621 26.723  10.204  1.00   32.62 ? 100  ARG A NE  1 
ATOM   821  C  CZ  . ARG A 1 113 ? -34.591 27.362  11.368  1.00   29.58 ? 100  ARG A CZ  1 
ATOM   822  N  NH1 . ARG A 1 113 ? -34.863 26.729  12.497  1.00   32.94 ? 100  ARG A NH1 1 
ATOM   823  N  NH2 . ARG A 1 113 ? -34.283 28.649  11.376  1.00   32.81 ? 100  ARG A NH2 1 
ATOM   824  N  N   . ALA A 1 114 ? -36.339 21.008  6.703   1.00   21.73 ? 101  ALA A N   1 
ATOM   825  C  CA  . ALA A 1 114 ? -36.590 19.573  6.575   1.00   21.69 ? 101  ALA A CA  1 
ATOM   826  C  C   . ALA A 1 114 ? -35.832 18.981  5.392   1.00   20.81 ? 101  ALA A C   1 
ATOM   827  O  O   . ALA A 1 114 ? -35.166 17.964  5.542   1.00   20.85 ? 101  ALA A O   1 
ATOM   828  C  CB  . ALA A 1 114 ? -38.052 19.280  6.478   1.00   24.40 ? 101  ALA A CB  1 
ATOM   829  N  N   . LEU A 1 115 ? -35.874 19.638  4.238   1.00   21.45 ? 102  LEU A N   1 
ATOM   830  C  CA  . LEU A 1 115 ? -35.138 19.155  3.096   1.00   19.78 ? 102  LEU A CA  1 
ATOM   831  C  C   . LEU A 1 115 ? -33.629 19.255  3.306   1.00   18.37 ? 102  LEU A C   1 
ATOM   832  O  O   . LEU A 1 115 ? -32.898 18.388  2.825   1.00   19.94 ? 102  LEU A O   1 
ATOM   833  C  CB  . LEU A 1 115 ? -35.559 19.908  1.821   1.00   20.22 ? 102  LEU A CB  1 
ATOM   834  C  CG  . LEU A 1 115 ? -37.009 19.653  1.420   1.00   22.36 ? 102  LEU A CG  1 
ATOM   835  C  CD1 . LEU A 1 115 ? -37.281 20.522  0.177   1.00   29.39 ? 102  LEU A CD1 1 
ATOM   836  C  CD2 . LEU A 1 115 ? -37.283 18.216  1.100   1.00   25.96 ? 102  LEU A CD2 1 
ATOM   837  N  N   . ALA A 1 116 ? -33.150 20.331  3.963   1.00   19.04 ? 103  ALA A N   1 
ATOM   838  C  CA  . ALA A 1 116 ? -31.721 20.479  4.204   1.00   19.66 ? 103  ALA A CA  1 
ATOM   839  C  C   . ALA A 1 116 ? -31.234 19.269  5.036   1.00   19.02 ? 103  ALA A C   1 
ATOM   840  O  O   . ALA A 1 116 ? -30.201 18.688  4.731   1.00   20.06 ? 103  ALA A O   1 
ATOM   841  C  CB  . ALA A 1 116 ? -31.438 21.766  4.938   1.00   22.22 ? 103  ALA A CB  1 
ATOM   842  N  N   . TRP A 1 117 ? -31.988 18.927  6.075   1.00   19.25 ? 104  TRP A N   1 
ATOM   843  C  CA  . TRP A 1 117 ? -31.643 17.764  6.899   1.00   18.82 ? 104  TRP A CA  1 
ATOM   844  C  C   . TRP A 1 117 ? -31.647 16.444  6.076   1.00   16.70 ? 104  TRP A C   1 
ATOM   845  O  O   . TRP A 1 117 ? -30.701 15.622  6.148   1.00   18.41 ? 104  TRP A O   1 
ATOM   846  C  CB  . TRP A 1 117 ? -32.651 17.644  8.047   1.00   18.73 ? 104  TRP A CB  1 
ATOM   847  C  CG  . TRP A 1 117 ? -32.604 16.318  8.742   1.00   16.74 ? 104  TRP A CG  1 
ATOM   848  C  CD1 . TRP A 1 117 ? -33.517 15.342  8.637   1.00   17.85 ? 104  TRP A CD1 1 
ATOM   849  C  CD2 . TRP A 1 117 ? -31.606 15.871  9.674   1.00   20.09 ? 104  TRP A CD2 1 
ATOM   850  N  NE1 . TRP A 1 117 ? -33.140 14.238  9.440   1.00   20.32 ? 104  TRP A NE1 1 
ATOM   851  C  CE2 . TRP A 1 117 ? -31.971 14.564  10.085  1.00   19.32 ? 104  TRP A CE2 1 
ATOM   852  C  CE3 . TRP A 1 117 ? -30.401 16.429  10.156  1.00   19.85 ? 104  TRP A CE3 1 
ATOM   853  C  CZ2 . TRP A 1 117 ? -31.177 13.827  11.023  1.00   20.53 ? 104  TRP A CZ2 1 
ATOM   854  C  CZ3 . TRP A 1 117 ? -29.618 15.694  11.057  1.00   22.31 ? 104  TRP A CZ3 1 
ATOM   855  C  CH2 . TRP A 1 117 ? -30.003 14.428  11.447  1.00   20.53 ? 104  TRP A CH2 1 
ATOM   856  N  N   . MET A 1 118 ? -32.705 16.231  5.283   1.00   16.67 ? 105  MET A N   1 
ATOM   857  C  CA  . MET A 1 118 ? -32.800 14.990  4.526   1.00   16.92 ? 105  MET A CA  1 
ATOM   858  C  C   . MET A 1 118 ? -31.662 14.881  3.500   1.00   16.57 ? 105  MET A C   1 
ATOM   859  O  O   . MET A 1 118 ? -31.096 13.822  3.314   1.00   17.27 ? 105  MET A O   1 
ATOM   860  C  CB  . MET A 1 118 ? -34.158 14.875  3.835   1.00   18.54 ? 105  MET A CB  1 
ATOM   861  C  CG  . MET A 1 118 ? -35.359 14.928  4.820   1.00   19.47 ? 105  MET A CG  1 
ATOM   862  S  SD  . MET A 1 118 ? -35.602 13.397  5.643   1.00   22.41 ? 105  MET A SD  1 
ATOM   863  C  CE  . MET A 1 118 ? -36.525 12.624  4.326   1.00   20.92 ? 105  MET A CE  1 
ATOM   864  N  N   . ALA A 1 119 ? -31.355 16.019  2.858   1.00   16.05 ? 106  ALA A N   1 
ATOM   865  C  CA  . ALA A 1 119 ? -30.260 16.027  1.891   1.00   17.16 ? 106  ALA A CA  1 
ATOM   866  C  C   . ALA A 1 119 ? -28.924 15.747  2.561   1.00   15.85 ? 106  ALA A C   1 
ATOM   867  O  O   . ALA A 1 119 ? -28.097 15.017  2.030   1.00   17.73 ? 106  ALA A O   1 
ATOM   868  C  CB  . ALA A 1 119 ? -30.206 17.409  1.200   1.00   16.08 ? 106  ALA A CB  1 
ATOM   869  N  N   . TRP A 1 120 ? -28.696 16.349  3.742   1.00   16.76 ? 107  TRP A N   1 
ATOM   870  C  CA  . TRP A 1 120 ? -27.458 16.078  4.478   1.00   17.87 ? 107  TRP A CA  1 
ATOM   871  C  C   . TRP A 1 120 ? -27.333 14.601  4.863   1.00   17.09 ? 107  TRP A C   1 
ATOM   872  O  O   . TRP A 1 120 ? -26.260 13.994  4.740   1.00   18.29 ? 107  TRP A O   1 
ATOM   873  C  CB  . TRP A 1 120 ? -27.384 16.998  5.702   1.00   19.05 ? 107  TRP A CB  1 
ATOM   874  C  CG  . TRP A 1 120 ? -26.063 17.026  6.356   1.00   18.83 ? 107  TRP A CG  1 
ATOM   875  C  CD1 . TRP A 1 120 ? -24.942 17.738  5.947   1.00   18.66 ? 107  TRP A CD1 1 
ATOM   876  C  CD2 . TRP A 1 120 ? -25.701 16.359  7.559   1.00   18.09 ? 107  TRP A CD2 1 
ATOM   877  N  NE1 . TRP A 1 120 ? -23.904 17.492  6.806   1.00   18.00 ? 107  TRP A NE1 1 
ATOM   878  C  CE2 . TRP A 1 120 ? -24.343 16.672  7.820   1.00   17.78 ? 107  TRP A CE2 1 
ATOM   879  C  CE3 . TRP A 1 120 ? -26.393 15.517  8.454   1.00   18.44 ? 107  TRP A CE3 1 
ATOM   880  C  CZ2 . TRP A 1 120 ? -23.657 16.180  8.933   1.00   19.49 ? 107  TRP A CZ2 1 
ATOM   881  C  CZ3 . TRP A 1 120 ? -25.691 15.014  9.576   1.00   20.71 ? 107  TRP A CZ3 1 
ATOM   882  C  CH2 . TRP A 1 120 ? -24.340 15.366  9.802   1.00   19.41 ? 107  TRP A CH2 1 
ATOM   883  N  N   . CYS A 1 121 ? -28.454 14.025  5.297   1.00   16.39 ? 108  CYS A N   1 
ATOM   884  C  CA  . CYS A 1 121 ? -28.430 12.600  5.633   1.00   15.56 ? 108  CYS A CA  1 
ATOM   885  C  C   . CYS A 1 121 ? -28.145 11.735  4.389   1.00   14.78 ? 108  CYS A C   1 
ATOM   886  O  O   . CYS A 1 121 ? -27.343 10.784  4.437   1.00   16.29 ? 108  CYS A O   1 
ATOM   887  C  CB  . CYS A 1 121 ? -29.760 12.160  6.281   1.00   16.94 ? 108  CYS A CB  1 
ATOM   888  S  SG  . CYS A 1 121 ? -29.912 12.818  7.975   1.00   18.08 ? 108  CYS A SG  1 
ATOM   889  N  N   . MET A 1 122 ? -28.854 12.065  3.290   1.00   15.85 ? 109  MET A N   1 
ATOM   890  C  CA  . MET A 1 122 ? -28.612 11.249  2.073   1.00   17.01 ? 109  MET A CA  1 
ATOM   891  C  C   . MET A 1 122 ? -27.168 11.401  1.599   1.00   15.99 ? 109  MET A C   1 
ATOM   892  O  O   . MET A 1 122 ? -26.527 10.428  1.182   1.00   17.44 ? 109  MET A O   1 
ATOM   893  C  CB  . MET A 1 122 ? -29.601 11.650  0.984   1.00   18.64 ? 109  MET A CB  1 
ATOM   894  C  CG  . MET A 1 122 ? -29.539 10.738  -0.213  1.00   16.97 ? 109  MET A CG  1 
ATOM   895  S  SD  . MET A 1 122 ? -30.747 11.196  -1.518  1.00   19.36 ? 109  MET A SD  1 
ATOM   896  C  CE  . MET A 1 122 ? -29.865 12.565  -2.315  1.00   19.91 ? 109  MET A CE  1 
ATOM   897  N  N   . HIS A 1 123 ? -26.625 12.615  1.671   1.00   16.30 ? 110  HIS A N   1 
ATOM   898  C  CA  . HIS A 1 123 ? -25.232 12.790  1.293   1.00   16.97 ? 110  HIS A CA  1 
ATOM   899  C  C   . HIS A 1 123 ? -24.279 11.994  2.216   1.00   16.27 ? 110  HIS A C   1 
ATOM   900  O  O   . HIS A 1 123 ? -23.298 11.407  1.758   1.00   17.74 ? 110  HIS A O   1 
ATOM   901  C  CB  . HIS A 1 123 ? -24.860 14.278  1.350   1.00   16.94 ? 110  HIS A CB  1 
ATOM   902  C  CG  . HIS A 1 123 ? -23.387 14.527  1.383   1.00   19.36 ? 110  HIS A CG  1 
ATOM   903  N  ND1 . HIS A 1 123 ? -22.595 14.598  0.253   1.00   24.54 ? 110  HIS A ND1 1 
ATOM   904  C  CD2 . HIS A 1 123 ? -22.563 14.670  2.440   1.00   17.26 ? 110  HIS A CD2 1 
ATOM   905  C  CE1 . HIS A 1 123 ? -21.341 14.825  0.629   1.00   19.12 ? 110  HIS A CE1 1 
ATOM   906  N  NE2 . HIS A 1 123 ? -21.294 14.841  1.947   1.00   26.26 ? 110  HIS A NE2 1 
ATOM   907  N  N   . ALA A 1 124 ? -24.583 11.955  3.527   1.00   15.86 ? 111  ALA A N   1 
ATOM   908  C  CA  . ALA A 1 124 ? -23.740 11.192  4.450   1.00   16.56 ? 111  ALA A CA  1 
ATOM   909  C  C   . ALA A 1 124 ? -23.781 9.716   4.078   1.00   16.40 ? 111  ALA A C   1 
ATOM   910  O  O   . ALA A 1 124 ? -22.756 9.068   4.029   1.00   16.68 ? 111  ALA A O   1 
ATOM   911  C  CB  . ALA A 1 124 ? -24.224 11.406  5.895   1.00   17.05 ? 111  ALA A CB  1 
ATOM   912  N  N   . CYS A 1 125 ? -24.989 9.178   3.865   1.00   16.50 ? 112  CYS A N   1 
ATOM   913  C  CA  . CYS A 1 125 ? -25.096 7.784   3.495   1.00   17.43 ? 112  CYS A CA  1 
ATOM   914  C  C   . CYS A 1 125 ? -24.355 7.473   2.198   1.00   18.36 ? 112  CYS A C   1 
ATOM   915  O  O   . CYS A 1 125 ? -23.599 6.506   2.126   1.00   17.77 ? 112  CYS A O   1 
ATOM   916  C  CB  . CYS A 1 125 ? -26.572 7.477   3.319   1.00   16.96 ? 112  CYS A CB  1 
ATOM   917  S  SG  . CYS A 1 125 ? -26.870 5.679   3.088   1.00   19.68 ? 112  CYS A SG  1 
ATOM   918  N  N   . ARG A 1 126 ? -24.482 8.353   1.208   1.00   17.11 ? 113  ARG A N   1 
ATOM   919  C  CA  . ARG A 1 126 ? -23.758 8.158   -0.057  1.00   17.45 ? 113  ARG A CA  1 
ATOM   920  C  C   . ARG A 1 126 ? -22.232 8.130   0.189   1.00   18.51 ? 113  ARG A C   1 
ATOM   921  O  O   . ARG A 1 126 ? -21.549 7.251   -0.323  1.00   18.99 ? 113  ARG A O   1 
ATOM   922  C  CB  . ARG A 1 126 ? -24.051 9.371   -0.947  1.00   17.95 ? 113  ARG A CB  1 
ATOM   923  C  CG  . ARG A 1 126 ? -23.350 9.266   -2.322  1.00   21.86 ? 113  ARG A CG  1 
ATOM   924  C  CD  . ARG A 1 126 ? -23.398 10.626  -3.005  1.00   21.23 ? 113  ARG A CD  1 
ATOM   925  N  NE  . ARG A 1 126 ? -24.785 10.889  -3.396  1.00   21.90 ? 113  ARG A NE  1 
ATOM   926  C  CZ  . ARG A 1 126 ? -25.251 12.005  -3.943  1.00   24.71 ? 113  ARG A CZ  1 
ATOM   927  N  NH1 . ARG A 1 126 ? -26.525 12.046  -4.288  1.00   23.43 ? 113  ARG A NH1 1 
ATOM   928  N  NH2 . ARG A 1 126 ? -24.455 13.057  -4.153  1.00   25.73 ? 113  ARG A NH2 1 
ATOM   929  N  N   . THR A 1 127 ? -21.724 9.057   0.993   1.00   18.32 ? 114  THR A N   1 
ATOM   930  C  CA  . THR A 1 127 ? -20.286 9.091   1.249   1.00   20.81 ? 114  THR A CA  1 
ATOM   931  C  C   . THR A 1 127 ? -19.799 7.814   1.920   1.00   19.91 ? 114  THR A C   1 
ATOM   932  O  O   . THR A 1 127 ? -18.762 7.247   1.566   1.00   21.11 ? 114  THR A O   1 
ATOM   933  C  CB  . THR A 1 127 ? -19.933 10.319  2.083   1.00   21.62 ? 114  THR A CB  1 
ATOM   934  O  OG1 . THR A 1 127 ? -20.407 11.475  1.369   1.00   26.16 ? 114  THR A OG1 1 
ATOM   935  C  CG2 . THR A 1 127 ? -18.417 10.405  2.308   1.00   24.13 ? 114  THR A CG2 1 
ATOM   936  N  N   . LEU A 1 128 ? -20.561 7.372   2.900   1.00   19.37 ? 115  LEU A N   1 
ATOM   937  C  CA  . LEU A 1 128 ? -20.204 6.196   3.691   1.00   20.71 ? 115  LEU A CA  1 
ATOM   938  C  C   . LEU A 1 128 ? -20.248 4.959   2.822   1.00   22.17 ? 115  LEU A C   1 
ATOM   939  O  O   . LEU A 1 128 ? -19.408 4.084   2.947   1.00   24.37 ? 115  LEU A O   1 
ATOM   940  C  CB  . LEU A 1 128 ? -21.235 6.002   4.804   1.00   20.00 ? 115  LEU A CB  1 
ATOM   941  C  CG  . LEU A 1 128 ? -21.134 7.017   5.966   1.00   21.14 ? 115  LEU A CG  1 
ATOM   942  C  CD1 . LEU A 1 128 ? -22.463 7.056   6.760   1.00   20.80 ? 115  LEU A CD1 1 
ATOM   943  C  CD2 . LEU A 1 128 ? -19.925 6.680   6.835   1.00   27.50 ? 115  LEU A CD2 1 
ATOM   944  N  N   . CYS A 1 129 ? -21.238 4.870   1.954   1.00   22.84 ? 116  CYS A N   1 
ATOM   945  C  CA  . CYS A 1 129 ? -21.394 3.642   1.157   1.00   26.15 ? 116  CYS A CA  1 
ATOM   946  C  C   . CYS A 1 129 ? -20.452 3.599   -0.054  1.00   29.23 ? 116  CYS A C   1 
ATOM   947  O  O   . CYS A 1 129 ? -20.152 2.520   -0.540  1.00   31.09 ? 116  CYS A O   1 
ATOM   948  C  CB  . CYS A 1 129 ? -22.827 3.500   0.701   1.00   25.33 ? 116  CYS A CB  1 
ATOM   949  S  SG  . CYS A 1 129 ? -23.952 3.119   2.025   1.00   26.75 ? 116  CYS A SG  1 
ATOM   950  N  N   . CYS A 1 130 ? -19.989 4.752   -0.536  1.00   31.40 ? 117  CYS A N   1 
ATOM   951  C  CA  A CYS A 1 130 ? -19.066 4.761   -1.672  0.50   33.51 ? 117  CYS A CA  1 
ATOM   952  C  CA  B CYS A 1 130 ? -19.034 4.855   -1.676  0.50   33.42 ? 117  CYS A CA  1 
ATOM   953  C  C   . CYS A 1 130 ? -17.608 4.532   -1.264  1.00   34.72 ? 117  CYS A C   1 
ATOM   954  O  O   . CYS A 1 130 ? -16.789 4.139   -2.093  1.00   35.81 ? 117  CYS A O   1 
ATOM   955  C  CB  A CYS A 1 130 ? -19.217 6.053   -2.465  0.50   33.03 ? 117  CYS A CB  1 
ATOM   956  C  CB  B CYS A 1 130 ? -19.035 6.275   -2.283  0.50   32.54 ? 117  CYS A CB  1 
ATOM   957  S  SG  A CYS A 1 130 ? -20.805 6.150   -3.323  0.50   35.52 ? 117  CYS A SG  1 
ATOM   958  S  SG  B CYS A 1 130 ? -17.656 6.694   -3.473  0.50   35.12 ? 117  CYS A SG  1 
ATOM   959  N  N   . ASN A 1 131 ? -17.287 4.759   0.005   1.00   35.35 ? 118  ASN A N   1 
ATOM   960  C  CA  . ASN A 1 131 ? -15.920 4.541   0.486   1.00   37.27 ? 118  ASN A CA  1 
ATOM   961  C  C   . ASN A 1 131 ? -15.769 3.093   0.952   1.00   38.04 ? 118  ASN A C   1 
ATOM   962  O  O   . ASN A 1 131 ? -16.237 2.718   2.036   1.00   35.96 ? 118  ASN A O   1 
ATOM   963  C  CB  . ASN A 1 131 ? -15.557 5.560   1.577   1.00   37.28 ? 118  ASN A CB  1 
ATOM   964  C  CG  . ASN A 1 131 ? -14.075 5.550   1.934   1.00   41.26 ? 118  ASN A CG  1 
ATOM   965  O  OD1 . ASN A 1 131 ? -13.334 4.627   1.589   1.00   41.25 ? 118  ASN A OD1 1 
ATOM   966  N  ND2 . ASN A 1 131 ? -13.642 6.589   2.638   1.00   43.44 ? 118  ASN A ND2 1 
ATOM   967  N  N   . GLN A 1 132 ? -15.124 2.290   0.103   1.00   38.44 ? 119  GLN A N   1 
ATOM   968  C  CA  . GLN A 1 132 ? -14.901 0.861   0.351   1.00   40.12 ? 119  GLN A CA  1 
ATOM   969  C  C   . GLN A 1 132 ? -14.120 0.569   1.632   1.00   37.81 ? 119  GLN A C   1 
ATOM   970  O  O   . GLN A 1 132 ? -14.220 -0.527  2.183   1.00   38.88 ? 119  GLN A O   1 
ATOM   971  C  CB  . GLN A 1 132 ? -14.195 0.219   -0.848  1.00   40.35 ? 119  GLN A CB  1 
ATOM   972  C  CG  . GLN A 1 132 ? -15.117 -0.021  -2.046  1.00   44.21 ? 119  GLN A CG  1 
ATOM   973  C  CD  . GLN A 1 132 ? -14.370 -0.415  -3.314  1.00   44.45 ? 119  GLN A CD  1 
ATOM   974  O  OE1 . GLN A 1 132 ? -13.278 -0.995  -3.259  1.00   53.34 ? 119  GLN A OE1 1 
ATOM   975  N  NE2 . GLN A 1 132 ? -14.964 -0.109  -4.471  1.00   51.81 ? 119  GLN A NE2 1 
ATOM   976  N  N   . SER A 1 133 ? -13.371 1.558   2.111   1.00   35.88 ? 120  SER A N   1 
ATOM   977  C  CA  . SER A 1 133 ? -12.587 1.426   3.335   1.00   35.00 ? 120  SER A CA  1 
ATOM   978  C  C   . SER A 1 133 ? -13.375 1.680   4.642   1.00   33.46 ? 120  SER A C   1 
ATOM   979  O  O   . SER A 1 133 ? -12.868 1.352   5.731   1.00   33.78 ? 120  SER A O   1 
ATOM   980  C  CB  . SER A 1 133 ? -11.384 2.364   3.293   1.00   36.01 ? 120  SER A CB  1 
ATOM   981  O  OG  . SER A 1 133 ? -11.792 3.719   3.397   1.00   39.60 ? 120  SER A OG  1 
ATOM   982  N  N   . THR A 1 134 ? -14.569 2.289   4.536   1.00   29.95 ? 121  THR A N   1 
ATOM   983  C  CA  . THR A 1 134 ? -15.372 2.633   5.709   1.00   27.17 ? 121  THR A CA  1 
ATOM   984  C  C   . THR A 1 134 ? -15.687 1.374   6.515   1.00   24.04 ? 121  THR A C   1 
ATOM   985  O  O   . THR A 1 134 ? -16.246 0.437   5.977   1.00   24.09 ? 121  THR A O   1 
ATOM   986  C  CB  . THR A 1 134 ? -16.718 3.327   5.329   1.00   27.35 ? 121  THR A CB  1 
ATOM   987  O  OG1 . THR A 1 134 ? -16.478 4.381   4.390   1.00   31.12 ? 121  THR A OG1 1 
ATOM   988  C  CG2 . THR A 1 134 ? -17.398 3.918   6.587   1.00   27.00 ? 121  THR A CG2 1 
ATOM   989  N  N   . PRO A 1 135 ? -15.348 1.367   7.819   1.00   24.20 ? 122  PRO A N   1 
ATOM   990  C  CA  . PRO A 1 135 ? -15.736 0.195   8.609   1.00   22.85 ? 122  PRO A CA  1 
ATOM   991  C  C   . PRO A 1 135 ? -17.254 0.014   8.647   1.00   23.07 ? 122  PRO A C   1 
ATOM   992  O  O   . PRO A 1 135 ? -18.009 1.004   8.712   1.00   20.46 ? 122  PRO A O   1 
ATOM   993  C  CB  . PRO A 1 135 ? -15.189 0.510   10.009  1.00   23.56 ? 122  PRO A CB  1 
ATOM   994  C  CG  . PRO A 1 135 ? -14.186 1.607   9.817   1.00   26.39 ? 122  PRO A CG  1 
ATOM   995  C  CD  . PRO A 1 135 ? -14.691 2.391   8.641   1.00   22.67 ? 122  PRO A CD  1 
ATOM   996  N  N   . TYR A 1 136 ? -17.666 -1.245  8.607   1.00   20.55 ? 123  TYR A N   1 
ATOM   997  C  CA  . TYR A 1 136 ? -19.083 -1.627  8.672   1.00   19.00 ? 123  TYR A CA  1 
ATOM   998  C  C   . TYR A 1 136 ? -19.796 -0.869  9.809   1.00   18.98 ? 123  TYR A C   1 
ATOM   999  O  O   . TYR A 1 136 ? -20.869 -0.298  9.613   1.00   18.40 ? 123  TYR A O   1 
ATOM   1000 C  CB  . TYR A 1 136 ? -19.217 -3.140  8.890   1.00   20.12 ? 123  TYR A CB  1 
ATOM   1001 C  CG  . TYR A 1 136 ? -20.617 -3.593  9.142   1.00   19.20 ? 123  TYR A CG  1 
ATOM   1002 C  CD1 . TYR A 1 136 ? -21.487 -3.839  8.073   1.00   19.19 ? 123  TYR A CD1 1 
ATOM   1003 C  CD2 . TYR A 1 136 ? -21.098 -3.790  10.438  1.00   20.48 ? 123  TYR A CD2 1 
ATOM   1004 C  CE1 . TYR A 1 136 ? -22.782 -4.272  8.273   1.00   19.91 ? 123  TYR A CE1 1 
ATOM   1005 C  CE2 . TYR A 1 136 ? -22.418 -4.211  10.658  1.00   18.78 ? 123  TYR A CE2 1 
ATOM   1006 C  CZ  . TYR A 1 136 ? -23.267 -4.440  9.585   1.00   16.32 ? 123  TYR A CZ  1 
ATOM   1007 O  OH  . TYR A 1 136 ? -24.540 -4.875  9.737   1.00   19.49 ? 123  TYR A OH  1 
ATOM   1008 N  N   . TYR A 1 137 ? -19.223 -0.888  11.003  1.00   18.59 ? 124  TYR A N   1 
ATOM   1009 C  CA  . TYR A 1 137 ? -19.973 -0.328  12.139  1.00   17.81 ? 124  TYR A CA  1 
ATOM   1010 C  C   . TYR A 1 137 ? -20.232 1.164   11.943  1.00   18.33 ? 124  TYR A C   1 
ATOM   1011 O  O   . TYR A 1 137 ? -21.230 1.689   12.447  1.00   18.81 ? 124  TYR A O   1 
ATOM   1012 C  CB  . TYR A 1 137 ? -19.222 -0.560  13.474  1.00   19.10 ? 124  TYR A CB  1 
ATOM   1013 C  CG  . TYR A 1 137 ? -18.066 0.377   13.742  1.00   19.70 ? 124  TYR A CG  1 
ATOM   1014 C  CD1 . TYR A 1 137 ? -16.756 -0.020  13.463  1.00   21.43 ? 124  TYR A CD1 1 
ATOM   1015 C  CD2 . TYR A 1 137 ? -18.262 1.625   14.339  1.00   20.96 ? 124  TYR A CD2 1 
ATOM   1016 C  CE1 . TYR A 1 137 ? -15.698 0.839   13.733  1.00   22.60 ? 124  TYR A CE1 1 
ATOM   1017 C  CE2 . TYR A 1 137 ? -17.207 2.497   14.613  1.00   25.30 ? 124  TYR A CE2 1 
ATOM   1018 C  CZ  . TYR A 1 137 ? -15.941 2.109   14.293  1.00   22.84 ? 124  TYR A CZ  1 
ATOM   1019 O  OH  . TYR A 1 137 ? -14.901 2.964   14.582  1.00   29.08 ? 124  TYR A OH  1 
ATOM   1020 N  N   . VAL A 1 138 ? -19.365 1.875   11.216  1.00   17.14 ? 125  VAL A N   1 
ATOM   1021 C  CA  . VAL A 1 138 ? -19.556 3.322   11.045  1.00   16.31 ? 125  VAL A CA  1 
ATOM   1022 C  C   . VAL A 1 138 ? -20.733 3.554   10.081  1.00   17.22 ? 125  VAL A C   1 
ATOM   1023 O  O   . VAL A 1 138 ? -21.613 4.415   10.312  1.00   17.40 ? 125  VAL A O   1 
ATOM   1024 C  CB  . VAL A 1 138 ? -18.293 4.007   10.478  1.00   18.97 ? 125  VAL A CB  1 
ATOM   1025 C  CG1 . VAL A 1 138 ? -18.567 5.458   10.133  1.00   21.05 ? 125  VAL A CG1 1 
ATOM   1026 C  CG2 . VAL A 1 138 ? -17.203 3.935   11.513  1.00   19.62 ? 125  VAL A CG2 1 
ATOM   1027 N  N   . VAL A 1 139 ? -20.792 2.778   9.011   1.00   17.76 ? 126  VAL A N   1 
ATOM   1028 C  CA  . VAL A 1 139 ? -21.971 2.845   8.121   1.00   16.97 ? 126  VAL A CA  1 
ATOM   1029 C  C   . VAL A 1 139 ? -23.260 2.477   8.877   1.00   15.41 ? 126  VAL A C   1 
ATOM   1030 O  O   . VAL A 1 139 ? -24.282 3.162   8.761   1.00   16.60 ? 126  VAL A O   1 
ATOM   1031 C  CB  . VAL A 1 139 ? -21.803 1.901   6.908   1.00   18.95 ? 126  VAL A CB  1 
ATOM   1032 C  CG1 . VAL A 1 139 ? -22.985 2.083   5.899   1.00   19.56 ? 126  VAL A CG1 1 
ATOM   1033 C  CG2 . VAL A 1 139 ? -20.448 2.090   6.211   1.00   19.40 ? 126  VAL A CG2 1 
ATOM   1034 N  N   . ASP A 1 140 ? -23.195 1.398   9.651   1.00   16.57 ? 127  ASP A N   1 
ATOM   1035 C  CA  . ASP A 1 140 ? -24.367 0.853   10.338  1.00   15.55 ? 127  ASP A CA  1 
ATOM   1036 C  C   . ASP A 1 140 ? -24.898 1.881   11.323  1.00   17.39 ? 127  ASP A C   1 
ATOM   1037 O  O   . ASP A 1 140 ? -26.058 2.283   11.245  1.00   17.53 ? 127  ASP A O   1 
ATOM   1038 C  CB  . ASP A 1 140 ? -23.932 -0.472  10.999  1.00   16.28 ? 127  ASP A CB  1 
ATOM   1039 C  CG  . ASP A 1 140 ? -25.071 -1.244  11.578  1.00   19.42 ? 127  ASP A CG  1 
ATOM   1040 O  OD1 . ASP A 1 140 ? -26.004 -0.634  12.088  1.00   20.31 ? 127  ASP A OD1 1 
ATOM   1041 O  OD2 . ASP A 1 140 ? -24.983 -2.485  11.554  1.00   20.63 ? 127  ASP A OD2 1 
ATOM   1042 N  N   . LEU A 1 141 ? -24.049 2.370   12.217  1.00   15.66 ? 128  LEU A N   1 
ATOM   1043 C  CA  . LEU A 1 141 ? -24.522 3.310   13.243  1.00   15.68 ? 128  LEU A CA  1 
ATOM   1044 C  C   . LEU A 1 141 ? -24.957 4.638   12.625  1.00   16.51 ? 128  LEU A C   1 
ATOM   1045 O  O   . LEU A 1 141 ? -25.860 5.279   13.154  1.00   17.50 ? 128  LEU A O   1 
ATOM   1046 C  CB  . LEU A 1 141 ? -23.481 3.521   14.350  1.00   18.12 ? 128  LEU A CB  1 
ATOM   1047 C  CG  . LEU A 1 141 ? -23.284 2.225   15.169  1.00   20.28 ? 128  LEU A CG  1 
ATOM   1048 C  CD1 . LEU A 1 141 ? -22.275 2.491   16.260  1.00   27.53 ? 128  LEU A CD1 1 
ATOM   1049 C  CD2 . LEU A 1 141 ? -24.631 1.760   15.748  1.00   26.01 ? 128  LEU A CD2 1 
ATOM   1050 N  N   . SER A 1 142 ? -24.349 5.042   11.500  1.00   16.50 ? 129  SER A N   1 
ATOM   1051 C  CA  . SER A 1 142 ? -24.755 6.307   10.879  1.00   16.61 ? 129  SER A CA  1 
ATOM   1052 C  C   . SER A 1 142 ? -26.142 6.152   10.267  1.00   16.49 ? 129  SER A C   1 
ATOM   1053 O  O   . SER A 1 142 ? -26.987 7.068   10.393  1.00   17.70 ? 129  SER A O   1 
ATOM   1054 C  CB  . SER A 1 142 ? -23.780 6.696   9.784   1.00   17.02 ? 129  SER A CB  1 
ATOM   1055 O  OG  . SER A 1 142 ? -22.517 7.031   10.315  1.00   17.04 ? 129  SER A OG  1 
ATOM   1056 N  N   . VAL A 1 143 ? -26.377 5.063   9.529   1.00   15.17 ? 130  VAL A N   1 
ATOM   1057 C  CA  . VAL A 1 143 ? -27.695 4.925   8.910   1.00   17.08 ? 130  VAL A CA  1 
ATOM   1058 C  C   . VAL A 1 143 ? -28.746 4.761   10.004  1.00   17.06 ? 130  VAL A C   1 
ATOM   1059 O  O   . VAL A 1 143 ? -29.810 5.394   9.957   1.00   17.59 ? 130  VAL A O   1 
ATOM   1060 C  CB  . VAL A 1 143 ? -27.719 3.754   7.941   1.00   18.00 ? 130  VAL A CB  1 
ATOM   1061 C  CG1 . VAL A 1 143 ? -29.137 3.375   7.527   1.00   20.21 ? 130  VAL A CG1 1 
ATOM   1062 C  CG2 . VAL A 1 143 ? -26.814 4.081   6.698   1.00   19.13 ? 130  VAL A CG2 1 
ATOM   1063 N  N   . ARG A 1 144 ? -28.463 3.947   11.023  1.00   15.50 ? 131  ARG A N   1 
ATOM   1064 C  CA  . ARG A 1 144 ? -29.455 3.852   12.106  1.00   15.99 ? 131  ARG A CA  1 
ATOM   1065 C  C   . ARG A 1 144 ? -29.689 5.216   12.735  1.00   16.25 ? 131  ARG A C   1 
ATOM   1066 O  O   . ARG A 1 144 ? -30.860 5.601   13.053  1.00   16.78 ? 131  ARG A O   1 
ATOM   1067 C  CB  . ARG A 1 144 ? -28.982 2.844   13.145  1.00   17.12 ? 131  ARG A CB  1 
ATOM   1068 C  CG  . ARG A 1 144 ? -28.944 1.455   12.585  1.00   16.86 ? 131  ARG A CG  1 
ATOM   1069 C  CD  . ARG A 1 144 ? -28.429 0.539   13.681  1.00   17.63 ? 131  ARG A CD  1 
ATOM   1070 N  NE  . ARG A 1 144 ? -28.413 -0.913  13.414  1.00   16.07 ? 131  ARG A NE  1 
ATOM   1071 C  CZ  . ARG A 1 144 ? -29.419 -1.735  13.657  1.00   16.02 ? 131  ARG A CZ  1 
ATOM   1072 N  NH1 . ARG A 1 144 ? -30.583 -1.259  14.076  1.00   17.80 ? 131  ARG A NH1 1 
ATOM   1073 N  NH2 . ARG A 1 144 ? -29.220 -3.042  13.513  1.00   16.70 ? 131  ARG A NH2 1 
ATOM   1074 N  N   . GLY A 1 145 ? -28.597 5.960   12.970  1.00   16.04 ? 132  GLY A N   1 
ATOM   1075 C  CA  . GLY A 1 145 ? -28.690 7.273   13.644  1.00   16.45 ? 132  GLY A CA  1 
ATOM   1076 C  C   . GLY A 1 145 ? -29.545 8.237   12.838  1.00   15.57 ? 132  GLY A C   1 
ATOM   1077 O  O   . GLY A 1 145 ? -30.421 8.972   13.396  1.00   16.97 ? 132  GLY A O   1 
ATOM   1078 N  N   . MET A 1 146 ? -29.311 8.297   11.534  1.00   15.80 ? 133  MET A N   1 
ATOM   1079 C  CA  . MET A 1 146 ? -30.078 9.283   10.726  1.00   15.56 ? 133  MET A CA  1 
ATOM   1080 C  C   . MET A 1 146 ? -31.528 8.898   10.650  1.00   17.08 ? 133  MET A C   1 
ATOM   1081 O  O   . MET A 1 146 ? -32.419 9.759   10.688  1.00   18.43 ? 133  MET A O   1 
ATOM   1082 C  CB  . MET A 1 146 ? -29.486 9.455   9.312   1.00   16.98 ? 133  MET A CB  1 
ATOM   1083 C  CG  . MET A 1 146 ? -29.540 8.226   8.441   1.00   17.79 ? 133  MET A CG  1 
ATOM   1084 S  SD  . MET A 1 146 ? -28.740 8.520   6.805   1.00   20.24 ? 133  MET A SD  1 
ATOM   1085 C  CE  . MET A 1 146 ? -27.054 8.866   7.315   1.00   21.25 ? 133  MET A CE  1 
ATOM   1086 N  N   . LEU A 1 147 ? -31.770 7.593   10.518  1.00   15.89 ? 134  LEU A N   1 
ATOM   1087 C  CA  . LEU A 1 147 ? -33.163 7.157   10.420  1.00   16.38 ? 134  LEU A CA  1 
ATOM   1088 C  C   . LEU A 1 147 ? -33.921 7.416   11.731  1.00   17.68 ? 134  LEU A C   1 
ATOM   1089 O  O   . LEU A 1 147 ? -35.095 7.854   11.728  1.00   18.14 ? 134  LEU A O   1 
ATOM   1090 C  CB  . LEU A 1 147 ? -33.255 5.660   10.066  1.00   17.18 ? 134  LEU A CB  1 
ATOM   1091 C  CG  . LEU A 1 147 ? -32.779 5.354   8.672   1.00   17.07 ? 134  LEU A CG  1 
ATOM   1092 C  CD1 . LEU A 1 147 ? -32.815 3.810   8.403   1.00   17.54 ? 134  LEU A CD1 1 
ATOM   1093 C  CD2 . LEU A 1 147 ? -33.541 6.086   7.571   1.00   19.78 ? 134  LEU A CD2 1 
ATOM   1094 N  N   . GLU A 1 148 ? -33.303 7.082   12.861  1.00   16.10 ? 135  GLU A N   1 
ATOM   1095 C  CA  . GLU A 1 148 ? -33.969 7.291   14.145  1.00   17.29 ? 135  GLU A CA  1 
ATOM   1096 C  C   . GLU A 1 148 ? -34.187 8.770   14.433  1.00   17.97 ? 135  GLU A C   1 
ATOM   1097 O  O   . GLU A 1 148 ? -35.247 9.118   14.942  1.00   20.38 ? 135  GLU A O   1 
ATOM   1098 C  CB  . GLU A 1 148 ? -33.136 6.588   15.249  1.00   17.21 ? 135  GLU A CB  1 
ATOM   1099 C  CG  . GLU A 1 148 ? -33.293 5.085   15.074  1.00   18.60 ? 135  GLU A CG  1 
ATOM   1100 C  CD  . GLU A 1 148 ? -32.391 4.248   15.946  1.00   19.10 ? 135  GLU A CD  1 
ATOM   1101 O  OE1 . GLU A 1 148 ? -31.502 4.769   16.676  1.00   19.69 ? 135  GLU A OE1 1 
ATOM   1102 O  OE2 . GLU A 1 148 ? -32.606 2.989   15.870  1.00   20.39 ? 135  GLU A OE2 1 
ATOM   1103 N  N   . ALA A 1 149 ? -33.202 9.618   14.154  1.00   17.48 ? 136  ALA A N   1 
ATOM   1104 C  CA  . ALA A 1 149 ? -33.360 10.995  14.493  1.00   17.21 ? 136  ALA A CA  1 
ATOM   1105 C  C   . ALA A 1 149 ? -34.485 11.561  13.623  1.00   18.83 ? 136  ALA A C   1 
ATOM   1106 O  O   . ALA A 1 149 ? -35.275 12.394  14.098  1.00   19.17 ? 136  ALA A O   1 
ATOM   1107 C  CB  . ALA A 1 149 ? -32.055 11.719  14.233  1.00   17.47 ? 136  ALA A CB  1 
ATOM   1108 N  N   . SER A 1 150 ? -34.553 11.117  12.379  1.00   16.96 ? 137  SER A N   1 
ATOM   1109 C  CA  . SER A 1 150 ? -35.531 11.685  11.417  1.00   17.47 ? 137  SER A CA  1 
ATOM   1110 C  C   . SER A 1 150 ? -36.977 11.430  11.813  1.00   18.37 ? 137  SER A C   1 
ATOM   1111 O  O   . SER A 1 150 ? -37.892 12.120  11.306  1.00   19.11 ? 137  SER A O   1 
ATOM   1112 C  CB  . SER A 1 150 ? -35.267 11.091  10.034  1.00   17.46 ? 137  SER A CB  1 
ATOM   1113 O  OG  . SER A 1 150 ? -34.016 11.573  9.543   1.00   18.45 ? 137  SER A OG  1 
ATOM   1114 N  N   . GLU A 1 151 ? -37.241 10.436  12.669  1.00   19.12 ? 138  GLU A N   1 
ATOM   1115 C  CA  . GLU A 1 151 ? -38.595 10.209  13.151  1.00   19.18 ? 138  GLU A CA  1 
ATOM   1116 C  C   . GLU A 1 151 ? -39.166 11.483  13.772  1.00   22.71 ? 138  GLU A C   1 
ATOM   1117 O  O   . GLU A 1 151 ? -40.390 11.655  13.801  1.00   22.88 ? 138  GLU A O   1 
ATOM   1118 C  CB  . GLU A 1 151 ? -38.629 9.081   14.173  1.00   21.25 ? 138  GLU A CB  1 
ATOM   1119 C  CG  . GLU A 1 151 ? -38.164 7.763   13.571  1.00   23.44 ? 138  GLU A CG  1 
ATOM   1120 C  CD  . GLU A 1 151 ? -37.927 6.688   14.595  1.00   29.06 ? 138  GLU A CD  1 
ATOM   1121 O  OE1 . GLU A 1 151 ? -38.251 6.927   15.747  1.00   30.44 ? 138  GLU A OE1 1 
ATOM   1122 O  OE2 . GLU A 1 151 ? -37.410 5.601   14.237  1.00   29.34 ? 138  GLU A OE2 1 
ATOM   1123 N  N   . GLY A 1 152 ? -38.294 12.378  14.241  1.00   19.90 ? 139  GLY A N   1 
ATOM   1124 C  CA  . GLY A 1 152 ? -38.746 13.611  14.871  1.00   22.11 ? 139  GLY A CA  1 
ATOM   1125 C  C   . GLY A 1 152 ? -39.441 14.534  13.902  1.00   22.39 ? 139  GLY A C   1 
ATOM   1126 O  O   . GLY A 1 152 ? -40.093 15.475  14.370  1.00   24.92 ? 139  GLY A O   1 
ATOM   1127 N  N   . LEU A 1 153 ? -39.359 14.278  12.598  1.00   21.21 ? 140  LEU A N   1 
ATOM   1128 C  CA  . LEU A 1 153 ? -40.095 15.130  11.607  1.00   21.00 ? 140  LEU A CA  1 
ATOM   1129 C  C   . LEU A 1 153 ? -41.533 14.683  11.396  1.00   22.62 ? 140  LEU A C   1 
ATOM   1130 O  O   . LEU A 1 153 ? -42.323 15.411  10.767  1.00   22.75 ? 140  LEU A O   1 
ATOM   1131 C  CB  . LEU A 1 153 ? -39.405 15.151  10.256  1.00   22.05 ? 140  LEU A CB  1 
ATOM   1132 C  CG  . LEU A 1 153 ? -38.169 16.016  10.159  1.00   23.84 ? 140  LEU A CG  1 
ATOM   1133 C  CD1 . LEU A 1 153 ? -37.501 15.849  8.831   1.00   27.71 ? 140  LEU A CD1 1 
ATOM   1134 C  CD2 . LEU A 1 153 ? -38.587 17.470  10.380  1.00   30.35 ? 140  LEU A CD2 1 
ATOM   1135 N  N   . ASP A 1 154 ? -41.911 13.516  11.891  1.00   22.34 ? 141  ASP A N   1 
ATOM   1136 C  CA  . ASP A 1 154 ? -43.221 12.958  11.535  1.00   23.76 ? 141  ASP A CA  1 
ATOM   1137 C  C   . ASP A 1 154 ? -44.379 13.852  11.951  1.00   25.58 ? 141  ASP A C   1 
ATOM   1138 O  O   . ASP A 1 154 ? -45.342 14.000  11.190  1.00   24.62 ? 141  ASP A O   1 
ATOM   1139 C  CB  . ASP A 1 154 ? -43.387 11.596  12.165  1.00   21.51 ? 141  ASP A CB  1 
ATOM   1140 C  CG  . ASP A 1 154 ? -42.634 10.497  11.411  1.00   24.26 ? 141  ASP A CG  1 
ATOM   1141 O  OD1 . ASP A 1 154 ? -42.233 10.741  10.264  1.00   26.76 ? 141  ASP A OD1 1 
ATOM   1142 O  OD2 . ASP A 1 154 ? -42.475 9.413   12.007  1.00   27.05 ? 141  ASP A OD2 1 
ATOM   1143 N  N   . GLY A 1 155 ? -44.299 14.444  13.139  1.00   24.68 ? 142  GLY A N   1 
ATOM   1144 C  CA  . GLY A 1 155 ? -45.416 15.281  13.624  1.00   27.28 ? 142  GLY A CA  1 
ATOM   1145 C  C   . GLY A 1 155 ? -45.639 16.446  12.692  1.00   28.05 ? 142  GLY A C   1 
ATOM   1146 O  O   . GLY A 1 155 ? -46.772 16.697  12.247  1.00   29.97 ? 142  GLY A O   1 
ATOM   1147 N  N   . TRP A 1 156 ? -44.566 17.153  12.349  1.00   26.75 ? 143  TRP A N   1 
ATOM   1148 C  CA  . TRP A 1 156 ? -44.690 18.342  11.542  1.00   28.09 ? 143  TRP A CA  1 
ATOM   1149 C  C   . TRP A 1 156 ? -45.055 17.988  10.106  1.00   28.94 ? 143  TRP A C   1 
ATOM   1150 O  O   . TRP A 1 156 ? -45.867 18.687  9.483   1.00   26.79 ? 143  TRP A O   1 
ATOM   1151 C  CB  . TRP A 1 156 ? -43.406 19.149  11.590  1.00   30.15 ? 143  TRP A CB  1 
ATOM   1152 C  CG  . TRP A 1 156 ? -43.500 20.431  10.858  1.00   32.88 ? 143  TRP A CG  1 
ATOM   1153 C  CD1 . TRP A 1 156 ? -43.971 21.617  11.338  1.00   36.15 ? 143  TRP A CD1 1 
ATOM   1154 C  CD2 . TRP A 1 156 ? -43.090 20.673  9.511   1.00   34.71 ? 143  TRP A CD2 1 
ATOM   1155 N  NE1 . TRP A 1 156 ? -43.887 22.584  10.364  1.00   34.40 ? 143  TRP A NE1 1 
ATOM   1156 C  CE2 . TRP A 1 156 ? -43.344 22.031  9.234   1.00   33.13 ? 143  TRP A CE2 1 
ATOM   1157 C  CE3 . TRP A 1 156 ? -42.523 19.873  8.510   1.00   32.29 ? 143  TRP A CE3 1 
ATOM   1158 C  CZ2 . TRP A 1 156 ? -43.067 22.607  7.998   1.00   33.96 ? 143  TRP A CZ2 1 
ATOM   1159 C  CZ3 . TRP A 1 156 ? -42.255 20.445  7.278   1.00   33.46 ? 143  TRP A CZ3 1 
ATOM   1160 C  CH2 . TRP A 1 156 ? -42.529 21.801  7.031   1.00   35.82 ? 143  TRP A CH2 1 
ATOM   1161 N  N   . ILE A 1 157 ? -44.499 16.908  9.560   1.00   27.52 ? 144  ILE A N   1 
ATOM   1162 C  CA  . ILE A 1 157 ? -44.811 16.669  8.168   1.00   29.21 ? 144  ILE A CA  1 
ATOM   1163 C  C   . ILE A 1 157 ? -46.249 16.174  7.991   1.00   28.55 ? 144  ILE A C   1 
ATOM   1164 O  O   . ILE A 1 157 ? -46.891 16.461  6.983   1.00   27.73 ? 144  ILE A O   1 
ATOM   1165 C  CB  . ILE A 1 157 ? -43.740 15.864  7.381   1.00   30.07 ? 144  ILE A CB  1 
ATOM   1166 C  CG1 . ILE A 1 157 ? -44.135 14.423  7.216   1.00   35.45 ? 144  ILE A CG1 1 
ATOM   1167 C  CG2 . ILE A 1 157 ? -42.332 16.113  7.862   1.00   32.60 ? 144  ILE A CG2 1 
ATOM   1168 C  CD1 . ILE A 1 157 ? -44.487 14.221  5.832   1.00   38.44 ? 144  ILE A CD1 1 
ATOM   1169 N  N   . HIS A 1 158 ? -46.753 15.463  8.987   1.00   27.75 ? 145  HIS A N   1 
ATOM   1170 C  CA  . HIS A 1 158 ? -48.143 15.054  9.009   1.00   29.59 ? 145  HIS A CA  1 
ATOM   1171 C  C   . HIS A 1 158 ? -49.029 16.305  8.961   1.00   29.56 ? 145  HIS A C   1 
ATOM   1172 O  O   . HIS A 1 158 ? -50.061 16.339  8.244   1.00   29.39 ? 145  HIS A O   1 
ATOM   1173 C  CB  . HIS A 1 158 ? -48.426 14.259  10.284  1.00   29.40 ? 145  HIS A CB  1 
ATOM   1174 C  CG  . HIS A 1 158 ? -49.859 13.872  10.446  1.00   35.18 ? 145  HIS A CG  1 
ATOM   1175 N  ND1 . HIS A 1 158 ? -50.377 12.705  9.928   1.00   40.28 ? 145  HIS A ND1 1 
ATOM   1176 C  CD2 . HIS A 1 158 ? -50.890 14.504  11.055  1.00   37.31 ? 145  HIS A CD2 1 
ATOM   1177 C  CE1 . HIS A 1 158 ? -51.663 12.629  10.219  1.00   39.17 ? 145  HIS A CE1 1 
ATOM   1178 N  NE2 . HIS A 1 158 ? -51.998 13.708  10.904  1.00   37.74 ? 145  HIS A NE2 1 
ATOM   1179 N  N   . GLN A 1 159 ? -48.623 17.335  9.707   1.00   29.90 ? 146  GLN A N   1 
ATOM   1180 C  CA  . GLN A 1 159 ? -49.358 18.627  9.708   1.00   31.98 ? 146  GLN A CA  1 
ATOM   1181 C  C   . GLN A 1 159 ? -49.375 19.276  8.327   1.00   31.35 ? 146  GLN A C   1 
ATOM   1182 O  O   . GLN A 1 159 ? -50.214 20.150  8.060   1.00   32.23 ? 146  GLN A O   1 
ATOM   1183 C  CB  . GLN A 1 159 ? -48.773 19.612  10.737  1.00   31.64 ? 146  GLN A CB  1 
ATOM   1184 C  CG  . GLN A 1 159 ? -49.165 19.337  12.184  1.00   35.43 ? 146  GLN A CG  1 
ATOM   1185 C  CD  . GLN A 1 159 ? -48.202 19.971  13.205  1.00   35.50 ? 146  GLN A CD  1 
ATOM   1186 O  OE1 . GLN A 1 159 ? -47.585 21.159  12.689  0.0000 43.87 ? 146  GLN A OE1 1 
ATOM   1187 N  NE2 . GLN A 1 159 ? -48.386 19.983  14.443  0.0000 42.05 ? 146  GLN A NE2 1 
ATOM   1188 N  N   . GLN A 1 160 ? -48.468 18.859  7.445   1.00   30.53 ? 147  GLN A N   1 
ATOM   1189 C  CA  . GLN A 1 160 ? -48.417 19.387  6.081   1.00   30.21 ? 147  GLN A CA  1 
ATOM   1190 C  C   . GLN A 1 160 ? -49.137 18.486  5.053   1.00   28.35 ? 147  GLN A C   1 
ATOM   1191 O  O   . GLN A 1 160 ? -49.113 18.757  3.839   1.00   29.78 ? 147  GLN A O   1 
ATOM   1192 C  CB  . GLN A 1 160 ? -46.972 19.712  5.664   1.00   30.56 ? 147  GLN A CB  1 
ATOM   1193 C  CG  . GLN A 1 160 ? -46.110 20.344  6.774   1.00   32.68 ? 147  GLN A CG  1 
ATOM   1194 C  CD  . GLN A 1 160 ? -46.765 21.536  7.415   1.00   35.69 ? 147  GLN A CD  1 
ATOM   1195 O  OE1 . GLN A 1 160 ? -47.138 22.494  6.727   1.00   38.52 ? 147  GLN A OE1 1 
ATOM   1196 N  NE2 . GLN A 1 160 ? -46.945 21.482  8.738   1.00   36.96 ? 147  GLN A NE2 1 
ATOM   1197 N  N   . GLY A 1 161 ? -49.806 17.448  5.550   1.00   26.28 ? 148  GLY A N   1 
ATOM   1198 C  CA  . GLY A 1 161 ? -50.474 16.477  4.700   1.00   26.85 ? 148  GLY A CA  1 
ATOM   1199 C  C   . GLY A 1 161 ? -49.596 15.351  4.214   1.00   28.04 ? 148  GLY A C   1 
ATOM   1200 O  O   . GLY A 1 161 ? -49.964 14.624  3.301   1.00   27.93 ? 148  GLY A O   1 
ATOM   1201 N  N   . GLY A 1 162 ? -48.425 15.199  4.830   1.00   26.96 ? 149  GLY A N   1 
ATOM   1202 C  CA  . GLY A 1 162 ? -47.509 14.131  4.450   1.00   26.45 ? 149  GLY A CA  1 
ATOM   1203 C  C   . GLY A 1 162 ? -46.536 14.473  3.333   1.00   27.01 ? 149  GLY A C   1 
ATOM   1204 O  O   . GLY A 1 162 ? -46.697 15.468  2.624   1.00   25.70 ? 149  GLY A O   1 
ATOM   1205 N  N   . TRP A 1 163 ? -45.501 13.631  3.188   1.00   25.37 ? 150  TRP A N   1 
ATOM   1206 C  CA  . TRP A 1 163 ? -44.446 13.826  2.190   1.00   25.31 ? 150  TRP A CA  1 
ATOM   1207 C  C   . TRP A 1 163 ? -44.981 13.925  0.767   1.00   24.22 ? 150  TRP A C   1 
ATOM   1208 O  O   . TRP A 1 163 ? -44.494 14.731  -0.023  1.00   24.73 ? 150  TRP A O   1 
ATOM   1209 C  CB  . TRP A 1 163 ? -43.354 12.735  2.301   1.00   24.68 ? 150  TRP A CB  1 
ATOM   1210 C  CG  . TRP A 1 163 ? -42.517 12.895  3.544   1.00   24.96 ? 150  TRP A CG  1 
ATOM   1211 C  CD1 . TRP A 1 163 ? -42.595 12.159  4.710   1.00   24.06 ? 150  TRP A CD1 1 
ATOM   1212 C  CD2 . TRP A 1 163 ? -41.477 13.868  3.747   1.00   26.61 ? 150  TRP A CD2 1 
ATOM   1213 N  NE1 . TRP A 1 163 ? -41.662 12.627  5.627   1.00   23.56 ? 150  TRP A NE1 1 
ATOM   1214 C  CE2 . TRP A 1 163 ? -40.969 13.667  5.060   1.00   23.07 ? 150  TRP A CE2 1 
ATOM   1215 C  CE3 . TRP A 1 163 ? -40.920 14.894  2.951   1.00   25.04 ? 150  TRP A CE3 1 
ATOM   1216 C  CZ2 . TRP A 1 163 ? -39.925 14.457  5.586   1.00   25.95 ? 150  TRP A CZ2 1 
ATOM   1217 C  CZ3 . TRP A 1 163 ? -39.866 15.687  3.485   1.00   25.53 ? 150  TRP A CZ3 1 
ATOM   1218 C  CH2 . TRP A 1 163 ? -39.396 15.458  4.796   1.00   25.68 ? 150  TRP A CH2 1 
ATOM   1219 N  N   . SER A 1 164 ? -45.972 13.089  0.448   1.00   24.91 ? 151  SER A N   1 
ATOM   1220 C  CA  . SER A 1 164 ? -46.509 13.052  -0.913  1.00   26.87 ? 151  SER A CA  1 
ATOM   1221 C  C   . SER A 1 164 ? -47.224 14.353  -1.287  1.00   27.98 ? 151  SER A C   1 
ATOM   1222 O  O   . SER A 1 164 ? -47.014 14.894  -2.383  1.00   28.00 ? 151  SER A O   1 
ATOM   1223 C  CB  . SER A 1 164 ? -47.381 11.821  -1.131  1.00   26.35 ? 151  SER A CB  1 
ATOM   1224 O  OG  . SER A 1 164 ? -46.584 10.652  -1.123  1.00   30.78 ? 151  SER A OG  1 
ATOM   1225 N  N   . THR A 1 165 ? -48.044 14.870  -0.369  1.00   29.21 ? 152  THR A N   1 
ATOM   1226 C  CA  . THR A 1 165 ? -48.687 16.185  -0.571  1.00   29.28 ? 152  THR A CA  1 
ATOM   1227 C  C   . THR A 1 165 ? -47.671 17.295  -0.806  1.00   29.29 ? 152  THR A C   1 
ATOM   1228 O  O   . THR A 1 165 ? -47.808 18.071  -1.755  1.00   29.14 ? 152  THR A O   1 
ATOM   1229 C  CB  . THR A 1 165 ? -49.626 16.557  0.610   1.00   29.62 ? 152  THR A CB  1 
ATOM   1230 O  OG1 . THR A 1 165 ? -50.628 15.550  0.748   1.00   33.23 ? 152  THR A OG1 1 
ATOM   1231 C  CG2 . THR A 1 165 ? -50.308 17.893  0.374   1.00   31.46 ? 152  THR A CG2 1 
ATOM   1232 N  N   . LEU A 1 166 ? -46.619 17.349  0.022   1.00   28.11 ? 153  LEU A N   1 
ATOM   1233 C  CA  . LEU A 1 166 ? -45.617 18.407  -0.099  1.00   28.17 ? 153  LEU A CA  1 
ATOM   1234 C  C   . LEU A 1 166 ? -44.958 18.462  -1.484  1.00   28.57 ? 153  LEU A C   1 
ATOM   1235 O  O   . LEU A 1 166 ? -44.812 19.551  -2.045  1.00   29.24 ? 153  LEU A O   1 
ATOM   1236 C  CB  . LEU A 1 166 ? -44.555 18.326  1.020   1.00   28.10 ? 153  LEU A CB  1 
ATOM   1237 C  CG  . LEU A 1 166 ? -44.885 18.804  2.456   1.00   30.83 ? 153  LEU A CG  1 
ATOM   1238 C  CD1 . LEU A 1 166 ? -43.930 18.219  3.513   1.00   31.61 ? 153  LEU A CD1 1 
ATOM   1239 C  CD2 . LEU A 1 166 ? -44.879 20.327  2.575   1.00   30.94 ? 153  LEU A CD2 1 
ATOM   1240 N  N   . ILE A 1 167 ? -44.583 17.305  -2.044  1.00   27.95 ? 154  ILE A N   1 
ATOM   1241 C  CA  . ILE A 1 167 ? -43.931 17.314  -3.357  1.00   28.11 ? 154  ILE A CA  1 
ATOM   1242 C  C   . ILE A 1 167 ? -44.908 17.619  -4.498  1.00   28.54 ? 154  ILE A C   1 
ATOM   1243 O  O   . ILE A 1 167 ? -44.573 18.392  -5.394  1.00   28.66 ? 154  ILE A O   1 
ATOM   1244 C  CB  . ILE A 1 167 ? -43.056 16.043  -3.636  1.00   26.61 ? 154  ILE A CB  1 
ATOM   1245 C  CG1 . ILE A 1 167 ? -42.123 16.268  -4.828  1.00   30.31 ? 154  ILE A CG1 1 
ATOM   1246 C  CG2 . ILE A 1 167 ? -43.896 14.819  -3.881  1.00   26.02 ? 154  ILE A CG2 1 
ATOM   1247 C  CD1 . ILE A 1 167 ? -41.157 17.365  -4.640  1.00   31.06 ? 154  ILE A CD1 1 
ATOM   1248 N  N   . GLU A 1 168 ? -46.102 17.017  -4.439  1.00   29.55 ? 155  GLU A N   1 
ATOM   1249 C  CA  . GLU A 1 168 ? -47.098 17.118  -5.511  1.00   31.58 ? 155  GLU A CA  1 
ATOM   1250 C  C   . GLU A 1 168 ? -47.657 18.518  -5.589  1.00   32.89 ? 155  GLU A C   1 
ATOM   1251 O  O   . GLU A 1 168 ? -47.958 19.018  -6.689  1.00   31.89 ? 155  GLU A O   1 
ATOM   1252 C  CB  . GLU A 1 168 ? -48.229 16.105  -5.294  1.00   31.61 ? 155  GLU A CB  1 
ATOM   1253 C  CG  . GLU A 1 168 ? -47.828 14.685  -5.656  1.00   36.60 ? 155  GLU A CG  1 
ATOM   1254 C  CD  . GLU A 1 168 ? -48.664 13.608  -4.972  1.00   43.01 ? 155  GLU A CD  1 
ATOM   1255 O  OE1 . GLU A 1 168 ? -49.803 13.893  -4.540  1.00   43.91 ? 155  GLU A OE1 1 
ATOM   1256 O  OE2 . GLU A 1 168 ? -48.173 12.460  -4.876  1.00   44.02 ? 155  GLU A OE2 1 
ATOM   1257 N  N   . ASP A 1 169 ? -47.764 19.169  -4.432  1.00   33.53 ? 156  ASP A N   1 
ATOM   1258 C  CA  . ASP A 1 169 ? -48.520 20.410  -4.357  1.00   35.02 ? 156  ASP A CA  1 
ATOM   1259 C  C   . ASP A 1 169 ? -47.772 21.656  -3.872  1.00   36.03 ? 156  ASP A C   1 
ATOM   1260 O  O   . ASP A 1 169 ? -48.188 22.769  -4.193  1.00   36.92 ? 156  ASP A O   1 
ATOM   1261 C  CB  . ASP A 1 169 ? -49.803 20.166  -3.556  1.00   34.55 ? 156  ASP A CB  1 
ATOM   1262 C  CG  . ASP A 1 169 ? -50.691 19.089  -4.191  1.00   33.38 ? 156  ASP A CG  1 
ATOM   1263 O  OD1 . ASP A 1 169 ? -50.713 19.001  -5.440  1.00   36.51 ? 156  ASP A OD1 1 
ATOM   1264 O  OD2 . ASP A 1 169 ? -51.375 18.342  -3.461  1.00   26.69 ? 156  ASP A OD2 1 
ATOM   1265 N  N   . ASN A 1 170 ? -46.664 21.492  -3.153  1.00   37.52 ? 157  ASN A N   1 
ATOM   1266 C  CA  . ASN A 1 170 ? -45.976 22.640  -2.538  1.00   38.71 ? 157  ASN A CA  1 
ATOM   1267 C  C   . ASN A 1 170 ? -44.550 22.902  -3.017  1.00   39.69 ? 157  ASN A C   1 
ATOM   1268 O  O   . ASN A 1 170 ? -44.034 24.007  -2.830  1.00   42.34 ? 157  ASN A O   1 
ATOM   1269 C  CB  . ASN A 1 170 ? -45.944 22.516  -0.999  1.00   39.98 ? 157  ASN A CB  1 
ATOM   1270 C  CG  . ASN A 1 170 ? -47.338 22.474  -0.363  1.00   41.54 ? 157  ASN A CG  1 
ATOM   1271 O  OD1 . ASN A 1 170 ? -48.335 22.911  -0.951  1.00   40.82 ? 157  ASN A OD1 1 
ATOM   1272 N  ND2 . ASN A 1 170 ? -47.400 21.958  0.859   1.00   43.53 ? 157  ASN A ND2 1 
ATOM   1273 N  N   . ILE A 1 171 ? -43.893 21.903  -3.599  1.00   38.46 ? 158  ILE A N   1 
ATOM   1274 C  CA  . ILE A 1 171 ? -42.513 22.121  -4.068  1.00   37.42 ? 158  ILE A CA  1 
ATOM   1275 C  C   . ILE A 1 171 ? -42.387 21.945  -5.583  1.00   36.02 ? 158  ILE A C   1 
ATOM   1276 O  O   . ILE A 1 171 ? -42.835 20.951  -6.143  1.00   34.66 ? 158  ILE A O   1 
ATOM   1277 C  CB  . ILE A 1 171 ? -41.460 21.236  -3.353  1.00   37.02 ? 158  ILE A CB  1 
ATOM   1278 C  CG1 . ILE A 1 171 ? -41.892 20.870  -1.927  1.00   35.67 ? 158  ILE A CG1 1 
ATOM   1279 C  CG2 . ILE A 1 171 ? -40.106 21.959  -3.335  1.00   39.18 ? 158  ILE A CG2 1 
ATOM   1280 C  CD1 . ILE A 1 171 ? -41.103 19.719  -1.337  1.00   37.92 ? 158  ILE A CD1 1 
ATOM   1281 N  N   . ASP B 2 1   ? -16.296 19.451  21.803  1.00   43.62 ? 51   ASP B N   1 
ATOM   1282 C  CA  . ASP B 2 1   ? -16.845 18.059  21.763  1.00   44.15 ? 51   ASP B CA  1 
ATOM   1283 C  C   . ASP B 2 1   ? -18.217 17.993  21.078  1.00   43.04 ? 51   ASP B C   1 
ATOM   1284 O  O   . ASP B 2 1   ? -18.377 17.287  20.070  1.00   43.46 ? 51   ASP B O   1 
ATOM   1285 C  CB  . ASP B 2 1   ? -16.917 17.439  23.163  1.00   44.83 ? 51   ASP B CB  1 
ATOM   1286 C  CG  . ASP B 2 1   ? -17.280 15.956  23.130  1.00   47.59 ? 51   ASP B CG  1 
ATOM   1287 O  OD1 . ASP B 2 1   ? -16.808 15.237  22.217  1.00   51.42 ? 51   ASP B OD1 1 
ATOM   1288 O  OD2 . ASP B 2 1   ? -18.037 15.504  24.021  1.00   52.77 ? 51   ASP B OD2 1 
ATOM   1289 N  N   . MET B 2 2   ? -19.201 18.710  21.628  1.00   41.15 ? 52   MET B N   1 
ATOM   1290 C  CA  . MET B 2 2   ? -20.475 18.917  20.932  1.00   39.45 ? 52   MET B CA  1 
ATOM   1291 C  C   . MET B 2 2   ? -20.428 20.129  19.987  1.00   37.05 ? 52   MET B C   1 
ATOM   1292 O  O   . MET B 2 2   ? -21.412 20.462  19.324  1.00   35.05 ? 52   MET B O   1 
ATOM   1293 C  CB  . MET B 2 2   ? -21.649 19.002  21.918  1.00   40.78 ? 52   MET B CB  1 
ATOM   1294 C  CG  . MET B 2 2   ? -22.641 17.821  21.851  1.00   46.26 ? 52   MET B CG  1 
ATOM   1295 S  SD  . MET B 2 2   ? -21.951 16.158  21.580  1.00   51.81 ? 52   MET B SD  1 
ATOM   1296 C  CE  . MET B 2 2   ? -23.455 15.181  21.484  1.00   47.17 ? 52   MET B CE  1 
ATOM   1297 N  N   . ARG B 2 3   ? -19.267 20.778  19.912  1.00   35.03 ? 53   ARG B N   1 
ATOM   1298 C  CA  . ARG B 2 3   ? -19.091 21.935  19.031  1.00   33.98 ? 53   ARG B CA  1 
ATOM   1299 C  C   . ARG B 2 3   ? -19.263 21.657  17.521  1.00   31.77 ? 53   ARG B C   1 
ATOM   1300 O  O   . ARG B 2 3   ? -19.891 22.466  16.830  1.00   31.90 ? 53   ARG B O   1 
ATOM   1301 C  CB  . ARG B 2 3   ? -17.782 22.672  19.342  1.00   33.78 ? 53   ARG B CB  1 
ATOM   1302 C  CG  . ARG B 2 3   ? -17.740 23.297  20.748  1.00   35.48 ? 53   ARG B CG  1 
ATOM   1303 C  CD  . ARG B 2 3   ? -16.786 23.813  21.408  0.0000 44.97 ? 53   ARG B CD  1 
ATOM   1304 N  NE  . ARG B 2 3   ? -17.078 24.815  22.439  0.0000 48.74 ? 53   ARG B NE  1 
ATOM   1305 C  CZ  . ARG B 2 3   ? -16.417 24.951  23.583  0.0000 49.94 ? 53   ARG B CZ  1 
ATOM   1306 N  NH1 . ARG B 2 3   ? -15.396 24.151  23.870  0.0000 52.04 ? 53   ARG B NH1 1 
ATOM   1307 N  NH2 . ARG B 2 3   ? -16.781 25.895  24.443  0.0000 50.97 ? 53   ARG B NH2 1 
ATOM   1308 N  N   . PRO B 2 4   ? -18.741 20.518  16.991  1.00   31.35 ? 54   PRO B N   1 
ATOM   1309 C  CA  . PRO B 2 4   ? -19.023 20.240  15.577  1.00   29.93 ? 54   PRO B CA  1 
ATOM   1310 C  C   . PRO B 2 4   ? -20.507 20.210  15.272  1.00   28.72 ? 54   PRO B C   1 
ATOM   1311 O  O   . PRO B 2 4   ? -20.948 20.792  14.285  1.00   29.41 ? 54   PRO B O   1 
ATOM   1312 C  CB  . PRO B 2 4   ? -18.435 18.842  15.352  1.00   29.54 ? 54   PRO B CB  1 
ATOM   1313 C  CG  . PRO B 2 4   ? -17.379 18.718  16.374  1.00   31.27 ? 54   PRO B CG  1 
ATOM   1314 C  CD  . PRO B 2 4   ? -17.869 19.487  17.584  1.00   31.06 ? 54   PRO B CD  1 
ATOM   1315 N  N   . GLU B 2 5   ? -21.281 19.583  16.160  1.00   26.29 ? 55   GLU B N   1 
ATOM   1316 C  CA  . GLU B 2 5   ? -22.713 19.406  15.914  1.00   25.71 ? 55   GLU B CA  1 
ATOM   1317 C  C   . GLU B 2 5   ? -23.489 20.731  15.940  1.00   25.29 ? 55   GLU B C   1 
ATOM   1318 O  O   . GLU B 2 5   ? -24.451 20.885  15.185  1.00   25.21 ? 55   GLU B O   1 
ATOM   1319 C  CB  . GLU B 2 5   ? -23.344 18.317  16.826  1.00   25.36 ? 55   GLU B CB  1 
ATOM   1320 C  CG  . GLU B 2 5   ? -22.566 17.955  18.056  1.00   35.61 ? 55   GLU B CG  1 
ATOM   1321 C  CD  . GLU B 2 5   ? -21.452 16.928  17.839  1.00   34.57 ? 55   GLU B CD  1 
ATOM   1322 O  OE1 . GLU B 2 5   ? -21.724 15.742  17.524  1.00   33.64 ? 55   GLU B OE1 1 
ATOM   1323 O  OE2 . GLU B 2 5   ? -20.291 17.304  18.074  1.00   34.09 ? 55   GLU B OE2 1 
ATOM   1324 N  N   . ILE B 2 6   ? -23.065 21.689  16.774  1.00   25.34 ? 56   ILE B N   1 
ATOM   1325 C  CA  . ILE B 2 6   ? -23.735 22.993  16.751  1.00   27.05 ? 56   ILE B CA  1 
ATOM   1326 C  C   . ILE B 2 6   ? -23.406 23.779  15.468  1.00   27.11 ? 56   ILE B C   1 
ATOM   1327 O  O   . ILE B 2 6   ? -24.284 24.438  14.908  1.00   25.82 ? 56   ILE B O   1 
ATOM   1328 C  CB  . ILE B 2 6   ? -23.611 23.849  18.080  1.00   28.79 ? 56   ILE B CB  1 
ATOM   1329 C  CG1 . ILE B 2 6   ? -22.825 25.124  17.876  1.00   32.25 ? 56   ILE B CG1 1 
ATOM   1330 C  CG2 . ILE B 2 6   ? -23.284 22.994  19.338  1.00   30.13 ? 56   ILE B CG2 1 
ATOM   1331 C  CD1 . ILE B 2 6   ? -23.727 26.292  17.766  1.00   37.04 ? 56   ILE B CD1 1 
ATOM   1332 N  N   . TRP B 2 7   ? -22.170 23.678  14.975  1.00   26.34 ? 57   TRP B N   1 
ATOM   1333 C  CA  . TRP B 2 7   ? -21.836 24.329  13.706  1.00   26.99 ? 57   TRP B CA  1 
ATOM   1334 C  C   . TRP B 2 7   ? -22.595 23.731  12.535  1.00   27.13 ? 57   TRP B C   1 
ATOM   1335 O  O   . TRP B 2 7   ? -23.095 24.441  11.667  1.00   29.18 ? 57   TRP B O   1 
ATOM   1336 C  CB  . TRP B 2 7   ? -20.341 24.258  13.418  1.00   27.96 ? 57   TRP B CB  1 
ATOM   1337 C  CG  . TRP B 2 7   ? -19.992 24.833  12.049  1.00   30.04 ? 57   TRP B CG  1 
ATOM   1338 C  CD1 . TRP B 2 7   ? -20.224 26.116  11.608  1.00   33.53 ? 57   TRP B CD1 1 
ATOM   1339 C  CD2 . TRP B 2 7   ? -19.367 24.144  10.962  1.00   27.42 ? 57   TRP B CD2 1 
ATOM   1340 N  NE1 . TRP B 2 7   ? -19.774 26.258  10.309  1.00   31.70 ? 57   TRP B NE1 1 
ATOM   1341 C  CE2 . TRP B 2 7   ? -19.226 25.074  9.897   1.00   29.54 ? 57   TRP B CE2 1 
ATOM   1342 C  CE3 . TRP B 2 7   ? -18.877 22.842  10.786  1.00   27.91 ? 57   TRP B CE3 1 
ATOM   1343 C  CZ2 . TRP B 2 7   ? -18.650 24.724  8.664   1.00   27.61 ? 57   TRP B CZ2 1 
ATOM   1344 C  CZ3 . TRP B 2 7   ? -18.273 22.502  9.554   1.00   28.68 ? 57   TRP B CZ3 1 
ATOM   1345 C  CH2 . TRP B 2 7   ? -18.174 23.443  8.513   1.00   26.43 ? 57   TRP B CH2 1 
ATOM   1346 N  N   . ILE B 2 8   ? -22.671 22.407  12.513  1.00   26.26 ? 58   ILE B N   1 
ATOM   1347 C  CA  . ILE B 2 8   ? -23.398 21.694  11.477  1.00   25.98 ? 58   ILE B CA  1 
ATOM   1348 C  C   . ILE B 2 8   ? -24.875 22.161  11.430  1.00   25.70 ? 58   ILE B C   1 
ATOM   1349 O  O   . ILE B 2 8   ? -25.385 22.482  10.363  1.00   25.30 ? 58   ILE B O   1 
ATOM   1350 C  CB  . ILE B 2 8   ? -23.283 20.192  11.693  1.00   27.46 ? 58   ILE B CB  1 
ATOM   1351 C  CG1 . ILE B 2 8   ? -21.811 19.743  11.536  1.00   24.23 ? 58   ILE B CG1 1 
ATOM   1352 C  CG2 . ILE B 2 8   ? -24.186 19.464  10.733  1.00   25.99 ? 58   ILE B CG2 1 
ATOM   1353 C  CD1 . ILE B 2 8   ? -21.574 18.297  12.011  1.00   29.16 ? 58   ILE B CD1 1 
ATOM   1354 N  N   . ALA B 2 9   ? -25.532 22.199  12.596  1.00   25.78 ? 59   ALA B N   1 
ATOM   1355 C  CA  . ALA B 2 9   ? -26.905 22.652  12.691  1.00   25.63 ? 59   ALA B CA  1 
ATOM   1356 C  C   . ALA B 2 9   ? -27.049 24.118  12.260  1.00   27.26 ? 59   ALA B C   1 
ATOM   1357 O  O   . ALA B 2 9   ? -28.027 24.463  11.599  1.00   29.03 ? 59   ALA B O   1 
ATOM   1358 C  CB  . ALA B 2 9   ? -27.426 22.453  14.107  1.00   25.57 ? 59   ALA B CB  1 
ATOM   1359 N  N   . GLN B 2 10  ? -26.089 24.981  12.622  1.00   27.06 ? 60   GLN B N   1 
ATOM   1360 C  CA  . GLN B 2 10  ? -26.102 26.373  12.150  1.00   28.50 ? 60   GLN B CA  1 
ATOM   1361 C  C   . GLN B 2 10  ? -26.143 26.409  10.621  1.00   28.07 ? 60   GLN B C   1 
ATOM   1362 O  O   . GLN B 2 10  ? -26.951 27.112  10.006  1.00   28.00 ? 60   GLN B O   1 
ATOM   1363 C  CB  . GLN B 2 10  ? -24.875 27.153  12.683  1.00   28.40 ? 60   GLN B CB  1 
ATOM   1364 C  CG  . GLN B 2 10  ? -24.839 27.376  14.200  1.00   33.73 ? 60   GLN B CG  1 
ATOM   1365 C  CD  . GLN B 2 10  ? -23.559 28.049  14.742  1.00   33.17 ? 60   GLN B CD  1 
ATOM   1366 O  OE1 . GLN B 2 10  ? -23.559 28.565  15.868  1.00   37.34 ? 60   GLN B OE1 1 
ATOM   1367 N  NE2 . GLN B 2 10  ? -22.479 28.050  13.960  1.00   36.49 ? 60   GLN B NE2 1 
ATOM   1368 N  N   . GLU B 2 11  ? -25.288 25.606  10.008  1.00   26.58 ? 61   GLU B N   1 
ATOM   1369 C  CA  . GLU B 2 11  ? -25.228 25.583  8.548   1.00   26.97 ? 61   GLU B CA  1 
ATOM   1370 C  C   . GLU B 2 11  ? -26.520 25.069  7.908   1.00   26.05 ? 61   GLU B C   1 
ATOM   1371 O  O   . GLU B 2 11  ? -26.995 25.653  6.907   1.00   27.30 ? 61   GLU B O   1 
ATOM   1372 C  CB  . GLU B 2 11  ? -24.013 24.802  8.041   1.00   28.90 ? 61   GLU B CB  1 
ATOM   1373 C  CG  . GLU B 2 11  ? -22.690 25.429  8.400   1.00   29.62 ? 61   GLU B CG  1 
ATOM   1374 C  CD  . GLU B 2 11  ? -22.441 26.738  7.637   1.00   33.01 ? 61   GLU B CD  1 
ATOM   1375 O  OE1 . GLU B 2 11  ? -22.930 26.879  6.495   1.00   32.72 ? 61   GLU B OE1 1 
ATOM   1376 O  OE2 . GLU B 2 11  ? -21.758 27.623  8.186   1.00   36.59 ? 61   GLU B OE2 1 
ATOM   1377 N  N   . LEU B 2 12  ? -27.081 24.000  8.467   1.00   26.57 ? 62   LEU B N   1 
ATOM   1378 C  CA  . LEU B 2 12  ? -28.299 23.465  7.894   1.00   27.31 ? 62   LEU B CA  1 
ATOM   1379 C  C   . LEU B 2 12  ? -29.522 24.337  8.118   1.00   29.36 ? 62   LEU B C   1 
ATOM   1380 O  O   . LEU B 2 12  ? -30.372 24.437  7.233   1.00   30.08 ? 62   LEU B O   1 
ATOM   1381 C  CB  . LEU B 2 12  ? -28.529 22.020  8.341   1.00   26.86 ? 62   LEU B CB  1 
ATOM   1382 C  CG  . LEU B 2 12  ? -27.452 21.040  7.857   1.00   27.79 ? 62   LEU B CG  1 
ATOM   1383 C  CD1 . LEU B 2 12  ? -27.745 19.702  8.470   1.00   27.95 ? 62   LEU B CD1 1 
ATOM   1384 C  CD2 . LEU B 2 12  ? -27.440 20.919  6.346   1.00   26.63 ? 62   LEU B CD2 1 
ATOM   1385 N  N   . ARG B 2 13  ? -29.603 24.996  9.272   1.00   30.31 ? 63   ARG B N   1 
ATOM   1386 C  CA  . ARG B 2 13  ? -30.634 26.008  9.449   1.00   30.11 ? 63   ARG B CA  1 
ATOM   1387 C  C   . ARG B 2 13  ? -30.497 27.095  8.369   1.00   30.50 ? 63   ARG B C   1 
ATOM   1388 O  O   . ARG B 2 13  ? -31.488 27.475  7.758   1.00   31.46 ? 63   ARG B O   1 
ATOM   1389 C  CB  . ARG B 2 13  ? -30.579 26.628  10.864  1.00   29.56 ? 63   ARG B CB  1 
ATOM   1390 C  CG  . ARG B 2 13  ? -30.947 25.628  12.014  1.00   28.68 ? 63   ARG B CG  1 
ATOM   1391 C  CD  . ARG B 2 13  ? -31.312 26.378  13.332  1.00   29.12 ? 63   ARG B CD  1 
ATOM   1392 N  NE  . ARG B 2 13  ? -30.235 27.273  13.757  1.00   28.97 ? 63   ARG B NE  1 
ATOM   1393 C  CZ  . ARG B 2 13  ? -29.240 26.924  14.569  1.00   29.14 ? 63   ARG B CZ  1 
ATOM   1394 N  NH1 . ARG B 2 13  ? -28.295 27.816  14.890  1.00   26.88 ? 63   ARG B NH1 1 
ATOM   1395 N  NH2 . ARG B 2 13  ? -29.196 25.695  15.078  1.00   30.02 ? 63   ARG B NH2 1 
ATOM   1396 N  N   . ARG B 2 14  ? -29.272 27.582  8.148   1.00   29.41 ? 64   ARG B N   1 
ATOM   1397 C  CA  . ARG B 2 14  ? -29.013 28.616  7.136   1.00   31.62 ? 64   ARG B CA  1 
ATOM   1398 C  C   . ARG B 2 14  ? -29.448 28.124  5.760   1.00   32.35 ? 64   ARG B C   1 
ATOM   1399 O  O   . ARG B 2 14  ? -30.148 28.833  5.035   1.00   34.35 ? 64   ARG B O   1 
ATOM   1400 C  CB  . ARG B 2 14  ? -27.530 28.992  7.079   1.00   31.20 ? 64   ARG B CB  1 
ATOM   1401 C  CG  . ARG B 2 14  ? -26.988 29.745  8.266   1.00   35.75 ? 64   ARG B CG  1 
ATOM   1402 C  CD  . ARG B 2 14  ? -25.508 30.030  8.054   1.00   35.79 ? 64   ARG B CD  1 
ATOM   1403 N  NE  . ARG B 2 14  ? -24.705 29.824  9.248   1.00   41.10 ? 64   ARG B NE  1 
ATOM   1404 C  CZ  . ARG B 2 14  ? -24.532 30.751  10.191  1.00   42.11 ? 64   ARG B CZ  1 
ATOM   1405 N  NH1 . ARG B 2 14  ? -23.964 30.661  11.334  0.0000 44.80 ? 64   ARG B NH1 1 
ATOM   1406 N  NH2 . ARG B 2 14  ? -25.104 31.944  10.070  1.00   43.36 ? 64   ARG B NH2 1 
ATOM   1407 N  N   . ILE B 2 15  ? -29.013 26.920  5.395   1.00   30.34 ? 65   ILE B N   1 
ATOM   1408 C  CA  . ILE B 2 15  ? -29.334 26.359  4.092   1.00   31.56 ? 65   ILE B CA  1 
ATOM   1409 C  C   . ILE B 2 15  ? -30.838 26.213  3.939   1.00   32.66 ? 65   ILE B C   1 
ATOM   1410 O  O   . ILE B 2 15  ? -31.392 26.626  2.927   1.00   34.38 ? 65   ILE B O   1 
ATOM   1411 C  CB  . ILE B 2 15  ? -28.586 25.028  3.862   1.00   30.80 ? 65   ILE B CB  1 
ATOM   1412 C  CG1 . ILE B 2 15  ? -27.087 25.335  3.693   1.00   29.00 ? 65   ILE B CG1 1 
ATOM   1413 C  CG2 . ILE B 2 15  ? -29.156 24.255  2.657   1.00   30.93 ? 65   ILE B CG2 1 
ATOM   1414 C  CD1 . ILE B 2 15  ? -26.155 24.125  3.706   1.00   31.07 ? 65   ILE B CD1 1 
ATOM   1415 N  N   . GLY B 2 16  ? -31.501 25.695  4.972   1.00   33.31 ? 66   GLY B N   1 
ATOM   1416 C  CA  . GLY B 2 16  ? -32.964 25.560  4.961   1.00   34.83 ? 66   GLY B CA  1 
ATOM   1417 C  C   . GLY B 2 16  ? -33.702 26.891  4.818   1.00   36.94 ? 66   GLY B C   1 
ATOM   1418 O  O   . GLY B 2 16  ? -34.703 26.978  4.104   1.00   37.03 ? 66   GLY B O   1 
ATOM   1419 N  N   . ASP B 2 17  ? -33.199 27.930  5.482   1.00   37.67 ? 67   ASP B N   1 
ATOM   1420 C  CA  . ASP B 2 17  ? -33.813 29.253  5.377   1.00   39.19 ? 67   ASP B CA  1 
ATOM   1421 C  C   . ASP B 2 17  ? -33.606 29.856  3.983   1.00   39.97 ? 67   ASP B C   1 
ATOM   1422 O  O   . ASP B 2 17  ? -34.527 30.494  3.462   1.00   40.75 ? 67   ASP B O   1 
ATOM   1423 C  CB  . ASP B 2 17  ? -33.345 30.182  6.517   1.00   39.38 ? 67   ASP B CB  1 
ATOM   1424 C  CG  . ASP B 2 17  ? -33.747 29.649  7.912   1.00   39.39 ? 67   ASP B CG  1 
ATOM   1425 O  OD1 . ASP B 2 17  ? -34.559 28.687  8.002   1.00   40.35 ? 67   ASP B OD1 1 
ATOM   1426 O  OD2 . ASP B 2 17  ? -33.228 30.167  8.923   1.00   41.17 ? 67   ASP B OD2 1 
ATOM   1427 N  N   . GLU B 2 18  ? -32.432 29.628  3.369   1.00   41.55 ? 68   GLU B N   1 
ATOM   1428 C  CA  . GLU B 2 18  ? -32.177 30.084  1.977   1.00   43.68 ? 68   GLU B CA  1 
ATOM   1429 C  C   . GLU B 2 18  ? -33.168 29.435  1.016   1.00   43.92 ? 68   GLU B C   1 
ATOM   1430 O  O   . GLU B 2 18  ? -33.652 30.088  0.090   1.00   43.67 ? 68   GLU B O   1 
ATOM   1431 C  CB  . GLU B 2 18  ? -30.772 29.700  1.480   1.00   44.17 ? 68   GLU B CB  1 
ATOM   1432 C  CG  . GLU B 2 18  ? -29.631 29.935  2.440   1.00   49.79 ? 68   GLU B CG  1 
ATOM   1433 C  CD  . GLU B 2 18  ? -28.688 31.032  2.012   1.00   53.36 ? 68   GLU B CD  1 
ATOM   1434 O  OE1 . GLU B 2 18  ? -29.023 31.812  1.081   1.00   58.17 ? 68   GLU B OE1 1 
ATOM   1435 O  OE2 . GLU B 2 18  ? -27.591 31.113  2.615   1.00   56.82 ? 68   GLU B OE2 1 
ATOM   1436 N  N   . PHE B 2 19  ? -33.433 28.139  1.220   1.00   44.61 ? 69   PHE B N   1 
ATOM   1437 C  CA  . PHE B 2 19  ? -34.341 27.371  0.365   1.00   45.09 ? 69   PHE B CA  1 
ATOM   1438 C  C   . PHE B 2 19  ? -35.756 27.938  0.447   1.00   47.51 ? 69   PHE B C   1 
ATOM   1439 O  O   . PHE B 2 19  ? -36.434 28.073  -0.576  1.00   48.80 ? 69   PHE B O   1 
ATOM   1440 C  CB  . PHE B 2 19  ? -34.352 25.888  0.738   1.00   43.34 ? 69   PHE B CB  1 
ATOM   1441 C  CG  . PHE B 2 19  ? -35.202 25.038  -0.172  1.00   40.65 ? 69   PHE B CG  1 
ATOM   1442 C  CD1 . PHE B 2 19  ? -34.604 24.260  -1.160  1.00   38.91 ? 69   PHE B CD1 1 
ATOM   1443 C  CD2 . PHE B 2 19  ? -36.607 24.979  -0.026  1.00   39.78 ? 69   PHE B CD2 1 
ATOM   1444 C  CE1 . PHE B 2 19  ? -35.394 23.473  -2.009  1.00   39.62 ? 69   PHE B CE1 1 
ATOM   1445 C  CE2 . PHE B 2 19  ? -37.405 24.193  -0.841  1.00   40.69 ? 69   PHE B CE2 1 
ATOM   1446 C  CZ  . PHE B 2 19  ? -36.796 23.454  -1.870  1.00   39.41 ? 69   PHE B CZ  1 
ATOM   1447 N  N   . ASN B 2 20  ? -36.198 28.269  1.661   1.00   49.46 ? 70   ASN B N   1 
ATOM   1448 C  CA  . ASN B 2 20  ? -37.528 28.840  1.894   1.00   50.88 ? 70   ASN B CA  1 
ATOM   1449 C  C   . ASN B 2 20  ? -37.872 30.054  1.020   1.00   52.61 ? 70   ASN B C   1 
ATOM   1450 O  O   . ASN B 2 20  ? -39.010 30.535  1.033   1.00   53.27 ? 70   ASN B O   1 
ATOM   1451 C  CB  . ASN B 2 20  ? -37.704 29.168  3.378   1.00   50.21 ? 70   ASN B CB  1 
ATOM   1452 C  CG  . ASN B 2 20  ? -37.963 27.930  4.215   1.00   49.69 ? 70   ASN B CG  1 
ATOM   1453 O  OD1 . ASN B 2 20  ? -38.594 26.982  3.748   1.00   44.31 ? 70   ASN B OD1 1 
ATOM   1454 N  ND2 . ASN B 2 20  ? -37.483 27.933  5.461   1.00   50.00 ? 70   ASN B ND2 1 
ATOM   1455 N  N   . ALA B 2 21  ? -36.879 30.533  0.268   1.00   54.43 ? 71   ALA B N   1 
ATOM   1456 C  CA  . ALA B 2 21  ? -37.052 31.597  -0.728  1.00   55.70 ? 71   ALA B CA  1 
ATOM   1457 C  C   . ALA B 2 21  ? -36.558 31.098  -2.101  1.00   57.15 ? 71   ALA B C   1 
ATOM   1458 O  O   . ALA B 2 21  ? -35.742 31.749  -2.768  1.00   56.97 ? 71   ALA B O   1 
ATOM   1459 C  CB  . ALA B 2 21  ? -36.299 32.837  -0.289  1.00   55.84 ? 71   ALA B CB  1 
ATOM   1460 N  N   . TYR B 2 22  ? -37.071 29.934  -2.511  1.00   59.12 ? 72   TYR B N   1 
ATOM   1461 C  CA  . TYR B 2 22  ? -36.515 29.169  -3.636  1.00   60.74 ? 72   TYR B CA  1 
ATOM   1462 C  C   . TYR B 2 22  ? -37.583 28.269  -4.265  1.00   60.67 ? 72   TYR B C   1 
ATOM   1463 O  O   . TYR B 2 22  ? -37.702 27.090  -3.919  1.00   60.84 ? 72   TYR B O   1 
ATOM   1464 C  CB  . TYR B 2 22  ? -35.342 28.302  -3.138  1.00   61.66 ? 72   TYR B CB  1 
ATOM   1465 C  CG  . TYR B 2 22  ? -34.049 28.413  -3.921  1.00   63.44 ? 72   TYR B CG  1 
ATOM   1466 C  CD1 . TYR B 2 22  ? -33.521 27.306  -4.587  1.00   64.02 ? 72   TYR B CD1 1 
ATOM   1467 C  CD2 . TYR B 2 22  ? -33.343 29.621  -3.978  1.00   64.72 ? 72   TYR B CD2 1 
ATOM   1468 C  CE1 . TYR B 2 22  ? -32.334 27.401  -5.304  1.00   64.64 ? 72   TYR B CE1 1 
ATOM   1469 C  CE2 . TYR B 2 22  ? -32.151 29.725  -4.689  1.00   65.36 ? 72   TYR B CE2 1 
ATOM   1470 C  CZ  . TYR B 2 22  ? -31.652 28.609  -5.349  1.00   64.98 ? 72   TYR B CZ  1 
ATOM   1471 O  OH  . TYR B 2 22  ? -30.473 28.704  -6.061  1.00   64.95 ? 72   TYR B OH  1 
HETATM 1472 BR BR  . BR  C 3 .   ? -19.235 5.015   16.925  1.00   27.54 ? 1159 BR  A BR  1 
HETATM 1473 BR BR  . BR  D 3 .   ? -39.903 -2.129  -4.760  1.00   31.69 ? 1160 BR  A BR  1 
HETATM 1474 BR BR  . BR  E 3 .   ? -21.941 17.365  -4.969  1.00   24.28 ? 1161 BR  A BR  1 
HETATM 1475 BR BR  . BR  F 3 .   ? -17.342 8.768   5.603   0.50   24.90 ? 1162 BR  A BR  1 
HETATM 1476 BR BR  . BR  G 3 .   ? -17.077 -3.080  11.872  0.80   43.52 ? 1163 BR  A BR  1 
HETATM 1477 BR BR  . BR  H 3 .   ? -48.034 15.599  -9.189  0.50   17.55 ? 1164 BR  A BR  1 
HETATM 1478 BR BR  . BR  I 3 .   ? -26.371 28.072  17.831  0.50   16.65 ? 1165 BR  A BR  1 
HETATM 1479 BR BR  . BR  J 3 .   ? -30.231 25.067  -1.329  0.50   20.36 ? 1166 BR  A BR  1 
HETATM 1480 BR BR  . BR  K 3 .   ? -19.885 -4.823  4.748   0.50   38.16 ? 1167 BR  A BR  1 
HETATM 1481 C  C1  . GOL L 4 .   ? -34.831 1.983   12.024  1.00   30.59 ? 1168 GOL A C1  1 
HETATM 1482 O  O1  . GOL L 4 .   ? -35.229 1.782   10.738  1.00   20.50 ? 1168 GOL A O1  1 
HETATM 1483 C  C2  . GOL L 4 .   ? -34.084 0.713   12.369  1.00   23.99 ? 1168 GOL A C2  1 
HETATM 1484 O  O2  . GOL L 4 .   ? -34.779 0.292   13.504  1.00   20.51 ? 1168 GOL A O2  1 
HETATM 1485 C  C3  . GOL L 4 .   ? -32.761 1.431   12.546  1.00   15.35 ? 1168 GOL A C3  1 
HETATM 1486 O  O3  . GOL L 4 .   ? -32.155 1.390   13.761  1.00   10.32 ? 1168 GOL A O3  1 
HETATM 1487 C  C1  . GOL M 4 .   ? -16.223 17.889  -3.763  1.00   31.48 ? 1169 GOL A C1  1 
HETATM 1488 O  O1  . GOL M 4 .   ? -17.344 17.079  -4.037  1.00   33.85 ? 1169 GOL A O1  1 
HETATM 1489 C  C2  . GOL M 4 .   ? -16.389 18.515  -2.388  1.00   31.60 ? 1169 GOL A C2  1 
HETATM 1490 O  O2  . GOL M 4 .   ? -17.667 19.090  -2.212  1.00   24.11 ? 1169 GOL A O2  1 
HETATM 1491 C  C3  . GOL M 4 .   ? -15.287 19.522  -2.120  1.00   33.81 ? 1169 GOL A C3  1 
HETATM 1492 O  O3  . GOL M 4 .   ? -14.492 19.099  -1.027  1.00   42.06 ? 1169 GOL A O3  1 
HETATM 1493 O  O   . HOH N 5 .   ? -47.159 6.295   8.852   1.00   44.15 ? 2001 HOH A O   1 
HETATM 1494 O  O   . HOH N 5 .   ? -47.255 10.140  2.121   1.00   11.67 ? 2002 HOH A O   1 
HETATM 1495 O  O   . HOH N 5 .   ? -49.557 5.571   3.372   1.00   49.91 ? 2003 HOH A O   1 
HETATM 1496 O  O   . HOH N 5 .   ? -45.991 11.094  4.761   1.00   29.75 ? 2004 HOH A O   1 
HETATM 1497 O  O   . HOH N 5 .   ? -41.712 3.358   9.747   1.00   17.86 ? 2005 HOH A O   1 
HETATM 1498 O  O   . HOH N 5 .   ? -41.267 5.089   11.462  1.00   11.56 ? 2006 HOH A O   1 
HETATM 1499 O  O   . HOH N 5 .   ? -38.121 -0.220  13.664  1.00   33.55 ? 2007 HOH A O   1 
HETATM 1500 O  O   . HOH N 5 .   ? -46.038 1.792   5.884   1.00   36.78 ? 2008 HOH A O   1 
HETATM 1501 O  O   . HOH N 5 .   ? -44.004 23.737  -10.490 1.00   11.10 ? 2009 HOH A O   1 
HETATM 1502 O  O   . HOH N 5 .   ? -34.028 1.999   -7.663  1.00   10.47 ? 2010 HOH A O   1 
HETATM 1503 O  O   . HOH N 5 .   ? -25.365 6.319   -2.591  1.00   25.23 ? 2011 HOH A O   1 
HETATM 1504 O  O   . HOH N 5 .   ? -27.438 8.062   -0.269  1.00   22.02 ? 2012 HOH A O   1 
HETATM 1505 O  O   . HOH N 5 .   ? -14.722 6.706   10.111  1.00   26.20 ? 2013 HOH A O   1 
HETATM 1506 O  O   . HOH N 5 .   ? -43.996 20.604  -9.658  1.00   21.10 ? 2014 HOH A O   1 
HETATM 1507 O  O   . HOH N 5 .   ? -19.950 3.397   -5.404  1.00   49.88 ? 2015 HOH A O   1 
HETATM 1508 O  O   . HOH N 5 .   ? -28.910 -0.769  -9.478  1.00   29.33 ? 2016 HOH A O   1 
HETATM 1509 O  O   . HOH N 5 .   ? -24.213 1.367   -4.868  1.00   28.18 ? 2017 HOH A O   1 
HETATM 1510 O  O   . HOH N 5 .   ? -26.361 -6.113  -0.344  1.00   26.08 ? 2018 HOH A O   1 
HETATM 1511 O  O   . HOH N 5 .   ? -28.106 -7.083  5.693   1.00   9.60  ? 2019 HOH A O   1 
HETATM 1512 O  O   . HOH N 5 .   ? -36.421 -10.326 9.726   1.00   27.24 ? 2020 HOH A O   1 
HETATM 1513 O  O   . HOH N 5 .   ? -30.088 -9.678  9.263   1.00   48.10 ? 2021 HOH A O   1 
HETATM 1514 O  O   . HOH N 5 .   ? -39.559 -7.074  7.256   1.00   23.08 ? 2022 HOH A O   1 
HETATM 1515 O  O   . HOH N 5 .   ? -35.782 -8.855  13.329  1.00   9.40  ? 2023 HOH A O   1 
HETATM 1516 O  O   . HOH N 5 .   ? -43.142 0.830   8.137   1.00   35.44 ? 2024 HOH A O   1 
HETATM 1517 O  O   . HOH N 5 .   ? -48.048 -3.024  4.540   1.00   43.99 ? 2025 HOH A O   1 
HETATM 1518 O  O   . HOH N 5 .   ? -44.075 2.157   -3.240  1.00   30.77 ? 2026 HOH A O   1 
HETATM 1519 O  O   . HOH N 5 .   ? -15.358 7.265   7.988   1.00   29.31 ? 2027 HOH A O   1 
HETATM 1520 O  O   . HOH N 5 .   ? -44.504 5.304   -8.868  1.00   27.24 ? 2028 HOH A O   1 
HETATM 1521 O  O   . HOH N 5 .   ? -46.054 18.669  -8.814  1.00   25.82 ? 2029 HOH A O   1 
HETATM 1522 O  O   . HOH N 5 .   ? -40.991 16.976  -8.581  1.00   18.07 ? 2030 HOH A O   1 
HETATM 1523 O  O   . HOH N 5 .   ? -42.543 18.316  -8.108  1.00   19.81 ? 2031 HOH A O   1 
HETATM 1524 O  O   . HOH N 5 .   ? -42.087 19.532  15.526  1.00   36.78 ? 2032 HOH A O   1 
HETATM 1525 O  O   . HOH N 5 .   ? -49.088 13.494  14.173  1.00   42.59 ? 2033 HOH A O   1 
HETATM 1526 O  O   . HOH N 5 .   ? -32.468 12.683  -8.773  1.00   41.21 ? 2034 HOH A O   1 
HETATM 1527 O  O   . HOH N 5 .   ? -24.042 15.071  -5.725  1.00   41.68 ? 2035 HOH A O   1 
HETATM 1528 O  O   . HOH N 5 .   ? -28.410 22.184  -8.432  1.00   30.28 ? 2036 HOH A O   1 
HETATM 1529 O  O   . HOH N 5 .   ? -35.817 20.596  -9.857  1.00   26.03 ? 2037 HOH A O   1 
HETATM 1530 O  O   . HOH N 5 .   ? -31.303 23.920  -7.774  1.00   21.07 ? 2038 HOH A O   1 
HETATM 1531 O  O   . HOH N 5 .   ? -24.892 27.789  -2.292  1.00   20.58 ? 2039 HOH A O   1 
HETATM 1532 O  O   . HOH N 5 .   ? -33.603 21.339  -4.530  1.00   32.09 ? 2040 HOH A O   1 
HETATM 1533 O  O   . HOH N 5 .   ? -24.068 26.761  1.650   1.00   21.58 ? 2041 HOH A O   1 
HETATM 1534 O  O   . HOH N 5 .   ? -27.461 27.672  0.482   1.00   26.80 ? 2042 HOH A O   1 
HETATM 1535 O  O   . HOH N 5 .   ? -13.476 19.727  1.594   1.00   26.82 ? 2043 HOH A O   1 
HETATM 1536 O  O   . HOH N 5 .   ? -18.624 14.738  -0.344  1.00   22.17 ? 2044 HOH A O   1 
HETATM 1537 O  O   . HOH N 5 .   ? -18.159 14.187  2.838   1.00   27.45 ? 2045 HOH A O   1 
HETATM 1538 O  O   . HOH N 5 .   ? -16.177 25.468  13.024  1.00   31.28 ? 2046 HOH A O   1 
HETATM 1539 O  O   . HOH N 5 .   ? -15.097 23.545  11.464  1.00   36.13 ? 2047 HOH A O   1 
HETATM 1540 O  O   . HOH N 5 .   ? -19.072 14.495  15.890  1.00   31.36 ? 2048 HOH A O   1 
HETATM 1541 O  O   . HOH N 5 .   ? -11.562 13.960  17.638  1.00   39.29 ? 2049 HOH A O   1 
HETATM 1542 O  O   . HOH N 5 .   ? -11.060 15.084  15.467  1.00   37.14 ? 2050 HOH A O   1 
HETATM 1543 O  O   . HOH N 5 .   ? -12.077 16.761  9.641   1.00   42.72 ? 2051 HOH A O   1 
HETATM 1544 O  O   . HOH N 5 .   ? -14.847 10.069  15.048  1.00   31.42 ? 2052 HOH A O   1 
HETATM 1545 O  O   . HOH N 5 .   ? -17.638 6.195   22.905  1.00   24.57 ? 2053 HOH A O   1 
HETATM 1546 O  O   . HOH N 5 .   ? -29.487 10.261  17.613  1.00   30.54 ? 2054 HOH A O   1 
HETATM 1547 O  O   . HOH N 5 .   ? -28.690 11.126  22.034  1.00   13.26 ? 2055 HOH A O   1 
HETATM 1548 O  O   . HOH N 5 .   ? -24.394 15.698  18.278  1.00   74.02 ? 2056 HOH A O   1 
HETATM 1549 O  O   . HOH N 5 .   ? -33.341 9.406   17.639  1.00   22.30 ? 2057 HOH A O   1 
HETATM 1550 O  O   . HOH N 5 .   ? -33.011 13.689  17.231  1.00   39.51 ? 2058 HOH A O   1 
HETATM 1551 O  O   . HOH N 5 .   ? -29.241 24.981  22.173  1.00   18.41 ? 2059 HOH A O   1 
HETATM 1552 O  O   . HOH N 5 .   ? -36.411 24.455  21.861  1.00   19.85 ? 2060 HOH A O   1 
HETATM 1553 O  O   . HOH N 5 .   ? -39.378 23.252  20.682  1.00   17.03 ? 2061 HOH A O   1 
HETATM 1554 O  O   . HOH N 5 .   ? -37.902 18.728  20.431  1.00   34.72 ? 2062 HOH A O   1 
HETATM 1555 O  O   . HOH N 5 .   ? -38.293 15.259  18.482  1.00   29.82 ? 2063 HOH A O   1 
HETATM 1556 O  O   . HOH N 5 .   ? -33.773 29.948  18.797  1.00   7.89  ? 2064 HOH A O   1 
HETATM 1557 O  O   . HOH N 5 .   ? -33.957 29.784  14.155  1.00   27.25 ? 2065 HOH A O   1 
HETATM 1558 O  O   . HOH N 5 .   ? -38.901 25.608  17.758  1.00   30.86 ? 2066 HOH A O   1 
HETATM 1559 O  O   . HOH N 5 .   ? -36.695 24.721  14.209  1.00   23.60 ? 2067 HOH A O   1 
HETATM 1560 O  O   . HOH N 5 .   ? -42.726 25.875  5.626   1.00   16.34 ? 2068 HOH A O   1 
HETATM 1561 O  O   . HOH N 5 .   ? -23.690 14.956  4.891   1.00   13.15 ? 2069 HOH A O   1 
HETATM 1562 O  O   . HOH N 5 .   ? -21.638 13.585  -3.129  1.00   25.46 ? 2070 HOH A O   1 
HETATM 1563 O  O   . HOH N 5 .   ? -20.211 11.523  -1.562  1.00   24.03 ? 2071 HOH A O   1 
HETATM 1564 O  O   . HOH N 5 .   ? -16.884 8.267   -0.318  1.00   27.55 ? 2072 HOH A O   1 
HETATM 1565 O  O   . HOH N 5 .   ? -18.709 1.490   2.451   1.00   25.21 ? 2073 HOH A O   1 
HETATM 1566 O  O   . HOH N 5 .   ? -17.943 0.541   -0.967  1.00   53.15 ? 2074 HOH A O   1 
HETATM 1567 O  O   . HOH N 5 .   ? -13.194 3.032   -2.270  1.00   29.64 ? 2075 HOH A O   1 
HETATM 1568 O  O   . HOH N 5 .   ? -12.403 -1.267  6.302   1.00   40.80 ? 2076 HOH A O   1 
HETATM 1569 O  O   . HOH N 5 .   ? -18.826 -1.024  5.160   1.00   23.88 ? 2077 HOH A O   1 
HETATM 1570 O  O   . HOH N 5 .   ? -14.780 5.790   5.890   1.00   66.11 ? 2078 HOH A O   1 
HETATM 1571 O  O   . HOH N 5 .   ? -15.538 -3.321  8.254   1.00   15.20 ? 2079 HOH A O   1 
HETATM 1572 O  O   . HOH N 5 .   ? -30.300 9.100   16.278  1.00   22.97 ? 2080 HOH A O   1 
HETATM 1573 O  O   . HOH N 5 .   ? -35.098 2.050   15.899  1.00   15.94 ? 2081 HOH A O   1 
HETATM 1574 O  O   . HOH N 5 .   ? -29.932 6.844   17.167  1.00   21.55 ? 2082 HOH A O   1 
HETATM 1575 O  O   . HOH N 5 .   ? -36.783 10.924  17.581  1.00   31.43 ? 2083 HOH A O   1 
HETATM 1576 O  O   . HOH N 5 .   ? -35.592 13.184  16.777  1.00   21.91 ? 2084 HOH A O   1 
HETATM 1577 O  O   . HOH N 5 .   ? -37.081 3.734   16.141  1.00   21.11 ? 2085 HOH A O   1 
HETATM 1578 O  O   . HOH N 5 .   ? -37.712 7.670   18.205  1.00   36.34 ? 2086 HOH A O   1 
HETATM 1579 O  O   . HOH N 5 .   ? -42.393 16.899  14.325  1.00   22.36 ? 2087 HOH A O   1 
HETATM 1580 O  O   . HOH N 5 .   ? -47.397 11.874  13.105  1.00   35.33 ? 2088 HOH A O   1 
HETATM 1581 O  O   . HOH N 5 .   ? -40.361 8.036   10.873  1.00   15.16 ? 2089 HOH A O   1 
HETATM 1582 O  O   . HOH N 5 .   ? -42.448 9.233   14.664  1.00   32.24 ? 2090 HOH A O   1 
HETATM 1583 O  O   . HOH N 5 .   ? -42.528 13.501  15.479  1.00   23.27 ? 2091 HOH A O   1 
HETATM 1584 O  O   . HOH N 5 .   ? -50.521 23.068  7.167   1.00   20.70 ? 2092 HOH A O   1 
HETATM 1585 O  O   . HOH N 5 .   ? -49.060 12.692  1.390   1.00   25.39 ? 2093 HOH A O   1 
HETATM 1586 O  O   . HOH N 5 .   ? -45.707 12.069  -6.283  1.00   33.91 ? 2094 HOH A O   1 
HETATM 1587 O  O   . HOH N 5 .   ? -49.626 19.870  -7.763  1.00   12.28 ? 2095 HOH A O   1 
HETATM 1588 O  O   . HOH N 5 .   ? -45.692 21.306  -6.685  1.00   27.42 ? 2096 HOH A O   1 
HETATM 1589 O  O   . HOH N 5 .   ? -44.117 19.761  -7.167  1.00   10.73 ? 2097 HOH A O   1 
HETATM 1590 O  O   . HOH N 5 .   ? -40.949 20.572  -8.354  1.00   22.03 ? 2098 HOH A O   1 
HETATM 1591 O  O   . HOH N 5 .   ? -41.221 23.819  -6.527  1.00   44.41 ? 2099 HOH A O   1 
HETATM 1592 O  O   . HOH O 5 .   ? -15.214 16.591  19.247  1.00   45.37 ? 2001 HOH B O   1 
HETATM 1593 O  O   . HOH O 5 .   ? -24.577 19.418  20.183  1.00   65.05 ? 2002 HOH B O   1 
HETATM 1594 O  O   . HOH O 5 .   ? -17.420 24.219  16.756  1.00   56.96 ? 2003 HOH B O   1 
HETATM 1595 O  O   . HOH O 5 .   ? -17.546 22.620  25.783  1.00   35.54 ? 2004 HOH B O   1 
HETATM 1596 O  O   . HOH O 5 .   ? -26.029 20.211  17.407  1.00   71.06 ? 2005 HOH B O   1 
HETATM 1597 O  O   . HOH O 5 .   ? -26.654 25.115  16.464  1.00   16.21 ? 2006 HOH B O   1 
HETATM 1598 O  O   . HOH O 5 .   ? -20.530 27.069  15.633  1.00   30.11 ? 2007 HOH B O   1 
HETATM 1599 O  O   . HOH O 5 .   ? -28.212 29.664  11.213  1.00   26.63 ? 2008 HOH B O   1 
HETATM 1600 O  O   . HOH O 5 .   ? -28.002 30.367  13.224  1.00   30.93 ? 2009 HOH B O   1 
HETATM 1601 O  O   . HOH O 5 .   ? -25.195 30.526  13.439  1.00   61.50 ? 2010 HOH B O   1 
HETATM 1602 O  O   . HOH O 5 .   ? -30.795 31.054  9.786   1.00   42.81 ? 2011 HOH B O   1 
HETATM 1603 O  O   . HOH O 5 .   ? -25.961 29.045  3.465   1.00   27.16 ? 2012 HOH B O   1 
HETATM 1604 O  O   . HOH O 5 .   ? -25.937 29.848  5.264   1.00   39.08 ? 2013 HOH B O   1 
HETATM 1605 O  O   . HOH O 5 .   ? -39.673 30.275  5.864   1.00   36.46 ? 2014 HOH B O   1 
HETATM 1606 O  O   . HOH O 5 .   ? -29.290 26.790  -7.473  1.00   32.80 ? 2015 HOH B O   1 
HETATM 1607 O  O   . HOH O 5 .   ? -37.541 24.448  -5.188  1.00   34.34 ? 2016 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -12 ?   ?   ?   A . n 
A 1 2   GLY 2   -11 ?   ?   ?   A . n 
A 1 3   SER 3   -10 ?   ?   ?   A . n 
A 1 4   HIS 4   -9  ?   ?   ?   A . n 
A 1 5   HIS 5   -8  ?   ?   ?   A . n 
A 1 6   HIS 6   -7  ?   ?   ?   A . n 
A 1 7   HIS 7   -6  ?   ?   ?   A . n 
A 1 8   HIS 8   -5  ?   ?   ?   A . n 
A 1 9   HIS 9   -4  ?   ?   ?   A . n 
A 1 10  SER 10  -3  ?   ?   ?   A . n 
A 1 11  GLN 11  -2  ?   ?   ?   A . n 
A 1 12  ASP 12  -1  ?   ?   ?   A . n 
A 1 13  PRO 13  0   ?   ?   ?   A . n 
A 1 14  MET 14  1   ?   ?   ?   A . n 
A 1 15  ALA 15  2   2   ALA ALA A . n 
A 1 16  TYR 16  3   3   TYR TYR A . n 
A 1 17  SER 17  4   4   SER SER A . n 
A 1 18  THR 18  5   5   THR THR A . n 
A 1 19  ARG 19  6   6   ARG ARG A . n 
A 1 20  GLU 20  7   7   GLU GLU A . n 
A 1 21  ILE 21  8   8   ILE ILE A . n 
A 1 22  LEU 22  9   9   LEU LEU A . n 
A 1 23  LEU 23  10  10  LEU LEU A . n 
A 1 24  ALA 24  11  11  ALA ALA A . n 
A 1 25  LEU 25  12  12  LEU LEU A . n 
A 1 26  CYS 26  13  13  CYS CYS A . n 
A 1 27  ILE 27  14  14  ILE ILE A . n 
A 1 28  ARG 28  15  15  ARG ARG A . n 
A 1 29  ASP 29  16  16  ASP ASP A . n 
A 1 30  SER 30  17  17  SER SER A . n 
A 1 31  ARG 31  18  18  ARG ARG A . n 
A 1 32  VAL 32  19  19  VAL VAL A . n 
A 1 33  HIS 33  20  20  HIS HIS A . n 
A 1 34  GLY 34  21  21  GLY GLY A . n 
A 1 35  ASN 35  22  22  ASN ASN A . n 
A 1 36  GLY 36  23  23  GLY GLY A . n 
A 1 37  THR 37  24  24  THR THR A . n 
A 1 38  LEU 38  25  25  LEU LEU A . n 
A 1 39  HIS 39  26  26  HIS HIS A . n 
A 1 40  PRO 40  27  27  PRO PRO A . n 
A 1 41  VAL 41  28  28  VAL VAL A . n 
A 1 42  LEU 42  29  29  LEU LEU A . n 
A 1 43  GLU 43  30  30  GLU GLU A . n 
A 1 44  LEU 44  31  31  LEU LEU A . n 
A 1 45  ALA 45  32  32  ALA ALA A . n 
A 1 46  ALA 46  33  33  ALA ALA A . n 
A 1 47  ARG 47  34  34  ARG ARG A . n 
A 1 48  GLU 48  35  35  GLU GLU A . n 
A 1 49  THR 49  36  36  THR THR A . n 
A 1 50  PRO 50  37  37  PRO PRO A . n 
A 1 51  LEU 51  38  38  LEU LEU A . n 
A 1 52  ARG 52  39  39  ARG ARG A . n 
A 1 53  LEU 53  40  40  LEU LEU A . n 
A 1 54  SER 54  41  41  SER SER A . n 
A 1 55  PRO 55  42  42  PRO PRO A . n 
A 1 56  GLU 56  43  43  GLU GLU A . n 
A 1 57  ASP 57  44  44  ASP ASP A . n 
A 1 58  THR 58  45  45  THR THR A . n 
A 1 59  VAL 59  46  46  VAL VAL A . n 
A 1 60  VAL 60  47  47  VAL VAL A . n 
A 1 61  LEU 61  48  48  LEU LEU A . n 
A 1 62  ARG 62  49  49  ARG ARG A . n 
A 1 63  TYR 63  50  50  TYR TYR A . n 
A 1 64  HIS 64  51  51  HIS HIS A . n 
A 1 65  VAL 65  52  52  VAL VAL A . n 
A 1 66  LEU 66  53  53  LEU LEU A . n 
A 1 67  LEU 67  54  54  LEU LEU A . n 
A 1 68  GLU 68  55  55  GLU GLU A . n 
A 1 69  GLU 69  56  56  GLU GLU A . n 
A 1 70  ILE 70  57  57  ILE ILE A . n 
A 1 71  ILE 71  58  58  ILE ILE A . n 
A 1 72  GLU 72  59  59  GLU GLU A . n 
A 1 73  ARG 73  60  60  ARG ARG A . n 
A 1 74  ASN 74  61  61  ASN ASN A . n 
A 1 75  SER 75  62  62  SER SER A . n 
A 1 76  GLU 76  63  63  GLU GLU A . n 
A 1 77  THR 77  64  64  THR THR A . n 
A 1 78  PHE 78  65  65  PHE PHE A . n 
A 1 79  THR 79  66  66  THR THR A . n 
A 1 80  GLU 80  67  67  GLU GLU A . n 
A 1 81  THR 81  68  68  THR THR A . n 
A 1 82  TRP 82  69  69  TRP TRP A . n 
A 1 83  ASN 83  70  70  ASN ASN A . n 
A 1 84  ARG 84  71  71  ARG ARG A . n 
A 1 85  PHE 85  72  72  PHE PHE A . n 
A 1 86  ILE 86  73  73  ILE ILE A . n 
A 1 87  THR 87  74  74  THR THR A . n 
A 1 88  HIS 88  75  75  HIS HIS A . n 
A 1 89  THR 89  76  76  THR THR A . n 
A 1 90  GLU 90  77  77  GLU GLU A . n 
A 1 91  HIS 91  78  78  HIS HIS A . n 
A 1 92  VAL 92  79  79  VAL VAL A . n 
A 1 93  ASP 93  80  80  ASP ASP A . n 
A 1 94  LEU 94  81  81  LEU LEU A . n 
A 1 95  ASP 95  82  82  ASP ASP A . n 
A 1 96  PHE 96  83  83  PHE PHE A . n 
A 1 97  ASN 97  84  84  ASN ASN A . n 
A 1 98  SER 98  85  85  SER SER A . n 
A 1 99  VAL 99  86  86  VAL VAL A . n 
A 1 100 PHE 100 87  87  PHE PHE A . n 
A 1 101 LEU 101 88  88  LEU LEU A . n 
A 1 102 GLU 102 89  89  GLU GLU A . n 
A 1 103 ILE 103 90  90  ILE ILE A . n 
A 1 104 PHE 104 91  91  PHE PHE A . n 
A 1 105 HIS 105 92  92  HIS HIS A . n 
A 1 106 ARG 106 93  93  ARG ARG A . n 
A 1 107 GLY 107 94  94  GLY GLY A . n 
A 1 108 ASP 108 95  95  ASP ASP A . n 
A 1 109 PRO 109 96  96  PRO PRO A . n 
A 1 110 SER 110 97  97  SER SER A . n 
A 1 111 LEU 111 98  98  LEU LEU A . n 
A 1 112 GLY 112 99  99  GLY GLY A . n 
A 1 113 ARG 113 100 100 ARG ARG A . n 
A 1 114 ALA 114 101 101 ALA ALA A . n 
A 1 115 LEU 115 102 102 LEU LEU A . n 
A 1 116 ALA 116 103 103 ALA ALA A . n 
A 1 117 TRP 117 104 104 TRP TRP A . n 
A 1 118 MET 118 105 105 MET MET A . n 
A 1 119 ALA 119 106 106 ALA ALA A . n 
A 1 120 TRP 120 107 107 TRP TRP A . n 
A 1 121 CYS 121 108 108 CYS CYS A . n 
A 1 122 MET 122 109 109 MET MET A . n 
A 1 123 HIS 123 110 110 HIS HIS A . n 
A 1 124 ALA 124 111 111 ALA ALA A . n 
A 1 125 CYS 125 112 112 CYS CYS A . n 
A 1 126 ARG 126 113 113 ARG ARG A . n 
A 1 127 THR 127 114 114 THR THR A . n 
A 1 128 LEU 128 115 115 LEU LEU A . n 
A 1 129 CYS 129 116 116 CYS CYS A . n 
A 1 130 CYS 130 117 117 CYS CYS A . n 
A 1 131 ASN 131 118 118 ASN ASN A . n 
A 1 132 GLN 132 119 119 GLN GLN A . n 
A 1 133 SER 133 120 120 SER SER A . n 
A 1 134 THR 134 121 121 THR THR A . n 
A 1 135 PRO 135 122 122 PRO PRO A . n 
A 1 136 TYR 136 123 123 TYR TYR A . n 
A 1 137 TYR 137 124 124 TYR TYR A . n 
A 1 138 VAL 138 125 125 VAL VAL A . n 
A 1 139 VAL 139 126 126 VAL VAL A . n 
A 1 140 ASP 140 127 127 ASP ASP A . n 
A 1 141 LEU 141 128 128 LEU LEU A . n 
A 1 142 SER 142 129 129 SER SER A . n 
A 1 143 VAL 143 130 130 VAL VAL A . n 
A 1 144 ARG 144 131 131 ARG ARG A . n 
A 1 145 GLY 145 132 132 GLY GLY A . n 
A 1 146 MET 146 133 133 MET MET A . n 
A 1 147 LEU 147 134 134 LEU LEU A . n 
A 1 148 GLU 148 135 135 GLU GLU A . n 
A 1 149 ALA 149 136 136 ALA ALA A . n 
A 1 150 SER 150 137 137 SER SER A . n 
A 1 151 GLU 151 138 138 GLU GLU A . n 
A 1 152 GLY 152 139 139 GLY GLY A . n 
A 1 153 LEU 153 140 140 LEU LEU A . n 
A 1 154 ASP 154 141 141 ASP ASP A . n 
A 1 155 GLY 155 142 142 GLY GLY A . n 
A 1 156 TRP 156 143 143 TRP TRP A . n 
A 1 157 ILE 157 144 144 ILE ILE A . n 
A 1 158 HIS 158 145 145 HIS HIS A . n 
A 1 159 GLN 159 146 146 GLN GLN A . n 
A 1 160 GLN 160 147 147 GLN GLN A . n 
A 1 161 GLY 161 148 148 GLY GLY A . n 
A 1 162 GLY 162 149 149 GLY GLY A . n 
A 1 163 TRP 163 150 150 TRP TRP A . n 
A 1 164 SER 164 151 151 SER SER A . n 
A 1 165 THR 165 152 152 THR THR A . n 
A 1 166 LEU 166 153 153 LEU LEU A . n 
A 1 167 ILE 167 154 154 ILE ILE A . n 
A 1 168 GLU 168 155 155 GLU GLU A . n 
A 1 169 ASP 169 156 156 ASP ASP A . n 
A 1 170 ASN 170 157 157 ASN ASN A . n 
A 1 171 ILE 171 158 158 ILE ILE A . n 
A 1 172 PRO 172 159 ?   ?   ?   A . n 
A 1 173 GLY 173 160 ?   ?   ?   A . n 
B 2 1   ASP 1   51  51  ASP ASP B . n 
B 2 2   MET 2   52  52  MET MET B . n 
B 2 3   ARG 3   53  53  ARG ARG B . n 
B 2 4   PRO 4   54  54  PRO PRO B . n 
B 2 5   GLU 5   55  55  GLU GLU B . n 
B 2 6   ILE 6   56  56  ILE ILE B . n 
B 2 7   TRP 7   57  57  TRP TRP B . n 
B 2 8   ILE 8   58  58  ILE ILE B . n 
B 2 9   ALA 9   59  59  ALA ALA B . n 
B 2 10  GLN 10  60  60  GLN GLN B . n 
B 2 11  GLU 11  61  61  GLU GLU B . n 
B 2 12  LEU 12  62  62  LEU LEU B . n 
B 2 13  ARG 13  63  63  ARG ARG B . n 
B 2 14  ARG 14  64  64  ARG ARG B . n 
B 2 15  ILE 15  65  65  ILE ILE B . n 
B 2 16  GLY 16  66  66  GLY GLY B . n 
B 2 17  ASP 17  67  67  ASP ASP B . n 
B 2 18  GLU 18  68  68  GLU GLU B . n 
B 2 19  PHE 19  69  69  PHE PHE B . n 
B 2 20  ASN 20  70  70  ASN ASN B . n 
B 2 21  ALA 21  71  71  ALA ALA B . n 
B 2 22  TYR 22  72  72  TYR TYR B . n 
B 2 23  TYR 23  73  ?   ?   ?   B . n 
B 2 24  ALA 24  74  ?   ?   ?   B . n 
B 2 25  ARG 25  75  ?   ?   ?   B . n 
B 2 26  ARG 26  76  ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 BR  1  1159 1159 BR  BR  A . 
D 3 BR  1  1160 1160 BR  BR  A . 
E 3 BR  1  1161 1161 BR  BR  A . 
F 3 BR  1  1162 1162 BR  BR  A . 
G 3 BR  1  1163 1163 BR  BR  A . 
H 3 BR  1  1164 1164 BR  BR  A . 
I 3 BR  1  1165 1165 BR  BR  A . 
J 3 BR  1  1166 1166 BR  BR  A . 
K 3 BR  1  1167 1167 BR  BR  A . 
L 4 GOL 1  1168 1168 GOL GOL A . 
M 4 GOL 1  1169 1169 GOL GOL A . 
N 5 HOH 1  2001 2001 HOH HOH A . 
N 5 HOH 2  2002 2002 HOH HOH A . 
N 5 HOH 3  2003 2003 HOH HOH A . 
N 5 HOH 4  2004 2004 HOH HOH A . 
N 5 HOH 5  2005 2005 HOH HOH A . 
N 5 HOH 6  2006 2006 HOH HOH A . 
N 5 HOH 7  2007 2007 HOH HOH A . 
N 5 HOH 8  2008 2008 HOH HOH A . 
N 5 HOH 9  2009 2009 HOH HOH A . 
N 5 HOH 10 2010 2010 HOH HOH A . 
N 5 HOH 11 2011 2011 HOH HOH A . 
N 5 HOH 12 2012 2012 HOH HOH A . 
N 5 HOH 13 2013 2013 HOH HOH A . 
N 5 HOH 14 2014 2014 HOH HOH A . 
N 5 HOH 15 2015 2015 HOH HOH A . 
N 5 HOH 16 2016 2016 HOH HOH A . 
N 5 HOH 17 2017 2017 HOH HOH A . 
N 5 HOH 18 2018 2018 HOH HOH A . 
N 5 HOH 19 2019 2019 HOH HOH A . 
N 5 HOH 20 2020 2020 HOH HOH A . 
N 5 HOH 21 2021 2021 HOH HOH A . 
N 5 HOH 22 2022 2022 HOH HOH A . 
N 5 HOH 23 2023 2023 HOH HOH A . 
N 5 HOH 24 2024 2024 HOH HOH A . 
N 5 HOH 25 2025 2025 HOH HOH A . 
N 5 HOH 26 2026 2026 HOH HOH A . 
N 5 HOH 27 2027 2027 HOH HOH A . 
N 5 HOH 28 2028 2028 HOH HOH A . 
N 5 HOH 29 2029 2029 HOH HOH A . 
N 5 HOH 30 2030 2030 HOH HOH A . 
N 5 HOH 31 2031 2031 HOH HOH A . 
N 5 HOH 32 2032 2032 HOH HOH A . 
N 5 HOH 33 2033 2033 HOH HOH A . 
N 5 HOH 34 2034 2034 HOH HOH A . 
N 5 HOH 35 2035 2035 HOH HOH A . 
N 5 HOH 36 2036 2036 HOH HOH A . 
N 5 HOH 37 2037 2037 HOH HOH A . 
N 5 HOH 38 2038 2038 HOH HOH A . 
N 5 HOH 39 2039 2039 HOH HOH A . 
N 5 HOH 40 2040 2040 HOH HOH A . 
N 5 HOH 41 2041 2041 HOH HOH A . 
N 5 HOH 42 2042 2042 HOH HOH A . 
N 5 HOH 43 2043 2043 HOH HOH A . 
N 5 HOH 44 2044 2044 HOH HOH A . 
N 5 HOH 45 2045 2045 HOH HOH A . 
N 5 HOH 46 2046 2046 HOH HOH A . 
N 5 HOH 47 2047 2047 HOH HOH A . 
N 5 HOH 48 2048 2048 HOH HOH A . 
N 5 HOH 49 2049 2049 HOH HOH A . 
N 5 HOH 50 2050 2050 HOH HOH A . 
N 5 HOH 51 2051 2051 HOH HOH A . 
N 5 HOH 52 2052 2052 HOH HOH A . 
N 5 HOH 53 2053 2053 HOH HOH A . 
N 5 HOH 54 2054 2054 HOH HOH A . 
N 5 HOH 55 2055 2055 HOH HOH A . 
N 5 HOH 56 2056 2056 HOH HOH A . 
N 5 HOH 57 2057 2057 HOH HOH A . 
N 5 HOH 58 2058 2058 HOH HOH A . 
N 5 HOH 59 2059 2059 HOH HOH A . 
N 5 HOH 60 2060 2060 HOH HOH A . 
N 5 HOH 61 2061 2061 HOH HOH A . 
N 5 HOH 62 2062 2062 HOH HOH A . 
N 5 HOH 63 2063 2063 HOH HOH A . 
N 5 HOH 64 2064 2064 HOH HOH A . 
N 5 HOH 65 2065 2065 HOH HOH A . 
N 5 HOH 66 2066 2066 HOH HOH A . 
N 5 HOH 67 2067 2067 HOH HOH A . 
N 5 HOH 68 2068 2068 HOH HOH A . 
N 5 HOH 69 2069 2069 HOH HOH A . 
N 5 HOH 70 2070 2070 HOH HOH A . 
N 5 HOH 71 2071 2071 HOH HOH A . 
N 5 HOH 72 2072 2072 HOH HOH A . 
N 5 HOH 73 2073 2073 HOH HOH A . 
N 5 HOH 74 2074 2074 HOH HOH A . 
N 5 HOH 75 2075 2075 HOH HOH A . 
N 5 HOH 76 2076 2076 HOH HOH A . 
N 5 HOH 77 2077 2077 HOH HOH A . 
N 5 HOH 78 2078 2078 HOH HOH A . 
N 5 HOH 79 2079 2079 HOH HOH A . 
N 5 HOH 80 2080 2080 HOH HOH A . 
N 5 HOH 81 2081 2081 HOH HOH A . 
N 5 HOH 82 2082 2082 HOH HOH A . 
N 5 HOH 83 2083 2083 HOH HOH A . 
N 5 HOH 84 2084 2084 HOH HOH A . 
N 5 HOH 85 2085 2085 HOH HOH A . 
N 5 HOH 86 2086 2086 HOH HOH A . 
N 5 HOH 87 2087 2087 HOH HOH A . 
N 5 HOH 88 2088 2088 HOH HOH A . 
N 5 HOH 89 2089 2089 HOH HOH A . 
N 5 HOH 90 2090 2090 HOH HOH A . 
N 5 HOH 91 2091 2091 HOH HOH A . 
N 5 HOH 92 2092 2092 HOH HOH A . 
N 5 HOH 93 2093 2093 HOH HOH A . 
N 5 HOH 94 2094 2094 HOH HOH A . 
N 5 HOH 95 2095 2095 HOH HOH A . 
N 5 HOH 96 2096 2096 HOH HOH A . 
N 5 HOH 97 2097 2097 HOH HOH A . 
N 5 HOH 98 2098 2098 HOH HOH A . 
N 5 HOH 99 2099 2099 HOH HOH A . 
O 5 HOH 1  2001 2001 HOH HOH B . 
O 5 HOH 2  2002 2002 HOH HOH B . 
O 5 HOH 3  2003 2003 HOH HOH B . 
O 5 HOH 4  2004 2004 HOH HOH B . 
O 5 HOH 5  2005 2005 HOH HOH B . 
O 5 HOH 6  2006 2006 HOH HOH B . 
O 5 HOH 7  2007 2007 HOH HOH B . 
O 5 HOH 8  2008 2008 HOH HOH B . 
O 5 HOH 9  2009 2009 HOH HOH B . 
O 5 HOH 10 2010 2010 HOH HOH B . 
O 5 HOH 11 2011 2011 HOH HOH B . 
O 5 HOH 12 2012 2012 HOH HOH B . 
O 5 HOH 13 2013 2013 HOH HOH B . 
O 5 HOH 14 2014 2014 HOH HOH B . 
O 5 HOH 15 2015 2015 HOH HOH B . 
O 5 HOH 16 2016 2016 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3410  ? 
1 MORE         -17.5 ? 
1 'SSA (A^2)'  8880  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-05-26 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-03-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' Advisory                    
5 3 'Structure model' 'Database references'       
6 3 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation                     
2 3 'Structure model' citation_author              
3 3 'Structure model' entity_src_gen               
4 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_abbrev'                       
2  3 'Structure model' '_citation.journal_id_ISSN'                      
3  3 'Structure model' '_citation.page_first'                           
4  3 'Structure model' '_citation.page_last'                            
5  3 'Structure model' '_citation.pdbx_database_id_DOI'                 
6  3 'Structure model' '_citation.title'                                
7  3 'Structure model' '_citation.year'                                 
8  3 'Structure model' '_citation_author.name'                          
9  3 'Structure model' '_entity_src_gen.gene_src_strain'                
10 3 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 
11 3 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name'  
12 3 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
13 3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
14 3 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
15 3 'Structure model' '_entity_src_gen.pdbx_host_org_variant'          
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -31.2863 10.8281 4.9905 -0.0182 -0.0602 -0.0487 -0.0351 -0.0121 0.0172  0.3053 1.0312 1.5152 
0.3420 -0.2875 -0.5980 -0.0555 0.0472  -0.0333 -0.0507 0.0960 0.0569  -0.1177 -0.0378 -0.0404 
'X-RAY DIFFRACTION' 2 ? refined -27.1692 24.9296 9.2571 0.1921  -0.1638 -0.0635 -0.0904 0.1041  -0.0042 7.5978 3.2718 3.3341 
0.6473 2.5020  1.2713  0.0839  -0.2723 0.5385  -0.4480 0.2327 0.0050  -0.4916 0.3781  -0.3166 
'X-RAY DIFFRACTION' 3 ? refined -30.6051 12.5791 5.2648 0.0402  0.0284  0.0625  -0.0183 -0.0006 0.0005  1.5328 1.2257 2.4635 
0.2994 -0.3345 -0.6295 0.0016  -0.0351 0.0229  0.0583  0.0496 -0.0564 -0.1638 -0.0246 -0.0512 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 1    ? ? A 159  ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 51   ? ? B 76   ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 2001 ? ? A 2099 ? ? ? ? 
'X-RAY DIFFRACTION' 4 3 B 2001 ? ? B 2016 ? ? ? ? 
'X-RAY DIFFRACTION' 5 3 A 1159 ? ? A 1167 ? ? ? ? 
'X-RAY DIFFRACTION' 6 3 A 1168 ? ? A 1169 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC   refinement       5.2.0019 ? 1 ? ? ? ? 
HKL-2000 'data reduction' .        ? 2 ? ? ? ? 
HKL-2000 'data scaling'   .        ? 3 ? ? ? ? 
PHASER   phasing          .        ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 2054 ? ? O  A HOH 2080 ? ? 1.95 
2 1 O   B HOH 2012 ? ? O  B HOH 2013 ? ? 1.97 
3 1 O   A ILE 158  ? ? O  A HOH 2097 ? ? 2.03 
4 1 O   A HOH 2030 ? ? O  A HOH 2031 ? ? 2.10 
5 1 NE2 A HIS 92   ? ? O  A HOH 2062 ? ? 2.13 
6 1 O   A GLY 94   ? ? O  A HOH 2067 ? ? 2.14 
7 1 O   B HOH 2008 ? ? O  B HOH 2009 ? ? 2.14 
8 1 O   A GLU 155  ? ? O  A HOH 2095 ? ? 2.16 
9 1 NH1 A ARG 60   ? ? BR A BR  1166 ? ? 2.18 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 2021 ? ? 1_555 O   A HOH 2055 ? ? 5_555 2.07 
2 1 OE1 A GLU 59   ? ? 1_555 ND2 A ASN 84   ? ? 2_564 2.08 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD  A GLU 55  ? B OE2 A GLU 55  ? B 1.323 1.252 0.071  0.011 N 
2 1 NE2 A HIS 92  ? ? CD2 A HIS 92  ? ? 1.297 1.373 -0.076 0.011 N 
3 1 CD  A GLN 146 ? ? OE1 A GLN 146 ? ? 1.435 1.235 0.200  0.022 N 
4 1 CG  B ARG 53  ? ? CD  B ARG 53  ? ? 1.270 1.515 -0.245 0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 ND1 A HIS 92 ? ? CG A HIS 92 ? ? CD2 A HIS 92 ? ? 94.50  106.00 -11.50 1.40 N 
2 1 CB  A HIS 92 ? ? CG A HIS 92 ? ? ND1 A HIS 92 ? ? 112.64 121.40 -8.76  1.30 N 
3 1 CA  A ASP 95 ? ? CB A ASP 95 ? ? CG  A ASP 95 ? ? 90.98  113.40 -22.42 2.20 N 
4 1 CB  A ASP 95 ? ? CG A ASP 95 ? ? OD1 A ASP 95 ? ? 153.31 118.30 35.01  0.90 N 
5 1 CB  A ASP 95 ? ? CG A ASP 95 ? ? OD2 A ASP 95 ? ? 86.39  118.30 -31.91 0.90 N 
6 1 CB  B ARG 53 ? ? CG B ARG 53 ? ? CD  B ARG 53 ? ? 131.33 111.60 19.73  2.60 N 
7 1 NH1 B ARG 64 ? ? CZ B ARG 64 ? ? NH2 B ARG 64 ? ? 109.61 119.40 -9.79  1.10 N 
8 1 NE  B ARG 64 ? ? CZ B ARG 64 ? ? NH1 B ARG 64 ? ? 129.82 120.30 9.52   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 36 ? ? -60.70  -75.52 
2 1 HIS A 78 ? ? -158.60 89.76  
3 1 ARG A 93 ? ? -112.78 67.48  
4 1 ASN B 70 ? ? -51.38  -7.16  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   THR 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    36 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    37 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            35.54 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             THR 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              36 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   12.36 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 HIS A 92  ? ? 0.167 'SIDE CHAIN' 
2 1 GLN A 146 ? ? 0.107 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -12 ? A MET 1   
2  1 Y 1 A GLY -11 ? A GLY 2   
3  1 Y 1 A SER -10 ? A SER 3   
4  1 Y 1 A HIS -9  ? A HIS 4   
5  1 Y 1 A HIS -8  ? A HIS 5   
6  1 Y 1 A HIS -7  ? A HIS 6   
7  1 Y 1 A HIS -6  ? A HIS 7   
8  1 Y 1 A HIS -5  ? A HIS 8   
9  1 Y 1 A HIS -4  ? A HIS 9   
10 1 Y 1 A SER -3  ? A SER 10  
11 1 Y 1 A GLN -2  ? A GLN 11  
12 1 Y 1 A ASP -1  ? A ASP 12  
13 1 Y 1 A PRO 0   ? A PRO 13  
14 1 Y 1 A MET 1   ? A MET 14  
15 1 Y 1 A PRO 159 ? A PRO 172 
16 1 Y 1 A GLY 160 ? A GLY 173 
17 1 Y 1 B TYR 73  ? B TYR 23  
18 1 Y 1 B ALA 74  ? B ALA 24  
19 1 Y 1 B ARG 75  ? B ARG 25  
20 1 Y 1 B ARG 76  ? B ARG 26  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'BROMIDE ION' BR  
4 GLYCEROL      GOL 
5 water         HOH 
#