data_2WHP
# 
_entry.id   2WHP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WHP         
PDBE  EBI-39643    
WWPDB D_1290039643 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WHP 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ekstrom, F.'       1 
'Hornberg, A.'      2 
'Artursson, E.'     3 
'Hammarstrom, L.G.' 4 
'Schneider, G.'     5 
'Pang, Y.P.'        6 
# 
_citation.id                        primary 
_citation.title                     
;Structure of Hi-6Sarin-Acetylcholinesterase Determined by X-Ray Crystallography and Molecular Dynamics Simulation: Reactivator Mechanism and Design.
;
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            4 
_citation.page_first                E5957 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19536291 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PONE.0005957 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ekstrom, F.'       1 ? 
primary 'Hornberg, A.'      2 ? 
primary 'Artursson, E.'     3 ? 
primary 'Hammarstrom, L.G.' 4 ? 
primary 'Schneider, G.'     5 ? 
primary 'Pang, Y.P.'        6 ? 
# 
_cell.entry_id           2WHP 
_cell.length_a           79.260 
_cell.length_b           112.150 
_cell.length_c           226.950 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WHP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                                                           60354.070 1   
3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-573' 'CATALYTIC SER203 PHOSPHONYLATED BY SARIN' 
2 polymer     man ACETYLCHOLINESTERASE                                                                           60341.031 1   
3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-573' 'CATALYTIC SER203 PHOSPHONYLATED BY SARIN' 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       221.208   3   ? ? 
?                                   ?                                          
4 non-polymer syn '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 288.302   2   ? ? 
?                                   ?                                          
5 non-polymer syn 'CARBONATE ION'                                                                                60.009    1   ? ? 
?                                   ?                                          
6 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                        106.120   1   ? ? 
?                                   ?                                          
7 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                                          282.331   1   ? ? 
?                                   ?                                          
8 water       nat water                                                                                          18.015    793 ? ? 
?                                   ?                                          
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 ACHE 
2 ACHE 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SGB)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
A ? 
2 'polypeptide(L)' no yes 
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SGB)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPDWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPDWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SGB n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
2 1   GLU n 
2 2   GLY n 
2 3   ARG n 
2 4   GLU n 
2 5   ASP n 
2 6   PRO n 
2 7   GLN n 
2 8   LEU n 
2 9   LEU n 
2 10  VAL n 
2 11  ARG n 
2 12  VAL n 
2 13  ARG n 
2 14  GLY n 
2 15  GLY n 
2 16  GLN n 
2 17  LEU n 
2 18  ARG n 
2 19  GLY n 
2 20  ILE n 
2 21  ARG n 
2 22  LEU n 
2 23  LYS n 
2 24  ALA n 
2 25  PRO n 
2 26  GLY n 
2 27  GLY n 
2 28  PRO n 
2 29  VAL n 
2 30  SER n 
2 31  ALA n 
2 32  PHE n 
2 33  LEU n 
2 34  GLY n 
2 35  ILE n 
2 36  PRO n 
2 37  PHE n 
2 38  ALA n 
2 39  GLU n 
2 40  PRO n 
2 41  PRO n 
2 42  VAL n 
2 43  GLY n 
2 44  SER n 
2 45  ARG n 
2 46  ARG n 
2 47  PHE n 
2 48  MET n 
2 49  PRO n 
2 50  PRO n 
2 51  GLU n 
2 52  PRO n 
2 53  LYS n 
2 54  ARG n 
2 55  PRO n 
2 56  TRP n 
2 57  SER n 
2 58  GLY n 
2 59  VAL n 
2 60  LEU n 
2 61  ASP n 
2 62  ALA n 
2 63  THR n 
2 64  THR n 
2 65  PHE n 
2 66  GLN n 
2 67  ASN n 
2 68  VAL n 
2 69  CYS n 
2 70  TYR n 
2 71  GLN n 
2 72  TYR n 
2 73  VAL n 
2 74  ASP n 
2 75  THR n 
2 76  LEU n 
2 77  TYR n 
2 78  PRO n 
2 79  GLY n 
2 80  PHE n 
2 81  GLU n 
2 82  GLY n 
2 83  THR n 
2 84  GLU n 
2 85  MET n 
2 86  TRP n 
2 87  ASN n 
2 88  PRO n 
2 89  ASN n 
2 90  ARG n 
2 91  GLU n 
2 92  LEU n 
2 93  SER n 
2 94  GLU n 
2 95  ASP n 
2 96  CYS n 
2 97  LEU n 
2 98  TYR n 
2 99  LEU n 
2 100 ASN n 
2 101 VAL n 
2 102 TRP n 
2 103 THR n 
2 104 PRO n 
2 105 TYR n 
2 106 PRO n 
2 107 ARG n 
2 108 PRO n 
2 109 ALA n 
2 110 SER n 
2 111 PRO n 
2 112 THR n 
2 113 PRO n 
2 114 VAL n 
2 115 LEU n 
2 116 ILE n 
2 117 TRP n 
2 118 ILE n 
2 119 TYR n 
2 120 GLY n 
2 121 GLY n 
2 122 GLY n 
2 123 PHE n 
2 124 TYR n 
2 125 SER n 
2 126 GLY n 
2 127 ALA n 
2 128 ALA n 
2 129 SER n 
2 130 LEU n 
2 131 ASP n 
2 132 VAL n 
2 133 TYR n 
2 134 ASP n 
2 135 GLY n 
2 136 ARG n 
2 137 PHE n 
2 138 LEU n 
2 139 ALA n 
2 140 GLN n 
2 141 VAL n 
2 142 GLU n 
2 143 GLY n 
2 144 ALA n 
2 145 VAL n 
2 146 LEU n 
2 147 VAL n 
2 148 SER n 
2 149 MET n 
2 150 ASN n 
2 151 TYR n 
2 152 ARG n 
2 153 VAL n 
2 154 GLY n 
2 155 THR n 
2 156 PHE n 
2 157 GLY n 
2 158 PHE n 
2 159 LEU n 
2 160 ALA n 
2 161 LEU n 
2 162 PRO n 
2 163 GLY n 
2 164 SER n 
2 165 ARG n 
2 166 GLU n 
2 167 ALA n 
2 168 PRO n 
2 169 GLY n 
2 170 ASN n 
2 171 VAL n 
2 172 GLY n 
2 173 LEU n 
2 174 LEU n 
2 175 ASP n 
2 176 GLN n 
2 177 ARG n 
2 178 LEU n 
2 179 ALA n 
2 180 LEU n 
2 181 GLN n 
2 182 TRP n 
2 183 VAL n 
2 184 GLN n 
2 185 GLU n 
2 186 ASN n 
2 187 ILE n 
2 188 ALA n 
2 189 ALA n 
2 190 PHE n 
2 191 GLY n 
2 192 GLY n 
2 193 ASP n 
2 194 PRO n 
2 195 MET n 
2 196 SER n 
2 197 VAL n 
2 198 THR n 
2 199 LEU n 
2 200 PHE n 
2 201 GLY n 
2 202 GLU n 
2 203 SGB n 
2 204 ALA n 
2 205 GLY n 
2 206 ALA n 
2 207 ALA n 
2 208 SER n 
2 209 VAL n 
2 210 GLY n 
2 211 MET n 
2 212 HIS n 
2 213 ILE n 
2 214 LEU n 
2 215 SER n 
2 216 LEU n 
2 217 PRO n 
2 218 SER n 
2 219 ARG n 
2 220 SER n 
2 221 LEU n 
2 222 PHE n 
2 223 HIS n 
2 224 ARG n 
2 225 ALA n 
2 226 VAL n 
2 227 LEU n 
2 228 GLN n 
2 229 SER n 
2 230 GLY n 
2 231 THR n 
2 232 PRO n 
2 233 ASN n 
2 234 GLY n 
2 235 PRO n 
2 236 TRP n 
2 237 ALA n 
2 238 THR n 
2 239 VAL n 
2 240 SER n 
2 241 ALA n 
2 242 GLY n 
2 243 GLU n 
2 244 ALA n 
2 245 ARG n 
2 246 ARG n 
2 247 ARG n 
2 248 ALA n 
2 249 THR n 
2 250 LEU n 
2 251 LEU n 
2 252 ALA n 
2 253 ARG n 
2 254 LEU n 
2 255 VAL n 
2 256 GLY n 
2 257 CYS n 
2 258 PRO n 
2 259 PRO n 
2 260 GLY n 
2 261 GLY n 
2 262 ALA n 
2 263 GLY n 
2 264 GLY n 
2 265 ASN n 
2 266 ASP n 
2 267 THR n 
2 268 GLU n 
2 269 LEU n 
2 270 ILE n 
2 271 ALA n 
2 272 CYS n 
2 273 LEU n 
2 274 ARG n 
2 275 THR n 
2 276 ARG n 
2 277 PRO n 
2 278 ALA n 
2 279 GLN n 
2 280 ASP n 
2 281 LEU n 
2 282 VAL n 
2 283 ASP n 
2 284 HIS n 
2 285 GLU n 
2 286 TRP n 
2 287 HIS n 
2 288 VAL n 
2 289 LEU n 
2 290 PRO n 
2 291 GLN n 
2 292 GLU n 
2 293 SER n 
2 294 ILE n 
2 295 PHE n 
2 296 ARG n 
2 297 PHE n 
2 298 SER n 
2 299 PHE n 
2 300 VAL n 
2 301 PRO n 
2 302 VAL n 
2 303 VAL n 
2 304 ASP n 
2 305 GLY n 
2 306 ASP n 
2 307 PHE n 
2 308 LEU n 
2 309 SER n 
2 310 ASP n 
2 311 THR n 
2 312 PRO n 
2 313 GLU n 
2 314 ALA n 
2 315 LEU n 
2 316 ILE n 
2 317 ASN n 
2 318 THR n 
2 319 GLY n 
2 320 ASP n 
2 321 PHE n 
2 322 GLN n 
2 323 ASP n 
2 324 LEU n 
2 325 GLN n 
2 326 VAL n 
2 327 LEU n 
2 328 VAL n 
2 329 GLY n 
2 330 VAL n 
2 331 VAL n 
2 332 LYS n 
2 333 ASP n 
2 334 GLU n 
2 335 GLY n 
2 336 SER n 
2 337 TYR n 
2 338 PHE n 
2 339 LEU n 
2 340 VAL n 
2 341 TYR n 
2 342 GLY n 
2 343 VAL n 
2 344 PRO n 
2 345 GLY n 
2 346 PHE n 
2 347 SER n 
2 348 LYS n 
2 349 ASP n 
2 350 ASN n 
2 351 GLU n 
2 352 SER n 
2 353 LEU n 
2 354 ILE n 
2 355 SER n 
2 356 ARG n 
2 357 ALA n 
2 358 GLN n 
2 359 PHE n 
2 360 LEU n 
2 361 ALA n 
2 362 GLY n 
2 363 VAL n 
2 364 ARG n 
2 365 ILE n 
2 366 GLY n 
2 367 VAL n 
2 368 PRO n 
2 369 GLN n 
2 370 ALA n 
2 371 SER n 
2 372 ASP n 
2 373 LEU n 
2 374 ALA n 
2 375 ALA n 
2 376 GLU n 
2 377 ALA n 
2 378 VAL n 
2 379 VAL n 
2 380 LEU n 
2 381 HIS n 
2 382 TYR n 
2 383 THR n 
2 384 ASP n 
2 385 TRP n 
2 386 LEU n 
2 387 HIS n 
2 388 PRO n 
2 389 GLU n 
2 390 ASP n 
2 391 PRO n 
2 392 THR n 
2 393 HIS n 
2 394 LEU n 
2 395 ARG n 
2 396 ASP n 
2 397 ALA n 
2 398 MET n 
2 399 SER n 
2 400 ALA n 
2 401 VAL n 
2 402 VAL n 
2 403 GLY n 
2 404 ASP n 
2 405 HIS n 
2 406 ASN n 
2 407 VAL n 
2 408 VAL n 
2 409 CYS n 
2 410 PRO n 
2 411 VAL n 
2 412 ALA n 
2 413 GLN n 
2 414 LEU n 
2 415 ALA n 
2 416 GLY n 
2 417 ARG n 
2 418 LEU n 
2 419 ALA n 
2 420 ALA n 
2 421 GLN n 
2 422 GLY n 
2 423 ALA n 
2 424 ARG n 
2 425 VAL n 
2 426 TYR n 
2 427 ALA n 
2 428 TYR n 
2 429 ILE n 
2 430 PHE n 
2 431 GLU n 
2 432 HIS n 
2 433 ARG n 
2 434 ALA n 
2 435 SER n 
2 436 THR n 
2 437 LEU n 
2 438 THR n 
2 439 TRP n 
2 440 PRO n 
2 441 LEU n 
2 442 TRP n 
2 443 MET n 
2 444 GLY n 
2 445 VAL n 
2 446 PRO n 
2 447 HIS n 
2 448 GLY n 
2 449 TYR n 
2 450 GLU n 
2 451 ILE n 
2 452 GLU n 
2 453 PHE n 
2 454 ILE n 
2 455 PHE n 
2 456 GLY n 
2 457 LEU n 
2 458 PRO n 
2 459 LEU n 
2 460 ASP n 
2 461 PRO n 
2 462 SER n 
2 463 LEU n 
2 464 ASN n 
2 465 TYR n 
2 466 THR n 
2 467 THR n 
2 468 GLU n 
2 469 GLU n 
2 470 ARG n 
2 471 ILE n 
2 472 PHE n 
2 473 ALA n 
2 474 GLN n 
2 475 ARG n 
2 476 LEU n 
2 477 MET n 
2 478 LYS n 
2 479 TYR n 
2 480 TRP n 
2 481 THR n 
2 482 ASN n 
2 483 PHE n 
2 484 ALA n 
2 485 ARG n 
2 486 THR n 
2 487 GLY n 
2 488 ASP n 
2 489 PRO n 
2 490 ASN n 
2 491 ASP n 
2 492 PRO n 
2 493 ARG n 
2 494 ASP n 
2 495 SER n 
2 496 LYS n 
2 497 SER n 
2 498 PRO n 
2 499 ASP n 
2 500 TRP n 
2 501 PRO n 
2 502 PRO n 
2 503 TYR n 
2 504 THR n 
2 505 THR n 
2 506 ALA n 
2 507 ALA n 
2 508 GLN n 
2 509 GLN n 
2 510 TYR n 
2 511 VAL n 
2 512 SER n 
2 513 LEU n 
2 514 ASN n 
2 515 LEU n 
2 516 LYS n 
2 517 PRO n 
2 518 LEU n 
2 519 GLU n 
2 520 VAL n 
2 521 ARG n 
2 522 ARG n 
2 523 GLY n 
2 524 LEU n 
2 525 ARG n 
2 526 ALA n 
2 527 GLN n 
2 528 THR n 
2 529 CYS n 
2 530 ALA n 
2 531 PHE n 
2 532 TRP n 
2 533 ASN n 
2 534 ARG n 
2 535 PHE n 
2 536 LEU n 
2 537 PRO n 
2 538 LYS n 
2 539 LEU n 
2 540 LEU n 
2 541 SER n 
2 542 ALA n 
2 543 THR n 
2 544 ALA n 
2 545 THR n 
2 546 GLU n 
2 547 ALA n 
2 548 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? MOUSE ? ? ? ? ? ? ? ? 'MUS MUSCULUS' 10090 ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 
'HUMAN EMBRYONIC KIDNEY (HEK) 293 CELLS' ? ? ? ? ? ? ? ? ? PCDNA3.1 ? ? 
2 1 sample ? ? ? MOUSE ? ? ? ? ? ? ? ? 'MUS MUSCULUS' 10090 ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 
'HUMAN EMBRYONIC KIDNEY (HEK) 293 CELLS' ? ? ? ? ? ? ? ? ? PCDNA3.1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACES_MOUSE 1 ? ? P21836 ? 
2 PDB 2WHP       1 ? ? 2WHP   ? 
3 UNP ACES_MOUSE 2 ? ? P21836 ? 
4 PDB 2WHP       2 ? ? 2WHP   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2WHP A 1   ? 542 ? P21836 32  ? 573 ? 1   542 
2 2 2WHP A 543 ? 548 ? 2WHP   543 ? 548 ? 543 548 
3 3 2WHP B 1   ? 542 ? P21836 32  ? 573 ? 1   542 
4 4 2WHP B 543 ? 548 ? 2WHP   543 ? 548 ? 543 548 
# 
_struct_ref_seq_dif.align_id                     3 
_struct_ref_seq_dif.pdbx_pdb_id_code             2WHP 
_struct_ref_seq_dif.mon_id                       ASP 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      499 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P21836 
_struct_ref_seq_dif.db_mon_id                    GLN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          531 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            499 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                        
?                                                                                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                       
?                                                                                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                     
?                                                                                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                                
?                                                                                 'C4 H7 N O4'      133.103 
CO3 non-polymer                  . 'CARBONATE ION'                                                                                
?                                                                                 'C O3 -2'         60.009  
CYS 'L-peptide linking'          y CYSTEINE                                                                                       
?                                                                                 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                      
?                                                                                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                                
?                                                                                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                                                        
?                                                                                 'C2 H5 N O2'      75.067  
HI6 non-polymer                  . '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 
'1-(2-HYDROXY-IMINOMETHYLPYRIDINIUM)-1-(4-CARBOXYAMINO)-PYRIDINIUM DIMETHYLETHER' 'C14 H16 N4 O3 2' 288.302 
HIS 'L-peptide linking'          y HISTIDINE                                                                                      
?                                                                                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                                                                                          
?                                                                                 'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                     
?                                                                                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                        
?                                                                                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                         
?                                                                                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                     
?                                                                                 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       
?                                                                                 'C8 H15 N O6'     221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                                                                          
'POLYETHYLENE GLYCOL PEG400'                                                      'C12 H26 O7'      282.331 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                                                                        
?                                                                                 'C4 H10 O3'       106.120 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                  
?                                                                                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                        
?                                                                                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE                                                                                         
?                                                                                 'C3 H7 N O3'      105.093 
SGB 'L-peptide linking'          n 'O-[(S)-METHYL(1-METHYLETHOXY)PHOSPHORYL]-L-SERINE'                                            
?                                                                                 'C7 H16 N O5 P'   225.179 
THR 'L-peptide linking'          y THREONINE                                                                                      
?                                                                                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                     
?                                                                                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                       
?                                                                                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                                                         
?                                                                                 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2WHP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.1 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '26-30 % (V/V) PEG750MME 0.1 M HEPES PH 7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-02-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.041 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             1.041 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WHP 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.80 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   102346 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.90 
_reflns.B_iso_Wilson_estimate        38.88 
_reflns.pdbx_redundancy              7.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   98.9 
_reflns_shell.Rmerge_I_obs           0.46 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.10 
_reflns_shell.pdbx_redundancy        7.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WHP 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     102274 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.988 
_refine.ls_d_res_high                            2.2000 
_refine.ls_percent_reflns_obs                    98.98 
_refine.ls_R_factor_obs                          0.1761 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1754 
_refine.ls_R_factor_R_free                       0.2100 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2048 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -2.9857 
_refine.aniso_B[2][2]                            -0.8695 
_refine.aniso_B[3][3]                            3.8553 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.353 
_refine.solvent_model_param_bsol                 71.363 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'RESIDUES 258-264 ARE DISORDERED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.30 
_refine.pdbx_overall_phase_error                 20.21 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8275 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             793 
_refine_hist.number_atoms_total               9172 
_refine_hist.d_res_high                       2.2000 
_refine_hist.d_res_low                        28.988 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.013  ? ? 8699  'X-RAY DIFFRACTION' ? 
f_angle_d          1.425  ? ? 11877 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.957 ? ? 3103  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.091  ? ? 1276  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 1559  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.2000 2.2512  6542 0.2964 99.00  0.3149 . . 162 . . 
'X-RAY DIFFRACTION' . 2.2512 2.3074  6570 0.2586 99.00  0.2908 . . 127 . . 
'X-RAY DIFFRACTION' . 2.3074 2.3698  6601 0.2403 99.00  0.2690 . . 137 . . 
'X-RAY DIFFRACTION' . 2.3698 2.4395  6589 0.2286 99.00  0.2741 . . 128 . . 
'X-RAY DIFFRACTION' . 2.4395 2.5182  6616 0.2023 99.00  0.2349 . . 117 . . 
'X-RAY DIFFRACTION' . 2.5182 2.6081  6651 0.1785 99.00  0.2170 . . 138 . . 
'X-RAY DIFFRACTION' . 2.6081 2.7125  6615 0.1712 99.00  0.2331 . . 154 . . 
'X-RAY DIFFRACTION' . 2.7125 2.8358  6658 0.1682 99.00  0.2195 . . 134 . . 
'X-RAY DIFFRACTION' . 2.8358 2.9852  6682 0.1582 99.00  0.2053 . . 133 . . 
'X-RAY DIFFRACTION' . 2.9852 3.1720  6681 0.1623 99.00  0.1776 . . 149 . . 
'X-RAY DIFFRACTION' . 3.1720 3.4166  6715 0.1592 99.00  0.2016 . . 117 . . 
'X-RAY DIFFRACTION' . 3.4166 3.7598  6748 0.1463 99.00  0.1859 . . 145 . . 
'X-RAY DIFFRACTION' . 3.7598 4.3023  6758 0.1337 99.00  0.1594 . . 135 . . 
'X-RAY DIFFRACTION' . 4.3023 5.4147  6855 0.1306 100.00 0.1637 . . 134 . . 
'X-RAY DIFFRACTION' . 5.4147 28.9907 6945 0.1864 97.00  0.2137 . . 138 . . 
# 
_struct.entry_id                  2WHP 
_struct.title                     'Crystal structure of acetylcholinesterase, phosphonylated by sarin and in complex with HI-6' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WHP 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE ESTERASE, ALTERNATIVE SPLICING, NEUROTRANSMITTER DEGRADATION, HI-6, SARIN, SYNAPSE, MEMBRANE, SECRETED, HYDROLASE, CELL MEMBRANE, DISULFIDE BOND, CHOLINESTERASE, GPI-ANCHOR, LIPOPROTEIN, GLYCOPROTEIN, CELL JUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 3 ? 
H N N 4 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  ALA A 204 ? LEU A 214 ? ALA A 204 LEU A 214 1 ? 11 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 276 ? ASN A 265 ARG A 276 1 ? 12 
HELX_P HELX_P13 13 PRO A 277 ? TRP A 286 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 14 HIS A 287 ? LEU A 289 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 343 ? GLY A 335 VAL A 343 1 ? 9  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 ALA B 204 ? SER B 215 ? ALA B 204 SER B 215 1 ? 12 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P39 39 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P40 40 PRO B 277 ? TRP B 286 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P41 41 HIS B 287 ? LEU B 289 ? HIS B 287 LEU B 289 5 ? 3  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P50 50 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P51 51 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P52 52 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P53 53 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P54 54 ARG B 534 ? ALA B 542 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.111 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
covale1 covale one  ? A GLU 202 C   ? ? ? 1_555 A SGB 203 N  ? ? A GLU 202 A SGB 203 1_555 ? ? ? ? ? ? ? 1.327 ? ?               
covale2 covale both ? A SGB 203 C   ? ? ? 1_555 A ALA 204 N  ? ? A SGB 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.324 ? ?               
covale3 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 601 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale4 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale5 covale one  ? B GLU 202 C   ? ? ? 1_555 B SGB 203 N  ? ? B GLU 202 B SGB 203 1_555 ? ? ? ? ? ? ? 1.332 ? ?               
covale6 covale both ? B SGB 203 C   ? ? ? 1_555 B ALA 204 N  ? ? B SGB 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.334 ? ?               
covale7 covale one  ? B ASN 350 ND2 ? ? ? 1_555 G NAG .   C1 ? ? B ASN 350 B NAG 601 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -0.91 
2 SER 541 A . ? SER 541 A ALA 542 A ? ALA 542 A 1 12.34 
3 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 3.14  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
BD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
BD 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLY A 201 ? GLY A 192 GLY A 201 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLY B 201 ? GLY B 192 GLY B 201 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
BD 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
BD 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
BD 1  2  O VAL B 239 ? O VAL B 239 N VAL B 303 ? N VAL B 303 
# 
_database_PDB_matrix.entry_id          2WHP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WHP 
_atom_sites.fract_transf_matrix[1][1]   0.012617 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008917 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004406 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 30.662  15.690  54.202  1.00 95.52  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 29.894  14.620  54.844  1.00 88.74  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.731  14.857  56.339  1.00 82.95  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.710  14.905  57.093  1.00 78.53  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.502  13.229  54.592  1.00 78.75  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 29.803  12.138  55.379  1.00 68.40  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.747  10.811  54.659  1.00 66.90  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.696  10.115  54.772  1.00 59.54  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.757  10.472  53.993  1.00 66.94  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.470  14.986  56.740  1.00 75.83  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.081  15.300  58.098  1.00 64.33  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.808  16.088  57.923  1.00 65.48  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.713  15.620  58.241  1.00 59.07  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.977  17.274  57.341  1.00 74.70  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.905  18.242  57.114  1.00 73.35  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.437  18.265  55.668  1.00 67.45  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.619  19.079  55.303  1.00 70.57  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.388  19.639  57.504  1.00 77.85  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 25.880  20.129  58.860  1.00 84.86  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 26.630  19.516  60.036  1.00 84.73  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.834  19.458  61.274  1.00 83.24  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.506  19.312  61.336  1.00 74.85  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.778  19.207  60.225  1.00 75.81  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 23.903  19.259  62.518  1.00 60.52  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 25.964  17.356  54.862  1.00 65.47  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.767  17.339  53.424  1.00 58.82  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.528  16.539  53.119  1.00 53.83  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.036  15.817  53.969  1.00 56.81  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.950  16.623  52.791  1.00 68.90  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 27.554  17.318  51.614  1.00 82.34  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.059  17.220  51.639  1.00 89.65  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 29.572  16.089  51.793  1.00 90.10  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.725  18.276  51.526  1.00 91.95  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 24.039  16.643  51.892  1.00 48.76  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.848  15.916  51.471  1.00 42.74  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.234  14.463  51.265  1.00 45.06  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 23.978  14.155  50.366  1.00 43.71  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.302  16.527  50.177  1.00 37.14  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.138  15.754  49.602  1.00 42.63  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.894  14.634  50.065  1.00 46.80  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.449  16.266  48.685  1.00 44.57  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.715  13.559  52.101  1.00 55.68  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.115  12.146  52.058  1.00 55.21  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.770  11.483  50.722  1.00 50.17  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.315  10.432  50.365  1.00 44.82  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.272  11.533  53.187  1.00 58.90  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.044  12.451  53.223  1.00 55.42  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.685  13.790  53.132  1.00 55.08  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.863  12.088  49.969  1.00 49.36  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.485  11.486  48.699  1.00 46.63  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.470  11.735  47.574  1.00 46.03  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.291  11.174  46.511  1.00 49.18  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.094  11.931  48.252  1.00 63.25  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 18.994  10.872  48.450  1.00 77.38  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 18.121  11.127  49.678  1.00 81.73  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 17.826  10.201  50.446  1.00 81.71  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 17.689  12.384  49.855  1.00 74.51  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.501  12.557  47.801  1.00 40.82  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.435  12.960  46.728  1.00 41.47  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.871  12.414  46.891  1.00 41.05  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.797  12.849  46.199  1.00 42.56  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.482  14.498  46.608  1.00 40.25  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.146  15.181  46.229  1.00 39.85  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.208  16.692  46.371  1.00 34.81  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.700  14.767  44.814  1.00 31.31  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.067  11.488  47.818  1.00 36.56  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.410  10.962  48.055  1.00 34.53  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.409  9.544   47.544  1.00 37.62  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.573  8.756   47.952  1.00 37.25  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.767  10.997  49.545  1.00 35.77  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.602  12.386  50.220  1.00 50.81  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.646  12.340  51.795  1.00 43.43  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.613  13.408  49.678  1.00 37.07  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.339  9.235   46.642  1.00 36.68  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.434  7.933   45.999  1.00 35.03  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.926  7.532   45.839  1.00 41.60  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.812  8.391   45.683  1.00 41.98  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.725  7.967   44.611  1.00 40.65  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 27.894  6.662   43.873  1.00 43.77  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.231  8.270   44.779  1.00 41.21  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.195  6.232   45.879  1.00 33.77  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.537  5.713   45.728  1.00 33.09  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.639  4.913   44.435  1.00 39.00  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.778  4.091   44.163  1.00 40.01  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.920  4.811   46.913  1.00 31.54  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.289  4.114   46.684  1.00 34.18  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.797  3.357   47.876  1.00 35.53  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.130  4.207   49.015  1.00 34.82  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.344  4.678   49.260  1.00 42.15  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.547  5.430   50.334  1.00 44.62  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.345  4.435   48.408  1.00 38.51  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.689  5.160   43.650  1.00 34.77  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 32.982  4.370   42.474  1.00 26.94  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.374  3.752   42.623  1.00 35.10  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.061  3.994   43.639  1.00 34.45  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.836  5.181   41.169  1.00 29.49  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.390  5.578   40.986  1.00 30.63  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.734  6.442   41.200  1.00 30.98  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.760  2.921   41.651  1.00 32.35  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.015  2.161   41.742  1.00 39.97  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.193  3.083   42.130  1.00 37.03  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.024  2.723   42.941  1.00 39.61  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.290  1.394   40.436  1.00 33.26  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.617  0.679   40.420  1.00 40.82  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.626  -0.636  41.228  1.00 45.53  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.780  -0.589  42.108  1.00 51.15  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 39.987  -1.007  41.785  1.00 49.90  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.199  -1.551  40.611  1.00 70.54  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.972  -0.882  42.634  1.00 47.85  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.222  4.290   41.594  1.00 35.16  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.304  5.198   41.908  1.00 40.47  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.164  6.025   43.177  1.00 42.92  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.087  6.747   43.566  1.00 41.00  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.008  5.957   43.825  1.00 43.46  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.830  6.712   45.044  1.00 41.71  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.475  7.340   45.256  1.00 40.42  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.493  6.974   44.625  1.00 38.97  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.443  8.298   46.168  1.00 41.85  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.202  8.922   46.591  1.00 41.84  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.879  10.125  45.755  1.00 40.63  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.772  10.899  45.405  1.00 44.27  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.273  9.328   48.055  1.00 38.44  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.923  8.209   48.979  1.00 44.88  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 34.049  8.604   50.423  1.00 50.68  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 35.130  8.998   50.876  1.00 56.18  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.953  8.494   51.162  1.00 44.32  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.591  10.289  45.469  1.00 36.08  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.108  11.391  44.657  1.00 37.24  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.037  12.159  45.417  1.00 38.27  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.269  11.576  46.179  1.00 38.15  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.471  10.851  43.371  1.00 33.74  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.360  10.179  42.340  1.00 37.34  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.509  9.622   41.244  1.00 36.46  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.375  11.174  41.775  1.00 41.42  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 30.960  13.464  45.178  1.00 35.13  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.849  14.241  45.662  1.00 32.16  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.167  14.951  44.474  1.00 36.61  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.796  15.751  43.761  1.00 36.69  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.293  15.273  46.696  1.00 36.22  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.146  16.260  47.081  1.00 37.03  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.527  17.162  48.254  1.00 47.78  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.779  17.818  47.927  1.00 56.34  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 31.934  17.649  48.577  1.00 59.73  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.016  16.887  49.676  1.00 52.07  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.016  18.284  48.124  1.00 61.38  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 27.879  14.675  44.285  1.00 27.77  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.147  15.225  43.166  1.00 28.81  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.332  16.448  43.583  1.00 39.84  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.520  17.017  44.671  1.00 38.29  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.425  16.858  42.701  1.00 35.75  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.624  18.033  42.945  1.00 33.62  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.152  17.758  42.629  1.00 36.79  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.818  16.993  41.709  1.00 36.86  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.156  19.239  42.128  1.00 38.85  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.381  20.508  42.492  1.00 37.41  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.057  18.967  40.634  1.00 32.54  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 24.764  21.714  41.662  1.00 36.86  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.272  18.365  43.409  1.00 35.61  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.850  18.266  43.153  1.00 35.18  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.442  19.360  42.157  1.00 38.84  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.630  20.548  42.429  1.00 41.48  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.115  18.471  44.472  1.00 37.84  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.672  17.982  44.541  1.00 39.97  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.978  18.487  45.822  1.00 41.54  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.968  19.479  45.471  1.00 58.53  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.683  19.438  45.837  1.00 65.62  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.227  18.476  46.639  1.00 67.62  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.849  20.385  45.416  1.00 65.41  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 19.879  18.978  41.016  1.00 35.39  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.476  19.951  40.008  1.00 32.38  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 17.977  20.018  39.925  1.00 41.50  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.294  19.048  40.234  1.00 45.70  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.002  19.570  38.626  1.00 37.27  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.525  19.475  38.470  1.00 37.91  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 21.849  19.038  37.061  1.00 35.92  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.191  20.796  38.826  1.00 31.86  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.465  21.151  39.459  1.00 39.07  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.047  21.309  39.283  1.00 45.15  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.688  20.976  37.849  1.00 41.91  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.200  21.587  36.929  1.00 43.98  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.641  22.753  39.597  1.00 55.24  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 14.184  22.897  39.986  1.00 74.60  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 13.654  24.332  39.803  1.00 85.24  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 12.126  24.364  39.934  1.00 86.52  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 11.477  23.191  39.255  1.00 82.65  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.816  19.997  37.648  1.00 38.29  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.182  19.846  36.345  1.00 37.08  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.759  20.358  36.527  1.00 41.11  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.312  20.537  37.652  1.00 43.10  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.199  18.394  35.884  1.00 33.99  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.035  20.593  35.430  1.00 45.58  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.729  21.269  35.584  1.00 41.66  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.743   20.512  36.465  1.00 44.28  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.002   21.140  37.214  1.00 51.53  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.208  21.349  34.151  1.00 38.96  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.466  21.274  33.274  1.00 42.32  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.341  20.281  34.024  1.00 42.84  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.740   19.187  36.389  1.00 45.29  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.836   18.370  37.184  1.00 42.32  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.412   17.874  38.508  1.00 46.84  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.758   17.114  39.215  1.00 40.87  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.630  18.299  38.859  1.00 49.83  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.233  17.868  40.114  1.00 45.93  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.744  17.802  40.088  1.00 51.69  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.376  18.134  39.081  1.00 50.47  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.353  17.349  41.198  1.00 48.03  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.822  17.352  41.244  1.00 35.16  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.436  16.126  40.572  1.00 40.34  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.764  15.093  40.454  1.00 37.46  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.130  17.315  42.733  1.00 34.31  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.767  16.883  43.432  1.00 42.30  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.742  16.710  42.373  1.00 43.26  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.697  16.245  40.141  1.00 33.36  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.454  15.111  39.657  1.00 35.76  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.848  15.145  40.284  1.00 37.91  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.292  16.178  40.771  1.00 39.70  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.562  15.068  38.086  1.00 40.51  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.193  14.959  37.436  1.00 41.31  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.273  16.256  37.563  1.00 34.14  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.530  14.014  40.277  1.00 36.08  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 20.897  13.947  40.789  1.00 38.10  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.862  14.107  39.616  1.00 37.29  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.704  13.456  38.590  1.00 32.60  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.152  12.583  41.445  1.00 41.60  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.206  12.281  42.466  1.00 47.90  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.865  14.966  39.749  1.00 39.69  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.884  15.034  38.718  1.00 36.17  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.284  14.811  39.296  1.00 41.39  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.624  15.339  40.365  1.00 43.28  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.808  16.356  37.974  1.00 30.69  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.088  14.041  38.571  1.00 36.45  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.490  13.825  38.913  1.00 29.04  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.279  14.167  37.673  1.00 33.53  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.334  13.382  36.709  1.00 35.42  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.730  12.370  39.345  1.00 31.39  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 26.969  11.975  40.594  1.00 33.40  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.677  11.463  40.509  1.00 26.31  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.546  12.129  41.851  1.00 33.34  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 24.981  11.123  41.658  1.00 32.54  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.859  11.789  42.998  1.00 36.06  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.565  11.291  42.908  1.00 32.78  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.859  15.360  37.692  1.00 27.76  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.484  15.961  36.519  1.00 31.56  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.008  16.045  36.701  1.00 29.51  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.477  16.352  37.799  1.00 26.91  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 28.946  17.387  36.322  1.00 33.74  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.421  17.519  36.425  1.00 34.04  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.003  19.000  36.379  1.00 31.17  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.731  16.682  35.321  1.00 27.16  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.763  15.774  35.638  1.00 26.49  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.206  15.940  35.690  1.00 32.60  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 33.920  14.771  36.365  1.00 29.69  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 34.919  14.948  37.029  1.00 32.49  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.401  13.564  36.202  1.00 33.08  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.048  12.416  36.813  1.00 30.40  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.160  11.931  35.909  1.00 31.73  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 34.917  11.588  34.763  1.00 35.24  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.091  11.238  36.949  1.00 29.33  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.899  11.610  37.822  1.00 25.40  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.864  10.044  37.532  1.00 22.82  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.762  10.566  37.773  1.00 28.17  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.384  11.885  36.419  1.00 35.25  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.478  11.441  35.542  1.00 30.36  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.366  9.945   35.313  1.00 34.83  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.067  9.212   36.266  1.00 34.01  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.730  11.742  36.374  1.00 28.84  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.240  11.718  37.826  1.00 32.25  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.820  12.186  37.795  1.00 33.73  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.592  9.491   34.089  1.00 33.23  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.567  8.058   33.816  1.00 29.72  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.899  7.604   33.194  1.00 30.75  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.103  6.425   32.951  1.00 36.42  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.374  7.689   32.929  1.00 25.77  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.426  8.277   31.539  1.00 28.88  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.076  7.611   30.516  1.00 25.53  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.824  9.508   31.259  1.00 30.59  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.137  8.158   29.249  1.00 30.39  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 35.851  10.037  29.980  1.00 26.76  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.517  9.362   28.972  1.00 28.92  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.796  8.559   32.949  1.00 29.50  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.138  8.294   32.417  1.00 27.60  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.203  9.181   33.051  1.00 31.95  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.900  10.286  33.534  1.00 31.40  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.160  8.494   30.910  1.00 27.89  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.454  8.707   33.039  1.00 30.70  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.579  9.586   33.311  1.00 31.66  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.610  10.674  32.226  1.00 30.51  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.450  10.390  31.050  1.00 32.81  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.901  8.792   33.324  1.00 36.32  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.074  7.893   34.533  1.00 39.91  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.133  8.685   35.820  1.00 45.73  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.007  9.552   35.943  1.00 51.61  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.315  8.454   36.721  1.00 48.45  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.813  11.929  32.623  1.00 36.85  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.910  13.017  31.635  1.00 35.88  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.825  12.648  30.468  1.00 35.25  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 46.988  12.291  30.670  1.00 37.07  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.541  14.161  32.441  1.00 33.90  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.128  13.892  33.862  1.00 36.90  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.195  12.368  33.977  1.00 35.40  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.307  12.692  29.241  1.00 33.94  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.203  12.235  28.168  1.00 33.84  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.105  13.371  27.667  1.00 36.85  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 46.977  13.748  26.496  1.00 30.59  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.235  11.800  27.072  1.00 36.68  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.040  12.710  27.264  1.00 36.98  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 43.953  13.012  28.757  1.00 35.32  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 47.971  13.893  28.544  1.00 33.66  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.802  15.051  28.240  1.00 40.81  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.307  14.676  28.164  1.00 41.63  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.695  13.579  28.561  1.00 34.57  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.604  16.172  29.299  1.00 49.92  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.103  16.446  29.533  1.00 44.99  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.324  15.826  30.630  1.00 33.90  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.143  15.578  27.647  1.00 37.76  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.579  15.339  27.649  1.00 36.42  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.921  14.122  26.822  1.00 38.15  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.535  14.022  25.660  1.00 45.76  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.631  13.175  27.413  1.00 39.79  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.029  11.973  26.683  1.00 41.73  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.820  11.104  26.306  1.00 38.64  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 52.959  10.168  25.526  1.00 34.62  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.009  11.145  27.499  1.00 41.20  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.396  10.744  28.711  1.00 50.62  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.638  11.414  26.845  1.00 36.03  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.462  10.574  26.568  1.00 35.01  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.619  11.073  25.394  1.00 36.89  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.678  10.395  24.953  1.00 39.81  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.596  10.425  27.806  1.00 37.63  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.238  9.757   28.994  1.00 35.29  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.188  9.770   30.114  1.00 51.44  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.708  9.513   31.452  1.00 67.69  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.722  8.314   32.028  1.00 76.75  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 49.248  7.252   31.378  1.00 76.06  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 50.214  8.180   33.254  1.00 80.29  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 49.953  12.247  24.870  1.00 37.38  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.261  12.716  23.675  1.00 35.43  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.354  11.677  22.560  1.00 32.96  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.433  11.122  22.331  1.00 30.01  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 49.843  14.027  23.174  1.00 38.20  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.013  14.680  22.049  1.00 32.05  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 49.799  15.904  21.496  1.00 27.86  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.662  17.073  22.347  1.00 32.11  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.264  18.238  22.113  1.00 31.65  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.090  18.369  21.083  1.00 31.43  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.069  19.254  22.922  1.00 31.65  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.238  11.457  21.854  1.00 25.80  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.132  10.483  20.766  1.00 27.09  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.082  9.055   21.244  1.00 27.91  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.962  8.147   20.418  1.00 37.29  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.280  10.586  19.743  1.00 30.60  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.519  11.961  19.258  1.00 33.57  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.481  12.702  18.720  1.00 29.80  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 50.783  12.538  19.369  1.00 27.81  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.702  13.995  18.249  1.00 30.35  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 50.992  13.815  18.942  1.00 30.67  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 49.932  14.559  18.375  1.00 26.33  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.185  8.829   22.551  1.00 29.97  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.178  7.429   23.057  1.00 32.12  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 46.814  6.974   23.540  1.00 33.27  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 45.970  7.823   23.874  1.00 28.82  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.180  7.268   24.182  1.00 29.68  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.576  7.698   23.734  1.00 41.11  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.846  6.822   24.673  1.00 52.75  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.719  5.301   23.743  1.00 47.78  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.585  5.647   23.516  1.00 32.47  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.368  5.045   24.072  1.00 31.63  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.257  5.558   25.485  1.00 36.23  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.292  5.810   26.124  1.00 31.14  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.661  3.525   24.078  1.00 31.48  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.744  3.340   22.995  1.00 32.60  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.530  4.644   22.961  1.00 31.58  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.022  5.758   25.957  1.00 28.05  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.823  6.288   27.307  1.00 31.50  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.175  5.218   28.332  1.00 33.12  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.044  4.035   28.067  1.00 37.09  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.310  6.560   27.361  1.00 28.33  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.729  5.486   26.389  1.00 26.62  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.748  5.511   25.251  1.00 30.01  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.599  5.658   29.498  1.00 33.66  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 44.915  4.784   30.611  1.00 43.08  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.831  5.023   31.653  1.00 40.63  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.445  6.166   31.908  1.00 37.98  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.297  5.137   31.164  1.00 54.64  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 46.615  4.527   32.528  1.00 79.70  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.077  4.721   32.961  1.00 92.61  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 48.962  4.792   32.071  1.00 101.52 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 48.334  4.784   34.190  1.00 86.79  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.304  3.943   32.234  1.00 40.68  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.300  4.041   33.303  1.00 35.13  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.771  4.974   34.413  1.00 35.79  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.945  4.968   34.785  1.00 38.30  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.223  2.606   33.831  1.00 37.18  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.619  1.752   32.620  1.00 42.99  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.720  2.551   31.974  1.00 40.12  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.856  5.783   34.918  1.00 31.48  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.162  6.755   35.947  1.00 32.14  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.523  6.047   37.237  1.00 39.91  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.886  5.077   37.618  1.00 44.35  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.920  7.622   36.185  1.00 31.97  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.981  8.541   37.394  1.00 33.01  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.022  9.648   37.214  1.00 36.09  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 42.014  10.630  38.382  1.00 37.09  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.861  11.783  38.057  1.00 40.56  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.519  6.561   37.932  1.00 39.81  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 43.994  5.928   39.131  1.00 43.54  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.198  6.511   40.281  1.00 43.19  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.864  7.692   40.230  1.00 36.31  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.482  6.199   39.286  1.00 46.97  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.297  5.629   38.145  1.00 55.61  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.760  5.589   38.504  1.00 67.64  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.334  6.924   38.597  1.00 76.86  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.077  7.476   37.646  1.00 86.04  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.340  6.807   36.528  1.00 81.51  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.560  8.697   37.815  1.00 89.10  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.869  5.680   41.302  1.00 37.04  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.040  6.120   42.445  1.00 35.20  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.578  7.400   43.070  1.00 41.20  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.798  7.645   43.081  1.00 35.27  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.157  4.971   43.460  1.00 36.20  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.497  3.757   42.642  1.00 40.57  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.274  4.267   41.400  1.00 34.13  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.657  8.209   43.571  1.00 34.53  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.984  9.455   44.226  1.00 39.03  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.645  9.301   45.696  1.00 45.78  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 41.028  8.306   46.109  1.00 45.58  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.179  10.600  43.609  1.00 39.53  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.702  10.330  43.564  1.00 41.41  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.789  10.604  44.546  1.00 40.54  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 38.959  9.748   42.474  1.00 39.84  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.527  10.222  44.136  1.00 42.41  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.606  9.692   42.870  1.00 41.57  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.310  9.248   41.218  1.00 39.08  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.608  9.154   42.053  1.00 37.22  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.313  8.704   40.400  1.00 40.29  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.981  8.672   40.816  1.00 36.56  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.060  10.264  46.505  1.00 47.56  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.680  10.209  47.908  1.00 52.73  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.741  11.360  48.182  1.00 45.15  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.722  12.340  47.446  1.00 47.92  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.902  10.268  48.826  1.00 57.46  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.563  11.504  48.677  1.00 63.72  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.950  11.230  49.231  1.00 44.42  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 39.019  12.272  49.591  1.00 41.96  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.783  12.171  48.720  1.00 45.16  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.608  11.221  47.942  1.00 43.50  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.912  13.155  48.863  1.00 42.01  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.696  13.170  48.105  1.00 41.65  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.936  14.076  46.905  1.00 39.77  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.236  15.256  47.067  1.00 47.48  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.523  13.708  48.977  1.00 43.93  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.227  13.739  48.189  1.00 35.32  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.382  12.895  50.273  1.00 35.62  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.826  13.520  45.705  1.00 36.58  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.971  14.299  44.481  1.00 34.56  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.706  15.133  44.256  1.00 39.95  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.596  14.601  44.304  1.00 42.07  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.239  13.364  43.296  1.00 35.58  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.489  13.973  41.908  1.00 40.62  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.619  13.245  41.203  1.00 36.35  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.207  13.917  41.060  1.00 42.55  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.855  16.441  44.056  1.00 36.15  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.688  17.265  43.802  1.00 36.69  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.202  17.070  42.367  1.00 37.01  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 33.908  17.419  41.420  1.00 35.36  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 33.970  18.744  44.063  1.00 43.88  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.770  19.617  43.755  1.00 55.56  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.512  19.874  42.561  1.00 55.70  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.059  20.018  44.703  1.00 62.18  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.002  16.508  42.219  1.00 31.86  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.425  16.261  40.904  1.00 32.45  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.185  17.116  40.668  1.00 37.65  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.143  16.600  40.280  1.00 38.44  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.087  14.795  40.754  1.00 33.25  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.297  18.418  40.906  1.00 33.17  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.141  19.319  40.827  1.00 33.33  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.166  20.234  39.604  1.00 35.21  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.202  20.941  39.339  1.00 38.06  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.028  20.209  42.090  1.00 31.87  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.149  21.085  42.153  1.00 34.58  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 28.993  19.375  43.377  1.00 35.86  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.269  20.219  38.857  1.00 36.17  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.395  21.008  37.639  1.00 31.34  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.036  20.266  36.455  1.00 35.93  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.840  19.343  36.616  1.00 36.09  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.212  22.287  37.891  1.00 37.47  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.569  21.934  38.183  1.00 39.00  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.631  23.083  39.069  1.00 35.76  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.666  20.668  35.249  1.00 29.94  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.288  20.113  34.073  1.00 31.25  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.790  20.367  34.051  1.00 35.87  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.245  21.395  34.505  1.00 31.71  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.655  20.693  32.832  1.00 25.80  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.247  20.219  32.603  1.00 28.66  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 28.996  18.885  32.395  1.00 26.49  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.169  21.123  32.600  1.00 30.46  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.688  18.432  32.168  1.00 31.32  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.871  20.682  32.377  1.00 27.23  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.634  19.338  32.156  1.00 28.22  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.537  19.411  33.516  1.00 29.27  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 34.973  19.521  33.390  1.00 27.60  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.391  20.131  32.050  1.00 29.14  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.539  20.490  31.217  1.00 30.53  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.590  18.130  33.565  1.00 27.19  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.070  17.940  34.970  1.00 32.18  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.337  18.751  35.241  1.00 40.24  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.774  19.570  34.397  1.00 40.02  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.953  18.507  36.400  1.00 38.50  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.703  20.259  31.847  1.00 35.29  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.248  20.836  30.617  1.00 31.55  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.728  20.133  29.356  1.00 30.26  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.436  18.937  29.367  1.00 28.33  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.763  20.751  30.635  1.00 38.65  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.390  21.549  31.779  1.00 35.21  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 38.901  22.598  32.171  1.00 35.23  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.487  21.056  32.288  1.00 36.80  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.629  20.908  28.281  1.00 23.02  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.306  20.392  26.962  1.00 22.82  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.605  20.028  26.250  1.00 33.09  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.587  20.763  26.333  1.00 29.55  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.561  21.454  26.130  1.00 34.95  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.362  20.979  24.700  1.00 28.50  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.228  21.797  26.776  1.00 26.78  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.613  18.894  25.555  1.00 21.76  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.796  18.477  24.805  1.00 28.07  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.200  19.541  23.783  1.00 37.54  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.349  20.108  23.099  1.00 25.43  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.557  17.129  24.121  1.00 21.84  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.338  15.756  25.270  1.00 35.57  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.502  19.808  23.692  1.00 29.58  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.009  20.893  22.852  1.00 33.88  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.506  20.756  21.425  1.00 34.90  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.563  19.674  20.840  1.00 29.69  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.537  20.921  22.864  1.00 33.97  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.119  22.315  22.946  1.00 39.64  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.612  22.806  24.146  1.00 42.26  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.169  23.141  21.829  1.00 40.19  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.145  24.075  24.235  1.00 43.63  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.701  24.416  21.908  1.00 45.60  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.187  24.878  23.114  1.00 53.68  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.717  26.146  23.194  1.00 76.40  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.011  21.851  20.861  1.00 27.84  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.392  21.759  19.553  1.00 28.86  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.305  23.096  18.880  1.00 29.93  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.305  24.132  19.526  1.00 33.94  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 37.958  21.180  19.655  1.00 26.59  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.006  22.034  20.480  1.00 22.11  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 35.732  21.300  20.878  1.00 30.49  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.661  21.570  20.335  1.00 28.69  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 35.851  20.332  21.803  1.00 31.85  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.162  23.037  17.564  1.00 36.62  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 38.794  24.177  16.737  1.00 39.00  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.420  24.758  17.147  1.00 43.86  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.465  24.024  17.438  1.00 35.11  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.788  23.712  15.281  1.00 35.97  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.408  24.772  14.299  1.00 42.49  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.082  24.915  13.866  1.00 38.65  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.373  25.650  13.801  1.00 44.82  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.735  25.903  12.971  1.00 45.50  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.042  26.633  12.898  1.00 49.04  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.725  26.761  12.477  1.00 58.12  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.415  27.767  11.568  1.00 65.49  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.345  26.079  17.206  1.00 37.81  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.121  26.761  17.582  1.00 38.22  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 35.523  27.470  16.360  1.00 41.72  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.165  28.286  15.766  1.00 41.30  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.377  27.756  18.705  1.00 36.75  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.135  28.635  18.936  1.00 40.99  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 36.724  26.990  19.959  1.00 32.65  ? 73   VAL A CG2 1 
ATOM   570  N N   A ASP A 1 74  ? 34.281  27.133  16.026  0.20 46.85  ? 74   ASP A N   1 
ATOM   571  N N   B ASP A 1 74  ? 34.301  27.113  15.969  0.80 47.67  ? 74   ASP A N   1 
ATOM   572  C CA  A ASP A 1 74  ? 33.605  27.699  14.864  0.20 48.42  ? 74   ASP A CA  1 
ATOM   573  C CA  B ASP A 1 74  ? 33.724  27.632  14.725  0.80 48.96  ? 74   ASP A CA  1 
ATOM   574  C C   A ASP A 1 74  ? 33.479  29.209  14.973  0.20 51.08  ? 74   ASP A C   1 
ATOM   575  C C   B ASP A 1 74  ? 33.404  29.130  14.891  0.80 50.81  ? 74   ASP A C   1 
ATOM   576  O O   A ASP A 1 74  ? 33.117  29.734  16.025  0.20 51.08  ? 74   ASP A O   1 
ATOM   577  O O   B ASP A 1 74  ? 32.888  29.562  15.918  0.80 51.18  ? 74   ASP A O   1 
ATOM   578  C CB  A ASP A 1 74  ? 32.211  27.091  14.723  0.20 44.83  ? 74   ASP A CB  1 
ATOM   579  C CB  B ASP A 1 74  ? 32.495  26.798  14.252  0.80 47.18  ? 74   ASP A CB  1 
ATOM   580  C CG  A ASP A 1 74  ? 31.484  27.583  13.492  0.20 42.63  ? 74   ASP A CG  1 
ATOM   581  C CG  B ASP A 1 74  ? 32.893  25.403  13.611  0.80 70.14  ? 74   ASP A CG  1 
ATOM   582  O OD1 A ASP A 1 74  ? 32.130  28.181  12.607  0.20 38.57  ? 74   ASP A OD1 1 
ATOM   583  O OD1 B ASP A 1 74  ? 33.532  25.373  12.525  0.80 66.75  ? 74   ASP A OD1 1 
ATOM   584  O OD2 A ASP A 1 74  ? 30.263  27.363  13.412  0.20 41.55  ? 74   ASP A OD2 1 
ATOM   585  O OD2 B ASP A 1 74  ? 32.538  24.331  14.177  0.80 61.22  ? 74   ASP A OD2 1 
ATOM   586  N N   . THR A 1 75  ? 33.764  29.916  13.885  1.00 54.38  ? 75   THR A N   1 
ATOM   587  C CA  . THR A 1 75  ? 33.617  31.373  13.922  1.00 69.15  ? 75   THR A CA  1 
ATOM   588  C C   . THR A 1 75  ? 32.927  31.975  12.696  1.00 70.70  ? 75   THR A C   1 
ATOM   589  O O   . THR A 1 75  ? 33.041  33.177  12.458  1.00 69.85  ? 75   THR A O   1 
ATOM   590  C CB  . THR A 1 75  ? 34.982  32.098  14.121  1.00 81.78  ? 75   THR A CB  1 
ATOM   591  O OG1 . THR A 1 75  ? 35.994  31.451  13.333  1.00 80.09  ? 75   THR A OG1 1 
ATOM   592  C CG2 . THR A 1 75  ? 35.382  32.099  15.593  1.00 77.66  ? 75   THR A CG2 1 
ATOM   593  N N   . LEU A 1 76  ? 32.198  31.154  11.944  1.00 73.26  ? 76   LEU A N   1 
ATOM   594  C CA  . LEU A 1 76  ? 31.528  31.625  10.737  1.00 74.01  ? 76   LEU A CA  1 
ATOM   595  C C   . LEU A 1 76  ? 30.527  32.761  11.007  1.00 75.70  ? 76   LEU A C   1 
ATOM   596  O O   . LEU A 1 76  ? 30.509  33.767  10.290  1.00 79.83  ? 76   LEU A O   1 
ATOM   597  C CB  . LEU A 1 76  ? 30.836  30.467  10.022  1.00 80.10  ? 76   LEU A CB  1 
ATOM   598  C CG  . LEU A 1 76  ? 30.222  30.837  8.666   1.00 85.76  ? 76   LEU A CG  1 
ATOM   599  C CD1 . LEU A 1 76  ? 31.325  31.189  7.677   1.00 87.24  ? 76   LEU A CD1 1 
ATOM   600  C CD2 . LEU A 1 76  ? 29.348  29.709  8.130   1.00 86.78  ? 76   LEU A CD2 1 
ATOM   601  N N   . TYR A 1 77  ? 29.701  32.608  12.038  1.00 71.53  ? 77   TYR A N   1 
ATOM   602  C CA  . TYR A 1 77  ? 28.680  33.614  12.356  1.00 66.76  ? 77   TYR A CA  1 
ATOM   603  C C   . TYR A 1 77  ? 28.678  34.016  13.832  1.00 66.36  ? 77   TYR A C   1 
ATOM   604  O O   . TYR A 1 77  ? 27.786  33.630  14.583  1.00 66.20  ? 77   TYR A O   1 
ATOM   605  C CB  . TYR A 1 77  ? 27.291  33.095  11.986  1.00 56.73  ? 77   TYR A CB  1 
ATOM   606  C CG  . TYR A 1 77  ? 27.070  32.860  10.514  1.00 60.53  ? 77   TYR A CG  1 
ATOM   607  C CD1 . TYR A 1 77  ? 27.108  33.909  9.610   1.00 56.32  ? 77   TYR A CD1 1 
ATOM   608  C CD2 . TYR A 1 77  ? 26.780  31.586  10.027  1.00 66.32  ? 77   TYR A CD2 1 
ATOM   609  C CE1 . TYR A 1 77  ? 26.888  33.704  8.266   1.00 57.26  ? 77   TYR A CE1 1 
ATOM   610  C CE2 . TYR A 1 77  ? 26.549  31.366  8.672   1.00 65.39  ? 77   TYR A CE2 1 
ATOM   611  C CZ  . TYR A 1 77  ? 26.608  32.432  7.795   1.00 65.15  ? 77   TYR A CZ  1 
ATOM   612  O OH  . TYR A 1 77  ? 26.377  32.233  6.442   1.00 66.20  ? 77   TYR A OH  1 
ATOM   613  N N   . PRO A 1 78  ? 29.670  34.810  14.241  1.00 76.18  ? 78   PRO A N   1 
ATOM   614  C CA  . PRO A 1 78  ? 29.949  35.275  15.615  1.00 77.86  ? 78   PRO A CA  1 
ATOM   615  C C   . PRO A 1 78  ? 28.737  35.739  16.436  1.00 75.92  ? 78   PRO A C   1 
ATOM   616  O O   . PRO A 1 78  ? 28.078  36.700  16.044  1.00 80.18  ? 78   PRO A O   1 
ATOM   617  C CB  . PRO A 1 78  ? 30.880  36.472  15.386  1.00 79.65  ? 78   PRO A CB  1 
ATOM   618  C CG  . PRO A 1 78  ? 31.607  36.134  14.119  1.00 82.18  ? 78   PRO A CG  1 
ATOM   619  C CD  . PRO A 1 78  ? 30.638  35.344  13.263  1.00 80.12  ? 78   PRO A CD  1 
ATOM   620  N N   . GLY A 1 79  ? 28.471  35.090  17.571  1.00 72.98  ? 79   GLY A N   1 
ATOM   621  C CA  . GLY A 1 79  ? 27.414  35.525  18.486  1.00 68.58  ? 79   GLY A CA  1 
ATOM   622  C C   . GLY A 1 79  ? 26.010  35.085  18.092  1.00 65.58  ? 79   GLY A C   1 
ATOM   623  O O   . GLY A 1 79  ? 25.030  35.359  18.792  1.00 60.95  ? 79   GLY A O   1 
ATOM   624  N N   . PHE A 1 80  ? 25.922  34.409  16.949  1.00 62.76  ? 80   PHE A N   1 
ATOM   625  C CA  . PHE A 1 80  ? 24.668  33.882  16.417  1.00 56.35  ? 80   PHE A CA  1 
ATOM   626  C C   . PHE A 1 80  ? 24.390  32.507  17.055  1.00 52.26  ? 80   PHE A C   1 
ATOM   627  O O   . PHE A 1 80  ? 25.244  31.621  17.005  1.00 47.11  ? 80   PHE A O   1 
ATOM   628  C CB  . PHE A 1 80  ? 24.821  33.802  14.897  1.00 50.31  ? 80   PHE A CB  1 
ATOM   629  C CG  . PHE A 1 80  ? 23.832  32.918  14.216  1.00 51.09  ? 80   PHE A CG  1 
ATOM   630  C CD1 . PHE A 1 80  ? 22.494  33.292  14.118  1.00 45.31  ? 80   PHE A CD1 1 
ATOM   631  C CD2 . PHE A 1 80  ? 24.246  31.719  13.634  1.00 48.22  ? 80   PHE A CD2 1 
ATOM   632  C CE1 . PHE A 1 80  ? 21.583  32.488  13.477  1.00 49.79  ? 80   PHE A CE1 1 
ATOM   633  C CE2 . PHE A 1 80  ? 23.337  30.897  12.979  1.00 45.19  ? 80   PHE A CE2 1 
ATOM   634  C CZ  . PHE A 1 80  ? 22.000  31.281  12.901  1.00 50.64  ? 80   PHE A CZ  1 
ATOM   635  N N   . GLU A 1 81  ? 23.219  32.338  17.672  1.00 50.79  ? 81   GLU A N   1 
ATOM   636  C CA  . GLU A 1 81  ? 22.932  31.129  18.464  1.00 57.98  ? 81   GLU A CA  1 
ATOM   637  C C   . GLU A 1 81  ? 23.019  29.846  17.631  1.00 57.09  ? 81   GLU A C   1 
ATOM   638  O O   . GLU A 1 81  ? 23.337  28.766  18.149  1.00 50.90  ? 81   GLU A O   1 
ATOM   639  C CB  . GLU A 1 81  ? 21.552  31.208  19.131  1.00 57.45  ? 81   GLU A CB  1 
ATOM   640  N N   . GLY A 1 82  ? 22.728  29.982  16.341  1.00 53.44  ? 82   GLY A N   1 
ATOM   641  C CA  . GLY A 1 82  ? 22.757  28.856  15.437  1.00 51.48  ? 82   GLY A CA  1 
ATOM   642  C C   . GLY A 1 82  ? 24.104  28.165  15.469  1.00 47.38  ? 82   GLY A C   1 
ATOM   643  O O   . GLY A 1 82  ? 24.165  26.949  15.436  1.00 49.22  ? 82   GLY A O   1 
ATOM   644  N N   . THR A 1 83  ? 25.188  28.931  15.529  1.00 49.76  ? 83   THR A N   1 
ATOM   645  C CA  . THR A 1 83  ? 26.514  28.326  15.634  1.00 51.64  ? 83   THR A CA  1 
ATOM   646  C C   . THR A 1 83  ? 27.027  28.199  17.082  1.00 47.83  ? 83   THR A C   1 
ATOM   647  O O   . THR A 1 83  ? 27.703  27.243  17.416  1.00 48.01  ? 83   THR A O   1 
ATOM   648  C CB  . THR A 1 83  ? 27.536  29.026  14.725  1.00 54.24  ? 83   THR A CB  1 
ATOM   649  O OG1 . THR A 1 83  ? 27.600  30.414  15.063  1.00 61.26  ? 83   THR A OG1 1 
ATOM   650  C CG2 . THR A 1 83  ? 27.129  28.885  13.255  1.00 52.62  ? 83   THR A CG2 1 
ATOM   651  N N   . GLU A 1 84  ? 26.657  29.135  17.943  1.00 46.81  ? 84   GLU A N   1 
ATOM   652  C CA  . GLU A 1 84  ? 27.203  29.178  19.287  1.00 46.94  ? 84   GLU A CA  1 
ATOM   653  C C   . GLU A 1 84  ? 26.794  27.997  20.170  1.00 44.68  ? 84   GLU A C   1 
ATOM   654  O O   . GLU A 1 84  ? 27.585  27.544  21.015  1.00 43.15  ? 84   GLU A O   1 
ATOM   655  C CB  . GLU A 1 84  ? 26.814  30.482  19.970  1.00 51.14  ? 84   GLU A CB  1 
ATOM   656  C CG  . GLU A 1 84  ? 27.347  31.725  19.257  1.00 68.00  ? 84   GLU A CG  1 
ATOM   657  C CD  . GLU A 1 84  ? 28.869  31.843  19.310  1.00 76.41  ? 84   GLU A CD  1 
ATOM   658  O OE1 . GLU A 1 84  ? 29.534  30.892  19.813  1.00 73.33  ? 84   GLU A OE1 1 
ATOM   659  O OE2 . GLU A 1 84  ? 29.397  32.896  18.852  1.00 77.22  ? 84   GLU A OE2 1 
ATOM   660  N N   . MET A 1 85  ? 25.567  27.512  19.991  1.00 36.15  ? 85   MET A N   1 
ATOM   661  C CA  . MET A 1 85  ? 25.088  26.410  20.809  1.00 40.37  ? 85   MET A CA  1 
ATOM   662  C C   . MET A 1 85  ? 26.039  25.192  20.724  1.00 34.83  ? 85   MET A C   1 
ATOM   663  O O   . MET A 1 85  ? 26.125  24.428  21.658  1.00 44.53  ? 85   MET A O   1 
ATOM   664  C CB  . MET A 1 85  ? 23.657  26.018  20.423  1.00 38.59  ? 85   MET A CB  1 
ATOM   665  C CG  . MET A 1 85  ? 23.499  25.551  18.974  1.00 41.90  ? 85   MET A CG  1 
ATOM   666  S SD  . MET A 1 85  ? 21.769  25.131  18.617  1.00 54.25  ? 85   MET A SD  1 
ATOM   667  C CE  . MET A 1 85  ? 21.666  23.553  19.429  1.00 33.95  ? 85   MET A CE  1 
ATOM   668  N N   . TRP A 1 86  ? 26.740  25.034  19.607  1.00 24.74  ? 86   TRP A N   1 
ATOM   669  C CA  . TRP A 1 86  ? 27.642  23.906  19.411  1.00 33.01  ? 86   TRP A CA  1 
ATOM   670  C C   . TRP A 1 86  ? 29.056  24.149  19.948  1.00 34.40  ? 86   TRP A C   1 
ATOM   671  O O   . TRP A 1 86  ? 29.855  23.219  20.051  1.00 30.85  ? 86   TRP A O   1 
ATOM   672  C CB  . TRP A 1 86  ? 27.701  23.508  17.925  1.00 30.32  ? 86   TRP A CB  1 
ATOM   673  C CG  . TRP A 1 86  ? 26.363  23.329  17.333  1.00 29.72  ? 86   TRP A CG  1 
ATOM   674  C CD1 . TRP A 1 86  ? 25.726  24.192  16.485  1.00 33.79  ? 86   TRP A CD1 1 
ATOM   675  C CD2 . TRP A 1 86  ? 25.454  22.236  17.555  1.00 30.22  ? 86   TRP A CD2 1 
ATOM   676  N NE1 . TRP A 1 86  ? 24.488  23.688  16.145  1.00 32.25  ? 86   TRP A NE1 1 
ATOM   677  C CE2 . TRP A 1 86  ? 24.297  22.496  16.795  1.00 29.04  ? 86   TRP A CE2 1 
ATOM   678  C CE3 . TRP A 1 86  ? 25.518  21.053  18.302  1.00 30.61  ? 86   TRP A CE3 1 
ATOM   679  C CZ2 . TRP A 1 86  ? 23.202  21.624  16.778  1.00 35.65  ? 86   TRP A CZ2 1 
ATOM   680  C CZ3 . TRP A 1 86  ? 24.419  20.192  18.279  1.00 29.45  ? 86   TRP A CZ3 1 
ATOM   681  C CH2 . TRP A 1 86  ? 23.288  20.484  17.533  1.00 34.80  ? 86   TRP A CH2 1 
ATOM   682  N N   . ASN A 1 87  ? 29.380  25.393  20.269  1.00 31.16  ? 87   ASN A N   1 
ATOM   683  C CA  . ASN A 1 87  ? 30.745  25.722  20.684  1.00 30.29  ? 87   ASN A CA  1 
ATOM   684  C C   . ASN A 1 87  ? 31.074  25.305  22.116  1.00 33.20  ? 87   ASN A C   1 
ATOM   685  O O   . ASN A 1 87  ? 30.186  25.238  22.956  1.00 33.50  ? 87   ASN A O   1 
ATOM   686  C CB  . ASN A 1 87  ? 30.986  27.240  20.543  1.00 32.77  ? 87   ASN A CB  1 
ATOM   687  C CG  . ASN A 1 87  ? 31.318  27.640  19.115  1.00 42.52  ? 87   ASN A CG  1 
ATOM   688  O OD1 . ASN A 1 87  ? 31.737  26.809  18.292  1.00 50.55  ? 87   ASN A OD1 1 
ATOM   689  N ND2 . ASN A 1 87  ? 31.127  28.905  18.811  1.00 44.60  ? 87   ASN A ND2 1 
ATOM   690  N N   . PRO A 1 88  ? 32.369  25.067  22.418  1.00 36.23  ? 88   PRO A N   1 
ATOM   691  C CA  . PRO A 1 88  ? 32.794  24.748  23.802  1.00 36.82  ? 88   PRO A CA  1 
ATOM   692  C C   . PRO A 1 88  ? 32.235  25.704  24.847  1.00 36.50  ? 88   PRO A C   1 
ATOM   693  O O   . PRO A 1 88  ? 32.284  26.914  24.663  1.00 30.51  ? 88   PRO A O   1 
ATOM   694  C CB  . PRO A 1 88  ? 34.321  24.933  23.760  1.00 35.33  ? 88   PRO A CB  1 
ATOM   695  C CG  . PRO A 1 88  ? 34.697  24.612  22.327  1.00 39.26  ? 88   PRO A CG  1 
ATOM   696  C CD  . PRO A 1 88  ? 33.520  25.219  21.501  1.00 33.36  ? 88   PRO A CD  1 
ATOM   697  N N   . ASN A 1 89  ? 31.717  25.172  25.945  1.00 35.31  ? 89   ASN A N   1 
ATOM   698  C CA  . ASN A 1 89  ? 31.208  26.025  26.995  1.00 31.44  ? 89   ASN A CA  1 
ATOM   699  C C   . ASN A 1 89  ? 31.979  25.854  28.313  1.00 36.78  ? 89   ASN A C   1 
ATOM   700  O O   . ASN A 1 89  ? 31.490  26.249  29.368  1.00 33.42  ? 89   ASN A O   1 
ATOM   701  C CB  . ASN A 1 89  ? 29.691  25.817  27.173  1.00 30.39  ? 89   ASN A CB  1 
ATOM   702  C CG  . ASN A 1 89  ? 29.342  24.427  27.716  1.00 38.38  ? 89   ASN A CG  1 
ATOM   703  O OD1 . ASN A 1 89  ? 30.129  23.484  27.590  1.00 29.64  ? 89   ASN A OD1 1 
ATOM   704  N ND2 . ASN A 1 89  ? 28.138  24.296  28.309  1.00 35.90  ? 89   ASN A ND2 1 
ATOM   705  N N   A ARG A 1 90  ? 33.164  25.243  28.246  0.50 31.13  ? 90   ARG A N   1 
ATOM   706  N N   B ARG A 1 90  ? 33.168  25.246  28.228  0.50 31.06  ? 90   ARG A N   1 
ATOM   707  C CA  A ARG A 1 90  ? 34.105  25.229  29.364  0.50 29.52  ? 90   ARG A CA  1 
ATOM   708  C CA  B ARG A 1 90  ? 34.109  25.141  29.343  0.50 29.92  ? 90   ARG A CA  1 
ATOM   709  C C   A ARG A 1 90  ? 35.474  25.346  28.744  0.50 32.55  ? 90   ARG A C   1 
ATOM   710  C C   B ARG A 1 90  ? 35.479  25.331  28.738  0.50 32.53  ? 90   ARG A C   1 
ATOM   711  O O   A ARG A 1 90  ? 35.608  25.286  27.521  0.50 33.21  ? 90   ARG A O   1 
ATOM   712  O O   B ARG A 1 90  ? 35.621  25.309  27.514  0.50 33.28  ? 90   ARG A O   1 
ATOM   713  C CB  A ARG A 1 90  ? 34.041  23.931  30.188  0.50 31.13  ? 90   ARG A CB  1 
ATOM   714  C CB  B ARG A 1 90  ? 34.065  23.757  30.014  0.50 30.84  ? 90   ARG A CB  1 
ATOM   715  C CG  A ARG A 1 90  ? 32.839  23.794  31.108  0.50 35.03  ? 90   ARG A CG  1 
ATOM   716  C CG  B ARG A 1 90  ? 32.723  23.361  30.578  0.50 31.46  ? 90   ARG A CG  1 
ATOM   717  C CD  A ARG A 1 90  ? 32.555  25.079  31.899  0.50 37.54  ? 90   ARG A CD  1 
ATOM   718  C CD  B ARG A 1 90  ? 32.351  24.313  31.683  0.50 36.62  ? 90   ARG A CD  1 
ATOM   719  N NE  A ARG A 1 90  ? 31.319  24.926  32.660  0.50 41.95  ? 90   ARG A NE  1 
ATOM   720  N NE  B ARG A 1 90  ? 32.737  23.850  33.008  0.50 32.11  ? 90   ARG A NE  1 
ATOM   721  C CZ  A ARG A 1 90  ? 30.167  25.531  32.384  0.50 41.23  ? 90   ARG A CZ  1 
ATOM   722  C CZ  B ARG A 1 90  ? 32.773  24.643  34.081  0.50 38.63  ? 90   ARG A CZ  1 
ATOM   723  N NH1 A ARG A 1 90  ? 30.080  26.385  31.370  0.50 33.22  ? 90   ARG A NH1 1 
ATOM   724  N NH1 B ARG A 1 90  ? 32.481  25.945  33.951  0.50 37.28  ? 90   ARG A NH1 1 
ATOM   725  N NH2 A ARG A 1 90  ? 29.104  25.292  33.148  0.50 40.26  ? 90   ARG A NH2 1 
ATOM   726  N NH2 B ARG A 1 90  ? 33.112  24.150  35.269  0.50 27.52  ? 90   ARG A NH2 1 
ATOM   727  N N   . GLU A 1 91  ? 36.488  25.508  29.584  1.00 31.41  ? 91   GLU A N   1 
ATOM   728  C CA  . GLU A 1 91  ? 37.845  25.712  29.119  1.00 33.05  ? 91   GLU A CA  1 
ATOM   729  C C   . GLU A 1 91  ? 38.349  24.547  28.228  1.00 33.53  ? 91   GLU A C   1 
ATOM   730  O O   . GLU A 1 91  ? 38.148  23.358  28.554  1.00 30.38  ? 91   GLU A O   1 
ATOM   731  C CB  . GLU A 1 91  ? 38.766  25.881  30.338  1.00 32.61  ? 91   GLU A CB  1 
ATOM   732  C CG  . GLU A 1 91  ? 40.247  26.034  29.992  1.00 43.01  ? 91   GLU A CG  1 
ATOM   733  C CD  . GLU A 1 91  ? 41.141  26.066  31.232  1.00 52.54  ? 91   GLU A CD  1 
ATOM   734  O OE1 . GLU A 1 91  ? 40.629  26.415  32.310  1.00 39.98  ? 91   GLU A OE1 1 
ATOM   735  O OE2 . GLU A 1 91  ? 42.352  25.728  31.126  1.00 63.51  ? 91   GLU A OE2 1 
ATOM   736  N N   . LEU A 1 92  ? 39.002  24.887  27.116  1.00 30.22  ? 92   LEU A N   1 
ATOM   737  C CA  . LEU A 1 92  ? 39.668  23.878  26.284  1.00 34.26  ? 92   LEU A CA  1 
ATOM   738  C C   . LEU A 1 92  ? 40.921  23.369  26.982  1.00 36.31  ? 92   LEU A C   1 
ATOM   739  O O   . LEU A 1 92  ? 41.689  24.148  27.486  1.00 34.51  ? 92   LEU A O   1 
ATOM   740  C CB  . LEU A 1 92  ? 40.077  24.439  24.922  1.00 31.42  ? 92   LEU A CB  1 
ATOM   741  C CG  . LEU A 1 92  ? 38.993  25.041  24.034  1.00 39.61  ? 92   LEU A CG  1 
ATOM   742  C CD1 . LEU A 1 92  ? 39.612  25.320  22.652  1.00 35.78  ? 92   LEU A CD1 1 
ATOM   743  C CD2 . LEU A 1 92  ? 37.822  24.071  23.937  1.00 35.86  ? 92   LEU A CD2 1 
ATOM   744  N N   . SER A 1 93  ? 41.123  22.052  27.001  1.00 32.79  ? 93   SER A N   1 
ATOM   745  C CA  . SER A 1 93  ? 42.292  21.514  27.612  1.00 28.18  ? 93   SER A CA  1 
ATOM   746  C C   . SER A 1 93  ? 42.492  20.099  27.095  1.00 38.14  ? 93   SER A C   1 
ATOM   747  O O   . SER A 1 93  ? 41.519  19.423  26.780  1.00 32.51  ? 93   SER A O   1 
ATOM   748  C CB  . SER A 1 93  ? 42.111  21.500  29.133  1.00 32.18  ? 93   SER A CB  1 
ATOM   749  O OG  . SER A 1 93  ? 43.186  20.834  29.784  1.00 30.23  ? 93   SER A OG  1 
ATOM   750  N N   . GLU A 1 94  ? 43.741  19.633  27.038  1.00 32.23  ? 94   GLU A N   1 
ATOM   751  C CA  . GLU A 1 94  ? 43.964  18.241  26.699  1.00 30.49  ? 94   GLU A CA  1 
ATOM   752  C C   . GLU A 1 94  ? 43.564  17.374  27.886  1.00 31.40  ? 94   GLU A C   1 
ATOM   753  O O   . GLU A 1 94  ? 43.238  16.184  27.757  1.00 32.48  ? 94   GLU A O   1 
ATOM   754  C CB  . GLU A 1 94  ? 45.411  18.012  26.334  1.00 36.11  ? 94   GLU A CB  1 
ATOM   755  C CG  . GLU A 1 94  ? 45.834  18.689  25.028  1.00 33.94  ? 94   GLU A CG  1 
ATOM   756  C CD  . GLU A 1 94  ? 47.268  18.286  24.644  1.00 36.65  ? 94   GLU A CD  1 
ATOM   757  O OE1 . GLU A 1 94  ? 47.477  17.140  24.159  1.00 29.90  ? 94   GLU A OE1 1 
ATOM   758  O OE2 . GLU A 1 94  ? 48.174  19.113  24.844  1.00 34.69  ? 94   GLU A OE2 1 
ATOM   759  N N   . ASP A 1 95  ? 43.577  17.971  29.075  1.00 30.50  ? 95   ASP A N   1 
ATOM   760  C CA  . ASP A 1 95  ? 43.059  17.291  30.263  1.00 37.74  ? 95   ASP A CA  1 
ATOM   761  C C   . ASP A 1 95  ? 41.542  17.385  30.244  1.00 32.96  ? 95   ASP A C   1 
ATOM   762  O O   . ASP A 1 95  ? 40.965  18.305  30.827  1.00 31.35  ? 95   ASP A O   1 
ATOM   763  C CB  . ASP A 1 95  ? 43.619  17.922  31.542  1.00 32.03  ? 95   ASP A CB  1 
ATOM   764  C CG  . ASP A 1 95  ? 43.116  17.233  32.800  1.00 31.70  ? 95   ASP A CG  1 
ATOM   765  O OD1 . ASP A 1 95  ? 42.335  16.265  32.691  1.00 36.53  ? 95   ASP A OD1 1 
ATOM   766  O OD2 . ASP A 1 95  ? 43.511  17.668  33.903  1.00 40.52  ? 95   ASP A OD2 1 
ATOM   767  N N   . CYS A 1 96  ? 40.888  16.436  29.585  1.00 29.31  ? 96   CYS A N   1 
ATOM   768  C CA  . CYS A 1 96  ? 39.466  16.577  29.288  1.00 32.73  ? 96   CYS A CA  1 
ATOM   769  C C   . CYS A 1 96  ? 38.666  15.279  29.366  1.00 35.40  ? 96   CYS A C   1 
ATOM   770  O O   . CYS A 1 96  ? 37.469  15.273  29.083  1.00 25.07  ? 96   CYS A O   1 
ATOM   771  C CB  . CYS A 1 96  ? 39.284  17.207  27.904  1.00 37.96  ? 96   CYS A CB  1 
ATOM   772  S SG  . CYS A 1 96  ? 39.868  16.173  26.538  1.00 36.14  ? 96   CYS A SG  1 
ATOM   773  N N   . LEU A 1 97  ? 39.307  14.184  29.745  1.00 24.79  ? 97   LEU A N   1 
ATOM   774  C CA  . LEU A 1 97  ? 38.615  12.899  29.790  1.00 32.29  ? 97   LEU A CA  1 
ATOM   775  C C   . LEU A 1 97  ? 37.780  12.713  31.058  1.00 33.04  ? 97   LEU A C   1 
ATOM   776  O O   . LEU A 1 97  ? 38.230  12.117  32.035  1.00 31.00  ? 97   LEU A O   1 
ATOM   777  C CB  . LEU A 1 97  ? 39.613  11.755  29.626  1.00 27.60  ? 97   LEU A CB  1 
ATOM   778  C CG  . LEU A 1 97  ? 40.347  11.777  28.285  1.00 28.87  ? 97   LEU A CG  1 
ATOM   779  C CD1 . LEU A 1 97  ? 41.132  10.497  28.089  1.00 26.26  ? 97   LEU A CD1 1 
ATOM   780  C CD2 . LEU A 1 97  ? 39.360  11.982  27.143  1.00 25.39  ? 97   LEU A CD2 1 
ATOM   781  N N   . TYR A 1 98  ? 36.550  13.227  31.024  1.00 31.18  ? 98   TYR A N   1 
ATOM   782  C CA  . TYR A 1 98  ? 35.655  13.182  32.163  1.00 27.42  ? 98   TYR A CA  1 
ATOM   783  C C   . TYR A 1 98  ? 34.291  12.787  31.645  1.00 29.60  ? 98   TYR A C   1 
ATOM   784  O O   . TYR A 1 98  ? 33.998  12.968  30.458  1.00 30.01  ? 98   TYR A O   1 
ATOM   785  C CB  . TYR A 1 98  ? 35.584  14.571  32.807  1.00 29.92  ? 98   TYR A CB  1 
ATOM   786  C CG  . TYR A 1 98  ? 36.897  15.031  33.372  1.00 29.77  ? 98   TYR A CG  1 
ATOM   787  C CD1 . TYR A 1 98  ? 37.238  14.768  34.710  1.00 33.25  ? 98   TYR A CD1 1 
ATOM   788  C CD2 . TYR A 1 98  ? 37.813  15.721  32.577  1.00 29.44  ? 98   TYR A CD2 1 
ATOM   789  C CE1 . TYR A 1 98  ? 38.480  15.194  35.242  1.00 36.15  ? 98   TYR A CE1 1 
ATOM   790  C CE2 . TYR A 1 98  ? 39.056  16.148  33.098  1.00 28.95  ? 98   TYR A CE2 1 
ATOM   791  C CZ  . TYR A 1 98  ? 39.385  15.864  34.416  1.00 36.21  ? 98   TYR A CZ  1 
ATOM   792  O OH  . TYR A 1 98  ? 40.606  16.266  34.917  1.00 31.18  ? 98   TYR A OH  1 
ATOM   793  N N   . LEU A 1 99  ? 33.447  12.252  32.513  1.00 28.37  ? 99   LEU A N   1 
ATOM   794  C CA  . LEU A 1 99  ? 32.100  11.891  32.083  1.00 30.49  ? 99   LEU A CA  1 
ATOM   795  C C   . LEU A 1 99  ? 31.058  12.362  33.098  1.00 27.75  ? 99   LEU A C   1 
ATOM   796  O O   . LEU A 1 99  ? 31.385  12.750  34.207  1.00 29.13  ? 99   LEU A O   1 
ATOM   797  C CB  . LEU A 1 99  ? 31.993  10.378  31.821  1.00 27.48  ? 99   LEU A CB  1 
ATOM   798  C CG  . LEU A 1 99  ? 32.308  9.418   32.961  1.00 25.94  ? 99   LEU A CG  1 
ATOM   799  C CD1 . LEU A 1 99  ? 31.222  9.412   34.043  1.00 23.42  ? 99   LEU A CD1 1 
ATOM   800  C CD2 . LEU A 1 99  ? 32.491  7.971   32.429  1.00 28.68  ? 99   LEU A CD2 1 
ATOM   801  N N   . ASN A 1 100 ? 29.794  12.279  32.715  1.00 31.27  ? 100  ASN A N   1 
ATOM   802  C CA  . ASN A 1 100 ? 28.724  12.921  33.443  1.00 22.33  ? 100  ASN A CA  1 
ATOM   803  C C   . ASN A 1 100 ? 27.623  11.891  33.649  1.00 29.10  ? 100  ASN A C   1 
ATOM   804  O O   . ASN A 1 100 ? 27.308  11.145  32.728  1.00 27.33  ? 100  ASN A O   1 
ATOM   805  C CB  . ASN A 1 100 ? 28.198  14.041  32.568  1.00 19.64  ? 100  ASN A CB  1 
ATOM   806  C CG  . ASN A 1 100 ? 29.299  15.078  32.194  1.00 29.67  ? 100  ASN A CG  1 
ATOM   807  O OD1 . ASN A 1 100 ? 29.960  15.631  33.081  1.00 29.47  ? 100  ASN A OD1 1 
ATOM   808  N ND2 . ASN A 1 100 ? 29.452  15.370  30.876  1.00 23.49  ? 100  ASN A ND2 1 
ATOM   809  N N   . VAL A 1 101 ? 27.019  11.869  34.833  1.00 28.98  ? 101  VAL A N   1 
ATOM   810  C CA  . VAL A 1 101 ? 25.914  10.981  35.085  1.00 30.66  ? 101  VAL A CA  1 
ATOM   811  C C   . VAL A 1 101 ? 24.716  11.778  35.628  1.00 29.29  ? 101  VAL A C   1 
ATOM   812  O O   . VAL A 1 101 ? 24.856  12.493  36.592  1.00 34.37  ? 101  VAL A O   1 
ATOM   813  C CB  . VAL A 1 101 ? 26.304  9.904   36.145  1.00 30.52  ? 101  VAL A CB  1 
ATOM   814  C CG1 . VAL A 1 101 ? 25.081  9.109   36.570  1.00 27.33  ? 101  VAL A CG1 1 
ATOM   815  C CG2 . VAL A 1 101 ? 27.430  8.964   35.626  1.00 24.07  ? 101  VAL A CG2 1 
ATOM   816  N N   . TRP A 1 102 ? 23.542  11.623  35.034  1.00 29.69  ? 102  TRP A N   1 
ATOM   817  C CA  . TRP A 1 102 ? 22.293  12.102  35.657  1.00 29.10  ? 102  TRP A CA  1 
ATOM   818  C C   . TRP A 1 102 ? 21.413  10.910  36.009  1.00 33.46  ? 102  TRP A C   1 
ATOM   819  O O   . TRP A 1 102 ? 21.354  9.925   35.267  1.00 30.74  ? 102  TRP A O   1 
ATOM   820  C CB  . TRP A 1 102 ? 21.480  12.969  34.712  1.00 30.15  ? 102  TRP A CB  1 
ATOM   821  C CG  . TRP A 1 102 ? 22.073  14.312  34.295  1.00 31.28  ? 102  TRP A CG  1 
ATOM   822  C CD1 . TRP A 1 102 ? 21.743  15.549  34.785  1.00 30.49  ? 102  TRP A CD1 1 
ATOM   823  C CD2 . TRP A 1 102 ? 23.015  14.535  33.242  1.00 26.25  ? 102  TRP A CD2 1 
ATOM   824  N NE1 . TRP A 1 102 ? 22.432  16.535  34.100  1.00 31.59  ? 102  TRP A NE1 1 
ATOM   825  C CE2 . TRP A 1 102 ? 23.214  15.934  33.145  1.00 34.84  ? 102  TRP A CE2 1 
ATOM   826  C CE3 . TRP A 1 102 ? 23.676  13.694  32.354  1.00 30.28  ? 102  TRP A CE3 1 
ATOM   827  C CZ2 . TRP A 1 102 ? 24.095  16.503  32.216  1.00 32.35  ? 102  TRP A CZ2 1 
ATOM   828  C CZ3 . TRP A 1 102 ? 24.533  14.256  31.427  1.00 38.57  ? 102  TRP A CZ3 1 
ATOM   829  C CH2 . TRP A 1 102 ? 24.732  15.662  31.361  1.00 31.61  ? 102  TRP A CH2 1 
ATOM   830  N N   . THR A 1 103 ? 20.724  11.012  37.141  1.00 35.96  ? 103  THR A N   1 
ATOM   831  C CA  . THR A 1 103 ? 19.821  9.972   37.601  1.00 32.69  ? 103  THR A CA  1 
ATOM   832  C C   . THR A 1 103 ? 18.697  10.678  38.322  1.00 35.26  ? 103  THR A C   1 
ATOM   833  O O   . THR A 1 103 ? 18.867  11.829  38.747  1.00 37.95  ? 103  THR A O   1 
ATOM   834  C CB  . THR A 1 103 ? 20.519  8.986   38.622  1.00 39.57  ? 103  THR A CB  1 
ATOM   835  O OG1 . THR A 1 103 ? 20.783  9.655   39.862  1.00 39.34  ? 103  THR A OG1 1 
ATOM   836  C CG2 . THR A 1 103 ? 21.828  8.487   38.095  1.00 37.01  ? 103  THR A CG2 1 
ATOM   837  N N   . PRO A 1 104 ? 17.551  9.995   38.475  1.00 40.13  ? 104  PRO A N   1 
ATOM   838  C CA  . PRO A 1 104 ? 16.457  10.447  39.334  1.00 39.27  ? 104  PRO A CA  1 
ATOM   839  C C   . PRO A 1 104 ? 16.950  10.784  40.729  1.00 39.90  ? 104  PRO A C   1 
ATOM   840  O O   . PRO A 1 104 ? 18.021  10.356  41.129  1.00 45.46  ? 104  PRO A O   1 
ATOM   841  C CB  . PRO A 1 104 ? 15.547  9.221   39.397  1.00 38.13  ? 104  PRO A CB  1 
ATOM   842  C CG  . PRO A 1 104 ? 15.802  8.522   38.089  1.00 34.42  ? 104  PRO A CG  1 
ATOM   843  C CD  . PRO A 1 104 ? 17.245  8.696   37.836  1.00 38.33  ? 104  PRO A CD  1 
ATOM   844  N N   . TYR A 1 105 ? 16.164  11.563  41.454  1.00 38.29  ? 105  TYR A N   1 
ATOM   845  C CA  . TYR A 1 105 ? 16.479  11.936  42.821  1.00 41.83  ? 105  TYR A CA  1 
ATOM   846  C C   . TYR A 1 105 ? 15.251  11.676  43.648  1.00 46.11  ? 105  TYR A C   1 
ATOM   847  O O   . TYR A 1 105 ? 14.199  12.251  43.367  1.00 51.69  ? 105  TYR A O   1 
ATOM   848  C CB  . TYR A 1 105 ? 16.797  13.422  42.889  1.00 30.14  ? 105  TYR A CB  1 
ATOM   849  C CG  . TYR A 1 105 ? 17.140  13.957  44.264  1.00 36.07  ? 105  TYR A CG  1 
ATOM   850  C CD1 . TYR A 1 105 ? 18.468  14.202  44.619  1.00 38.07  ? 105  TYR A CD1 1 
ATOM   851  C CD2 . TYR A 1 105 ? 16.144  14.263  45.198  1.00 32.26  ? 105  TYR A CD2 1 
ATOM   852  C CE1 . TYR A 1 105 ? 18.799  14.709  45.879  1.00 35.99  ? 105  TYR A CE1 1 
ATOM   853  C CE2 . TYR A 1 105 ? 16.468  14.763  46.462  1.00 30.44  ? 105  TYR A CE2 1 
ATOM   854  C CZ  . TYR A 1 105 ? 17.797  14.994  46.781  1.00 40.39  ? 105  TYR A CZ  1 
ATOM   855  O OH  . TYR A 1 105 ? 18.151  15.508  48.009  1.00 44.30  ? 105  TYR A OH  1 
ATOM   856  N N   . PRO A 1 106 ? 15.360  10.809  44.659  1.00 46.60  ? 106  PRO A N   1 
ATOM   857  C CA  . PRO A 1 106 ? 16.566  10.064  45.035  1.00 42.29  ? 106  PRO A CA  1 
ATOM   858  C C   . PRO A 1 106 ? 16.841  9.001   43.998  1.00 43.43  ? 106  PRO A C   1 
ATOM   859  O O   . PRO A 1 106 ? 15.992  8.791   43.131  1.00 42.59  ? 106  PRO A O   1 
ATOM   860  C CB  . PRO A 1 106 ? 16.179  9.395   46.360  1.00 48.36  ? 106  PRO A CB  1 
ATOM   861  C CG  . PRO A 1 106 ? 14.814  9.901   46.709  1.00 51.93  ? 106  PRO A CG  1 
ATOM   862  C CD  . PRO A 1 106 ? 14.187  10.390  45.446  1.00 49.46  ? 106  PRO A CD  1 
ATOM   863  N N   . ARG A 1 107 ? 17.995  8.341   44.071  1.00 43.20  ? 107  ARG A N   1 
ATOM   864  C CA  . ARG A 1 107 ? 18.367  7.389   43.035  1.00 40.27  ? 107  ARG A CA  1 
ATOM   865  C C   . ARG A 1 107 ? 17.364  6.231   42.976  1.00 42.25  ? 107  ARG A C   1 
ATOM   866  O O   . ARG A 1 107 ? 16.723  5.904   43.965  1.00 42.64  ? 107  ARG A O   1 
ATOM   867  C CB  . ARG A 1 107 ? 19.816  6.918   43.235  1.00 41.68  ? 107  ARG A CB  1 
ATOM   868  C CG  . ARG A 1 107 ? 20.821  8.090   43.166  1.00 44.07  ? 107  ARG A CG  1 
ATOM   869  C CD  . ARG A 1 107 ? 22.283  7.690   43.198  1.00 35.98  ? 107  ARG A CD  1 
ATOM   870  N NE  . ARG A 1 107 ? 22.625  6.889   44.370  1.00 26.00  ? 107  ARG A NE  1 
ATOM   871  C CZ  . ARG A 1 107 ? 23.004  7.383   45.542  1.00 25.05  ? 107  ARG A CZ  1 
ATOM   872  N NH1 . ARG A 1 107 ? 23.095  8.690   45.717  1.00 27.24  ? 107  ARG A NH1 1 
ATOM   873  N NH2 . ARG A 1 107 ? 23.297  6.565   46.549  1.00 25.52  ? 107  ARG A NH2 1 
ATOM   874  N N   . PRO A 1 108 ? 17.223  5.622   41.796  1.00 47.39  ? 108  PRO A N   1 
ATOM   875  C CA  . PRO A 1 108 ? 16.303  4.498   41.645  1.00 53.31  ? 108  PRO A CA  1 
ATOM   876  C C   . PRO A 1 108 ? 16.686  3.393   42.637  1.00 55.87  ? 108  PRO A C   1 
ATOM   877  O O   . PRO A 1 108 ? 17.875  3.136   42.827  1.00 59.02  ? 108  PRO A O   1 
ATOM   878  C CB  . PRO A 1 108 ? 16.577  4.020   40.216  1.00 50.16  ? 108  PRO A CB  1 
ATOM   879  C CG  . PRO A 1 108 ? 17.298  5.143   39.546  1.00 51.25  ? 108  PRO A CG  1 
ATOM   880  C CD  . PRO A 1 108 ? 18.067  5.818   40.606  1.00 50.57  ? 108  PRO A CD  1 
ATOM   881  N N   . ALA A 1 109 ? 15.710  2.741   43.248  1.00 53.76  ? 109  ALA A N   1 
ATOM   882  C CA  . ALA A 1 109 ? 16.025  1.689   44.201  1.00 65.23  ? 109  ALA A CA  1 
ATOM   883  C C   . ALA A 1 109 ? 16.266  0.348   43.498  1.00 65.27  ? 109  ALA A C   1 
ATOM   884  O O   . ALA A 1 109 ? 16.905  -0.543  44.054  1.00 67.33  ? 109  ALA A O   1 
ATOM   885  C CB  . ALA A 1 109 ? 14.934  1.560   45.231  1.00 69.89  ? 109  ALA A CB  1 
ATOM   886  N N   . SER A 1 110 ? 15.764  0.210   42.279  1.00 58.18  ? 110  SER A N   1 
ATOM   887  C CA  . SER A 1 110 ? 16.072  -0.976  41.498  1.00 57.69  ? 110  SER A CA  1 
ATOM   888  C C   . SER A 1 110 ? 16.739  -0.601  40.164  1.00 54.66  ? 110  SER A C   1 
ATOM   889  O O   . SER A 1 110 ? 16.561  0.511   39.654  1.00 46.84  ? 110  SER A O   1 
ATOM   890  C CB  . SER A 1 110 ? 14.830  -1.844  41.306  1.00 52.71  ? 110  SER A CB  1 
ATOM   891  O OG  . SER A 1 110 ? 13.855  -1.178  40.547  1.00 57.42  ? 110  SER A OG  1 
ATOM   892  N N   . PRO A 1 111 ? 17.515  -1.538  39.605  1.00 47.13  ? 111  PRO A N   1 
ATOM   893  C CA  . PRO A 1 111 ? 18.387  -1.263  38.465  1.00 44.16  ? 111  PRO A CA  1 
ATOM   894  C C   . PRO A 1 111 ? 17.644  -0.656  37.265  1.00 47.22  ? 111  PRO A C   1 
ATOM   895  O O   . PRO A 1 111 ? 16.699  -1.249  36.761  1.00 46.90  ? 111  PRO A O   1 
ATOM   896  C CB  . PRO A 1 111 ? 18.992  -2.650  38.132  1.00 39.92  ? 111  PRO A CB  1 
ATOM   897  C CG  . PRO A 1 111 ? 18.831  -3.461  39.432  1.00 42.08  ? 111  PRO A CG  1 
ATOM   898  C CD  . PRO A 1 111 ? 17.515  -2.966  39.980  1.00 45.24  ? 111  PRO A CD  1 
ATOM   899  N N   . THR A 1 112 ? 18.088  0.517   36.819  1.00 42.05  ? 112  THR A N   1 
ATOM   900  C CA  . THR A 1 112 ? 17.445  1.244   35.727  1.00 37.94  ? 112  THR A CA  1 
ATOM   901  C C   . THR A 1 112 ? 18.292  1.212   34.453  1.00 36.15  ? 112  THR A C   1 
ATOM   902  O O   . THR A 1 112 ? 19.520  1.326   34.524  1.00 40.50  ? 112  THR A O   1 
ATOM   903  C CB  . THR A 1 112 ? 17.290  2.726   36.123  1.00 42.22  ? 112  THR A CB  1 
ATOM   904  O OG1 . THR A 1 112 ? 16.758  2.802   37.440  1.00 45.20  ? 112  THR A OG1 1 
ATOM   905  C CG2 . THR A 1 112 ? 16.389  3.468   35.160  1.00 41.27  ? 112  THR A CG2 1 
ATOM   906  N N   . PRO A 1 113 ? 17.638  1.072   33.289  1.00 37.75  ? 113  PRO A N   1 
ATOM   907  C CA  . PRO A 1 113 ? 18.273  1.105   31.964  1.00 34.64  ? 113  PRO A CA  1 
ATOM   908  C C   . PRO A 1 113 ? 19.080  2.376   31.798  1.00 38.01  ? 113  PRO A C   1 
ATOM   909  O O   . PRO A 1 113 ? 18.632  3.435   32.214  1.00 34.19  ? 113  PRO A O   1 
ATOM   910  C CB  . PRO A 1 113 ? 17.083  1.133   31.010  1.00 34.26  ? 113  PRO A CB  1 
ATOM   911  C CG  . PRO A 1 113 ? 16.027  0.306   31.765  1.00 39.02  ? 113  PRO A CG  1 
ATOM   912  C CD  . PRO A 1 113 ? 16.197  0.775   33.197  1.00 40.54  ? 113  PRO A CD  1 
ATOM   913  N N   . VAL A 1 114 ? 20.244  2.251   31.177  1.00 38.21  ? 114  VAL A N   1 
ATOM   914  C CA  . VAL A 1 114 ? 21.204  3.332   31.067  1.00 36.56  ? 114  VAL A CA  1 
ATOM   915  C C   . VAL A 1 114 ? 21.245  3.763   29.612  1.00 33.45  ? 114  VAL A C   1 
ATOM   916  O O   . VAL A 1 114 ? 21.226  2.924   28.720  1.00 32.52  ? 114  VAL A O   1 
ATOM   917  C CB  . VAL A 1 114 ? 22.615  2.828   31.524  1.00 28.80  ? 114  VAL A CB  1 
ATOM   918  C CG1 . VAL A 1 114 ? 23.671  3.928   31.373  1.00 34.52  ? 114  VAL A CG1 1 
ATOM   919  C CG2 . VAL A 1 114 ? 22.549  2.343   32.963  1.00 21.78  ? 114  VAL A CG2 1 
ATOM   920  N N   . LEU A 1 115 ? 21.261  5.069   29.384  1.00 31.85  ? 115  LEU A N   1 
ATOM   921  C CA  . LEU A 1 115 ? 21.517  5.640   28.068  1.00 30.20  ? 115  LEU A CA  1 
ATOM   922  C C   . LEU A 1 115 ? 22.870  6.304   28.107  1.00 32.23  ? 115  LEU A C   1 
ATOM   923  O O   . LEU A 1 115 ? 23.152  7.055   29.041  1.00 34.24  ? 115  LEU A O   1 
ATOM   924  C CB  . LEU A 1 115 ? 20.487  6.711   27.746  1.00 29.72  ? 115  LEU A CB  1 
ATOM   925  C CG  . LEU A 1 115 ? 19.119  6.142   27.365  1.00 41.88  ? 115  LEU A CG  1 
ATOM   926  C CD1 . LEU A 1 115 ? 18.079  7.212   27.078  1.00 34.43  ? 115  LEU A CD1 1 
ATOM   927  C CD2 . LEU A 1 115 ? 19.332  5.324   26.136  1.00 50.99  ? 115  LEU A CD2 1 
ATOM   928  N N   . ILE A 1 116 ? 23.703  6.034   27.100  1.00 32.58  ? 116  ILE A N   1 
ATOM   929  C CA  . ILE A 1 116 ? 25.004  6.669   27.015  1.00 28.01  ? 116  ILE A CA  1 
ATOM   930  C C   . ILE A 1 116 ? 25.076  7.495   25.745  1.00 29.19  ? 116  ILE A C   1 
ATOM   931  O O   . ILE A 1 116 ? 24.935  6.951   24.654  1.00 27.56  ? 116  ILE A O   1 
ATOM   932  C CB  . ILE A 1 116 ? 26.140  5.639   26.995  1.00 36.02  ? 116  ILE A CB  1 
ATOM   933  C CG1 . ILE A 1 116 ? 26.087  4.742   28.217  1.00 33.54  ? 116  ILE A CG1 1 
ATOM   934  C CG2 . ILE A 1 116 ? 27.524  6.318   26.929  1.00 27.02  ? 116  ILE A CG2 1 
ATOM   935  C CD1 . ILE A 1 116 ? 27.254  3.886   28.270  1.00 27.43  ? 116  ILE A CD1 1 
ATOM   936  N N   . TRP A 1 117 ? 25.289  8.803   25.898  1.00 25.78  ? 117  TRP A N   1 
ATOM   937  C CA  . TRP A 1 117 ? 25.345  9.734   24.782  1.00 27.83  ? 117  TRP A CA  1 
ATOM   938  C C   . TRP A 1 117 ? 26.744  9.959   24.253  1.00 31.74  ? 117  TRP A C   1 
ATOM   939  O O   . TRP A 1 117 ? 27.663  10.292  25.012  1.00 30.22  ? 117  TRP A O   1 
ATOM   940  C CB  . TRP A 1 117 ? 24.799  11.097  25.200  1.00 25.72  ? 117  TRP A CB  1 
ATOM   941  C CG  . TRP A 1 117 ? 24.890  12.135  24.091  1.00 25.88  ? 117  TRP A CG  1 
ATOM   942  C CD1 . TRP A 1 117 ? 25.719  13.225  24.054  1.00 31.77  ? 117  TRP A CD1 1 
ATOM   943  C CD2 . TRP A 1 117 ? 24.105  12.196  22.887  1.00 27.82  ? 117  TRP A CD2 1 
ATOM   944  N NE1 . TRP A 1 117 ? 25.502  13.950  22.912  1.00 29.77  ? 117  TRP A NE1 1 
ATOM   945  C CE2 . TRP A 1 117 ? 24.518  13.341  22.180  1.00 24.04  ? 117  TRP A CE2 1 
ATOM   946  C CE3 . TRP A 1 117 ? 23.071  11.415  22.360  1.00 29.01  ? 117  TRP A CE3 1 
ATOM   947  C CZ2 . TRP A 1 117 ? 23.950  13.712  20.956  1.00 26.31  ? 117  TRP A CZ2 1 
ATOM   948  C CZ3 . TRP A 1 117 ? 22.512  11.782  21.131  1.00 27.79  ? 117  TRP A CZ3 1 
ATOM   949  C CH2 . TRP A 1 117 ? 22.956  12.925  20.446  1.00 26.59  ? 117  TRP A CH2 1 
ATOM   950  N N   . ILE A 1 118 ? 26.905  9.825   22.944  1.00 29.01  ? 118  ILE A N   1 
ATOM   951  C CA  . ILE A 1 118 ? 28.163  10.218  22.306  1.00 22.33  ? 118  ILE A CA  1 
ATOM   952  C C   . ILE A 1 118 ? 27.954  11.381  21.354  1.00 25.55  ? 118  ILE A C   1 
ATOM   953  O O   . ILE A 1 118 ? 27.326  11.223  20.315  1.00 30.91  ? 118  ILE A O   1 
ATOM   954  C CB  . ILE A 1 118 ? 28.798  9.032   21.567  1.00 22.10  ? 118  ILE A CB  1 
ATOM   955  C CG1 . ILE A 1 118 ? 28.953  7.854   22.552  1.00 21.96  ? 118  ILE A CG1 1 
ATOM   956  C CG2 . ILE A 1 118 ? 30.198  9.393   21.014  1.00 26.20  ? 118  ILE A CG2 1 
ATOM   957  C CD1 . ILE A 1 118 ? 29.255  6.559   21.829  1.00 24.75  ? 118  ILE A CD1 1 
ATOM   958  N N   . TYR A 1 119 ? 28.517  12.547  21.671  1.00 30.75  ? 119  TYR A N   1 
ATOM   959  C CA  . TYR A 1 119 ? 28.260  13.740  20.833  1.00 24.74  ? 119  TYR A CA  1 
ATOM   960  C C   . TYR A 1 119 ? 28.933  13.654  19.457  1.00 25.93  ? 119  TYR A C   1 
ATOM   961  O O   . TYR A 1 119 ? 29.929  12.922  19.273  1.00 25.12  ? 119  TYR A O   1 
ATOM   962  C CB  . TYR A 1 119 ? 28.693  15.022  21.559  1.00 24.53  ? 119  TYR A CB  1 
ATOM   963  C CG  . TYR A 1 119 ? 30.166  15.016  21.960  1.00 21.93  ? 119  TYR A CG  1 
ATOM   964  C CD1 . TYR A 1 119 ? 31.181  15.212  21.002  1.00 23.75  ? 119  TYR A CD1 1 
ATOM   965  C CD2 . TYR A 1 119 ? 30.532  14.832  23.287  1.00 24.08  ? 119  TYR A CD2 1 
ATOM   966  C CE1 . TYR A 1 119 ? 32.525  15.223  21.379  1.00 27.63  ? 119  TYR A CE1 1 
ATOM   967  C CE2 . TYR A 1 119 ? 31.844  14.813  23.673  1.00 27.32  ? 119  TYR A CE2 1 
ATOM   968  C CZ  . TYR A 1 119 ? 32.857  15.011  22.724  1.00 31.68  ? 119  TYR A CZ  1 
ATOM   969  O OH  . TYR A 1 119 ? 34.183  14.949  23.139  1.00 27.65  ? 119  TYR A OH  1 
ATOM   970  N N   . GLY A 1 120 ? 28.364  14.368  18.486  1.00 18.21  ? 120  GLY A N   1 
ATOM   971  C CA  . GLY A 1 120 ? 28.984  14.563  17.184  1.00 21.00  ? 120  GLY A CA  1 
ATOM   972  C C   . GLY A 1 120 ? 29.795  15.883  17.163  1.00 24.49  ? 120  GLY A C   1 
ATOM   973  O O   . GLY A 1 120 ? 30.090  16.461  18.215  1.00 23.15  ? 120  GLY A O   1 
ATOM   974  N N   . GLY A 1 121 ? 30.104  16.355  15.955  1.00 25.58  ? 121  GLY A N   1 
ATOM   975  C CA  . GLY A 1 121 ? 30.997  17.464  15.679  1.00 22.37  ? 121  GLY A CA  1 
ATOM   976  C C   . GLY A 1 121 ? 32.178  17.087  14.790  1.00 28.68  ? 121  GLY A C   1 
ATOM   977  O O   . GLY A 1 121 ? 33.295  17.638  14.942  1.00 28.39  ? 121  GLY A O   1 
ATOM   978  N N   . GLY A 1 122 ? 31.945  16.170  13.855  1.00 24.71  ? 122  GLY A N   1 
ATOM   979  C CA  . GLY A 1 122 ? 32.923  15.867  12.812  1.00 24.24  ? 122  GLY A CA  1 
ATOM   980  C C   . GLY A 1 122 ? 34.212  15.205  13.283  1.00 33.27  ? 122  GLY A C   1 
ATOM   981  O O   . GLY A 1 122 ? 35.222  15.209  12.561  1.00 32.13  ? 122  GLY A O   1 
ATOM   982  N N   . PHE A 1 123 ? 34.199  14.657  14.498  1.00 32.04  ? 123  PHE A N   1 
ATOM   983  C CA  . PHE A 1 123 ? 35.413  14.100  15.109  1.00 26.81  ? 123  PHE A CA  1 
ATOM   984  C C   . PHE A 1 123 ? 36.472  15.176  15.333  1.00 28.70  ? 123  PHE A C   1 
ATOM   985  O O   . PHE A 1 123 ? 37.609  14.863  15.679  1.00 30.24  ? 123  PHE A O   1 
ATOM   986  C CB  . PHE A 1 123 ? 36.000  12.973  14.250  1.00 27.25  ? 123  PHE A CB  1 
ATOM   987  C CG  . PHE A 1 123 ? 35.152  11.739  14.209  1.00 25.83  ? 123  PHE A CG  1 
ATOM   988  C CD1 . PHE A 1 123 ? 35.006  10.949  15.357  1.00 27.06  ? 123  PHE A CD1 1 
ATOM   989  C CD2 . PHE A 1 123 ? 34.460  11.390  13.041  1.00 26.13  ? 123  PHE A CD2 1 
ATOM   990  C CE1 . PHE A 1 123 ? 34.215  9.808   15.353  1.00 26.80  ? 123  PHE A CE1 1 
ATOM   991  C CE2 . PHE A 1 123 ? 33.658  10.234  13.002  1.00 24.79  ? 123  PHE A CE2 1 
ATOM   992  C CZ  . PHE A 1 123 ? 33.540  9.436   14.167  1.00 28.93  ? 123  PHE A CZ  1 
ATOM   993  N N   . TYR A 1 124 ? 36.104  16.450  15.146  1.00 23.79  ? 124  TYR A N   1 
ATOM   994  C CA  . TYR A 1 124 ? 37.021  17.560  15.426  1.00 32.75  ? 124  TYR A CA  1 
ATOM   995  C C   . TYR A 1 124 ? 36.464  18.547  16.468  1.00 31.51  ? 124  TYR A C   1 
ATOM   996  O O   . TYR A 1 124 ? 37.102  19.526  16.804  1.00 30.48  ? 124  TYR A O   1 
ATOM   997  C CB  . TYR A 1 124 ? 37.396  18.310  14.136  1.00 35.67  ? 124  TYR A CB  1 
ATOM   998  C CG  . TYR A 1 124 ? 36.282  19.176  13.640  1.00 34.98  ? 124  TYR A CG  1 
ATOM   999  C CD1 . TYR A 1 124 ? 36.069  20.445  14.190  1.00 36.16  ? 124  TYR A CD1 1 
ATOM   1000 C CD2 . TYR A 1 124 ? 35.423  18.732  12.630  1.00 33.57  ? 124  TYR A CD2 1 
ATOM   1001 C CE1 . TYR A 1 124 ? 35.020  21.248  13.747  1.00 32.21  ? 124  TYR A CE1 1 
ATOM   1002 C CE2 . TYR A 1 124 ? 34.353  19.540  12.181  1.00 33.60  ? 124  TYR A CE2 1 
ATOM   1003 C CZ  . TYR A 1 124 ? 34.187  20.800  12.735  1.00 34.62  ? 124  TYR A CZ  1 
ATOM   1004 O OH  . TYR A 1 124 ? 33.153  21.609  12.329  1.00 37.82  ? 124  TYR A OH  1 
ATOM   1005 N N   . SER A 1 125 ? 35.278  18.282  16.991  1.00 28.56  ? 125  SER A N   1 
ATOM   1006 C CA  . SER A 1 125 ? 34.708  19.169  17.985  1.00 24.20  ? 125  SER A CA  1 
ATOM   1007 C C   . SER A 1 125 ? 33.633  18.469  18.774  1.00 27.32  ? 125  SER A C   1 
ATOM   1008 O O   . SER A 1 125 ? 33.286  17.304  18.481  1.00 24.71  ? 125  SER A O   1 
ATOM   1009 C CB  . SER A 1 125 ? 34.115  20.409  17.324  1.00 27.82  ? 125  SER A CB  1 
ATOM   1010 O OG  . SER A 1 125 ? 33.104  20.041  16.396  1.00 29.20  ? 125  SER A OG  1 
ATOM   1011 N N   . GLY A 1 126 ? 33.078  19.207  19.738  1.00 31.34  ? 126  GLY A N   1 
ATOM   1012 C CA  . GLY A 1 126 ? 31.975  18.711  20.555  1.00 26.35  ? 126  GLY A CA  1 
ATOM   1013 C C   . GLY A 1 126 ? 32.355  18.545  22.021  1.00 29.56  ? 126  GLY A C   1 
ATOM   1014 O O   . GLY A 1 126 ? 33.546  18.512  22.423  1.00 26.68  ? 126  GLY A O   1 
ATOM   1015 N N   . ALA A 1 127 ? 31.335  18.410  22.843  1.00 22.06  ? 127  ALA A N   1 
ATOM   1016 C CA  . ALA A 1 127 ? 31.527  18.322  24.288  1.00 25.68  ? 127  ALA A CA  1 
ATOM   1017 C C   . ALA A 1 127 ? 30.259  17.776  24.886  1.00 29.37  ? 127  ALA A C   1 
ATOM   1018 O O   . ALA A 1 127 ? 29.173  18.053  24.370  1.00 23.01  ? 127  ALA A O   1 
ATOM   1019 C CB  . ALA A 1 127 ? 31.801  19.690  24.871  1.00 24.52  ? 127  ALA A CB  1 
ATOM   1020 N N   . ALA A 1 128 ? 30.389  17.029  25.980  1.00 29.41  ? 128  ALA A N   1 
ATOM   1021 C CA  . ALA A 1 128 ? 29.218  16.465  26.608  1.00 30.96  ? 128  ALA A CA  1 
ATOM   1022 C C   . ALA A 1 128 ? 28.525  17.491  27.500  1.00 31.86  ? 128  ALA A C   1 
ATOM   1023 O O   . ALA A 1 128 ? 27.481  17.223  28.064  1.00 31.70  ? 128  ALA A O   1 
ATOM   1024 C CB  . ALA A 1 128 ? 29.572  15.226  27.384  1.00 26.55  ? 128  ALA A CB  1 
ATOM   1025 N N   . SER A 1 129 ? 29.121  18.664  27.659  1.00 31.37  ? 129  SER A N   1 
ATOM   1026 C CA  . SER A 1 129 ? 28.548  19.641  28.588  1.00 30.99  ? 129  SER A CA  1 
ATOM   1027 C C   . SER A 1 129 ? 27.599  20.645  27.914  1.00 28.65  ? 129  SER A C   1 
ATOM   1028 O O   . SER A 1 129 ? 27.111  21.563  28.571  1.00 33.17  ? 129  SER A O   1 
ATOM   1029 C CB  . SER A 1 129 ? 29.661  20.404  29.313  1.00 33.01  ? 129  SER A CB  1 
ATOM   1030 O OG  . SER A 1 129 ? 30.581  20.981  28.377  1.00 34.05  ? 129  SER A OG  1 
ATOM   1031 N N   . LEU A 1 130 ? 27.374  20.525  26.605  1.00 23.73  ? 130  LEU A N   1 
ATOM   1032 C CA  . LEU A 1 130 ? 26.535  21.530  25.940  1.00 27.34  ? 130  LEU A CA  1 
ATOM   1033 C C   . LEU A 1 130 ? 25.113  21.437  26.473  1.00 27.62  ? 130  LEU A C   1 
ATOM   1034 O O   . LEU A 1 130 ? 24.639  20.351  26.848  1.00 27.81  ? 130  LEU A O   1 
ATOM   1035 C CB  . LEU A 1 130 ? 26.534  21.343  24.424  1.00 28.58  ? 130  LEU A CB  1 
ATOM   1036 C CG  . LEU A 1 130 ? 27.871  21.238  23.698  1.00 34.46  ? 130  LEU A CG  1 
ATOM   1037 C CD1 . LEU A 1 130 ? 27.613  21.215  22.220  1.00 26.25  ? 130  LEU A CD1 1 
ATOM   1038 C CD2 . LEU A 1 130 ? 28.802  22.421  24.087  1.00 36.15  ? 130  LEU A CD2 1 
ATOM   1039 N N   . ASP A 1 131 ? 24.421  22.561  26.473  1.00 35.23  ? 131  ASP A N   1 
ATOM   1040 C CA  . ASP A 1 131 ? 23.038  22.589  26.915  1.00 32.66  ? 131  ASP A CA  1 
ATOM   1041 C C   . ASP A 1 131 ? 22.164  21.585  26.194  1.00 32.38  ? 131  ASP A C   1 
ATOM   1042 O O   . ASP A 1 131 ? 21.330  20.975  26.840  1.00 40.34  ? 131  ASP A O   1 
ATOM   1043 C CB  . ASP A 1 131 ? 22.459  23.996  26.807  1.00 37.33  ? 131  ASP A CB  1 
ATOM   1044 C CG  . ASP A 1 131 ? 23.065  24.938  27.829  1.00 42.31  ? 131  ASP A CG  1 
ATOM   1045 O OD1 . ASP A 1 131 ? 23.799  24.474  28.726  1.00 42.88  ? 131  ASP A OD1 1 
ATOM   1046 O OD2 . ASP A 1 131 ? 22.814  26.146  27.737  1.00 52.78  ? 131  ASP A OD2 1 
ATOM   1047 N N   . VAL A 1 132 ? 22.349  21.383  24.886  1.00 28.91  ? 132  VAL A N   1 
ATOM   1048 C CA  . VAL A 1 132 ? 21.470  20.465  24.164  1.00 33.89  ? 132  VAL A CA  1 
ATOM   1049 C C   . VAL A 1 132 ? 21.622  19.001  24.561  1.00 35.09  ? 132  VAL A C   1 
ATOM   1050 O O   . VAL A 1 132 ? 20.814  18.167  24.133  1.00 36.05  ? 132  VAL A O   1 
ATOM   1051 C CB  . VAL A 1 132 ? 21.629  20.507  22.633  1.00 37.40  ? 132  VAL A CB  1 
ATOM   1052 C CG1 . VAL A 1 132 ? 20.693  21.492  22.049  1.00 45.55  ? 132  VAL A CG1 1 
ATOM   1053 C CG2 . VAL A 1 132 ? 23.058  20.759  22.247  1.00 34.13  ? 132  VAL A CG2 1 
ATOM   1054 N N   . TYR A 1 133 ? 22.649  18.684  25.338  1.00 29.91  ? 133  TYR A N   1 
ATOM   1055 C CA  . TYR A 1 133 ? 22.871  17.288  25.762  1.00 32.92  ? 133  TYR A CA  1 
ATOM   1056 C C   . TYR A 1 133 ? 22.578  17.128  27.243  1.00 32.79  ? 133  TYR A C   1 
ATOM   1057 O O   . TYR A 1 133 ? 23.008  16.167  27.853  1.00 26.86  ? 133  TYR A O   1 
ATOM   1058 C CB  . TYR A 1 133 ? 24.319  16.815  25.485  1.00 20.65  ? 133  TYR A CB  1 
ATOM   1059 C CG  . TYR A 1 133 ? 24.832  17.066  24.071  1.00 24.43  ? 133  TYR A CG  1 
ATOM   1060 C CD1 . TYR A 1 133 ? 23.989  16.930  22.978  1.00 27.04  ? 133  TYR A CD1 1 
ATOM   1061 C CD2 . TYR A 1 133 ? 26.189  17.390  23.822  1.00 23.21  ? 133  TYR A CD2 1 
ATOM   1062 C CE1 . TYR A 1 133 ? 24.433  17.154  21.687  1.00 27.80  ? 133  TYR A CE1 1 
ATOM   1063 C CE2 . TYR A 1 133 ? 26.647  17.590  22.522  1.00 21.23  ? 133  TYR A CE2 1 
ATOM   1064 C CZ  . TYR A 1 133 ? 25.770  17.472  21.456  1.00 25.73  ? 133  TYR A CZ  1 
ATOM   1065 O OH  . TYR A 1 133 ? 26.152  17.672  20.142  1.00 25.04  ? 133  TYR A OH  1 
ATOM   1066 N N   . ASP A 1 134 ? 21.872  18.099  27.815  1.00 29.96  ? 134  ASP A N   1 
ATOM   1067 C CA  . ASP A 1 134 ? 21.468  18.073  29.212  1.00 31.16  ? 134  ASP A CA  1 
ATOM   1068 C C   . ASP A 1 134 ? 20.524  16.872  29.540  1.00 33.40  ? 134  ASP A C   1 
ATOM   1069 O O   . ASP A 1 134 ? 19.384  16.808  29.075  1.00 33.20  ? 134  ASP A O   1 
ATOM   1070 C CB  . ASP A 1 134 ? 20.800  19.423  29.536  1.00 30.48  ? 134  ASP A CB  1 
ATOM   1071 C CG  . ASP A 1 134 ? 20.514  19.613  31.028  1.00 39.88  ? 134  ASP A CG  1 
ATOM   1072 O OD1 . ASP A 1 134 ? 20.626  18.652  31.813  1.00 42.52  ? 134  ASP A OD1 1 
ATOM   1073 O OD2 . ASP A 1 134 ? 20.160  20.737  31.420  1.00 45.41  ? 134  ASP A OD2 1 
ATOM   1074 N N   . GLY A 1 135 ? 21.004  15.952  30.376  1.00 31.90  ? 135  GLY A N   1 
ATOM   1075 C CA  . GLY A 1 135 ? 20.265  14.752  30.744  1.00 29.30  ? 135  GLY A CA  1 
ATOM   1076 C C   . GLY A 1 135 ? 19.194  14.897  31.818  1.00 31.75  ? 135  GLY A C   1 
ATOM   1077 O O   . GLY A 1 135 ? 18.497  13.928  32.125  1.00 30.30  ? 135  GLY A O   1 
ATOM   1078 N N   . ARG A 1 136 ? 19.027  16.094  32.382  1.00 32.13  ? 136  ARG A N   1 
ATOM   1079 C CA  . ARG A 1 136 ? 18.064  16.240  33.486  1.00 39.67  ? 136  ARG A CA  1 
ATOM   1080 C C   . ARG A 1 136 ? 16.606  15.829  33.140  1.00 42.41  ? 136  ARG A C   1 
ATOM   1081 O O   . ARG A 1 136 ? 15.881  15.310  33.992  1.00 38.91  ? 136  ARG A O   1 
ATOM   1082 C CB  . ARG A 1 136 ? 18.127  17.646  34.133  1.00 32.80  ? 136  ARG A CB  1 
ATOM   1083 C CG  . ARG A 1 136 ? 17.407  18.736  33.377  1.00 30.52  ? 136  ARG A CG  1 
ATOM   1084 C CD  . ARG A 1 136 ? 17.542  20.117  34.090  1.00 34.52  ? 136  ARG A CD  1 
ATOM   1085 N NE  . ARG A 1 136 ? 18.933  20.578  34.038  1.00 43.04  ? 136  ARG A NE  1 
ATOM   1086 C CZ  . ARG A 1 136 ? 19.472  21.517  34.821  1.00 42.76  ? 136  ARG A CZ  1 
ATOM   1087 N NH1 . ARG A 1 136 ? 20.741  21.847  34.648  1.00 40.59  ? 136  ARG A NH1 1 
ATOM   1088 N NH2 . ARG A 1 136 ? 18.753  22.142  35.761  1.00 36.10  ? 136  ARG A NH2 1 
ATOM   1089 N N   . PHE A 1 137 ? 16.189  16.039  31.891  1.00 35.61  ? 137  PHE A N   1 
ATOM   1090 C CA  . PHE A 1 137 ? 14.800  15.816  31.512  1.00 34.52  ? 137  PHE A CA  1 
ATOM   1091 C C   . PHE A 1 137 ? 14.486  14.323  31.361  1.00 35.81  ? 137  PHE A C   1 
ATOM   1092 O O   . PHE A 1 137 ? 13.454  13.840  31.837  1.00 40.21  ? 137  PHE A O   1 
ATOM   1093 C CB  . PHE A 1 137 ? 14.482  16.597  30.228  1.00 32.54  ? 137  PHE A CB  1 
ATOM   1094 C CG  . PHE A 1 137 ? 14.859  18.054  30.318  1.00 34.76  ? 137  PHE A CG  1 
ATOM   1095 C CD1 . PHE A 1 137 ? 14.107  18.930  31.085  1.00 40.35  ? 137  PHE A CD1 1 
ATOM   1096 C CD2 . PHE A 1 137 ? 15.970  18.543  29.666  1.00 33.58  ? 137  PHE A CD2 1 
ATOM   1097 C CE1 . PHE A 1 137 ? 14.452  20.287  31.186  1.00 41.61  ? 137  PHE A CE1 1 
ATOM   1098 C CE2 . PHE A 1 137 ? 16.331  19.890  29.777  1.00 34.30  ? 137  PHE A CE2 1 
ATOM   1099 C CZ  . PHE A 1 137 ? 15.575  20.758  30.529  1.00 35.17  ? 137  PHE A CZ  1 
ATOM   1100 N N   . LEU A 1 138 ? 15.359  13.616  30.659  1.00 28.71  ? 138  LEU A N   1 
ATOM   1101 C CA  . LEU A 1 138 ? 15.237  12.183  30.486  1.00 35.39  ? 138  LEU A CA  1 
ATOM   1102 C C   . LEU A 1 138 ? 15.283  11.481  31.850  1.00 38.33  ? 138  LEU A C   1 
ATOM   1103 O O   . LEU A 1 138 ? 14.478  10.564  32.117  1.00 35.79  ? 138  LEU A O   1 
ATOM   1104 C CB  . LEU A 1 138 ? 16.359  11.676  29.559  1.00 32.68  ? 138  LEU A CB  1 
ATOM   1105 C CG  . LEU A 1 138 ? 16.124  11.975  28.068  1.00 32.71  ? 138  LEU A CG  1 
ATOM   1106 C CD1 . LEU A 1 138 ? 17.377  11.872  27.222  1.00 29.01  ? 138  LEU A CD1 1 
ATOM   1107 C CD2 . LEU A 1 138 ? 15.055  11.019  27.538  1.00 32.07  ? 138  LEU A CD2 1 
ATOM   1108 N N   . ALA A 1 139 ? 16.238  11.883  32.691  1.00 32.50  ? 139  ALA A N   1 
ATOM   1109 C CA  . ALA A 1 139 ? 16.330  11.375  34.065  1.00 36.46  ? 139  ALA A CA  1 
ATOM   1110 C C   . ALA A 1 139 ? 15.049  11.678  34.877  1.00 38.81  ? 139  ALA A C   1 
ATOM   1111 O O   . ALA A 1 139 ? 14.460  10.780  35.480  1.00 37.58  ? 139  ALA A O   1 
ATOM   1112 C CB  . ALA A 1 139 ? 17.533  11.955  34.781  1.00 32.67  ? 139  ALA A CB  1 
ATOM   1113 N N   . GLN A 1 140 ? 14.617  12.938  34.884  1.00 36.88  ? 140  GLN A N   1 
ATOM   1114 C CA  . GLN A 1 140 ? 13.445  13.320  35.691  1.00 37.91  ? 140  GLN A CA  1 
ATOM   1115 C C   . GLN A 1 140 ? 12.153  12.707  35.153  1.00 40.67  ? 140  GLN A C   1 
ATOM   1116 O O   . GLN A 1 140 ? 11.408  12.120  35.911  1.00 42.09  ? 140  GLN A O   1 
ATOM   1117 C CB  . GLN A 1 140 ? 13.306  14.841  35.834  1.00 28.85  ? 140  GLN A CB  1 
ATOM   1118 C CG  . GLN A 1 140 ? 12.589  15.253  37.104  1.00 31.71  ? 140  GLN A CG  1 
ATOM   1119 C CD  . GLN A 1 140 ? 11.068  15.021  37.000  1.00 41.48  ? 140  GLN A CD  1 
ATOM   1120 O OE1 . GLN A 1 140 ? 10.501  15.124  35.908  1.00 43.26  ? 140  GLN A OE1 1 
ATOM   1121 N NE2 . GLN A 1 140 ? 10.421  14.674  38.127  1.00 40.02  ? 140  GLN A NE2 1 
ATOM   1122 N N   . VAL A 1 141 ? 11.892  12.829  33.855  1.00 41.38  ? 141  VAL A N   1 
ATOM   1123 C CA  . VAL A 1 141 ? 10.584  12.425  33.321  1.00 38.90  ? 141  VAL A CA  1 
ATOM   1124 C C   . VAL A 1 141 ? 10.516  10.925  33.033  1.00 40.59  ? 141  VAL A C   1 
ATOM   1125 O O   . VAL A 1 141 ? 9.519   10.294  33.330  1.00 41.30  ? 141  VAL A O   1 
ATOM   1126 C CB  . VAL A 1 141 ? 10.242  13.213  32.052  1.00 38.94  ? 141  VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 141 ? 8.922   12.743  31.446  1.00 37.61  ? 141  VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 141 ? 10.209  14.714  32.357  1.00 35.52  ? 141  VAL A CG2 1 
ATOM   1129 N N   . GLU A 1 142 ? 11.583  10.348  32.474  1.00 37.91  ? 142  GLU A N   1 
ATOM   1130 C CA  . GLU A 1 142 ? 11.574  8.918   32.114  1.00 32.69  ? 142  GLU A CA  1 
ATOM   1131 C C   . GLU A 1 142 ? 12.246  8.015   33.131  1.00 34.37  ? 142  GLU A C   1 
ATOM   1132 O O   . GLU A 1 142 ? 12.249  6.780   32.987  1.00 40.77  ? 142  GLU A O   1 
ATOM   1133 C CB  . GLU A 1 142 ? 12.188  8.685   30.737  1.00 28.15  ? 142  GLU A CB  1 
ATOM   1134 C CG  . GLU A 1 142 ? 11.375  9.264   29.604  1.00 35.85  ? 142  GLU A CG  1 
ATOM   1135 C CD  . GLU A 1 142 ? 9.966   8.681   29.587  1.00 47.48  ? 142  GLU A CD  1 
ATOM   1136 O OE1 . GLU A 1 142 ? 9.793   7.511   29.984  1.00 50.60  ? 142  GLU A OE1 1 
ATOM   1137 O OE2 . GLU A 1 142 ? 9.031   9.400   29.207  1.00 51.92  ? 142  GLU A OE2 1 
ATOM   1138 N N   . GLY A 1 143 ? 12.798  8.612   34.177  1.00 36.90  ? 143  GLY A N   1 
ATOM   1139 C CA  . GLY A 1 143 ? 13.514  7.834   35.181  1.00 37.20  ? 143  GLY A CA  1 
ATOM   1140 C C   . GLY A 1 143 ? 14.812  7.215   34.683  1.00 41.45  ? 143  GLY A C   1 
ATOM   1141 O O   . GLY A 1 143 ? 15.328  6.291   35.309  1.00 46.27  ? 143  GLY A O   1 
ATOM   1142 N N   . ALA A 1 144 ? 15.351  7.705   33.567  1.00 40.95  ? 144  ALA A N   1 
ATOM   1143 C CA  . ALA A 1 144 ? 16.588  7.125   32.981  1.00 40.34  ? 144  ALA A CA  1 
ATOM   1144 C C   . ALA A 1 144 ? 17.863  7.404   33.785  1.00 39.59  ? 144  ALA A C   1 
ATOM   1145 O O   . ALA A 1 144 ? 17.983  8.430   34.442  1.00 36.77  ? 144  ALA A O   1 
ATOM   1146 C CB  . ALA A 1 144 ? 16.798  7.656   31.579  1.00 37.77  ? 144  ALA A CB  1 
ATOM   1147 N N   . VAL A 1 145 ? 18.836  6.506   33.725  1.00 37.85  ? 145  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 145 ? 20.174  6.917   34.126  1.00 34.10  ? 145  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 145 ? 20.874  7.359   32.844  1.00 36.85  ? 145  VAL A C   1 
ATOM   1150 O O   . VAL A 1 145 ? 20.944  6.599   31.881  1.00 38.27  ? 145  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 145 ? 20.949  5.773   34.824  1.00 33.25  ? 145  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 145 ? 22.465  6.180   35.051  1.00 25.01  ? 145  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 145 ? 20.269  5.449   36.160  1.00 27.16  ? 145  VAL A CG2 1 
ATOM   1154 N N   . LEU A 1 146 ? 21.371  8.590   32.801  1.00 36.34  ? 146  LEU A N   1 
ATOM   1155 C CA  . LEU A 1 146 ? 21.991  9.042   31.571  1.00 30.16  ? 146  LEU A CA  1 
ATOM   1156 C C   . LEU A 1 146 ? 23.494  9.310   31.738  1.00 34.33  ? 146  LEU A C   1 
ATOM   1157 O O   . LEU A 1 146 ? 23.933  9.993   32.675  1.00 30.15  ? 146  LEU A O   1 
ATOM   1158 C CB  . LEU A 1 146 ? 21.234  10.251  30.990  1.00 27.97  ? 146  LEU A CB  1 
ATOM   1159 C CG  . LEU A 1 146 ? 21.421  10.430  29.482  1.00 39.43  ? 146  LEU A CG  1 
ATOM   1160 C CD1 . LEU A 1 146 ? 20.129  10.708  28.811  1.00 45.81  ? 146  LEU A CD1 1 
ATOM   1161 C CD2 . LEU A 1 146 ? 22.428  11.542  29.177  1.00 43.69  ? 146  LEU A CD2 1 
ATOM   1162 N N   . VAL A 1 147 ? 24.282  8.786   30.810  1.00 32.61  ? 147  VAL A N   1 
ATOM   1163 C CA  . VAL A 1 147 ? 25.710  9.032   30.875  1.00 34.03  ? 147  VAL A CA  1 
ATOM   1164 C C   . VAL A 1 147 ? 26.226  9.697   29.596  1.00 31.74  ? 147  VAL A C   1 
ATOM   1165 O O   . VAL A 1 147 ? 25.817  9.322   28.507  1.00 28.28  ? 147  VAL A O   1 
ATOM   1166 C CB  . VAL A 1 147 ? 26.469  7.709   31.107  1.00 39.12  ? 147  VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 147 ? 28.012  7.981   31.217  1.00 25.35  ? 147  VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 147 ? 25.898  6.972   32.362  1.00 23.22  ? 147  VAL A CG2 1 
ATOM   1169 N N   . SER A 1 148 ? 27.122  10.672  29.721  1.00 22.17  ? 148  SER A N   1 
ATOM   1170 C CA  . SER A 1 148 ? 27.801  11.187  28.533  1.00 26.60  ? 148  SER A CA  1 
ATOM   1171 C C   . SER A 1 148 ? 29.306  11.382  28.835  1.00 28.39  ? 148  SER A C   1 
ATOM   1172 O O   . SER A 1 148 ? 29.675  11.734  29.968  1.00 30.12  ? 148  SER A O   1 
ATOM   1173 C CB  . SER A 1 148 ? 27.154  12.512  28.124  1.00 28.85  ? 148  SER A CB  1 
ATOM   1174 O OG  . SER A 1 148 ? 27.334  13.443  29.170  1.00 29.74  ? 148  SER A OG  1 
ATOM   1175 N N   . MET A 1 149 ? 30.190  11.104  27.873  1.00 26.01  ? 149  MET A N   1 
ATOM   1176 C CA  . MET A 1 149 ? 31.643  11.265  28.150  1.00 22.85  ? 149  MET A CA  1 
ATOM   1177 C C   . MET A 1 149 ? 32.281  12.197  27.159  1.00 24.33  ? 149  MET A C   1 
ATOM   1178 O O   . MET A 1 149 ? 31.834  12.250  25.999  1.00 28.11  ? 149  MET A O   1 
ATOM   1179 C CB  . MET A 1 149 ? 32.383  9.926   28.032  1.00 23.00  ? 149  MET A CB  1 
ATOM   1180 C CG  . MET A 1 149 ? 32.723  9.629   26.527  1.00 23.19  ? 149  MET A CG  1 
ATOM   1181 S SD  . MET A 1 149 ? 31.302  9.127   25.479  1.00 30.86  ? 149  MET A SD  1 
ATOM   1182 C CE  . MET A 1 149 ? 30.990  7.472   26.034  1.00 26.05  ? 149  MET A CE  1 
ATOM   1183 N N   . ASN A 1 150 ? 33.320  12.934  27.589  1.00 25.57  ? 150  ASN A N   1 
ATOM   1184 C CA  . ASN A 1 150 ? 34.166  13.640  26.622  1.00 26.54  ? 150  ASN A CA  1 
ATOM   1185 C C   . ASN A 1 150 ? 35.083  12.585  26.008  1.00 29.71  ? 150  ASN A C   1 
ATOM   1186 O O   . ASN A 1 150 ? 35.369  11.593  26.665  1.00 26.08  ? 150  ASN A O   1 
ATOM   1187 C CB  . ASN A 1 150 ? 35.027  14.744  27.260  1.00 26.03  ? 150  ASN A CB  1 
ATOM   1188 C CG  . ASN A 1 150 ? 34.231  15.977  27.653  1.00 37.59  ? 150  ASN A CG  1 
ATOM   1189 O OD1 . ASN A 1 150 ? 33.036  16.140  27.306  1.00 25.54  ? 150  ASN A OD1 1 
ATOM   1190 N ND2 . ASN A 1 150 ? 34.903  16.877  28.373  1.00 38.42  ? 150  ASN A ND2 1 
ATOM   1191 N N   . TYR A 1 151 ? 35.509  12.794  24.762  1.00 29.07  ? 151  TYR A N   1 
ATOM   1192 C CA  . TYR A 1 151 ? 36.544  11.972  24.124  1.00 25.72  ? 151  TYR A CA  1 
ATOM   1193 C C   . TYR A 1 151 ? 37.402  12.881  23.277  1.00 28.75  ? 151  TYR A C   1 
ATOM   1194 O O   . TYR A 1 151 ? 36.913  13.923  22.767  1.00 22.80  ? 151  TYR A O   1 
ATOM   1195 C CB  . TYR A 1 151 ? 35.961  10.842  23.239  1.00 29.11  ? 151  TYR A CB  1 
ATOM   1196 C CG  . TYR A 1 151 ? 35.013  11.304  22.111  1.00 28.91  ? 151  TYR A CG  1 
ATOM   1197 C CD1 . TYR A 1 151 ? 33.647  11.511  22.349  1.00 28.43  ? 151  TYR A CD1 1 
ATOM   1198 C CD2 . TYR A 1 151 ? 35.487  11.518  20.822  1.00 23.47  ? 151  TYR A CD2 1 
ATOM   1199 C CE1 . TYR A 1 151 ? 32.777  11.946  21.315  1.00 24.64  ? 151  TYR A CE1 1 
ATOM   1200 C CE2 . TYR A 1 151 ? 34.637  11.925  19.780  1.00 20.81  ? 151  TYR A CE2 1 
ATOM   1201 C CZ  . TYR A 1 151 ? 33.299  12.148  20.031  1.00 25.56  ? 151  TYR A CZ  1 
ATOM   1202 O OH  . TYR A 1 151 ? 32.512  12.560  18.982  1.00 23.97  ? 151  TYR A OH  1 
ATOM   1203 N N   . ARG A 1 152 ? 38.683  12.516  23.116  1.00 27.42  ? 152  ARG A N   1 
ATOM   1204 C CA  . ARG A 1 152 ? 39.593  13.375  22.328  1.00 27.20  ? 152  ARG A CA  1 
ATOM   1205 C C   . ARG A 1 152 ? 39.158  13.522  20.857  1.00 29.03  ? 152  ARG A C   1 
ATOM   1206 O O   . ARG A 1 152 ? 38.828  12.538  20.184  1.00 29.00  ? 152  ARG A O   1 
ATOM   1207 C CB  . ARG A 1 152 ? 41.057  12.897  22.430  1.00 23.81  ? 152  ARG A CB  1 
ATOM   1208 C CG  . ARG A 1 152 ? 41.686  13.157  23.824  1.00 17.53  ? 152  ARG A CG  1 
ATOM   1209 C CD  . ARG A 1 152 ? 43.024  12.402  23.915  1.00 26.52  ? 152  ARG A CD  1 
ATOM   1210 N NE  . ARG A 1 152 ? 42.720  10.987  24.133  1.00 27.09  ? 152  ARG A NE  1 
ATOM   1211 C CZ  . ARG A 1 152 ? 43.639  10.032  24.170  1.00 29.43  ? 152  ARG A CZ  1 
ATOM   1212 N NH1 . ARG A 1 152 ? 44.918  10.354  23.972  1.00 22.27  ? 152  ARG A NH1 1 
ATOM   1213 N NH2 . ARG A 1 152 ? 43.280  8.753   24.406  1.00 25.20  ? 152  ARG A NH2 1 
ATOM   1214 N N   . VAL A 1 153 ? 39.149  14.759  20.364  1.00 23.89  ? 153  VAL A N   1 
ATOM   1215 C CA  . VAL A 1 153 ? 38.811  14.991  18.978  1.00 26.85  ? 153  VAL A CA  1 
ATOM   1216 C C   . VAL A 1 153 ? 39.997  15.562  18.208  1.00 30.74  ? 153  VAL A C   1 
ATOM   1217 O O   . VAL A 1 153 ? 41.056  15.835  18.801  1.00 30.21  ? 153  VAL A O   1 
ATOM   1218 C CB  . VAL A 1 153 ? 37.634  15.958  18.859  1.00 28.58  ? 153  VAL A CB  1 
ATOM   1219 C CG1 . VAL A 1 153 ? 36.380  15.310  19.347  1.00 28.99  ? 153  VAL A CG1 1 
ATOM   1220 C CG2 . VAL A 1 153 ? 37.908  17.277  19.646  1.00 22.05  ? 153  VAL A CG2 1 
ATOM   1221 N N   . GLY A 1 154 ? 39.819  15.748  16.895  1.00 28.05  ? 154  GLY A N   1 
ATOM   1222 C CA  . GLY A 1 154 ? 40.875  16.309  16.062  1.00 25.79  ? 154  GLY A CA  1 
ATOM   1223 C C   . GLY A 1 154 ? 42.148  15.468  16.064  1.00 23.31  ? 154  GLY A C   1 
ATOM   1224 O O   . GLY A 1 154 ? 42.098  14.239  16.220  1.00 31.73  ? 154  GLY A O   1 
ATOM   1225 N N   . THR A 1 155 ? 43.294  16.122  15.944  1.00 23.08  ? 155  THR A N   1 
ATOM   1226 C CA  . THR A 1 155 ? 44.565  15.411  15.967  1.00 26.53  ? 155  THR A CA  1 
ATOM   1227 C C   . THR A 1 155 ? 44.695  14.637  17.280  1.00 29.58  ? 155  THR A C   1 
ATOM   1228 O O   . THR A 1 155 ? 45.061  13.465  17.285  1.00 33.63  ? 155  THR A O   1 
ATOM   1229 C CB  . THR A 1 155 ? 45.797  16.341  15.763  1.00 26.70  ? 155  THR A CB  1 
ATOM   1230 O OG1 . THR A 1 155 ? 45.818  17.352  16.778  1.00 24.28  ? 155  THR A OG1 1 
ATOM   1231 C CG2 . THR A 1 155 ? 45.780  16.988  14.396  1.00 23.50  ? 155  THR A CG2 1 
ATOM   1232 N N   . PHE A 1 156 ? 44.360  15.271  18.392  1.00 26.51  ? 156  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 156 ? 44.524  14.619  19.701  1.00 28.07  ? 156  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 156 ? 43.836  13.269  19.789  1.00 32.68  ? 156  PHE A C   1 
ATOM   1235 O O   . PHE A 1 156 ? 44.330  12.363  20.480  1.00 23.97  ? 156  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 156 ? 44.019  15.554  20.808  1.00 28.53  ? 156  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 156 ? 44.548  16.940  20.662  1.00 30.53  ? 156  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 156 ? 45.804  17.262  21.143  1.00 29.06  ? 156  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 156 ? 43.827  17.897  19.963  1.00 30.33  ? 156  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 156 ? 46.327  18.524  20.950  1.00 32.41  ? 156  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 156 ? 44.332  19.177  19.787  1.00 27.80  ? 156  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 156 ? 45.590  19.481  20.286  1.00 34.00  ? 156  PHE A CZ  1 
ATOM   1243 N N   . GLY A 1 157 ? 42.688  13.148  19.107  1.00 30.22  ? 157  GLY A N   1 
ATOM   1244 C CA  . GLY A 1 157 ? 41.913  11.923  19.145  1.00 27.77  ? 157  GLY A CA  1 
ATOM   1245 C C   . GLY A 1 157 ? 42.144  10.970  17.979  1.00 31.95  ? 157  GLY A C   1 
ATOM   1246 O O   . GLY A 1 157 ? 41.853  9.784   18.109  1.00 29.18  ? 157  GLY A O   1 
ATOM   1247 N N   . PHE A 1 158 ? 42.672  11.476  16.856  1.00 26.84  ? 158  PHE A N   1 
ATOM   1248 C CA  . PHE A 1 158 ? 42.586  10.742  15.604  1.00 25.24  ? 158  PHE A CA  1 
ATOM   1249 C C   . PHE A 1 158 ? 43.780  10.793  14.683  1.00 26.98  ? 158  PHE A C   1 
ATOM   1250 O O   . PHE A 1 158 ? 43.808  10.094  13.673  1.00 30.40  ? 158  PHE A O   1 
ATOM   1251 C CB  . PHE A 1 158 ? 41.247  11.063  14.875  1.00 23.82  ? 158  PHE A CB  1 
ATOM   1252 C CG  . PHE A 1 158 ? 40.027  10.590  15.663  1.00 28.53  ? 158  PHE A CG  1 
ATOM   1253 C CD1 . PHE A 1 158 ? 39.704  9.238   15.717  1.00 23.41  ? 158  PHE A CD1 1 
ATOM   1254 C CD2 . PHE A 1 158 ? 39.277  11.480  16.415  1.00 28.68  ? 158  PHE A CD2 1 
ATOM   1255 C CE1 . PHE A 1 158 ? 38.603  8.786   16.470  1.00 26.13  ? 158  PHE A CE1 1 
ATOM   1256 C CE2 . PHE A 1 158 ? 38.165  11.054  17.181  1.00 29.62  ? 158  PHE A CE2 1 
ATOM   1257 C CZ  . PHE A 1 158 ? 37.831  9.705   17.215  1.00 28.96  ? 158  PHE A CZ  1 
ATOM   1258 N N   . LEU A 1 159 ? 44.774  11.601  15.012  1.00 33.35  ? 159  LEU A N   1 
ATOM   1259 C CA  . LEU A 1 159 ? 45.989  11.586  14.210  1.00 33.54  ? 159  LEU A CA  1 
ATOM   1260 C C   . LEU A 1 159 ? 46.585  10.210  14.364  1.00 34.64  ? 159  LEU A C   1 
ATOM   1261 O O   . LEU A 1 159 ? 46.707  9.707   15.474  1.00 38.05  ? 159  LEU A O   1 
ATOM   1262 C CB  . LEU A 1 159 ? 46.981  12.635  14.669  1.00 33.39  ? 159  LEU A CB  1 
ATOM   1263 C CG  . LEU A 1 159 ? 48.263  12.705  13.843  1.00 40.64  ? 159  LEU A CG  1 
ATOM   1264 C CD1 . LEU A 1 159 ? 48.614  14.188  13.517  1.00 33.38  ? 159  LEU A CD1 1 
ATOM   1265 C CD2 . LEU A 1 159 ? 49.440  11.947  14.556  1.00 33.07  ? 159  LEU A CD2 1 
ATOM   1266 N N   . ALA A 1 160 ? 46.957  9.609   13.247  1.00 34.84  ? 160  ALA A N   1 
ATOM   1267 C CA  . ALA A 1 160 ? 47.504  8.266   13.254  1.00 35.08  ? 160  ALA A CA  1 
ATOM   1268 C C   . ALA A 1 160 ? 48.700  8.085   12.305  1.00 36.30  ? 160  ALA A C   1 
ATOM   1269 O O   . ALA A 1 160 ? 48.720  8.582   11.180  1.00 32.23  ? 160  ALA A O   1 
ATOM   1270 C CB  . ALA A 1 160 ? 46.409  7.266   12.917  1.00 27.62  ? 160  ALA A CB  1 
ATOM   1271 N N   . LEU A 1 161 ? 49.707  7.375   12.787  1.00 35.21  ? 161  LEU A N   1 
ATOM   1272 C CA  . LEU A 1 161 ? 50.726  6.816   11.916  1.00 36.47  ? 161  LEU A CA  1 
ATOM   1273 C C   . LEU A 1 161 ? 50.504  5.316   12.033  1.00 31.62  ? 161  LEU A C   1 
ATOM   1274 O O   . LEU A 1 161 ? 51.001  4.676   12.953  1.00 34.90  ? 161  LEU A O   1 
ATOM   1275 C CB  . LEU A 1 161 ? 52.108  7.278   12.382  1.00 41.62  ? 161  LEU A CB  1 
ATOM   1276 C CG  . LEU A 1 161 ? 52.077  8.779   12.056  1.00 46.62  ? 161  LEU A CG  1 
ATOM   1277 C CD1 . LEU A 1 161 ? 52.744  9.638   13.096  1.00 52.25  ? 161  LEU A CD1 1 
ATOM   1278 C CD2 . LEU A 1 161 ? 52.651  9.040   10.668  1.00 46.33  ? 161  LEU A CD2 1 
ATOM   1279 N N   . PRO A 1 162 ? 49.638  4.780   11.171  1.00 37.19  ? 162  PRO A N   1 
ATOM   1280 C CA  . PRO A 1 162 ? 49.150  3.406   11.364  1.00 37.58  ? 162  PRO A CA  1 
ATOM   1281 C C   . PRO A 1 162 ? 50.305  2.446   11.487  1.00 41.28  ? 162  PRO A C   1 
ATOM   1282 O O   . PRO A 1 162 ? 51.234  2.471   10.676  1.00 41.65  ? 162  PRO A O   1 
ATOM   1283 C CB  . PRO A 1 162 ? 48.347  3.150   10.098  1.00 34.35  ? 162  PRO A CB  1 
ATOM   1284 C CG  . PRO A 1 162 ? 47.823  4.531   9.753   1.00 34.46  ? 162  PRO A CG  1 
ATOM   1285 C CD  . PRO A 1 162 ? 48.913  5.480   10.093  1.00 29.48  ? 162  PRO A CD  1 
ATOM   1286 N N   . GLY A 1 163 ? 50.275  1.624   12.527  1.00 48.18  ? 163  GLY A N   1 
ATOM   1287 C CA  . GLY A 1 163 ? 51.343  0.665   12.734  1.00 46.34  ? 163  GLY A CA  1 
ATOM   1288 C C   . GLY A 1 163 ? 52.367  1.097   13.766  1.00 49.54  ? 163  GLY A C   1 
ATOM   1289 O O   . GLY A 1 163 ? 53.046  0.240   14.342  1.00 50.46  ? 163  GLY A O   1 
ATOM   1290 N N   . SER A 1 164 ? 52.491  2.404   14.004  1.00 40.60  ? 164  SER A N   1 
ATOM   1291 C CA  . SER A 1 164 ? 53.376  2.900   15.061  1.00 42.29  ? 164  SER A CA  1 
ATOM   1292 C C   . SER A 1 164 ? 52.827  2.514   16.434  1.00 46.40  ? 164  SER A C   1 
ATOM   1293 O O   . SER A 1 164 ? 51.668  2.097   16.576  1.00 49.32  ? 164  SER A O   1 
ATOM   1294 C CB  . SER A 1 164 ? 53.511  4.428   14.995  1.00 47.06  ? 164  SER A CB  1 
ATOM   1295 O OG  . SER A 1 164 ? 52.274  5.077   15.334  1.00 45.92  ? 164  SER A OG  1 
ATOM   1296 N N   . ARG A 1 165 ? 53.641  2.691   17.458  1.00 48.75  ? 165  ARG A N   1 
ATOM   1297 C CA  . ARG A 1 165 ? 53.204  2.372   18.805  1.00 55.44  ? 165  ARG A CA  1 
ATOM   1298 C C   . ARG A 1 165 ? 52.686  3.647   19.467  1.00 49.29  ? 165  ARG A C   1 
ATOM   1299 O O   . ARG A 1 165 ? 51.800  3.624   20.334  1.00 45.58  ? 165  ARG A O   1 
ATOM   1300 C CB  . ARG A 1 165 ? 54.390  1.829   19.603  1.00 65.82  ? 165  ARG A CB  1 
ATOM   1301 C CG  . ARG A 1 165 ? 54.001  0.960   20.770  1.00 83.28  ? 165  ARG A CG  1 
ATOM   1302 C CD  . ARG A 1 165 ? 54.953  1.188   21.925  1.00 98.33  ? 165  ARG A CD  1 
ATOM   1303 N NE  . ARG A 1 165 ? 54.594  2.398   22.668  1.00 107.75 ? 165  ARG A NE  1 
ATOM   1304 C CZ  . ARG A 1 165 ? 55.451  3.114   23.391  1.00 107.97 ? 165  ARG A CZ  1 
ATOM   1305 N NH1 . ARG A 1 165 ? 56.727  2.747   23.459  1.00 111.61 ? 165  ARG A NH1 1 
ATOM   1306 N NH2 . ARG A 1 165 ? 55.036  4.196   24.038  1.00 97.49  ? 165  ARG A NH2 1 
ATOM   1307 N N   . GLU A 1 166 ? 53.259  4.764   19.042  1.00 40.25  ? 166  GLU A N   1 
ATOM   1308 C CA  . GLU A 1 166 ? 53.049  6.019   19.721  1.00 39.64  ? 166  GLU A CA  1 
ATOM   1309 C C   . GLU A 1 166 ? 51.812  6.804   19.234  1.00 41.34  ? 166  GLU A C   1 
ATOM   1310 O O   . GLU A 1 166 ? 51.383  7.743   19.910  1.00 43.93  ? 166  GLU A O   1 
ATOM   1311 C CB  . GLU A 1 166 ? 54.320  6.857   19.619  1.00 41.24  ? 166  GLU A CB  1 
ATOM   1312 C CG  . GLU A 1 166 ? 55.606  6.133   20.158  1.00 52.01  ? 166  GLU A CG  1 
ATOM   1313 C CD  . GLU A 1 166 ? 56.383  5.345   19.070  1.00 63.14  ? 166  GLU A CD  1 
ATOM   1314 O OE1 . GLU A 1 166 ? 55.805  4.963   18.013  1.00 55.80  ? 166  GLU A OE1 1 
ATOM   1315 O OE2 . GLU A 1 166 ? 57.598  5.117   19.274  1.00 66.28  ? 166  GLU A OE2 1 
ATOM   1316 N N   . ALA A 1 167 ? 51.245  6.409   18.087  1.00 38.80  ? 167  ALA A N   1 
ATOM   1317 C CA  . ALA A 1 167 ? 50.116  7.115   17.463  1.00 36.75  ? 167  ALA A CA  1 
ATOM   1318 C C   . ALA A 1 167 ? 49.376  6.166   16.554  1.00 39.81  ? 167  ALA A C   1 
ATOM   1319 O O   . ALA A 1 167 ? 49.393  6.334   15.314  1.00 36.04  ? 167  ALA A O   1 
ATOM   1320 C CB  . ALA A 1 167 ? 50.597  8.320   16.663  1.00 36.53  ? 167  ALA A CB  1 
ATOM   1321 N N   . PRO A 1 168 ? 48.716  5.163   17.163  1.00 35.16  ? 168  PRO A N   1 
ATOM   1322 C CA  . PRO A 1 168 ? 48.162  4.006   16.446  1.00 37.29  ? 168  PRO A CA  1 
ATOM   1323 C C   . PRO A 1 168 ? 46.818  4.336   15.797  1.00 42.63  ? 168  PRO A C   1 
ATOM   1324 O O   . PRO A 1 168 ? 46.288  3.508   15.022  1.00 41.46  ? 168  PRO A O   1 
ATOM   1325 C CB  . PRO A 1 168 ? 47.950  2.965   17.548  1.00 31.64  ? 168  PRO A CB  1 
ATOM   1326 C CG  . PRO A 1 168 ? 48.156  3.690   18.870  1.00 33.03  ? 168  PRO A CG  1 
ATOM   1327 C CD  . PRO A 1 168 ? 48.490  5.106   18.617  1.00 30.37  ? 168  PRO A CD  1 
ATOM   1328 N N   . GLY A 1 169 ? 46.260  5.506   16.123  1.00 33.94  ? 169  GLY A N   1 
ATOM   1329 C CA  . GLY A 1 169 ? 44.964  5.878   15.571  1.00 32.53  ? 169  GLY A CA  1 
ATOM   1330 C C   . GLY A 1 169 ? 43.786  5.501   16.460  1.00 33.57  ? 169  GLY A C   1 
ATOM   1331 O O   . GLY A 1 169 ? 43.921  4.694   17.395  1.00 32.40  ? 169  GLY A O   1 
ATOM   1332 N N   . ASN A 1 170 ? 42.632  6.122   16.204  1.00 30.14  ? 170  ASN A N   1 
ATOM   1333 C CA  . ASN A 1 170 ? 41.407  5.750   16.885  1.00 28.28  ? 170  ASN A CA  1 
ATOM   1334 C C   . ASN A 1 170 ? 41.373  5.964   18.410  1.00 30.07  ? 170  ASN A C   1 
ATOM   1335 O O   . ASN A 1 170 ? 40.465  5.463   19.084  1.00 30.90  ? 170  ASN A O   1 
ATOM   1336 C CB  . ASN A 1 170 ? 41.066  4.282   16.547  1.00 24.93  ? 170  ASN A CB  1 
ATOM   1337 C CG  . ASN A 1 170 ? 40.803  4.081   15.065  1.00 35.47  ? 170  ASN A CG  1 
ATOM   1338 O OD1 . ASN A 1 170 ? 40.193  4.942   14.419  1.00 37.03  ? 170  ASN A OD1 1 
ATOM   1339 N ND2 . ASN A 1 170 ? 41.276  2.942   14.504  1.00 37.19  ? 170  ASN A ND2 1 
ATOM   1340 N N   . VAL A 1 171 ? 42.337  6.675   18.983  1.00 29.03  ? 171  VAL A N   1 
ATOM   1341 C CA  . VAL A 1 171 ? 42.329  6.776   20.439  1.00 26.78  ? 171  VAL A CA  1 
ATOM   1342 C C   . VAL A 1 171 ? 41.106  7.541   21.000  1.00 31.03  ? 171  VAL A C   1 
ATOM   1343 O O   . VAL A 1 171 ? 40.718  7.342   22.154  1.00 32.60  ? 171  VAL A O   1 
ATOM   1344 C CB  . VAL A 1 171 ? 43.646  7.285   21.007  1.00 32.05  ? 171  VAL A CB  1 
ATOM   1345 C CG1 . VAL A 1 171 ? 44.814  6.483   20.424  1.00 31.11  ? 171  VAL A CG1 1 
ATOM   1346 C CG2 . VAL A 1 171 ? 43.812  8.802   20.752  1.00 29.77  ? 171  VAL A CG2 1 
ATOM   1347 N N   . GLY A 1 172 ? 40.471  8.381   20.188  1.00 29.59  ? 172  GLY A N   1 
ATOM   1348 C CA  . GLY A 1 172 ? 39.206  8.987   20.620  1.00 29.52  ? 172  GLY A CA  1 
ATOM   1349 C C   . GLY A 1 172 ? 38.119  7.919   20.806  1.00 29.21  ? 172  GLY A C   1 
ATOM   1350 O O   . GLY A 1 172 ? 37.260  8.007   21.691  1.00 32.64  ? 172  GLY A O   1 
ATOM   1351 N N   . LEU A 1 173 ? 38.135  6.915   19.941  1.00 24.08  ? 173  LEU A N   1 
ATOM   1352 C CA  . LEU A 1 173 ? 37.216  5.767   20.067  1.00 28.11  ? 173  LEU A CA  1 
ATOM   1353 C C   . LEU A 1 173 ? 37.521  4.901   21.298  1.00 28.63  ? 173  LEU A C   1 
ATOM   1354 O O   . LEU A 1 173 ? 36.628  4.374   21.940  1.00 28.11  ? 173  LEU A O   1 
ATOM   1355 C CB  . LEU A 1 173 ? 37.280  4.920   18.816  1.00 25.60  ? 173  LEU A CB  1 
ATOM   1356 C CG  . LEU A 1 173 ? 36.636  5.555   17.589  1.00 30.53  ? 173  LEU A CG  1 
ATOM   1357 C CD1 . LEU A 1 173 ? 36.959  4.749   16.360  1.00 31.75  ? 173  LEU A CD1 1 
ATOM   1358 C CD2 . LEU A 1 173 ? 35.130  5.610   17.787  1.00 32.18  ? 173  LEU A CD2 1 
ATOM   1359 N N   . LEU A 1 174 ? 38.793  4.825   21.660  1.00 31.64  ? 174  LEU A N   1 
ATOM   1360 C CA  . LEU A 1 174 ? 39.200  4.099   22.834  1.00 28.25  ? 174  LEU A CA  1 
ATOM   1361 C C   . LEU A 1 174 ? 38.843  4.914   24.065  1.00 30.30  ? 174  LEU A C   1 
ATOM   1362 O O   . LEU A 1 174 ? 38.597  4.328   25.106  1.00 30.46  ? 174  LEU A O   1 
ATOM   1363 C CB  . LEU A 1 174 ? 40.710  3.778   22.793  1.00 30.71  ? 174  LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 174 ? 41.188  2.844   21.668  1.00 36.85  ? 174  LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 174 ? 42.709  2.811   21.626  1.00 37.55  ? 174  LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 174 ? 40.639  1.416   21.832  1.00 37.14  ? 174  LEU A CD2 1 
ATOM   1367 N N   . ASP A 1 175 ? 38.848  6.258   23.974  1.00 28.11  ? 175  ASP A N   1 
ATOM   1368 C CA  . ASP A 1 175 ? 38.317  7.070   25.086  1.00 30.23  ? 175  ASP A CA  1 
ATOM   1369 C C   . ASP A 1 175 ? 36.861  6.679   25.337  1.00 28.76  ? 175  ASP A C   1 
ATOM   1370 O O   . ASP A 1 175 ? 36.448  6.448   26.481  1.00 29.84  ? 175  ASP A O   1 
ATOM   1371 C CB  . ASP A 1 175 ? 38.392  8.575   24.816  1.00 22.65  ? 175  ASP A CB  1 
ATOM   1372 C CG  . ASP A 1 175 ? 39.828  9.073   24.666  1.00 30.99  ? 175  ASP A CG  1 
ATOM   1373 O OD1 . ASP A 1 175 ? 40.774  8.345   25.061  1.00 30.22  ? 175  ASP A OD1 1 
ATOM   1374 O OD2 . ASP A 1 175 ? 40.011  10.192  24.150  1.00 36.97  ? 175  ASP A OD2 1 
ATOM   1375 N N   . GLN A 1 176 ? 36.089  6.587   24.260  1.00 25.84  ? 176  GLN A N   1 
ATOM   1376 C CA  . GLN A 1 176 ? 34.679  6.221   24.402  1.00 29.40  ? 176  GLN A CA  1 
ATOM   1377 C C   . GLN A 1 176 ? 34.569  4.821   25.019  1.00 28.76  ? 176  GLN A C   1 
ATOM   1378 O O   . GLN A 1 176 ? 33.773  4.592   25.920  1.00 31.53  ? 176  GLN A O   1 
ATOM   1379 C CB  . GLN A 1 176 ? 33.938  6.296   23.059  1.00 25.06  ? 176  GLN A CB  1 
ATOM   1380 C CG  . GLN A 1 176 ? 33.932  7.690   22.440  1.00 28.59  ? 176  GLN A CG  1 
ATOM   1381 C CD  . GLN A 1 176 ? 33.494  7.642   20.985  1.00 31.91  ? 176  GLN A CD  1 
ATOM   1382 O OE1 . GLN A 1 176 ? 33.026  6.606   20.517  1.00 34.32  ? 176  GLN A OE1 1 
ATOM   1383 N NE2 . GLN A 1 176 ? 33.625  8.770   20.268  1.00 28.84  ? 176  GLN A NE2 1 
ATOM   1384 N N   . ARG A 1 177 ? 35.380  3.893   24.528  1.00 30.82  ? 177  ARG A N   1 
ATOM   1385 C CA  . ARG A 1 177 ? 35.335  2.523   25.015  1.00 36.41  ? 177  ARG A CA  1 
ATOM   1386 C C   . ARG A 1 177 ? 35.645  2.450   26.526  1.00 36.44  ? 177  ARG A C   1 
ATOM   1387 O O   . ARG A 1 177 ? 34.975  1.716   27.266  1.00 34.11  ? 177  ARG A O   1 
ATOM   1388 C CB  . ARG A 1 177 ? 36.302  1.631   24.220  1.00 33.29  ? 177  ARG A CB  1 
ATOM   1389 C CG  . ARG A 1 177 ? 36.398  0.188   24.798  1.00 40.57  ? 177  ARG A CG  1 
ATOM   1390 C CD  . ARG A 1 177 ? 37.345  -0.676  23.953  1.00 33.57  ? 177  ARG A CD  1 
ATOM   1391 N NE  . ARG A 1 177 ? 36.651  -1.005  22.714  1.00 39.21  ? 177  ARG A NE  1 
ATOM   1392 C CZ  . ARG A 1 177 ? 37.252  -1.413  21.605  1.00 38.72  ? 177  ARG A CZ  1 
ATOM   1393 N NH1 . ARG A 1 177 ? 38.581  -1.534  21.571  1.00 35.48  ? 177  ARG A NH1 1 
ATOM   1394 N NH2 . ARG A 1 177 ? 36.518  -1.713  20.543  1.00 35.62  ? 177  ARG A NH2 1 
ATOM   1395 N N   . LEU A 1 178 ? 36.632  3.231   26.981  1.00 28.94  ? 178  LEU A N   1 
ATOM   1396 C CA  . LEU A 1 178 ? 36.980  3.270   28.402  1.00 25.36  ? 178  LEU A CA  1 
ATOM   1397 C C   . LEU A 1 178 ? 35.806  3.783   29.252  1.00 35.09  ? 178  LEU A C   1 
ATOM   1398 O O   . LEU A 1 178 ? 35.496  3.197   30.307  1.00 31.50  ? 178  LEU A O   1 
ATOM   1399 C CB  . LEU A 1 178 ? 38.224  4.112   28.641  1.00 25.01  ? 178  LEU A CB  1 
ATOM   1400 C CG  . LEU A 1 178 ? 38.833  4.147   30.038  1.00 35.67  ? 178  LEU A CG  1 
ATOM   1401 C CD1 . LEU A 1 178 ? 38.997  2.723   30.632  1.00 30.70  ? 178  LEU A CD1 1 
ATOM   1402 C CD2 . LEU A 1 178 ? 40.192  4.880   29.936  1.00 35.42  ? 178  LEU A CD2 1 
ATOM   1403 N N   . ALA A 1 179 ? 35.140  4.843   28.780  1.00 29.36  ? 179  ALA A N   1 
ATOM   1404 C CA  . ALA A 1 179 ? 33.912  5.299   29.441  1.00 36.75  ? 179  ALA A CA  1 
ATOM   1405 C C   . ALA A 1 179 ? 32.865  4.211   29.515  1.00 27.63  ? 179  ALA A C   1 
ATOM   1406 O O   . ALA A 1 179 ? 32.182  4.134   30.517  1.00 36.51  ? 179  ALA A O   1 
ATOM   1407 C CB  . ALA A 1 179 ? 33.300  6.603   28.791  1.00 19.52  ? 179  ALA A CB  1 
ATOM   1408 N N   . LEU A 1 180 ? 32.718  3.399   28.467  1.00 30.13  ? 180  LEU A N   1 
ATOM   1409 C CA  . LEU A 1 180 ? 31.742  2.284   28.486  1.00 34.07  ? 180  LEU A CA  1 
ATOM   1410 C C   . LEU A 1 180 ? 32.166  1.231   29.512  1.00 38.21  ? 180  LEU A C   1 
ATOM   1411 O O   . LEU A 1 180 ? 31.318  0.637   30.151  1.00 39.66  ? 180  LEU A O   1 
ATOM   1412 C CB  . LEU A 1 180 ? 31.507  1.610   27.100  1.00 17.52  ? 180  LEU A CB  1 
ATOM   1413 C CG  . LEU A 1 180 ? 31.171  2.443   25.848  1.00 29.65  ? 180  LEU A CG  1 
ATOM   1414 C CD1 . LEU A 1 180 ? 30.698  1.582   24.672  1.00 28.98  ? 180  LEU A CD1 1 
ATOM   1415 C CD2 . LEU A 1 180 ? 30.164  3.589   26.126  1.00 27.61  ? 180  LEU A CD2 1 
ATOM   1416 N N   . GLN A 1 181 ? 33.471  0.988   29.657  1.00 34.65  ? 181  GLN A N   1 
ATOM   1417 C CA  . GLN A 1 181 ? 33.944  0.020   30.661  1.00 36.83  ? 181  GLN A CA  1 
ATOM   1418 C C   . GLN A 1 181 ? 33.681  0.573   32.053  1.00 39.40  ? 181  GLN A C   1 
ATOM   1419 O O   . GLN A 1 181 ? 33.279  -0.159  32.949  1.00 34.65  ? 181  GLN A O   1 
ATOM   1420 C CB  . GLN A 1 181 ? 35.424  -0.303  30.457  1.00 31.26  ? 181  GLN A CB  1 
ATOM   1421 C CG  . GLN A 1 181 ? 35.627  -0.981  29.109  1.00 44.07  ? 181  GLN A CG  1 
ATOM   1422 C CD  . GLN A 1 181 ? 37.082  -1.211  28.729  1.00 46.69  ? 181  GLN A CD  1 
ATOM   1423 O OE1 . GLN A 1 181 ? 37.965  -0.432  29.081  1.00 48.43  ? 181  GLN A OE1 1 
ATOM   1424 N NE2 . GLN A 1 181 ? 37.326  -2.271  27.973  1.00 42.79  ? 181  GLN A NE2 1 
ATOM   1425 N N   . TRP A 1 182 ? 33.876  1.887   32.214  1.00 31.63  ? 182  TRP A N   1 
ATOM   1426 C CA  . TRP A 1 182 ? 33.531  2.545   33.443  1.00 30.52  ? 182  TRP A CA  1 
ATOM   1427 C C   . TRP A 1 182 ? 32.038  2.356   33.775  1.00 35.84  ? 182  TRP A C   1 
ATOM   1428 O O   . TRP A 1 182 ? 31.675  2.185   34.936  1.00 36.44  ? 182  TRP A O   1 
ATOM   1429 C CB  . TRP A 1 182 ? 33.852  4.032   33.352  1.00 34.29  ? 182  TRP A CB  1 
ATOM   1430 C CG  . TRP A 1 182 ? 33.716  4.754   34.661  1.00 37.44  ? 182  TRP A CG  1 
ATOM   1431 C CD1 . TRP A 1 182 ? 34.727  5.029   35.554  1.00 29.41  ? 182  TRP A CD1 1 
ATOM   1432 C CD2 . TRP A 1 182 ? 32.513  5.322   35.225  1.00 30.79  ? 182  TRP A CD2 1 
ATOM   1433 N NE1 . TRP A 1 182 ? 34.220  5.732   36.630  1.00 37.50  ? 182  TRP A NE1 1 
ATOM   1434 C CE2 . TRP A 1 182 ? 32.877  5.935   36.452  1.00 37.37  ? 182  TRP A CE2 1 
ATOM   1435 C CE3 . TRP A 1 182 ? 31.191  5.395   34.807  1.00 26.39  ? 182  TRP A CE3 1 
ATOM   1436 C CZ2 . TRP A 1 182 ? 31.942  6.587   37.277  1.00 36.57  ? 182  TRP A CZ2 1 
ATOM   1437 C CZ3 . TRP A 1 182 ? 30.267  6.055   35.612  1.00 24.25  ? 182  TRP A CZ3 1 
ATOM   1438 C CH2 . TRP A 1 182 ? 30.638  6.622   36.843  1.00 30.80  ? 182  TRP A CH2 1 
ATOM   1439 N N   . VAL A 1 183 ? 31.165  2.383   32.771  1.00 30.83  ? 183  VAL A N   1 
ATOM   1440 C CA  . VAL A 1 183 ? 29.770  2.279   33.104  1.00 31.51  ? 183  VAL A CA  1 
ATOM   1441 C C   . VAL A 1 183 ? 29.511  0.864   33.616  1.00 34.59  ? 183  VAL A C   1 
ATOM   1442 O O   . VAL A 1 183 ? 28.810  0.664   34.610  1.00 39.64  ? 183  VAL A O   1 
ATOM   1443 C CB  . VAL A 1 183 ? 28.855  2.701   31.931  1.00 36.66  ? 183  VAL A CB  1 
ATOM   1444 C CG1 . VAL A 1 183 ? 27.442  2.246   32.144  1.00 26.31  ? 183  VAL A CG1 1 
ATOM   1445 C CG2 . VAL A 1 183 ? 28.883  4.245   31.762  1.00 39.35  ? 183  VAL A CG2 1 
ATOM   1446 N N   . GLN A 1 184 ? 30.140  -0.117  32.986  1.00 35.45  ? 184  GLN A N   1 
ATOM   1447 C CA  . GLN A 1 184 ? 29.925  -1.502  33.377  1.00 36.50  ? 184  GLN A CA  1 
ATOM   1448 C C   . GLN A 1 184 ? 30.329  -1.706  34.823  1.00 37.80  ? 184  GLN A C   1 
ATOM   1449 O O   . GLN A 1 184 ? 29.637  -2.392  35.578  1.00 33.67  ? 184  GLN A O   1 
ATOM   1450 C CB  . GLN A 1 184 ? 30.725  -2.447  32.487  1.00 31.23  ? 184  GLN A CB  1 
ATOM   1451 C CG  . GLN A 1 184 ? 30.137  -2.539  31.141  1.00 31.70  ? 184  GLN A CG  1 
ATOM   1452 C CD  . GLN A 1 184 ? 28.774  -3.163  31.193  1.00 38.93  ? 184  GLN A CD  1 
ATOM   1453 O OE1 . GLN A 1 184 ? 28.616  -4.332  31.618  1.00 41.43  ? 184  GLN A OE1 1 
ATOM   1454 N NE2 . GLN A 1 184 ? 27.773  -2.411  30.758  1.00 35.69  ? 184  GLN A NE2 1 
ATOM   1455 N N   . GLU A 1 185 ? 31.458  -1.122  35.203  1.00 31.17  ? 185  GLU A N   1 
ATOM   1456 C CA  . GLU A 1 185 ? 31.958  -1.338  36.536  1.00 33.70  ? 185  GLU A CA  1 
ATOM   1457 C C   . GLU A 1 185 ? 31.200  -0.557  37.610  1.00 40.43  ? 185  GLU A C   1 
ATOM   1458 O O   . GLU A 1 185 ? 31.015  -1.093  38.707  1.00 37.36  ? 185  GLU A O   1 
ATOM   1459 C CB  . GLU A 1 185 ? 33.458  -1.057  36.668  1.00 34.62  ? 185  GLU A CB  1 
ATOM   1460 C CG  . GLU A 1 185 ? 33.911  -1.334  38.087  1.00 42.56  ? 185  GLU A CG  1 
ATOM   1461 C CD  . GLU A 1 185 ? 35.396  -1.592  38.267  1.00 54.67  ? 185  GLU A CD  1 
ATOM   1462 O OE1 . GLU A 1 185 ? 35.761  -2.192  39.322  1.00 54.73  ? 185  GLU A OE1 1 
ATOM   1463 O OE2 . GLU A 1 185 ? 36.191  -1.196  37.378  1.00 57.47  ? 185  GLU A OE2 1 
ATOM   1464 N N   . ASN A 1 186 ? 30.747  0.671   37.296  1.00 32.24  ? 186  ASN A N   1 
ATOM   1465 C CA  . ASN A 1 186 ? 30.374  1.624   38.337  1.00 27.32  ? 186  ASN A CA  1 
ATOM   1466 C C   . ASN A 1 186 ? 28.918  2.076   38.359  1.00 33.34  ? 186  ASN A C   1 
ATOM   1467 O O   . ASN A 1 186 ? 28.470  2.591   39.361  1.00 36.55  ? 186  ASN A O   1 
ATOM   1468 C CB  . ASN A 1 186 ? 31.247  2.878   38.233  1.00 27.22  ? 186  ASN A CB  1 
ATOM   1469 C CG  . ASN A 1 186 ? 32.710  2.594   38.482  1.00 34.29  ? 186  ASN A CG  1 
ATOM   1470 O OD1 . ASN A 1 186 ? 33.112  2.274   39.603  1.00 38.71  ? 186  ASN A OD1 1 
ATOM   1471 N ND2 . ASN A 1 186 ? 33.526  2.712   37.433  1.00 37.54  ? 186  ASN A ND2 1 
ATOM   1472 N N   . ILE A 1 187 ? 28.190  1.908   37.259  1.00 31.74  ? 187  ILE A N   1 
ATOM   1473 C CA  . ILE A 1 187 ? 26.862  2.495   37.139  1.00 33.38  ? 187  ILE A CA  1 
ATOM   1474 C C   . ILE A 1 187 ? 25.848  1.881   38.133  1.00 38.07  ? 187  ILE A C   1 
ATOM   1475 O O   . ILE A 1 187 ? 24.893  2.550   38.542  1.00 33.11  ? 187  ILE A O   1 
ATOM   1476 C CB  . ILE A 1 187 ? 26.332  2.429   35.668  1.00 29.46  ? 187  ILE A CB  1 
ATOM   1477 C CG1 . ILE A 1 187 ? 25.353  3.588   35.385  1.00 33.13  ? 187  ILE A CG1 1 
ATOM   1478 C CG2 . ILE A 1 187 ? 25.719  1.082   35.362  1.00 29.31  ? 187  ILE A CG2 1 
ATOM   1479 C CD1 . ILE A 1 187 ? 26.039  4.964   35.538  1.00 29.79  ? 187  ILE A CD1 1 
ATOM   1480 N N   . ALA A 1 188 ? 26.041  0.618   38.526  1.00 31.28  ? 188  ALA A N   1 
ATOM   1481 C CA  . ALA A 1 188 ? 25.174  0.046   39.561  1.00 27.53  ? 188  ALA A CA  1 
ATOM   1482 C C   . ALA A 1 188 ? 25.215  0.906   40.828  1.00 36.40  ? 188  ALA A C   1 
ATOM   1483 O O   . ALA A 1 188 ? 24.261  0.913   41.615  1.00 36.88  ? 188  ALA A O   1 
ATOM   1484 C CB  . ALA A 1 188 ? 25.542  -1.419  39.874  1.00 30.05  ? 188  ALA A CB  1 
ATOM   1485 N N   . ALA A 1 189 ? 26.301  1.650   41.034  1.00 35.01  ? 189  ALA A N   1 
ATOM   1486 C CA  . ALA A 1 189 ? 26.396  2.479   42.241  1.00 32.04  ? 189  ALA A CA  1 
ATOM   1487 C C   . ALA A 1 189 ? 25.395  3.609   42.207  1.00 34.76  ? 189  ALA A C   1 
ATOM   1488 O O   . ALA A 1 189 ? 25.108  4.195   43.237  1.00 43.07  ? 189  ALA A O   1 
ATOM   1489 C CB  . ALA A 1 189 ? 27.791  3.053   42.430  1.00 30.42  ? 189  ALA A CB  1 
ATOM   1490 N N   . PHE A 1 190 ? 24.904  3.960   41.025  1.00 33.91  ? 190  PHE A N   1 
ATOM   1491 C CA  . PHE A 1 190 ? 24.020  5.118   40.893  1.00 34.68  ? 190  PHE A CA  1 
ATOM   1492 C C   . PHE A 1 190 ? 22.597  4.638   40.655  1.00 33.77  ? 190  PHE A C   1 
ATOM   1493 O O   . PHE A 1 190 ? 21.722  5.442   40.428  1.00 41.03  ? 190  PHE A O   1 
ATOM   1494 C CB  . PHE A 1 190 ? 24.424  6.034   39.715  1.00 33.59  ? 190  PHE A CB  1 
ATOM   1495 C CG  . PHE A 1 190 ? 25.806  6.596   39.810  1.00 31.39  ? 190  PHE A CG  1 
ATOM   1496 C CD1 . PHE A 1 190 ? 26.906  5.834   39.463  1.00 34.26  ? 190  PHE A CD1 1 
ATOM   1497 C CD2 . PHE A 1 190 ? 26.014  7.900   40.232  1.00 33.24  ? 190  PHE A CD2 1 
ATOM   1498 C CE1 . PHE A 1 190 ? 28.197  6.382   39.538  1.00 27.16  ? 190  PHE A CE1 1 
ATOM   1499 C CE2 . PHE A 1 190 ? 27.279  8.441   40.317  1.00 26.12  ? 190  PHE A CE2 1 
ATOM   1500 C CZ  . PHE A 1 190 ? 28.372  7.689   39.968  1.00 26.05  ? 190  PHE A CZ  1 
ATOM   1501 N N   . GLY A 1 191 ? 22.373  3.328   40.683  1.00 33.79  ? 191  GLY A N   1 
ATOM   1502 C CA  . GLY A 1 191 ? 21.059  2.767   40.405  1.00 27.00  ? 191  GLY A CA  1 
ATOM   1503 C C   . GLY A 1 191 ? 20.900  2.331   38.961  1.00 36.11  ? 191  GLY A C   1 
ATOM   1504 O O   . GLY A 1 191 ? 19.816  1.883   38.561  1.00 36.88  ? 191  GLY A O   1 
ATOM   1505 N N   . GLY A 1 192 ? 21.971  2.455   38.164  1.00 31.99  ? 192  GLY A N   1 
ATOM   1506 C CA  . GLY A 1 192 ? 21.923  2.008   36.782  1.00 35.16  ? 192  GLY A CA  1 
ATOM   1507 C C   . GLY A 1 192 ? 22.145  0.504   36.598  1.00 38.83  ? 192  GLY A C   1 
ATOM   1508 O O   . GLY A 1 192 ? 22.833  -0.123  37.388  1.00 41.18  ? 192  GLY A O   1 
ATOM   1509 N N   . ASP A 1 193 ? 21.581  -0.059  35.533  1.00 36.52  ? 193  ASP A N   1 
ATOM   1510 C CA  . ASP A 1 193 ? 21.658  -1.489  35.220  1.00 33.18  ? 193  ASP A CA  1 
ATOM   1511 C C   . ASP A 1 193 ? 22.714  -1.760  34.148  1.00 34.20  ? 193  ASP A C   1 
ATOM   1512 O O   . ASP A 1 193 ? 22.469  -1.541  32.971  1.00 32.34  ? 193  ASP A O   1 
ATOM   1513 C CB  . ASP A 1 193 ? 20.291  -1.921  34.680  1.00 39.73  ? 193  ASP A CB  1 
ATOM   1514 C CG  . ASP A 1 193 ? 20.172  -3.423  34.456  1.00 44.68  ? 193  ASP A CG  1 
ATOM   1515 O OD1 . ASP A 1 193 ? 21.192  -4.148  34.545  1.00 42.97  ? 193  ASP A OD1 1 
ATOM   1516 O OD2 . ASP A 1 193 ? 19.026  -3.872  34.200  1.00 47.46  ? 193  ASP A OD2 1 
ATOM   1517 N N   . PRO A 1 194 ? 23.902  -2.241  34.548  1.00 36.73  ? 194  PRO A N   1 
ATOM   1518 C CA  . PRO A 1 194 ? 24.948  -2.424  33.534  1.00 36.45  ? 194  PRO A CA  1 
ATOM   1519 C C   . PRO A 1 194 ? 24.539  -3.477  32.484  1.00 43.79  ? 194  PRO A C   1 
ATOM   1520 O O   . PRO A 1 194 ? 25.220  -3.607  31.447  1.00 35.83  ? 194  PRO A O   1 
ATOM   1521 C CB  . PRO A 1 194 ? 26.136  -2.933  34.353  1.00 36.85  ? 194  PRO A CB  1 
ATOM   1522 C CG  . PRO A 1 194 ? 25.478  -3.640  35.553  1.00 32.92  ? 194  PRO A CG  1 
ATOM   1523 C CD  . PRO A 1 194 ? 24.340  -2.690  35.888  1.00 34.45  ? 194  PRO A CD  1 
ATOM   1524 N N   . MET A 1 195 ? 23.475  -4.240  32.770  1.00 39.41  ? 195  MET A N   1 
ATOM   1525 C CA  . MET A 1 195 ? 23.003  -5.258  31.821  1.00 42.15  ? 195  MET A CA  1 
ATOM   1526 C C   . MET A 1 195 ? 21.949  -4.707  30.847  1.00 42.92  ? 195  MET A C   1 
ATOM   1527 O O   . MET A 1 195 ? 21.484  -5.418  29.959  1.00 44.50  ? 195  MET A O   1 
ATOM   1528 C CB  . MET A 1 195 ? 22.529  -6.551  32.539  1.00 42.00  ? 195  MET A CB  1 
ATOM   1529 C CG  . MET A 1 195 ? 23.670  -7.293  33.295  1.00 39.34  ? 195  MET A CG  1 
ATOM   1530 S SD  . MET A 1 195 ? 23.260  -8.978  33.795  1.00 64.99  ? 195  MET A SD  1 
ATOM   1531 C CE  . MET A 1 195 ? 21.547  -8.715  34.245  1.00 49.80  ? 195  MET A CE  1 
ATOM   1532 N N   . SER A 1 196 ? 21.603  -3.428  30.998  1.00 36.86  ? 196  SER A N   1 
ATOM   1533 C CA  . SER A 1 196 ? 20.798  -2.745  29.994  1.00 33.42  ? 196  SER A CA  1 
ATOM   1534 C C   . SER A 1 196 ? 21.384  -1.371  29.620  1.00 35.12  ? 196  SER A C   1 
ATOM   1535 O O   . SER A 1 196 ? 21.039  -0.346  30.203  1.00 37.83  ? 196  SER A O   1 
ATOM   1536 C CB  . SER A 1 196 ? 19.324  -2.647  30.437  1.00 33.96  ? 196  SER A CB  1 
ATOM   1537 O OG  . SER A 1 196 ? 18.543  -1.949  29.465  1.00 36.37  ? 196  SER A OG  1 
ATOM   1538 N N   . VAL A 1 197 ? 22.284  -1.367  28.644  1.00 38.79  ? 197  VAL A N   1 
ATOM   1539 C CA  . VAL A 1 197 ? 22.983  -0.161  28.242  1.00 36.22  ? 197  VAL A CA  1 
ATOM   1540 C C   . VAL A 1 197 ? 22.735  0.084   26.764  1.00 37.74  ? 197  VAL A C   1 
ATOM   1541 O O   . VAL A 1 197 ? 23.053  -0.763  25.926  1.00 34.88  ? 197  VAL A O   1 
ATOM   1542 C CB  . VAL A 1 197 ? 24.513  -0.268  28.471  1.00 44.47  ? 197  VAL A CB  1 
ATOM   1543 C CG1 . VAL A 1 197 ? 25.258  0.948   27.815  1.00 38.79  ? 197  VAL A CG1 1 
ATOM   1544 C CG2 . VAL A 1 197 ? 24.839  -0.387  29.982  1.00 32.52  ? 197  VAL A CG2 1 
ATOM   1545 N N   . THR A 1 198 ? 22.148  1.238   26.450  1.00 33.04  ? 198  THR A N   1 
ATOM   1546 C CA  . THR A 1 198 ? 21.852  1.607   25.070  1.00 30.82  ? 198  THR A CA  1 
ATOM   1547 C C   . THR A 1 198 ? 22.766  2.786   24.721  1.00 30.53  ? 198  THR A C   1 
ATOM   1548 O O   . THR A 1 198 ? 22.745  3.801   25.421  1.00 29.76  ? 198  THR A O   1 
ATOM   1549 C CB  . THR A 1 198 ? 20.379  2.046   24.933  1.00 35.14  ? 198  THR A CB  1 
ATOM   1550 O OG1 . THR A 1 198 ? 19.521  0.934   25.217  1.00 42.08  ? 198  THR A OG1 1 
ATOM   1551 C CG2 . THR A 1 198 ? 20.079  2.574   23.533  1.00 31.40  ? 198  THR A CG2 1 
ATOM   1552 N N   . LEU A 1 199 ? 23.562  2.656   23.662  1.00 29.73  ? 199  LEU A N   1 
ATOM   1553 C CA  . LEU A 1 199 ? 24.339  3.781   23.148  1.00 33.47  ? 199  LEU A CA  1 
ATOM   1554 C C   . LEU A 1 199 ? 23.465  4.685   22.249  1.00 39.09  ? 199  LEU A C   1 
ATOM   1555 O O   . LEU A 1 199 ? 22.621  4.193   21.501  1.00 34.71  ? 199  LEU A O   1 
ATOM   1556 C CB  . LEU A 1 199 ? 25.512  3.272   22.342  1.00 30.99  ? 199  LEU A CB  1 
ATOM   1557 C CG  . LEU A 1 199 ? 26.472  2.269   23.007  1.00 33.32  ? 199  LEU A CG  1 
ATOM   1558 C CD1 . LEU A 1 199 ? 27.632  2.004   22.055  1.00 27.91  ? 199  LEU A CD1 1 
ATOM   1559 C CD2 . LEU A 1 199 ? 27.000  2.807   24.353  1.00 30.57  ? 199  LEU A CD2 1 
ATOM   1560 N N   . PHE A 1 200 ? 23.649  6.001   22.322  1.00 31.83  ? 200  PHE A N   1 
ATOM   1561 C CA  . PHE A 1 200 ? 23.051  6.842   21.292  1.00 30.35  ? 200  PHE A CA  1 
ATOM   1562 C C   . PHE A 1 200 ? 23.928  8.019   20.999  1.00 28.80  ? 200  PHE A C   1 
ATOM   1563 O O   . PHE A 1 200 ? 24.629  8.481   21.882  1.00 29.43  ? 200  PHE A O   1 
ATOM   1564 C CB  . PHE A 1 200 ? 21.584  7.215   21.573  1.00 21.61  ? 200  PHE A CB  1 
ATOM   1565 C CG  . PHE A 1 200 ? 21.338  8.196   22.726  1.00 30.97  ? 200  PHE A CG  1 
ATOM   1566 C CD1 . PHE A 1 200 ? 21.895  8.010   23.983  1.00 31.44  ? 200  PHE A CD1 1 
ATOM   1567 C CD2 . PHE A 1 200 ? 20.396  9.232   22.568  1.00 25.97  ? 200  PHE A CD2 1 
ATOM   1568 C CE1 . PHE A 1 200 ? 21.590  8.894   25.048  1.00 29.15  ? 200  PHE A CE1 1 
ATOM   1569 C CE2 . PHE A 1 200 ? 20.081  10.092  23.617  1.00 25.37  ? 200  PHE A CE2 1 
ATOM   1570 C CZ  . PHE A 1 200 ? 20.701  9.937   24.867  1.00 21.55  ? 200  PHE A CZ  1 
ATOM   1571 N N   . GLY A 1 201 ? 23.930  8.472   19.749  1.00 27.39  ? 201  GLY A N   1 
ATOM   1572 C CA  . GLY A 1 201 ? 24.771  9.597   19.387  1.00 28.68  ? 201  GLY A CA  1 
ATOM   1573 C C   . GLY A 1 201 ? 24.290  10.155  18.076  1.00 31.82  ? 201  GLY A C   1 
ATOM   1574 O O   . GLY A 1 201 ? 23.506  9.541   17.359  1.00 28.86  ? 201  GLY A O   1 
ATOM   1575 N N   . GLU A 1 202 ? 24.777  11.334  17.755  1.00 26.36  ? 202  GLU A N   1 
ATOM   1576 C CA  . GLU A 1 202 ? 24.346  11.977  16.559  1.00 30.61  ? 202  GLU A CA  1 
ATOM   1577 C C   . GLU A 1 202 ? 25.528  12.375  15.697  1.00 26.74  ? 202  GLU A C   1 
ATOM   1578 O O   . GLU A 1 202 ? 26.583  12.735  16.196  1.00 31.90  ? 202  GLU A O   1 
ATOM   1579 C CB  . GLU A 1 202 ? 23.426  13.156  16.904  1.00 28.24  ? 202  GLU A CB  1 
ATOM   1580 C CG  . GLU A 1 202 ? 22.810  13.820  15.701  1.00 30.81  ? 202  GLU A CG  1 
ATOM   1581 C CD  . GLU A 1 202 ? 23.684  14.963  15.193  1.00 34.17  ? 202  GLU A CD  1 
ATOM   1582 O OE1 . GLU A 1 202 ? 24.663  15.310  15.884  1.00 30.69  ? 202  GLU A OE1 1 
ATOM   1583 O OE2 . GLU A 1 202 ? 23.341  15.550  14.152  1.00 31.70  ? 202  GLU A OE2 1 
HETATM 1584 N N   . SGB A 1 203 ? 25.331  12.280  14.388  1.00 27.26  ? 203  SGB A N   1 
HETATM 1585 C CA  . SGB A 1 203 ? 26.324  12.647  13.406  1.00 25.03  ? 203  SGB A CA  1 
HETATM 1586 C C   . SGB A 1 203 ? 27.577  11.812  13.659  1.00 30.53  ? 203  SGB A C   1 
HETATM 1587 O O   . SGB A 1 203 ? 27.511  10.583  13.664  1.00 32.38  ? 203  SGB A O   1 
HETATM 1588 C CB  . SGB A 1 203 ? 26.576  14.147  13.512  1.00 26.12  ? 203  SGB A CB  1 
HETATM 1589 O OG  . SGB A 1 203 ? 27.269  14.468  12.322  1.00 32.87  ? 203  SGB A OG  1 
HETATM 1590 O O1  . SGB A 1 203 ? 29.508  15.103  13.432  1.00 40.38  ? 203  SGB A O1  1 
HETATM 1591 P P1  . SGB A 1 203 ? 28.619  15.379  12.271  1.00 50.31  ? 203  SGB A P1  1 
HETATM 1592 C C1  . SGB A 1 203 ? 29.372  15.097  10.999  1.00 46.95  ? 203  SGB A C1  1 
HETATM 1593 O O2  . SGB A 1 203 ? 28.069  16.938  12.459  1.00 58.93  ? 203  SGB A O2  1 
HETATM 1594 C C2  . SGB A 1 203 ? 28.842  18.131  12.625  1.00 53.72  ? 203  SGB A C2  1 
HETATM 1595 C C4  . SGB A 1 203 ? 27.881  19.294  12.531  1.00 51.12  ? 203  SGB A C4  1 
HETATM 1596 C C3  . SGB A 1 203 ? 29.895  18.321  11.531  1.00 53.42  ? 203  SGB A C3  1 
ATOM   1597 N N   . ALA A 1 204 ? 28.707  12.454  13.911  1.00 18.31  ? 204  ALA A N   1 
ATOM   1598 C CA  . ALA A 1 204 ? 29.912  11.673  14.299  1.00 29.78  ? 204  ALA A CA  1 
ATOM   1599 C C   . ALA A 1 204 ? 29.757  10.812  15.564  1.00 29.97  ? 204  ALA A C   1 
ATOM   1600 O O   . ALA A 1 204 ? 30.420  9.768   15.701  1.00 30.22  ? 204  ALA A O   1 
ATOM   1601 C CB  . ALA A 1 204 ? 31.147  12.551  14.410  1.00 23.07  ? 204  ALA A CB  1 
ATOM   1602 N N   . GLY A 1 205 ? 28.909  11.245  16.495  1.00 24.50  ? 205  GLY A N   1 
ATOM   1603 C CA  . GLY A 1 205 ? 28.601  10.417  17.655  1.00 22.65  ? 205  GLY A CA  1 
ATOM   1604 C C   . GLY A 1 205 ? 27.895  9.137   17.178  1.00 30.75  ? 205  GLY A C   1 
ATOM   1605 O O   . GLY A 1 205 ? 28.225  8.025   17.641  1.00 33.84  ? 205  GLY A O   1 
ATOM   1606 N N   . ALA A 1 206 ? 26.942  9.284   16.244  1.00 22.38  ? 206  ALA A N   1 
ATOM   1607 C CA  . ALA A 1 206 ? 26.330  8.127   15.581  1.00 23.76  ? 206  ALA A CA  1 
ATOM   1608 C C   . ALA A 1 206 ? 27.373  7.234   14.843  1.00 29.99  ? 206  ALA A C   1 
ATOM   1609 O O   . ALA A 1 206 ? 27.329  6.011   14.990  1.00 31.93  ? 206  ALA A O   1 
ATOM   1610 C CB  . ALA A 1 206 ? 25.273  8.566   14.602  1.00 22.08  ? 206  ALA A CB  1 
ATOM   1611 N N   . ALA A 1 207 ? 28.242  7.813   14.005  1.00 20.78  ? 207  ALA A N   1 
ATOM   1612 C CA  . ALA A 1 207 ? 29.300  7.007   13.386  1.00 28.09  ? 207  ALA A CA  1 
ATOM   1613 C C   . ALA A 1 207 ? 30.035  6.229   14.485  1.00 34.69  ? 207  ALA A C   1 
ATOM   1614 O O   . ALA A 1 207 ? 30.363  5.035   14.320  1.00 33.54  ? 207  ALA A O   1 
ATOM   1615 C CB  . ALA A 1 207 ? 30.311  7.866   12.618  1.00 22.63  ? 207  ALA A CB  1 
ATOM   1616 N N   . SER A 1 208 ? 30.307  6.916   15.598  1.00 25.99  ? 208  SER A N   1 
ATOM   1617 C CA  . SER A 1 208 ? 31.012  6.290   16.732  1.00 30.36  ? 208  SER A CA  1 
ATOM   1618 C C   . SER A 1 208 ? 30.242  5.074   17.269  1.00 30.24  ? 208  SER A C   1 
ATOM   1619 O O   . SER A 1 208 ? 30.820  4.026   17.508  1.00 30.72  ? 208  SER A O   1 
ATOM   1620 C CB  . SER A 1 208 ? 31.275  7.296   17.866  1.00 21.33  ? 208  SER A CB  1 
ATOM   1621 O OG  . SER A 1 208 ? 32.194  8.307   17.462  1.00 26.99  ? 208  SER A OG  1 
ATOM   1622 N N   . VAL A 1 209 ? 28.942  5.233   17.455  1.00 29.12  ? 209  VAL A N   1 
ATOM   1623 C CA  . VAL A 1 209 ? 28.117  4.178   17.988  1.00 27.30  ? 209  VAL A CA  1 
ATOM   1624 C C   . VAL A 1 209 ? 28.252  3.035   17.014  1.00 32.60  ? 209  VAL A C   1 
ATOM   1625 O O   . VAL A 1 209 ? 28.436  1.878   17.420  1.00 32.68  ? 209  VAL A O   1 
ATOM   1626 C CB  . VAL A 1 209 ? 26.640  4.600   18.049  1.00 28.83  ? 209  VAL A CB  1 
ATOM   1627 C CG1 . VAL A 1 209 ? 25.737  3.380   18.172  1.00 23.77  ? 209  VAL A CG1 1 
ATOM   1628 C CG2 . VAL A 1 209 ? 26.414  5.544   19.214  1.00 25.27  ? 209  VAL A CG2 1 
ATOM   1629 N N   . GLY A 1 210 ? 28.209  3.379   15.726  1.00 28.30  ? 210  GLY A N   1 
ATOM   1630 C CA  . GLY A 1 210 ? 28.374  2.418   14.654  1.00 26.95  ? 210  GLY A CA  1 
ATOM   1631 C C   . GLY A 1 210 ? 29.655  1.633   14.759  1.00 32.13  ? 210  GLY A C   1 
ATOM   1632 O O   . GLY A 1 210 ? 29.685  0.422   14.509  1.00 33.61  ? 210  GLY A O   1 
ATOM   1633 N N   . MET A 1 211 ? 30.733  2.306   15.145  1.00 27.63  ? 211  MET A N   1 
ATOM   1634 C CA  . MET A 1 211 ? 32.012  1.622   15.197  1.00 28.48  ? 211  MET A CA  1 
ATOM   1635 C C   . MET A 1 211 ? 32.145  0.698   16.381  1.00 27.52  ? 211  MET A C   1 
ATOM   1636 O O   . MET A 1 211 ? 32.863  -0.278  16.307  1.00 27.26  ? 211  MET A O   1 
ATOM   1637 C CB  . MET A 1 211 ? 33.169  2.631   15.143  1.00 28.84  ? 211  MET A CB  1 
ATOM   1638 C CG  . MET A 1 211 ? 33.446  2.931   13.654  1.00 35.84  ? 211  MET A CG  1 
ATOM   1639 S SD  . MET A 1 211 ? 34.231  4.461   13.507  1.00 45.47  ? 211  MET A SD  1 
ATOM   1640 C CE  . MET A 1 211 ? 33.596  4.961   11.906  1.00 40.93  ? 211  MET A CE  1 
ATOM   1641 N N   . HIS A 1 212 ? 31.439  1.016   17.464  1.00 26.75  ? 212  HIS A N   1 
ATOM   1642 C CA  . HIS A 1 212 ? 31.363  0.132   18.600  1.00 28.38  ? 212  HIS A CA  1 
ATOM   1643 C C   . HIS A 1 212 ? 30.593  -1.132  18.266  1.00 33.38  ? 212  HIS A C   1 
ATOM   1644 O O   . HIS A 1 212 ? 30.986  -2.218  18.705  1.00 31.79  ? 212  HIS A O   1 
ATOM   1645 C CB  . HIS A 1 212 ? 30.775  0.831   19.816  1.00 27.75  ? 212  HIS A CB  1 
ATOM   1646 C CG  . HIS A 1 212 ? 31.674  1.889   20.361  1.00 29.14  ? 212  HIS A CG  1 
ATOM   1647 N ND1 . HIS A 1 212 ? 32.914  1.601   20.890  1.00 28.04  ? 212  HIS A ND1 1 
ATOM   1648 C CD2 . HIS A 1 212 ? 31.536  3.234   20.431  1.00 27.18  ? 212  HIS A CD2 1 
ATOM   1649 C CE1 . HIS A 1 212 ? 33.501  2.725   21.266  1.00 33.30  ? 212  HIS A CE1 1 
ATOM   1650 N NE2 . HIS A 1 212 ? 32.685  3.731   20.998  1.00 30.63  ? 212  HIS A NE2 1 
ATOM   1651 N N   . ILE A 1 213 ? 29.521  -0.993  17.485  1.00 32.49  ? 213  ILE A N   1 
ATOM   1652 C CA  . ILE A 1 213 ? 28.813  -2.160  16.962  1.00 32.74  ? 213  ILE A CA  1 
ATOM   1653 C C   . ILE A 1 213 ? 29.776  -3.064  16.176  1.00 41.35  ? 213  ILE A C   1 
ATOM   1654 O O   . ILE A 1 213 ? 29.667  -4.268  16.236  1.00 41.67  ? 213  ILE A O   1 
ATOM   1655 C CB  . ILE A 1 213 ? 27.644  -1.753  16.044  1.00 28.41  ? 213  ILE A CB  1 
ATOM   1656 C CG1 . ILE A 1 213 ? 26.597  -0.943  16.838  1.00 28.82  ? 213  ILE A CG1 1 
ATOM   1657 C CG2 . ILE A 1 213 ? 27.026  -3.006  15.324  1.00 30.94  ? 213  ILE A CG2 1 
ATOM   1658 C CD1 . ILE A 1 213 ? 25.401  -0.521  16.003  1.00 24.83  ? 213  ILE A CD1 1 
ATOM   1659 N N   . LEU A 1 214 ? 30.732  -2.483  15.457  1.00 38.58  ? 214  LEU A N   1 
ATOM   1660 C CA  . LEU A 1 214 ? 31.551  -3.258  14.528  1.00 35.54  ? 214  LEU A CA  1 
ATOM   1661 C C   . LEU A 1 214 ? 32.891  -3.668  15.127  1.00 40.48  ? 214  LEU A C   1 
ATOM   1662 O O   . LEU A 1 214 ? 33.711  -4.302  14.458  1.00 38.20  ? 214  LEU A O   1 
ATOM   1663 C CB  . LEU A 1 214 ? 31.825  -2.438  13.261  1.00 29.15  ? 214  LEU A CB  1 
ATOM   1664 C CG  . LEU A 1 214 ? 30.576  -2.022  12.513  1.00 39.38  ? 214  LEU A CG  1 
ATOM   1665 C CD1 . LEU A 1 214 ? 30.911  -1.081  11.352  1.00 33.91  ? 214  LEU A CD1 1 
ATOM   1666 C CD2 . LEU A 1 214 ? 29.803  -3.291  12.045  1.00 31.66  ? 214  LEU A CD2 1 
ATOM   1667 N N   . SER A 1 215 ? 33.136  -3.252  16.358  1.00 40.55  ? 215  SER A N   1 
ATOM   1668 C CA  . SER A 1 215 ? 34.378  -3.576  17.014  1.00 34.17  ? 215  SER A CA  1 
ATOM   1669 C C   . SER A 1 215 ? 34.129  -4.482  18.205  1.00 37.00  ? 215  SER A C   1 
ATOM   1670 O O   . SER A 1 215 ? 33.552  -4.064  19.214  1.00 34.30  ? 215  SER A O   1 
ATOM   1671 C CB  . SER A 1 215 ? 35.097  -2.305  17.457  1.00 34.32  ? 215  SER A CB  1 
ATOM   1672 O OG  . SER A 1 215 ? 36.415  -2.647  17.887  1.00 40.14  ? 215  SER A OG  1 
ATOM   1673 N N   . LEU A 1 216 ? 34.611  -5.718  18.094  1.00 39.51  ? 216  LEU A N   1 
ATOM   1674 C CA  . LEU A 1 216 ? 34.269  -6.783  19.023  1.00 38.35  ? 216  LEU A CA  1 
ATOM   1675 C C   . LEU A 1 216 ? 34.435  -6.431  20.480  1.00 37.05  ? 216  LEU A C   1 
ATOM   1676 O O   . LEU A 1 216 ? 33.556  -6.684  21.279  1.00 39.98  ? 216  LEU A O   1 
ATOM   1677 C CB  . LEU A 1 216 ? 35.089  -8.052  18.704  1.00 53.34  ? 216  LEU A CB  1 
ATOM   1678 C CG  . LEU A 1 216 ? 34.693  -8.640  17.346  1.00 68.24  ? 216  LEU A CG  1 
ATOM   1679 C CD1 . LEU A 1 216 ? 35.441  -9.940  17.001  1.00 66.18  ? 216  LEU A CD1 1 
ATOM   1680 C CD2 . LEU A 1 216 ? 33.172  -8.855  17.313  1.00 75.30  ? 216  LEU A CD2 1 
ATOM   1681 N N   . PRO A 1 217 ? 35.594  -5.874  20.854  1.00 38.41  ? 217  PRO A N   1 
ATOM   1682 C CA  . PRO A 1 217 ? 35.754  -5.618  22.290  1.00 32.33  ? 217  PRO A CA  1 
ATOM   1683 C C   . PRO A 1 217 ? 34.761  -4.599  22.842  1.00 34.70  ? 217  PRO A C   1 
ATOM   1684 O O   . PRO A 1 217 ? 34.655  -4.498  24.055  1.00 40.81  ? 217  PRO A O   1 
ATOM   1685 C CB  . PRO A 1 217 ? 37.175  -5.061  22.383  1.00 32.76  ? 217  PRO A CB  1 
ATOM   1686 C CG  . PRO A 1 217 ? 37.865  -5.607  21.161  1.00 33.10  ? 217  PRO A CG  1 
ATOM   1687 C CD  . PRO A 1 217 ? 36.818  -5.572  20.092  1.00 27.10  ? 217  PRO A CD  1 
ATOM   1688 N N   . SER A 1 218 ? 34.080  -3.833  21.995  1.00 35.38  ? 218  SER A N   1 
ATOM   1689 C CA  . SER A 1 218 ? 33.053  -2.911  22.512  1.00 37.48  ? 218  SER A CA  1 
ATOM   1690 C C   . SER A 1 218 ? 31.741  -3.637  22.701  1.00 41.63  ? 218  SER A C   1 
ATOM   1691 O O   . SER A 1 218 ? 30.897  -3.217  23.486  1.00 39.17  ? 218  SER A O   1 
ATOM   1692 C CB  . SER A 1 218 ? 32.847  -1.730  21.582  1.00 30.99  ? 218  SER A CB  1 
ATOM   1693 O OG  . SER A 1 218 ? 34.010  -0.929  21.609  1.00 36.12  ? 218  SER A OG  1 
ATOM   1694 N N   . ARG A 1 219 ? 31.591  -4.760  22.002  1.00 46.21  ? 219  ARG A N   1 
ATOM   1695 C CA  . ARG A 1 219 ? 30.289  -5.409  21.917  1.00 50.66  ? 219  ARG A CA  1 
ATOM   1696 C C   . ARG A 1 219 ? 29.732  -5.878  23.251  1.00 45.36  ? 219  ARG A C   1 
ATOM   1697 O O   . ARG A 1 219 ? 28.528  -5.837  23.456  1.00 47.08  ? 219  ARG A O   1 
ATOM   1698 C CB  . ARG A 1 219 ? 30.326  -6.534  20.900  1.00 55.16  ? 219  ARG A CB  1 
ATOM   1699 C CG  . ARG A 1 219 ? 30.486  -5.987  19.487  1.00 56.60  ? 219  ARG A CG  1 
ATOM   1700 C CD  . ARG A 1 219 ? 29.334  -5.040  19.168  1.00 60.25  ? 219  ARG A CD  1 
ATOM   1701 N NE  . ARG A 1 219 ? 28.037  -5.675  19.404  1.00 57.33  ? 219  ARG A NE  1 
ATOM   1702 C CZ  . ARG A 1 219 ? 27.349  -6.336  18.485  1.00 63.32  ? 219  ARG A CZ  1 
ATOM   1703 N NH1 . ARG A 1 219 ? 27.818  -6.444  17.251  1.00 63.59  ? 219  ARG A NH1 1 
ATOM   1704 N NH2 . ARG A 1 219 ? 26.186  -6.890  18.802  1.00 73.83  ? 219  ARG A NH2 1 
ATOM   1705 N N   . SER A 1 220 ? 30.610  -6.289  24.156  1.00 38.87  ? 220  SER A N   1 
ATOM   1706 C CA  . SER A 1 220 ? 30.191  -6.733  25.472  1.00 42.73  ? 220  SER A CA  1 
ATOM   1707 C C   . SER A 1 220 ? 29.844  -5.596  26.419  1.00 44.01  ? 220  SER A C   1 
ATOM   1708 O O   . SER A 1 220 ? 29.556  -5.849  27.583  1.00 49.74  ? 220  SER A O   1 
ATOM   1709 C CB  . SER A 1 220 ? 31.282  -7.603  26.121  1.00 54.84  ? 220  SER A CB  1 
ATOM   1710 O OG  . SER A 1 220 ? 32.496  -6.892  26.326  1.00 58.80  ? 220  SER A OG  1 
ATOM   1711 N N   . LEU A 1 221 ? 29.849  -4.353  25.936  1.00 38.68  ? 221  LEU A N   1 
ATOM   1712 C CA  . LEU A 1 221 ? 29.715  -3.205  26.833  1.00 32.15  ? 221  LEU A CA  1 
ATOM   1713 C C   . LEU A 1 221 ? 28.399  -2.482  26.636  1.00 32.64  ? 221  LEU A C   1 
ATOM   1714 O O   . LEU A 1 221 ? 28.146  -1.439  27.276  1.00 32.02  ? 221  LEU A O   1 
ATOM   1715 C CB  . LEU A 1 221 ? 30.873  -2.203  26.636  1.00 33.27  ? 221  LEU A CB  1 
ATOM   1716 C CG  . LEU A 1 221 ? 32.319  -2.727  26.697  1.00 42.26  ? 221  LEU A CG  1 
ATOM   1717 C CD1 . LEU A 1 221 ? 33.336  -1.646  26.262  1.00 38.59  ? 221  LEU A CD1 1 
ATOM   1718 C CD2 . LEU A 1 221 ? 32.681  -3.325  28.095  1.00 39.58  ? 221  LEU A CD2 1 
ATOM   1719 N N   . PHE A 1 222 ? 27.581  -2.988  25.720  1.00 30.67  ? 222  PHE A N   1 
ATOM   1720 C CA  . PHE A 1 222 ? 26.257  -2.387  25.516  1.00 39.64  ? 222  PHE A CA  1 
ATOM   1721 C C   . PHE A 1 222 ? 25.334  -3.389  24.844  1.00 37.15  ? 222  PHE A C   1 
ATOM   1722 O O   . PHE A 1 222 ? 25.798  -4.362  24.285  1.00 40.04  ? 222  PHE A O   1 
ATOM   1723 C CB  . PHE A 1 222 ? 26.341  -1.085  24.686  1.00 27.74  ? 222  PHE A CB  1 
ATOM   1724 C CG  . PHE A 1 222 ? 26.776  -1.301  23.260  1.00 30.33  ? 222  PHE A CG  1 
ATOM   1725 C CD1 . PHE A 1 222 ? 28.125  -1.467  22.943  1.00 32.97  ? 222  PHE A CD1 1 
ATOM   1726 C CD2 . PHE A 1 222 ? 25.849  -1.340  22.234  1.00 32.05  ? 222  PHE A CD2 1 
ATOM   1727 C CE1 . PHE A 1 222 ? 28.538  -1.678  21.614  1.00 35.94  ? 222  PHE A CE1 1 
ATOM   1728 C CE2 . PHE A 1 222 ? 26.254  -1.568  20.900  1.00 35.93  ? 222  PHE A CE2 1 
ATOM   1729 C CZ  . PHE A 1 222 ? 27.590  -1.732  20.593  1.00 33.51  ? 222  PHE A CZ  1 
ATOM   1730 N N   . HIS A 1 223 ? 24.035  -3.129  24.867  1.00 37.39  ? 223  HIS A N   1 
ATOM   1731 C CA  . HIS A 1 223 ? 23.060  -4.089  24.350  1.00 41.30  ? 223  HIS A CA  1 
ATOM   1732 C C   . HIS A 1 223 ? 22.255  -3.574  23.169  1.00 43.77  ? 223  HIS A C   1 
ATOM   1733 O O   . HIS A 1 223 ? 21.752  -4.358  22.385  1.00 51.62  ? 223  HIS A O   1 
ATOM   1734 C CB  . HIS A 1 223 ? 22.166  -4.528  25.502  1.00 37.28  ? 223  HIS A CB  1 
ATOM   1735 C CG  . HIS A 1 223 ? 22.945  -4.707  26.766  1.00 44.73  ? 223  HIS A CG  1 
ATOM   1736 N ND1 . HIS A 1 223 ? 23.576  -5.895  27.091  1.00 44.86  ? 223  HIS A ND1 1 
ATOM   1737 C CD2 . HIS A 1 223 ? 23.299  -3.815  27.723  1.00 35.27  ? 223  HIS A CD2 1 
ATOM   1738 C CE1 . HIS A 1 223 ? 24.242  -5.737  28.221  1.00 41.05  ? 223  HIS A CE1 1 
ATOM   1739 N NE2 . HIS A 1 223 ? 24.089  -4.486  28.621  1.00 43.51  ? 223  HIS A NE2 1 
ATOM   1740 N N   . ARG A 1 224 ? 22.165  -2.262  23.020  1.00 41.44  ? 224  ARG A N   1 
ATOM   1741 C CA  . ARG A 1 224 ? 21.312  -1.675  21.987  1.00 42.33  ? 224  ARG A CA  1 
ATOM   1742 C C   . ARG A 1 224 ? 21.959  -0.369  21.540  1.00 40.16  ? 224  ARG A C   1 
ATOM   1743 O O   . ARG A 1 224 ? 22.774  0.174   22.274  1.00 38.37  ? 224  ARG A O   1 
ATOM   1744 C CB  . ARG A 1 224 ? 19.922  -1.386  22.568  1.00 39.09  ? 224  ARG A CB  1 
ATOM   1745 C CG  . ARG A 1 224 ? 18.973  -2.535  22.441  1.00 49.03  ? 224  ARG A CG  1 
ATOM   1746 C CD  . ARG A 1 224 ? 17.701  -2.351  23.267  1.00 47.55  ? 224  ARG A CD  1 
ATOM   1747 N NE  . ARG A 1 224 ? 18.041  -2.212  24.661  1.00 58.27  ? 224  ARG A NE  1 
ATOM   1748 C CZ  . ARG A 1 224 ? 18.259  -3.229  25.489  1.00 62.62  ? 224  ARG A CZ  1 
ATOM   1749 N NH1 . ARG A 1 224 ? 18.158  -4.473  25.058  1.00 60.30  ? 224  ARG A NH1 1 
ATOM   1750 N NH2 . ARG A 1 224 ? 18.593  -2.991  26.754  1.00 64.99  ? 224  ARG A NH2 1 
ATOM   1751 N N   . ALA A 1 225 ? 21.564  0.153   20.380  1.00 37.05  ? 225  ALA A N   1 
ATOM   1752 C CA  . ALA A 1 225 ? 22.197  1.342   19.829  1.00 32.65  ? 225  ALA A CA  1 
ATOM   1753 C C   . ALA A 1 225 ? 21.248  2.228   19.014  1.00 32.60  ? 225  ALA A C   1 
ATOM   1754 O O   . ALA A 1 225 ? 20.412  1.733   18.267  1.00 32.57  ? 225  ALA A O   1 
ATOM   1755 C CB  . ALA A 1 225 ? 23.365  0.925   18.961  1.00 28.44  ? 225  ALA A CB  1 
ATOM   1756 N N   . VAL A 1 226 ? 21.416  3.539   19.147  1.00 28.00  ? 226  VAL A N   1 
ATOM   1757 C CA  . VAL A 1 226 ? 20.661  4.491   18.368  1.00 30.33  ? 226  VAL A CA  1 
ATOM   1758 C C   . VAL A 1 226 ? 21.603  5.343   17.521  1.00 34.72  ? 226  VAL A C   1 
ATOM   1759 O O   . VAL A 1 226 ? 22.533  5.979   18.065  1.00 36.65  ? 226  VAL A O   1 
ATOM   1760 C CB  . VAL A 1 226 ? 19.857  5.406   19.283  1.00 30.64  ? 226  VAL A CB  1 
ATOM   1761 C CG1 . VAL A 1 226 ? 19.010  6.372   18.414  1.00 35.44  ? 226  VAL A CG1 1 
ATOM   1762 C CG2 . VAL A 1 226 ? 18.987  4.567   20.228  1.00 27.46  ? 226  VAL A CG2 1 
ATOM   1763 N N   . LEU A 1 227 ? 21.400  5.356   16.204  1.00 31.96  ? 227  LEU A N   1 
ATOM   1764 C CA  . LEU A 1 227 ? 22.280  6.154   15.327  1.00 34.09  ? 227  LEU A CA  1 
ATOM   1765 C C   . LEU A 1 227 ? 21.471  7.279   14.719  1.00 33.15  ? 227  LEU A C   1 
ATOM   1766 O O   . LEU A 1 227 ? 20.626  7.051   13.849  1.00 28.49  ? 227  LEU A O   1 
ATOM   1767 C CB  . LEU A 1 227 ? 22.929  5.319   14.210  1.00 29.69  ? 227  LEU A CB  1 
ATOM   1768 C CG  . LEU A 1 227 ? 24.006  4.303   14.676  1.00 34.28  ? 227  LEU A CG  1 
ATOM   1769 C CD1 . LEU A 1 227 ? 23.363  3.058   15.310  1.00 25.39  ? 227  LEU A CD1 1 
ATOM   1770 C CD2 . LEU A 1 227 ? 24.952  3.900   13.575  1.00 27.90  ? 227  LEU A CD2 1 
ATOM   1771 N N   . GLN A 1 228 ? 21.742  8.498   15.165  1.00 28.88  ? 228  GLN A N   1 
ATOM   1772 C CA  . GLN A 1 228 ? 21.017  9.676   14.653  1.00 26.82  ? 228  GLN A CA  1 
ATOM   1773 C C   . GLN A 1 228 ? 21.835  10.423  13.597  1.00 31.29  ? 228  GLN A C   1 
ATOM   1774 O O   . GLN A 1 228 ? 22.940  10.930  13.890  1.00 30.96  ? 228  GLN A O   1 
ATOM   1775 C CB  . GLN A 1 228 ? 20.626  10.596  15.802  1.00 21.33  ? 228  GLN A CB  1 
ATOM   1776 C CG  . GLN A 1 228 ? 19.819  9.895   16.901  1.00 22.09  ? 228  GLN A CG  1 
ATOM   1777 C CD  . GLN A 1 228 ? 19.585  10.746  18.144  1.00 29.12  ? 228  GLN A CD  1 
ATOM   1778 O OE1 . GLN A 1 228 ? 19.420  10.210  19.237  1.00 28.91  ? 228  GLN A OE1 1 
ATOM   1779 N NE2 . GLN A 1 228 ? 19.627  12.079  17.990  1.00 28.42  ? 228  GLN A NE2 1 
ATOM   1780 N N   . SER A 1 229 ? 21.331  10.442  12.355  1.00 26.51  ? 229  SER A N   1 
ATOM   1781 C CA  . SER A 1 229 ? 22.016  11.143  11.276  1.00 21.54  ? 229  SER A CA  1 
ATOM   1782 C C   . SER A 1 229 ? 23.549  10.858  11.196  1.00 23.32  ? 229  SER A C   1 
ATOM   1783 O O   . SER A 1 229 ? 24.327  11.785  11.081  1.00 22.10  ? 229  SER A O   1 
ATOM   1784 C CB  . SER A 1 229 ? 21.877  12.649  11.459  1.00 22.68  ? 229  SER A CB  1 
ATOM   1785 O OG  . SER A 1 229 ? 20.536  13.050  11.613  1.00 30.34  ? 229  SER A OG  1 
ATOM   1786 N N   . GLY A 1 230 ? 23.955  9.604   11.191  1.00 24.74  ? 230  GLY A N   1 
ATOM   1787 C CA  . GLY A 1 230 ? 25.353  9.252   11.092  1.00 26.93  ? 230  GLY A CA  1 
ATOM   1788 C C   . GLY A 1 230 ? 25.512  7.737   11.080  1.00 28.70  ? 230  GLY A C   1 
ATOM   1789 O O   . GLY A 1 230 ? 24.675  7.018   11.638  1.00 32.74  ? 230  GLY A O   1 
ATOM   1790 N N   . THR A 1 231 ? 26.594  7.267   10.464  1.00 24.64  ? 231  THR A N   1 
ATOM   1791 C CA  . THR A 1 231 ? 26.819  5.833   10.237  1.00 34.92  ? 231  THR A CA  1 
ATOM   1792 C C   . THR A 1 231 ? 28.311  5.596   10.188  1.00 30.77  ? 231  THR A C   1 
ATOM   1793 O O   . THR A 1 231 ? 29.037  6.494   9.831   1.00 28.77  ? 231  THR A O   1 
ATOM   1794 C CB  . THR A 1 231 ? 26.209  5.355   8.869   1.00 30.81  ? 231  THR A CB  1 
ATOM   1795 O OG1 . THR A 1 231 ? 26.729  6.164   7.806   1.00 33.25  ? 231  THR A OG1 1 
ATOM   1796 C CG2 . THR A 1 231 ? 24.688  5.462   8.880   1.00 26.82  ? 231  THR A CG2 1 
ATOM   1797 N N   . PRO A 1 232 ? 28.770  4.384   10.523  1.00 33.17  ? 232  PRO A N   1 
ATOM   1798 C CA  . PRO A 1 232 ? 30.219  4.179   10.347  1.00 28.92  ? 232  PRO A CA  1 
ATOM   1799 C C   . PRO A 1 232 ? 30.596  3.986   8.861   1.00 31.63  ? 232  PRO A C   1 
ATOM   1800 O O   . PRO A 1 232 ? 31.725  4.263   8.477   1.00 33.12  ? 232  PRO A O   1 
ATOM   1801 C CB  . PRO A 1 232 ? 30.508  2.916   11.171  1.00 25.50  ? 232  PRO A CB  1 
ATOM   1802 C CG  . PRO A 1 232 ? 29.164  2.186   11.295  1.00 25.46  ? 232  PRO A CG  1 
ATOM   1803 C CD  . PRO A 1 232 ? 28.059  3.162   10.981  1.00 31.80  ? 232  PRO A CD  1 
ATOM   1804 N N   . ASN A 1 233 ? 29.668  3.508   8.031   1.00 31.64  ? 233  ASN A N   1 
ATOM   1805 C CA  . ASN A 1 233 ? 29.924  3.419   6.584   1.00 29.88  ? 233  ASN A CA  1 
ATOM   1806 C C   . ASN A 1 233 ? 29.699  4.814   5.977   1.00 30.62  ? 233  ASN A C   1 
ATOM   1807 O O   . ASN A 1 233 ? 29.277  5.716   6.667   1.00 31.63  ? 233  ASN A O   1 
ATOM   1808 C CB  . ASN A 1 233 ? 28.962  2.426   5.934   1.00 29.06  ? 233  ASN A CB  1 
ATOM   1809 C CG  . ASN A 1 233 ? 27.541  2.692   6.343   1.00 35.05  ? 233  ASN A CG  1 
ATOM   1810 O OD1 . ASN A 1 233 ? 27.230  2.632   7.521   1.00 37.31  ? 233  ASN A OD1 1 
ATOM   1811 N ND2 . ASN A 1 233 ? 26.675  3.024   5.389   1.00 33.37  ? 233  ASN A ND2 1 
ATOM   1812 N N   . GLY A 1 234 ? 29.949  4.977   4.685   1.00 28.16  ? 234  GLY A N   1 
ATOM   1813 C CA  . GLY A 1 234 ? 29.822  6.277   4.057   1.00 27.44  ? 234  GLY A CA  1 
ATOM   1814 C C   . GLY A 1 234 ? 31.153  6.986   3.865   1.00 32.51  ? 234  GLY A C   1 
ATOM   1815 O O   . GLY A 1 234 ? 32.192  6.476   4.225   1.00 36.66  ? 234  GLY A O   1 
ATOM   1816 N N   . PRO A 1 235 ? 31.120  8.179   3.294   1.00 34.10  ? 235  PRO A N   1 
ATOM   1817 C CA  . PRO A 1 235 ? 32.340  8.770   2.729   1.00 33.88  ? 235  PRO A CA  1 
ATOM   1818 C C   . PRO A 1 235 ? 33.152  9.650   3.687   1.00 34.95  ? 235  PRO A C   1 
ATOM   1819 O O   . PRO A 1 235 ? 34.262  10.095  3.324   1.00 37.25  ? 235  PRO A O   1 
ATOM   1820 C CB  . PRO A 1 235 ? 31.805  9.644   1.581   1.00 37.96  ? 235  PRO A CB  1 
ATOM   1821 C CG  . PRO A 1 235 ? 30.326  9.879   1.890   1.00 36.84  ? 235  PRO A CG  1 
ATOM   1822 C CD  . PRO A 1 235 ? 29.894  8.949   2.989   1.00 29.57  ? 235  PRO A CD  1 
ATOM   1823 N N   . TRP A 1 236 ? 32.633  9.913   4.881   1.00 31.08  ? 236  TRP A N   1 
ATOM   1824 C CA  . TRP A 1 236 ? 33.327  10.857  5.779   1.00 34.48  ? 236  TRP A CA  1 
ATOM   1825 C C   . TRP A 1 236 ? 33.836  10.232  7.100   1.00 34.09  ? 236  TRP A C   1 
ATOM   1826 O O   . TRP A 1 236 ? 34.773  10.732  7.697   1.00 31.99  ? 236  TRP A O   1 
ATOM   1827 C CB  . TRP A 1 236 ? 32.449  12.097  6.049   1.00 27.97  ? 236  TRP A CB  1 
ATOM   1828 C CG  . TRP A 1 236 ? 31.099  11.742  6.656   1.00 30.24  ? 236  TRP A CG  1 
ATOM   1829 C CD1 . TRP A 1 236 ? 29.894  11.537  5.972   1.00 27.99  ? 236  TRP A CD1 1 
ATOM   1830 C CD2 . TRP A 1 236 ? 30.798  11.538  8.052   1.00 26.26  ? 236  TRP A CD2 1 
ATOM   1831 N NE1 . TRP A 1 236 ? 28.899  11.206  6.864   1.00 27.28  ? 236  TRP A NE1 1 
ATOM   1832 C CE2 . TRP A 1 236 ? 29.412  11.194  8.137   1.00 26.07  ? 236  TRP A CE2 1 
ATOM   1833 C CE3 . TRP A 1 236 ? 31.546  11.623  9.232   1.00 24.36  ? 236  TRP A CE3 1 
ATOM   1834 C CZ2 . TRP A 1 236 ? 28.769  10.950  9.369   1.00 21.66  ? 236  TRP A CZ2 1 
ATOM   1835 C CZ3 . TRP A 1 236 ? 30.895  11.356  10.475  1.00 26.62  ? 236  TRP A CZ3 1 
ATOM   1836 C CH2 . TRP A 1 236 ? 29.520  11.011  10.522  1.00 18.05  ? 236  TRP A CH2 1 
ATOM   1837 N N   . ALA A 1 237 ? 33.233  9.126   7.533   1.00 30.04  ? 237  ALA A N   1 
ATOM   1838 C CA  . ALA A 1 237 ? 33.445  8.638   8.903   1.00 31.34  ? 237  ALA A CA  1 
ATOM   1839 C C   . ALA A 1 237 ? 34.768  7.919   9.114   1.00 27.77  ? 237  ALA A C   1 
ATOM   1840 O O   . ALA A 1 237 ? 35.184  7.782   10.252  1.00 26.99  ? 237  ALA A O   1 
ATOM   1841 C CB  . ALA A 1 237 ? 32.286  7.719   9.379   1.00 19.91  ? 237  ALA A CB  1 
ATOM   1842 N N   . THR A 1 238 ? 35.400  7.433   8.049   1.00 28.12  ? 238  THR A N   1 
ATOM   1843 C CA  . THR A 1 238 ? 36.696  6.744   8.201   1.00 29.57  ? 238  THR A CA  1 
ATOM   1844 C C   . THR A 1 238 ? 37.621  7.143   7.065   1.00 35.33  ? 238  THR A C   1 
ATOM   1845 O O   . THR A 1 238 ? 37.169  7.709   6.057   1.00 31.54  ? 238  THR A O   1 
ATOM   1846 C CB  . THR A 1 238 ? 36.576  5.231   8.179   1.00 30.46  ? 238  THR A CB  1 
ATOM   1847 O OG1 . THR A 1 238 ? 35.973  4.821   6.953   1.00 31.87  ? 238  THR A OG1 1 
ATOM   1848 C CG2 . THR A 1 238 ? 35.737  4.713   9.335   1.00 41.02  ? 238  THR A CG2 1 
ATOM   1849 N N   . VAL A 1 239 ? 38.924  6.908   7.251   1.00 28.35  ? 239  VAL A N   1 
ATOM   1850 C CA  . VAL A 1 239 ? 39.875  7.076   6.178   1.00 27.60  ? 239  VAL A CA  1 
ATOM   1851 C C   . VAL A 1 239 ? 40.740  5.821   6.209   1.00 31.31  ? 239  VAL A C   1 
ATOM   1852 O O   . VAL A 1 239 ? 40.805  5.157   7.232   1.00 35.53  ? 239  VAL A O   1 
ATOM   1853 C CB  . VAL A 1 239 ? 40.820  8.285   6.394   1.00 35.55  ? 239  VAL A CB  1 
ATOM   1854 C CG1 . VAL A 1 239 ? 40.138  9.595   6.057   1.00 27.13  ? 239  VAL A CG1 1 
ATOM   1855 C CG2 . VAL A 1 239 ? 41.447  8.261   7.808   1.00 32.61  ? 239  VAL A CG2 1 
ATOM   1856 N N   . SER A 1 240 ? 41.400  5.512   5.102   1.00 26.66  ? 240  SER A N   1 
ATOM   1857 C CA  . SER A 1 240 ? 42.290  4.347   5.026   1.00 34.90  ? 240  SER A CA  1 
ATOM   1858 C C   . SER A 1 240 ? 43.558  4.605   5.798   1.00 34.17  ? 240  SER A C   1 
ATOM   1859 O O   . SER A 1 240 ? 43.869  5.741   6.150   1.00 32.96  ? 240  SER A O   1 
ATOM   1860 C CB  . SER A 1 240 ? 42.664  4.086   3.560   1.00 29.73  ? 240  SER A CB  1 
ATOM   1861 O OG  . SER A 1 240 ? 43.501  5.145   3.107   1.00 39.81  ? 240  SER A OG  1 
ATOM   1862 N N   . ALA A 1 241 ? 44.338  3.563   6.025   1.00 36.47  ? 241  ALA A N   1 
ATOM   1863 C CA  . ALA A 1 241 ? 45.584  3.748   6.732   1.00 32.49  ? 241  ALA A CA  1 
ATOM   1864 C C   . ALA A 1 241 ? 46.488  4.677   5.926   1.00 40.24  ? 241  ALA A C   1 
ATOM   1865 O O   . ALA A 1 241 ? 47.148  5.555   6.487   1.00 36.07  ? 241  ALA A O   1 
ATOM   1866 C CB  . ALA A 1 241 ? 46.281  2.391   6.988   1.00 38.65  ? 241  ALA A CB  1 
ATOM   1867 N N   . GLY A 1 242 ? 46.502  4.497   4.606   1.00 40.55  ? 242  GLY A N   1 
ATOM   1868 C CA  . GLY A 1 242 ? 47.357  5.298   3.740   1.00 40.71  ? 242  GLY A CA  1 
ATOM   1869 C C   . GLY A 1 242 ? 47.041  6.784   3.835   1.00 41.68  ? 242  GLY A C   1 
ATOM   1870 O O   . GLY A 1 242 ? 47.937  7.629   3.924   1.00 45.41  ? 242  GLY A O   1 
ATOM   1871 N N   . GLU A 1 243 ? 45.759  7.104   3.803   1.00 35.04  ? 243  GLU A N   1 
ATOM   1872 C CA  . GLU A 1 243 ? 45.338  8.488   3.862   1.00 38.21  ? 243  GLU A CA  1 
ATOM   1873 C C   . GLU A 1 243 ? 45.631  9.091   5.253   1.00 37.55  ? 243  GLU A C   1 
ATOM   1874 O O   . GLU A 1 243 ? 46.167  10.208  5.348   1.00 35.89  ? 243  GLU A O   1 
ATOM   1875 C CB  . GLU A 1 243 ? 43.870  8.617   3.410   1.00 35.64  ? 243  GLU A CB  1 
ATOM   1876 C CG  . GLU A 1 243 ? 43.278  10.007  3.500   1.00 38.27  ? 243  GLU A CG  1 
ATOM   1877 C CD  . GLU A 1 243 ? 43.932  11.033  2.560   1.00 42.34  ? 243  GLU A CD  1 
ATOM   1878 O OE1 . GLU A 1 243 ? 43.553  12.222  2.654   1.00 40.17  ? 243  GLU A OE1 1 
ATOM   1879 O OE2 . GLU A 1 243 ? 44.805  10.665  1.733   1.00 41.20  ? 243  GLU A OE2 1 
ATOM   1880 N N   . ALA A 1 244 ? 45.354  8.333   6.318   1.00 32.39  ? 244  ALA A N   1 
ATOM   1881 C CA  . ALA A 1 244 ? 45.672  8.781   7.670   1.00 27.53  ? 244  ALA A CA  1 
ATOM   1882 C C   . ALA A 1 244 ? 47.169  9.108   7.774   1.00 38.08  ? 244  ALA A C   1 
ATOM   1883 O O   . ALA A 1 244 ? 47.566  10.146  8.341   1.00 39.23  ? 244  ALA A O   1 
ATOM   1884 C CB  . ALA A 1 244 ? 45.286  7.749   8.692   1.00 27.50  ? 244  ALA A CB  1 
ATOM   1885 N N   . ARG A 1 245 ? 47.994  8.253   7.191   1.00 28.31  ? 245  ARG A N   1 
ATOM   1886 C CA  . ARG A 1 245 ? 49.435  8.439   7.285   1.00 41.87  ? 245  ARG A CA  1 
ATOM   1887 C C   . ARG A 1 245 ? 49.817  9.710   6.533   1.00 41.47  ? 245  ARG A C   1 
ATOM   1888 O O   . ARG A 1 245 ? 50.615  10.517  7.004   1.00 38.62  ? 245  ARG A O   1 
ATOM   1889 C CB  . ARG A 1 245 ? 50.210  7.214   6.721   1.00 36.03  ? 245  ARG A CB  1 
ATOM   1890 C CG  . ARG A 1 245 ? 51.718  7.448   6.523   1.00 38.47  ? 245  ARG A CG  1 
ATOM   1891 C CD  . ARG A 1 245 ? 52.510  6.097   6.445   1.00 28.13  ? 245  ARG A CD  1 
ATOM   1892 N NE  . ARG A 1 245 ? 52.384  5.306   7.679   1.00 33.68  ? 245  ARG A NE  1 
ATOM   1893 C CZ  . ARG A 1 245 ? 53.231  5.387   8.702   1.00 41.54  ? 245  ARG A CZ  1 
ATOM   1894 N NH1 . ARG A 1 245 ? 54.261  6.226   8.643   1.00 40.07  ? 245  ARG A NH1 1 
ATOM   1895 N NH2 . ARG A 1 245 ? 53.060  4.632   9.784   1.00 39.39  ? 245  ARG A NH2 1 
ATOM   1896 N N   . ARG A 1 246 ? 49.228  9.881   5.363   1.00 34.33  ? 246  ARG A N   1 
ATOM   1897 C CA  . ARG A 1 246 ? 49.535  11.030  4.529   1.00 40.54  ? 246  ARG A CA  1 
ATOM   1898 C C   . ARG A 1 246 ? 49.142  12.360  5.225   1.00 42.62  ? 246  ARG A C   1 
ATOM   1899 O O   . ARG A 1 246 ? 49.943  13.298  5.284   1.00 36.05  ? 246  ARG A O   1 
ATOM   1900 C CB  . ARG A 1 246 ? 48.822  10.841  3.208   1.00 38.48  ? 246  ARG A CB  1 
ATOM   1901 C CG  . ARG A 1 246 ? 49.136  11.839  2.160   1.00 39.63  ? 246  ARG A CG  1 
ATOM   1902 C CD  . ARG A 1 246 ? 47.811  12.221  1.511   1.00 47.80  ? 246  ARG A CD  1 
ATOM   1903 N NE  . ARG A 1 246 ? 47.825  13.668  1.471   1.00 55.83  ? 246  ARG A NE  1 
ATOM   1904 C CZ  . ARG A 1 246 ? 46.805  14.460  1.709   1.00 46.56  ? 246  ARG A CZ  1 
ATOM   1905 N NH1 . ARG A 1 246 ? 45.606  13.986  1.981   1.00 36.24  ? 246  ARG A NH1 1 
ATOM   1906 N NH2 . ARG A 1 246 ? 47.015  15.755  1.650   1.00 59.16  ? 246  ARG A NH2 1 
ATOM   1907 N N   . ARG A 1 247 ? 47.925  12.432  5.772   1.00 34.24  ? 247  ARG A N   1 
ATOM   1908 C CA  . ARG A 1 247 ? 47.518  13.602  6.582   1.00 33.34  ? 247  ARG A CA  1 
ATOM   1909 C C   . ARG A 1 247 ? 48.339  13.857  7.848   1.00 30.55  ? 247  ARG A C   1 
ATOM   1910 O O   . ARG A 1 247 ? 48.638  15.002  8.164   1.00 36.82  ? 247  ARG A O   1 
ATOM   1911 C CB  . ARG A 1 247 ? 46.040  13.525  6.973   1.00 26.21  ? 247  ARG A CB  1 
ATOM   1912 C CG  . ARG A 1 247 ? 45.129  13.340  5.786   1.00 30.94  ? 247  ARG A CG  1 
ATOM   1913 C CD  . ARG A 1 247 ? 43.632  13.172  6.242   1.00 25.65  ? 247  ARG A CD  1 
ATOM   1914 N NE  . ARG A 1 247 ? 42.755  12.989  5.092   1.00 26.42  ? 247  ARG A NE  1 
ATOM   1915 C CZ  . ARG A 1 247 ? 41.414  12.962  5.154   1.00 33.89  ? 247  ARG A CZ  1 
ATOM   1916 N NH1 . ARG A 1 247 ? 40.778  13.160  6.313   1.00 29.08  ? 247  ARG A NH1 1 
ATOM   1917 N NH2 . ARG A 1 247 ? 40.706  12.749  4.050   1.00 30.11  ? 247  ARG A NH2 1 
ATOM   1918 N N   . ALA A 1 248 ? 48.675  12.817  8.596   1.00 29.75  ? 248  ALA A N   1 
ATOM   1919 C CA  . ALA A 1 248 ? 49.458  13.003  9.808   1.00 34.00  ? 248  ALA A CA  1 
ATOM   1920 C C   . ALA A 1 248 ? 50.812  13.589  9.428   1.00 32.53  ? 248  ALA A C   1 
ATOM   1921 O O   . ALA A 1 248 ? 51.337  14.477  10.096  1.00 33.48  ? 248  ALA A O   1 
ATOM   1922 C CB  . ALA A 1 248 ? 49.640  11.694  10.569  1.00 33.01  ? 248  ALA A CB  1 
ATOM   1923 N N   . THR A 1 249 ? 51.363  13.141  8.322   1.00 33.53  ? 249  THR A N   1 
ATOM   1924 C CA  . THR A 1 249 ? 52.728  13.572  8.032   1.00 32.47  ? 249  THR A CA  1 
ATOM   1925 C C   . THR A 1 249 ? 52.743  14.948  7.399   1.00 32.75  ? 249  THR A C   1 
ATOM   1926 O O   . THR A 1 249 ? 53.628  15.730  7.706   1.00 34.89  ? 249  THR A O   1 
ATOM   1927 C CB  . THR A 1 249 ? 53.646  12.456  7.367   1.00 48.96  ? 249  THR A CB  1 
ATOM   1928 O OG1 . THR A 1 249 ? 54.311  12.947  6.199   1.00 48.35  ? 249  THR A OG1 1 
ATOM   1929 C CG2 . THR A 1 249 ? 52.875  11.212  7.036   1.00 34.16  ? 249  THR A CG2 1 
ATOM   1930 N N   . LEU A 1 250 ? 51.706  15.277  6.622   1.00 35.12  ? 250  LEU A N   1 
ATOM   1931 C CA  . LEU A 1 250 ? 51.534  16.641  6.128   1.00 36.21  ? 250  LEU A CA  1 
ATOM   1932 C C   . LEU A 1 250 ? 51.379  17.604  7.308   1.00 41.68  ? 250  LEU A C   1 
ATOM   1933 O O   . LEU A 1 250 ? 52.069  18.637  7.371   1.00 42.18  ? 250  LEU A O   1 
ATOM   1934 C CB  . LEU A 1 250 ? 50.332  16.773  5.163   1.00 33.34  ? 250  LEU A CB  1 
ATOM   1935 C CG  . LEU A 1 250 ? 50.076  18.182  4.600   1.00 31.64  ? 250  LEU A CG  1 
ATOM   1936 C CD1 . LEU A 1 250 ? 51.382  18.818  4.044   1.00 34.14  ? 250  LEU A CD1 1 
ATOM   1937 C CD2 . LEU A 1 250 ? 49.037  18.151  3.516   1.00 31.21  ? 250  LEU A CD2 1 
ATOM   1938 N N   . LEU A 1 251 ? 50.491  17.269  8.252   1.00 35.83  ? 251  LEU A N   1 
ATOM   1939 C CA  . LEU A 1 251 ? 50.320  18.107  9.427   1.00 33.58  ? 251  LEU A CA  1 
ATOM   1940 C C   . LEU A 1 251 ? 51.638  18.294  10.201  1.00 31.88  ? 251  LEU A C   1 
ATOM   1941 O O   . LEU A 1 251 ? 51.978  19.416  10.586  1.00 35.19  ? 251  LEU A O   1 
ATOM   1942 C CB  . LEU A 1 251 ? 49.258  17.563  10.380  1.00 41.41  ? 251  LEU A CB  1 
ATOM   1943 C CG  . LEU A 1 251 ? 49.295  18.542  11.551  1.00 43.23  ? 251  LEU A CG  1 
ATOM   1944 C CD1 . LEU A 1 251 ? 48.191  19.571  11.450  1.00 37.00  ? 251  LEU A CD1 1 
ATOM   1945 C CD2 . LEU A 1 251 ? 49.282  17.833  12.864  1.00 47.16  ? 251  LEU A CD2 1 
ATOM   1946 N N   . ALA A 1 252 ? 52.357  17.208  10.466  1.00 31.52  ? 252  ALA A N   1 
ATOM   1947 C CA  . ALA A 1 252 ? 53.684  17.323  11.083  1.00 36.79  ? 252  ALA A CA  1 
ATOM   1948 C C   . ALA A 1 252 ? 54.519  18.370  10.344  1.00 37.84  ? 252  ALA A C   1 
ATOM   1949 O O   . ALA A 1 252 ? 55.083  19.255  10.986  1.00 40.06  ? 252  ALA A O   1 
ATOM   1950 C CB  . ALA A 1 252 ? 54.406  16.001  11.123  1.00 36.44  ? 252  ALA A CB  1 
ATOM   1951 N N   A ARG A 1 253 ? 54.589  18.271  9.014   0.70 34.49  ? 253  ARG A N   1 
ATOM   1952 N N   B ARG A 1 253 ? 54.577  18.278  9.015   0.30 36.53  ? 253  ARG A N   1 
ATOM   1953 C CA  A ARG A 1 253 ? 55.361  19.242  8.224   0.70 41.53  ? 253  ARG A CA  1 
ATOM   1954 C CA  B ARG A 1 253 ? 55.354  19.230  8.212   0.30 40.28  ? 253  ARG A CA  1 
ATOM   1955 C C   A ARG A 1 253 ? 54.892  20.681  8.509   0.70 43.46  ? 253  ARG A C   1 
ATOM   1956 C C   B ARG A 1 253 ? 54.893  20.682  8.421   0.30 41.76  ? 253  ARG A C   1 
ATOM   1957 O O   A ARG A 1 253 ? 55.702  21.568  8.828   0.70 42.80  ? 253  ARG A O   1 
ATOM   1958 O O   B ARG A 1 253 ? 55.715  21.587  8.579   0.30 43.13  ? 253  ARG A O   1 
ATOM   1959 C CB  A ARG A 1 253 ? 55.265  18.932  6.728   0.70 38.74  ? 253  ARG A CB  1 
ATOM   1960 C CB  B ARG A 1 253 ? 55.310  18.860  6.723   0.30 41.59  ? 253  ARG A CB  1 
ATOM   1961 C CG  A ARG A 1 253 ? 56.447  18.212  6.180   0.70 48.47  ? 253  ARG A CG  1 
ATOM   1962 C CG  B ARG A 1 253 ? 56.170  17.667  6.347   0.30 47.46  ? 253  ARG A CG  1 
ATOM   1963 C CD  A ARG A 1 253 ? 56.295  17.957  4.687   0.70 56.04  ? 253  ARG A CD  1 
ATOM   1964 C CD  B ARG A 1 253 ? 56.433  17.630  4.839   0.30 53.29  ? 253  ARG A CD  1 
ATOM   1965 N NE  A ARG A 1 253 ? 55.475  16.769  4.464   0.70 60.54  ? 253  ARG A NE  1 
ATOM   1966 N NE  B ARG A 1 253 ? 57.693  16.969  4.500   0.30 49.07  ? 253  ARG A NE  1 
ATOM   1967 C CZ  A ARG A 1 253 ? 54.683  16.586  3.415   0.70 57.28  ? 253  ARG A CZ  1 
ATOM   1968 C CZ  B ARG A 1 253 ? 57.797  15.717  4.063   0.30 44.48  ? 253  ARG A CZ  1 
ATOM   1969 N NH1 A ARG A 1 253 ? 53.975  15.468  3.331   0.70 48.28  ? 253  ARG A NH1 1 
ATOM   1970 N NH1 B ARG A 1 253 ? 58.994  15.217  3.780   0.30 38.45  ? 253  ARG A NH1 1 
ATOM   1971 N NH2 A ARG A 1 253 ? 54.595  17.522  2.465   0.70 54.72  ? 253  ARG A NH2 1 
ATOM   1972 N NH2 B ARG A 1 253 ? 56.712  14.965  3.906   0.30 40.56  ? 253  ARG A NH2 1 
ATOM   1973 N N   . LEU A 1 254 ? 53.578  20.892  8.435   1.00 34.39  ? 254  LEU A N   1 
ATOM   1974 C CA  . LEU A 1 254 ? 53.001  22.225  8.640   1.00 36.17  ? 254  LEU A CA  1 
ATOM   1975 C C   . LEU A 1 254 ? 53.361  22.867  9.969   1.00 36.26  ? 254  LEU A C   1 
ATOM   1976 O O   . LEU A 1 254 ? 53.322  24.084  10.083  1.00 39.20  ? 254  LEU A O   1 
ATOM   1977 C CB  . LEU A 1 254 ? 51.452  22.192  8.489   1.00 31.14  ? 254  LEU A CB  1 
ATOM   1978 C CG  . LEU A 1 254 ? 51.032  21.845  7.055   1.00 36.24  ? 254  LEU A CG  1 
ATOM   1979 C CD1 . LEU A 1 254 ? 49.534  21.795  6.860   1.00 34.02  ? 254  LEU A CD1 1 
ATOM   1980 C CD2 . LEU A 1 254 ? 51.684  22.830  6.072   1.00 38.78  ? 254  LEU A CD2 1 
ATOM   1981 N N   . VAL A 1 255 ? 53.670  22.062  10.983  1.00 42.65  ? 255  VAL A N   1 
ATOM   1982 C CA  . VAL A 1 255 ? 54.060  22.591  12.290  1.00 41.19  ? 255  VAL A CA  1 
ATOM   1983 C C   . VAL A 1 255 ? 55.537  22.346  12.558  1.00 51.15  ? 255  VAL A C   1 
ATOM   1984 O O   . VAL A 1 255 ? 55.995  22.434  13.692  1.00 56.54  ? 255  VAL A O   1 
ATOM   1985 C CB  . VAL A 1 255 ? 53.233  21.994  13.463  1.00 41.00  ? 255  VAL A CB  1 
ATOM   1986 C CG1 . VAL A 1 255 ? 51.737  22.330  13.302  1.00 35.04  ? 255  VAL A CG1 1 
ATOM   1987 C CG2 . VAL A 1 255 ? 53.450  20.469  13.618  1.00 35.48  ? 255  VAL A CG2 1 
ATOM   1988 N N   . GLY A 1 256 ? 56.291  22.024  11.521  1.00 54.26  ? 256  GLY A N   1 
ATOM   1989 C CA  . GLY A 1 256 ? 57.739  21.934  11.683  1.00 53.06  ? 256  GLY A CA  1 
ATOM   1990 C C   . GLY A 1 256 ? 58.281  20.670  12.322  1.00 54.11  ? 256  GLY A C   1 
ATOM   1991 O O   . GLY A 1 256 ? 59.159  20.727  13.157  1.00 56.29  ? 256  GLY A O   1 
ATOM   1992 N N   . CYS A 1 257 ? 57.769  19.518  11.923  1.00 57.82  ? 257  CYS A N   1 
ATOM   1993 C CA  . CYS A 1 257 ? 58.269  18.260  12.441  1.00 52.04  ? 257  CYS A CA  1 
ATOM   1994 C C   . CYS A 1 257 ? 58.694  17.391  11.282  1.00 56.58  ? 257  CYS A C   1 
ATOM   1995 O O   . CYS A 1 257 ? 57.868  17.093  10.429  1.00 65.06  ? 257  CYS A O   1 
ATOM   1996 C CB  . CYS A 1 257 ? 57.178  17.566  13.272  1.00 44.06  ? 257  CYS A CB  1 
ATOM   1997 S SG  . CYS A 1 257 ? 56.922  18.327  14.894  1.00 46.21  ? 257  CYS A SG  1 
ATOM   1998 N N   . ASN A 1 265 ? 61.114  8.007   10.111  1.00 70.16  ? 265  ASN A N   1 
ATOM   1999 C CA  . ASN A 1 265 ? 60.949  7.365   11.424  1.00 69.68  ? 265  ASN A CA  1 
ATOM   2000 C C   . ASN A 1 265 ? 59.732  7.920   12.209  1.00 58.77  ? 265  ASN A C   1 
ATOM   2001 O O   . ASN A 1 265 ? 59.708  9.110   12.561  1.00 53.89  ? 265  ASN A O   1 
ATOM   2002 C CB  . ASN A 1 265 ? 62.261  7.505   12.213  1.00 69.98  ? 265  ASN A CB  1 
ATOM   2003 C CG  . ASN A 1 265 ? 62.255  6.737   13.525  1.00 71.68  ? 265  ASN A CG  1 
ATOM   2004 O OD1 . ASN A 1 265 ? 61.764  7.234   14.538  1.00 67.25  ? 265  ASN A OD1 1 
ATOM   2005 N ND2 . ASN A 1 265 ? 62.849  5.532   13.523  1.00 72.55  ? 265  ASN A ND2 1 
ATOM   2006 N N   . ASP A 1 266 ? 58.719  7.079   12.463  1.00 46.86  ? 266  ASP A N   1 
ATOM   2007 C CA  . ASP A 1 266 ? 57.506  7.562   13.133  1.00 47.25  ? 266  ASP A CA  1 
ATOM   2008 C C   . ASP A 1 266 ? 57.776  8.073   14.542  1.00 51.04  ? 266  ASP A C   1 
ATOM   2009 O O   . ASP A 1 266 ? 57.204  9.081   14.958  1.00 49.15  ? 266  ASP A O   1 
ATOM   2010 C CB  . ASP A 1 266 ? 56.403  6.494   13.203  1.00 42.93  ? 266  ASP A CB  1 
ATOM   2011 C CG  . ASP A 1 266 ? 55.833  6.137   11.848  1.00 40.14  ? 266  ASP A CG  1 
ATOM   2012 O OD1 . ASP A 1 266 ? 56.019  6.904   10.876  1.00 47.27  ? 266  ASP A OD1 1 
ATOM   2013 O OD2 . ASP A 1 266 ? 55.183  5.075   11.743  1.00 44.13  ? 266  ASP A OD2 1 
ATOM   2014 N N   . THR A 1 267 ? 58.633  7.366   15.274  1.00 49.18  ? 267  THR A N   1 
ATOM   2015 C CA  . THR A 1 267 ? 58.936  7.679   16.674  1.00 47.16  ? 267  THR A CA  1 
ATOM   2016 C C   . THR A 1 267 ? 59.412  9.126   16.825  1.00 45.88  ? 267  THR A C   1 
ATOM   2017 O O   . THR A 1 267 ? 58.989  9.823   17.743  1.00 49.40  ? 267  THR A O   1 
ATOM   2018 C CB  . THR A 1 267 ? 60.018  6.699   17.253  1.00 50.91  ? 267  THR A CB  1 
ATOM   2019 O OG1 . THR A 1 267 ? 59.558  5.350   17.131  1.00 49.73  ? 267  THR A OG1 1 
ATOM   2020 C CG2 . THR A 1 267 ? 60.315  6.996   18.717  1.00 41.15  ? 267  THR A CG2 1 
ATOM   2021 N N   . GLU A 1 268 ? 60.289  9.565   15.925  1.00 41.65  ? 268  GLU A N   1 
ATOM   2022 C CA  . GLU A 1 268 ? 60.794  10.953  15.923  1.00 45.63  ? 268  GLU A CA  1 
ATOM   2023 C C   . GLU A 1 268 ? 59.735  11.987  15.501  1.00 41.17  ? 268  GLU A C   1 
ATOM   2024 O O   . GLU A 1 268 ? 59.588  13.007  16.139  1.00 47.02  ? 268  GLU A O   1 
ATOM   2025 C CB  . GLU A 1 268 ? 61.992  11.098  14.979  1.00 47.05  ? 268  GLU A CB  1 
ATOM   2026 C CG  . GLU A 1 268 ? 63.084  10.074  15.224  1.00 70.99  ? 268  GLU A CG  1 
ATOM   2027 C CD  . GLU A 1 268 ? 64.257  10.219  14.249  1.00 91.41  ? 268  GLU A CD  1 
ATOM   2028 O OE1 . GLU A 1 268 ? 64.373  11.289  13.582  1.00 91.34  ? 268  GLU A OE1 1 
ATOM   2029 O OE2 . GLU A 1 268 ? 65.062  9.256   14.159  1.00 99.92  ? 268  GLU A OE2 1 
ATOM   2030 N N   . LEU A 1 269 ? 59.066  11.744  14.383  1.00 36.08  ? 269  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 269 ? 57.959  12.585  13.955  1.00 45.79  ? 269  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 269 ? 56.970  12.805  15.116  1.00 43.71  ? 269  LEU A C   1 
ATOM   2033 O O   . LEU A 1 269 ? 56.655  13.930  15.461  1.00 45.16  ? 269  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 269 ? 57.264  11.960  12.744  1.00 42.31  ? 269  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 269 ? 56.149  12.766  12.105  1.00 51.59  ? 269  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 269 ? 55.956  12.335  10.679  1.00 56.93  ? 269  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 269 ? 54.866  12.559  12.883  1.00 48.61  ? 269  LEU A CD2 1 
ATOM   2038 N N   . ILE A 1 270 ? 56.524  11.716  15.737  1.00 45.12  ? 270  ILE A N   1 
ATOM   2039 C CA  . ILE A 1 270 ? 55.556  11.785  16.825  1.00 39.66  ? 270  ILE A CA  1 
ATOM   2040 C C   . ILE A 1 270 ? 56.064  12.507  18.066  1.00 37.53  ? 270  ILE A C   1 
ATOM   2041 O O   . ILE A 1 270 ? 55.326  13.266  18.685  1.00 41.68  ? 270  ILE A O   1 
ATOM   2042 C CB  . ILE A 1 270 ? 55.015  10.394  17.195  1.00 33.95  ? 270  ILE A CB  1 
ATOM   2043 C CG1 . ILE A 1 270 ? 54.345  9.768   15.976  1.00 38.07  ? 270  ILE A CG1 1 
ATOM   2044 C CG2 . ILE A 1 270 ? 54.021  10.504  18.333  1.00 30.71  ? 270  ILE A CG2 1 
ATOM   2045 C CD1 . ILE A 1 270 ? 54.170  8.274   16.086  1.00 46.50  ? 270  ILE A CD1 1 
ATOM   2046 N N   . ALA A 1 271 ? 57.319  12.271  18.425  1.00 36.11  ? 271  ALA A N   1 
ATOM   2047 C CA  . ALA A 1 271 ? 57.916  12.940  19.556  1.00 34.30  ? 271  ALA A CA  1 
ATOM   2048 C C   . ALA A 1 271 ? 57.927  14.433  19.275  1.00 42.05  ? 271  ALA A C   1 
ATOM   2049 O O   . ALA A 1 271 ? 57.701  15.253  20.162  1.00 44.82  ? 271  ALA A O   1 
ATOM   2050 C CB  . ALA A 1 271 ? 59.355  12.432  19.778  1.00 39.76  ? 271  ALA A CB  1 
ATOM   2051 N N   . CYS A 1 272 ? 58.195  14.796  18.027  1.00 41.79  ? 272  CYS A N   1 
ATOM   2052 C CA  . CYS A 1 272 ? 58.232  16.197  17.703  1.00 42.87  ? 272  CYS A CA  1 
ATOM   2053 C C   . CYS A 1 272 ? 56.806  16.766  17.824  1.00 39.18  ? 272  CYS A C   1 
ATOM   2054 O O   . CYS A 1 272 ? 56.627  17.796  18.491  1.00 34.63  ? 272  CYS A O   1 
ATOM   2055 C CB  . CYS A 1 272 ? 58.870  16.461  16.335  1.00 46.43  ? 272  CYS A CB  1 
ATOM   2056 S SG  . CYS A 1 272 ? 58.811  18.227  15.831  1.00 50.09  ? 272  CYS A SG  1 
ATOM   2057 N N   . LEU A 1 273 ? 55.808  16.065  17.265  1.00 32.98  ? 273  LEU A N   1 
ATOM   2058 C CA  . LEU A 1 273 ? 54.402  16.495  17.405  1.00 34.39  ? 273  LEU A CA  1 
ATOM   2059 C C   . LEU A 1 273 ? 54.024  16.693  18.882  1.00 35.73  ? 273  LEU A C   1 
ATOM   2060 O O   . LEU A 1 273 ? 53.283  17.626  19.208  1.00 39.96  ? 273  LEU A O   1 
ATOM   2061 C CB  . LEU A 1 273 ? 53.407  15.529  16.722  1.00 34.16  ? 273  LEU A CB  1 
ATOM   2062 C CG  . LEU A 1 273 ? 53.328  15.572  15.186  1.00 35.50  ? 273  LEU A CG  1 
ATOM   2063 C CD1 . LEU A 1 273 ? 52.404  14.516  14.659  1.00 34.44  ? 273  LEU A CD1 1 
ATOM   2064 C CD2 . LEU A 1 273 ? 52.911  16.932  14.634  1.00 36.61  ? 273  LEU A CD2 1 
ATOM   2065 N N   . ARG A 1 274 ? 54.561  15.842  19.765  1.00 30.58  ? 274  ARG A N   1 
ATOM   2066 C CA  . ARG A 1 274 ? 54.274  15.933  21.194  1.00 32.86  ? 274  ARG A CA  1 
ATOM   2067 C C   . ARG A 1 274 ? 54.871  17.182  21.849  1.00 38.30  ? 274  ARG A C   1 
ATOM   2068 O O   . ARG A 1 274 ? 54.435  17.577  22.925  1.00 38.46  ? 274  ARG A O   1 
ATOM   2069 C CB  . ARG A 1 274 ? 54.653  14.650  21.966  1.00 30.15  ? 274  ARG A CB  1 
ATOM   2070 C CG  . ARG A 1 274 ? 53.708  13.467  21.698  1.00 32.30  ? 274  ARG A CG  1 
ATOM   2071 C CD  . ARG A 1 274 ? 53.871  12.360  22.753  1.00 39.33  ? 274  ARG A CD  1 
ATOM   2072 N NE  . ARG A 1 274 ? 55.301  12.110  22.933  1.00 49.64  ? 274  ARG A NE  1 
ATOM   2073 C CZ  . ARG A 1 274 ? 55.955  11.102  22.355  1.00 50.13  ? 274  ARG A CZ  1 
ATOM   2074 N NH1 . ARG A 1 274 ? 55.257  10.232  21.605  1.00 38.18  ? 274  ARG A NH1 1 
ATOM   2075 N NH2 . ARG A 1 274 ? 57.288  10.961  22.532  1.00 40.54  ? 274  ARG A NH2 1 
ATOM   2076 N N   . THR A 1 275 ? 55.835  17.832  21.202  1.00 33.66  ? 275  THR A N   1 
ATOM   2077 C CA  . THR A 1 275 ? 56.378  19.056  21.778  1.00 36.41  ? 275  THR A CA  1 
ATOM   2078 C C   . THR A 1 275 ? 55.578  20.299  21.341  1.00 39.47  ? 275  THR A C   1 
ATOM   2079 O O   . THR A 1 275 ? 55.778  21.373  21.887  1.00 42.71  ? 275  THR A O   1 
ATOM   2080 C CB  . THR A 1 275 ? 57.857  19.284  21.382  1.00 35.85  ? 275  THR A CB  1 
ATOM   2081 O OG1 . THR A 1 275 ? 57.919  19.588  19.978  1.00 39.11  ? 275  THR A OG1 1 
ATOM   2082 C CG2 . THR A 1 275 ? 58.719  18.041  21.697  1.00 29.61  ? 275  THR A CG2 1 
ATOM   2083 N N   . ARG A 1 276 ? 54.696  20.157  20.355  1.00 36.38  ? 276  ARG A N   1 
ATOM   2084 C CA  . ARG A 1 276 ? 53.909  21.287  19.845  1.00 36.73  ? 276  ARG A CA  1 
ATOM   2085 C C   . ARG A 1 276 ? 52.744  21.726  20.760  1.00 37.92  ? 276  ARG A C   1 
ATOM   2086 O O   . ARG A 1 276 ? 52.058  20.902  21.348  1.00 31.56  ? 276  ARG A O   1 
ATOM   2087 C CB  . ARG A 1 276 ? 53.382  20.977  18.442  1.00 35.61  ? 276  ARG A CB  1 
ATOM   2088 C CG  . ARG A 1 276 ? 54.506  20.821  17.443  1.00 42.64  ? 276  ARG A CG  1 
ATOM   2089 C CD  . ARG A 1 276 ? 55.337  22.089  17.381  1.00 47.92  ? 276  ARG A CD  1 
ATOM   2090 N NE  . ARG A 1 276 ? 56.464  21.950  16.472  1.00 61.56  ? 276  ARG A NE  1 
ATOM   2091 C CZ  . ARG A 1 276 ? 57.739  21.818  16.856  1.00 65.23  ? 276  ARG A CZ  1 
ATOM   2092 N NH1 . ARG A 1 276 ? 58.064  21.820  18.151  1.00 61.67  ? 276  ARG A NH1 1 
ATOM   2093 N NH2 . ARG A 1 276 ? 58.692  21.694  15.938  1.00 60.73  ? 276  ARG A NH2 1 
ATOM   2094 N N   . PRO A 1 277 ? 52.562  23.044  20.907  1.00 38.29  ? 277  PRO A N   1 
ATOM   2095 C CA  . PRO A 1 277 ? 51.416  23.602  21.624  1.00 28.37  ? 277  PRO A CA  1 
ATOM   2096 C C   . PRO A 1 277 ? 50.132  23.001  21.052  1.00 33.80  ? 277  PRO A C   1 
ATOM   2097 O O   . PRO A 1 277 ? 50.015  22.914  19.838  1.00 35.96  ? 277  PRO A O   1 
ATOM   2098 C CB  . PRO A 1 277 ? 51.475  25.095  21.261  1.00 36.31  ? 277  PRO A CB  1 
ATOM   2099 C CG  . PRO A 1 277 ? 52.980  25.391  21.024  1.00 28.17  ? 277  PRO A CG  1 
ATOM   2100 C CD  . PRO A 1 277 ? 53.564  24.066  20.511  1.00 34.86  ? 277  PRO A CD  1 
ATOM   2101 N N   . ALA A 1 278 ? 49.209  22.556  21.898  1.00 31.08  ? 278  ALA A N   1 
ATOM   2102 C CA  . ALA A 1 278 ? 47.888  22.153  21.406  1.00 35.04  ? 278  ALA A CA  1 
ATOM   2103 C C   . ALA A 1 278 ? 47.369  23.091  20.317  1.00 31.88  ? 278  ALA A C   1 
ATOM   2104 O O   . ALA A 1 278 ? 46.943  22.642  19.261  1.00 32.54  ? 278  ALA A O   1 
ATOM   2105 C CB  . ALA A 1 278 ? 46.871  22.029  22.568  1.00 23.55  ? 278  ALA A CB  1 
ATOM   2106 N N   . GLN A 1 279 ? 47.435  24.394  20.543  1.00 35.61  ? 279  GLN A N   1 
ATOM   2107 C CA  . GLN A 1 279 ? 46.749  25.317  19.621  1.00 33.15  ? 279  GLN A CA  1 
ATOM   2108 C C   . GLN A 1 279 ? 47.384  25.321  18.231  1.00 35.86  ? 279  GLN A C   1 
ATOM   2109 O O   . GLN A 1 279 ? 46.679  25.550  17.240  1.00 33.29  ? 279  GLN A O   1 
ATOM   2110 C CB  . GLN A 1 279 ? 46.666  26.743  20.196  1.00 29.05  ? 279  GLN A CB  1 
ATOM   2111 C CG  . GLN A 1 279 ? 45.821  27.707  19.380  1.00 31.03  ? 279  GLN A CG  1 
ATOM   2112 C CD  . GLN A 1 279 ? 44.347  27.346  19.450  1.00 36.26  ? 279  GLN A CD  1 
ATOM   2113 O OE1 . GLN A 1 279 ? 43.795  27.154  20.536  1.00 39.44  ? 279  GLN A OE1 1 
ATOM   2114 N NE2 . GLN A 1 279 ? 43.722  27.201  18.296  1.00 36.36  ? 279  GLN A NE2 1 
ATOM   2115 N N   . ASP A 1 280 ? 48.702  25.075  18.146  1.00 32.73  ? 280  ASP A N   1 
ATOM   2116 C CA  . ASP A 1 280 ? 49.365  24.953  16.836  1.00 28.64  ? 280  ASP A CA  1 
ATOM   2117 C C   . ASP A 1 280 ? 48.798  23.788  16.021  1.00 32.01  ? 280  ASP A C   1 
ATOM   2118 O O   . ASP A 1 280 ? 48.671  23.897  14.814  1.00 39.55  ? 280  ASP A O   1 
ATOM   2119 C CB  . ASP A 1 280 ? 50.879  24.714  16.980  1.00 38.42  ? 280  ASP A CB  1 
ATOM   2120 C CG  . ASP A 1 280 ? 51.655  25.968  17.369  1.00 55.26  ? 280  ASP A CG  1 
ATOM   2121 O OD1 . ASP A 1 280 ? 51.031  27.029  17.596  1.00 61.55  ? 280  ASP A OD1 1 
ATOM   2122 O OD2 . ASP A 1 280 ? 52.910  25.888  17.460  1.00 68.35  ? 280  ASP A OD2 1 
ATOM   2123 N N   . LEU A 1 281 ? 48.509  22.656  16.679  1.00 33.80  ? 281  LEU A N   1 
ATOM   2124 C CA  . LEU A 1 281 ? 47.926  21.501  15.991  1.00 32.80  ? 281  LEU A CA  1 
ATOM   2125 C C   . LEU A 1 281 ? 46.553  21.893  15.479  1.00 30.46  ? 281  LEU A C   1 
ATOM   2126 O O   . LEU A 1 281 ? 46.226  21.642  14.316  1.00 32.17  ? 281  LEU A O   1 
ATOM   2127 C CB  . LEU A 1 281 ? 47.832  20.256  16.906  1.00 30.47  ? 281  LEU A CB  1 
ATOM   2128 C CG  . LEU A 1 281 ? 49.216  19.791  17.458  1.00 30.92  ? 281  LEU A CG  1 
ATOM   2129 C CD1 . LEU A 1 281 ? 49.123  18.524  18.272  1.00 27.02  ? 281  LEU A CD1 1 
ATOM   2130 C CD2 . LEU A 1 281 ? 50.163  19.573  16.318  1.00 29.95  ? 281  LEU A CD2 1 
ATOM   2131 N N   . VAL A 1 282 ? 45.763  22.544  16.336  1.00 35.92  ? 282  VAL A N   1 
ATOM   2132 C CA  . VAL A 1 282 ? 44.407  22.947  15.953  1.00 33.59  ? 282  VAL A CA  1 
ATOM   2133 C C   . VAL A 1 282 ? 44.496  23.908  14.775  1.00 35.64  ? 282  VAL A C   1 
ATOM   2134 O O   . VAL A 1 282 ? 43.759  23.751  13.813  1.00 34.63  ? 282  VAL A O   1 
ATOM   2135 C CB  . VAL A 1 282 ? 43.606  23.578  17.130  1.00 36.16  ? 282  VAL A CB  1 
ATOM   2136 C CG1 . VAL A 1 282 ? 42.366  24.305  16.610  1.00 33.31  ? 282  VAL A CG1 1 
ATOM   2137 C CG2 . VAL A 1 282 ? 43.190  22.492  18.141  1.00 31.45  ? 282  VAL A CG2 1 
ATOM   2138 N N   . ASP A 1 283 ? 45.434  24.864  14.827  1.00 36.14  ? 283  ASP A N   1 
ATOM   2139 C CA  . ASP A 1 283 ? 45.549  25.864  13.762  1.00 37.84  ? 283  ASP A CA  1 
ATOM   2140 C C   . ASP A 1 283 ? 45.825  25.283  12.373  1.00 39.23  ? 283  ASP A C   1 
ATOM   2141 O O   . ASP A 1 283 ? 45.595  25.951  11.382  1.00 37.71  ? 283  ASP A O   1 
ATOM   2142 C CB  . ASP A 1 283 ? 46.633  26.932  14.079  1.00 28.84  ? 283  ASP A CB  1 
ATOM   2143 C CG  . ASP A 1 283 ? 46.212  27.901  15.210  1.00 42.08  ? 283  ASP A CG  1 
ATOM   2144 O OD1 . ASP A 1 283 ? 45.031  27.897  15.626  1.00 36.68  ? 283  ASP A OD1 1 
ATOM   2145 O OD2 . ASP A 1 283 ? 47.088  28.672  15.693  1.00 55.89  ? 283  ASP A OD2 1 
ATOM   2146 N N   . HIS A 1 284 ? 46.353  24.067  12.280  1.00 38.37  ? 284  HIS A N   1 
ATOM   2147 C CA  . HIS A 1 284 ? 46.716  23.558  10.956  1.00 32.94  ? 284  HIS A CA  1 
ATOM   2148 C C   . HIS A 1 284 ? 45.920  22.333  10.515  1.00 32.84  ? 284  HIS A C   1 
ATOM   2149 O O   . HIS A 1 284 ? 46.014  21.894  9.353   1.00 32.57  ? 284  HIS A O   1 
ATOM   2150 C CB  . HIS A 1 284 ? 48.205  23.246  10.925  1.00 30.27  ? 284  HIS A CB  1 
ATOM   2151 C CG  . HIS A 1 284 ? 49.059  24.470  10.913  1.00 36.13  ? 284  HIS A CG  1 
ATOM   2152 N ND1 . HIS A 1 284 ? 49.672  24.959  12.044  1.00 44.29  ? 284  HIS A ND1 1 
ATOM   2153 C CD2 . HIS A 1 284 ? 49.376  25.320  9.910   1.00 40.00  ? 284  HIS A CD2 1 
ATOM   2154 C CE1 . HIS A 1 284 ? 50.358  26.047  11.731  1.00 49.19  ? 284  HIS A CE1 1 
ATOM   2155 N NE2 . HIS A 1 284 ? 50.190  26.291  10.444  1.00 47.07  ? 284  HIS A NE2 1 
ATOM   2156 N N   . GLU A 1 285 ? 45.121  21.795  11.417  1.00 27.58  ? 285  GLU A N   1 
ATOM   2157 C CA  . GLU A 1 285 ? 44.517  20.489  11.145  1.00 35.09  ? 285  GLU A CA  1 
ATOM   2158 C C   . GLU A 1 285 ? 43.669  20.488  9.869   1.00 37.72  ? 285  GLU A C   1 
ATOM   2159 O O   . GLU A 1 285 ? 43.703  19.540  9.089   1.00 37.23  ? 285  GLU A O   1 
ATOM   2160 C CB  . GLU A 1 285 ? 43.746  19.975  12.352  1.00 32.97  ? 285  GLU A CB  1 
ATOM   2161 C CG  . GLU A 1 285 ? 42.499  20.781  12.680  1.00 43.22  ? 285  GLU A CG  1 
ATOM   2162 C CD  . GLU A 1 285 ? 41.615  20.098  13.744  1.00 47.77  ? 285  GLU A CD  1 
ATOM   2163 O OE1 . GLU A 1 285 ? 40.567  20.676  14.120  1.00 44.41  ? 285  GLU A OE1 1 
ATOM   2164 O OE2 . GLU A 1 285 ? 41.988  18.988  14.198  1.00 45.76  ? 285  GLU A OE2 1 
ATOM   2165 N N   . TRP A 1 286 ? 42.978  21.586  9.617   1.00 34.93  ? 286  TRP A N   1 
ATOM   2166 C CA  . TRP A 1 286 ? 42.044  21.662  8.505   1.00 35.61  ? 286  TRP A CA  1 
ATOM   2167 C C   . TRP A 1 286 ? 42.760  21.741  7.142   1.00 40.85  ? 286  TRP A C   1 
ATOM   2168 O O   . TRP A 1 286 ? 42.178  21.413  6.114   1.00 45.33  ? 286  TRP A O   1 
ATOM   2169 C CB  . TRP A 1 286 ? 41.117  22.855  8.726   1.00 33.58  ? 286  TRP A CB  1 
ATOM   2170 C CG  . TRP A 1 286 ? 39.796  22.791  8.041   1.00 45.94  ? 286  TRP A CG  1 
ATOM   2171 C CD1 . TRP A 1 286 ? 39.375  21.867  7.113   1.00 46.18  ? 286  TRP A CD1 1 
ATOM   2172 C CD2 . TRP A 1 286 ? 38.734  23.756  8.154   1.00 53.47  ? 286  TRP A CD2 1 
ATOM   2173 N NE1 . TRP A 1 286 ? 38.114  22.190  6.665   1.00 48.36  ? 286  TRP A NE1 1 
ATOM   2174 C CE2 . TRP A 1 286 ? 37.697  23.341  7.286   1.00 54.01  ? 286  TRP A CE2 1 
ATOM   2175 C CE3 . TRP A 1 286 ? 38.560  24.931  8.908   1.00 53.22  ? 286  TRP A CE3 1 
ATOM   2176 C CZ2 . TRP A 1 286 ? 36.490  24.064  7.159   1.00 51.48  ? 286  TRP A CZ2 1 
ATOM   2177 C CZ3 . TRP A 1 286 ? 37.370  25.633  8.783   1.00 52.32  ? 286  TRP A CZ3 1 
ATOM   2178 C CH2 . TRP A 1 286 ? 36.354  25.200  7.906   1.00 51.70  ? 286  TRP A CH2 1 
ATOM   2179 N N   . HIS A 1 287 ? 44.032  22.126  7.148   1.00 35.73  ? 287  HIS A N   1 
ATOM   2180 C CA  . HIS A 1 287 ? 44.812  22.290  5.921   1.00 39.87  ? 287  HIS A CA  1 
ATOM   2181 C C   . HIS A 1 287 ? 45.227  20.986  5.235   1.00 43.55  ? 287  HIS A C   1 
ATOM   2182 O O   . HIS A 1 287 ? 45.714  21.001  4.118   1.00 46.06  ? 287  HIS A O   1 
ATOM   2183 C CB  . HIS A 1 287 ? 46.064  23.135  6.204   1.00 43.43  ? 287  HIS A CB  1 
ATOM   2184 C CG  . HIS A 1 287 ? 45.754  24.511  6.706   1.00 56.23  ? 287  HIS A CG  1 
ATOM   2185 N ND1 . HIS A 1 287 ? 46.535  25.161  7.638   1.00 62.07  ? 287  HIS A ND1 1 
ATOM   2186 C CD2 . HIS A 1 287 ? 44.732  25.354  6.418   1.00 60.51  ? 287  HIS A CD2 1 
ATOM   2187 C CE1 . HIS A 1 287 ? 46.014  26.348  7.895   1.00 64.71  ? 287  HIS A CE1 1 
ATOM   2188 N NE2 . HIS A 1 287 ? 44.920  26.490  7.165   1.00 63.82  ? 287  HIS A NE2 1 
ATOM   2189 N N   . VAL A 1 288 ? 45.011  19.847  5.870   1.00 39.64  ? 288  VAL A N   1 
ATOM   2190 C CA  . VAL A 1 288 ? 45.482  18.609  5.256   1.00 38.94  ? 288  VAL A CA  1 
ATOM   2191 C C   . VAL A 1 288 ? 44.480  17.828  4.415   1.00 37.46  ? 288  VAL A C   1 
ATOM   2192 O O   . VAL A 1 288 ? 44.826  16.742  3.928   1.00 34.27  ? 288  VAL A O   1 
ATOM   2193 C CB  . VAL A 1 288 ? 46.068  17.640  6.304   1.00 35.47  ? 288  VAL A CB  1 
ATOM   2194 C CG1 . VAL A 1 288 ? 47.109  18.369  7.146   1.00 35.23  ? 288  VAL A CG1 1 
ATOM   2195 C CG2 . VAL A 1 288 ? 44.960  17.028  7.168   1.00 26.76  ? 288  VAL A CG2 1 
ATOM   2196 N N   . LEU A 1 289 ? 43.256  18.344  4.258   1.00 32.51  ? 289  LEU A N   1 
ATOM   2197 C CA  . LEU A 1 289 ? 42.258  17.711  3.369   1.00 38.02  ? 289  LEU A CA  1 
ATOM   2198 C C   . LEU A 1 289 ? 42.723  17.702  1.911   1.00 36.90  ? 289  LEU A C   1 
ATOM   2199 O O   . LEU A 1 289 ? 43.250  18.679  1.440   1.00 46.04  ? 289  LEU A O   1 
ATOM   2200 C CB  . LEU A 1 289 ? 40.879  18.400  3.465   1.00 29.28  ? 289  LEU A CB  1 
ATOM   2201 C CG  . LEU A 1 289 ? 40.051  18.150  4.729   1.00 36.41  ? 289  LEU A CG  1 
ATOM   2202 C CD1 . LEU A 1 289 ? 38.690  18.882  4.687   1.00 33.86  ? 289  LEU A CD1 1 
ATOM   2203 C CD2 . LEU A 1 289 ? 39.870  16.659  4.966   1.00 30.99  ? 289  LEU A CD2 1 
ATOM   2204 N N   . PRO A 1 290 ? 42.506  16.596  1.185   1.00 42.10  ? 290  PRO A N   1 
ATOM   2205 C CA  . PRO A 1 290 ? 43.064  16.487  -0.181  1.00 40.86  ? 290  PRO A CA  1 
ATOM   2206 C C   . PRO A 1 290 ? 42.331  17.353  -1.220  1.00 45.03  ? 290  PRO A C   1 
ATOM   2207 O O   . PRO A 1 290 ? 42.932  17.695  -2.234  1.00 42.39  ? 290  PRO A O   1 
ATOM   2208 C CB  . PRO A 1 290 ? 42.888  15.002  -0.538  1.00 41.91  ? 290  PRO A CB  1 
ATOM   2209 C CG  . PRO A 1 290 ? 42.006  14.408  0.560   1.00 41.81  ? 290  PRO A CG  1 
ATOM   2210 C CD  . PRO A 1 290 ? 41.584  15.500  1.511   1.00 34.73  ? 290  PRO A CD  1 
ATOM   2211 N N   . GLN A 1 291 ? 41.063  17.691  -0.981  1.00 43.43  ? 291  GLN A N   1 
ATOM   2212 C CA  . GLN A 1 291 ? 40.332  18.594  -1.884  1.00 46.53  ? 291  GLN A CA  1 
ATOM   2213 C C   . GLN A 1 291 ? 39.469  19.613  -1.115  1.00 44.44  ? 291  GLN A C   1 
ATOM   2214 O O   . GLN A 1 291 ? 39.208  19.433  0.068   1.00 42.22  ? 291  GLN A O   1 
ATOM   2215 C CB  . GLN A 1 291 ? 39.435  17.806  -2.856  1.00 44.59  ? 291  GLN A CB  1 
ATOM   2216 C CG  . GLN A 1 291 ? 40.067  16.601  -3.533  1.00 43.98  ? 291  GLN A CG  1 
ATOM   2217 C CD  . GLN A 1 291 ? 39.783  15.290  -2.788  1.00 54.96  ? 291  GLN A CD  1 
ATOM   2218 O OE1 . GLN A 1 291 ? 40.386  14.235  -3.084  1.00 58.14  ? 291  GLN A OE1 1 
ATOM   2219 N NE2 . GLN A 1 291 ? 38.862  15.345  -1.821  1.00 46.99  ? 291  GLN A NE2 1 
ATOM   2220 N N   . GLU A 1 292 ? 39.047  20.682  -1.788  1.00 46.21  ? 292  GLU A N   1 
ATOM   2221 C CA  . GLU A 1 292 ? 38.127  21.651  -1.221  1.00 46.40  ? 292  GLU A CA  1 
ATOM   2222 C C   . GLU A 1 292 ? 36.861  20.879  -0.980  1.00 39.35  ? 292  GLU A C   1 
ATOM   2223 O O   . GLU A 1 292 ? 36.351  20.269  -1.907  1.00 43.21  ? 292  GLU A O   1 
ATOM   2224 C CB  . GLU A 1 292 ? 37.867  22.780  -2.226  1.00 56.04  ? 292  GLU A CB  1 
ATOM   2225 C CG  . GLU A 1 292 ? 37.154  24.002  -1.648  1.00 66.74  ? 292  GLU A CG  1 
ATOM   2226 C CD  . GLU A 1 292 ? 36.800  25.045  -2.731  1.00 85.31  ? 292  GLU A CD  1 
ATOM   2227 O OE1 . GLU A 1 292 ? 37.376  24.970  -3.850  1.00 89.95  ? 292  GLU A OE1 1 
ATOM   2228 O OE2 . GLU A 1 292 ? 35.952  25.946  -2.469  1.00 89.11  ? 292  GLU A OE2 1 
ATOM   2229 N N   . SER A 1 293 ? 36.352  20.869  0.248   1.00 37.82  ? 293  SER A N   1 
ATOM   2230 C CA  . SER A 1 293 ? 35.249  19.954  0.570   1.00 33.21  ? 293  SER A CA  1 
ATOM   2231 C C   . SER A 1 293 ? 34.232  20.567  1.473   1.00 31.34  ? 293  SER A C   1 
ATOM   2232 O O   . SER A 1 293 ? 34.489  21.582  2.101   1.00 29.87  ? 293  SER A O   1 
ATOM   2233 C CB  . SER A 1 293 ? 35.767  18.731  1.333   1.00 35.82  ? 293  SER A CB  1 
ATOM   2234 O OG  . SER A 1 293 ? 36.970  18.254  0.812   1.00 42.69  ? 293  SER A OG  1 
ATOM   2235 N N   . ILE A 1 294 ? 33.069  19.919  1.566   1.00 36.07  ? 294  ILE A N   1 
ATOM   2236 C CA  . ILE A 1 294 ? 32.247  20.050  2.761   1.00 35.26  ? 294  ILE A CA  1 
ATOM   2237 C C   . ILE A 1 294 ? 31.871  18.654  3.237   1.00 33.81  ? 294  ILE A C   1 
ATOM   2238 O O   . ILE A 1 294 ? 31.976  17.692  2.483   1.00 33.91  ? 294  ILE A O   1 
ATOM   2239 C CB  . ILE A 1 294 ? 31.018  20.904  2.551   1.00 37.68  ? 294  ILE A CB  1 
ATOM   2240 C CG1 . ILE A 1 294 ? 30.143  20.309  1.464   1.00 35.83  ? 294  ILE A CG1 1 
ATOM   2241 C CG2 . ILE A 1 294 ? 31.416  22.363  2.266   1.00 36.93  ? 294  ILE A CG2 1 
ATOM   2242 C CD1 . ILE A 1 294 ? 28.911  21.125  1.233   1.00 37.54  ? 294  ILE A CD1 1 
ATOM   2243 N N   . PHE A 1 295 ? 31.496  18.541  4.506   1.00 31.66  ? 295  PHE A N   1 
ATOM   2244 C CA  . PHE A 1 295 ? 31.181  17.249  5.106   1.00 28.14  ? 295  PHE A CA  1 
ATOM   2245 C C   . PHE A 1 295 ? 32.385  16.309  4.940   1.00 31.44  ? 295  PHE A C   1 
ATOM   2246 O O   . PHE A 1 295 ? 32.220  15.128  4.644   1.00 29.49  ? 295  PHE A O   1 
ATOM   2247 C CB  . PHE A 1 295 ? 29.895  16.641  4.490   1.00 24.15  ? 295  PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 295 ? 28.950  16.003  5.513   1.00 29.57  ? 295  PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 295 ? 29.431  15.069  6.449   1.00 25.65  ? 295  PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 295 ? 27.574  16.350  5.548   1.00 27.60  ? 295  PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 295 ? 28.580  14.470  7.384   1.00 30.86  ? 295  PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 295 ? 26.687  15.749  6.483   1.00 21.50  ? 295  PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 295 ? 27.176  14.822  7.405   1.00 29.97  ? 295  PHE A CZ  1 
ATOM   2254 N N   . ARG A 1 296 ? 33.597  16.855  5.115   1.00 29.11  ? 296  ARG A N   1 
ATOM   2255 C CA  . ARG A 1 296 ? 34.814  16.033  5.223   1.00 31.13  ? 296  ARG A CA  1 
ATOM   2256 C C   . ARG A 1 296 ? 35.689  16.543  6.356   1.00 29.40  ? 296  ARG A C   1 
ATOM   2257 O O   . ARG A 1 296 ? 35.799  17.749  6.585   1.00 29.72  ? 296  ARG A O   1 
ATOM   2258 C CB  . ARG A 1 296 ? 35.622  15.966  3.912   1.00 31.23  ? 296  ARG A CB  1 
ATOM   2259 C CG  . ARG A 1 296 ? 34.901  15.315  2.687   1.00 31.62  ? 296  ARG A CG  1 
ATOM   2260 C CD  . ARG A 1 296 ? 34.720  13.791  2.759   1.00 31.29  ? 296  ARG A CD  1 
ATOM   2261 N NE  . ARG A 1 296 ? 34.163  13.290  1.503   1.00 33.36  ? 296  ARG A NE  1 
ATOM   2262 C CZ  . ARG A 1 296 ? 32.855  13.229  1.243   1.00 33.93  ? 296  ARG A CZ  1 
ATOM   2263 N NH1 . ARG A 1 296 ? 31.972  13.600  2.164   1.00 29.01  ? 296  ARG A NH1 1 
ATOM   2264 N NH2 . ARG A 1 296 ? 32.434  12.802  0.068   1.00 32.32  ? 296  ARG A NH2 1 
ATOM   2265 N N   . PHE A 1 297 ? 36.340  15.636  7.069   1.00 25.55  ? 297  PHE A N   1 
ATOM   2266 C CA  . PHE A 1 297 ? 37.050  16.042  8.281   1.00 23.04  ? 297  PHE A CA  1 
ATOM   2267 C C   . PHE A 1 297 ? 38.440  15.406  8.307   1.00 32.75  ? 297  PHE A C   1 
ATOM   2268 O O   . PHE A 1 297 ? 38.603  14.235  7.926   1.00 32.29  ? 297  PHE A O   1 
ATOM   2269 C CB  . PHE A 1 297 ? 36.213  15.674  9.491   1.00 27.37  ? 297  PHE A CB  1 
ATOM   2270 C CG  . PHE A 1 297 ? 34.722  15.982  9.303   1.00 28.80  ? 297  PHE A CG  1 
ATOM   2271 C CD1 . PHE A 1 297 ? 34.269  17.299  9.308   1.00 26.27  ? 297  PHE A CD1 1 
ATOM   2272 C CD2 . PHE A 1 297 ? 33.807  14.962  9.075   1.00 29.01  ? 297  PHE A CD2 1 
ATOM   2273 C CE1 . PHE A 1 297 ? 32.892  17.611  9.089   1.00 30.88  ? 297  PHE A CE1 1 
ATOM   2274 C CE2 . PHE A 1 297 ? 32.436  15.249  8.876   1.00 28.37  ? 297  PHE A CE2 1 
ATOM   2275 C CZ  . PHE A 1 297 ? 31.977  16.580  8.887   1.00 24.34  ? 297  PHE A CZ  1 
ATOM   2276 N N   . SER A 1 298 ? 39.427  16.188  8.741   1.00 26.11  ? 298  SER A N   1 
ATOM   2277 C CA  . SER A 1 298 ? 40.839  15.826  8.622   1.00 29.89  ? 298  SER A CA  1 
ATOM   2278 C C   . SER A 1 298 ? 41.222  14.573  9.391   1.00 27.78  ? 298  SER A C   1 
ATOM   2279 O O   . SER A 1 298 ? 41.768  13.635  8.825   1.00 35.37  ? 298  SER A O   1 
ATOM   2280 C CB  . SER A 1 298 ? 41.687  16.996  9.087   1.00 29.32  ? 298  SER A CB  1 
ATOM   2281 O OG  . SER A 1 298 ? 41.413  18.057  8.211   1.00 39.36  ? 298  SER A OG  1 
ATOM   2282 N N   . PHE A 1 299 ? 40.843  14.537  10.662  1.00 25.32  ? 299  PHE A N   1 
ATOM   2283 C CA  . PHE A 1 299 ? 41.240  13.466  11.538  1.00 29.22  ? 299  PHE A CA  1 
ATOM   2284 C C   . PHE A 1 299 ? 40.047  12.711  12.119  1.00 33.81  ? 299  PHE A C   1 
ATOM   2285 O O   . PHE A 1 299 ? 39.353  13.211  13.033  1.00 30.15  ? 299  PHE A O   1 
ATOM   2286 C CB  . PHE A 1 299 ? 42.190  14.039  12.588  1.00 27.41  ? 299  PHE A CB  1 
ATOM   2287 C CG  . PHE A 1 299 ? 43.470  14.560  11.980  1.00 25.73  ? 299  PHE A CG  1 
ATOM   2288 C CD1 . PHE A 1 299 ? 44.536  13.714  11.772  1.00 26.37  ? 299  PHE A CD1 1 
ATOM   2289 C CD2 . PHE A 1 299 ? 43.580  15.883  11.583  1.00 28.02  ? 299  PHE A CD2 1 
ATOM   2290 C CE1 . PHE A 1 299 ? 45.722  14.179  11.211  1.00 28.96  ? 299  PHE A CE1 1 
ATOM   2291 C CE2 . PHE A 1 299 ? 44.773  16.373  11.006  1.00 32.07  ? 299  PHE A CE2 1 
ATOM   2292 C CZ  . PHE A 1 299 ? 45.846  15.496  10.818  1.00 28.05  ? 299  PHE A CZ  1 
ATOM   2293 N N   . VAL A 1 300 ? 39.832  11.505  11.564  1.00 26.46  ? 300  VAL A N   1 
ATOM   2294 C CA  . VAL A 1 300 ? 38.660  10.674  11.873  1.00 23.47  ? 300  VAL A CA  1 
ATOM   2295 C C   . VAL A 1 300 ? 39.159  9.214   12.090  1.00 31.17  ? 300  VAL A C   1 
ATOM   2296 O O   . VAL A 1 300 ? 40.333  8.921   11.913  1.00 29.73  ? 300  VAL A O   1 
ATOM   2297 C CB  . VAL A 1 300 ? 37.631  10.708  10.697  1.00 19.04  ? 300  VAL A CB  1 
ATOM   2298 C CG1 . VAL A 1 300 ? 37.165  12.103  10.404  1.00 20.49  ? 300  VAL A CG1 1 
ATOM   2299 C CG2 . VAL A 1 300 ? 38.256  10.098  9.405   1.00 25.31  ? 300  VAL A CG2 1 
ATOM   2300 N N   . PRO A 1 301 ? 38.268  8.305   12.502  1.00 31.88  ? 301  PRO A N   1 
ATOM   2301 C CA  . PRO A 1 301 ? 38.695  6.898   12.632  1.00 29.90  ? 301  PRO A CA  1 
ATOM   2302 C C   . PRO A 1 301 ? 39.371  6.353   11.376  1.00 31.48  ? 301  PRO A C   1 
ATOM   2303 O O   . PRO A 1 301 ? 38.974  6.621   10.235  1.00 32.41  ? 301  PRO A O   1 
ATOM   2304 C CB  . PRO A 1 301 ? 37.375  6.158   12.909  1.00 27.64  ? 301  PRO A CB  1 
ATOM   2305 C CG  . PRO A 1 301 ? 36.609  7.186   13.766  1.00 26.04  ? 301  PRO A CG  1 
ATOM   2306 C CD  . PRO A 1 301 ? 36.911  8.528   13.035  1.00 30.07  ? 301  PRO A CD  1 
ATOM   2307 N N   . VAL A 1 302 ? 40.421  5.593   11.613  1.00 32.26  ? 302  VAL A N   1 
ATOM   2308 C CA  . VAL A 1 302 ? 41.210  5.041   10.554  1.00 32.23  ? 302  VAL A CA  1 
ATOM   2309 C C   . VAL A 1 302 ? 40.962  3.520   10.509  1.00 33.43  ? 302  VAL A C   1 
ATOM   2310 O O   . VAL A 1 302 ? 40.773  2.881   11.547  1.00 34.28  ? 302  VAL A O   1 
ATOM   2311 C CB  . VAL A 1 302 ? 42.723  5.361   10.788  1.00 31.78  ? 302  VAL A CB  1 
ATOM   2312 C CG1 . VAL A 1 302 ? 43.212  4.873   12.175  1.00 24.79  ? 302  VAL A CG1 1 
ATOM   2313 C CG2 . VAL A 1 302 ? 43.540  4.766   9.711   1.00 28.01  ? 302  VAL A CG2 1 
ATOM   2314 N N   . VAL A 1 303 ? 40.945  2.937   9.313   1.00 32.55  ? 303  VAL A N   1 
ATOM   2315 C CA  . VAL A 1 303 ? 40.811  1.492   9.209   1.00 36.48  ? 303  VAL A CA  1 
ATOM   2316 C C   . VAL A 1 303 ? 42.205  0.887   9.525   1.00 43.03  ? 303  VAL A C   1 
ATOM   2317 O O   . VAL A 1 303 ? 43.070  0.787   8.655   1.00 42.83  ? 303  VAL A O   1 
ATOM   2318 C CB  . VAL A 1 303 ? 40.297  1.109   7.847   1.00 37.26  ? 303  VAL A CB  1 
ATOM   2319 C CG1 . VAL A 1 303 ? 40.081  -0.410  7.748   1.00 34.54  ? 303  VAL A CG1 1 
ATOM   2320 C CG2 . VAL A 1 303 ? 39.015  1.837   7.599   1.00 31.07  ? 303  VAL A CG2 1 
ATOM   2321 N N   . ASP A 1 304 ? 42.417  0.559   10.797  1.00 40.46  ? 304  ASP A N   1 
ATOM   2322 C CA  . ASP A 1 304 ? 43.743  0.218   11.318  1.00 35.76  ? 304  ASP A CA  1 
ATOM   2323 C C   . ASP A 1 304 ? 43.992  -1.289  11.293  1.00 42.79  ? 304  ASP A C   1 
ATOM   2324 O O   . ASP A 1 304 ? 45.094  -1.737  11.633  1.00 35.46  ? 304  ASP A O   1 
ATOM   2325 C CB  . ASP A 1 304 ? 43.899  0.699   12.776  1.00 29.23  ? 304  ASP A CB  1 
ATOM   2326 C CG  . ASP A 1 304 ? 42.752  0.207   13.691  1.00 34.93  ? 304  ASP A CG  1 
ATOM   2327 O OD1 . ASP A 1 304 ? 41.768  -0.355  13.168  1.00 37.61  ? 304  ASP A OD1 1 
ATOM   2328 O OD2 . ASP A 1 304 ? 42.804  0.411   14.929  1.00 34.95  ? 304  ASP A OD2 1 
ATOM   2329 N N   . GLY A 1 305 ? 42.967  -2.054  10.918  1.00 39.56  ? 305  GLY A N   1 
ATOM   2330 C CA  . GLY A 1 305 ? 43.010  -3.499  11.052  1.00 41.79  ? 305  GLY A CA  1 
ATOM   2331 C C   . GLY A 1 305 ? 43.049  -3.905  12.512  1.00 46.81  ? 305  GLY A C   1 
ATOM   2332 O O   . GLY A 1 305 ? 43.358  -5.043  12.831  1.00 43.45  ? 305  GLY A O   1 
ATOM   2333 N N   . ASP A 1 306 ? 42.733  -2.968  13.408  1.00 46.89  ? 306  ASP A N   1 
ATOM   2334 C CA  . ASP A 1 306 ? 42.761  -3.237  14.841  1.00 44.80  ? 306  ASP A CA  1 
ATOM   2335 C C   . ASP A 1 306 ? 41.376  -2.967  15.469  1.00 44.99  ? 306  ASP A C   1 
ATOM   2336 O O   . ASP A 1 306 ? 40.516  -3.870  15.527  1.00 40.65  ? 306  ASP A O   1 
ATOM   2337 C CB  . ASP A 1 306 ? 43.871  -2.416  15.511  1.00 41.97  ? 306  ASP A CB  1 
ATOM   2338 C CG  . ASP A 1 306 ? 44.039  -2.742  17.001  1.00 53.48  ? 306  ASP A CG  1 
ATOM   2339 O OD1 . ASP A 1 306 ? 43.435  -3.740  17.480  1.00 47.83  ? 306  ASP A OD1 1 
ATOM   2340 O OD2 . ASP A 1 306 ? 44.774  -1.984  17.692  1.00 51.21  ? 306  ASP A OD2 1 
ATOM   2341 N N   . PHE A 1 307 ? 41.151  -1.736  15.938  1.00 41.78  ? 307  PHE A N   1 
ATOM   2342 C CA  . PHE A 1 307 ? 39.798  -1.336  16.329  1.00 34.82  ? 307  PHE A CA  1 
ATOM   2343 C C   . PHE A 1 307 ? 38.833  -1.700  15.193  1.00 38.53  ? 307  PHE A C   1 
ATOM   2344 O O   . PHE A 1 307 ? 37.796  -2.316  15.408  1.00 41.86  ? 307  PHE A O   1 
ATOM   2345 C CB  . PHE A 1 307 ? 39.730  0.162   16.683  1.00 33.96  ? 307  PHE A CB  1 
ATOM   2346 C CG  . PHE A 1 307 ? 38.436  0.574   17.376  1.00 33.07  ? 307  PHE A CG  1 
ATOM   2347 C CD1 . PHE A 1 307 ? 37.254  0.612   16.677  1.00 28.86  ? 307  PHE A CD1 1 
ATOM   2348 C CD2 . PHE A 1 307 ? 38.427  0.914   18.732  1.00 33.28  ? 307  PHE A CD2 1 
ATOM   2349 C CE1 . PHE A 1 307 ? 36.062  0.983   17.317  1.00 36.18  ? 307  PHE A CE1 1 
ATOM   2350 C CE2 . PHE A 1 307 ? 37.253  1.301   19.377  1.00 38.00  ? 307  PHE A CE2 1 
ATOM   2351 C CZ  . PHE A 1 307 ? 36.060  1.330   18.673  1.00 35.23  ? 307  PHE A CZ  1 
ATOM   2352 N N   . LEU A 1 308 ? 39.186  -1.333  13.970  1.00 39.04  ? 308  LEU A N   1 
ATOM   2353 C CA  . LEU A 1 308 ? 38.374  -1.707  12.820  1.00 41.26  ? 308  LEU A CA  1 
ATOM   2354 C C   . LEU A 1 308 ? 39.160  -2.751  12.035  1.00 41.67  ? 308  LEU A C   1 
ATOM   2355 O O   . LEU A 1 308 ? 40.196  -2.436  11.464  1.00 41.08  ? 308  LEU A O   1 
ATOM   2356 C CB  . LEU A 1 308 ? 38.096  -0.478  11.943  1.00 38.62  ? 308  LEU A CB  1 
ATOM   2357 C CG  . LEU A 1 308 ? 37.155  0.587   12.521  1.00 39.96  ? 308  LEU A CG  1 
ATOM   2358 C CD1 . LEU A 1 308 ? 36.998  1.726   11.533  1.00 32.69  ? 308  LEU A CD1 1 
ATOM   2359 C CD2 . LEU A 1 308 ? 35.786  -0.017  12.881  1.00 39.26  ? 308  LEU A CD2 1 
ATOM   2360 N N   . SER A 1 309 ? 38.689  -3.992  12.013  1.00 41.81  ? 309  SER A N   1 
ATOM   2361 C CA  . SER A 1 309 ? 39.468  -5.064  11.398  1.00 40.57  ? 309  SER A CA  1 
ATOM   2362 C C   . SER A 1 309 ? 39.397  -4.975  9.879   1.00 42.04  ? 309  SER A C   1 
ATOM   2363 O O   . SER A 1 309 ? 40.182  -5.612  9.179   1.00 44.15  ? 309  SER A O   1 
ATOM   2364 C CB  . SER A 1 309 ? 39.002  -6.438  11.901  1.00 46.66  ? 309  SER A CB  1 
ATOM   2365 O OG  . SER A 1 309 ? 37.643  -6.663  11.554  1.00 50.89  ? 309  SER A OG  1 
ATOM   2366 N N   . ASP A 1 310 ? 38.479  -4.152  9.375   1.00 37.80  ? 310  ASP A N   1 
ATOM   2367 C CA  . ASP A 1 310 ? 38.285  -3.975  7.932   1.00 38.16  ? 310  ASP A CA  1 
ATOM   2368 C C   . ASP A 1 310 ? 37.405  -2.726  7.744   1.00 32.84  ? 310  ASP A C   1 
ATOM   2369 O O   . ASP A 1 310 ? 36.971  -2.131  8.740   1.00 33.73  ? 310  ASP A O   1 
ATOM   2370 C CB  . ASP A 1 310 ? 37.604  -5.227  7.341   1.00 40.04  ? 310  ASP A CB  1 
ATOM   2371 C CG  . ASP A 1 310 ? 37.804  -5.368  5.823   1.00 50.85  ? 310  ASP A CG  1 
ATOM   2372 O OD1 . ASP A 1 310 ? 38.336  -4.434  5.174   1.00 49.03  ? 310  ASP A OD1 1 
ATOM   2373 O OD2 . ASP A 1 310 ? 37.425  -6.435  5.271   1.00 57.95  ? 310  ASP A OD2 1 
ATOM   2374 N N   . THR A 1 311 ? 37.150  -2.307  6.509   1.00 30.66  ? 311  THR A N   1 
ATOM   2375 C CA  . THR A 1 311 ? 36.310  -1.130  6.295   1.00 39.47  ? 311  THR A CA  1 
ATOM   2376 C C   . THR A 1 311 ? 34.930  -1.386  6.873   1.00 40.10  ? 311  THR A C   1 
ATOM   2377 O O   . THR A 1 311 ? 34.475  -2.526  6.895   1.00 39.56  ? 311  THR A O   1 
ATOM   2378 C CB  . THR A 1 311 ? 36.092  -0.854  4.824   1.00 45.88  ? 311  THR A CB  1 
ATOM   2379 O OG1 . THR A 1 311 ? 35.248  -1.886  4.286   1.00 46.37  ? 311  THR A OG1 1 
ATOM   2380 C CG2 . THR A 1 311 ? 37.441  -0.799  4.078   1.00 40.03  ? 311  THR A CG2 1 
ATOM   2381 N N   . PRO A 1 312 ? 34.262  -0.333  7.357   1.00 40.08  ? 312  PRO A N   1 
ATOM   2382 C CA  . PRO A 1 312 ? 32.881  -0.511  7.820   1.00 41.31  ? 312  PRO A CA  1 
ATOM   2383 C C   . PRO A 1 312 ? 31.974  -1.140  6.769   1.00 39.23  ? 312  PRO A C   1 
ATOM   2384 O O   . PRO A 1 312 ? 31.087  -1.883  7.145   1.00 50.23  ? 312  PRO A O   1 
ATOM   2385 C CB  . PRO A 1 312 ? 32.444  0.911   8.171   1.00 36.14  ? 312  PRO A CB  1 
ATOM   2386 C CG  . PRO A 1 312 ? 33.707  1.543   8.596   1.00 39.51  ? 312  PRO A CG  1 
ATOM   2387 C CD  . PRO A 1 312 ? 34.779  1.001   7.685   1.00 36.54  ? 312  PRO A CD  1 
ATOM   2388 N N   . GLU A 1 313 ? 32.197  -0.859  5.494   1.00 42.18  ? 313  GLU A N   1 
ATOM   2389 C CA  . GLU A 1 313 ? 31.436  -1.474  4.408   1.00 47.45  ? 313  GLU A CA  1 
ATOM   2390 C C   . GLU A 1 313 ? 31.574  -3.003  4.427   1.00 51.00  ? 313  GLU A C   1 
ATOM   2391 O O   . GLU A 1 313 ? 30.591  -3.749  4.318   1.00 45.96  ? 313  GLU A O   1 
ATOM   2392 C CB  . GLU A 1 313 ? 31.918  -0.923  3.055   1.00 59.78  ? 313  GLU A CB  1 
ATOM   2393 C CG  . GLU A 1 313 ? 31.019  -1.262  1.865   1.00 79.84  ? 313  GLU A CG  1 
ATOM   2394 C CD  . GLU A 1 313 ? 31.606  -0.827  0.505   1.00 94.94  ? 313  GLU A CD  1 
ATOM   2395 O OE1 . GLU A 1 313 ? 32.854  -0.744  0.371   1.00 98.72  ? 313  GLU A OE1 1 
ATOM   2396 O OE2 . GLU A 1 313 ? 30.814  -0.581  -0.438  1.00 98.75  ? 313  GLU A OE2 1 
ATOM   2397 N N   . ALA A 1 314 ? 32.803  -3.478  4.567   1.00 45.95  ? 314  ALA A N   1 
ATOM   2398 C CA  . ALA A 1 314 ? 33.031  -4.902  4.536   1.00 42.35  ? 314  ALA A CA  1 
ATOM   2399 C C   . ALA A 1 314 ? 32.423  -5.517  5.781   1.00 49.51  ? 314  ALA A C   1 
ATOM   2400 O O   . ALA A 1 314 ? 31.848  -6.600  5.721   1.00 57.79  ? 314  ALA A O   1 
ATOM   2401 C CB  . ALA A 1 314 ? 34.517  -5.201  4.453   1.00 44.18  ? 314  ALA A CB  1 
ATOM   2402 N N   . LEU A 1 315 ? 32.548  -4.828  6.911   1.00 44.86  ? 315  LEU A N   1 
ATOM   2403 C CA  . LEU A 1 315 ? 32.074  -5.361  8.191   1.00 41.93  ? 315  LEU A CA  1 
ATOM   2404 C C   . LEU A 1 315 ? 30.561  -5.353  8.347   1.00 43.83  ? 315  LEU A C   1 
ATOM   2405 O O   . LEU A 1 315 ? 30.039  -6.233  9.006   1.00 49.67  ? 315  LEU A O   1 
ATOM   2406 C CB  . LEU A 1 315 ? 32.686  -4.616  9.374   1.00 43.32  ? 315  LEU A CB  1 
ATOM   2407 C CG  . LEU A 1 315 ? 34.193  -4.725  9.495   1.00 39.90  ? 315  LEU A CG  1 
ATOM   2408 C CD1 . LEU A 1 315 ? 34.684  -3.913  10.673  1.00 25.17  ? 315  LEU A CD1 1 
ATOM   2409 C CD2 . LEU A 1 315 ? 34.550  -6.241  9.620   1.00 31.57  ? 315  LEU A CD2 1 
ATOM   2410 N N   . ILE A 1 316 ? 29.844  -4.373  7.791   1.00 42.12  ? 316  ILE A N   1 
ATOM   2411 C CA  . ILE A 1 316 ? 28.380  -4.469  7.845   1.00 47.44  ? 316  ILE A CA  1 
ATOM   2412 C C   . ILE A 1 316 ? 27.893  -5.507  6.821   1.00 61.89  ? 316  ILE A C   1 
ATOM   2413 O O   . ILE A 1 316 ? 26.820  -6.072  6.979   1.00 64.83  ? 316  ILE A O   1 
ATOM   2414 C CB  . ILE A 1 316 ? 27.592  -3.107  7.625   1.00 44.03  ? 316  ILE A CB  1 
ATOM   2415 C CG1 . ILE A 1 316 ? 27.865  -2.492  6.249   1.00 49.32  ? 316  ILE A CG1 1 
ATOM   2416 C CG2 . ILE A 1 316 ? 27.898  -2.084  8.702   1.00 47.27  ? 316  ILE A CG2 1 
ATOM   2417 C CD1 . ILE A 1 316 ? 27.124  -1.158  5.992   1.00 45.53  ? 316  ILE A CD1 1 
ATOM   2418 N N   . ASN A 1 317 ? 28.680  -5.754  5.774   1.00 65.50  ? 317  ASN A N   1 
ATOM   2419 C CA  . ASN A 1 317 ? 28.288  -6.708  4.736   1.00 68.83  ? 317  ASN A CA  1 
ATOM   2420 C C   . ASN A 1 317 ? 28.324  -8.155  5.203   1.00 69.34  ? 317  ASN A C   1 
ATOM   2421 O O   . ASN A 1 317 ? 27.518  -8.970  4.767   1.00 70.27  ? 317  ASN A O   1 
ATOM   2422 C CB  . ASN A 1 317 ? 29.164  -6.568  3.488   1.00 66.78  ? 317  ASN A CB  1 
ATOM   2423 C CG  . ASN A 1 317 ? 28.781  -5.373  2.646   1.00 72.99  ? 317  ASN A CG  1 
ATOM   2424 O OD1 . ASN A 1 317 ? 27.766  -4.715  2.906   1.00 78.99  ? 317  ASN A OD1 1 
ATOM   2425 N ND2 . ASN A 1 317 ? 29.602  -5.067  1.634   1.00 70.13  ? 317  ASN A ND2 1 
ATOM   2426 N N   . THR A 1 318 ? 29.255  -8.464  6.098   1.00 65.50  ? 318  THR A N   1 
ATOM   2427 C CA  . THR A 1 318 ? 29.537  -9.843  6.454   1.00 64.44  ? 318  THR A CA  1 
ATOM   2428 C C   . THR A 1 318 ? 29.161  -10.138 7.886   1.00 64.96  ? 318  THR A C   1 
ATOM   2429 O O   . THR A 1 318 ? 29.211  -11.276 8.327   1.00 67.30  ? 318  THR A O   1 
ATOM   2430 C CB  . THR A 1 318 ? 31.031  -10.129 6.333   1.00 69.26  ? 318  THR A CB  1 
ATOM   2431 O OG1 . THR A 1 318 ? 31.743  -9.330  7.292   1.00 70.15  ? 318  THR A OG1 1 
ATOM   2432 C CG2 . THR A 1 318 ? 31.520  -9.803  4.936   1.00 71.49  ? 318  THR A CG2 1 
ATOM   2433 N N   . GLY A 1 319 ? 28.815  -9.107  8.631   1.00 66.66  ? 319  GLY A N   1 
ATOM   2434 C CA  . GLY A 1 319 ? 28.571  -9.289  10.044  1.00 68.14  ? 319  GLY A CA  1 
ATOM   2435 C C   . GLY A 1 319 ? 27.308  -10.067 10.354  1.00 68.18  ? 319  GLY A C   1 
ATOM   2436 O O   . GLY A 1 319 ? 26.362  -10.123 9.559   1.00 64.02  ? 319  GLY A O   1 
ATOM   2437 N N   . ASP A 1 320 ? 27.306  -10.680 11.529  1.00 67.47  ? 320  ASP A N   1 
ATOM   2438 C CA  . ASP A 1 320 ? 26.123  -11.312 12.062  1.00 69.50  ? 320  ASP A CA  1 
ATOM   2439 C C   . ASP A 1 320 ? 25.586  -10.377 13.145  1.00 67.74  ? 320  ASP A C   1 
ATOM   2440 O O   . ASP A 1 320 ? 26.281  -10.104 14.134  1.00 68.81  ? 320  ASP A O   1 
ATOM   2441 C CB  . ASP A 1 320 ? 26.502  -12.661 12.659  1.00 75.04  ? 320  ASP A CB  1 
ATOM   2442 C CG  . ASP A 1 320 ? 25.316  -13.409 13.225  1.00 77.69  ? 320  ASP A CG  1 
ATOM   2443 O OD1 . ASP A 1 320 ? 24.185  -13.219 12.728  1.00 83.67  ? 320  ASP A OD1 1 
ATOM   2444 O OD2 . ASP A 1 320 ? 25.530  -14.208 14.157  1.00 78.26  ? 320  ASP A OD2 1 
ATOM   2445 N N   . PHE A 1 321 ? 24.364  -9.875  12.958  1.00 57.78  ? 321  PHE A N   1 
ATOM   2446 C CA  . PHE A 1 321 ? 23.822  -8.885  13.886  1.00 58.19  ? 321  PHE A CA  1 
ATOM   2447 C C   . PHE A 1 321 ? 22.547  -9.344  14.583  1.00 61.74  ? 321  PHE A C   1 
ATOM   2448 O O   . PHE A 1 321 ? 21.642  -8.548  14.842  1.00 63.90  ? 321  PHE A O   1 
ATOM   2449 C CB  . PHE A 1 321 ? 23.629  -7.546  13.168  1.00 55.54  ? 321  PHE A CB  1 
ATOM   2450 C CG  . PHE A 1 321 ? 24.904  -6.997  12.587  1.00 49.11  ? 321  PHE A CG  1 
ATOM   2451 C CD1 . PHE A 1 321 ? 25.864  -6.436  13.410  1.00 42.91  ? 321  PHE A CD1 1 
ATOM   2452 C CD2 . PHE A 1 321 ? 25.161  -7.088  11.229  1.00 51.60  ? 321  PHE A CD2 1 
ATOM   2453 C CE1 . PHE A 1 321 ? 27.060  -5.949  12.885  1.00 44.61  ? 321  PHE A CE1 1 
ATOM   2454 C CE2 . PHE A 1 321 ? 26.349  -6.593  10.692  1.00 52.64  ? 321  PHE A CE2 1 
ATOM   2455 C CZ  . PHE A 1 321 ? 27.293  -6.015  11.526  1.00 45.61  ? 321  PHE A CZ  1 
ATOM   2456 N N   . GLN A 1 322 ? 22.526  -10.624 14.938  1.00 61.78  ? 322  GLN A N   1 
ATOM   2457 C CA  . GLN A 1 322 ? 21.336  -11.281 15.450  1.00 63.53  ? 322  GLN A CA  1 
ATOM   2458 C C   . GLN A 1 322 ? 20.858  -10.810 16.810  1.00 59.57  ? 322  GLN A C   1 
ATOM   2459 O O   . GLN A 1 322 ? 19.661  -10.651 17.029  1.00 66.94  ? 322  GLN A O   1 
ATOM   2460 C CB  . GLN A 1 322 ? 21.540  -12.787 15.467  1.00 71.75  ? 322  GLN A CB  1 
ATOM   2461 C CG  . GLN A 1 322 ? 21.343  -13.408 14.113  1.00 84.30  ? 322  GLN A CG  1 
ATOM   2462 C CD  . GLN A 1 322 ? 21.335  -14.915 14.174  1.00 94.07  ? 322  GLN A CD  1 
ATOM   2463 O OE1 . GLN A 1 322 ? 22.239  -15.531 14.751  1.00 91.86  ? 322  GLN A OE1 1 
ATOM   2464 N NE2 . GLN A 1 322 ? 20.310  -15.525 13.578  1.00 98.64  ? 322  GLN A NE2 1 
ATOM   2465 N N   . ASP A 1 323 ? 21.763  -10.584 17.736  1.00 55.40  ? 323  ASP A N   1 
ATOM   2466 C CA  . ASP A 1 323 ? 21.294  -10.177 19.051  1.00 66.29  ? 323  ASP A CA  1 
ATOM   2467 C C   . ASP A 1 323 ? 21.276  -8.652  19.212  1.00 58.75  ? 323  ASP A C   1 
ATOM   2468 O O   . ASP A 1 323 ? 21.432  -8.140  20.311  1.00 55.70  ? 323  ASP A O   1 
ATOM   2469 C CB  . ASP A 1 323 ? 22.166  -10.802 20.138  1.00 81.58  ? 323  ASP A CB  1 
ATOM   2470 C CG  . ASP A 1 323 ? 23.627  -10.380 20.023  1.00 97.17  ? 323  ASP A CG  1 
ATOM   2471 O OD1 . ASP A 1 323 ? 24.002  -9.768  18.981  1.00 96.46  ? 323  ASP A OD1 1 
ATOM   2472 O OD2 . ASP A 1 323 ? 24.395  -10.664 20.977  1.00 105.35 ? 323  ASP A OD2 1 
ATOM   2473 N N   . LEU A 1 324 ? 21.090  -7.928  18.117  1.00 58.60  ? 324  LEU A N   1 
ATOM   2474 C CA  . LEU A 1 324 ? 21.220  -6.472  18.158  1.00 54.81  ? 324  LEU A CA  1 
ATOM   2475 C C   . LEU A 1 324 ? 19.917  -5.766  17.788  1.00 46.01  ? 324  LEU A C   1 
ATOM   2476 O O   . LEU A 1 324 ? 19.311  -6.087  16.768  1.00 45.12  ? 324  LEU A O   1 
ATOM   2477 C CB  . LEU A 1 324 ? 22.331  -6.029  17.207  1.00 48.78  ? 324  LEU A CB  1 
ATOM   2478 C CG  . LEU A 1 324 ? 22.612  -4.528  17.201  1.00 48.06  ? 324  LEU A CG  1 
ATOM   2479 C CD1 . LEU A 1 324 ? 23.256  -4.139  18.488  1.00 46.01  ? 324  LEU A CD1 1 
ATOM   2480 C CD2 . LEU A 1 324 ? 23.506  -4.170  16.055  1.00 52.19  ? 324  LEU A CD2 1 
ATOM   2481 N N   . GLN A 1 325 ? 19.487  -4.810  18.613  1.00 43.48  ? 325  GLN A N   1 
ATOM   2482 C CA  . GLN A 1 325 ? 18.399  -3.920  18.201  1.00 45.80  ? 325  GLN A CA  1 
ATOM   2483 C C   . GLN A 1 325 ? 18.914  -2.509  17.952  1.00 43.28  ? 325  GLN A C   1 
ATOM   2484 O O   . GLN A 1 325 ? 19.769  -2.020  18.688  1.00 45.91  ? 325  GLN A O   1 
ATOM   2485 C CB  . GLN A 1 325 ? 17.251  -3.902  19.210  1.00 47.46  ? 325  GLN A CB  1 
ATOM   2486 C CG  . GLN A 1 325 ? 16.737  -5.265  19.569  1.00 49.44  ? 325  GLN A CG  1 
ATOM   2487 C CD  . GLN A 1 325 ? 17.323  -5.712  20.862  1.00 59.80  ? 325  GLN A CD  1 
ATOM   2488 O OE1 . GLN A 1 325 ? 17.211  -5.018  21.873  1.00 58.99  ? 325  GLN A OE1 1 
ATOM   2489 N NE2 . GLN A 1 325 ? 17.992  -6.854  20.846  1.00 65.72  ? 325  GLN A NE2 1 
ATOM   2490 N N   . VAL A 1 326 ? 18.398  -1.854  16.917  1.00 37.59  ? 326  VAL A N   1 
ATOM   2491 C CA  . VAL A 1 326 ? 18.996  -0.596  16.480  1.00 34.62  ? 326  VAL A CA  1 
ATOM   2492 C C   . VAL A 1 326 ? 17.909  0.364   16.051  1.00 36.95  ? 326  VAL A C   1 
ATOM   2493 O O   . VAL A 1 326 ? 16.980  -0.023  15.348  1.00 36.60  ? 326  VAL A O   1 
ATOM   2494 C CB  . VAL A 1 326 ? 19.974  -0.833  15.303  1.00 42.10  ? 326  VAL A CB  1 
ATOM   2495 C CG1 . VAL A 1 326 ? 20.476  0.445   14.764  1.00 47.88  ? 326  VAL A CG1 1 
ATOM   2496 C CG2 . VAL A 1 326 ? 21.152  -1.681  15.758  1.00 48.00  ? 326  VAL A CG2 1 
ATOM   2497 N N   . LEU A 1 327 ? 18.019  1.613   16.495  1.00 34.89  ? 327  LEU A N   1 
ATOM   2498 C CA  . LEU A 1 327 ? 17.143  2.674   16.034  1.00 32.28  ? 327  LEU A CA  1 
ATOM   2499 C C   . LEU A 1 327 ? 17.989  3.673   15.210  1.00 38.26  ? 327  LEU A C   1 
ATOM   2500 O O   . LEU A 1 327 ? 18.995  4.218   15.712  1.00 34.57  ? 327  LEU A O   1 
ATOM   2501 C CB  . LEU A 1 327 ? 16.498  3.350   17.239  1.00 32.89  ? 327  LEU A CB  1 
ATOM   2502 C CG  . LEU A 1 327 ? 15.657  4.617   16.991  1.00 39.14  ? 327  LEU A CG  1 
ATOM   2503 C CD1 . LEU A 1 327 ? 14.774  4.462   15.819  1.00 43.15  ? 327  LEU A CD1 1 
ATOM   2504 C CD2 . LEU A 1 327 ? 14.788  4.848   18.180  1.00 47.99  ? 327  LEU A CD2 1 
ATOM   2505 N N   . VAL A 1 328 ? 17.628  3.902   13.948  1.00 29.81  ? 328  VAL A N   1 
ATOM   2506 C CA  . VAL A 1 328 ? 18.439  4.800   13.124  1.00 33.38  ? 328  VAL A CA  1 
ATOM   2507 C C   . VAL A 1 328 ? 17.521  5.747   12.434  1.00 36.13  ? 328  VAL A C   1 
ATOM   2508 O O   . VAL A 1 328 ? 16.393  5.381   12.129  1.00 42.78  ? 328  VAL A O   1 
ATOM   2509 C CB  . VAL A 1 328 ? 19.201  4.060   11.981  1.00 37.05  ? 328  VAL A CB  1 
ATOM   2510 C CG1 . VAL A 1 328 ? 20.362  3.270   12.516  1.00 35.44  ? 328  VAL A CG1 1 
ATOM   2511 C CG2 . VAL A 1 328 ? 18.228  3.147   11.184  1.00 37.17  ? 328  VAL A CG2 1 
ATOM   2512 N N   . GLY A 1 329 ? 18.007  6.940   12.119  1.00 32.07  ? 329  GLY A N   1 
ATOM   2513 C CA  . GLY A 1 329 ? 17.216  7.862   11.317  1.00 29.63  ? 329  GLY A CA  1 
ATOM   2514 C C   . GLY A 1 329 ? 17.922  9.125   10.881  1.00 33.86  ? 329  GLY A C   1 
ATOM   2515 O O   . GLY A 1 329 ? 19.143  9.270   11.087  1.00 31.97  ? 329  GLY A O   1 
ATOM   2516 N N   . VAL A 1 330 ? 17.152  10.056  10.294  1.00 33.34  ? 330  VAL A N   1 
ATOM   2517 C CA  . VAL A 1 330 ? 17.722  11.241  9.623   1.00 27.53  ? 330  VAL A CA  1 
ATOM   2518 C C   . VAL A 1 330 ? 16.784  12.412  9.866   1.00 32.88  ? 330  VAL A C   1 
ATOM   2519 O O   . VAL A 1 330 ? 15.606  12.203  10.226  1.00 29.65  ? 330  VAL A O   1 
ATOM   2520 C CB  . VAL A 1 330 ? 17.890  11.000  8.082   1.00 31.83  ? 330  VAL A CB  1 
ATOM   2521 C CG1 . VAL A 1 330 ? 18.832  9.810   7.795   1.00 28.35  ? 330  VAL A CG1 1 
ATOM   2522 C CG2 . VAL A 1 330 ? 16.525  10.739  7.420   1.00 32.06  ? 330  VAL A CG2 1 
ATOM   2523 N N   . VAL A 1 331 ? 17.280  13.641  9.692   1.00 26.00  ? 331  VAL A N   1 
ATOM   2524 C CA  . VAL A 1 331 ? 16.369  14.785  9.661   1.00 32.13  ? 331  VAL A CA  1 
ATOM   2525 C C   . VAL A 1 331 ? 15.987  15.078  8.211   1.00 34.35  ? 331  VAL A C   1 
ATOM   2526 O O   . VAL A 1 331 ? 16.624  14.589  7.273   1.00 35.15  ? 331  VAL A O   1 
ATOM   2527 C CB  . VAL A 1 331 ? 16.966  16.053  10.309  1.00 30.94  ? 331  VAL A CB  1 
ATOM   2528 C CG1 . VAL A 1 331 ? 17.213  15.830  11.792  1.00 28.34  ? 331  VAL A CG1 1 
ATOM   2529 C CG2 . VAL A 1 331 ? 18.246  16.491  9.578   1.00 22.32  ? 331  VAL A CG2 1 
ATOM   2530 N N   . LYS A 1 332 ? 14.963  15.892  8.032   1.00 31.23  ? 332  LYS A N   1 
ATOM   2531 C CA  . LYS A 1 332 ? 14.445  16.152  6.722   1.00 33.07  ? 332  LYS A CA  1 
ATOM   2532 C C   . LYS A 1 332 ? 15.481  16.781  5.803   1.00 38.09  ? 332  LYS A C   1 
ATOM   2533 O O   . LYS A 1 332 ? 15.531  16.456  4.624   1.00 40.25  ? 332  LYS A O   1 
ATOM   2534 C CB  . LYS A 1 332 ? 13.178  17.003  6.816   1.00 38.80  ? 332  LYS A CB  1 
ATOM   2535 C CG  . LYS A 1 332 ? 12.494  17.287  5.470   1.00 40.29  ? 332  LYS A CG  1 
ATOM   2536 C CD  . LYS A 1 332 ? 11.176  18.024  5.698   1.00 49.91  ? 332  LYS A CD  1 
ATOM   2537 C CE  . LYS A 1 332 ? 11.025  19.289  4.828   1.00 62.07  ? 332  LYS A CE  1 
ATOM   2538 N NZ  . LYS A 1 332 ? 11.826  20.506  5.305   1.00 55.75  ? 332  LYS A NZ  1 
ATOM   2539 N N   . ASP A 1 333 ? 16.325  17.666  6.334   1.00 33.48  ? 333  ASP A N   1 
ATOM   2540 C CA  . ASP A 1 333 ? 17.278  18.367  5.486   1.00 27.79  ? 333  ASP A CA  1 
ATOM   2541 C C   . ASP A 1 333 ? 18.756  18.223  5.949   1.00 31.57  ? 333  ASP A C   1 
ATOM   2542 O O   . ASP A 1 333 ? 19.368  19.171  6.438   1.00 28.07  ? 333  ASP A O   1 
ATOM   2543 C CB  . ASP A 1 333 ? 16.865  19.839  5.334   1.00 23.49  ? 333  ASP A CB  1 
ATOM   2544 C CG  . ASP A 1 333 ? 15.429  19.993  4.823   1.00 33.58  ? 333  ASP A CG  1 
ATOM   2545 O OD1 . ASP A 1 333 ? 14.485  19.945  5.653   1.00 30.22  ? 333  ASP A OD1 1 
ATOM   2546 O OD2 . ASP A 1 333 ? 15.244  20.177  3.601   1.00 35.08  ? 333  ASP A OD2 1 
ATOM   2547 N N   . GLU A 1 334 ? 19.322  17.027  5.806   1.00 31.16  ? 334  GLU A N   1 
ATOM   2548 C CA  . GLU A 1 334 ? 20.648  16.782  6.351   1.00 28.47  ? 334  GLU A CA  1 
ATOM   2549 C C   . GLU A 1 334 ? 21.690  17.764  5.755   1.00 32.16  ? 334  GLU A C   1 
ATOM   2550 O O   . GLU A 1 334 ? 22.603  18.203  6.442   1.00 31.58  ? 334  GLU A O   1 
ATOM   2551 C CB  . GLU A 1 334 ? 21.035  15.324  6.093   1.00 31.48  ? 334  GLU A CB  1 
ATOM   2552 C CG  . GLU A 1 334 ? 20.218  14.304  6.875   1.00 24.31  ? 334  GLU A CG  1 
ATOM   2553 C CD  . GLU A 1 334 ? 20.619  14.299  8.336   1.00 32.01  ? 334  GLU A CD  1 
ATOM   2554 O OE1 . GLU A 1 334 ? 21.662  14.954  8.682   1.00 31.43  ? 334  GLU A OE1 1 
ATOM   2555 O OE2 . GLU A 1 334 ? 19.902  13.658  9.137   1.00 29.13  ? 334  GLU A OE2 1 
ATOM   2556 N N   . GLY A 1 335 ? 21.536  18.127  4.482   1.00 25.57  ? 335  GLY A N   1 
ATOM   2557 C CA  . GLY A 1 335 ? 22.582  18.860  3.815   1.00 27.28  ? 335  GLY A CA  1 
ATOM   2558 C C   . GLY A 1 335 ? 22.672  20.367  4.015   1.00 30.87  ? 335  GLY A C   1 
ATOM   2559 O O   . GLY A 1 335 ? 23.760  20.919  3.898   1.00 36.00  ? 335  GLY A O   1 
ATOM   2560 N N   . SER A 1 336 ? 21.568  21.033  4.344   1.00 24.11  ? 336  SER A N   1 
ATOM   2561 C CA  . SER A 1 336 ? 21.495  22.492  4.209   1.00 30.76  ? 336  SER A CA  1 
ATOM   2562 C C   . SER A 1 336 ? 22.498  23.211  5.081   1.00 36.24  ? 336  SER A C   1 
ATOM   2563 O O   . SER A 1 336 ? 23.170  24.116  4.620   1.00 38.79  ? 336  SER A O   1 
ATOM   2564 C CB  . SER A 1 336 ? 20.076  23.011  4.512   1.00 32.09  ? 336  SER A CB  1 
ATOM   2565 O OG  . SER A 1 336 ? 19.665  22.715  5.845   1.00 31.13  ? 336  SER A OG  1 
ATOM   2566 N N   . TYR A 1 337 ? 22.575  22.798  6.343   1.00 35.67  ? 337  TYR A N   1 
ATOM   2567 C CA  . TYR A 1 337 ? 23.560  23.297  7.310   1.00 41.32  ? 337  TYR A CA  1 
ATOM   2568 C C   . TYR A 1 337 ? 24.976  23.421  6.738   1.00 33.63  ? 337  TYR A C   1 
ATOM   2569 O O   . TYR A 1 337 ? 25.685  24.387  6.987   1.00 35.31  ? 337  TYR A O   1 
ATOM   2570 C CB  . TYR A 1 337 ? 23.590  22.341  8.520   1.00 45.88  ? 337  TYR A CB  1 
ATOM   2571 C CG  . TYR A 1 337 ? 24.431  22.801  9.657   1.00 42.45  ? 337  TYR A CG  1 
ATOM   2572 C CD1 . TYR A 1 337 ? 23.976  23.778  10.496  1.00 50.53  ? 337  TYR A CD1 1 
ATOM   2573 C CD2 . TYR A 1 337 ? 25.683  22.256  9.899   1.00 49.92  ? 337  TYR A CD2 1 
ATOM   2574 C CE1 . TYR A 1 337 ? 24.732  24.229  11.564  1.00 57.99  ? 337  TYR A CE1 1 
ATOM   2575 C CE2 . TYR A 1 337 ? 26.465  22.704  10.974  1.00 57.08  ? 337  TYR A CE2 1 
ATOM   2576 C CZ  . TYR A 1 337 ? 25.968  23.706  11.807  1.00 61.06  ? 337  TYR A CZ  1 
ATOM   2577 O OH  . TYR A 1 337 ? 26.676  24.209  12.888  1.00 61.65  ? 337  TYR A OH  1 
ATOM   2578 N N   . PHE A 1 338 ? 25.382  22.436  5.963   1.00 33.33  ? 338  PHE A N   1 
ATOM   2579 C CA  . PHE A 1 338 ? 26.759  22.379  5.457   1.00 32.18  ? 338  PHE A CA  1 
ATOM   2580 C C   . PHE A 1 338 ? 27.041  23.292  4.287   1.00 36.78  ? 338  PHE A C   1 
ATOM   2581 O O   . PHE A 1 338 ? 28.194  23.651  4.060   1.00 43.74  ? 338  PHE A O   1 
ATOM   2582 C CB  . PHE A 1 338 ? 27.105  20.944  5.091   1.00 29.27  ? 338  PHE A CB  1 
ATOM   2583 C CG  . PHE A 1 338 ? 27.111  20.040  6.272   1.00 31.70  ? 338  PHE A CG  1 
ATOM   2584 C CD1 . PHE A 1 338 ? 25.941  19.395  6.677   1.00 26.72  ? 338  PHE A CD1 1 
ATOM   2585 C CD2 . PHE A 1 338 ? 28.257  19.892  7.033   1.00 28.05  ? 338  PHE A CD2 1 
ATOM   2586 C CE1 . PHE A 1 338 ? 25.933  18.563  7.807   1.00 24.81  ? 338  PHE A CE1 1 
ATOM   2587 C CE2 . PHE A 1 338 ? 28.258  19.051  8.169   1.00 33.71  ? 338  PHE A CE2 1 
ATOM   2588 C CZ  . PHE A 1 338 ? 27.102  18.395  8.554   1.00 31.49  ? 338  PHE A CZ  1 
ATOM   2589 N N   . LEU A 1 339 ? 26.003  23.668  3.547   1.00 32.81  ? 339  LEU A N   1 
ATOM   2590 C CA  . LEU A 1 339 ? 26.186  24.513  2.374   1.00 37.52  ? 339  LEU A CA  1 
ATOM   2591 C C   . LEU A 1 339 ? 26.653  25.928  2.757   1.00 39.97  ? 339  LEU A C   1 
ATOM   2592 O O   . LEU A 1 339 ? 27.442  26.531  2.034   1.00 37.04  ? 339  LEU A O   1 
ATOM   2593 C CB  . LEU A 1 339 ? 24.892  24.605  1.529   1.00 30.07  ? 339  LEU A CB  1 
ATOM   2594 C CG  . LEU A 1 339 ? 24.264  23.255  1.160   1.00 38.25  ? 339  LEU A CG  1 
ATOM   2595 C CD1 . LEU A 1 339 ? 23.003  23.418  0.331   1.00 38.15  ? 339  LEU A CD1 1 
ATOM   2596 C CD2 . LEU A 1 339 ? 25.245  22.353  0.426   1.00 38.53  ? 339  LEU A CD2 1 
ATOM   2597 N N   . VAL A 1 340 ? 26.160  26.455  3.873   1.00 40.77  ? 340  VAL A N   1 
ATOM   2598 C CA  . VAL A 1 340 ? 26.456  27.844  4.232   1.00 49.69  ? 340  VAL A CA  1 
ATOM   2599 C C   . VAL A 1 340 ? 27.879  28.023  4.703   1.00 55.76  ? 340  VAL A C   1 
ATOM   2600 O O   . VAL A 1 340 ? 28.336  29.141  4.835   1.00 66.11  ? 340  VAL A O   1 
ATOM   2601 C CB  . VAL A 1 340 ? 25.518  28.433  5.315   1.00 52.16  ? 340  VAL A CB  1 
ATOM   2602 C CG1 . VAL A 1 340 ? 24.074  28.440  4.838   1.00 57.77  ? 340  VAL A CG1 1 
ATOM   2603 C CG2 . VAL A 1 340 ? 25.651  27.668  6.624   1.00 49.37  ? 340  VAL A CG2 1 
ATOM   2604 N N   . TYR A 1 341 ? 28.591  26.934  4.940   1.00 53.94  ? 341  TYR A N   1 
ATOM   2605 C CA  . TYR A 1 341 ? 29.961  27.060  5.387   1.00 61.01  ? 341  TYR A CA  1 
ATOM   2606 C C   . TYR A 1 341 ? 30.900  27.201  4.220   1.00 70.26  ? 341  TYR A C   1 
ATOM   2607 O O   . TYR A 1 341 ? 31.736  28.106  4.205   1.00 83.12  ? 341  TYR A O   1 
ATOM   2608 C CB  . TYR A 1 341 ? 30.377  25.875  6.265   1.00 70.66  ? 341  TYR A CB  1 
ATOM   2609 C CG  . TYR A 1 341 ? 29.988  26.065  7.711   1.00 72.43  ? 341  TYR A CG  1 
ATOM   2610 C CD1 . TYR A 1 341 ? 28.703  25.768  8.149   1.00 63.39  ? 341  TYR A CD1 1 
ATOM   2611 C CD2 . TYR A 1 341 ? 30.901  26.578  8.632   1.00 76.07  ? 341  TYR A CD2 1 
ATOM   2612 C CE1 . TYR A 1 341 ? 28.343  25.962  9.452   1.00 65.09  ? 341  TYR A CE1 1 
ATOM   2613 C CE2 . TYR A 1 341 ? 30.551  26.769  9.944   1.00 74.47  ? 341  TYR A CE2 1 
ATOM   2614 C CZ  . TYR A 1 341 ? 29.268  26.462  10.349  1.00 73.29  ? 341  TYR A CZ  1 
ATOM   2615 O OH  . TYR A 1 341 ? 28.915  26.650  11.659  1.00 78.11  ? 341  TYR A OH  1 
ATOM   2616 N N   . GLY A 1 342 ? 30.766  26.335  3.221   1.00 62.48  ? 342  GLY A N   1 
ATOM   2617 C CA  . GLY A 1 342 ? 31.783  26.315  2.190   1.00 56.91  ? 342  GLY A CA  1 
ATOM   2618 C C   . GLY A 1 342 ? 31.373  26.184  0.741   1.00 55.82  ? 342  GLY A C   1 
ATOM   2619 O O   . GLY A 1 342 ? 32.209  25.849  -0.097  1.00 63.55  ? 342  GLY A O   1 
ATOM   2620 N N   . VAL A 1 343 ? 30.111  26.431  0.419   1.00 45.19  ? 343  VAL A N   1 
ATOM   2621 C CA  . VAL A 1 343 ? 29.727  26.375  -0.982  1.00 38.17  ? 343  VAL A CA  1 
ATOM   2622 C C   . VAL A 1 343 ? 29.357  27.773  -1.463  1.00 36.69  ? 343  VAL A C   1 
ATOM   2623 O O   . VAL A 1 343 ? 28.419  28.363  -0.981  1.00 44.52  ? 343  VAL A O   1 
ATOM   2624 C CB  . VAL A 1 343 ? 28.570  25.380  -1.214  1.00 37.75  ? 343  VAL A CB  1 
ATOM   2625 C CG1 . VAL A 1 343 ? 28.196  25.303  -2.704  1.00 31.70  ? 343  VAL A CG1 1 
ATOM   2626 C CG2 . VAL A 1 343 ? 28.940  24.037  -0.661  1.00 37.83  ? 343  VAL A CG2 1 
ATOM   2627 N N   . PRO A 1 344 ? 30.111  28.316  -2.413  1.00 36.41  ? 344  PRO A N   1 
ATOM   2628 C CA  . PRO A 1 344 ? 29.811  29.708  -2.759  1.00 39.41  ? 344  PRO A CA  1 
ATOM   2629 C C   . PRO A 1 344 ? 28.356  29.868  -3.251  1.00 42.37  ? 344  PRO A C   1 
ATOM   2630 O O   . PRO A 1 344 ? 27.841  29.000  -3.969  1.00 41.45  ? 344  PRO A O   1 
ATOM   2631 C CB  . PRO A 1 344 ? 30.797  30.004  -3.893  1.00 40.12  ? 344  PRO A CB  1 
ATOM   2632 C CG  . PRO A 1 344 ? 31.930  28.971  -3.718  1.00 39.05  ? 344  PRO A CG  1 
ATOM   2633 C CD  . PRO A 1 344 ? 31.234  27.747  -3.185  1.00 36.34  ? 344  PRO A CD  1 
ATOM   2634 N N   . GLY A 1 345 ? 27.710  30.962  -2.861  1.00 38.34  ? 345  GLY A N   1 
ATOM   2635 C CA  . GLY A 1 345 ? 26.345  31.246  -3.269  1.00 34.79  ? 345  GLY A CA  1 
ATOM   2636 C C   . GLY A 1 345 ? 25.379  30.962  -2.134  1.00 39.71  ? 345  GLY A C   1 
ATOM   2637 O O   . GLY A 1 345 ? 24.205  31.374  -2.162  1.00 43.36  ? 345  GLY A O   1 
ATOM   2638 N N   . PHE A 1 346 ? 25.859  30.248  -1.121  1.00 37.94  ? 346  PHE A N   1 
ATOM   2639 C CA  . PHE A 1 346 ? 25.006  29.929  0.025   1.00 44.95  ? 346  PHE A CA  1 
ATOM   2640 C C   . PHE A 1 346 ? 25.262  30.815  1.248   1.00 41.49  ? 346  PHE A C   1 
ATOM   2641 O O   . PHE A 1 346 ? 26.384  31.204  1.504   1.00 47.61  ? 346  PHE A O   1 
ATOM   2642 C CB  . PHE A 1 346 ? 25.095  28.435  0.373   1.00 37.58  ? 346  PHE A CB  1 
ATOM   2643 C CG  . PHE A 1 346 ? 24.494  27.558  -0.674  1.00 33.03  ? 346  PHE A CG  1 
ATOM   2644 C CD1 . PHE A 1 346 ? 25.218  27.221  -1.815  1.00 32.24  ? 346  PHE A CD1 1 
ATOM   2645 C CD2 . PHE A 1 346 ? 23.180  27.109  -0.553  1.00 31.82  ? 346  PHE A CD2 1 
ATOM   2646 C CE1 . PHE A 1 346 ? 24.651  26.434  -2.825  1.00 34.06  ? 346  PHE A CE1 1 
ATOM   2647 C CE2 . PHE A 1 346 ? 22.626  26.306  -1.514  1.00 25.12  ? 346  PHE A CE2 1 
ATOM   2648 C CZ  . PHE A 1 346 ? 23.336  25.969  -2.668  1.00 28.64  ? 346  PHE A CZ  1 
ATOM   2649 N N   . SER A 1 347 ? 24.200  31.115  1.991   1.00 41.98  ? 347  SER A N   1 
ATOM   2650 C CA  . SER A 1 347 ? 24.274  32.010  3.144   1.00 45.92  ? 347  SER A CA  1 
ATOM   2651 C C   . SER A 1 347 ? 23.073  31.849  4.067   1.00 42.73  ? 347  SER A C   1 
ATOM   2652 O O   . SER A 1 347 ? 21.969  31.573  3.609   1.00 42.44  ? 347  SER A O   1 
ATOM   2653 C CB  . SER A 1 347 ? 24.336  33.479  2.682   1.00 48.38  ? 347  SER A CB  1 
ATOM   2654 O OG  . SER A 1 347 ? 24.303  34.337  3.808   1.00 48.47  ? 347  SER A OG  1 
ATOM   2655 N N   . LYS A 1 348 ? 23.273  32.048  5.365   1.00 38.63  ? 348  LYS A N   1 
ATOM   2656 C CA  . LYS A 1 348 ? 22.141  32.041  6.281   1.00 42.07  ? 348  LYS A CA  1 
ATOM   2657 C C   . LYS A 1 348 ? 21.319  33.312  6.140   1.00 44.59  ? 348  LYS A C   1 
ATOM   2658 O O   . LYS A 1 348 ? 20.154  33.328  6.540   1.00 45.21  ? 348  LYS A O   1 
ATOM   2659 C CB  . LYS A 1 348 ? 22.590  31.864  7.745   1.00 45.30  ? 348  LYS A CB  1 
ATOM   2660 C CG  . LYS A 1 348 ? 23.199  33.102  8.393   1.00 48.95  ? 348  LYS A CG  1 
ATOM   2661 C CD  . LYS A 1 348 ? 23.628  32.833  9.851   1.00 53.56  ? 348  LYS A CD  1 
ATOM   2662 C CE  . LYS A 1 348 ? 23.487  34.078  10.729  1.00 56.06  ? 348  LYS A CE  1 
ATOM   2663 N NZ  . LYS A 1 348 ? 22.057  34.592  10.768  1.00 56.89  ? 348  LYS A NZ  1 
ATOM   2664 N N   . ASP A 1 349 ? 21.916  34.361  5.559   1.00 41.61  ? 349  ASP A N   1 
ATOM   2665 C CA  . ASP A 1 349 ? 21.321  35.715  5.575   1.00 44.84  ? 349  ASP A CA  1 
ATOM   2666 C C   . ASP A 1 349 ? 20.540  36.110  4.324   1.00 48.02  ? 349  ASP A C   1 
ATOM   2667 O O   . ASP A 1 349 ? 20.139  37.261  4.196   1.00 48.21  ? 349  ASP A O   1 
ATOM   2668 C CB  . ASP A 1 349 ? 22.377  36.795  5.861   1.00 43.88  ? 349  ASP A CB  1 
ATOM   2669 C CG  . ASP A 1 349 ? 23.028  36.625  7.228   1.00 50.53  ? 349  ASP A CG  1 
ATOM   2670 O OD1 . ASP A 1 349 ? 22.315  36.264  8.197   1.00 44.69  ? 349  ASP A OD1 1 
ATOM   2671 O OD2 . ASP A 1 349 ? 24.269  36.816  7.319   1.00 55.94  ? 349  ASP A OD2 1 
ATOM   2672 N N   . ASN A 1 350 ? 20.353  35.169  3.403   1.00 44.31  ? 350  ASN A N   1 
ATOM   2673 C CA  . ASN A 1 350 ? 19.494  35.380  2.248   1.00 44.04  ? 350  ASN A CA  1 
ATOM   2674 C C   . ASN A 1 350 ? 18.995  34.050  1.770   1.00 42.15  ? 350  ASN A C   1 
ATOM   2675 O O   . ASN A 1 350 ? 19.328  33.014  2.347   1.00 43.87  ? 350  ASN A O   1 
ATOM   2676 C CB  . ASN A 1 350 ? 20.189  36.148  1.105   1.00 41.16  ? 350  ASN A CB  1 
ATOM   2677 C CG  . ASN A 1 350 ? 21.363  35.404  0.513   1.00 46.88  ? 350  ASN A CG  1 
ATOM   2678 O OD1 . ASN A 1 350 ? 21.332  34.184  0.376   1.00 49.50  ? 350  ASN A OD1 1 
ATOM   2679 N ND2 . ASN A 1 350 ? 22.417  36.153  0.148   1.00 57.34  ? 350  ASN A ND2 1 
ATOM   2680 N N   . GLU A 1 351 ? 18.219  34.075  0.701   1.00 38.45  ? 351  GLU A N   1 
ATOM   2681 C CA  . GLU A 1 351 ? 17.548  32.884  0.223   1.00 40.96  ? 351  GLU A CA  1 
ATOM   2682 C C   . GLU A 1 351 ? 18.477  31.918  -0.520  1.00 37.69  ? 351  GLU A C   1 
ATOM   2683 O O   . GLU A 1 351 ? 18.063  30.821  -0.878  1.00 34.39  ? 351  GLU A O   1 
ATOM   2684 C CB  . GLU A 1 351 ? 16.350  33.274  -0.658  1.00 47.09  ? 351  GLU A CB  1 
ATOM   2685 C CG  . GLU A 1 351 ? 15.117  33.673  0.136   1.00 62.13  ? 351  GLU A CG  1 
ATOM   2686 C CD  . GLU A 1 351 ? 14.472  32.470  0.828   1.00 81.25  ? 351  GLU A CD  1 
ATOM   2687 O OE1 . GLU A 1 351 ? 13.715  31.693  0.167   1.00 87.60  ? 351  GLU A OE1 1 
ATOM   2688 O OE2 . GLU A 1 351 ? 14.728  32.298  2.039   1.00 81.81  ? 351  GLU A OE2 1 
ATOM   2689 N N   . SER A 1 352 ? 19.721  32.316  -0.770  1.00 40.37  ? 352  SER A N   1 
ATOM   2690 C CA  . SER A 1 352 ? 20.676  31.409  -1.408  1.00 34.40  ? 352  SER A CA  1 
ATOM   2691 C C   . SER A 1 352 ? 20.149  30.840  -2.723  1.00 35.57  ? 352  SER A C   1 
ATOM   2692 O O   . SER A 1 352 ? 20.356  29.668  -3.014  1.00 34.88  ? 352  SER A O   1 
ATOM   2693 C CB  . SER A 1 352 ? 20.971  30.238  -0.477  1.00 32.61  ? 352  SER A CB  1 
ATOM   2694 O OG  . SER A 1 352 ? 21.622  30.670  0.700   1.00 40.32  ? 352  SER A OG  1 
ATOM   2695 N N   . LEU A 1 353 ? 19.459  31.649  -3.514  1.00 33.18  ? 353  LEU A N   1 
ATOM   2696 C CA  . LEU A 1 353 ? 19.030  31.210  -4.824  1.00 36.07  ? 353  LEU A CA  1 
ATOM   2697 C C   . LEU A 1 353 ? 20.256  31.198  -5.735  1.00 45.68  ? 353  LEU A C   1 
ATOM   2698 O O   . LEU A 1 353 ? 20.768  32.243  -6.092  1.00 62.96  ? 353  LEU A O   1 
ATOM   2699 C CB  . LEU A 1 353 ? 17.968  32.171  -5.373  1.00 35.99  ? 353  LEU A CB  1 
ATOM   2700 C CG  . LEU A 1 353 ? 16.685  32.314  -4.547  1.00 41.74  ? 353  LEU A CG  1 
ATOM   2701 C CD1 . LEU A 1 353 ? 15.774  33.458  -5.078  1.00 44.44  ? 353  LEU A CD1 1 
ATOM   2702 C CD2 . LEU A 1 353 ? 15.927  31.026  -4.513  1.00 39.05  ? 353  LEU A CD2 1 
ATOM   2703 N N   . ILE A 1 354 ? 20.728  30.027  -6.118  1.00 37.54  ? 354  ILE A N   1 
ATOM   2704 C CA  . ILE A 1 354 ? 21.951  29.914  -6.888  1.00 28.73  ? 354  ILE A CA  1 
ATOM   2705 C C   . ILE A 1 354 ? 21.742  29.654  -8.387  1.00 33.95  ? 354  ILE A C   1 
ATOM   2706 O O   . ILE A 1 354 ? 20.636  29.328  -8.857  1.00 35.24  ? 354  ILE A O   1 
ATOM   2707 C CB  . ILE A 1 354 ? 22.870  28.813  -6.287  1.00 35.19  ? 354  ILE A CB  1 
ATOM   2708 C CG1 . ILE A 1 354 ? 22.145  27.468  -6.252  1.00 29.26  ? 354  ILE A CG1 1 
ATOM   2709 C CG2 . ILE A 1 354 ? 23.231  29.184  -4.896  1.00 36.65  ? 354  ILE A CG2 1 
ATOM   2710 C CD1 . ILE A 1 354 ? 23.043  26.234  -6.367  1.00 26.77  ? 354  ILE A CD1 1 
ATOM   2711 N N   . SER A 1 355 ? 22.825  29.819  -9.137  1.00 30.62  ? 355  SER A N   1 
ATOM   2712 C CA  . SER A 1 355 ? 22.821  29.591  -10.572 1.00 30.22  ? 355  SER A CA  1 
ATOM   2713 C C   . SER A 1 355 ? 23.247  28.153  -10.902 1.00 30.34  ? 355  SER A C   1 
ATOM   2714 O O   . SER A 1 355 ? 23.729  27.417  -10.044 1.00 28.30  ? 355  SER A O   1 
ATOM   2715 C CB  . SER A 1 355 ? 23.829  30.542  -11.203 1.00 35.28  ? 355  SER A CB  1 
ATOM   2716 O OG  . SER A 1 355 ? 25.126  30.124  -10.782 1.00 38.02  ? 355  SER A OG  1 
ATOM   2717 N N   . ARG A 1 356 ? 23.082  27.766  -12.159 1.00 32.22  ? 356  ARG A N   1 
ATOM   2718 C CA  . ARG A 1 356 ? 23.512  26.456  -12.598 1.00 35.49  ? 356  ARG A CA  1 
ATOM   2719 C C   . ARG A 1 356 ? 25.019  26.326  -12.400 1.00 35.86  ? 356  ARG A C   1 
ATOM   2720 O O   . ARG A 1 356 ? 25.483  25.325  -11.905 1.00 38.44  ? 356  ARG A O   1 
ATOM   2721 C CB  . ARG A 1 356 ? 23.130  26.204  -14.065 1.00 36.54  ? 356  ARG A CB  1 
ATOM   2722 C CG  . ARG A 1 356 ? 23.493  24.808  -14.553 1.00 44.21  ? 356  ARG A CG  1 
ATOM   2723 C CD  . ARG A 1 356 ? 22.438  24.160  -15.458 1.00 43.36  ? 356  ARG A CD  1 
ATOM   2724 N NE  . ARG A 1 356 ? 22.738  22.736  -15.661 1.00 47.77  ? 356  ARG A NE  1 
ATOM   2725 C CZ  . ARG A 1 356 ? 22.237  21.730  -14.942 1.00 43.27  ? 356  ARG A CZ  1 
ATOM   2726 N NH1 . ARG A 1 356 ? 21.363  21.945  -13.965 1.00 40.19  ? 356  ARG A NH1 1 
ATOM   2727 N NH2 . ARG A 1 356 ? 22.598  20.492  -15.222 1.00 46.96  ? 356  ARG A NH2 1 
ATOM   2728 N N   . ALA A 1 357 ? 25.773  27.346  -12.764 1.00 32.12  ? 357  ALA A N   1 
ATOM   2729 C CA  . ALA A 1 357 ? 27.218  27.314  -12.542 1.00 38.07  ? 357  ALA A CA  1 
ATOM   2730 C C   . ALA A 1 357 ? 27.585  27.046  -11.082 1.00 34.54  ? 357  ALA A C   1 
ATOM   2731 O O   . ALA A 1 357 ? 28.491  26.288  -10.792 1.00 36.97  ? 357  ALA A O   1 
ATOM   2732 C CB  . ALA A 1 357 ? 27.893  28.637  -13.055 1.00 33.02  ? 357  ALA A CB  1 
ATOM   2733 N N   . GLN A 1 358 ? 26.899  27.678  -10.152 1.00 33.59  ? 358  GLN A N   1 
ATOM   2734 C CA  . GLN A 1 358 ? 27.239  27.465  -8.756  1.00 31.27  ? 358  GLN A CA  1 
ATOM   2735 C C   . GLN A 1 358 ? 26.780  26.068  -8.293  1.00 32.30  ? 358  GLN A C   1 
ATOM   2736 O O   . GLN A 1 358 ? 27.357  25.493  -7.367  1.00 33.11  ? 358  GLN A O   1 
ATOM   2737 C CB  . GLN A 1 358 ? 26.638  28.568  -7.866  1.00 35.58  ? 358  GLN A CB  1 
ATOM   2738 C CG  . GLN A 1 358 ? 27.131  29.999  -8.137  1.00 29.75  ? 358  GLN A CG  1 
ATOM   2739 C CD  . GLN A 1 358 ? 26.236  31.044  -7.470  1.00 38.41  ? 358  GLN A CD  1 
ATOM   2740 O OE1 . GLN A 1 358 ? 24.992  31.040  -7.624  1.00 42.92  ? 358  GLN A OE1 1 
ATOM   2741 N NE2 . GLN A 1 358 ? 26.851  31.934  -6.715  1.00 38.60  ? 358  GLN A NE2 1 
ATOM   2742 N N   . PHE A 1 359 ? 25.762  25.514  -8.948  1.00 28.71  ? 359  PHE A N   1 
ATOM   2743 C CA  . PHE A 1 359 ? 25.341  24.139  -8.643  1.00 29.94  ? 359  PHE A CA  1 
ATOM   2744 C C   . PHE A 1 359 ? 26.447  23.179  -9.068  1.00 29.78  ? 359  PHE A C   1 
ATOM   2745 O O   . PHE A 1 359 ? 26.855  22.336  -8.281  1.00 30.71  ? 359  PHE A O   1 
ATOM   2746 C CB  . PHE A 1 359 ? 24.029  23.789  -9.340  1.00 31.51  ? 359  PHE A CB  1 
ATOM   2747 C CG  . PHE A 1 359 ? 23.578  22.361  -9.132  1.00 30.52  ? 359  PHE A CG  1 
ATOM   2748 C CD1 . PHE A 1 359 ? 23.461  21.503  -10.198 1.00 29.22  ? 359  PHE A CD1 1 
ATOM   2749 C CD2 . PHE A 1 359 ? 23.265  21.889  -7.885  1.00 30.02  ? 359  PHE A CD2 1 
ATOM   2750 C CE1 . PHE A 1 359 ? 23.030  20.194  -10.027 1.00 27.28  ? 359  PHE A CE1 1 
ATOM   2751 C CE2 . PHE A 1 359 ? 22.858  20.562  -7.706  1.00 28.47  ? 359  PHE A CE2 1 
ATOM   2752 C CZ  . PHE A 1 359 ? 22.739  19.726  -8.796  1.00 25.27  ? 359  PHE A CZ  1 
ATOM   2753 N N   . LEU A 1 360 ? 26.928  23.311  -10.306 1.00 33.01  ? 360  LEU A N   1 
ATOM   2754 C CA  . LEU A 1 360 ? 28.010  22.444  -10.784 1.00 40.34  ? 360  LEU A CA  1 
ATOM   2755 C C   . LEU A 1 360 ? 29.212  22.574  -9.867  1.00 38.50  ? 360  LEU A C   1 
ATOM   2756 O O   . LEU A 1 360 ? 29.748  21.577  -9.429  1.00 40.07  ? 360  LEU A O   1 
ATOM   2757 C CB  . LEU A 1 360 ? 28.370  22.712  -12.257 1.00 42.54  ? 360  LEU A CB  1 
ATOM   2758 C CG  . LEU A 1 360 ? 27.158  22.642  -13.219 1.00 53.02  ? 360  LEU A CG  1 
ATOM   2759 C CD1 . LEU A 1 360 ? 27.515  22.838  -14.703 1.00 56.12  ? 360  LEU A CD1 1 
ATOM   2760 C CD2 . LEU A 1 360 ? 26.399  21.360  -13.071 1.00 51.36  ? 360  LEU A CD2 1 
ATOM   2761 N N   . ALA A 1 361 ? 29.610  23.799  -9.531  1.00 36.84  ? 361  ALA A N   1 
ATOM   2762 C CA  . ALA A 1 361 ? 30.736  23.975  -8.605  1.00 36.09  ? 361  ALA A CA  1 
ATOM   2763 C C   . ALA A 1 361 ? 30.505  23.340  -7.214  1.00 36.77  ? 361  ALA A C   1 
ATOM   2764 O O   . ALA A 1 361 ? 31.414  22.716  -6.665  1.00 40.82  ? 361  ALA A O   1 
ATOM   2765 C CB  . ALA A 1 361 ? 31.157  25.458  -8.494  1.00 31.88  ? 361  ALA A CB  1 
ATOM   2766 N N   . GLY A 1 362 ? 29.307  23.500  -6.655  1.00 32.19  ? 362  GLY A N   1 
ATOM   2767 C CA  . GLY A 1 362 ? 28.971  22.925  -5.361  1.00 32.07  ? 362  GLY A CA  1 
ATOM   2768 C C   . GLY A 1 362 ? 28.965  21.397  -5.381  1.00 38.70  ? 362  GLY A C   1 
ATOM   2769 O O   . GLY A 1 362 ? 29.351  20.739  -4.399  1.00 33.19  ? 362  GLY A O   1 
ATOM   2770 N N   . VAL A 1 363 ? 28.551  20.815  -6.506  1.00 34.33  ? 363  VAL A N   1 
ATOM   2771 C CA  . VAL A 1 363 ? 28.629  19.368  -6.620  1.00 30.67  ? 363  VAL A CA  1 
ATOM   2772 C C   . VAL A 1 363 ? 30.087  18.874  -6.497  1.00 36.39  ? 363  VAL A C   1 
ATOM   2773 O O   . VAL A 1 363 ? 30.332  17.869  -5.831  1.00 36.90  ? 363  VAL A O   1 
ATOM   2774 C CB  . VAL A 1 363 ? 27.938  18.835  -7.881  1.00 28.28  ? 363  VAL A CB  1 
ATOM   2775 C CG1 . VAL A 1 363 ? 28.388  17.351  -8.169  1.00 25.29  ? 363  VAL A CG1 1 
ATOM   2776 C CG2 . VAL A 1 363 ? 26.408  18.910  -7.691  1.00 32.70  ? 363  VAL A CG2 1 
ATOM   2777 N N   . ARG A 1 364 ? 31.050  19.595  -7.093  1.00 37.34  ? 364  ARG A N   1 
ATOM   2778 C CA  . ARG A 1 364 ? 32.466  19.214  -6.989  1.00 34.49  ? 364  ARG A CA  1 
ATOM   2779 C C   . ARG A 1 364 ? 32.973  19.355  -5.547  1.00 36.03  ? 364  ARG A C   1 
ATOM   2780 O O   . ARG A 1 364 ? 33.813  18.579  -5.120  1.00 34.89  ? 364  ARG A O   1 
ATOM   2781 C CB  . ARG A 1 364 ? 33.373  20.024  -7.916  1.00 35.59  ? 364  ARG A CB  1 
ATOM   2782 C CG  . ARG A 1 364 ? 33.176  19.807  -9.401  1.00 40.85  ? 364  ARG A CG  1 
ATOM   2783 C CD  . ARG A 1 364 ? 32.857  18.368  -9.701  1.00 53.98  ? 364  ARG A CD  1 
ATOM   2784 N NE  . ARG A 1 364 ? 33.996  17.446  -9.569  1.00 61.05  ? 364  ARG A NE  1 
ATOM   2785 C CZ  . ARG A 1 364 ? 34.721  17.015  -10.599 1.00 58.84  ? 364  ARG A CZ  1 
ATOM   2786 N NH1 . ARG A 1 364 ? 34.446  17.462  -11.822 1.00 63.74  ? 364  ARG A NH1 1 
ATOM   2787 N NH2 . ARG A 1 364 ? 35.717  16.163  -10.413 1.00 51.94  ? 364  ARG A NH2 1 
ATOM   2788 N N   . ILE A 1 365 ? 32.470  20.351  -4.817  1.00 31.95  ? 365  ILE A N   1 
ATOM   2789 C CA  . ILE A 1 365 ? 32.798  20.509  -3.402  1.00 36.11  ? 365  ILE A CA  1 
ATOM   2790 C C   . ILE A 1 365 ? 32.083  19.485  -2.508  1.00 36.66  ? 365  ILE A C   1 
ATOM   2791 O O   . ILE A 1 365 ? 32.681  18.941  -1.576  1.00 41.96  ? 365  ILE A O   1 
ATOM   2792 C CB  . ILE A 1 365 ? 32.540  21.971  -2.939  1.00 33.95  ? 365  ILE A CB  1 
ATOM   2793 C CG1 . ILE A 1 365 ? 33.442  22.902  -3.720  1.00 36.06  ? 365  ILE A CG1 1 
ATOM   2794 C CG2 . ILE A 1 365 ? 32.763  22.157  -1.425  1.00 29.02  ? 365  ILE A CG2 1 
ATOM   2795 C CD1 . ILE A 1 365 ? 33.006  24.371  -3.661  1.00 38.28  ? 365  ILE A CD1 1 
ATOM   2796 N N   . GLY A 1 366 ? 30.821  19.194  -2.819  1.00 38.20  ? 366  GLY A N   1 
ATOM   2797 C CA  . GLY A 1 366 ? 30.033  18.208  -2.072  1.00 32.53  ? 366  GLY A CA  1 
ATOM   2798 C C   . GLY A 1 366 ? 30.440  16.762  -2.306  1.00 37.63  ? 366  GLY A C   1 
ATOM   2799 O O   . GLY A 1 366 ? 30.183  15.904  -1.467  1.00 35.52  ? 366  GLY A O   1 
ATOM   2800 N N   . VAL A 1 367 ? 31.056  16.480  -3.456  1.00 35.25  ? 367  VAL A N   1 
ATOM   2801 C CA  . VAL A 1 367 ? 31.453  15.126  -3.786  1.00 28.53  ? 367  VAL A CA  1 
ATOM   2802 C C   . VAL A 1 367 ? 32.923  15.206  -4.196  1.00 36.16  ? 367  VAL A C   1 
ATOM   2803 O O   . VAL A 1 367 ? 33.263  14.949  -5.350  1.00 32.98  ? 367  VAL A O   1 
ATOM   2804 C CB  . VAL A 1 367 ? 30.626  14.529  -4.954  1.00 34.23  ? 367  VAL A CB  1 
ATOM   2805 C CG1 . VAL A 1 367 ? 30.879  13.024  -5.033  1.00 34.78  ? 367  VAL A CG1 1 
ATOM   2806 C CG2 . VAL A 1 367 ? 29.089  14.815  -4.782  1.00 26.80  ? 367  VAL A CG2 1 
ATOM   2807 N N   . PRO A 1 368 ? 33.799  15.553  -3.235  1.00 32.47  ? 368  PRO A N   1 
ATOM   2808 C CA  . PRO A 1 368 ? 35.141  15.984  -3.620  1.00 31.92  ? 368  PRO A CA  1 
ATOM   2809 C C   . PRO A 1 368 ? 35.951  14.822  -4.192  1.00 40.48  ? 368  PRO A C   1 
ATOM   2810 O O   . PRO A 1 368 ? 36.919  15.052  -4.890  1.00 41.82  ? 368  PRO A O   1 
ATOM   2811 C CB  . PRO A 1 368 ? 35.725  16.484  -2.312  1.00 29.04  ? 368  PRO A CB  1 
ATOM   2812 C CG  . PRO A 1 368 ? 35.001  15.657  -1.271  1.00 30.29  ? 368  PRO A CG  1 
ATOM   2813 C CD  . PRO A 1 368 ? 33.592  15.620  -1.770  1.00 25.42  ? 368  PRO A CD  1 
ATOM   2814 N N   . GLN A 1 369 ? 35.523  13.588  -3.943  1.00 40.36  ? 369  GLN A N   1 
ATOM   2815 C CA  . GLN A 1 369 ? 36.261  12.432  -4.451  1.00 39.52  ? 369  GLN A CA  1 
ATOM   2816 C C   . GLN A 1 369 ? 35.832  12.064  -5.858  1.00 43.06  ? 369  GLN A C   1 
ATOM   2817 O O   . GLN A 1 369 ? 36.350  11.114  -6.421  1.00 42.62  ? 369  GLN A O   1 
ATOM   2818 C CB  . GLN A 1 369 ? 36.078  11.221  -3.532  1.00 34.38  ? 369  GLN A CB  1 
ATOM   2819 C CG  . GLN A 1 369 ? 34.698  10.538  -3.688  1.00 44.17  ? 369  GLN A CG  1 
ATOM   2820 C CD  . GLN A 1 369 ? 33.558  11.184  -2.863  1.00 43.00  ? 369  GLN A CD  1 
ATOM   2821 O OE1 . GLN A 1 369 ? 33.613  12.355  -2.478  1.00 35.41  ? 369  GLN A OE1 1 
ATOM   2822 N NE2 . GLN A 1 369 ? 32.517  10.400  -2.605  1.00 46.46  ? 369  GLN A NE2 1 
ATOM   2823 N N   . ALA A 1 370 ? 34.891  12.805  -6.437  1.00 42.59  ? 370  ALA A N   1 
ATOM   2824 C CA  . ALA A 1 370 ? 34.310  12.405  -7.734  1.00 42.21  ? 370  ALA A CA  1 
ATOM   2825 C C   . ALA A 1 370 ? 35.228  12.669  -8.932  1.00 43.04  ? 370  ALA A C   1 
ATOM   2826 O O   . ALA A 1 370 ? 35.837  13.712  -9.023  1.00 45.83  ? 370  ALA A O   1 
ATOM   2827 C CB  . ALA A 1 370 ? 32.943  13.098  -7.958  1.00 38.12  ? 370  ALA A CB  1 
ATOM   2828 N N   . SER A 1 371 ? 35.316  11.729  -9.864  1.00 41.31  ? 371  SER A N   1 
ATOM   2829 C CA  . SER A 1 371 ? 35.886  12.047  -11.169 1.00 39.52  ? 371  SER A CA  1 
ATOM   2830 C C   . SER A 1 371 ? 34.916  12.972  -11.906 1.00 38.82  ? 371  SER A C   1 
ATOM   2831 O O   . SER A 1 371 ? 33.808  13.230  -11.422 1.00 41.33  ? 371  SER A O   1 
ATOM   2832 C CB  . SER A 1 371 ? 36.063  10.779  -11.984 1.00 39.98  ? 371  SER A CB  1 
ATOM   2833 O OG  . SER A 1 371 ? 34.824  10.089  -12.143 1.00 44.88  ? 371  SER A OG  1 
ATOM   2834 N N   . ASP A 1 372 ? 35.308  13.426  -13.088 1.00 36.83  ? 372  ASP A N   1 
ATOM   2835 C CA  . ASP A 1 372 ? 34.459  14.282  -13.891 1.00 42.57  ? 372  ASP A CA  1 
ATOM   2836 C C   . ASP A 1 372 ? 33.163  13.590  -14.279 1.00 46.20  ? 372  ASP A C   1 
ATOM   2837 O O   . ASP A 1 372 ? 32.089  14.189  -14.233 1.00 42.99  ? 372  ASP A O   1 
ATOM   2838 C CB  . ASP A 1 372 ? 35.175  14.731  -15.154 1.00 44.84  ? 372  ASP A CB  1 
ATOM   2839 C CG  . ASP A 1 372 ? 36.175  15.824  -14.886 1.00 58.80  ? 372  ASP A CG  1 
ATOM   2840 O OD1 . ASP A 1 372 ? 36.251  16.261  -13.726 1.00 61.09  ? 372  ASP A OD1 1 
ATOM   2841 O OD2 . ASP A 1 372 ? 36.896  16.242  -15.825 1.00 67.67  ? 372  ASP A OD2 1 
ATOM   2842 N N   . LEU A 1 373 ? 33.273  12.338  -14.702 1.00 47.95  ? 373  LEU A N   1 
ATOM   2843 C CA  . LEU A 1 373 ? 32.096  11.611  -15.131 1.00 46.49  ? 373  LEU A CA  1 
ATOM   2844 C C   . LEU A 1 373 ? 31.157  11.391  -13.948 1.00 43.48  ? 373  LEU A C   1 
ATOM   2845 O O   . LEU A 1 373 ? 29.949  11.567  -14.079 1.00 49.99  ? 373  LEU A O   1 
ATOM   2846 C CB  . LEU A 1 373 ? 32.476  10.299  -15.810 1.00 46.26  ? 373  LEU A CB  1 
ATOM   2847 C CG  . LEU A 1 373 ? 31.267  9.520   -16.343 1.00 55.77  ? 373  LEU A CG  1 
ATOM   2848 C CD1 . LEU A 1 373 ? 30.497  10.316  -17.392 1.00 54.86  ? 373  LEU A CD1 1 
ATOM   2849 C CD2 . LEU A 1 373 ? 31.698  8.185   -16.903 1.00 57.35  ? 373  LEU A CD2 1 
ATOM   2850 N N   . ALA A 1 374 ? 31.703  11.034  -12.785 1.00 43.46  ? 374  ALA A N   1 
ATOM   2851 C CA  . ALA A 1 374 ? 30.873  10.770  -11.617 1.00 42.76  ? 374  ALA A CA  1 
ATOM   2852 C C   . ALA A 1 374 ? 30.115  12.041  -11.223 1.00 41.62  ? 374  ALA A C   1 
ATOM   2853 O O   . ALA A 1 374 ? 28.929  12.000  -10.895 1.00 42.48  ? 374  ALA A O   1 
ATOM   2854 C CB  . ALA A 1 374 ? 31.703  10.255  -10.447 1.00 42.08  ? 374  ALA A CB  1 
ATOM   2855 N N   . ALA A 1 375 ? 30.799  13.169  -11.279 1.00 35.16  ? 375  ALA A N   1 
ATOM   2856 C CA  . ALA A 1 375 ? 30.158  14.421  -10.959 1.00 36.37  ? 375  ALA A CA  1 
ATOM   2857 C C   . ALA A 1 375 ? 29.043  14.712  -11.972 1.00 41.70  ? 375  ALA A C   1 
ATOM   2858 O O   . ALA A 1 375 ? 27.947  15.151  -11.583 1.00 46.56  ? 375  ALA A O   1 
ATOM   2859 C CB  . ALA A 1 375 ? 31.175  15.541  -10.921 1.00 36.43  ? 375  ALA A CB  1 
ATOM   2860 N N   . GLU A 1 376 ? 29.293  14.490  -13.262 1.00 38.38  ? 376  GLU A N   1 
ATOM   2861 C CA  . GLU A 1 376 ? 28.262  14.640  -14.282 1.00 42.97  ? 376  GLU A CA  1 
ATOM   2862 C C   . GLU A 1 376 ? 27.055  13.748  -13.977 1.00 40.39  ? 376  GLU A C   1 
ATOM   2863 O O   . GLU A 1 376 ? 25.898  14.144  -14.153 1.00 40.78  ? 376  GLU A O   1 
ATOM   2864 C CB  . GLU A 1 376 ? 28.834  14.351  -15.680 1.00 46.52  ? 376  GLU A CB  1 
ATOM   2865 C CG  . GLU A 1 376 ? 29.755  15.473  -16.191 1.00 54.93  ? 376  GLU A CG  1 
ATOM   2866 C CD  . GLU A 1 376 ? 30.426  15.168  -17.524 1.00 61.42  ? 376  GLU A CD  1 
ATOM   2867 O OE1 . GLU A 1 376 ? 30.767  13.991  -17.780 1.00 60.21  ? 376  GLU A OE1 1 
ATOM   2868 O OE2 . GLU A 1 376 ? 30.631  16.121  -18.309 1.00 65.83  ? 376  GLU A OE2 1 
ATOM   2869 N N   . ALA A 1 377 ? 27.320  12.527  -13.518 1.00 32.45  ? 377  ALA A N   1 
ATOM   2870 C CA  . ALA A 1 377 ? 26.189  11.658  -13.185 1.00 31.32  ? 377  ALA A CA  1 
ATOM   2871 C C   . ALA A 1 377 ? 25.350  12.307  -12.054 1.00 41.15  ? 377  ALA A C   1 
ATOM   2872 O O   . ALA A 1 377 ? 24.104  12.310  -12.124 1.00 34.44  ? 377  ALA A O   1 
ATOM   2873 C CB  . ALA A 1 377 ? 26.624  10.259  -12.808 1.00 26.68  ? 377  ALA A CB  1 
ATOM   2874 N N   . VAL A 1 378 ? 26.031  12.883  -11.053 1.00 34.53  ? 378  VAL A N   1 
ATOM   2875 C CA  . VAL A 1 378 ? 25.347  13.511  -9.923  1.00 35.54  ? 378  VAL A CA  1 
ATOM   2876 C C   . VAL A 1 378 ? 24.483  14.674  -10.408 1.00 33.54  ? 378  VAL A C   1 
ATOM   2877 O O   . VAL A 1 378 ? 23.302  14.772  -10.060 1.00 32.68  ? 378  VAL A O   1 
ATOM   2878 C CB  . VAL A 1 378 ? 26.322  14.012  -8.818  1.00 29.84  ? 378  VAL A CB  1 
ATOM   2879 C CG1 . VAL A 1 378 ? 25.574  14.823  -7.777  1.00 25.47  ? 378  VAL A CG1 1 
ATOM   2880 C CG2 . VAL A 1 378 ? 27.043  12.869  -8.149  1.00 30.34  ? 378  VAL A CG2 1 
ATOM   2881 N N   . VAL A 1 379 ? 25.071  15.544  -11.220 1.00 30.29  ? 379  VAL A N   1 
ATOM   2882 C CA  . VAL A 1 379 ? 24.348  16.663  -11.790 1.00 34.04  ? 379  VAL A CA  1 
ATOM   2883 C C   . VAL A 1 379 ? 23.154  16.230  -12.663 1.00 44.71  ? 379  VAL A C   1 
ATOM   2884 O O   . VAL A 1 379 ? 22.060  16.812  -12.596 1.00 41.33  ? 379  VAL A O   1 
ATOM   2885 C CB  . VAL A 1 379 ? 25.278  17.548  -12.612 1.00 36.71  ? 379  VAL A CB  1 
ATOM   2886 C CG1 . VAL A 1 379 ? 24.466  18.551  -13.405 1.00 38.27  ? 379  VAL A CG1 1 
ATOM   2887 C CG2 . VAL A 1 379 ? 26.259  18.264  -11.668 1.00 31.70  ? 379  VAL A CG2 1 
ATOM   2888 N N   . LEU A 1 380 ? 23.366  15.189  -13.454 1.00 44.72  ? 380  LEU A N   1 
ATOM   2889 C CA  . LEU A 1 380 ? 22.336  14.686  -14.325 1.00 46.29  ? 380  LEU A CA  1 
ATOM   2890 C C   . LEU A 1 380 ? 21.168  14.214  -13.483 1.00 42.94  ? 380  LEU A C   1 
ATOM   2891 O O   . LEU A 1 380 ? 20.017  14.478  -13.808 1.00 34.94  ? 380  LEU A O   1 
ATOM   2892 C CB  . LEU A 1 380 ? 22.871  13.513  -15.135 1.00 57.48  ? 380  LEU A CB  1 
ATOM   2893 C CG  . LEU A 1 380 ? 23.474  13.870  -16.489 1.00 68.09  ? 380  LEU A CG  1 
ATOM   2894 C CD1 . LEU A 1 380 ? 22.345  14.009  -17.488 1.00 75.24  ? 380  LEU A CD1 1 
ATOM   2895 C CD2 . LEU A 1 380 ? 24.322  15.138  -16.420 1.00 62.34  ? 380  LEU A CD2 1 
ATOM   2896 N N   . HIS A 1 381 ? 21.478  13.497  -12.414 1.00 35.88  ? 381  HIS A N   1 
ATOM   2897 C CA  . HIS A 1 381 ? 20.451  12.901  -11.590 1.00 38.84  ? 381  HIS A CA  1 
ATOM   2898 C C   . HIS A 1 381 ? 19.682  13.917  -10.768 1.00 37.13  ? 381  HIS A C   1 
ATOM   2899 O O   . HIS A 1 381 ? 18.488  13.765  -10.562 1.00 36.08  ? 381  HIS A O   1 
ATOM   2900 C CB  . HIS A 1 381 ? 21.065  11.864  -10.653 1.00 38.54  ? 381  HIS A CB  1 
ATOM   2901 C CG  . HIS A 1 381 ? 20.074  11.234  -9.732  1.00 37.28  ? 381  HIS A CG  1 
ATOM   2902 N ND1 . HIS A 1 381 ? 19.427  10.059  -10.036 1.00 40.81  ? 381  HIS A ND1 1 
ATOM   2903 C CD2 . HIS A 1 381 ? 19.627  11.611  -8.512  1.00 38.01  ? 381  HIS A CD2 1 
ATOM   2904 C CE1 . HIS A 1 381 ? 18.625  9.731   -9.034  1.00 41.98  ? 381  HIS A CE1 1 
ATOM   2905 N NE2 . HIS A 1 381 ? 18.732  10.649  -8.093  1.00 40.40  ? 381  HIS A NE2 1 
ATOM   2906 N N   . TYR A 1 382 ? 20.358  14.951  -10.288 1.00 34.62  ? 382  TYR A N   1 
ATOM   2907 C CA  . TYR A 1 382 ? 19.682  15.967  -9.474  1.00 34.67  ? 382  TYR A CA  1 
ATOM   2908 C C   . TYR A 1 382 ? 19.130  17.181  -10.226 1.00 32.68  ? 382  TYR A C   1 
ATOM   2909 O O   . TYR A 1 382 ? 18.434  17.977  -9.622  1.00 36.97  ? 382  TYR A O   1 
ATOM   2910 C CB  . TYR A 1 382 ? 20.577  16.455  -8.317  1.00 31.15  ? 382  TYR A CB  1 
ATOM   2911 C CG  . TYR A 1 382 ? 20.687  15.452  -7.201  1.00 35.03  ? 382  TYR A CG  1 
ATOM   2912 C CD1 . TYR A 1 382 ? 21.603  14.401  -7.276  1.00 29.80  ? 382  TYR A CD1 1 
ATOM   2913 C CD2 . TYR A 1 382 ? 19.863  15.547  -6.061  1.00 36.32  ? 382  TYR A CD2 1 
ATOM   2914 C CE1 . TYR A 1 382 ? 21.686  13.472  -6.271  1.00 30.90  ? 382  TYR A CE1 1 
ATOM   2915 C CE2 . TYR A 1 382 ? 19.959  14.641  -5.027  1.00 30.86  ? 382  TYR A CE2 1 
ATOM   2916 C CZ  . TYR A 1 382 ? 20.881  13.601  -5.143  1.00 35.60  ? 382  TYR A CZ  1 
ATOM   2917 O OH  . TYR A 1 382 ? 21.000  12.681  -4.148  1.00 34.66  ? 382  TYR A OH  1 
ATOM   2918 N N   . THR A 1 383 ? 19.458  17.347  -11.510 1.00 32.57  ? 383  THR A N   1 
ATOM   2919 C CA  . THR A 1 383 ? 18.951  18.476  -12.279 1.00 31.15  ? 383  THR A CA  1 
ATOM   2920 C C   . THR A 1 383 ? 17.489  18.206  -12.508 1.00 41.42  ? 383  THR A C   1 
ATOM   2921 O O   . THR A 1 383 ? 17.111  17.054  -12.713 1.00 43.90  ? 383  THR A O   1 
ATOM   2922 C CB  . THR A 1 383 ? 19.661  18.610  -13.633 1.00 33.87  ? 383  THR A CB  1 
ATOM   2923 O OG1 . THR A 1 383 ? 20.979  19.131  -13.421 1.00 35.54  ? 383  THR A OG1 1 
ATOM   2924 C CG2 . THR A 1 383 ? 18.889  19.545  -14.607 1.00 24.90  ? 383  THR A CG2 1 
ATOM   2925 N N   . ASP A 1 384 ? 16.659  19.241  -12.414 1.00 42.31  ? 384  ASP A N   1 
ATOM   2926 C CA  . ASP A 1 384 ? 15.256  19.128  -12.828 1.00 40.43  ? 384  ASP A CA  1 
ATOM   2927 C C   . ASP A 1 384 ? 15.178  19.455  -14.314 1.00 40.16  ? 384  ASP A C   1 
ATOM   2928 O O   . ASP A 1 384 ? 15.340  20.619  -14.693 1.00 36.45  ? 384  ASP A O   1 
ATOM   2929 C CB  . ASP A 1 384 ? 14.391  20.098  -12.041 1.00 37.17  ? 384  ASP A CB  1 
ATOM   2930 C CG  . ASP A 1 384 ? 12.946  20.100  -12.508 1.00 53.50  ? 384  ASP A CG  1 
ATOM   2931 O OD1 . ASP A 1 384 ? 12.633  19.517  -13.581 1.00 48.88  ? 384  ASP A OD1 1 
ATOM   2932 O OD2 . ASP A 1 384 ? 12.119  20.723  -11.804 1.00 63.39  ? 384  ASP A OD2 1 
ATOM   2933 N N   . TRP A 1 385 ? 14.945  18.455  -15.175 1.00 39.73  ? 385  TRP A N   1 
ATOM   2934 C CA  . TRP A 1 385 ? 15.135  18.726  -16.605 1.00 40.19  ? 385  TRP A CA  1 
ATOM   2935 C C   . TRP A 1 385 ? 13.968  19.473  -17.257 1.00 33.68  ? 385  TRP A C   1 
ATOM   2936 O O   . TRP A 1 385 ? 14.027  19.840  -18.431 1.00 39.87  ? 385  TRP A O   1 
ATOM   2937 C CB  . TRP A 1 385 ? 15.650  17.502  -17.401 1.00 45.27  ? 385  TRP A CB  1 
ATOM   2938 C CG  . TRP A 1 385 ? 17.047  17.072  -16.979 1.00 37.51  ? 385  TRP A CG  1 
ATOM   2939 C CD1 . TRP A 1 385 ? 17.371  16.075  -16.113 1.00 33.77  ? 385  TRP A CD1 1 
ATOM   2940 C CD2 . TRP A 1 385 ? 18.279  17.646  -17.408 1.00 34.36  ? 385  TRP A CD2 1 
ATOM   2941 N NE1 . TRP A 1 385 ? 18.730  16.000  -15.965 1.00 32.08  ? 385  TRP A NE1 1 
ATOM   2942 C CE2 . TRP A 1 385 ? 19.314  16.944  -16.753 1.00 31.47  ? 385  TRP A CE2 1 
ATOM   2943 C CE3 . TRP A 1 385 ? 18.609  18.706  -18.268 1.00 37.55  ? 385  TRP A CE3 1 
ATOM   2944 C CZ2 . TRP A 1 385 ? 20.660  17.265  -16.924 1.00 37.40  ? 385  TRP A CZ2 1 
ATOM   2945 C CZ3 . TRP A 1 385 ? 19.959  19.030  -18.442 1.00 35.86  ? 385  TRP A CZ3 1 
ATOM   2946 C CH2 . TRP A 1 385 ? 20.963  18.312  -17.774 1.00 38.82  ? 385  TRP A CH2 1 
ATOM   2947 N N   . LEU A 1 386 ? 12.940  19.758  -16.465 1.00 40.14  ? 386  LEU A N   1 
ATOM   2948 C CA  . LEU A 1 386 ? 11.892  20.694  -16.892 1.00 49.08  ? 386  LEU A CA  1 
ATOM   2949 C C   . LEU A 1 386 ? 12.290  22.138  -16.587 1.00 52.76  ? 386  LEU A C   1 
ATOM   2950 O O   . LEU A 1 386 ? 11.706  23.070  -17.120 1.00 53.76  ? 386  LEU A O   1 
ATOM   2951 C CB  . LEU A 1 386 ? 10.575  20.419  -16.173 1.00 47.47  ? 386  LEU A CB  1 
ATOM   2952 C CG  . LEU A 1 386 ? 9.414   19.995  -17.055 1.00 57.92  ? 386  LEU A CG  1 
ATOM   2953 C CD1 . LEU A 1 386 ? 8.145   20.034  -16.225 1.00 53.47  ? 386  LEU A CD1 1 
ATOM   2954 C CD2 . LEU A 1 386 ? 9.287   20.895  -18.325 1.00 52.56  ? 386  LEU A CD2 1 
ATOM   2955 N N   . HIS A 1 387 ? 13.259  22.312  -15.695 1.00 48.58  ? 387  HIS A N   1 
ATOM   2956 C CA  . HIS A 1 387 ? 13.652  23.637  -15.234 1.00 48.63  ? 387  HIS A CA  1 
ATOM   2957 C C   . HIS A 1 387 ? 15.110  23.590  -14.798 1.00 37.65  ? 387  HIS A C   1 
ATOM   2958 O O   . HIS A 1 387 ? 15.407  23.801  -13.629 1.00 33.22  ? 387  HIS A O   1 
ATOM   2959 C CB  . HIS A 1 387 ? 12.803  24.041  -14.028 1.00 44.16  ? 387  HIS A CB  1 
ATOM   2960 C CG  . HIS A 1 387 ? 11.337  24.094  -14.305 1.00 54.60  ? 387  HIS A CG  1 
ATOM   2961 N ND1 . HIS A 1 387 ? 10.435  23.229  -13.719 1.00 54.94  ? 387  HIS A ND1 1 
ATOM   2962 C CD2 . HIS A 1 387 ? 10.609  24.922  -15.088 1.00 54.29  ? 387  HIS A CD2 1 
ATOM   2963 C CE1 . HIS A 1 387 ? 9.217   23.529  -14.125 1.00 53.65  ? 387  HIS A CE1 1 
ATOM   2964 N NE2 . HIS A 1 387 ? 9.295   24.549  -14.959 1.00 53.25  ? 387  HIS A NE2 1 
ATOM   2965 N N   . PRO A 1 388 ? 16.013  23.296  -15.733 1.00 37.89  ? 388  PRO A N   1 
ATOM   2966 C CA  . PRO A 1 388 ? 17.400  23.007  -15.358 1.00 35.16  ? 388  PRO A CA  1 
ATOM   2967 C C   . PRO A 1 388 ? 18.151  24.216  -14.770 1.00 36.84  ? 388  PRO A C   1 
ATOM   2968 O O   . PRO A 1 388 ? 19.222  23.999  -14.191 1.00 38.65  ? 388  PRO A O   1 
ATOM   2969 C CB  . PRO A 1 388 ? 18.064  22.572  -16.679 1.00 32.94  ? 388  PRO A CB  1 
ATOM   2970 C CG  . PRO A 1 388 ? 17.021  22.769  -17.771 1.00 40.65  ? 388  PRO A CG  1 
ATOM   2971 C CD  . PRO A 1 388 ? 15.817  23.439  -17.188 1.00 42.67  ? 388  PRO A CD  1 
ATOM   2972 N N   . GLU A 1 389 ? 17.640  25.433  -14.963 1.00 31.26  ? 389  GLU A N   1 
ATOM   2973 C CA  . GLU A 1 389 ? 18.308  26.667  -14.511 1.00 36.36  ? 389  GLU A CA  1 
ATOM   2974 C C   . GLU A 1 389 ? 17.559  27.330  -13.373 1.00 37.48  ? 389  GLU A C   1 
ATOM   2975 O O   . GLU A 1 389 ? 17.938  28.404  -12.942 1.00 36.09  ? 389  GLU A O   1 
ATOM   2976 C CB  . GLU A 1 389 ? 18.393  27.730  -15.607 1.00 35.67  ? 389  GLU A CB  1 
ATOM   2977 C CG  . GLU A 1 389 ? 18.969  27.303  -16.928 1.00 57.23  ? 389  GLU A CG  1 
ATOM   2978 C CD  . GLU A 1 389 ? 20.483  27.398  -16.961 1.00 76.37  ? 389  GLU A CD  1 
ATOM   2979 O OE1 . GLU A 1 389 ? 21.082  27.964  -16.010 1.00 80.09  ? 389  GLU A OE1 1 
ATOM   2980 O OE2 . GLU A 1 389 ? 21.073  26.915  -17.953 1.00 85.70  ? 389  GLU A OE2 1 
ATOM   2981 N N   . ASP A 1 390 ? 16.457  26.735  -12.928 1.00 36.14  ? 390  ASP A N   1 
ATOM   2982 C CA  . ASP A 1 390 ? 15.709  27.330  -11.834 1.00 31.76  ? 390  ASP A CA  1 
ATOM   2983 C C   . ASP A 1 390 ? 16.480  27.395  -10.482 1.00 32.95  ? 390  ASP A C   1 
ATOM   2984 O O   . ASP A 1 390 ? 16.869  26.374  -9.906  1.00 32.48  ? 390  ASP A O   1 
ATOM   2985 C CB  . ASP A 1 390 ? 14.385  26.617  -11.628 1.00 32.08  ? 390  ASP A CB  1 
ATOM   2986 C CG  . ASP A 1 390 ? 13.599  27.264  -10.559 1.00 35.05  ? 390  ASP A CG  1 
ATOM   2987 O OD1 . ASP A 1 390 ? 13.262  28.449  -10.714 1.00 42.97  ? 390  ASP A OD1 1 
ATOM   2988 O OD2 . ASP A 1 390 ? 13.398  26.637  -9.530  1.00 42.36  ? 390  ASP A OD2 1 
ATOM   2989 N N   . PRO A 1 391 ? 16.701  28.614  -9.975  1.00 34.53  ? 391  PRO A N   1 
ATOM   2990 C CA  . PRO A 1 391 ? 17.572  28.797  -8.799  1.00 32.59  ? 391  PRO A CA  1 
ATOM   2991 C C   . PRO A 1 391 ? 17.057  28.130  -7.542  1.00 35.05  ? 391  PRO A C   1 
ATOM   2992 O O   . PRO A 1 391 ? 17.857  27.668  -6.711  1.00 35.68  ? 391  PRO A O   1 
ATOM   2993 C CB  . PRO A 1 391 ? 17.644  30.330  -8.609  1.00 28.51  ? 391  PRO A CB  1 
ATOM   2994 C CG  . PRO A 1 391 ? 17.241  30.898  -9.932  1.00 36.85  ? 391  PRO A CG  1 
ATOM   2995 C CD  . PRO A 1 391 ? 16.336  29.892  -10.625 1.00 35.90  ? 391  PRO A CD  1 
ATOM   2996 N N   . THR A 1 392 ? 15.744  28.068  -7.385  1.00 27.08  ? 392  THR A N   1 
ATOM   2997 C CA  . THR A 1 392 ? 15.207  27.462  -6.185  1.00 28.93  ? 392  THR A CA  1 
ATOM   2998 C C   . THR A 1 392 ? 15.443  25.958  -6.224  1.00 32.83  ? 392  THR A C   1 
ATOM   2999 O O   . THR A 1 392 ? 15.845  25.394  -5.228  1.00 33.37  ? 392  THR A O   1 
ATOM   3000 C CB  . THR A 1 392 ? 13.663  27.740  -6.004  1.00 39.27  ? 392  THR A CB  1 
ATOM   3001 O OG1 . THR A 1 392 ? 13.436  29.147  -5.833  1.00 38.23  ? 392  THR A OG1 1 
ATOM   3002 C CG2 . THR A 1 392 ? 13.139  27.003  -4.787  1.00 30.69  ? 392  THR A CG2 1 
ATOM   3003 N N   A HIS A 1 393 ? 15.174  25.296  -7.350  0.50 32.94  ? 393  HIS A N   1 
ATOM   3004 N N   B HIS A 1 393 ? 15.163  25.346  -7.384  0.50 32.97  ? 393  HIS A N   1 
ATOM   3005 C CA  A HIS A 1 393 ? 15.432  23.862  -7.390  0.50 33.40  ? 393  HIS A CA  1 
ATOM   3006 C CA  B HIS A 1 393 ? 15.385  23.922  -7.640  0.50 32.49  ? 393  HIS A CA  1 
ATOM   3007 C C   A HIS A 1 393 ? 16.926  23.575  -7.236  0.50 37.70  ? 393  HIS A C   1 
ATOM   3008 C C   B HIS A 1 393 ? 16.853  23.525  -7.419  0.50 37.39  ? 393  HIS A C   1 
ATOM   3009 O O   A HIS A 1 393 ? 17.309  22.627  -6.566  0.50 40.45  ? 393  HIS A O   1 
ATOM   3010 O O   B HIS A 1 393 ? 17.137  22.461  -6.884  0.50 38.93  ? 393  HIS A O   1 
ATOM   3011 C CB  A HIS A 1 393 ? 14.937  23.191  -8.670  0.50 29.74  ? 393  HIS A CB  1 
ATOM   3012 C CB  B HIS A 1 393 ? 15.023  23.570  -9.093  0.50 29.20  ? 393  HIS A CB  1 
ATOM   3013 C CG  A HIS A 1 393 ? 15.445  21.790  -8.825  0.50 25.91  ? 393  HIS A CG  1 
ATOM   3014 C CG  B HIS A 1 393 ? 13.585  23.204  -9.306  0.50 36.33  ? 393  HIS A CG  1 
ATOM   3015 N ND1 A HIS A 1 393 ? 14.871  20.709  -8.178  0.50 29.25  ? 393  HIS A ND1 1 
ATOM   3016 N ND1 B HIS A 1 393 ? 13.048  22.005  -8.883  0.50 44.78  ? 393  HIS A ND1 1 
ATOM   3017 C CD2 A HIS A 1 393 ? 16.512  21.299  -9.497  0.50 20.02  ? 393  HIS A CD2 1 
ATOM   3018 C CD2 B HIS A 1 393 ? 12.581  23.865  -9.932  0.50 31.66  ? 393  HIS A CD2 1 
ATOM   3019 C CE1 A HIS A 1 393 ? 15.538  19.612  -8.478  0.50 27.69  ? 393  HIS A CE1 1 
ATOM   3020 C CE1 B HIS A 1 393 ? 11.771  21.954  -9.225  0.50 42.59  ? 393  HIS A CE1 1 
ATOM   3021 N NE2 A HIS A 1 393 ? 16.549  19.946  -9.270  0.50 31.66  ? 393  HIS A NE2 1 
ATOM   3022 N NE2 B HIS A 1 393 ? 11.462  23.075  -9.853  0.50 38.65  ? 393  HIS A NE2 1 
ATOM   3023 N N   . LEU A 1 394 ? 17.770  24.372  -7.882  1.00 33.44  ? 394  LEU A N   1 
ATOM   3024 C CA  . LEU A 1 394 ? 19.220  24.121  -7.800  1.00 32.90  ? 394  LEU A CA  1 
ATOM   3025 C C   . LEU A 1 394 ? 19.710  24.247  -6.359  1.00 37.06  ? 394  LEU A C   1 
ATOM   3026 O O   . LEU A 1 394 ? 20.495  23.423  -5.891  1.00 38.24  ? 394  LEU A O   1 
ATOM   3027 C CB  . LEU A 1 394 ? 20.002  25.090  -8.696  1.00 22.22  ? 394  LEU A CB  1 
ATOM   3028 C CG  . LEU A 1 394 ? 19.685  24.933  -10.183 1.00 26.70  ? 394  LEU A CG  1 
ATOM   3029 C CD1 . LEU A 1 394 ? 20.210  26.155  -10.958 1.00 28.60  ? 394  LEU A CD1 1 
ATOM   3030 C CD2 . LEU A 1 394 ? 20.267  23.614  -10.684 1.00 24.09  ? 394  LEU A CD2 1 
ATOM   3031 N N   . ARG A 1 395 ? 19.223  25.266  -5.655  1.00 32.48  ? 395  ARG A N   1 
ATOM   3032 C CA  . ARG A 1 395 ? 19.542  25.413  -4.254  1.00 32.27  ? 395  ARG A CA  1 
ATOM   3033 C C   . ARG A 1 395 ? 19.111  24.175  -3.450  1.00 37.42  ? 395  ARG A C   1 
ATOM   3034 O O   . ARG A 1 395 ? 19.946  23.552  -2.792  1.00 35.83  ? 395  ARG A O   1 
ATOM   3035 C CB  . ARG A 1 395 ? 18.951  26.691  -3.683  1.00 34.41  ? 395  ARG A CB  1 
ATOM   3036 C CG  . ARG A 1 395 ? 19.145  26.797  -2.184  1.00 37.93  ? 395  ARG A CG  1 
ATOM   3037 C CD  . ARG A 1 395 ? 17.803  26.619  -1.507  1.00 41.82  ? 395  ARG A CD  1 
ATOM   3038 N NE  . ARG A 1 395 ? 17.159  27.896  -1.403  1.00 42.38  ? 395  ARG A NE  1 
ATOM   3039 C CZ  . ARG A 1 395 ? 15.838  28.104  -1.280  1.00 43.21  ? 395  ARG A CZ  1 
ATOM   3040 N NH1 . ARG A 1 395 ? 14.951  27.102  -1.266  1.00 28.70  ? 395  ARG A NH1 1 
ATOM   3041 N NH2 . ARG A 1 395 ? 15.416  29.360  -1.196  1.00 40.24  ? 395  ARG A NH2 1 
ATOM   3042 N N   . ASP A 1 396 ? 17.842  23.781  -3.552  1.00 31.71  ? 396  ASP A N   1 
ATOM   3043 C CA  . ASP A 1 396 ? 17.376  22.569  -2.868  1.00 30.88  ? 396  ASP A CA  1 
ATOM   3044 C C   . ASP A 1 396 ? 18.029  21.273  -3.359  1.00 30.00  ? 396  ASP A C   1 
ATOM   3045 O O   . ASP A 1 396 ? 18.119  20.324  -2.607  1.00 28.97  ? 396  ASP A O   1 
ATOM   3046 C CB  . ASP A 1 396 ? 15.855  22.413  -2.967  1.00 28.44  ? 396  ASP A CB  1 
ATOM   3047 C CG  . ASP A 1 396 ? 15.084  23.591  -2.314  1.00 45.21  ? 396  ASP A CG  1 
ATOM   3048 O OD1 . ASP A 1 396 ? 15.664  24.332  -1.483  1.00 37.90  ? 396  ASP A OD1 1 
ATOM   3049 O OD2 . ASP A 1 396 ? 13.883  23.759  -2.631  1.00 46.12  ? 396  ASP A OD2 1 
ATOM   3050 N N   . ALA A 1 397 ? 18.415  21.200  -4.628  1.00 30.37  ? 397  ALA A N   1 
ATOM   3051 C CA  . ALA A 1 397 ? 19.010  19.967  -5.135  1.00 35.21  ? 397  ALA A CA  1 
ATOM   3052 C C   . ALA A 1 397 ? 20.424  19.816  -4.537  1.00 31.82  ? 397  ALA A C   1 
ATOM   3053 O O   . ALA A 1 397 ? 20.863  18.723  -4.176  1.00 34.44  ? 397  ALA A O   1 
ATOM   3054 C CB  . ALA A 1 397 ? 19.071  19.980  -6.637  1.00 32.22  ? 397  ALA A CB  1 
ATOM   3055 N N   . MET A 1 398 ? 21.124  20.933  -4.392  1.00 28.48  ? 398  MET A N   1 
ATOM   3056 C CA  . MET A 1 398 ? 22.434  20.983  -3.775  1.00 29.73  ? 398  MET A CA  1 
ATOM   3057 C C   . MET A 1 398 ? 22.399  20.504  -2.370  1.00 32.80  ? 398  MET A C   1 
ATOM   3058 O O   . MET A 1 398 ? 23.227  19.755  -1.965  1.00 29.84  ? 398  MET A O   1 
ATOM   3059 C CB  . MET A 1 398 ? 23.024  22.380  -3.814  1.00 27.31  ? 398  MET A CB  1 
ATOM   3060 C CG  . MET A 1 398 ? 24.489  22.469  -3.478  1.00 32.35  ? 398  MET A CG  1 
ATOM   3061 S SD  . MET A 1 398 ? 25.557  21.718  -4.643  1.00 35.45  ? 398  MET A SD  1 
ATOM   3062 C CE  . MET A 1 398 ? 26.159  20.388  -3.701  1.00 35.92  ? 398  MET A CE  1 
ATOM   3063 N N   . SER A 1 399 ? 21.394  20.934  -1.645  1.00 31.76  ? 399  SER A N   1 
ATOM   3064 C CA  . SER A 1 399 ? 21.212  20.437  -0.292  1.00 28.47  ? 399  SER A CA  1 
ATOM   3065 C C   . SER A 1 399 ? 21.032  18.909  -0.261  1.00 29.35  ? 399  SER A C   1 
ATOM   3066 O O   . SER A 1 399 ? 21.636  18.205  0.555   1.00 26.03  ? 399  SER A O   1 
ATOM   3067 C CB  . SER A 1 399 ? 19.989  21.135  0.330   1.00 29.57  ? 399  SER A CB  1 
ATOM   3068 O OG  . SER A 1 399 ? 19.742  20.583  1.613   1.00 32.12  ? 399  SER A OG  1 
ATOM   3069 N N   . ALA A 1 400 ? 20.161  18.410  -1.133  1.00 32.57  ? 400  ALA A N   1 
ATOM   3070 C CA  . ALA A 1 400 ? 19.854  16.982  -1.228  1.00 30.46  ? 400  ALA A CA  1 
ATOM   3071 C C   . ALA A 1 400 ? 21.110  16.148  -1.610  1.00 30.76  ? 400  ALA A C   1 
ATOM   3072 O O   . ALA A 1 400 ? 21.318  15.050  -1.077  1.00 30.45  ? 400  ALA A O   1 
ATOM   3073 C CB  . ALA A 1 400 ? 18.741  16.769  -2.244  1.00 27.88  ? 400  ALA A CB  1 
ATOM   3074 N N   . VAL A 1 401 ? 21.920  16.672  -2.534  1.00 26.63  ? 401  VAL A N   1 
ATOM   3075 C CA  . VAL A 1 401 ? 23.186  16.024  -2.914  1.00 31.14  ? 401  VAL A CA  1 
ATOM   3076 C C   . VAL A 1 401 ? 24.010  15.755  -1.665  1.00 28.43  ? 401  VAL A C   1 
ATOM   3077 O O   . VAL A 1 401 ? 24.379  14.613  -1.394  1.00 28.05  ? 401  VAL A O   1 
ATOM   3078 C CB  . VAL A 1 401 ? 24.014  16.852  -3.918  1.00 27.40  ? 401  VAL A CB  1 
ATOM   3079 C CG1 . VAL A 1 401 ? 25.474  16.339  -4.002  1.00 25.03  ? 401  VAL A CG1 1 
ATOM   3080 C CG2 . VAL A 1 401 ? 23.345  16.874  -5.311  1.00 21.91  ? 401  VAL A CG2 1 
ATOM   3081 N N   . VAL A 1 402 ? 24.251  16.805  -0.886  1.00 30.68  ? 402  VAL A N   1 
ATOM   3082 C CA  . VAL A 1 402 ? 25.039  16.715  0.327   1.00 26.84  ? 402  VAL A CA  1 
ATOM   3083 C C   . VAL A 1 402 ? 24.384  15.818  1.410   1.00 36.61  ? 402  VAL A C   1 
ATOM   3084 O O   . VAL A 1 402 ? 25.073  14.976  2.016   1.00 27.77  ? 402  VAL A O   1 
ATOM   3085 C CB  . VAL A 1 402 ? 25.334  18.097  0.907   1.00 34.61  ? 402  VAL A CB  1 
ATOM   3086 C CG1 . VAL A 1 402 ? 25.967  17.932  2.300   1.00 28.83  ? 402  VAL A CG1 1 
ATOM   3087 C CG2 . VAL A 1 402 ? 26.284  18.931  -0.053  1.00 26.05  ? 402  VAL A CG2 1 
ATOM   3088 N N   . GLY A 1 403 ? 23.066  15.985  1.647   1.00 23.00  ? 403  GLY A N   1 
ATOM   3089 C CA  . GLY A 1 403 ? 22.388  15.196  2.671   1.00 19.31  ? 403  GLY A CA  1 
ATOM   3090 C C   . GLY A 1 403 ? 22.296  13.717  2.239   1.00 29.04  ? 403  GLY A C   1 
ATOM   3091 O O   . GLY A 1 403 ? 22.447  12.819  3.070   1.00 29.18  ? 403  GLY A O   1 
ATOM   3092 N N   . ASP A 1 404 ? 22.061  13.455  0.950   1.00 27.61  ? 404  ASP A N   1 
ATOM   3093 C CA  . ASP A 1 404 ? 21.912  12.080  0.474   1.00 24.99  ? 404  ASP A CA  1 
ATOM   3094 C C   . ASP A 1 404 ? 23.250  11.355  0.473   1.00 30.61  ? 404  ASP A C   1 
ATOM   3095 O O   . ASP A 1 404 ? 23.344  10.234  0.927   1.00 32.66  ? 404  ASP A O   1 
ATOM   3096 C CB  . ASP A 1 404 ? 21.338  12.066  -0.946  1.00 30.98  ? 404  ASP A CB  1 
ATOM   3097 C CG  . ASP A 1 404 ? 19.865  12.544  -0.994  1.00 35.81  ? 404  ASP A CG  1 
ATOM   3098 O OD1 . ASP A 1 404 ? 19.248  12.702  0.082   1.00 32.20  ? 404  ASP A OD1 1 
ATOM   3099 O OD2 . ASP A 1 404 ? 19.343  12.778  -2.108  1.00 33.95  ? 404  ASP A OD2 1 
ATOM   3100 N N   . HIS A 1 405 ? 24.283  12.010  -0.052  1.00 24.57  ? 405  HIS A N   1 
ATOM   3101 C CA  . HIS A 1 405 ? 25.577  11.388  -0.196  1.00 29.05  ? 405  HIS A CA  1 
ATOM   3102 C C   . HIS A 1 405 ? 26.121  11.066  1.205   1.00 34.29  ? 405  HIS A C   1 
ATOM   3103 O O   . HIS A 1 405 ? 26.643  9.989   1.421   1.00 30.03  ? 405  HIS A O   1 
ATOM   3104 C CB  . HIS A 1 405 ? 26.511  12.343  -0.958  1.00 29.64  ? 405  HIS A CB  1 
ATOM   3105 C CG  . HIS A 1 405 ? 27.932  11.881  -1.074  1.00 33.36  ? 405  HIS A CG  1 
ATOM   3106 N ND1 . HIS A 1 405 ? 28.285  10.559  -1.260  1.00 33.11  ? 405  HIS A ND1 1 
ATOM   3107 C CD2 . HIS A 1 405 ? 29.097  12.578  -1.082  1.00 31.87  ? 405  HIS A CD2 1 
ATOM   3108 C CE1 . HIS A 1 405 ? 29.593  10.466  -1.384  1.00 32.64  ? 405  HIS A CE1 1 
ATOM   3109 N NE2 . HIS A 1 405 ? 30.114  11.680  -1.278  1.00 36.24  ? 405  HIS A NE2 1 
ATOM   3110 N N   . ASN A 1 406 ? 25.965  11.990  2.154   1.00 29.49  ? 406  ASN A N   1 
ATOM   3111 C CA  . ASN A 1 406 ? 26.681  11.895  3.446   1.00 26.89  ? 406  ASN A CA  1 
ATOM   3112 C C   . ASN A 1 406 ? 25.938  11.181  4.546   1.00 30.22  ? 406  ASN A C   1 
ATOM   3113 O O   . ASN A 1 406 ? 26.558  10.573  5.429   1.00 24.14  ? 406  ASN A O   1 
ATOM   3114 C CB  . ASN A 1 406 ? 27.100  13.276  3.939   1.00 17.38  ? 406  ASN A CB  1 
ATOM   3115 C CG  . ASN A 1 406 ? 28.191  13.845  3.081   1.00 32.83  ? 406  ASN A CG  1 
ATOM   3116 O OD1 . ASN A 1 406 ? 29.316  13.277  3.001   1.00 29.23  ? 406  ASN A OD1 1 
ATOM   3117 N ND2 . ASN A 1 406 ? 27.864  14.906  2.355   1.00 28.80  ? 406  ASN A ND2 1 
ATOM   3118 N N   . VAL A 1 407 ? 24.608  11.221  4.472   1.00 23.98  ? 407  VAL A N   1 
ATOM   3119 C CA  . VAL A 1 407 ? 23.809  10.773  5.597   1.00 28.81  ? 407  VAL A CA  1 
ATOM   3120 C C   . VAL A 1 407 ? 22.629  9.896   5.191   1.00 31.93  ? 407  VAL A C   1 
ATOM   3121 O O   . VAL A 1 407 ? 22.585  8.748   5.612   1.00 29.37  ? 407  VAL A O   1 
ATOM   3122 C CB  . VAL A 1 407 ? 23.280  11.984  6.434   1.00 32.27  ? 407  VAL A CB  1 
ATOM   3123 C CG1 . VAL A 1 407 ? 22.283  11.535  7.496   1.00 26.16  ? 407  VAL A CG1 1 
ATOM   3124 C CG2 . VAL A 1 407 ? 24.435  12.740  7.054   1.00 26.95  ? 407  VAL A CG2 1 
ATOM   3125 N N   . VAL A 1 408 ? 21.680  10.430  4.396   1.00 26.94  ? 408  VAL A N   1 
ATOM   3126 C CA  . VAL A 1 408 ? 20.482  9.660   4.087   1.00 26.24  ? 408  VAL A CA  1 
ATOM   3127 C C   . VAL A 1 408 ? 20.783  8.307   3.417   1.00 36.68  ? 408  VAL A C   1 
ATOM   3128 O O   . VAL A 1 408 ? 20.209  7.294   3.805   1.00 30.93  ? 408  VAL A O   1 
ATOM   3129 C CB  . VAL A 1 408 ? 19.448  10.420  3.220   1.00 30.75  ? 408  VAL A CB  1 
ATOM   3130 C CG1 . VAL A 1 408 ? 18.242  9.483   2.976   1.00 22.96  ? 408  VAL A CG1 1 
ATOM   3131 C CG2 . VAL A 1 408 ? 19.003  11.689  3.906   1.00 22.12  ? 408  VAL A CG2 1 
ATOM   3132 N N   . CYS A 1 409 ? 21.698  8.281   2.438   1.00 33.39  ? 409  CYS A N   1 
ATOM   3133 C CA  . CYS A 1 409 ? 21.956  7.037   1.745   1.00 34.07  ? 409  CYS A CA  1 
ATOM   3134 C C   . CYS A 1 409 ? 22.850  6.056   2.544   1.00 38.72  ? 409  CYS A C   1 
ATOM   3135 O O   . CYS A 1 409 ? 22.550  4.857   2.587   1.00 40.43  ? 409  CYS A O   1 
ATOM   3136 C CB  . CYS A 1 409 ? 22.413  7.286   0.305   1.00 33.71  ? 409  CYS A CB  1 
ATOM   3137 S SG  . CYS A 1 409 ? 21.092  8.098   -0.710  1.00 34.18  ? 409  CYS A SG  1 
ATOM   3138 N N   . PRO A 1 410 ? 23.923  6.557   3.201   1.00 32.00  ? 410  PRO A N   1 
ATOM   3139 C CA  . PRO A 1 410 ? 24.591  5.686   4.168   1.00 27.18  ? 410  PRO A CA  1 
ATOM   3140 C C   . PRO A 1 410 ? 23.664  5.091   5.243   1.00 33.99  ? 410  PRO A C   1 
ATOM   3141 O O   . PRO A 1 410 ? 23.812  3.914   5.616   1.00 29.07  ? 410  PRO A O   1 
ATOM   3142 C CB  . PRO A 1 410 ? 25.630  6.606   4.809   1.00 29.87  ? 410  PRO A CB  1 
ATOM   3143 C CG  . PRO A 1 410 ? 25.990  7.584   3.664   1.00 30.73  ? 410  PRO A CG  1 
ATOM   3144 C CD  . PRO A 1 410 ? 24.682  7.809   2.946   1.00 30.73  ? 410  PRO A CD  1 
ATOM   3145 N N   . VAL A 1 411 ? 22.733  5.883   5.757   1.00 29.72  ? 411  VAL A N   1 
ATOM   3146 C CA  . VAL A 1 411 ? 21.765  5.334   6.703   1.00 34.77  ? 411  VAL A CA  1 
ATOM   3147 C C   . VAL A 1 411 ? 20.941  4.210   6.022   1.00 35.52  ? 411  VAL A C   1 
ATOM   3148 O O   . VAL A 1 411 ? 20.812  3.131   6.571   1.00 38.93  ? 411  VAL A O   1 
ATOM   3149 C CB  . VAL A 1 411 ? 20.897  6.459   7.350   1.00 32.11  ? 411  VAL A CB  1 
ATOM   3150 C CG1 . VAL A 1 411 ? 19.616  5.905   7.993   1.00 29.81  ? 411  VAL A CG1 1 
ATOM   3151 C CG2 . VAL A 1 411 ? 21.713  7.211   8.367   1.00 31.15  ? 411  VAL A CG2 1 
ATOM   3152 N N   . ALA A 1 412 ? 20.439  4.456   4.811   1.00 33.39  ? 412  ALA A N   1 
ATOM   3153 C CA  . ALA A 1 412 ? 19.713  3.437   4.053   1.00 33.10  ? 412  ALA A CA  1 
ATOM   3154 C C   . ALA A 1 412 ? 20.518  2.141   3.915   1.00 34.04  ? 412  ALA A C   1 
ATOM   3155 O O   . ALA A 1 412 ? 20.019  1.053   4.198   1.00 38.76  ? 412  ALA A O   1 
ATOM   3156 C CB  . ALA A 1 412 ? 19.329  3.975   2.660   1.00 28.83  ? 412  ALA A CB  1 
ATOM   3157 N N   . GLN A 1 413 ? 21.770  2.265   3.489   1.00 32.41  ? 413  GLN A N   1 
ATOM   3158 C CA  . GLN A 1 413 ? 22.644  1.106   3.352   1.00 35.97  ? 413  GLN A CA  1 
ATOM   3159 C C   . GLN A 1 413 ? 22.808  0.356   4.687   1.00 39.31  ? 413  GLN A C   1 
ATOM   3160 O O   . GLN A 1 413 ? 22.702  -0.878  4.725   1.00 35.68  ? 413  GLN A O   1 
ATOM   3161 C CB  . GLN A 1 413 ? 24.020  1.545   2.855   1.00 37.28  ? 413  GLN A CB  1 
ATOM   3162 C CG  . GLN A 1 413 ? 24.871  0.426   2.317   1.00 47.47  ? 413  GLN A CG  1 
ATOM   3163 C CD  . GLN A 1 413 ? 26.147  0.968   1.745   1.00 60.06  ? 413  GLN A CD  1 
ATOM   3164 O OE1 . GLN A 1 413 ? 26.341  0.984   0.523   1.00 70.55  ? 413  GLN A OE1 1 
ATOM   3165 N NE2 . GLN A 1 413 ? 27.014  1.469   2.615   1.00 56.22  ? 413  GLN A NE2 1 
ATOM   3166 N N   . LEU A 1 414 ? 23.084  1.105   5.767   1.00 30.31  ? 414  LEU A N   1 
ATOM   3167 C CA  . LEU A 1 414 ? 23.183  0.523   7.096   1.00 34.99  ? 414  LEU A CA  1 
ATOM   3168 C C   . LEU A 1 414 ? 21.921  -0.221  7.539   1.00 40.57  ? 414  LEU A C   1 
ATOM   3169 O O   . LEU A 1 414 ? 22.013  -1.384  7.928   1.00 42.64  ? 414  LEU A O   1 
ATOM   3170 C CB  . LEU A 1 414 ? 23.595  1.539   8.170   1.00 34.03  ? 414  LEU A CB  1 
ATOM   3171 C CG  . LEU A 1 414 ? 23.768  0.993   9.592   1.00 33.36  ? 414  LEU A CG  1 
ATOM   3172 C CD1 . LEU A 1 414 ? 24.847  -0.141  9.662   1.00 24.17  ? 414  LEU A CD1 1 
ATOM   3173 C CD2 . LEU A 1 414 ? 24.140  2.135   10.551  1.00 37.23  ? 414  LEU A CD2 1 
ATOM   3174 N N   . ALA A 1 415 ? 20.759  0.428   7.498   1.00 35.34  ? 415  ALA A N   1 
ATOM   3175 C CA  . ALA A 1 415 ? 19.545  -0.241  7.957   1.00 36.70  ? 415  ALA A CA  1 
ATOM   3176 C C   . ALA A 1 415 ? 19.336  -1.536  7.172   1.00 44.17  ? 415  ALA A C   1 
ATOM   3177 O O   . ALA A 1 415 ? 19.003  -2.597  7.738   1.00 45.33  ? 415  ALA A O   1 
ATOM   3178 C CB  . ALA A 1 415 ? 18.337  0.664   7.804   1.00 39.08  ? 415  ALA A CB  1 
ATOM   3179 N N   . GLY A 1 416 ? 19.534  -1.447  5.865   1.00 38.42  ? 416  GLY A N   1 
ATOM   3180 C CA  . GLY A 1 416 ? 19.333  -2.604  5.012   1.00 44.71  ? 416  GLY A CA  1 
ATOM   3181 C C   . GLY A 1 416 ? 20.264  -3.766  5.308   1.00 41.31  ? 416  GLY A C   1 
ATOM   3182 O O   . GLY A 1 416 ? 19.810  -4.903  5.468   1.00 42.81  ? 416  GLY A O   1 
ATOM   3183 N N   . ARG A 1 417 ? 21.562  -3.495  5.392   1.00 40.09  ? 417  ARG A N   1 
ATOM   3184 C CA  . ARG A 1 417 ? 22.511  -4.558  5.721   1.00 42.54  ? 417  ARG A CA  1 
ATOM   3185 C C   . ARG A 1 417 ? 22.225  -5.148  7.107   1.00 41.50  ? 417  ARG A C   1 
ATOM   3186 O O   . ARG A 1 417 ? 22.317  -6.342  7.302   1.00 47.05  ? 417  ARG A O   1 
ATOM   3187 C CB  . ARG A 1 417 ? 23.967  -4.074  5.611   1.00 38.69  ? 417  ARG A CB  1 
ATOM   3188 C CG  . ARG A 1 417 ? 24.345  -3.575  4.218   1.00 48.67  ? 417  ARG A CG  1 
ATOM   3189 C CD  . ARG A 1 417 ? 24.779  -4.666  3.243   1.00 63.89  ? 417  ARG A CD  1 
ATOM   3190 N NE  . ARG A 1 417 ? 23.854  -5.797  3.178   1.00 81.57  ? 417  ARG A NE  1 
ATOM   3191 C CZ  . ARG A 1 417 ? 24.223  -7.064  2.959   1.00 90.79  ? 417  ARG A CZ  1 
ATOM   3192 N NH1 . ARG A 1 417 ? 25.512  -7.369  2.780   1.00 90.72  ? 417  ARG A NH1 1 
ATOM   3193 N NH2 . ARG A 1 417 ? 23.302  -8.032  2.933   1.00 92.10  ? 417  ARG A NH2 1 
ATOM   3194 N N   . LEU A 1 418 ? 21.877  -4.304  8.067   1.00 37.48  ? 418  LEU A N   1 
ATOM   3195 C CA  . LEU A 1 418 ? 21.708  -4.762  9.432   1.00 40.94  ? 418  LEU A CA  1 
ATOM   3196 C C   . LEU A 1 418 ? 20.492  -5.691  9.531   1.00 43.69  ? 418  LEU A C   1 
ATOM   3197 O O   . LEU A 1 418 ? 20.557  -6.719  10.199  1.00 45.03  ? 418  LEU A O   1 
ATOM   3198 C CB  . LEU A 1 418 ? 21.550  -3.578  10.383  1.00 38.69  ? 418  LEU A CB  1 
ATOM   3199 C CG  . LEU A 1 418 ? 22.715  -3.128  11.272  1.00 43.85  ? 418  LEU A CG  1 
ATOM   3200 C CD1 . LEU A 1 418 ? 24.084  -3.407  10.671  1.00 52.80  ? 418  LEU A CD1 1 
ATOM   3201 C CD2 . LEU A 1 418 ? 22.557  -1.676  11.590  1.00 33.89  ? 418  LEU A CD2 1 
ATOM   3202 N N   . ALA A 1 419 ? 19.392  -5.310  8.880   1.00 40.06  ? 419  ALA A N   1 
ATOM   3203 C CA  . ALA A 1 419 ? 18.202  -6.145  8.853   1.00 46.16  ? 419  ALA A CA  1 
ATOM   3204 C C   . ALA A 1 419 ? 18.457  -7.443  8.084   1.00 48.00  ? 419  ALA A C   1 
ATOM   3205 O O   . ALA A 1 419 ? 17.992  -8.503  8.483   1.00 52.69  ? 419  ALA A O   1 
ATOM   3206 C CB  . ALA A 1 419 ? 17.002  -5.385  8.242   1.00 41.28  ? 419  ALA A CB  1 
ATOM   3207 N N   . ALA A 1 420 ? 19.181  -7.363  6.974   1.00 48.06  ? 420  ALA A N   1 
ATOM   3208 C CA  . ALA A 1 420 ? 19.339  -8.544  6.136   1.00 50.66  ? 420  ALA A CA  1 
ATOM   3209 C C   . ALA A 1 420 ? 20.074  -9.577  6.956   1.00 57.99  ? 420  ALA A C   1 
ATOM   3210 O O   . ALA A 1 420 ? 19.988  -10.774 6.704   1.00 62.11  ? 420  ALA A O   1 
ATOM   3211 C CB  . ALA A 1 420 ? 20.091  -8.225  4.845   1.00 41.11  ? 420  ALA A CB  1 
ATOM   3212 N N   . GLN A 1 421 ? 20.756  -9.091  7.983   1.00 57.06  ? 421  GLN A N   1 
ATOM   3213 C CA  . GLN A 1 421 ? 21.657  -9.914  8.764   1.00 51.74  ? 421  GLN A CA  1 
ATOM   3214 C C   . GLN A 1 421 ? 21.216  -10.155 10.201  1.00 48.62  ? 421  GLN A C   1 
ATOM   3215 O O   . GLN A 1 421 ? 22.031  -10.470 11.068  1.00 51.76  ? 421  GLN A O   1 
ATOM   3216 C CB  . GLN A 1 421 ? 23.059  -9.317  8.693   1.00 51.87  ? 421  GLN A CB  1 
ATOM   3217 C CG  . GLN A 1 421 ? 23.737  -9.775  7.419   1.00 64.10  ? 421  GLN A CG  1 
ATOM   3218 C CD  . GLN A 1 421 ? 24.650  -8.749  6.893   1.00 73.78  ? 421  GLN A CD  1 
ATOM   3219 O OE1 . GLN A 1 421 ? 24.692  -8.488  5.687   1.00 80.70  ? 421  GLN A OE1 1 
ATOM   3220 N NE2 . GLN A 1 421 ? 25.386  -8.121  7.792   1.00 78.70  ? 421  GLN A NE2 1 
ATOM   3221 N N   . GLY A 1 422 ? 19.917  -10.012 10.443  1.00 51.56  ? 422  GLY A N   1 
ATOM   3222 C CA  . GLY A 1 422 ? 19.313  -10.474 11.677  1.00 43.07  ? 422  GLY A CA  1 
ATOM   3223 C C   . GLY A 1 422 ? 19.089  -9.465  12.776  1.00 45.17  ? 422  GLY A C   1 
ATOM   3224 O O   . GLY A 1 422 ? 18.573  -9.820  13.828  1.00 52.42  ? 422  GLY A O   1 
ATOM   3225 N N   . ALA A 1 423 ? 19.472  -8.210  12.564  1.00 42.47  ? 423  ALA A N   1 
ATOM   3226 C CA  . ALA A 1 423 ? 19.244  -7.200  13.585  1.00 36.06  ? 423  ALA A CA  1 
ATOM   3227 C C   . ALA A 1 423 ? 17.810  -6.742  13.515  1.00 36.43  ? 423  ALA A C   1 
ATOM   3228 O O   . ALA A 1 423 ? 17.236  -6.731  12.442  1.00 43.24  ? 423  ALA A O   1 
ATOM   3229 C CB  . ALA A 1 423 ? 20.170  -5.987  13.347  1.00 35.92  ? 423  ALA A CB  1 
ATOM   3230 N N   . ARG A 1 424 ? 17.241  -6.317  14.638  1.00 38.37  ? 424  ARG A N   1 
ATOM   3231 C CA  . ARG A 1 424 ? 15.952  -5.637  14.606  1.00 42.17  ? 424  ARG A CA  1 
ATOM   3232 C C   . ARG A 1 424 ? 16.203  -4.134  14.464  1.00 37.87  ? 424  ARG A C   1 
ATOM   3233 O O   . ARG A 1 424 ? 16.828  -3.553  15.329  1.00 37.74  ? 424  ARG A O   1 
ATOM   3234 C CB  . ARG A 1 424 ? 15.169  -5.901  15.892  1.00 43.95  ? 424  ARG A CB  1 
ATOM   3235 C CG  . ARG A 1 424 ? 13.829  -5.184  15.954  1.00 53.00  ? 424  ARG A CG  1 
ATOM   3236 C CD  . ARG A 1 424 ? 12.739  -6.057  16.595  1.00 77.35  ? 424  ARG A CD  1 
ATOM   3237 N NE  . ARG A 1 424 ? 12.765  -6.043  18.063  1.00 89.85  ? 424  ARG A NE  1 
ATOM   3238 C CZ  . ARG A 1 424 ? 13.239  -7.034  18.819  1.00 95.93  ? 424  ARG A CZ  1 
ATOM   3239 N NH1 . ARG A 1 424 ? 13.735  -8.129  18.249  1.00 97.63  ? 424  ARG A NH1 1 
ATOM   3240 N NH2 . ARG A 1 424 ? 13.217  -6.929  20.148  1.00 97.05  ? 424  ARG A NH2 1 
ATOM   3241 N N   . VAL A 1 425 ? 15.675  -3.529  13.399  1.00 34.39  ? 425  VAL A N   1 
ATOM   3242 C CA  . VAL A 1 425 ? 15.926  -2.130  13.040  1.00 32.58  ? 425  VAL A CA  1 
ATOM   3243 C C   . VAL A 1 425 ? 14.648  -1.326  13.050  1.00 35.89  ? 425  VAL A C   1 
ATOM   3244 O O   . VAL A 1 425 ? 13.645  -1.810  12.569  1.00 40.24  ? 425  VAL A O   1 
ATOM   3245 C CB  . VAL A 1 425 ? 16.488  -2.039  11.609  1.00 34.73  ? 425  VAL A CB  1 
ATOM   3246 C CG1 . VAL A 1 425 ? 16.921  -0.586  11.289  1.00 32.45  ? 425  VAL A CG1 1 
ATOM   3247 C CG2 . VAL A 1 425 ? 17.648  -3.049  11.423  1.00 30.54  ? 425  VAL A CG2 1 
ATOM   3248 N N   . TYR A 1 426 ? 14.678  -0.114  13.609  1.00 31.76  ? 426  TYR A N   1 
ATOM   3249 C CA  . TYR A 1 426 ? 13.578  0.836   13.489  1.00 26.81  ? 426  TYR A CA  1 
ATOM   3250 C C   . TYR A 1 426 ? 14.134  2.102   12.872  1.00 34.20  ? 426  TYR A C   1 
ATOM   3251 O O   . TYR A 1 426 ? 15.144  2.598   13.345  1.00 33.11  ? 426  TYR A O   1 
ATOM   3252 C CB  . TYR A 1 426 ? 13.011  1.181   14.868  1.00 27.78  ? 426  TYR A CB  1 
ATOM   3253 C CG  . TYR A 1 426 ? 12.342  0.022   15.523  1.00 44.38  ? 426  TYR A CG  1 
ATOM   3254 C CD1 . TYR A 1 426 ? 13.066  -0.852  16.343  1.00 41.65  ? 426  TYR A CD1 1 
ATOM   3255 C CD2 . TYR A 1 426 ? 10.989  -0.247  15.289  1.00 43.50  ? 426  TYR A CD2 1 
ATOM   3256 C CE1 . TYR A 1 426 ? 12.467  -1.929  16.913  1.00 43.10  ? 426  TYR A CE1 1 
ATOM   3257 C CE2 . TYR A 1 426 ? 10.368  -1.345  15.878  1.00 43.32  ? 426  TYR A CE2 1 
ATOM   3258 C CZ  . TYR A 1 426 ? 11.105  -2.173  16.685  1.00 45.13  ? 426  TYR A CZ  1 
ATOM   3259 O OH  . TYR A 1 426 ? 10.504  -3.261  17.266  1.00 48.53  ? 426  TYR A OH  1 
ATOM   3260 N N   . ALA A 1 427 ? 13.501  2.625   11.826  1.00 32.11  ? 427  ALA A N   1 
ATOM   3261 C CA  . ALA A 1 427 ? 14.024  3.810   11.145  1.00 28.93  ? 427  ALA A CA  1 
ATOM   3262 C C   . ALA A 1 427 ? 13.044  4.972   11.217  1.00 38.92  ? 427  ALA A C   1 
ATOM   3263 O O   . ALA A 1 427 ? 11.807  4.775   11.251  1.00 36.35  ? 427  ALA A O   1 
ATOM   3264 C CB  . ALA A 1 427 ? 14.328  3.488   9.682   1.00 28.34  ? 427  ALA A CB  1 
ATOM   3265 N N   . TYR A 1 428 ? 13.570  6.194   11.212  1.00 32.81  ? 428  TYR A N   1 
ATOM   3266 C CA  . TYR A 1 428 ? 12.691  7.369   11.250  1.00 28.18  ? 428  TYR A CA  1 
ATOM   3267 C C   . TYR A 1 428 ? 13.233  8.482   10.355  1.00 38.48  ? 428  TYR A C   1 
ATOM   3268 O O   . TYR A 1 428 ? 14.444  8.542   10.040  1.00 34.17  ? 428  TYR A O   1 
ATOM   3269 C CB  . TYR A 1 428 ? 12.550  7.917   12.693  1.00 30.16  ? 428  TYR A CB  1 
ATOM   3270 C CG  . TYR A 1 428 ? 13.847  8.514   13.212  1.00 40.18  ? 428  TYR A CG  1 
ATOM   3271 C CD1 . TYR A 1 428 ? 14.263  9.789   12.829  1.00 38.69  ? 428  TYR A CD1 1 
ATOM   3272 C CD2 . TYR A 1 428 ? 14.671  7.789   14.051  1.00 40.24  ? 428  TYR A CD2 1 
ATOM   3273 C CE1 . TYR A 1 428 ? 15.461  10.316  13.280  1.00 33.56  ? 428  TYR A CE1 1 
ATOM   3274 C CE2 . TYR A 1 428 ? 15.854  8.294   14.491  1.00 38.51  ? 428  TYR A CE2 1 
ATOM   3275 C CZ  . TYR A 1 428 ? 16.248  9.557   14.107  1.00 36.42  ? 428  TYR A CZ  1 
ATOM   3276 O OH  . TYR A 1 428 ? 17.444  10.033  14.554  1.00 36.21  ? 428  TYR A OH  1 
ATOM   3277 N N   . ILE A 1 429 ? 12.337  9.387   9.975   1.00 37.97  ? 429  ILE A N   1 
ATOM   3278 C CA  . ILE A 1 429 ? 12.748  10.667  9.454   1.00 34.12  ? 429  ILE A CA  1 
ATOM   3279 C C   . ILE A 1 429 ? 12.114  11.741  10.338  1.00 38.37  ? 429  ILE A C   1 
ATOM   3280 O O   . ILE A 1 429 ? 10.896  11.726  10.594  1.00 35.97  ? 429  ILE A O   1 
ATOM   3281 C CB  . ILE A 1 429 ? 12.370  10.849  7.988   1.00 34.13  ? 429  ILE A CB  1 
ATOM   3282 C CG1 . ILE A 1 429 ? 12.753  12.258  7.548   1.00 31.26  ? 429  ILE A CG1 1 
ATOM   3283 C CG2 . ILE A 1 429 ? 10.868  10.601  7.811   1.00 39.02  ? 429  ILE A CG2 1 
ATOM   3284 C CD1 . ILE A 1 429 ? 13.031  12.371  6.084   1.00 40.51  ? 429  ILE A CD1 1 
ATOM   3285 N N   . PHE A 1 430 ? 12.943  12.654  10.833  1.00 31.71  ? 430  PHE A N   1 
ATOM   3286 C CA  . PHE A 1 430 ? 12.476  13.666  11.757  1.00 35.01  ? 430  PHE A CA  1 
ATOM   3287 C C   . PHE A 1 430 ? 12.133  14.916  10.955  1.00 37.22  ? 430  PHE A C   1 
ATOM   3288 O O   . PHE A 1 430 ? 12.974  15.417  10.241  1.00 36.06  ? 430  PHE A O   1 
ATOM   3289 C CB  . PHE A 1 430 ? 13.569  13.963  12.777  1.00 35.41  ? 430  PHE A CB  1 
ATOM   3290 C CG  . PHE A 1 430 ? 13.191  15.002  13.774  1.00 35.22  ? 430  PHE A CG  1 
ATOM   3291 C CD1 . PHE A 1 430 ? 13.407  16.354  13.504  1.00 34.93  ? 430  PHE A CD1 1 
ATOM   3292 C CD2 . PHE A 1 430 ? 12.633  14.641  14.990  1.00 33.79  ? 430  PHE A CD2 1 
ATOM   3293 C CE1 . PHE A 1 430 ? 13.069  17.325  14.423  1.00 30.57  ? 430  PHE A CE1 1 
ATOM   3294 C CE2 . PHE A 1 430 ? 12.285  15.617  15.926  1.00 33.27  ? 430  PHE A CE2 1 
ATOM   3295 C CZ  . PHE A 1 430 ? 12.508  16.958  15.635  1.00 28.53  ? 430  PHE A CZ  1 
ATOM   3296 N N   . GLU A 1 431 ? 10.903  15.424  11.050  1.00 39.80  ? 431  GLU A N   1 
ATOM   3297 C CA  . GLU A 1 431 ? 10.507  16.465  10.091  1.00 40.21  ? 431  GLU A CA  1 
ATOM   3298 C C   . GLU A 1 431 ? 9.976   17.724  10.724  1.00 42.40  ? 431  GLU A C   1 
ATOM   3299 O O   . GLU A 1 431 ? 9.352   18.521  10.037  1.00 46.00  ? 431  GLU A O   1 
ATOM   3300 C CB  . GLU A 1 431 ? 9.407   15.959  9.161   1.00 39.64  ? 431  GLU A CB  1 
ATOM   3301 C CG  . GLU A 1 431 ? 9.776   14.860  8.230   1.00 46.99  ? 431  GLU A CG  1 
ATOM   3302 C CD  . GLU A 1 431 ? 8.565   14.382  7.431   1.00 50.69  ? 431  GLU A CD  1 
ATOM   3303 O OE1 . GLU A 1 431 ? 7.450   14.402  7.978   1.00 53.44  ? 431  GLU A OE1 1 
ATOM   3304 O OE2 . GLU A 1 431 ? 8.725   13.993  6.258   1.00 54.47  ? 431  GLU A OE2 1 
ATOM   3305 N N   . HIS A 1 432 ? 10.168  17.905  12.023  1.00 38.74  ? 432  HIS A N   1 
ATOM   3306 C CA  . HIS A 1 432 ? 9.632   19.104  12.650  1.00 41.59  ? 432  HIS A CA  1 
ATOM   3307 C C   . HIS A 1 432 ? 10.728  20.166  12.845  1.00 41.51  ? 432  HIS A C   1 
ATOM   3308 O O   . HIS A 1 432 ? 11.794  19.903  13.389  1.00 39.24  ? 432  HIS A O   1 
ATOM   3309 C CB  . HIS A 1 432 ? 8.901   18.793  13.960  1.00 36.63  ? 432  HIS A CB  1 
ATOM   3310 C CG  . HIS A 1 432 ? 8.604   20.010  14.772  1.00 42.26  ? 432  HIS A CG  1 
ATOM   3311 N ND1 . HIS A 1 432 ? 7.557   20.861  14.485  1.00 44.92  ? 432  HIS A ND1 1 
ATOM   3312 C CD2 . HIS A 1 432 ? 9.248   20.554  15.834  1.00 41.78  ? 432  HIS A CD2 1 
ATOM   3313 C CE1 . HIS A 1 432 ? 7.545   21.854  15.355  1.00 41.58  ? 432  HIS A CE1 1 
ATOM   3314 N NE2 . HIS A 1 432 ? 8.567   21.696  16.179  1.00 44.41  ? 432  HIS A NE2 1 
ATOM   3315 N N   . ARG A 1 433 ? 10.446  21.371  12.386  1.00 41.74  ? 433  ARG A N   1 
ATOM   3316 C CA  . ARG A 1 433 ? 11.372  22.472  12.539  1.00 41.81  ? 433  ARG A CA  1 
ATOM   3317 C C   . ARG A 1 433 ? 11.057  23.239  13.834  1.00 43.58  ? 433  ARG A C   1 
ATOM   3318 O O   . ARG A 1 433 ? 9.948   23.739  13.992  1.00 45.97  ? 433  ARG A O   1 
ATOM   3319 C CB  . ARG A 1 433 ? 11.230  23.380  11.320  1.00 40.46  ? 433  ARG A CB  1 
ATOM   3320 C CG  . ARG A 1 433 ? 12.079  24.597  11.333  1.00 41.32  ? 433  ARG A CG  1 
ATOM   3321 C CD  . ARG A 1 433 ? 11.755  25.464  10.140  1.00 43.41  ? 433  ARG A CD  1 
ATOM   3322 N NE  . ARG A 1 433 ? 12.936  26.205  9.726   1.00 52.74  ? 433  ARG A NE  1 
ATOM   3323 C CZ  . ARG A 1 433 ? 13.253  27.404  10.170  1.00 56.51  ? 433  ARG A CZ  1 
ATOM   3324 N NH1 . ARG A 1 433 ? 12.466  28.013  11.036  1.00 62.31  ? 433  ARG A NH1 1 
ATOM   3325 N NH2 . ARG A 1 433 ? 14.354  27.985  9.746   1.00 60.85  ? 433  ARG A NH2 1 
ATOM   3326 N N   . ALA A 1 434 ? 12.007  23.306  14.768  1.00 40.59  ? 434  ALA A N   1 
ATOM   3327 C CA  . ALA A 1 434 ? 11.753  24.011  16.016  1.00 37.90  ? 434  ALA A CA  1 
ATOM   3328 C C   . ALA A 1 434 ? 11.229  25.398  15.728  1.00 40.00  ? 434  ALA A C   1 
ATOM   3329 O O   . ALA A 1 434 ? 11.780  26.105  14.879  1.00 38.70  ? 434  ALA A O   1 
ATOM   3330 C CB  . ALA A 1 434 ? 12.994  24.119  16.836  1.00 30.97  ? 434  ALA A CB  1 
ATOM   3331 N N   . SER A 1 435 ? 10.185  25.797  16.452  1.00 38.98  ? 435  SER A N   1 
ATOM   3332 C CA  . SER A 1 435 ? 9.649   27.159  16.335  1.00 36.24  ? 435  SER A CA  1 
ATOM   3333 C C   . SER A 1 435 ? 10.702  28.195  16.739  1.00 45.83  ? 435  SER A C   1 
ATOM   3334 O O   . SER A 1 435 ? 10.583  29.362  16.406  1.00 51.88  ? 435  SER A O   1 
ATOM   3335 C CB  . SER A 1 435 ? 8.439   27.324  17.235  1.00 35.18  ? 435  SER A CB  1 
ATOM   3336 O OG  . SER A 1 435 ? 8.838   27.221  18.581  1.00 39.31  ? 435  SER A OG  1 
ATOM   3337 N N   . THR A 1 436 ? 11.741  27.750  17.439  1.00 45.21  ? 436  THR A N   1 
ATOM   3338 C CA  . THR A 1 436 ? 12.759  28.636  17.984  1.00 43.14  ? 436  THR A CA  1 
ATOM   3339 C C   . THR A 1 436 ? 14.036  28.661  17.142  1.00 45.77  ? 436  THR A C   1 
ATOM   3340 O O   . THR A 1 436 ? 15.055  29.179  17.581  1.00 47.44  ? 436  THR A O   1 
ATOM   3341 C CB  . THR A 1 436 ? 13.143  28.164  19.392  1.00 46.18  ? 436  THR A CB  1 
ATOM   3342 O OG1 . THR A 1 436 ? 13.625  26.822  19.319  1.00 48.14  ? 436  THR A OG1 1 
ATOM   3343 C CG2 . THR A 1 436 ? 11.904  28.182  20.312  1.00 52.78  ? 436  THR A CG2 1 
ATOM   3344 N N   . LEU A 1 437 ? 13.983  28.068  15.951  1.00 46.06  ? 437  LEU A N   1 
ATOM   3345 C CA  . LEU A 1 437 ? 15.146  27.923  15.082  1.00 46.79  ? 437  LEU A CA  1 
ATOM   3346 C C   . LEU A 1 437 ? 15.596  29.293  14.573  1.00 49.36  ? 437  LEU A C   1 
ATOM   3347 O O   . LEU A 1 437 ? 14.747  30.100  14.154  1.00 46.29  ? 437  LEU A O   1 
ATOM   3348 C CB  . LEU A 1 437 ? 14.768  27.050  13.886  1.00 47.78  ? 437  LEU A CB  1 
ATOM   3349 C CG  . LEU A 1 437 ? 15.876  26.178  13.287  1.00 56.21  ? 437  LEU A CG  1 
ATOM   3350 C CD1 . LEU A 1 437 ? 16.372  25.190  14.313  1.00 50.55  ? 437  LEU A CD1 1 
ATOM   3351 C CD2 . LEU A 1 437 ? 15.361  25.435  12.067  1.00 59.80  ? 437  LEU A CD2 1 
ATOM   3352 N N   . THR A 1 438 ? 16.909  29.553  14.597  1.00 45.25  ? 438  THR A N   1 
ATOM   3353 C CA  . THR A 1 438 ? 17.452  30.853  14.177  1.00 48.08  ? 438  THR A CA  1 
ATOM   3354 C C   . THR A 1 438 ? 18.028  30.810  12.759  1.00 57.99  ? 438  THR A C   1 
ATOM   3355 O O   . THR A 1 438 ? 18.367  31.849  12.203  1.00 58.60  ? 438  THR A O   1 
ATOM   3356 C CB  . THR A 1 438 ? 18.547  31.408  15.159  1.00 54.40  ? 438  THR A CB  1 
ATOM   3357 O OG1 . THR A 1 438 ? 19.642  30.484  15.269  1.00 57.75  ? 438  THR A OG1 1 
ATOM   3358 C CG2 . THR A 1 438 ? 17.972  31.651  16.558  1.00 52.28  ? 438  THR A CG2 1 
ATOM   3359 N N   . TRP A 1 439 ? 18.169  29.608  12.190  1.00 63.07  ? 439  TRP A N   1 
ATOM   3360 C CA  . TRP A 1 439 ? 18.551  29.451  10.774  1.00 57.14  ? 439  TRP A CA  1 
ATOM   3361 C C   . TRP A 1 439 ? 17.336  29.827  9.924   1.00 48.78  ? 439  TRP A C   1 
ATOM   3362 O O   . TRP A 1 439 ? 16.235  29.795  10.414  1.00 52.18  ? 439  TRP A O   1 
ATOM   3363 C CB  . TRP A 1 439 ? 19.007  28.016  10.456  1.00 45.71  ? 439  TRP A CB  1 
ATOM   3364 C CG  . TRP A 1 439 ? 20.220  27.575  11.174  1.00 39.19  ? 439  TRP A CG  1 
ATOM   3365 C CD1 . TRP A 1 439 ? 20.276  26.735  12.251  1.00 45.74  ? 439  TRP A CD1 1 
ATOM   3366 C CD2 . TRP A 1 439 ? 21.580  27.926  10.875  1.00 39.28  ? 439  TRP A CD2 1 
ATOM   3367 N NE1 . TRP A 1 439 ? 21.590  26.571  12.665  1.00 39.35  ? 439  TRP A NE1 1 
ATOM   3368 C CE2 . TRP A 1 439 ? 22.404  27.274  11.825  1.00 36.68  ? 439  TRP A CE2 1 
ATOM   3369 C CE3 . TRP A 1 439 ? 22.181  28.716  9.895   1.00 36.18  ? 439  TRP A CE3 1 
ATOM   3370 C CZ2 . TRP A 1 439 ? 23.790  27.392  11.818  1.00 43.23  ? 439  TRP A CZ2 1 
ATOM   3371 C CZ3 . TRP A 1 439 ? 23.559  28.832  9.889   1.00 39.48  ? 439  TRP A CZ3 1 
ATOM   3372 C CH2 . TRP A 1 439 ? 24.353  28.179  10.846  1.00 45.52  ? 439  TRP A CH2 1 
ATOM   3373 N N   . PRO A 1 440 ? 17.544  30.228  8.657   1.00 47.88  ? 440  PRO A N   1 
ATOM   3374 C CA  . PRO A 1 440 ? 16.446  30.637  7.764   1.00 36.79  ? 440  PRO A CA  1 
ATOM   3375 C C   . PRO A 1 440 ? 15.584  29.468  7.295   1.00 41.34  ? 440  PRO A C   1 
ATOM   3376 O O   . PRO A 1 440 ? 16.015  28.321  7.356   1.00 44.68  ? 440  PRO A O   1 
ATOM   3377 C CB  . PRO A 1 440 ? 17.185  31.220  6.554   1.00 35.97  ? 440  PRO A CB  1 
ATOM   3378 C CG  . PRO A 1 440 ? 18.538  30.529  6.574   1.00 42.14  ? 440  PRO A CG  1 
ATOM   3379 C CD  . PRO A 1 440 ? 18.862  30.476  8.044   1.00 43.02  ? 440  PRO A CD  1 
ATOM   3380 N N   . LEU A 1 441 ? 14.394  29.763  6.799   1.00 39.07  ? 441  LEU A N   1 
ATOM   3381 C CA  . LEU A 1 441 ? 13.441  28.739  6.429   1.00 41.52  ? 441  LEU A CA  1 
ATOM   3382 C C   . LEU A 1 441 ? 13.922  27.818  5.332   1.00 50.25  ? 441  LEU A C   1 
ATOM   3383 O O   . LEU A 1 441 ? 13.527  26.658  5.276   1.00 52.41  ? 441  LEU A O   1 
ATOM   3384 C CB  . LEU A 1 441 ? 12.161  29.385  5.935   1.00 42.20  ? 441  LEU A CB  1 
ATOM   3385 C CG  . LEU A 1 441 ? 11.366  30.099  7.014   1.00 62.75  ? 441  LEU A CG  1 
ATOM   3386 C CD1 . LEU A 1 441 ? 10.086  30.664  6.398   1.00 71.85  ? 441  LEU A CD1 1 
ATOM   3387 C CD2 . LEU A 1 441 ? 11.048  29.153  8.174   1.00 62.20  ? 441  LEU A CD2 1 
ATOM   3388 N N   . TRP A 1 442 ? 14.717  28.340  4.409   1.00 49.86  ? 442  TRP A N   1 
ATOM   3389 C CA  . TRP A 1 442 ? 15.052  27.538  3.250   1.00 44.33  ? 442  TRP A CA  1 
ATOM   3390 C C   . TRP A 1 442 ? 15.883  26.318  3.727   1.00 44.04  ? 442  TRP A C   1 
ATOM   3391 O O   . TRP A 1 442 ? 15.840  25.267  3.106   1.00 37.25  ? 442  TRP A O   1 
ATOM   3392 C CB  . TRP A 1 442 ? 15.730  28.379  2.134   1.00 37.41  ? 442  TRP A CB  1 
ATOM   3393 C CG  . TRP A 1 442 ? 17.128  28.800  2.437   1.00 34.68  ? 442  TRP A CG  1 
ATOM   3394 C CD1 . TRP A 1 442 ? 17.550  30.033  2.883   1.00 41.73  ? 442  TRP A CD1 1 
ATOM   3395 C CD2 . TRP A 1 442 ? 18.299  27.981  2.366   1.00 38.75  ? 442  TRP A CD2 1 
ATOM   3396 N NE1 . TRP A 1 442 ? 18.917  30.023  3.085   1.00 40.92  ? 442  TRP A NE1 1 
ATOM   3397 C CE2 . TRP A 1 442 ? 19.397  28.775  2.775   1.00 39.08  ? 442  TRP A CE2 1 
ATOM   3398 C CE3 . TRP A 1 442 ? 18.530  26.654  1.989   1.00 37.83  ? 442  TRP A CE3 1 
ATOM   3399 C CZ2 . TRP A 1 442 ? 20.696  28.285  2.804   1.00 41.32  ? 442  TRP A CZ2 1 
ATOM   3400 C CZ3 . TRP A 1 442 ? 19.834  26.172  2.021   1.00 31.58  ? 442  TRP A CZ3 1 
ATOM   3401 C CH2 . TRP A 1 442 ? 20.890  26.976  2.435   1.00 37.87  ? 442  TRP A CH2 1 
ATOM   3402 N N   . MET A 1 443 ? 16.593  26.452  4.853   1.00 40.96  ? 443  MET A N   1 
ATOM   3403 C CA  . MET A 1 443 ? 17.370  25.337  5.389   1.00 39.36  ? 443  MET A CA  1 
ATOM   3404 C C   . MET A 1 443 ? 16.489  24.215  5.923   1.00 37.09  ? 443  MET A C   1 
ATOM   3405 O O   . MET A 1 443 ? 16.984  23.125  6.218   1.00 31.17  ? 443  MET A O   1 
ATOM   3406 C CB  . MET A 1 443 ? 18.366  25.784  6.462   1.00 41.30  ? 443  MET A CB  1 
ATOM   3407 C CG  . MET A 1 443 ? 19.347  26.860  5.980   1.00 47.26  ? 443  MET A CG  1 
ATOM   3408 S SD  . MET A 1 443 ? 20.767  27.017  7.067   1.00 49.09  ? 443  MET A SD  1 
ATOM   3409 C CE  . MET A 1 443 ? 21.389  28.611  6.563   1.00 199.01 ? 443  MET A CE  1 
ATOM   3410 N N   . GLY A 1 444 ? 15.182  24.448  6.015   1.00 34.14  ? 444  GLY A N   1 
ATOM   3411 C CA  . GLY A 1 444 ? 14.273  23.374  6.404   1.00 26.55  ? 444  GLY A CA  1 
ATOM   3412 C C   . GLY A 1 444 ? 14.485  22.886  7.833   1.00 34.53  ? 444  GLY A C   1 
ATOM   3413 O O   . GLY A 1 444 ? 14.517  23.693  8.771   1.00 32.05  ? 444  GLY A O   1 
ATOM   3414 N N   . VAL A 1 445 ? 14.624  21.564  7.998   1.00 33.56  ? 445  VAL A N   1 
ATOM   3415 C CA  . VAL A 1 445 ? 14.877  20.958  9.305   1.00 36.22  ? 445  VAL A CA  1 
ATOM   3416 C C   . VAL A 1 445 ? 16.308  20.489  9.295   1.00 34.04  ? 445  VAL A C   1 
ATOM   3417 O O   . VAL A 1 445 ? 16.598  19.397  8.817   1.00 35.41  ? 445  VAL A O   1 
ATOM   3418 C CB  . VAL A 1 445 ? 13.974  19.709  9.597   1.00 30.94  ? 445  VAL A CB  1 
ATOM   3419 C CG1 . VAL A 1 445 ? 14.341  19.121  10.943  1.00 27.77  ? 445  VAL A CG1 1 
ATOM   3420 C CG2 . VAL A 1 445 ? 12.467  20.056  9.541   1.00 34.49  ? 445  VAL A CG2 1 
ATOM   3421 N N   . PRO A 1 446 ? 17.221  21.313  9.813   1.00 33.24  ? 446  PRO A N   1 
ATOM   3422 C CA  . PRO A 1 446 ? 18.607  21.037  9.494   1.00 25.30  ? 446  PRO A CA  1 
ATOM   3423 C C   . PRO A 1 446 ? 19.228  19.997  10.415  1.00 27.86  ? 446  PRO A C   1 
ATOM   3424 O O   . PRO A 1 446 ? 18.704  19.644  11.464  1.00 28.05  ? 446  PRO A O   1 
ATOM   3425 C CB  . PRO A 1 446 ? 19.303  22.408  9.723   1.00 29.85  ? 446  PRO A CB  1 
ATOM   3426 C CG  . PRO A 1 446 ? 18.202  23.403  9.907   1.00 28.59  ? 446  PRO A CG  1 
ATOM   3427 C CD  . PRO A 1 446 ? 17.077  22.604  10.505  1.00 36.74  ? 446  PRO A CD  1 
ATOM   3428 N N   . HIS A 1 447 ? 20.371  19.503  9.968   1.00 31.72  ? 447  HIS A N   1 
ATOM   3429 C CA  . HIS A 1 447 ? 21.166  18.514  10.671  1.00 34.74  ? 447  HIS A CA  1 
ATOM   3430 C C   . HIS A 1 447 ? 21.402  18.955  12.120  1.00 37.49  ? 447  HIS A C   1 
ATOM   3431 O O   . HIS A 1 447 ? 21.825  20.098  12.367  1.00 36.56  ? 447  HIS A O   1 
ATOM   3432 C CB  . HIS A 1 447 ? 22.507  18.441  9.929   1.00 34.37  ? 447  HIS A CB  1 
ATOM   3433 C CG  . HIS A 1 447 ? 23.471  17.469  10.500  1.00 34.56  ? 447  HIS A CG  1 
ATOM   3434 N ND1 . HIS A 1 447 ? 23.426  16.122  10.211  1.00 39.54  ? 447  HIS A ND1 1 
ATOM   3435 C CD2 . HIS A 1 447 ? 24.541  17.649  11.309  1.00 36.94  ? 447  HIS A CD2 1 
ATOM   3436 C CE1 . HIS A 1 447 ? 24.436  15.510  10.812  1.00 38.58  ? 447  HIS A CE1 1 
ATOM   3437 N NE2 . HIS A 1 447 ? 25.126  16.416  11.485  1.00 40.53  ? 447  HIS A NE2 1 
ATOM   3438 N N   . GLY A 1 448 ? 21.159  18.053  13.072  1.00 31.55  ? 448  GLY A N   1 
ATOM   3439 C CA  . GLY A 1 448 ? 21.446  18.348  14.472  1.00 31.02  ? 448  GLY A CA  1 
ATOM   3440 C C   . GLY A 1 448 ? 20.278  18.922  15.250  1.00 34.72  ? 448  GLY A C   1 
ATOM   3441 O O   . GLY A 1 448 ? 20.345  18.991  16.466  1.00 34.46  ? 448  GLY A O   1 
ATOM   3442 N N   . TYR A 1 449 ? 19.207  19.321  14.566  1.00 29.50  ? 449  TYR A N   1 
ATOM   3443 C CA  . TYR A 1 449 ? 18.110  20.033  15.239  1.00 36.10  ? 449  TYR A CA  1 
ATOM   3444 C C   . TYR A 1 449 ? 16.958  19.123  15.722  1.00 38.74  ? 449  TYR A C   1 
ATOM   3445 O O   . TYR A 1 449 ? 15.888  19.593  16.106  1.00 35.98  ? 449  TYR A O   1 
ATOM   3446 C CB  . TYR A 1 449 ? 17.664  21.301  14.443  1.00 29.22  ? 449  TYR A CB  1 
ATOM   3447 C CG  . TYR A 1 449 ? 18.779  22.343  14.543  1.00 32.47  ? 449  TYR A CG  1 
ATOM   3448 C CD1 . TYR A 1 449 ? 19.855  22.312  13.669  1.00 30.15  ? 449  TYR A CD1 1 
ATOM   3449 C CD2 . TYR A 1 449 ? 18.806  23.286  15.584  1.00 32.46  ? 449  TYR A CD2 1 
ATOM   3450 C CE1 . TYR A 1 449 ? 20.928  23.225  13.790  1.00 30.20  ? 449  TYR A CE1 1 
ATOM   3451 C CE2 . TYR A 1 449 ? 19.873  24.200  15.720  1.00 30.47  ? 449  TYR A CE2 1 
ATOM   3452 C CZ  . TYR A 1 449 ? 20.926  24.154  14.826  1.00 31.79  ? 449  TYR A CZ  1 
ATOM   3453 O OH  . TYR A 1 449 ? 21.990  25.019  14.946  1.00 38.64  ? 449  TYR A OH  1 
ATOM   3454 N N   . GLU A 1 450 ? 17.201  17.816  15.742  1.00 33.41  ? 450  GLU A N   1 
ATOM   3455 C CA  . GLU A 1 450 ? 16.285  16.908  16.430  1.00 33.44  ? 450  GLU A CA  1 
ATOM   3456 C C   . GLU A 1 450 ? 16.740  16.686  17.875  1.00 34.31  ? 450  GLU A C   1 
ATOM   3457 O O   . GLU A 1 450 ? 15.931  16.411  18.743  1.00 33.60  ? 450  GLU A O   1 
ATOM   3458 C CB  . GLU A 1 450 ? 16.150  15.564  15.696  1.00 29.67  ? 450  GLU A CB  1 
ATOM   3459 C CG  . GLU A 1 450 ? 17.181  14.523  16.061  1.00 25.78  ? 450  GLU A CG  1 
ATOM   3460 C CD  . GLU A 1 450 ? 18.599  14.770  15.467  1.00 35.42  ? 450  GLU A CD  1 
ATOM   3461 O OE1 . GLU A 1 450 ? 18.930  15.922  15.069  1.00 29.53  ? 450  GLU A OE1 1 
ATOM   3462 O OE2 . GLU A 1 450 ? 19.370  13.774  15.373  1.00 32.48  ? 450  GLU A OE2 1 
ATOM   3463 N N   . ILE A 1 451 ? 18.039  16.845  18.130  1.00 34.18  ? 451  ILE A N   1 
ATOM   3464 C CA  . ILE A 1 451 ? 18.615  16.493  19.424  1.00 32.39  ? 451  ILE A CA  1 
ATOM   3465 C C   . ILE A 1 451 ? 17.906  17.163  20.601  1.00 31.31  ? 451  ILE A C   1 
ATOM   3466 O O   . ILE A 1 451 ? 17.606  16.516  21.581  1.00 32.42  ? 451  ILE A O   1 
ATOM   3467 C CB  . ILE A 1 451 ? 20.119  16.882  19.488  1.00 28.88  ? 451  ILE A CB  1 
ATOM   3468 C CG1 . ILE A 1 451 ? 20.884  16.162  18.382  1.00 25.68  ? 451  ILE A CG1 1 
ATOM   3469 C CG2 . ILE A 1 451 ? 20.669  16.529  20.835  1.00 26.43  ? 451  ILE A CG2 1 
ATOM   3470 C CD1 . ILE A 1 451 ? 22.338  16.636  18.263  1.00 24.96  ? 451  ILE A CD1 1 
ATOM   3471 N N   . GLU A 1 452 ? 17.660  18.467  20.506  1.00 31.06  ? 452  GLU A N   1 
ATOM   3472 C CA  . GLU A 1 452 ? 17.024  19.205  21.584  1.00 24.51  ? 452  GLU A CA  1 
ATOM   3473 C C   . GLU A 1 452 ? 15.610  18.621  21.895  1.00 34.77  ? 452  GLU A C   1 
ATOM   3474 O O   . GLU A 1 452 ? 15.101  18.750  23.019  1.00 33.65  ? 452  GLU A O   1 
ATOM   3475 C CB  . GLU A 1 452 ? 16.981  20.713  21.225  1.00 30.64  ? 452  GLU A CB  1 
ATOM   3476 C CG  . GLU A 1 452 ? 15.971  21.070  20.098  1.00 37.82  ? 452  GLU A CG  1 
ATOM   3477 C CD  . GLU A 1 452 ? 16.343  22.327  19.328  1.00 42.46  ? 452  GLU A CD  1 
ATOM   3478 O OE1 . GLU A 1 452 ? 15.520  23.267  19.234  1.00 44.08  ? 452  GLU A OE1 1 
ATOM   3479 O OE2 . GLU A 1 452 ? 17.467  22.400  18.816  1.00 39.51  ? 452  GLU A OE2 1 
ATOM   3480 N N   . PHE A 1 453 ? 14.978  17.958  20.930  1.00 25.97  ? 453  PHE A N   1 
ATOM   3481 C CA  . PHE A 1 453 ? 13.683  17.329  21.258  1.00 30.34  ? 453  PHE A CA  1 
ATOM   3482 C C   . PHE A 1 453 ? 13.826  15.963  21.947  1.00 35.86  ? 453  PHE A C   1 
ATOM   3483 O O   . PHE A 1 453 ? 13.049  15.646  22.865  1.00 33.24  ? 453  PHE A O   1 
ATOM   3484 C CB  . PHE A 1 453 ? 12.780  17.199  20.033  1.00 30.22  ? 453  PHE A CB  1 
ATOM   3485 C CG  . PHE A 1 453 ? 12.319  18.507  19.506  1.00 33.80  ? 453  PHE A CG  1 
ATOM   3486 C CD1 . PHE A 1 453 ? 11.126  19.067  19.950  1.00 33.72  ? 453  PHE A CD1 1 
ATOM   3487 C CD2 . PHE A 1 453 ? 13.088  19.205  18.588  1.00 30.60  ? 453  PHE A CD2 1 
ATOM   3488 C CE1 . PHE A 1 453 ? 10.741  20.292  19.499  1.00 36.64  ? 453  PHE A CE1 1 
ATOM   3489 C CE2 . PHE A 1 453 ? 12.681  20.425  18.121  1.00 33.74  ? 453  PHE A CE2 1 
ATOM   3490 C CZ  . PHE A 1 453 ? 11.502  20.965  18.582  1.00 34.30  ? 453  PHE A CZ  1 
ATOM   3491 N N   . ILE A 1 454 ? 14.804  15.167  21.497  1.00 30.46  ? 454  ILE A N   1 
ATOM   3492 C CA  . ILE A 1 454 ? 15.083  13.875  22.087  1.00 25.47  ? 454  ILE A CA  1 
ATOM   3493 C C   . ILE A 1 454 ? 15.463  14.058  23.549  1.00 32.46  ? 454  ILE A C   1 
ATOM   3494 O O   . ILE A 1 454 ? 15.062  13.263  24.400  1.00 33.96  ? 454  ILE A O   1 
ATOM   3495 C CB  . ILE A 1 454 ? 16.242  13.197  21.354  1.00 35.93  ? 454  ILE A CB  1 
ATOM   3496 C CG1 . ILE A 1 454 ? 15.959  13.132  19.840  1.00 35.20  ? 454  ILE A CG1 1 
ATOM   3497 C CG2 . ILE A 1 454 ? 16.564  11.801  21.959  1.00 29.36  ? 454  ILE A CG2 1 
ATOM   3498 C CD1 . ILE A 1 454 ? 14.811  12.253  19.522  1.00 40.89  ? 454  ILE A CD1 1 
ATOM   3499 N N   . PHE A 1 455 ? 16.214  15.120  23.855  1.00 30.89  ? 455  PHE A N   1 
ATOM   3500 C CA  . PHE A 1 455 ? 16.635  15.357  25.238  1.00 30.08  ? 455  PHE A CA  1 
ATOM   3501 C C   . PHE A 1 455 ? 15.596  16.093  26.071  1.00 33.26  ? 455  PHE A C   1 
ATOM   3502 O O   . PHE A 1 455 ? 15.770  16.264  27.274  1.00 36.52  ? 455  PHE A O   1 
ATOM   3503 C CB  . PHE A 1 455 ? 17.966  16.115  25.317  1.00 26.87  ? 455  PHE A CB  1 
ATOM   3504 C CG  . PHE A 1 455 ? 19.159  15.241  25.158  1.00 25.18  ? 455  PHE A CG  1 
ATOM   3505 C CD1 . PHE A 1 455 ? 19.556  14.806  23.892  1.00 22.64  ? 455  PHE A CD1 1 
ATOM   3506 C CD2 . PHE A 1 455 ? 19.894  14.848  26.267  1.00 26.35  ? 455  PHE A CD2 1 
ATOM   3507 C CE1 . PHE A 1 455 ? 20.700  13.976  23.748  1.00 24.23  ? 455  PHE A CE1 1 
ATOM   3508 C CE2 . PHE A 1 455 ? 21.045  14.034  26.137  1.00 26.93  ? 455  PHE A CE2 1 
ATOM   3509 C CZ  . PHE A 1 455 ? 21.435  13.595  24.861  1.00 28.05  ? 455  PHE A CZ  1 
ATOM   3510 N N   . GLY A 1 456 ? 14.531  16.541  25.421  1.00 31.09  ? 456  GLY A N   1 
ATOM   3511 C CA  . GLY A 1 456 ? 13.398  17.116  26.113  1.00 29.88  ? 456  GLY A CA  1 
ATOM   3512 C C   . GLY A 1 456 ? 13.604  18.537  26.580  1.00 34.62  ? 456  GLY A C   1 
ATOM   3513 O O   . GLY A 1 456 ? 13.000  18.925  27.574  1.00 38.70  ? 456  GLY A O   1 
ATOM   3514 N N   . LEU A 1 457 ? 14.446  19.323  25.900  1.00 31.63  ? 457  LEU A N   1 
ATOM   3515 C CA  . LEU A 1 457 ? 14.518  20.757  26.228  1.00 35.85  ? 457  LEU A CA  1 
ATOM   3516 C C   . LEU A 1 457 ? 13.161  21.510  26.174  1.00 41.49  ? 457  LEU A C   1 
ATOM   3517 O O   . LEU A 1 457 ? 12.935  22.438  26.971  1.00 42.96  ? 457  LEU A O   1 
ATOM   3518 C CB  . LEU A 1 457 ? 15.529  21.503  25.361  1.00 32.24  ? 457  LEU A CB  1 
ATOM   3519 C CG  . LEU A 1 457 ? 16.979  21.455  25.886  1.00 37.41  ? 457  LEU A CG  1 
ATOM   3520 C CD1 . LEU A 1 457 ? 17.465  20.018  25.934  1.00 29.19  ? 457  LEU A CD1 1 
ATOM   3521 C CD2 . LEU A 1 457 ? 17.888  22.270  24.982  1.00 35.51  ? 457  LEU A CD2 1 
ATOM   3522 N N   . PRO A 1 458 ? 12.275  21.149  25.224  1.00 32.89  ? 458  PRO A N   1 
ATOM   3523 C CA  . PRO A 1 458 ? 10.999  21.874  25.216  1.00 40.32  ? 458  PRO A CA  1 
ATOM   3524 C C   . PRO A 1 458 ? 10.257  21.840  26.563  1.00 42.16  ? 458  PRO A C   1 
ATOM   3525 O O   . PRO A 1 458 ? 9.397   22.691  26.749  1.00 44.87  ? 458  PRO A O   1 
ATOM   3526 C CB  . PRO A 1 458 ? 10.192  21.177  24.102  1.00 38.01  ? 458  PRO A CB  1 
ATOM   3527 C CG  . PRO A 1 458 ? 11.288  20.671  23.163  1.00 37.35  ? 458  PRO A CG  1 
ATOM   3528 C CD  . PRO A 1 458 ? 12.354  20.181  24.123  1.00 29.65  ? 458  PRO A CD  1 
ATOM   3529 N N   . LEU A 1 459 ? 10.601  20.932  27.480  1.00 40.00  ? 459  LEU A N   1 
ATOM   3530 C CA  . LEU A 1 459 ? 9.951   20.892  28.796  1.00 38.05  ? 459  LEU A CA  1 
ATOM   3531 C C   . LEU A 1 459 ? 10.336  22.050  29.686  1.00 44.77  ? 459  LEU A C   1 
ATOM   3532 O O   . LEU A 1 459 ? 9.691   22.301  30.703  1.00 49.87  ? 459  LEU A O   1 
ATOM   3533 C CB  . LEU A 1 459 ? 10.294  19.612  29.529  1.00 37.79  ? 459  LEU A CB  1 
ATOM   3534 C CG  . LEU A 1 459 ? 9.439   18.380  29.243  1.00 46.05  ? 459  LEU A CG  1 
ATOM   3535 C CD1 . LEU A 1 459 ? 9.041   18.299  27.790  1.00 53.27  ? 459  LEU A CD1 1 
ATOM   3536 C CD2 . LEU A 1 459 ? 10.208  17.159  29.628  1.00 42.78  ? 459  LEU A CD2 1 
ATOM   3537 N N   . ASP A 1 460 ? 11.423  22.727  29.336  1.00 45.15  ? 460  ASP A N   1 
ATOM   3538 C CA  . ASP A 1 460 ? 11.891  23.837  30.141  1.00 44.53  ? 460  ASP A CA  1 
ATOM   3539 C C   . ASP A 1 460 ? 11.107  25.062  29.680  1.00 45.26  ? 460  ASP A C   1 
ATOM   3540 O O   . ASP A 1 460 ? 11.261  25.503  28.546  1.00 45.18  ? 460  ASP A O   1 
ATOM   3541 C CB  . ASP A 1 460 ? 13.406  24.033  29.970  1.00 39.47  ? 460  ASP A CB  1 
ATOM   3542 C CG  . ASP A 1 460 ? 13.946  25.131  30.872  1.00 51.85  ? 460  ASP A CG  1 
ATOM   3543 O OD1 . ASP A 1 460 ? 13.123  25.957  31.346  1.00 53.40  ? 460  ASP A OD1 1 
ATOM   3544 O OD2 . ASP A 1 460 ? 15.177  25.168  31.121  1.00 51.91  ? 460  ASP A OD2 1 
ATOM   3545 N N   . PRO A 1 461 ? 10.249  25.605  30.549  1.00 53.01  ? 461  PRO A N   1 
ATOM   3546 C CA  . PRO A 1 461 ? 9.329   26.667  30.106  1.00 55.83  ? 461  PRO A CA  1 
ATOM   3547 C C   . PRO A 1 461 ? 10.096  27.890  29.641  1.00 58.04  ? 461  PRO A C   1 
ATOM   3548 O O   . PRO A 1 461 ? 9.687   28.528  28.672  1.00 65.58  ? 461  PRO A O   1 
ATOM   3549 C CB  . PRO A 1 461 ? 8.531   27.012  31.363  1.00 55.50  ? 461  PRO A CB  1 
ATOM   3550 C CG  . PRO A 1 461 ? 8.887   25.970  32.383  1.00 59.40  ? 461  PRO A CG  1 
ATOM   3551 C CD  . PRO A 1 461 ? 10.227  25.413  32.007  1.00 56.82  ? 461  PRO A CD  1 
ATOM   3552 N N   . SER A 1 462 ? 11.215  28.188  30.295  1.00 50.97  ? 462  SER A N   1 
ATOM   3553 C CA  . SER A 1 462 ? 12.015  29.348  29.916  1.00 56.51  ? 462  SER A CA  1 
ATOM   3554 C C   . SER A 1 462 ? 12.592  29.307  28.484  1.00 58.17  ? 462  SER A C   1 
ATOM   3555 O O   . SER A 1 462 ? 13.046  30.338  27.976  1.00 56.58  ? 462  SER A O   1 
ATOM   3556 C CB  . SER A 1 462 ? 13.142  29.595  30.934  1.00 54.70  ? 462  SER A CB  1 
ATOM   3557 O OG  . SER A 1 462 ? 14.272  28.789  30.661  1.00 58.03  ? 462  SER A OG  1 
ATOM   3558 N N   . LEU A 1 463 ? 12.588  28.140  27.836  1.00 55.32  ? 463  LEU A N   1 
ATOM   3559 C CA  . LEU A 1 463 ? 13.148  28.042  26.482  1.00 49.79  ? 463  LEU A CA  1 
ATOM   3560 C C   . LEU A 1 463 ? 12.150  28.484  25.386  1.00 53.81  ? 463  LEU A C   1 
ATOM   3561 O O   . LEU A 1 463 ? 12.512  28.571  24.208  1.00 58.90  ? 463  LEU A O   1 
ATOM   3562 C CB  . LEU A 1 463 ? 13.716  26.643  26.193  1.00 41.91  ? 463  LEU A CB  1 
ATOM   3563 C CG  . LEU A 1 463 ? 14.880  26.147  27.069  1.00 47.81  ? 463  LEU A CG  1 
ATOM   3564 C CD1 . LEU A 1 463 ? 15.471  24.885  26.497  1.00 46.10  ? 463  LEU A CD1 1 
ATOM   3565 C CD2 . LEU A 1 463 ? 15.988  27.209  27.263  1.00 44.41  ? 463  LEU A CD2 1 
ATOM   3566 N N   . ASN A 1 464 ? 10.909  28.770  25.758  1.00 48.73  ? 464  ASN A N   1 
ATOM   3567 C CA  . ASN A 1 464 ? 9.975   29.410  24.802  1.00 56.69  ? 464  ASN A CA  1 
ATOM   3568 C C   . ASN A 1 464 ? 9.438   28.516  23.665  1.00 53.88  ? 464  ASN A C   1 
ATOM   3569 O O   . ASN A 1 464 ? 8.891   29.027  22.679  1.00 52.58  ? 464  ASN A O   1 
ATOM   3570 C CB  . ASN A 1 464 ? 10.590  30.696  24.194  1.00 57.79  ? 464  ASN A CB  1 
ATOM   3571 C CG  . ASN A 1 464 ? 10.734  31.829  25.218  1.00 64.98  ? 464  ASN A CG  1 
ATOM   3572 O OD1 . ASN A 1 464 ? 10.142  31.777  26.302  1.00 65.45  ? 464  ASN A OD1 1 
ATOM   3573 N ND2 . ASN A 1 464 ? 11.516  32.867  24.864  1.00 71.98  ? 464  ASN A ND2 1 
ATOM   3574 N N   . TYR A 1 465 ? 9.606   27.199  23.784  1.00 43.08  ? 465  TYR A N   1 
ATOM   3575 C CA  . TYR A 1 465 ? 8.997   26.274  22.831  1.00 41.44  ? 465  TYR A CA  1 
ATOM   3576 C C   . TYR A 1 465 ? 7.475   26.344  22.960  1.00 43.91  ? 465  TYR A C   1 
ATOM   3577 O O   . TYR A 1 465 ? 6.970   26.810  23.974  1.00 47.99  ? 465  TYR A O   1 
ATOM   3578 C CB  . TYR A 1 465 ? 9.443   24.853  23.116  1.00 37.51  ? 465  TYR A CB  1 
ATOM   3579 C CG  . TYR A 1 465 ? 10.857  24.572  22.719  1.00 34.78  ? 465  TYR A CG  1 
ATOM   3580 C CD1 . TYR A 1 465 ? 11.158  24.112  21.440  1.00 32.14  ? 465  TYR A CD1 1 
ATOM   3581 C CD2 . TYR A 1 465 ? 11.915  24.789  23.623  1.00 39.71  ? 465  TYR A CD2 1 
ATOM   3582 C CE1 . TYR A 1 465 ? 12.482  23.862  21.064  1.00 40.29  ? 465  TYR A CE1 1 
ATOM   3583 C CE2 . TYR A 1 465 ? 13.235  24.540  23.255  1.00 38.37  ? 465  TYR A CE2 1 
ATOM   3584 C CZ  . TYR A 1 465 ? 13.507  24.079  21.983  1.00 36.99  ? 465  TYR A CZ  1 
ATOM   3585 O OH  . TYR A 1 465 ? 14.798  23.818  21.629  1.00 44.08  ? 465  TYR A OH  1 
ATOM   3586 N N   . THR A 1 466 ? 6.748   25.860  21.952  1.00 45.72  ? 466  THR A N   1 
ATOM   3587 C CA  . THR A 1 466 ? 5.290   25.805  22.026  1.00 42.25  ? 466  THR A CA  1 
ATOM   3588 C C   . THR A 1 466 ? 4.813   24.595  22.833  1.00 49.77  ? 466  THR A C   1 
ATOM   3589 O O   . THR A 1 466 ? 5.595   23.663  23.144  1.00 44.89  ? 466  THR A O   1 
ATOM   3590 C CB  . THR A 1 466 ? 4.633   25.736  20.640  1.00 43.02  ? 466  THR A CB  1 
ATOM   3591 O OG1 . THR A 1 466 ? 4.923   24.470  20.019  1.00 46.26  ? 466  THR A OG1 1 
ATOM   3592 C CG2 . THR A 1 466 ? 5.096   26.893  19.740  1.00 35.45  ? 466  THR A CG2 1 
ATOM   3593 N N   . THR A 1 467 ? 3.521   24.605  23.157  1.00 47.24  ? 467  THR A N   1 
ATOM   3594 C CA  . THR A 1 467 ? 2.925   23.563  23.970  1.00 45.77  ? 467  THR A CA  1 
ATOM   3595 C C   . THR A 1 467 ? 2.919   22.227  23.214  1.00 47.07  ? 467  THR A C   1 
ATOM   3596 O O   . THR A 1 467 ? 3.190   21.181  23.787  1.00 49.25  ? 467  THR A O   1 
ATOM   3597 C CB  . THR A 1 467 ? 1.498   23.963  24.432  1.00 55.92  ? 467  THR A CB  1 
ATOM   3598 O OG1 . THR A 1 467 ? 1.595   24.996  25.424  1.00 51.06  ? 467  THR A OG1 1 
ATOM   3599 C CG2 . THR A 1 467 ? 0.773   22.757  25.036  1.00 54.76  ? 467  THR A CG2 1 
ATOM   3600 N N   . GLU A 1 468 ? 2.630   22.284  21.920  1.00 46.54  ? 468  GLU A N   1 
ATOM   3601 C CA  . GLU A 1 468 ? 2.691   21.122  21.049  1.00 46.04  ? 468  GLU A CA  1 
ATOM   3602 C C   . GLU A 1 468 ? 4.104   20.538  21.005  1.00 48.22  ? 468  GLU A C   1 
ATOM   3603 O O   . GLU A 1 468 ? 4.288   19.320  21.033  1.00 47.53  ? 468  GLU A O   1 
ATOM   3604 C CB  . GLU A 1 468 ? 2.270   21.514  19.633  1.00 53.65  ? 468  GLU A CB  1 
ATOM   3605 C CG  . GLU A 1 468 ? 0.862   22.148  19.544  1.00 69.17  ? 468  GLU A CG  1 
ATOM   3606 C CD  . GLU A 1 468 ? 0.878   23.681  19.670  1.00 76.73  ? 468  GLU A CD  1 
ATOM   3607 O OE1 . GLU A 1 468 ? 1.187   24.215  20.758  1.00 70.87  ? 468  GLU A OE1 1 
ATOM   3608 O OE2 . GLU A 1 468 ? 0.564   24.361  18.667  1.00 87.27  ? 468  GLU A OE2 1 
ATOM   3609 N N   . GLU A 1 469 ? 5.095   21.421  20.909  1.00 41.99  ? 469  GLU A N   1 
ATOM   3610 C CA  . GLU A 1 469 ? 6.483   21.016  20.893  1.00 40.86  ? 469  GLU A CA  1 
ATOM   3611 C C   . GLU A 1 469 ? 6.822   20.321  22.210  1.00 41.34  ? 469  GLU A C   1 
ATOM   3612 O O   . GLU A 1 469 ? 7.555   19.333  22.221  1.00 40.17  ? 469  GLU A O   1 
ATOM   3613 C CB  . GLU A 1 469 ? 7.386   22.217  20.629  1.00 42.14  ? 469  GLU A CB  1 
ATOM   3614 C CG  . GLU A 1 469 ? 7.368   22.654  19.159  1.00 46.16  ? 469  GLU A CG  1 
ATOM   3615 C CD  . GLU A 1 469 ? 8.188   23.895  18.933  1.00 46.04  ? 469  GLU A CD  1 
ATOM   3616 O OE1 . GLU A 1 469 ? 8.124   24.783  19.809  1.00 42.67  ? 469  GLU A OE1 1 
ATOM   3617 O OE2 . GLU A 1 469 ? 8.914   23.965  17.913  1.00 50.18  ? 469  GLU A OE2 1 
ATOM   3618 N N   . ARG A 1 470 ? 6.239   20.804  23.306  1.00 40.14  ? 470  ARG A N   1 
ATOM   3619 C CA  . ARG A 1 470 ? 6.388   20.156  24.600  1.00 44.25  ? 470  ARG A CA  1 
ATOM   3620 C C   . ARG A 1 470 ? 5.830   18.724  24.569  1.00 46.70  ? 470  ARG A C   1 
ATOM   3621 O O   . ARG A 1 470 ? 6.465   17.786  25.078  1.00 41.09  ? 470  ARG A O   1 
ATOM   3622 C CB  . ARG A 1 470 ? 5.721   20.998  25.696  1.00 52.60  ? 470  ARG A CB  1 
ATOM   3623 C CG  . ARG A 1 470 ? 6.360   20.889  27.069  1.00 65.59  ? 470  ARG A CG  1 
ATOM   3624 C CD  . ARG A 1 470 ? 5.477   20.168  28.105  1.00 77.44  ? 470  ARG A CD  1 
ATOM   3625 N NE  . ARG A 1 470 ? 4.312   20.977  28.458  1.00 88.24  ? 470  ARG A NE  1 
ATOM   3626 C CZ  . ARG A 1 470 ? 3.045   20.608  28.266  1.00 89.84  ? 470  ARG A CZ  1 
ATOM   3627 N NH1 . ARG A 1 470 ? 2.756   19.410  27.758  1.00 86.45  ? 470  ARG A NH1 1 
ATOM   3628 N NH2 . ARG A 1 470 ? 2.063   21.435  28.605  1.00 91.45  ? 470  ARG A NH2 1 
ATOM   3629 N N   . ILE A 1 471 ? 4.662   18.540  23.953  1.00 41.94  ? 471  ILE A N   1 
ATOM   3630 C CA  . ILE A 1 471 ? 4.073   17.203  23.880  1.00 42.97  ? 471  ILE A CA  1 
ATOM   3631 C C   . ILE A 1 471 ? 4.831   16.313  22.914  1.00 40.74  ? 471  ILE A C   1 
ATOM   3632 O O   . ILE A 1 471 ? 4.983   15.116  23.139  1.00 43.48  ? 471  ILE A O   1 
ATOM   3633 C CB  . ILE A 1 471 ? 2.573   17.260  23.478  1.00 50.97  ? 471  ILE A CB  1 
ATOM   3634 C CG1 . ILE A 1 471 ? 1.761   17.872  24.630  1.00 46.61  ? 471  ILE A CG1 1 
ATOM   3635 C CG2 . ILE A 1 471 ? 2.058   15.863  23.067  1.00 39.49  ? 471  ILE A CG2 1 
ATOM   3636 C CD1 . ILE A 1 471 ? 0.482   18.483  24.190  1.00 52.22  ? 471  ILE A CD1 1 
ATOM   3637 N N   . PHE A 1 472 ? 5.267   16.901  21.814  1.00 39.37  ? 472  PHE A N   1 
ATOM   3638 C CA  . PHE A 1 472 ? 6.122   16.205  20.856  1.00 42.70  ? 472  PHE A CA  1 
ATOM   3639 C C   . PHE A 1 472 ? 7.403   15.679  21.545  1.00 38.48  ? 472  PHE A C   1 
ATOM   3640 O O   . PHE A 1 472 ? 7.718   14.482  21.481  1.00 41.81  ? 472  PHE A O   1 
ATOM   3641 C CB  . PHE A 1 472 ? 6.440   17.149  19.702  1.00 40.40  ? 472  PHE A CB  1 
ATOM   3642 C CG  . PHE A 1 472 ? 7.274   16.538  18.616  1.00 39.13  ? 472  PHE A CG  1 
ATOM   3643 C CD1 . PHE A 1 472 ? 6.942   15.308  18.072  1.00 35.70  ? 472  PHE A CD1 1 
ATOM   3644 C CD2 . PHE A 1 472 ? 8.395   17.220  18.126  1.00 36.94  ? 472  PHE A CD2 1 
ATOM   3645 C CE1 . PHE A 1 472 ? 7.721   14.752  17.052  1.00 30.07  ? 472  PHE A CE1 1 
ATOM   3646 C CE2 . PHE A 1 472 ? 9.165   16.688  17.113  1.00 37.30  ? 472  PHE A CE2 1 
ATOM   3647 C CZ  . PHE A 1 472 ? 8.823   15.443  16.570  1.00 38.84  ? 472  PHE A CZ  1 
ATOM   3648 N N   . ALA A 1 473 ? 8.099   16.548  22.264  1.00 32.75  ? 473  ALA A N   1 
ATOM   3649 C CA  . ALA A 1 473 ? 9.331   16.127  22.958  1.00 37.28  ? 473  ALA A CA  1 
ATOM   3650 C C   . ALA A 1 473 ? 9.057   14.960  23.913  1.00 39.46  ? 473  ALA A C   1 
ATOM   3651 O O   . ALA A 1 473 ? 9.778   13.959  23.913  1.00 38.85  ? 473  ALA A O   1 
ATOM   3652 C CB  . ALA A 1 473 ? 9.941   17.294  23.703  1.00 34.52  ? 473  ALA A CB  1 
ATOM   3653 N N   . GLN A 1 474 ? 7.982   15.073  24.698  1.00 40.00  ? 474  GLN A N   1 
ATOM   3654 C CA  . GLN A 1 474 ? 7.530   13.961  25.543  1.00 41.95  ? 474  GLN A CA  1 
ATOM   3655 C C   . GLN A 1 474 ? 7.362   12.654  24.769  1.00 39.38  ? 474  GLN A C   1 
ATOM   3656 O O   . GLN A 1 474 ? 7.826   11.599  25.212  1.00 40.19  ? 474  GLN A O   1 
ATOM   3657 C CB  . GLN A 1 474 ? 6.256   14.316  26.312  1.00 41.53  ? 474  GLN A CB  1 
ATOM   3658 C CG  . GLN A 1 474 ? 6.511   15.210  27.499  1.00 50.65  ? 474  GLN A CG  1 
ATOM   3659 C CD  . GLN A 1 474 ? 5.271   15.967  27.949  1.00 64.36  ? 474  GLN A CD  1 
ATOM   3660 O OE1 . GLN A 1 474 ? 4.294   16.107  27.200  1.00 69.93  ? 474  GLN A OE1 1 
ATOM   3661 N NE2 . GLN A 1 474 ? 5.311   16.478  29.171  1.00 67.11  ? 474  GLN A NE2 1 
ATOM   3662 N N   . ARG A 1 475 ? 6.708   12.708  23.613  1.00 38.16  ? 475  ARG A N   1 
ATOM   3663 C CA  . ARG A 1 475 ? 6.586   11.496  22.792  1.00 42.00  ? 475  ARG A CA  1 
ATOM   3664 C C   . ARG A 1 475 ? 7.970   10.924  22.401  1.00 39.16  ? 475  ARG A C   1 
ATOM   3665 O O   . ARG A 1 475 ? 8.192   9.697   22.469  1.00 38.15  ? 475  ARG A O   1 
ATOM   3666 C CB  . ARG A 1 475 ? 5.793   11.760  21.501  1.00 45.18  ? 475  ARG A CB  1 
ATOM   3667 C CG  . ARG A 1 475 ? 4.315   11.610  21.596  1.00 45.01  ? 475  ARG A CG  1 
ATOM   3668 C CD  . ARG A 1 475 ? 3.642   12.132  20.289  1.00 58.84  ? 475  ARG A CD  1 
ATOM   3669 N NE  . ARG A 1 475 ? 4.091   11.345  19.154  1.00 49.45  ? 475  ARG A NE  1 
ATOM   3670 C CZ  . ARG A 1 475 ? 4.269   11.808  17.928  1.00 40.50  ? 475  ARG A CZ  1 
ATOM   3671 N NH1 . ARG A 1 475 ? 4.000   13.067  17.636  1.00 38.61  ? 475  ARG A NH1 1 
ATOM   3672 N NH2 . ARG A 1 475 ? 4.713   10.990  16.988  1.00 40.46  ? 475  ARG A NH2 1 
ATOM   3673 N N   . LEU A 1 476 ? 8.883   11.788  21.948  1.00 36.27  ? 476  LEU A N   1 
ATOM   3674 C CA  . LEU A 1 476 ? 10.173  11.286  21.465  1.00 32.70  ? 476  LEU A CA  1 
ATOM   3675 C C   . LEU A 1 476 ? 10.927  10.697  22.628  1.00 32.48  ? 476  LEU A C   1 
ATOM   3676 O O   . LEU A 1 476 ? 11.568  9.661   22.486  1.00 41.45  ? 476  LEU A O   1 
ATOM   3677 C CB  . LEU A 1 476 ? 11.010  12.361  20.756  1.00 34.45  ? 476  LEU A CB  1 
ATOM   3678 C CG  . LEU A 1 476 ? 10.326  12.987  19.531  1.00 41.25  ? 476  LEU A CG  1 
ATOM   3679 C CD1 . LEU A 1 476 ? 11.090  14.176  19.036  1.00 41.28  ? 476  LEU A CD1 1 
ATOM   3680 C CD2 . LEU A 1 476 ? 10.221  11.983  18.454  1.00 43.40  ? 476  LEU A CD2 1 
ATOM   3681 N N   . MET A 1 477 ? 10.851  11.343  23.786  1.00 32.37  ? 477  MET A N   1 
ATOM   3682 C CA  . MET A 1 477 ? 11.547  10.812  24.957  1.00 36.14  ? 477  MET A CA  1 
ATOM   3683 C C   . MET A 1 477 ? 11.029  9.420   25.272  1.00 41.54  ? 477  MET A C   1 
ATOM   3684 O O   . MET A 1 477 ? 11.822  8.544   25.635  1.00 40.74  ? 477  MET A O   1 
ATOM   3685 C CB  . MET A 1 477 ? 11.426  11.722  26.181  1.00 36.45  ? 477  MET A CB  1 
ATOM   3686 C CG  . MET A 1 477 ? 12.209  13.028  26.077  1.00 39.80  ? 477  MET A CG  1 
ATOM   3687 S SD  . MET A 1 477 ? 11.604  14.216  27.315  1.00 48.94  ? 477  MET A SD  1 
ATOM   3688 C CE  . MET A 1 477 ? 12.388  13.609  28.764  1.00 35.11  ? 477  MET A CE  1 
ATOM   3689 N N   . LYS A 1 478 ? 9.710   9.219   25.133  1.00 38.77  ? 478  LYS A N   1 
ATOM   3690 C CA  . LYS A 1 478 ? 9.087   7.896   25.359  1.00 42.36  ? 478  LYS A CA  1 
ATOM   3691 C C   . LYS A 1 478 ? 9.587   6.854   24.369  1.00 40.37  ? 478  LYS A C   1 
ATOM   3692 O O   . LYS A 1 478 ? 9.944   5.727   24.770  1.00 42.92  ? 478  LYS A O   1 
ATOM   3693 C CB  . LYS A 1 478 ? 7.557   7.961   25.229  1.00 46.48  ? 478  LYS A CB  1 
ATOM   3694 C CG  . LYS A 1 478 ? 6.825   8.365   26.460  1.00 58.46  ? 478  LYS A CG  1 
ATOM   3695 C CD  . LYS A 1 478 ? 6.819   7.252   27.483  1.00 69.32  ? 478  LYS A CD  1 
ATOM   3696 C CE  . LYS A 1 478 ? 6.036   7.655   28.731  1.00 70.24  ? 478  LYS A CE  1 
ATOM   3697 N NZ  . LYS A 1 478 ? 6.308   9.064   29.155  1.00 69.14  ? 478  LYS A NZ  1 
ATOM   3698 N N   . TYR A 1 479 ? 9.593   7.209   23.077  1.00 38.80  ? 479  TYR A N   1 
ATOM   3699 C CA  . TYR A 1 479 ? 10.112  6.292   22.042  1.00 39.81  ? 479  TYR A CA  1 
ATOM   3700 C C   . TYR A 1 479 ? 11.525  5.849   22.378  1.00 36.84  ? 479  TYR A C   1 
ATOM   3701 O O   . TYR A 1 479 ? 11.816  4.656   22.335  1.00 33.53  ? 479  TYR A O   1 
ATOM   3702 C CB  . TYR A 1 479 ? 10.144  6.909   20.632  1.00 37.74  ? 479  TYR A CB  1 
ATOM   3703 C CG  . TYR A 1 479 ? 8.782   7.153   20.010  1.00 41.23  ? 479  TYR A CG  1 
ATOM   3704 C CD1 . TYR A 1 479 ? 7.744   6.241   20.153  1.00 37.21  ? 479  TYR A CD1 1 
ATOM   3705 C CD2 . TYR A 1 479 ? 8.549   8.301   19.274  1.00 40.47  ? 479  TYR A CD2 1 
ATOM   3706 C CE1 . TYR A 1 479 ? 6.501   6.492   19.583  1.00 40.22  ? 479  TYR A CE1 1 
ATOM   3707 C CE2 . TYR A 1 479 ? 7.339   8.555   18.708  1.00 49.20  ? 479  TYR A CE2 1 
ATOM   3708 C CZ  . TYR A 1 479 ? 6.306   7.652   18.862  1.00 47.69  ? 479  TYR A CZ  1 
ATOM   3709 O OH  . TYR A 1 479 ? 5.099   7.952   18.270  1.00 50.05  ? 479  TYR A OH  1 
ATOM   3710 N N   . TRP A 1 480 ? 12.388  6.809   22.712  1.00 33.15  ? 480  TRP A N   1 
ATOM   3711 C CA  . TRP A 1 480 ? 13.817  6.517   22.909  1.00 38.07  ? 480  TRP A CA  1 
ATOM   3712 C C   . TRP A 1 480 ? 14.032  5.656   24.174  1.00 34.99  ? 480  TRP A C   1 
ATOM   3713 O O   . TRP A 1 480 ? 14.739  4.649   24.149  1.00 34.12  ? 480  TRP A O   1 
ATOM   3714 C CB  . TRP A 1 480 ? 14.633  7.826   22.973  1.00 32.32  ? 480  TRP A CB  1 
ATOM   3715 C CG  . TRP A 1 480 ? 15.378  8.232   21.686  1.00 31.94  ? 480  TRP A CG  1 
ATOM   3716 C CD1 . TRP A 1 480 ? 16.727  8.414   21.550  1.00 29.77  ? 480  TRP A CD1 1 
ATOM   3717 C CD2 . TRP A 1 480 ? 14.812  8.501   20.386  1.00 34.97  ? 480  TRP A CD2 1 
ATOM   3718 N NE1 . TRP A 1 480 ? 17.038  8.781   20.259  1.00 29.84  ? 480  TRP A NE1 1 
ATOM   3719 C CE2 . TRP A 1 480 ? 15.883  8.851   19.530  1.00 31.33  ? 480  TRP A CE2 1 
ATOM   3720 C CE3 . TRP A 1 480 ? 13.515  8.463   19.865  1.00 34.41  ? 480  TRP A CE3 1 
ATOM   3721 C CZ2 . TRP A 1 480 ? 15.689  9.172   18.198  1.00 29.51  ? 480  TRP A CZ2 1 
ATOM   3722 C CZ3 . TRP A 1 480 ? 13.334  8.779   18.553  1.00 34.59  ? 480  TRP A CZ3 1 
ATOM   3723 C CH2 . TRP A 1 480 ? 14.421  9.134   17.724  1.00 35.27  ? 480  TRP A CH2 1 
ATOM   3724 N N   . THR A 1 481 ? 13.364  6.013   25.264  1.00 32.94  ? 481  THR A N   1 
ATOM   3725 C CA  . THR A 1 481 ? 13.509  5.227   26.485  1.00 33.34  ? 481  THR A CA  1 
ATOM   3726 C C   . THR A 1 481 ? 12.760  3.879   26.410  1.00 37.90  ? 481  THR A C   1 
ATOM   3727 O O   . THR A 1 481 ? 13.251  2.897   26.971  1.00 36.67  ? 481  THR A O   1 
ATOM   3728 C CB  . THR A 1 481 ? 13.151  6.026   27.759  1.00 36.06  ? 481  THR A CB  1 
ATOM   3729 O OG1 . THR A 1 481 ? 11.824  6.557   27.641  1.00 40.84  ? 481  THR A OG1 1 
ATOM   3730 C CG2 . THR A 1 481 ? 14.094  7.196   27.911  1.00 40.00  ? 481  THR A CG2 1 
ATOM   3731 N N   . ASN A 1 482 ? 11.606  3.813   25.722  1.00 33.89  ? 482  ASN A N   1 
ATOM   3732 C CA  . ASN A 1 482 ? 11.006  2.479   25.452  1.00 40.01  ? 482  ASN A CA  1 
ATOM   3733 C C   . ASN A 1 482 ? 11.999  1.589   24.716  1.00 41.10  ? 482  ASN A C   1 
ATOM   3734 O O   . ASN A 1 482 ? 12.183  0.411   25.061  1.00 36.81  ? 482  ASN A O   1 
ATOM   3735 C CB  . ASN A 1 482 ? 9.730   2.547   24.620  1.00 36.48  ? 482  ASN A CB  1 
ATOM   3736 C CG  . ASN A 1 482 ? 8.553   3.048   25.406  1.00 39.36  ? 482  ASN A CG  1 
ATOM   3737 O OD1 . ASN A 1 482 ? 8.577   3.046   26.630  1.00 39.49  ? 482  ASN A OD1 1 
ATOM   3738 N ND2 . ASN A 1 482 ? 7.517   3.491   24.705  1.00 40.91  ? 482  ASN A ND2 1 
ATOM   3739 N N   . PHE A 1 483 ? 12.627  2.175   23.693  1.00 40.39  ? 483  PHE A N   1 
ATOM   3740 C CA  . PHE A 1 483 ? 13.635  1.467   22.921  1.00 42.45  ? 483  PHE A CA  1 
ATOM   3741 C C   . PHE A 1 483 ? 14.813  0.978   23.795  1.00 39.79  ? 483  PHE A C   1 
ATOM   3742 O O   . PHE A 1 483 ? 15.208  -0.190  23.712  1.00 35.84  ? 483  PHE A O   1 
ATOM   3743 C CB  . PHE A 1 483 ? 14.143  2.284   21.722  1.00 35.83  ? 483  PHE A CB  1 
ATOM   3744 C CG  . PHE A 1 483 ? 15.208  1.572   20.968  1.00 35.46  ? 483  PHE A CG  1 
ATOM   3745 C CD1 . PHE A 1 483 ? 14.885  0.449   20.185  1.00 38.86  ? 483  PHE A CD1 1 
ATOM   3746 C CD2 . PHE A 1 483 ? 16.532  1.926   21.121  1.00 29.80  ? 483  PHE A CD2 1 
ATOM   3747 C CE1 . PHE A 1 483 ? 15.870  -0.274  19.517  1.00 33.65  ? 483  PHE A CE1 1 
ATOM   3748 C CE2 . PHE A 1 483 ? 17.526  1.207   20.458  1.00 31.14  ? 483  PHE A CE2 1 
ATOM   3749 C CZ  . PHE A 1 483 ? 17.200  0.114   19.649  1.00 28.24  ? 483  PHE A CZ  1 
ATOM   3750 N N   . ALA A 1 484 ? 15.357  1.868   24.628  1.00 34.66  ? 484  ALA A N   1 
ATOM   3751 C CA  . ALA A 1 484 ? 16.466  1.523   25.530  1.00 33.82  ? 484  ALA A CA  1 
ATOM   3752 C C   . ALA A 1 484 ? 16.053  0.384   26.450  1.00 40.40  ? 484  ALA A C   1 
ATOM   3753 O O   . ALA A 1 484 ? 16.832  -0.535  26.738  1.00 36.84  ? 484  ALA A O   1 
ATOM   3754 C CB  . ALA A 1 484 ? 16.848  2.708   26.371  1.00 24.98  ? 484  ALA A CB  1 
ATOM   3755 N N   . ARG A 1 485 ? 14.814  0.481   26.918  1.00 38.87  ? 485  ARG A N   1 
ATOM   3756 C CA  . ARG A 1 485 ? 14.277  -0.432  27.906  1.00 43.02  ? 485  ARG A CA  1 
ATOM   3757 C C   . ARG A 1 485 ? 14.008  -1.834  27.320  1.00 45.68  ? 485  ARG A C   1 
ATOM   3758 O O   . ARG A 1 485 ? 14.304  -2.834  27.963  1.00 48.65  ? 485  ARG A O   1 
ATOM   3759 C CB  . ARG A 1 485 ? 12.999  0.185   28.498  1.00 51.81  ? 485  ARG A CB  1 
ATOM   3760 C CG  . ARG A 1 485 ? 12.579  -0.298  29.882  1.00 60.27  ? 485  ARG A CG  1 
ATOM   3761 C CD  . ARG A 1 485 ? 11.236  0.348   30.335  1.00 84.15  ? 485  ARG A CD  1 
ATOM   3762 N NE  . ARG A 1 485 ? 10.966  1.701   29.800  1.00 82.91  ? 485  ARG A NE  1 
ATOM   3763 C CZ  . ARG A 1 485 ? 11.344  2.852   30.372  1.00 79.56  ? 485  ARG A CZ  1 
ATOM   3764 N NH1 . ARG A 1 485 ? 12.033  2.840   31.512  1.00 82.31  ? 485  ARG A NH1 1 
ATOM   3765 N NH2 . ARG A 1 485 ? 11.029  4.025   29.807  1.00 69.29  ? 485  ARG A NH2 1 
ATOM   3766 N N   . THR A 1 486 ? 13.470  -1.910  26.103  1.00 42.23  ? 486  THR A N   1 
ATOM   3767 C CA  . THR A 1 486 ? 12.950  -3.186  25.579  1.00 43.29  ? 486  THR A CA  1 
ATOM   3768 C C   . THR A 1 486 ? 13.433  -3.553  24.164  1.00 45.00  ? 486  THR A C   1 
ATOM   3769 O O   . THR A 1 486 ? 13.169  -4.651  23.685  1.00 45.96  ? 486  THR A O   1 
ATOM   3770 C CB  . THR A 1 486 ? 11.417  -3.136  25.479  1.00 40.41  ? 486  THR A CB  1 
ATOM   3771 O OG1 . THR A 1 486 ? 11.062  -2.245  24.418  1.00 43.65  ? 486  THR A OG1 1 
ATOM   3772 C CG2 . THR A 1 486 ? 10.783  -2.628  26.792  1.00 33.94  ? 486  THR A CG2 1 
ATOM   3773 N N   . GLY A 1 487 ? 14.118  -2.638  23.481  1.00 40.09  ? 487  GLY A N   1 
ATOM   3774 C CA  . GLY A 1 487 ? 14.477  -2.861  22.086  1.00 35.38  ? 487  GLY A CA  1 
ATOM   3775 C C   . GLY A 1 487 ? 13.324  -2.526  21.146  1.00 40.72  ? 487  GLY A C   1 
ATOM   3776 O O   . GLY A 1 487 ? 13.367  -2.845  19.960  1.00 44.59  ? 487  GLY A O   1 
ATOM   3777 N N   . ASP A 1 488 ? 12.299  -1.848  21.660  1.00 40.32  ? 488  ASP A N   1 
ATOM   3778 C CA  . ASP A 1 488 ? 11.103  -1.580  20.861  1.00 44.30  ? 488  ASP A CA  1 
ATOM   3779 C C   . ASP A 1 488 ? 10.530  -0.188  21.188  1.00 37.48  ? 488  ASP A C   1 
ATOM   3780 O O   . ASP A 1 488 ? 10.114  0.040   22.306  1.00 40.24  ? 488  ASP A O   1 
ATOM   3781 C CB  . ASP A 1 488 ? 10.060  -2.690  21.114  1.00 41.59  ? 488  ASP A CB  1 
ATOM   3782 C CG  . ASP A 1 488 ? 8.809   -2.536  20.265  1.00 49.23  ? 488  ASP A CG  1 
ATOM   3783 O OD1 . ASP A 1 488 ? 8.608   -1.457  19.680  1.00 53.40  ? 488  ASP A OD1 1 
ATOM   3784 O OD2 . ASP A 1 488 ? 8.007   -3.497  20.179  1.00 55.18  ? 488  ASP A OD2 1 
ATOM   3785 N N   . PRO A 1 489 ? 10.501  0.741   20.209  1.00 43.38  ? 489  PRO A N   1 
ATOM   3786 C CA  . PRO A 1 489 ? 10.075  2.101   20.593  1.00 38.67  ? 489  PRO A CA  1 
ATOM   3787 C C   . PRO A 1 489 ? 8.590   2.166   20.986  1.00 46.04  ? 489  PRO A C   1 
ATOM   3788 O O   . PRO A 1 489 ? 8.155   3.138   21.603  1.00 49.61  ? 489  PRO A O   1 
ATOM   3789 C CB  . PRO A 1 489 ? 10.318  2.947   19.331  1.00 34.33  ? 489  PRO A CB  1 
ATOM   3790 C CG  . PRO A 1 489 ? 10.669  1.985   18.208  1.00 38.18  ? 489  PRO A CG  1 
ATOM   3791 C CD  . PRO A 1 489 ? 10.779  0.591   18.761  1.00 39.72  ? 489  PRO A CD  1 
ATOM   3792 N N   . ASN A 1 490 ? 7.823   1.145   20.630  1.00 45.69  ? 490  ASN A N   1 
ATOM   3793 C CA  . ASN A 1 490 ? 6.373   1.176   20.840  1.00 49.03  ? 490  ASN A CA  1 
ATOM   3794 C C   . ASN A 1 490 ? 6.007   0.966   22.300  1.00 51.93  ? 490  ASN A C   1 
ATOM   3795 O O   . ASN A 1 490 ? 6.701   0.250   23.021  1.00 56.90  ? 490  ASN A O   1 
ATOM   3796 C CB  . ASN A 1 490 ? 5.670   0.116   19.967  1.00 38.49  ? 490  ASN A CB  1 
ATOM   3797 C CG  . ASN A 1 490 ? 5.894   0.342   18.481  1.00 40.92  ? 490  ASN A CG  1 
ATOM   3798 O OD1 . ASN A 1 490 ? 5.409   1.330   17.897  1.00 46.55  ? 490  ASN A OD1 1 
ATOM   3799 N ND2 . ASN A 1 490 ? 6.639   -0.560  17.859  1.00 34.42  ? 490  ASN A ND2 1 
ATOM   3800 N N   . ASP A 1 491 ? 4.928   1.605   22.731  1.00 61.96  ? 491  ASP A N   1 
ATOM   3801 C CA  . ASP A 1 491 ? 4.357   1.378   24.058  1.00 76.94  ? 491  ASP A CA  1 
ATOM   3802 C C   . ASP A 1 491 ? 3.317   0.246   24.018  1.00 80.53  ? 491  ASP A C   1 
ATOM   3803 O O   . ASP A 1 491 ? 2.353   0.315   23.260  1.00 79.50  ? 491  ASP A O   1 
ATOM   3804 C CB  . ASP A 1 491 ? 3.715   2.672   24.566  1.00 91.61  ? 491  ASP A CB  1 
ATOM   3805 C CG  . ASP A 1 491 ? 3.226   2.565   26.003  1.00 103.40 ? 491  ASP A CG  1 
ATOM   3806 O OD1 . ASP A 1 491 ? 2.846   3.616   26.572  1.00 105.67 ? 491  ASP A OD1 1 
ATOM   3807 O OD2 . ASP A 1 491 ? 3.221   1.442   26.564  1.00 106.91 ? 491  ASP A OD2 1 
ATOM   3808 N N   . PRO A 1 492 ? 3.521   -0.810  24.826  1.00 88.94  ? 492  PRO A N   1 
ATOM   3809 C CA  . PRO A 1 492 ? 2.614   -1.977  24.867  1.00 90.78  ? 492  PRO A CA  1 
ATOM   3810 C C   . PRO A 1 492 ? 1.142   -1.645  25.155  1.00 89.59  ? 492  PRO A C   1 
ATOM   3811 O O   . PRO A 1 492 ? 0.768   -1.334  26.288  1.00 88.27  ? 492  PRO A O   1 
ATOM   3812 C CB  . PRO A 1 492 ? 3.196   -2.833  25.992  1.00 89.58  ? 492  PRO A CB  1 
ATOM   3813 C CG  . PRO A 1 492 ? 4.642   -2.465  26.029  1.00 90.97  ? 492  PRO A CG  1 
ATOM   3814 C CD  . PRO A 1 492 ? 4.721   -1.008  25.661  1.00 87.99  ? 492  PRO A CD  1 
ATOM   3815 N N   . SER A 1 497 ? -2.382  4.409   19.904  1.00 93.91  ? 497  SER A N   1 
ATOM   3816 C CA  . SER A 1 497 ? -1.498  5.115   18.980  1.00 90.59  ? 497  SER A CA  1 
ATOM   3817 C C   . SER A 1 497 ? -1.011  4.218   17.840  1.00 84.82  ? 497  SER A C   1 
ATOM   3818 O O   . SER A 1 497 ? -0.889  2.997   18.003  1.00 82.86  ? 497  SER A O   1 
ATOM   3819 C CB  . SER A 1 497 ? -0.290  5.690   19.725  1.00 89.78  ? 497  SER A CB  1 
ATOM   3820 O OG  . SER A 1 497 ? -0.641  6.100   21.035  1.00 94.17  ? 497  SER A OG  1 
ATOM   3821 N N   . PRO A 1 498 ? -0.721  4.831   16.680  1.00 78.16  ? 498  PRO A N   1 
ATOM   3822 C CA  . PRO A 1 498 ? -0.201  4.106   15.515  1.00 72.55  ? 498  PRO A CA  1 
ATOM   3823 C C   . PRO A 1 498 ? 1.123   3.439   15.881  1.00 67.31  ? 498  PRO A C   1 
ATOM   3824 O O   . PRO A 1 498 ? 1.850   3.978   16.715  1.00 67.76  ? 498  PRO A O   1 
ATOM   3825 C CB  . PRO A 1 498 ? 0.022   5.214   14.477  1.00 71.64  ? 498  PRO A CB  1 
ATOM   3826 C CG  . PRO A 1 498 ? -0.811  6.372   14.947  1.00 72.25  ? 498  PRO A CG  1 
ATOM   3827 C CD  . PRO A 1 498 ? -0.822  6.280   16.438  1.00 74.05  ? 498  PRO A CD  1 
ATOM   3828 N N   . GLN A 1 499 ? 1.412   2.286   15.284  1.00 63.14  ? 499  GLN A N   1 
ATOM   3829 C CA  . GLN A 1 499 ? 2.602   1.505   15.608  1.00 57.16  ? 499  GLN A CA  1 
ATOM   3830 C C   . GLN A 1 499 ? 3.793   1.861   14.728  1.00 56.65  ? 499  GLN A C   1 
ATOM   3831 O O   . GLN A 1 499 ? 3.643   2.338   13.611  1.00 53.04  ? 499  GLN A O   1 
ATOM   3832 C CB  . GLN A 1 499 ? 2.320   0.007   15.480  1.00 60.52  ? 499  GLN A CB  1 
ATOM   3833 C CG  . GLN A 1 499 ? 1.325   -0.525  16.504  1.00 64.84  ? 499  GLN A CG  1 
ATOM   3834 C CD  . GLN A 1 499 ? 1.859   -0.418  17.928  1.00 69.30  ? 499  GLN A CD  1 
ATOM   3835 O OE1 . GLN A 1 499 ? 1.382   0.402   18.732  1.00 70.52  ? 499  GLN A OE1 1 
ATOM   3836 N NE2 . GLN A 1 499 ? 2.870   -1.233  18.240  1.00 62.45  ? 499  GLN A NE2 1 
ATOM   3837 N N   . TRP A 1 500 ? 4.984   1.616   15.258  1.00 51.66  ? 500  TRP A N   1 
ATOM   3838 C CA  . TRP A 1 500 ? 6.212   1.821   14.534  1.00 44.27  ? 500  TRP A CA  1 
ATOM   3839 C C   . TRP A 1 500 ? 6.736   0.443   14.109  1.00 45.96  ? 500  TRP A C   1 
ATOM   3840 O O   . TRP A 1 500 ? 7.302   -0.309  14.930  1.00 47.72  ? 500  TRP A O   1 
ATOM   3841 C CB  . TRP A 1 500 ? 7.190   2.552   15.454  1.00 40.69  ? 500  TRP A CB  1 
ATOM   3842 C CG  . TRP A 1 500 ? 8.484   3.021   14.846  1.00 43.13  ? 500  TRP A CG  1 
ATOM   3843 C CD1 . TRP A 1 500 ? 9.117   2.519   13.741  1.00 48.10  ? 500  TRP A CD1 1 
ATOM   3844 C CD2 . TRP A 1 500 ? 9.339   4.040   15.371  1.00 38.99  ? 500  TRP A CD2 1 
ATOM   3845 N NE1 . TRP A 1 500 ? 10.305  3.186   13.530  1.00 45.45  ? 500  TRP A NE1 1 
ATOM   3846 C CE2 . TRP A 1 500 ? 10.465  4.124   14.522  1.00 46.02  ? 500  TRP A CE2 1 
ATOM   3847 C CE3 . TRP A 1 500 ? 9.257   4.901   16.472  1.00 35.52  ? 500  TRP A CE3 1 
ATOM   3848 C CZ2 . TRP A 1 500 ? 11.504  5.041   14.741  1.00 39.21  ? 500  TRP A CZ2 1 
ATOM   3849 C CZ3 . TRP A 1 500 ? 10.285  5.815   16.687  1.00 37.51  ? 500  TRP A CZ3 1 
ATOM   3850 C CH2 . TRP A 1 500 ? 11.397  5.872   15.828  1.00 36.85  ? 500  TRP A CH2 1 
ATOM   3851 N N   . PRO A 1 501 ? 6.539   0.086   12.828  1.00 36.95  ? 501  PRO A N   1 
ATOM   3852 C CA  . PRO A 1 501 ? 6.987   -1.247  12.422  1.00 41.70  ? 501  PRO A CA  1 
ATOM   3853 C C   . PRO A 1 501 ? 8.493   -1.268  12.278  1.00 41.21  ? 501  PRO A C   1 
ATOM   3854 O O   . PRO A 1 501 ? 9.074   -0.236  11.946  1.00 40.99  ? 501  PRO A O   1 
ATOM   3855 C CB  . PRO A 1 501 ? 6.371   -1.424  11.035  1.00 43.63  ? 501  PRO A CB  1 
ATOM   3856 C CG  . PRO A 1 501 ? 6.133   -0.024  10.527  1.00 40.43  ? 501  PRO A CG  1 
ATOM   3857 C CD  . PRO A 1 501 ? 6.095   0.909   11.694  1.00 35.30  ? 501  PRO A CD  1 
ATOM   3858 N N   . PRO A 1 502 ? 9.113   -2.427  12.491  1.00 40.41  ? 502  PRO A N   1 
ATOM   3859 C CA  . PRO A 1 502 ? 10.529  -2.636  12.165  1.00 36.00  ? 502  PRO A CA  1 
ATOM   3860 C C   . PRO A 1 502 ? 10.835  -2.418  10.677  1.00 46.92  ? 502  PRO A C   1 
ATOM   3861 O O   . PRO A 1 502 ? 10.024  -2.773  9.827   1.00 50.07  ? 502  PRO A O   1 
ATOM   3862 C CB  . PRO A 1 502 ? 10.746  -4.101  12.483  1.00 37.26  ? 502  PRO A CB  1 
ATOM   3863 C CG  . PRO A 1 502 ? 9.670   -4.458  13.495  1.00 41.92  ? 502  PRO A CG  1 
ATOM   3864 C CD  . PRO A 1 502 ? 8.477   -3.640  13.037  1.00 42.44  ? 502  PRO A CD  1 
ATOM   3865 N N   . TYR A 1 503 ? 11.992  -1.819  10.382  1.00 45.29  ? 503  TYR A N   1 
ATOM   3866 C CA  . TYR A 1 503 ? 12.517  -1.724  9.030   1.00 39.30  ? 503  TYR A CA  1 
ATOM   3867 C C   . TYR A 1 503 ? 12.998  -3.084  8.533   1.00 40.32  ? 503  TYR A C   1 
ATOM   3868 O O   . TYR A 1 503 ? 13.754  -3.746  9.222   1.00 44.59  ? 503  TYR A O   1 
ATOM   3869 C CB  . TYR A 1 503 ? 13.693  -0.744  9.020   1.00 32.44  ? 503  TYR A CB  1 
ATOM   3870 C CG  . TYR A 1 503 ? 14.231  -0.443  7.630   1.00 34.86  ? 503  TYR A CG  1 
ATOM   3871 C CD1 . TYR A 1 503 ? 15.225  -1.229  7.058   1.00 33.73  ? 503  TYR A CD1 1 
ATOM   3872 C CD2 . TYR A 1 503 ? 13.752  0.636   6.898   1.00 35.60  ? 503  TYR A CD2 1 
ATOM   3873 C CE1 . TYR A 1 503 ? 15.728  -0.945  5.792   1.00 35.78  ? 503  TYR A CE1 1 
ATOM   3874 C CE2 . TYR A 1 503 ? 14.237  0.917   5.633   1.00 39.92  ? 503  TYR A CE2 1 
ATOM   3875 C CZ  . TYR A 1 503 ? 15.238  0.129   5.090   1.00 39.53  ? 503  TYR A CZ  1 
ATOM   3876 O OH  . TYR A 1 503 ? 15.731  0.416   3.832   1.00 44.93  ? 503  TYR A OH  1 
ATOM   3877 N N   . THR A 1 504 ? 12.582  -3.480  7.331   1.00 45.06  ? 504  THR A N   1 
ATOM   3878 C CA  . THR A 1 504 ? 12.968  -4.764  6.727   1.00 50.68  ? 504  THR A CA  1 
ATOM   3879 C C   . THR A 1 504 ? 13.427  -4.549  5.289   1.00 50.15  ? 504  THR A C   1 
ATOM   3880 O O   . THR A 1 504 ? 13.026  -3.581  4.652   1.00 42.11  ? 504  THR A O   1 
ATOM   3881 C CB  . THR A 1 504 ? 11.775  -5.758  6.663   1.00 50.54  ? 504  THR A CB  1 
ATOM   3882 O OG1 . THR A 1 504 ? 10.704  -5.158  5.927   1.00 50.06  ? 504  THR A OG1 1 
ATOM   3883 C CG2 . THR A 1 504 ? 11.283  -6.133  8.055   1.00 41.53  ? 504  THR A CG2 1 
ATOM   3884 N N   . THR A 1 505 ? 14.265  -5.441  4.768   1.00 50.95  ? 505  THR A N   1 
ATOM   3885 C CA  . THR A 1 505 ? 14.692  -5.307  3.378   1.00 51.49  ? 505  THR A CA  1 
ATOM   3886 C C   . THR A 1 505 ? 13.506  -5.335  2.401   1.00 53.76  ? 505  THR A C   1 
ATOM   3887 O O   . THR A 1 505 ? 13.503  -4.611  1.398   1.00 55.82  ? 505  THR A O   1 
ATOM   3888 C CB  . THR A 1 505 ? 15.694  -6.394  2.977   1.00 56.07  ? 505  THR A CB  1 
ATOM   3889 O OG1 . THR A 1 505 ? 15.173  -7.677  3.330   1.00 60.20  ? 505  THR A OG1 1 
ATOM   3890 C CG2 . THR A 1 505 ? 17.019  -6.183  3.693   1.00 60.47  ? 505  THR A CG2 1 
ATOM   3891 N N   . ALA A 1 506 ? 12.494  -6.145  2.703   1.00 47.02  ? 506  ALA A N   1 
ATOM   3892 C CA  . ALA A 1 506 ? 11.357  -6.304  1.801   1.00 51.32  ? 506  ALA A CA  1 
ATOM   3893 C C   . ALA A 1 506 ? 10.438  -5.097  1.782   1.00 59.00  ? 506  ALA A C   1 
ATOM   3894 O O   . ALA A 1 506 ? 10.110  -4.605  0.707   1.00 70.14  ? 506  ALA A O   1 
ATOM   3895 C CB  . ALA A 1 506 ? 10.547  -7.559  2.143   1.00 45.26  ? 506  ALA A CB  1 
ATOM   3896 N N   . ALA A 1 507 ? 10.006  -4.633  2.956   1.00 52.87  ? 507  ALA A N   1 
ATOM   3897 C CA  . ALA A 1 507 ? 9.011   -3.554  3.033   1.00 48.35  ? 507  ALA A CA  1 
ATOM   3898 C C   . ALA A 1 507 ? 9.619   -2.168  3.221   1.00 45.33  ? 507  ALA A C   1 
ATOM   3899 O O   . ALA A 1 507 ? 8.981   -1.162  2.916   1.00 49.37  ? 507  ALA A O   1 
ATOM   3900 C CB  . ALA A 1 507 ? 8.010   -3.827  4.148   1.00 44.87  ? 507  ALA A CB  1 
ATOM   3901 N N   . GLN A 1 508 ? 10.820  -2.114  3.781   1.00 38.30  ? 508  GLN A N   1 
ATOM   3902 C CA  . GLN A 1 508 ? 11.542  -0.847  3.965   1.00 40.18  ? 508  GLN A CA  1 
ATOM   3903 C C   . GLN A 1 508 ? 10.721  0.228   4.655   1.00 37.77  ? 508  GLN A C   1 
ATOM   3904 O O   . GLN A 1 508 ? 10.663  1.372   4.199   1.00 42.61  ? 508  GLN A O   1 
ATOM   3905 C CB  . GLN A 1 508 ? 12.035  -0.302  2.619   1.00 43.53  ? 508  GLN A CB  1 
ATOM   3906 C CG  . GLN A 1 508 ? 13.003  -1.219  1.899   1.00 54.02  ? 508  GLN A CG  1 
ATOM   3907 C CD  . GLN A 1 508 ? 13.225  -0.812  0.451   1.00 58.83  ? 508  GLN A CD  1 
ATOM   3908 O OE1 . GLN A 1 508 ? 13.627  0.319   0.170   1.00 49.02  ? 508  GLN A OE1 1 
ATOM   3909 N NE2 . GLN A 1 508 ? 12.963  -1.736  -0.475  1.00 59.04  ? 508  GLN A NE2 1 
ATOM   3910 N N   . GLN A 1 509 ? 10.100  -0.124  5.760   1.00 39.02  ? 509  GLN A N   1 
ATOM   3911 C CA  . GLN A 1 509 ? 9.231   0.809   6.449   1.00 43.05  ? 509  GLN A CA  1 
ATOM   3912 C C   . GLN A 1 509 ? 9.978   1.693   7.456   1.00 43.65  ? 509  GLN A C   1 
ATOM   3913 O O   . GLN A 1 509 ? 10.867  1.230   8.181   1.00 43.56  ? 509  GLN A O   1 
ATOM   3914 C CB  . GLN A 1 509 ? 8.110   0.045   7.154   1.00 46.33  ? 509  GLN A CB  1 
ATOM   3915 C CG  . GLN A 1 509 ? 7.132   -0.621  6.231   1.00 48.60  ? 509  GLN A CG  1 
ATOM   3916 C CD  . GLN A 1 509 ? 6.162   -1.535  6.980   1.00 51.73  ? 509  GLN A CD  1 
ATOM   3917 O OE1 . GLN A 1 509 ? 6.511   -2.659  7.371   1.00 49.46  ? 509  GLN A OE1 1 
ATOM   3918 N NE2 . GLN A 1 509 ? 4.948   -1.053  7.188   1.00 50.14  ? 509  GLN A NE2 1 
ATOM   3919 N N   . TYR A 1 510 ? 9.593   2.962   7.497   1.00 34.36  ? 510  TYR A N   1 
ATOM   3920 C CA  . TYR A 1 510 ? 10.077  3.880   8.512   1.00 39.86  ? 510  TYR A CA  1 
ATOM   3921 C C   . TYR A 1 510 ? 8.963   4.837   8.861   1.00 41.66  ? 510  TYR A C   1 
ATOM   3922 O O   . TYR A 1 510 ? 7.994   4.937   8.126   1.00 50.59  ? 510  TYR A O   1 
ATOM   3923 C CB  . TYR A 1 510 ? 11.281  4.681   7.977   1.00 32.66  ? 510  TYR A CB  1 
ATOM   3924 C CG  . TYR A 1 510 ? 10.958  5.562   6.784   1.00 34.15  ? 510  TYR A CG  1 
ATOM   3925 C CD1 . TYR A 1 510 ? 10.876  5.038   5.487   1.00 33.64  ? 510  TYR A CD1 1 
ATOM   3926 C CD2 . TYR A 1 510 ? 10.732  6.925   6.953   1.00 37.11  ? 510  TYR A CD2 1 
ATOM   3927 C CE1 . TYR A 1 510 ? 10.587  5.863   4.389   1.00 34.71  ? 510  TYR A CE1 1 
ATOM   3928 C CE2 . TYR A 1 510 ? 10.439  7.756   5.877   1.00 31.73  ? 510  TYR A CE2 1 
ATOM   3929 C CZ  . TYR A 1 510 ? 10.375  7.235   4.603   1.00 38.49  ? 510  TYR A CZ  1 
ATOM   3930 O OH  . TYR A 1 510 ? 10.093  8.106   3.559   1.00 39.89  ? 510  TYR A OH  1 
ATOM   3931 N N   . VAL A 1 511 ? 9.083   5.552   9.973   1.00 40.99  ? 511  VAL A N   1 
ATOM   3932 C CA  . VAL A 1 511 ? 8.045   6.503   10.326  1.00 34.06  ? 511  VAL A CA  1 
ATOM   3933 C C   . VAL A 1 511 ? 8.531   7.939   10.261  1.00 43.14  ? 511  VAL A C   1 
ATOM   3934 O O   . VAL A 1 511 ? 9.760   8.220   10.310  1.00 41.09  ? 511  VAL A O   1 
ATOM   3935 C CB  . VAL A 1 511 ? 7.468   6.228   11.719  1.00 37.17  ? 511  VAL A CB  1 
ATOM   3936 C CG1 . VAL A 1 511 ? 6.772   4.856   11.750  1.00 36.66  ? 511  VAL A CG1 1 
ATOM   3937 C CG2 . VAL A 1 511 ? 8.555   6.316   12.793  1.00 36.21  ? 511  VAL A CG2 1 
ATOM   3938 N N   . SER A 1 512 ? 7.561   8.835   10.131  1.00 39.66  ? 512  SER A N   1 
ATOM   3939 C CA  . SER A 1 512 ? 7.781   10.266  10.250  1.00 45.88  ? 512  SER A CA  1 
ATOM   3940 C C   . SER A 1 512 ? 7.575   10.735  11.698  1.00 44.21  ? 512  SER A C   1 
ATOM   3941 O O   . SER A 1 512 ? 6.501   10.531  12.295  1.00 38.13  ? 512  SER A O   1 
ATOM   3942 C CB  . SER A 1 512 ? 6.812   11.026  9.333   1.00 48.29  ? 512  SER A CB  1 
ATOM   3943 O OG  . SER A 1 512 ? 5.460   10.678  9.612   1.00 49.74  ? 512  SER A OG  1 
ATOM   3944 N N   . LEU A 1 513 ? 8.599   11.367  12.258  1.00 37.69  ? 513  LEU A N   1 
ATOM   3945 C CA  . LEU A 1 513 ? 8.462   12.039  13.545  1.00 37.09  ? 513  LEU A CA  1 
ATOM   3946 C C   . LEU A 1 513 ? 8.165   13.527  13.351  1.00 38.34  ? 513  LEU A C   1 
ATOM   3947 O O   . LEU A 1 513 ? 9.057   14.311  12.966  1.00 42.22  ? 513  LEU A O   1 
ATOM   3948 C CB  . LEU A 1 513 ? 9.729   11.866  14.394  1.00 37.04  ? 513  LEU A CB  1 
ATOM   3949 C CG  . LEU A 1 513 ? 10.149  10.411  14.623  1.00 36.93  ? 513  LEU A CG  1 
ATOM   3950 C CD1 . LEU A 1 513 ? 11.436  10.315  15.428  1.00 30.76  ? 513  LEU A CD1 1 
ATOM   3951 C CD2 . LEU A 1 513 ? 8.997   9.612   15.282  1.00 35.93  ? 513  LEU A CD2 1 
ATOM   3952 N N   . ASN A 1 514 ? 6.932   13.919  13.650  1.00 40.28  ? 514  ASN A N   1 
ATOM   3953 C CA  . ASN A 1 514 ? 6.519   15.317  13.616  1.00 40.23  ? 514  ASN A CA  1 
ATOM   3954 C C   . ASN A 1 514 ? 5.336   15.532  14.558  1.00 43.41  ? 514  ASN A C   1 
ATOM   3955 O O   . ASN A 1 514 ? 5.015   14.633  15.333  1.00 50.08  ? 514  ASN A O   1 
ATOM   3956 C CB  . ASN A 1 514 ? 6.194   15.783  12.191  1.00 38.21  ? 514  ASN A CB  1 
ATOM   3957 C CG  . ASN A 1 514 ? 5.148   14.910  11.504  1.00 44.81  ? 514  ASN A CG  1 
ATOM   3958 O OD1 . ASN A 1 514 ? 4.108   14.553  12.093  1.00 48.09  ? 514  ASN A OD1 1 
ATOM   3959 N ND2 . ASN A 1 514 ? 5.412   14.570  10.241  1.00 42.71  ? 514  ASN A ND2 1 
ATOM   3960 N N   . LEU A 1 515 ? 4.710   16.709  14.521  1.00 37.08  ? 515  LEU A N   1 
ATOM   3961 C CA  . LEU A 1 515 ? 3.616   17.028  15.473  1.00 43.52  ? 515  LEU A CA  1 
ATOM   3962 C C   . LEU A 1 515 ? 2.412   16.122  15.317  1.00 39.60  ? 515  LEU A C   1 
ATOM   3963 O O   . LEU A 1 515 ? 1.690   15.911  16.261  1.00 43.21  ? 515  LEU A O   1 
ATOM   3964 C CB  . LEU A 1 515 ? 3.159   18.487  15.372  1.00 34.77  ? 515  LEU A CB  1 
ATOM   3965 C CG  . LEU A 1 515 ? 4.314   19.485  15.488  1.00 48.36  ? 515  LEU A CG  1 
ATOM   3966 C CD1 . LEU A 1 515 ? 3.798   20.926  15.537  1.00 46.49  ? 515  LEU A CD1 1 
ATOM   3967 C CD2 . LEU A 1 515 ? 5.254   19.171  16.694  1.00 36.65  ? 515  LEU A CD2 1 
ATOM   3968 N N   . LYS A 1 516 ? 2.232   15.564  14.129  1.00 45.19  ? 516  LYS A N   1 
ATOM   3969 C CA  . LYS A 1 516 ? 1.132   14.638  13.850  1.00 48.21  ? 516  LYS A CA  1 
ATOM   3970 C C   . LYS A 1 516 ? 1.465   13.223  14.323  1.00 47.26  ? 516  LYS A C   1 
ATOM   3971 O O   . LYS A 1 516 ? 2.614   12.918  14.601  1.00 50.42  ? 516  LYS A O   1 
ATOM   3972 C CB  . LYS A 1 516 ? 0.845   14.644  12.353  1.00 48.65  ? 516  LYS A CB  1 
ATOM   3973 C CG  . LYS A 1 516 ? 0.413   16.014  11.827  1.00 51.52  ? 516  LYS A CG  1 
ATOM   3974 C CD  . LYS A 1 516 ? 0.656   16.132  10.321  1.00 62.57  ? 516  LYS A CD  1 
ATOM   3975 C CE  . LYS A 1 516 ? 0.026   14.975  9.530   1.00 74.60  ? 516  LYS A CE  1 
ATOM   3976 N NZ  . LYS A 1 516 ? 0.272   15.089  8.032   1.00 80.44  ? 516  LYS A NZ  1 
ATOM   3977 N N   . PRO A 1 517 ? 0.456   12.353  14.433  1.00 48.79  ? 517  PRO A N   1 
ATOM   3978 C CA  . PRO A 1 517 ? 0.749   10.998  14.923  1.00 39.13  ? 517  PRO A CA  1 
ATOM   3979 C C   . PRO A 1 517 ? 1.575   10.241  13.911  1.00 43.02  ? 517  PRO A C   1 
ATOM   3980 O O   . PRO A 1 517 ? 1.547   10.590  12.724  1.00 43.69  ? 517  PRO A O   1 
ATOM   3981 C CB  . PRO A 1 517 ? -0.658  10.364  15.061  1.00 40.27  ? 517  PRO A CB  1 
ATOM   3982 C CG  . PRO A 1 517 ? -1.582  11.585  15.290  1.00 34.46  ? 517  PRO A CG  1 
ATOM   3983 C CD  . PRO A 1 517 ? -1.003  12.624  14.360  1.00 42.18  ? 517  PRO A CD  1 
ATOM   3984 N N   . LEU A 1 518 ? 2.303   9.226   14.372  1.00 46.39  ? 518  LEU A N   1 
ATOM   3985 C CA  . LEU A 1 518 ? 3.210   8.473   13.513  1.00 46.73  ? 518  LEU A CA  1 
ATOM   3986 C C   . LEU A 1 518 ? 2.555   8.126   12.190  1.00 46.29  ? 518  LEU A C   1 
ATOM   3987 O O   . LEU A 1 518 ? 1.467   7.559   12.170  1.00 53.40  ? 518  LEU A O   1 
ATOM   3988 C CB  . LEU A 1 518 ? 3.603   7.152   14.169  1.00 40.18  ? 518  LEU A CB  1 
ATOM   3989 C CG  . LEU A 1 518 ? 4.688   7.137   15.226  1.00 45.76  ? 518  LEU A CG  1 
ATOM   3990 C CD1 . LEU A 1 518 ? 5.206   5.717   15.345  1.00 42.65  ? 518  LEU A CD1 1 
ATOM   3991 C CD2 . LEU A 1 518 ? 5.813   8.105   14.887  1.00 39.41  ? 518  LEU A CD2 1 
ATOM   3992 N N   . GLU A 1 519 ? 3.230   8.425   11.093  1.00 42.75  ? 519  GLU A N   1 
ATOM   3993 C CA  . GLU A 1 519 ? 2.798   7.938   9.796   1.00 44.44  ? 519  GLU A CA  1 
ATOM   3994 C C   . GLU A 1 519 ? 3.857   7.008   9.214   1.00 48.14  ? 519  GLU A C   1 
ATOM   3995 O O   . GLU A 1 519 ? 5.034   7.346   9.202   1.00 50.37  ? 519  GLU A O   1 
ATOM   3996 C CB  . GLU A 1 519 ? 2.529   9.111   8.859   1.00 48.70  ? 519  GLU A CB  1 
ATOM   3997 C CG  . GLU A 1 519 ? 2.752   8.786   7.394   1.00 62.14  ? 519  GLU A CG  1 
ATOM   3998 C CD  . GLU A 1 519 ? 2.446   9.969   6.495   1.00 70.43  ? 519  GLU A CD  1 
ATOM   3999 O OE1 . GLU A 1 519 ? 1.397   10.617  6.756   1.00 80.07  ? 519  GLU A OE1 1 
ATOM   4000 O OE2 . GLU A 1 519 ? 3.242   10.250  5.553   1.00 63.18  ? 519  GLU A OE2 1 
ATOM   4001 N N   . VAL A 1 520 ? 3.449   5.838   8.745   1.00 43.80  ? 520  VAL A N   1 
ATOM   4002 C CA  . VAL A 1 520 ? 4.386   4.869   8.187   1.00 42.70  ? 520  VAL A CA  1 
ATOM   4003 C C   . VAL A 1 520 ? 4.635   5.125   6.704   1.00 44.51  ? 520  VAL A C   1 
ATOM   4004 O O   . VAL A 1 520 ? 3.700   5.406   5.949   1.00 45.92  ? 520  VAL A O   1 
ATOM   4005 C CB  . VAL A 1 520 ? 3.873   3.419   8.380   1.00 44.11  ? 520  VAL A CB  1 
ATOM   4006 C CG1 . VAL A 1 520 ? 4.675   2.445   7.533   1.00 36.74  ? 520  VAL A CG1 1 
ATOM   4007 C CG2 . VAL A 1 520 ? 3.919   3.032   9.852   1.00 41.57  ? 520  VAL A CG2 1 
ATOM   4008 N N   . ARG A 1 521 ? 5.899   5.048   6.289   1.00 38.19  ? 521  ARG A N   1 
ATOM   4009 C CA  . ARG A 1 521 ? 6.275   5.264   4.895   1.00 40.12  ? 521  ARG A CA  1 
ATOM   4010 C C   . ARG A 1 521 ? 7.167   4.129   4.425   1.00 39.55  ? 521  ARG A C   1 
ATOM   4011 O O   . ARG A 1 521 ? 7.655   3.328   5.223   1.00 41.28  ? 521  ARG A O   1 
ATOM   4012 C CB  . ARG A 1 521 ? 7.010   6.609   4.718   1.00 46.06  ? 521  ARG A CB  1 
ATOM   4013 C CG  . ARG A 1 521 ? 6.154   7.790   5.111   1.00 45.29  ? 521  ARG A CG  1 
ATOM   4014 C CD  . ARG A 1 521 ? 6.834   9.110   4.822   1.00 42.75  ? 521  ARG A CD  1 
ATOM   4015 N NE  . ARG A 1 521 ? 6.079   10.217  5.412   1.00 38.79  ? 521  ARG A NE  1 
ATOM   4016 C CZ  . ARG A 1 521 ? 6.588   11.420  5.658   1.00 42.14  ? 521  ARG A CZ  1 
ATOM   4017 N NH1 . ARG A 1 521 ? 7.871   11.674  5.380   1.00 36.29  ? 521  ARG A NH1 1 
ATOM   4018 N NH2 . ARG A 1 521 ? 5.836   12.354  6.233   1.00 36.70  ? 521  ARG A NH2 1 
ATOM   4019 N N   . ARG A 1 522 ? 7.385   4.049   3.126   1.00 41.47  ? 522  ARG A N   1 
ATOM   4020 C CA  . ARG A 1 522 ? 8.165   2.941   2.598   1.00 51.32  ? 522  ARG A CA  1 
ATOM   4021 C C   . ARG A 1 522 ? 9.275   3.466   1.690   1.00 49.87  ? 522  ARG A C   1 
ATOM   4022 O O   . ARG A 1 522 ? 9.053   4.362   0.873   1.00 47.61  ? 522  ARG A O   1 
ATOM   4023 C CB  . ARG A 1 522 ? 7.261   1.956   1.844   1.00 54.68  ? 522  ARG A CB  1 
ATOM   4024 C CG  . ARG A 1 522 ? 6.124   1.347   2.693   1.00 65.47  ? 522  ARG A CG  1 
ATOM   4025 C CD  . ARG A 1 522 ? 5.529   0.101   2.026   1.00 76.55  ? 522  ARG A CD  1 
ATOM   4026 N NE  . ARG A 1 522 ? 6.532   -0.561  1.185   1.00 91.51  ? 522  ARG A NE  1 
ATOM   4027 C CZ  . ARG A 1 522 ? 6.353   -1.699  0.513   1.00 100.16 ? 522  ARG A CZ  1 
ATOM   4028 N NH1 . ARG A 1 522 ? 5.192   -2.346  0.575   1.00 102.58 ? 522  ARG A NH1 1 
ATOM   4029 N NH2 . ARG A 1 522 ? 7.347   -2.194  -0.224  1.00 98.76  ? 522  ARG A NH2 1 
ATOM   4030 N N   . GLY A 1 523 ? 10.473  2.919   1.849   1.00 43.05  ? 523  GLY A N   1 
ATOM   4031 C CA  . GLY A 1 523 ? 11.577  3.281   0.984   1.00 39.48  ? 523  GLY A CA  1 
ATOM   4032 C C   . GLY A 1 523 ? 12.215  4.583   1.392   1.00 42.53  ? 523  GLY A C   1 
ATOM   4033 O O   . GLY A 1 523 ? 11.632  5.645   1.266   1.00 49.76  ? 523  GLY A O   1 
ATOM   4034 N N   . LEU A 1 524 ? 13.436  4.497   1.888   1.00 50.21  ? 524  LEU A N   1 
ATOM   4035 C CA  . LEU A 1 524 ? 14.185  5.677   2.292   1.00 49.65  ? 524  LEU A CA  1 
ATOM   4036 C C   . LEU A 1 524 ? 14.937  6.197   1.075   1.00 46.02  ? 524  LEU A C   1 
ATOM   4037 O O   . LEU A 1 524 ? 16.015  5.699   0.775   1.00 48.85  ? 524  LEU A O   1 
ATOM   4038 C CB  . LEU A 1 524 ? 15.164  5.261   3.381   1.00 53.82  ? 524  LEU A CB  1 
ATOM   4039 C CG  . LEU A 1 524 ? 15.559  6.254   4.469   1.00 61.70  ? 524  LEU A CG  1 
ATOM   4040 C CD1 . LEU A 1 524 ? 14.790  7.576   4.353   1.00 62.75  ? 524  LEU A CD1 1 
ATOM   4041 C CD2 . LEU A 1 524 ? 15.356  5.581   5.835   1.00 62.65  ? 524  LEU A CD2 1 
ATOM   4042 N N   . ARG A 1 525 ? 14.369  7.175   0.368   1.00 38.97  ? 525  ARG A N   1 
ATOM   4043 C CA  . ARG A 1 525 ? 14.924  7.618   -0.920  1.00 42.45  ? 525  ARG A CA  1 
ATOM   4044 C C   . ARG A 1 525 ? 15.471  6.444   -1.747  1.00 42.36  ? 525  ARG A C   1 
ATOM   4045 O O   . ARG A 1 525 ? 16.631  6.496   -2.215  1.00 35.29  ? 525  ARG A O   1 
ATOM   4046 C CB  . ARG A 1 525 ? 16.087  8.580   -0.713  1.00 40.95  ? 525  ARG A CB  1 
ATOM   4047 C CG  . ARG A 1 525 ? 15.797  9.725   0.171   1.00 50.99  ? 525  ARG A CG  1 
ATOM   4048 C CD  . ARG A 1 525 ? 15.389  10.875  -0.663  1.00 58.54  ? 525  ARG A CD  1 
ATOM   4049 N NE  . ARG A 1 525 ? 16.050  12.098  -0.243  1.00 64.72  ? 525  ARG A NE  1 
ATOM   4050 C CZ  . ARG A 1 525 ? 15.674  12.830  0.795   1.00 64.71  ? 525  ARG A CZ  1 
ATOM   4051 N NH1 . ARG A 1 525 ? 14.648  12.436  1.535   1.00 64.37  ? 525  ARG A NH1 1 
ATOM   4052 N NH2 . ARG A 1 525 ? 16.329  13.954  1.086   1.00 65.97  ? 525  ARG A NH2 1 
ATOM   4053 N N   . ALA A 1 526 ? 14.654  5.414   -1.936  1.00 29.75  ? 526  ALA A N   1 
ATOM   4054 C CA  . ALA A 1 526 ? 15.107  4.163   -2.522  1.00 33.29  ? 526  ALA A CA  1 
ATOM   4055 C C   . ALA A 1 526 ? 15.774  4.345   -3.877  1.00 35.16  ? 526  ALA A C   1 
ATOM   4056 O O   . ALA A 1 526 ? 16.840  3.803   -4.133  1.00 42.25  ? 526  ALA A O   1 
ATOM   4057 C CB  . ALA A 1 526 ? 13.923  3.165   -2.632  1.00 32.67  ? 526  ALA A CB  1 
ATOM   4058 N N   . GLN A 1 527 ? 15.154  5.132   -4.733  1.00 31.20  ? 527  GLN A N   1 
ATOM   4059 C CA  . GLN A 1 527 ? 15.615  5.311   -6.092  1.00 36.44  ? 527  GLN A CA  1 
ATOM   4060 C C   . GLN A 1 527 ? 16.937  6.101   -6.130  1.00 38.92  ? 527  GLN A C   1 
ATOM   4061 O O   . GLN A 1 527 ? 17.926  5.704   -6.750  1.00 42.70  ? 527  GLN A O   1 
ATOM   4062 C CB  . GLN A 1 527 ? 14.488  6.015   -6.878  1.00 46.06  ? 527  GLN A CB  1 
ATOM   4063 C CG  . GLN A 1 527 ? 14.305  5.577   -8.301  1.00 46.52  ? 527  GLN A CG  1 
ATOM   4064 C CD  . GLN A 1 527 ? 14.107  4.061   -8.468  1.00 47.12  ? 527  GLN A CD  1 
ATOM   4065 O OE1 . GLN A 1 527 ? 13.549  3.376   -7.599  1.00 46.61  ? 527  GLN A OE1 1 
ATOM   4066 N NE2 . GLN A 1 527 ? 14.570  3.542   -9.598  1.00 42.11  ? 527  GLN A NE2 1 
ATOM   4067 N N   . THR A 1 528 ? 16.972  7.211   -5.434  1.00 35.57  ? 528  THR A N   1 
ATOM   4068 C CA  . THR A 1 528 ? 18.187  7.998   -5.398  1.00 33.27  ? 528  THR A CA  1 
ATOM   4069 C C   . THR A 1 528 ? 19.309  7.261   -4.642  1.00 35.04  ? 528  THR A C   1 
ATOM   4070 O O   . THR A 1 528 ? 20.478  7.311   -5.037  1.00 34.71  ? 528  THR A O   1 
ATOM   4071 C CB  . THR A 1 528 ? 17.920  9.344   -4.747  1.00 35.71  ? 528  THR A CB  1 
ATOM   4072 O OG1 . THR A 1 528 ? 17.215  10.165  -5.684  1.00 42.43  ? 528  THR A OG1 1 
ATOM   4073 C CG2 . THR A 1 528 ? 19.266  10.047  -4.370  1.00 49.78  ? 528  THR A CG2 1 
ATOM   4074 N N   . CYS A 1 529 ? 18.957  6.537   -3.589  1.00 31.69  ? 529  CYS A N   1 
ATOM   4075 C CA  . CYS A 1 529 ? 19.980  5.826   -2.843  1.00 34.28  ? 529  CYS A CA  1 
ATOM   4076 C C   . CYS A 1 529 ? 20.599  4.648   -3.612  1.00 37.78  ? 529  CYS A C   1 
ATOM   4077 O O   . CYS A 1 529 ? 21.743  4.284   -3.349  1.00 39.97  ? 529  CYS A O   1 
ATOM   4078 C CB  . CYS A 1 529 ? 19.495  5.459   -1.428  1.00 31.24  ? 529  CYS A CB  1 
ATOM   4079 S SG  . CYS A 1 529 ? 19.438  6.957   -0.347  1.00 37.11  ? 529  CYS A SG  1 
ATOM   4080 N N   . ALA A 1 530 ? 19.863  4.074   -4.566  1.00 34.25  ? 530  ALA A N   1 
ATOM   4081 C CA  . ALA A 1 530 ? 20.446  3.078   -5.459  1.00 33.44  ? 530  ALA A CA  1 
ATOM   4082 C C   . ALA A 1 530 ? 21.559  3.699   -6.297  1.00 39.80  ? 530  ALA A C   1 
ATOM   4083 O O   . ALA A 1 530 ? 22.584  3.056   -6.557  1.00 41.42  ? 530  ALA A O   1 
ATOM   4084 C CB  . ALA A 1 530 ? 19.384  2.440   -6.372  1.00 31.03  ? 530  ALA A CB  1 
ATOM   4085 N N   . PHE A 1 531 ? 21.368  4.948   -6.716  1.00 34.72  ? 531  PHE A N   1 
ATOM   4086 C CA  . PHE A 1 531 ? 22.430  5.651   -7.407  1.00 33.34  ? 531  PHE A CA  1 
ATOM   4087 C C   . PHE A 1 531 ? 23.717  5.776   -6.565  1.00 32.83  ? 531  PHE A C   1 
ATOM   4088 O O   . PHE A 1 531 ? 24.803  5.434   -7.027  1.00 34.90  ? 531  PHE A O   1 
ATOM   4089 C CB  . PHE A 1 531 ? 21.944  7.028   -7.843  1.00 37.71  ? 531  PHE A CB  1 
ATOM   4090 C CG  . PHE A 1 531 ? 23.037  7.944   -8.293  1.00 37.95  ? 531  PHE A CG  1 
ATOM   4091 C CD1 . PHE A 1 531 ? 23.528  7.879   -9.594  1.00 40.59  ? 531  PHE A CD1 1 
ATOM   4092 C CD2 . PHE A 1 531 ? 23.569  8.883   -7.423  1.00 42.91  ? 531  PHE A CD2 1 
ATOM   4093 C CE1 . PHE A 1 531 ? 24.525  8.712   -10.027 1.00 39.00  ? 531  PHE A CE1 1 
ATOM   4094 C CE2 . PHE A 1 531 ? 24.593  9.733   -7.852  1.00 42.04  ? 531  PHE A CE2 1 
ATOM   4095 C CZ  . PHE A 1 531 ? 25.063  9.646   -9.160  1.00 42.10  ? 531  PHE A CZ  1 
ATOM   4096 N N   . TRP A 1 532 ? 23.604  6.294   -5.354  1.00 32.09  ? 532  TRP A N   1 
ATOM   4097 C CA  . TRP A 1 532 ? 24.783  6.504   -4.506  1.00 38.91  ? 532  TRP A CA  1 
ATOM   4098 C C   . TRP A 1 532 ? 25.397  5.209   -4.007  1.00 40.76  ? 532  TRP A C   1 
ATOM   4099 O O   . TRP A 1 532 ? 26.608  5.092   -3.964  1.00 41.62  ? 532  TRP A O   1 
ATOM   4100 C CB  . TRP A 1 532 ? 24.433  7.338   -3.273  1.00 32.86  ? 532  TRP A CB  1 
ATOM   4101 C CG  . TRP A 1 532 ? 24.064  8.719   -3.573  1.00 32.05  ? 532  TRP A CG  1 
ATOM   4102 C CD1 . TRP A 1 532 ? 22.801  9.247   -3.598  1.00 32.38  ? 532  TRP A CD1 1 
ATOM   4103 C CD2 . TRP A 1 532 ? 24.957  9.789   -3.910  1.00 27.56  ? 532  TRP A CD2 1 
ATOM   4104 N NE1 . TRP A 1 532 ? 22.860  10.589  -3.910  1.00 27.12  ? 532  TRP A NE1 1 
ATOM   4105 C CE2 . TRP A 1 532 ? 24.168  10.945  -4.108  1.00 25.65  ? 532  TRP A CE2 1 
ATOM   4106 C CE3 . TRP A 1 532 ? 26.351  9.881   -4.068  1.00 27.27  ? 532  TRP A CE3 1 
ATOM   4107 C CZ2 . TRP A 1 532 ? 24.721  12.174  -4.480  1.00 27.36  ? 532  TRP A CZ2 1 
ATOM   4108 C CZ3 . TRP A 1 532 ? 26.907  11.118  -4.416  1.00 23.54  ? 532  TRP A CZ3 1 
ATOM   4109 C CH2 . TRP A 1 532 ? 26.088  12.246  -4.608  1.00 23.00  ? 532  TRP A CH2 1 
ATOM   4110 N N   . ASN A 1 533 ? 24.549  4.256   -3.621  1.00 40.90  ? 533  ASN A N   1 
ATOM   4111 C CA  . ASN A 1 533 ? 24.985  3.014   -2.958  1.00 43.39  ? 533  ASN A CA  1 
ATOM   4112 C C   . ASN A 1 533 ? 25.410  1.871   -3.889  1.00 44.99  ? 533  ASN A C   1 
ATOM   4113 O O   . ASN A 1 533 ? 26.315  1.136   -3.558  1.00 42.46  ? 533  ASN A O   1 
ATOM   4114 C CB  . ASN A 1 533 ? 23.898  2.502   -2.002  1.00 31.54  ? 533  ASN A CB  1 
ATOM   4115 C CG  . ASN A 1 533 ? 23.631  3.459   -0.872  1.00 32.26  ? 533  ASN A CG  1 
ATOM   4116 O OD1 . ASN A 1 533 ? 24.389  4.397   -0.672  1.00 32.15  ? 533  ASN A OD1 1 
ATOM   4117 N ND2 . ASN A 1 533 ? 22.533  3.256   -0.144  1.00 30.17  ? 533  ASN A ND2 1 
ATOM   4118 N N   . ARG A 1 534 ? 24.744  1.728   -5.034  1.00 44.75  ? 534  ARG A N   1 
ATOM   4119 C CA  . ARG A 1 534 ? 25.062  0.679   -6.006  1.00 46.78  ? 534  ARG A CA  1 
ATOM   4120 C C   . ARG A 1 534 ? 25.803  1.189   -7.234  1.00 46.10  ? 534  ARG A C   1 
ATOM   4121 O O   . ARG A 1 534 ? 26.707  0.531   -7.715  1.00 49.12  ? 534  ARG A O   1 
ATOM   4122 C CB  . ARG A 1 534 ? 23.803  -0.050  -6.478  1.00 41.86  ? 534  ARG A CB  1 
ATOM   4123 C CG  . ARG A 1 534 ? 23.021  -0.728  -5.363  1.00 44.75  ? 534  ARG A CG  1 
ATOM   4124 C CD  . ARG A 1 534 ? 21.624  -1.117  -5.819  1.00 45.92  ? 534  ARG A CD  1 
ATOM   4125 N NE  . ARG A 1 534 ? 20.801  -1.526  -4.688  1.00 52.84  ? 534  ARG A NE  1 
ATOM   4126 C CZ  . ARG A 1 534 ? 20.682  -2.789  -4.267  1.00 56.39  ? 534  ARG A CZ  1 
ATOM   4127 N NH1 . ARG A 1 534 ? 21.330  -3.779  -4.891  1.00 52.20  ? 534  ARG A NH1 1 
ATOM   4128 N NH2 . ARG A 1 534 ? 19.913  -3.060  -3.222  1.00 53.34  ? 534  ARG A NH2 1 
ATOM   4129 N N   . PHE A 1 535 ? 25.417  2.345   -7.755  1.00 43.65  ? 535  PHE A N   1 
ATOM   4130 C CA  . PHE A 1 535 ? 25.977  2.783   -9.026  1.00 43.56  ? 535  PHE A CA  1 
ATOM   4131 C C   . PHE A 1 535 ? 27.240  3.649   -8.881  1.00 42.73  ? 535  PHE A C   1 
ATOM   4132 O O   . PHE A 1 535 ? 28.217  3.389   -9.558  1.00 43.29  ? 535  PHE A O   1 
ATOM   4133 C CB  . PHE A 1 535 ? 24.932  3.471   -9.919  1.00 38.89  ? 535  PHE A CB  1 
ATOM   4134 C CG  . PHE A 1 535 ? 25.457  3.833   -11.281 1.00 39.15  ? 535  PHE A CG  1 
ATOM   4135 C CD1 . PHE A 1 535 ? 25.675  2.846   -12.239 1.00 42.86  ? 535  PHE A CD1 1 
ATOM   4136 C CD2 . PHE A 1 535 ? 25.774  5.140   -11.591 1.00 36.56  ? 535  PHE A CD2 1 
ATOM   4137 C CE1 . PHE A 1 535 ? 26.203  3.164   -13.488 1.00 44.76  ? 535  PHE A CE1 1 
ATOM   4138 C CE2 . PHE A 1 535 ? 26.279  5.472   -12.847 1.00 40.37  ? 535  PHE A CE2 1 
ATOM   4139 C CZ  . PHE A 1 535 ? 26.500  4.491   -13.791 1.00 42.05  ? 535  PHE A CZ  1 
ATOM   4140 N N   . LEU A 1 536 ? 27.231  4.660   -8.016  1.00 39.35  ? 536  LEU A N   1 
ATOM   4141 C CA  . LEU A 1 536 ? 28.396  5.556   -7.892  1.00 40.66  ? 536  LEU A CA  1 
ATOM   4142 C C   . LEU A 1 536 ? 29.743  4.816   -7.726  1.00 45.02  ? 536  LEU A C   1 
ATOM   4143 O O   . LEU A 1 536 ? 30.715  5.157   -8.400  1.00 52.03  ? 536  LEU A O   1 
ATOM   4144 C CB  . LEU A 1 536 ? 28.220  6.526   -6.723  1.00 43.54  ? 536  LEU A CB  1 
ATOM   4145 C CG  . LEU A 1 536 ? 28.900  7.911   -6.692  1.00 54.44  ? 536  LEU A CG  1 
ATOM   4146 C CD1 . LEU A 1 536 ? 29.512  8.190   -5.299  1.00 56.31  ? 536  LEU A CD1 1 
ATOM   4147 C CD2 . LEU A 1 536 ? 29.967  8.070   -7.744  1.00 54.67  ? 536  LEU A CD2 1 
ATOM   4148 N N   . PRO A 1 537 ? 29.815  3.829   -6.807  1.00 47.04  ? 537  PRO A N   1 
ATOM   4149 C CA  . PRO A 1 537 ? 31.065  3.074   -6.638  1.00 50.08  ? 537  PRO A CA  1 
ATOM   4150 C C   . PRO A 1 537 ? 31.548  2.459   -7.953  1.00 49.97  ? 537  PRO A C   1 
ATOM   4151 O O   . PRO A 1 537 ? 32.720  2.611   -8.283  1.00 57.91  ? 537  PRO A O   1 
ATOM   4152 C CB  . PRO A 1 537 ? 30.678  1.966   -5.647  1.00 46.80  ? 537  PRO A CB  1 
ATOM   4153 C CG  . PRO A 1 537 ? 29.495  2.519   -4.920  1.00 44.53  ? 537  PRO A CG  1 
ATOM   4154 C CD  . PRO A 1 537 ? 28.744  3.300   -5.941  1.00 44.61  ? 537  PRO A CD  1 
ATOM   4155 N N   . LYS A 1 538 ? 30.672  1.790   -8.691  1.00 47.73  ? 538  LYS A N   1 
ATOM   4156 C CA  . LYS A 1 538 ? 31.052  1.225   -9.994  1.00 49.05  ? 538  LYS A CA  1 
ATOM   4157 C C   . LYS A 1 538 ? 31.539  2.287   -10.978 1.00 49.44  ? 538  LYS A C   1 
ATOM   4158 O O   . LYS A 1 538 ? 32.476  2.063   -11.739 1.00 49.47  ? 538  LYS A O   1 
ATOM   4159 C CB  . LYS A 1 538 ? 29.907  0.430   -10.599 1.00 49.71  ? 538  LYS A CB  1 
ATOM   4160 C CG  . LYS A 1 538 ? 29.606  -0.850  -9.841  1.00 53.35  ? 538  LYS A CG  1 
ATOM   4161 C CD  . LYS A 1 538 ? 28.372  -1.535  -10.393 1.00 60.39  ? 538  LYS A CD  1 
ATOM   4162 C CE  . LYS A 1 538 ? 27.823  -2.539  -9.391  1.00 66.54  ? 538  LYS A CE  1 
ATOM   4163 N NZ  . LYS A 1 538 ? 28.521  -3.856  -9.518  1.00 71.46  ? 538  LYS A NZ  1 
ATOM   4164 N N   . LEU A 1 539 ? 30.929  3.462   -10.944 1.00 43.91  ? 539  LEU A N   1 
ATOM   4165 C CA  . LEU A 1 539 ? 31.340  4.520   -11.851 1.00 46.41  ? 539  LEU A CA  1 
ATOM   4166 C C   . LEU A 1 539 ? 32.694  5.115   -11.471 1.00 52.04  ? 539  LEU A C   1 
ATOM   4167 O O   . LEU A 1 539 ? 33.458  5.491   -12.347 1.00 54.10  ? 539  LEU A O   1 
ATOM   4168 C CB  . LEU A 1 539 ? 30.298  5.625   -11.870 1.00 47.96  ? 539  LEU A CB  1 
ATOM   4169 C CG  . LEU A 1 539 ? 30.520  6.734   -12.881 1.00 49.12  ? 539  LEU A CG  1 
ATOM   4170 C CD1 . LEU A 1 539 ? 30.640  6.106   -14.265 1.00 51.01  ? 539  LEU A CD1 1 
ATOM   4171 C CD2 . LEU A 1 539 ? 29.367  7.715   -12.822 1.00 48.81  ? 539  LEU A CD2 1 
ATOM   4172 N N   . LEU A 1 540 ? 32.979  5.232   -10.173 1.00 56.05  ? 540  LEU A N   1 
ATOM   4173 C CA  . LEU A 1 540 ? 34.263  5.789   -9.710  1.00 57.10  ? 540  LEU A CA  1 
ATOM   4174 C C   . LEU A 1 540 ? 35.492  4.991   -10.219 1.00 65.80  ? 540  LEU A C   1 
ATOM   4175 O O   . LEU A 1 540 ? 36.518  5.595   -10.571 1.00 68.11  ? 540  LEU A O   1 
ATOM   4176 C CB  . LEU A 1 540 ? 34.286  5.975   -8.185  1.00 53.58  ? 540  LEU A CB  1 
ATOM   4177 C CG  . LEU A 1 540 ? 33.503  7.199   -7.662  1.00 57.52  ? 540  LEU A CG  1 
ATOM   4178 C CD1 . LEU A 1 540 ? 33.471  7.254   -6.129  1.00 52.36  ? 540  LEU A CD1 1 
ATOM   4179 C CD2 . LEU A 1 540 ? 34.046  8.528   -8.251  1.00 56.45  ? 540  LEU A CD2 1 
ATOM   4180 N N   . SER A 1 541 ? 35.385  3.661   -10.283 1.00 52.39  ? 541  SER A N   1 
ATOM   4181 C CA  . SER A 1 541 ? 36.282  2.868   -11.140 1.00 60.42  ? 541  SER A CA  1 
ATOM   4182 C C   . SER A 1 541 ? 35.628  2.441   -12.475 1.00 75.06  ? 541  SER A C   1 
ATOM   4183 O O   . SER A 1 541 ? 35.078  1.339   -12.523 1.00 91.00  ? 541  SER A O   1 
ATOM   4184 C CB  . SER A 1 541 ? 36.671  1.603   -10.391 1.00 57.33  ? 541  SER A CB  1 
ATOM   4185 O OG  . SER A 1 541 ? 35.561  1.049   -9.693  1.00 50.81  ? 541  SER A OG  1 
ATOM   4186 N N   . ALA A 1 542 ? 35.698  3.209   -13.572 1.00 69.21  ? 542  ALA A N   1 
ATOM   4187 C CA  . ALA A 1 542 ? 36.558  4.374   -13.783 1.00 66.98  ? 542  ALA A CA  1 
ATOM   4188 C C   . ALA A 1 542 ? 35.875  5.723   -13.448 1.00 74.76  ? 542  ALA A C   1 
ATOM   4189 O O   . ALA A 1 542 ? 35.862  6.694   -14.229 1.00 71.80  ? 542  ALA A O   1 
ATOM   4190 C CB  . ALA A 1 542 ? 37.036  4.363   -15.212 1.00 57.00  ? 542  ALA A CB  1 
ATOM   4191 N N   . GLU B 2 4   ? -16.887 5.450   -69.655 1.00 86.55  ? 4    GLU B N   1 
ATOM   4192 C CA  . GLU B 2 4   ? -15.707 6.241   -69.302 1.00 85.00  ? 4    GLU B CA  1 
ATOM   4193 C C   . GLU B 2 4   ? -16.043 7.454   -68.415 1.00 83.22  ? 4    GLU B C   1 
ATOM   4194 O O   . GLU B 2 4   ? -16.353 8.545   -68.913 1.00 85.33  ? 4    GLU B O   1 
ATOM   4195 C CB  . GLU B 2 4   ? -14.964 6.694   -70.564 1.00 82.57  ? 4    GLU B CB  1 
ATOM   4196 N N   . ASP B 2 5   ? -15.981 7.259   -67.100 1.00 74.92  ? 5    ASP B N   1 
ATOM   4197 C CA  . ASP B 2 5   ? -16.165 8.358   -66.151 1.00 68.79  ? 5    ASP B CA  1 
ATOM   4198 C C   . ASP B 2 5   ? -14.953 9.291   -66.242 1.00 70.89  ? 5    ASP B C   1 
ATOM   4199 O O   . ASP B 2 5   ? -13.837 8.895   -65.917 1.00 76.17  ? 5    ASP B O   1 
ATOM   4200 C CB  . ASP B 2 5   ? -16.338 7.786   -64.740 1.00 63.26  ? 5    ASP B CB  1 
ATOM   4201 C CG  . ASP B 2 5   ? -16.732 8.840   -63.701 1.00 61.33  ? 5    ASP B CG  1 
ATOM   4202 O OD1 . ASP B 2 5   ? -17.260 8.425   -62.633 1.00 50.46  ? 5    ASP B OD1 1 
ATOM   4203 O OD2 . ASP B 2 5   ? -16.487 10.053  -63.938 1.00 59.51  ? 5    ASP B OD2 1 
ATOM   4204 N N   . PRO B 2 6   ? -15.171 10.530  -66.704 1.00 66.52  ? 6    PRO B N   1 
ATOM   4205 C CA  . PRO B 2 6   ? -14.123 11.524  -66.993 1.00 63.43  ? 6    PRO B CA  1 
ATOM   4206 C C   . PRO B 2 6   ? -13.378 11.955  -65.741 1.00 61.96  ? 6    PRO B C   1 
ATOM   4207 O O   . PRO B 2 6   ? -12.242 12.431  -65.839 1.00 63.02  ? 6    PRO B O   1 
ATOM   4208 C CB  . PRO B 2 6   ? -14.907 12.725  -67.542 1.00 69.81  ? 6    PRO B CB  1 
ATOM   4209 C CG  . PRO B 2 6   ? -16.266 12.203  -67.869 1.00 68.89  ? 6    PRO B CG  1 
ATOM   4210 C CD  . PRO B 2 6   ? -16.520 11.057  -66.949 1.00 67.07  ? 6    PRO B CD  1 
ATOM   4211 N N   . GLN B 2 7   ? -14.029 11.819  -64.587 1.00 58.55  ? 7    GLN B N   1 
ATOM   4212 C CA  . GLN B 2 7   ? -13.372 12.038  -63.301 1.00 60.66  ? 7    GLN B CA  1 
ATOM   4213 C C   . GLN B 2 7   ? -12.244 11.050  -63.086 1.00 55.30  ? 7    GLN B C   1 
ATOM   4214 O O   . GLN B 2 7   ? -11.355 11.301  -62.287 1.00 52.25  ? 7    GLN B O   1 
ATOM   4215 C CB  . GLN B 2 7   ? -14.363 11.880  -62.143 1.00 64.90  ? 7    GLN B CB  1 
ATOM   4216 C CG  . GLN B 2 7   ? -15.361 13.024  -62.012 1.00 66.61  ? 7    GLN B CG  1 
ATOM   4217 C CD  . GLN B 2 7   ? -14.692 14.302  -61.588 1.00 65.18  ? 7    GLN B CD  1 
ATOM   4218 O OE1 . GLN B 2 7   ? -13.860 14.304  -60.695 1.00 70.17  ? 7    GLN B OE1 1 
ATOM   4219 N NE2 . GLN B 2 7   ? -15.038 15.392  -62.235 1.00 69.00  ? 7    GLN B NE2 1 
ATOM   4220 N N   . LEU B 2 8   ? -12.311 9.911   -63.774 1.00 51.12  ? 8    LEU B N   1 
ATOM   4221 C CA  . LEU B 2 8   ? -11.361 8.838   -63.548 1.00 54.06  ? 8    LEU B CA  1 
ATOM   4222 C C   . LEU B 2 8   ? -10.288 8.816   -64.627 1.00 52.08  ? 8    LEU B C   1 
ATOM   4223 O O   . LEU B 2 8   ? -9.429  7.944   -64.646 1.00 49.10  ? 8    LEU B O   1 
ATOM   4224 C CB  . LEU B 2 8   ? -12.078 7.490   -63.488 1.00 51.95  ? 8    LEU B CB  1 
ATOM   4225 C CG  . LEU B 2 8   ? -13.078 7.398   -62.337 1.00 50.31  ? 8    LEU B CG  1 
ATOM   4226 C CD1 . LEU B 2 8   ? -13.740 6.027   -62.298 1.00 49.95  ? 8    LEU B CD1 1 
ATOM   4227 C CD2 . LEU B 2 8   ? -12.361 7.711   -61.040 1.00 44.84  ? 8    LEU B CD2 1 
ATOM   4228 N N   . LEU B 2 9   ? -10.348 9.790   -65.523 1.00 51.95  ? 9    LEU B N   1 
ATOM   4229 C CA  . LEU B 2 9   ? -9.343  9.919   -66.563 1.00 52.48  ? 9    LEU B CA  1 
ATOM   4230 C C   . LEU B 2 9   ? -8.427  11.098  -66.287 1.00 51.05  ? 9    LEU B C   1 
ATOM   4231 O O   . LEU B 2 9   ? -8.888  12.229  -66.151 1.00 51.58  ? 9    LEU B O   1 
ATOM   4232 C CB  . LEU B 2 9   ? -10.006 10.085  -67.922 1.00 55.09  ? 9    LEU B CB  1 
ATOM   4233 C CG  . LEU B 2 9   ? -9.945  8.854   -68.799 1.00 63.59  ? 9    LEU B CG  1 
ATOM   4234 C CD1 . LEU B 2 9   ? -10.582 9.182   -70.149 1.00 67.50  ? 9    LEU B CD1 1 
ATOM   4235 C CD2 . LEU B 2 9   ? -8.466  8.429   -68.961 1.00 64.00  ? 9    LEU B CD2 1 
ATOM   4236 N N   . VAL B 2 10  ? -7.127  10.826  -66.218 1.00 43.84  ? 10   VAL B N   1 
ATOM   4237 C CA  . VAL B 2 10  ? -6.144  11.839  -65.911 1.00 45.24  ? 10   VAL B CA  1 
ATOM   4238 C C   . VAL B 2 10  ? -4.915  11.715  -66.813 1.00 48.25  ? 10   VAL B C   1 
ATOM   4239 O O   . VAL B 2 10  ? -4.461  10.604  -67.093 1.00 46.27  ? 10   VAL B O   1 
ATOM   4240 C CB  . VAL B 2 10  ? -5.697  11.706  -64.442 1.00 51.82  ? 10   VAL B CB  1 
ATOM   4241 C CG1 . VAL B 2 10  ? -4.527  12.639  -64.138 1.00 46.12  ? 10   VAL B CG1 1 
ATOM   4242 C CG2 . VAL B 2 10  ? -6.883  11.997  -63.515 1.00 58.87  ? 10   VAL B CG2 1 
ATOM   4243 N N   . ARG B 2 11  ? -4.378  12.854  -67.257 1.00 45.35  ? 11   ARG B N   1 
ATOM   4244 C CA  . ARG B 2 11  ? -3.111  12.873  -67.981 1.00 45.29  ? 11   ARG B CA  1 
ATOM   4245 C C   . ARG B 2 11  ? -1.992  13.426  -67.112 1.00 48.95  ? 11   ARG B C   1 
ATOM   4246 O O   . ARG B 2 11  ? -2.106  14.519  -66.554 1.00 47.97  ? 11   ARG B O   1 
ATOM   4247 C CB  . ARG B 2 11  ? -3.211  13.667  -69.281 1.00 47.75  ? 11   ARG B CB  1 
ATOM   4248 C CG  . ARG B 2 11  ? -1.861  13.982  -69.907 1.00 58.22  ? 11   ARG B CG  1 
ATOM   4249 C CD  . ARG B 2 11  ? -1.964  14.314  -71.397 1.00 68.18  ? 11   ARG B CD  1 
ATOM   4250 N NE  . ARG B 2 11  ? -1.509  13.176  -72.190 1.00 81.39  ? 11   ARG B NE  1 
ATOM   4251 C CZ  . ARG B 2 11  ? -2.283  12.427  -72.974 1.00 87.50  ? 11   ARG B CZ  1 
ATOM   4252 N NH1 . ARG B 2 11  ? -3.576  12.701  -73.120 1.00 82.93  ? 11   ARG B NH1 1 
ATOM   4253 N NH2 . ARG B 2 11  ? -1.748  11.401  -73.626 1.00 92.82  ? 11   ARG B NH2 1 
ATOM   4254 N N   . VAL B 2 12  ? -0.924  12.643  -66.981 1.00 48.64  ? 12   VAL B N   1 
ATOM   4255 C CA  . VAL B 2 12  ? 0.277   13.067  -66.279 1.00 44.78  ? 12   VAL B CA  1 
ATOM   4256 C C   . VAL B 2 12  ? 1.385   13.111  -67.320 1.00 51.51  ? 12   VAL B C   1 
ATOM   4257 O O   . VAL B 2 12  ? 1.182   12.673  -68.450 1.00 59.69  ? 12   VAL B O   1 
ATOM   4258 C CB  . VAL B 2 12  ? 0.626   12.115  -65.115 1.00 38.60  ? 12   VAL B CB  1 
ATOM   4259 C CG1 . VAL B 2 12  ? -0.393  12.259  -64.014 1.00 44.89  ? 12   VAL B CG1 1 
ATOM   4260 C CG2 . VAL B 2 12  ? 0.678   10.669  -65.583 1.00 37.61  ? 12   VAL B CG2 1 
ATOM   4261 N N   . ARG B 2 13  ? 2.535   13.654  -66.959 1.00 47.46  ? 13   ARG B N   1 
ATOM   4262 C CA  . ARG B 2 13  ? 3.657   13.758  -67.881 1.00 48.06  ? 13   ARG B CA  1 
ATOM   4263 C C   . ARG B 2 13  ? 3.961   12.464  -68.654 1.00 44.60  ? 13   ARG B C   1 
ATOM   4264 O O   . ARG B 2 13  ? 4.272   12.518  -69.838 1.00 42.29  ? 13   ARG B O   1 
ATOM   4265 C CB  . ARG B 2 13  ? 4.913   14.245  -67.150 1.00 52.85  ? 13   ARG B CB  1 
ATOM   4266 C CG  . ARG B 2 13  ? 4.863   15.711  -66.710 1.00 66.46  ? 13   ARG B CG  1 
ATOM   4267 C CD  . ARG B 2 13  ? 6.269   16.261  -66.483 1.00 78.41  ? 13   ARG B CD  1 
ATOM   4268 N NE  . ARG B 2 13  ? 6.255   17.600  -65.886 1.00 89.40  ? 13   ARG B NE  1 
ATOM   4269 C CZ  . ARG B 2 13  ? 7.328   18.217  -65.379 1.00 93.35  ? 13   ARG B CZ  1 
ATOM   4270 N NH1 . ARG B 2 13  ? 8.518   17.622  -65.389 1.00 96.72  ? 13   ARG B NH1 1 
ATOM   4271 N NH2 . ARG B 2 13  ? 7.215   19.433  -64.853 1.00 88.08  ? 13   ARG B NH2 1 
ATOM   4272 N N   . GLY B 2 14  ? 3.874   11.311  -67.996 1.00 38.91  ? 14   GLY B N   1 
ATOM   4273 C CA  . GLY B 2 14  ? 4.179   10.045  -68.639 1.00 31.49  ? 14   GLY B CA  1 
ATOM   4274 C C   . GLY B 2 14  ? 3.145   9.509   -69.612 1.00 39.17  ? 14   GLY B C   1 
ATOM   4275 O O   . GLY B 2 14  ? 3.434   8.611   -70.410 1.00 40.60  ? 14   GLY B O   1 
ATOM   4276 N N   . GLY B 2 15  ? 1.938   10.068  -69.579 1.00 39.01  ? 15   GLY B N   1 
ATOM   4277 C CA  . GLY B 2 15  ? 0.842   9.526   -70.366 1.00 44.06  ? 15   GLY B CA  1 
ATOM   4278 C C   . GLY B 2 15  ? -0.500  9.550   -69.647 1.00 45.15  ? 15   GLY B C   1 
ATOM   4279 O O   . GLY B 2 15  ? -0.665  10.245  -68.636 1.00 47.03  ? 15   GLY B O   1 
ATOM   4280 N N   . GLN B 2 16  ? -1.458  8.784   -70.156 1.00 38.96  ? 16   GLN B N   1 
ATOM   4281 C CA  . GLN B 2 16  ? -2.790  8.758   -69.575 1.00 43.21  ? 16   GLN B CA  1 
ATOM   4282 C C   . GLN B 2 16  ? -3.012  7.647   -68.556 1.00 41.67  ? 16   GLN B C   1 
ATOM   4283 O O   . GLN B 2 16  ? -2.488  6.549   -68.714 1.00 41.16  ? 16   GLN B O   1 
ATOM   4284 C CB  . GLN B 2 16  ? -3.835  8.612   -70.679 1.00 53.11  ? 16   GLN B CB  1 
ATOM   4285 C CG  . GLN B 2 16  ? -4.022  9.853   -71.508 1.00 65.02  ? 16   GLN B CG  1 
ATOM   4286 C CD  . GLN B 2 16  ? -5.467  10.029  -71.894 1.00 77.70  ? 16   GLN B CD  1 
ATOM   4287 O OE1 . GLN B 2 16  ? -5.974  9.384   -72.838 1.00 73.50  ? 16   GLN B OE1 1 
ATOM   4288 N NE2 . GLN B 2 16  ? -6.164  10.883  -71.139 1.00 85.09  ? 16   GLN B NE2 1 
ATOM   4289 N N   . LEU B 2 17  ? -3.827  7.930   -67.538 1.00 34.85  ? 17   LEU B N   1 
ATOM   4290 C CA  . LEU B 2 17  ? -4.110  6.972   -66.472 1.00 41.57  ? 17   LEU B CA  1 
ATOM   4291 C C   . LEU B 2 17  ? -5.609  6.841   -66.330 1.00 45.44  ? 17   LEU B C   1 
ATOM   4292 O O   . LEU B 2 17  ? -6.329  7.823   -66.514 1.00 46.55  ? 17   LEU B O   1 
ATOM   4293 C CB  . LEU B 2 17  ? -3.575  7.479   -65.114 1.00 36.84  ? 17   LEU B CB  1 
ATOM   4294 C CG  . LEU B 2 17  ? -2.074  7.713   -64.997 1.00 47.83  ? 17   LEU B CG  1 
ATOM   4295 C CD1 . LEU B 2 17  ? -1.741  8.506   -63.755 1.00 43.31  ? 17   LEU B CD1 1 
ATOM   4296 C CD2 . LEU B 2 17  ? -1.306  6.373   -65.043 1.00 45.58  ? 17   LEU B CD2 1 
ATOM   4297 N N   . ARG B 2 18  ? -6.081  5.659   -65.945 1.00 44.39  ? 18   ARG B N   1 
ATOM   4298 C CA  . ARG B 2 18  ? -7.498  5.499   -65.583 1.00 44.27  ? 18   ARG B CA  1 
ATOM   4299 C C   . ARG B 2 18  ? -7.589  4.977   -64.157 1.00 38.77  ? 18   ARG B C   1 
ATOM   4300 O O   . ARG B 2 18  ? -7.092  3.892   -63.860 1.00 42.81  ? 18   ARG B O   1 
ATOM   4301 C CB  . ARG B 2 18  ? -8.194  4.515   -66.538 1.00 47.75  ? 18   ARG B CB  1 
ATOM   4302 C CG  . ARG B 2 18  ? -9.600  4.110   -66.134 1.00 48.17  ? 18   ARG B CG  1 
ATOM   4303 C CD  . ARG B 2 18  ? -10.405 3.657   -67.347 1.00 65.79  ? 18   ARG B CD  1 
ATOM   4304 N NE  . ARG B 2 18  ? -9.649  2.683   -68.137 1.00 80.48  ? 18   ARG B NE  1 
ATOM   4305 C CZ  . ARG B 2 18  ? -9.372  2.807   -69.431 1.00 85.06  ? 18   ARG B CZ  1 
ATOM   4306 N NH1 . ARG B 2 18  ? -9.809  3.849   -70.125 1.00 82.11  ? 18   ARG B NH1 1 
ATOM   4307 N NH2 . ARG B 2 18  ? -8.665  1.867   -70.037 1.00 93.35  ? 18   ARG B NH2 1 
ATOM   4308 N N   . GLY B 2 19  ? -8.213  5.748   -63.277 1.00 37.32  ? 19   GLY B N   1 
ATOM   4309 C CA  . GLY B 2 19  ? -8.381  5.350   -61.892 1.00 40.75  ? 19   GLY B CA  1 
ATOM   4310 C C   . GLY B 2 19  ? -9.735  4.673   -61.697 1.00 47.21  ? 19   GLY B C   1 
ATOM   4311 O O   . GLY B 2 19  ? -10.423 4.371   -62.670 1.00 45.15  ? 19   GLY B O   1 
ATOM   4312 N N   . ILE B 2 20  ? -10.113 4.448   -60.442 1.00 41.95  ? 20   ILE B N   1 
ATOM   4313 C CA  . ILE B 2 20  ? -11.339 3.725   -60.111 1.00 42.65  ? 20   ILE B CA  1 
ATOM   4314 C C   . ILE B 2 20  ? -12.137 4.499   -59.051 1.00 46.09  ? 20   ILE B C   1 
ATOM   4315 O O   . ILE B 2 20  ? -11.553 5.169   -58.205 1.00 48.25  ? 20   ILE B O   1 
ATOM   4316 C CB  . ILE B 2 20  ? -11.033 2.286   -59.625 1.00 41.20  ? 20   ILE B CB  1 
ATOM   4317 C CG1 . ILE B 2 20  ? -12.296 1.611   -59.082 1.00 43.41  ? 20   ILE B CG1 1 
ATOM   4318 C CG2 . ILE B 2 20  ? -9.940  2.274   -58.549 1.00 35.64  ? 20   ILE B CG2 1 
ATOM   4319 C CD1 . ILE B 2 20  ? -12.157 0.084   -58.908 1.00 41.44  ? 20   ILE B CD1 1 
ATOM   4320 N N   . ARG B 2 21  ? -13.463 4.441   -59.121 1.00 46.65  ? 21   ARG B N   1 
ATOM   4321 C CA  . ARG B 2 21  ? -14.318 5.133   -58.152 1.00 46.93  ? 21   ARG B CA  1 
ATOM   4322 C C   . ARG B 2 21  ? -14.489 4.228   -56.949 1.00 46.64  ? 21   ARG B C   1 
ATOM   4323 O O   . ARG B 2 21  ? -14.915 3.089   -57.080 1.00 49.75  ? 21   ARG B O   1 
ATOM   4324 C CB  . ARG B 2 21  ? -15.689 5.461   -58.749 1.00 50.17  ? 21   ARG B CB  1 
ATOM   4325 C CG  . ARG B 2 21  ? -16.531 6.448   -57.920 1.00 59.28  ? 21   ARG B CG  1 
ATOM   4326 C CD  . ARG B 2 21  ? -17.943 6.678   -58.527 1.00 74.50  ? 21   ARG B CD  1 
ATOM   4327 N NE  . ARG B 2 21  ? -18.947 5.796   -57.932 1.00 79.30  ? 21   ARG B NE  1 
ATOM   4328 C CZ  . ARG B 2 21  ? -20.025 6.219   -57.264 1.00 91.74  ? 21   ARG B CZ  1 
ATOM   4329 N NH1 . ARG B 2 21  ? -20.275 7.519   -57.126 1.00 88.64  ? 21   ARG B NH1 1 
ATOM   4330 N NH2 . ARG B 2 21  ? -20.875 5.337   -56.745 1.00 99.31  ? 21   ARG B NH2 1 
ATOM   4331 N N   . LEU B 2 22  ? -14.134 4.723   -55.775 1.00 45.20  ? 22   LEU B N   1 
ATOM   4332 C CA  . LEU B 2 22  ? -14.211 3.892   -54.589 1.00 51.76  ? 22   LEU B CA  1 
ATOM   4333 C C   . LEU B 2 22  ? -15.245 4.484   -53.673 1.00 52.69  ? 22   LEU B C   1 
ATOM   4334 O O   . LEU B 2 22  ? -15.529 5.682   -53.728 1.00 56.40  ? 22   LEU B O   1 
ATOM   4335 C CB  . LEU B 2 22  ? -12.862 3.809   -53.870 1.00 48.94  ? 22   LEU B CB  1 
ATOM   4336 C CG  . LEU B 2 22  ? -11.727 3.027   -54.533 1.00 54.77  ? 22   LEU B CG  1 
ATOM   4337 C CD1 . LEU B 2 22  ? -10.524 3.021   -53.586 1.00 48.59  ? 22   LEU B CD1 1 
ATOM   4338 C CD2 . LEU B 2 22  ? -12.121 1.602   -54.914 1.00 53.07  ? 22   LEU B CD2 1 
ATOM   4339 N N   . LYS B 2 23  ? -15.816 3.639   -52.830 1.00 56.52  ? 23   LYS B N   1 
ATOM   4340 C CA  . LYS B 2 23  ? -16.855 4.082   -51.916 1.00 55.26  ? 23   LYS B CA  1 
ATOM   4341 C C   . LYS B 2 23  ? -16.260 4.317   -50.527 1.00 53.45  ? 23   LYS B C   1 
ATOM   4342 O O   . LYS B 2 23  ? -15.703 3.408   -49.916 1.00 49.55  ? 23   LYS B O   1 
ATOM   4343 C CB  . LYS B 2 23  ? -17.970 3.044   -51.870 1.00 58.02  ? 23   LYS B CB  1 
ATOM   4344 C CG  . LYS B 2 23  ? -18.891 3.190   -50.691 1.00 72.56  ? 23   LYS B CG  1 
ATOM   4345 C CD  . LYS B 2 23  ? -20.071 2.228   -50.784 1.00 84.51  ? 23   LYS B CD  1 
ATOM   4346 C CE  . LYS B 2 23  ? -20.990 2.355   -49.555 1.00 88.23  ? 23   LYS B CE  1 
ATOM   4347 N NZ  . LYS B 2 23  ? -21.242 3.781   -49.171 1.00 85.27  ? 23   LYS B NZ  1 
ATOM   4348 N N   . ALA B 2 24  ? -16.343 5.556   -50.052 1.00 48.26  ? 24   ALA B N   1 
ATOM   4349 C CA  . ALA B 2 24  ? -16.100 5.855   -48.651 1.00 45.56  ? 24   ALA B CA  1 
ATOM   4350 C C   . ALA B 2 24  ? -17.470 5.998   -47.967 1.00 50.44  ? 24   ALA B C   1 
ATOM   4351 O O   . ALA B 2 24  ? -18.470 6.213   -48.646 1.00 55.30  ? 24   ALA B O   1 
ATOM   4352 C CB  . ALA B 2 24  ? -15.286 7.117   -48.523 1.00 43.45  ? 24   ALA B CB  1 
ATOM   4353 N N   . PRO B 2 25  ? -17.529 5.886   -46.626 1.00 52.29  ? 25   PRO B N   1 
ATOM   4354 C CA  . PRO B 2 25  ? -18.862 5.844   -45.990 1.00 49.83  ? 25   PRO B CA  1 
ATOM   4355 C C   . PRO B 2 25  ? -19.691 7.085   -46.307 1.00 56.40  ? 25   PRO B C   1 
ATOM   4356 O O   . PRO B 2 25  ? -20.917 7.011   -46.427 1.00 64.29  ? 25   PRO B O   1 
ATOM   4357 C CB  . PRO B 2 25  ? -18.558 5.801   -44.482 1.00 44.79  ? 25   PRO B CB  1 
ATOM   4358 C CG  . PRO B 2 25  ? -17.069 5.436   -44.384 1.00 52.70  ? 25   PRO B CG  1 
ATOM   4359 C CD  . PRO B 2 25  ? -16.434 5.973   -45.641 1.00 46.93  ? 25   PRO B CD  1 
ATOM   4360 N N   . GLY B 2 26  ? -19.025 8.219   -46.449 1.00 56.09  ? 26   GLY B N   1 
ATOM   4361 C CA  . GLY B 2 26  ? -19.714 9.469   -46.702 1.00 56.78  ? 26   GLY B CA  1 
ATOM   4362 C C   . GLY B 2 26  ? -19.916 9.791   -48.171 1.00 58.64  ? 26   GLY B C   1 
ATOM   4363 O O   . GLY B 2 26  ? -20.613 10.745  -48.488 1.00 62.61  ? 26   GLY B O   1 
ATOM   4364 N N   . GLY B 2 27  ? -19.321 9.013   -49.071 1.00 52.62  ? 27   GLY B N   1 
ATOM   4365 C CA  . GLY B 2 27  ? -19.367 9.362   -50.482 1.00 52.79  ? 27   GLY B CA  1 
ATOM   4366 C C   . GLY B 2 27  ? -18.253 8.743   -51.314 1.00 56.95  ? 27   GLY B C   1 
ATOM   4367 O O   . GLY B 2 27  ? -17.417 8.007   -50.793 1.00 55.36  ? 27   GLY B O   1 
ATOM   4368 N N   . PRO B 2 28  ? -18.241 9.023   -52.629 1.00 55.75  ? 28   PRO B N   1 
ATOM   4369 C CA  . PRO B 2 28  ? -17.254 8.373   -53.495 1.00 49.54  ? 28   PRO B CA  1 
ATOM   4370 C C   . PRO B 2 28  ? -15.913 9.077   -53.413 1.00 51.14  ? 28   PRO B C   1 
ATOM   4371 O O   . PRO B 2 28  ? -15.854 10.240  -53.012 1.00 44.94  ? 28   PRO B O   1 
ATOM   4372 C CB  . PRO B 2 28  ? -17.827 8.569   -54.905 1.00 42.81  ? 28   PRO B CB  1 
ATOM   4373 C CG  . PRO B 2 28  ? -19.130 9.283   -54.716 1.00 44.11  ? 28   PRO B CG  1 
ATOM   4374 C CD  . PRO B 2 28  ? -19.161 9.885   -53.390 1.00 42.33  ? 28   PRO B CD  1 
ATOM   4375 N N   . VAL B 2 29  ? -14.849 8.376   -53.802 1.00 47.67  ? 29   VAL B N   1 
ATOM   4376 C CA  . VAL B 2 29  ? -13.548 9.005   -53.959 1.00 46.95  ? 29   VAL B CA  1 
ATOM   4377 C C   . VAL B 2 29  ? -12.907 8.447   -55.225 1.00 45.13  ? 29   VAL B C   1 
ATOM   4378 O O   . VAL B 2 29  ? -13.197 7.326   -55.619 1.00 51.80  ? 29   VAL B O   1 
ATOM   4379 C CB  . VAL B 2 29  ? -12.638 8.756   -52.731 1.00 50.84  ? 29   VAL B CB  1 
ATOM   4380 C CG1 . VAL B 2 29  ? -13.333 9.226   -51.451 1.00 51.65  ? 29   VAL B CG1 1 
ATOM   4381 C CG2 . VAL B 2 29  ? -12.315 7.295   -52.625 1.00 54.18  ? 29   VAL B CG2 1 
ATOM   4382 N N   . SER B 2 30  ? -12.069 9.235   -55.883 1.00 42.63  ? 30   SER B N   1 
ATOM   4383 C CA  . SER B 2 30  ? -11.314 8.740   -57.024 1.00 49.47  ? 30   SER B CA  1 
ATOM   4384 C C   . SER B 2 30  ? -9.985  8.141   -56.577 1.00 49.70  ? 30   SER B C   1 
ATOM   4385 O O   . SER B 2 30  ? -9.187  8.799   -55.913 1.00 53.20  ? 30   SER B O   1 
ATOM   4386 C CB  . SER B 2 30  ? -11.039 9.871   -58.010 1.00 48.95  ? 30   SER B CB  1 
ATOM   4387 O OG  . SER B 2 30  ? -12.218 10.621  -58.250 1.00 53.21  ? 30   SER B OG  1 
ATOM   4388 N N   . ALA B 2 31  ? -9.719  6.900   -56.948 1.00 47.97  ? 31   ALA B N   1 
ATOM   4389 C CA  . ALA B 2 31  ? -8.417  6.324   -56.619 1.00 41.97  ? 31   ALA B CA  1 
ATOM   4390 C C   . ALA B 2 31  ? -7.611  5.955   -57.875 1.00 43.88  ? 31   ALA B C   1 
ATOM   4391 O O   . ALA B 2 31  ? -8.155  5.420   -58.836 1.00 45.63  ? 31   ALA B O   1 
ATOM   4392 C CB  . ALA B 2 31  ? -8.595  5.140   -55.709 1.00 38.54  ? 31   ALA B CB  1 
ATOM   4393 N N   . PHE B 2 32  ? -6.328  6.294   -57.867 1.00 42.74  ? 32   PHE B N   1 
ATOM   4394 C CA  . PHE B 2 32  ? -5.399  5.961   -58.947 1.00 41.94  ? 32   PHE B CA  1 
ATOM   4395 C C   . PHE B 2 32  ? -4.286  5.176   -58.296 1.00 39.79  ? 32   PHE B C   1 
ATOM   4396 O O   . PHE B 2 32  ? -3.402  5.743   -57.661 1.00 36.88  ? 32   PHE B O   1 
ATOM   4397 C CB  . PHE B 2 32  ? -4.857  7.229   -59.621 1.00 39.44  ? 32   PHE B CB  1 
ATOM   4398 C CG  . PHE B 2 32  ? -5.946  8.114   -60.167 1.00 38.72  ? 32   PHE B CG  1 
ATOM   4399 C CD1 . PHE B 2 32  ? -6.643  8.968   -59.331 1.00 41.05  ? 32   PHE B CD1 1 
ATOM   4400 C CD2 . PHE B 2 32  ? -6.317  8.036   -61.503 1.00 42.59  ? 32   PHE B CD2 1 
ATOM   4401 C CE1 . PHE B 2 32  ? -7.666  9.736   -59.827 1.00 45.72  ? 32   PHE B CE1 1 
ATOM   4402 C CE2 . PHE B 2 32  ? -7.339  8.810   -62.008 1.00 46.39  ? 32   PHE B CE2 1 
ATOM   4403 C CZ  . PHE B 2 32  ? -8.023  9.656   -61.169 1.00 45.64  ? 32   PHE B CZ  1 
ATOM   4404 N N   . LEU B 2 33  ? -4.382  3.857   -58.418 1.00 39.24  ? 33   LEU B N   1 
ATOM   4405 C CA  . LEU B 2 33  ? -3.524  2.946   -57.712 1.00 38.58  ? 33   LEU B CA  1 
ATOM   4406 C C   . LEU B 2 33  ? -2.516  2.305   -58.664 1.00 43.14  ? 33   LEU B C   1 
ATOM   4407 O O   . LEU B 2 33  ? -2.870  1.970   -59.789 1.00 43.81  ? 33   LEU B O   1 
ATOM   4408 C CB  . LEU B 2 33  ? -4.377  1.865   -57.061 1.00 37.99  ? 33   LEU B CB  1 
ATOM   4409 C CG  . LEU B 2 33  ? -5.579  2.327   -56.235 1.00 35.83  ? 33   LEU B CG  1 
ATOM   4410 C CD1 . LEU B 2 33  ? -6.276  1.131   -55.677 1.00 29.60  ? 33   LEU B CD1 1 
ATOM   4411 C CD2 . LEU B 2 33  ? -5.120  3.249   -55.098 1.00 35.07  ? 33   LEU B CD2 1 
ATOM   4412 N N   . GLY B 2 34  ? -1.265  2.155   -58.213 1.00 38.53  ? 34   GLY B N   1 
ATOM   4413 C CA  . GLY B 2 34  ? -0.254  1.448   -58.984 1.00 41.22  ? 34   GLY B CA  1 
ATOM   4414 C C   . GLY B 2 34  ? 0.308   2.222   -60.164 1.00 36.44  ? 34   GLY B C   1 
ATOM   4415 O O   . GLY B 2 34  ? 0.572   1.651   -61.197 1.00 42.17  ? 34   GLY B O   1 
ATOM   4416 N N   . ILE B 2 35  ? 0.483   3.526   -60.008 1.00 33.94  ? 35   ILE B N   1 
ATOM   4417 C CA  . ILE B 2 35  ? 1.112   4.380   -61.006 1.00 31.58  ? 35   ILE B CA  1 
ATOM   4418 C C   . ILE B 2 35  ? 2.635   4.235   -60.960 1.00 35.30  ? 35   ILE B C   1 
ATOM   4419 O O   . ILE B 2 35  ? 3.263   4.473   -59.925 1.00 34.09  ? 35   ILE B O   1 
ATOM   4420 C CB  . ILE B 2 35  ? 0.799   5.865   -60.712 1.00 33.69  ? 35   ILE B CB  1 
ATOM   4421 C CG1 . ILE B 2 35  ? -0.727  6.113   -60.750 1.00 33.27  ? 35   ILE B CG1 1 
ATOM   4422 C CG2 . ILE B 2 35  ? 1.497   6.762   -61.702 1.00 26.09  ? 35   ILE B CG2 1 
ATOM   4423 C CD1 . ILE B 2 35  ? -1.171  7.375   -59.978 1.00 25.83  ? 35   ILE B CD1 1 
ATOM   4424 N N   . PRO B 2 36  ? 3.249   3.861   -62.093 1.00 36.86  ? 36   PRO B N   1 
ATOM   4425 C CA  . PRO B 2 36  ? 4.716   3.694   -62.078 1.00 31.27  ? 36   PRO B CA  1 
ATOM   4426 C C   . PRO B 2 36  ? 5.409   5.042   -61.960 1.00 31.64  ? 36   PRO B C   1 
ATOM   4427 O O   . PRO B 2 36  ? 5.059   5.959   -62.680 1.00 37.84  ? 36   PRO B O   1 
ATOM   4428 C CB  . PRO B 2 36  ? 5.035   3.132   -63.471 1.00 31.29  ? 36   PRO B CB  1 
ATOM   4429 C CG  . PRO B 2 36  ? 3.749   3.207   -64.293 1.00 34.17  ? 36   PRO B CG  1 
ATOM   4430 C CD  . PRO B 2 36  ? 2.665   3.832   -63.447 1.00 31.35  ? 36   PRO B CD  1 
ATOM   4431 N N   . PHE B 2 37  ? 6.390   5.177   -61.083 1.00 31.99  ? 37   PHE B N   1 
ATOM   4432 C CA  . PHE B 2 37  ? 7.095   6.438   -61.036 1.00 34.93  ? 37   PHE B CA  1 
ATOM   4433 C C   . PHE B 2 37  ? 8.563   6.241   -61.340 1.00 37.23  ? 37   PHE B C   1 
ATOM   4434 O O   . PHE B 2 37  ? 9.313   7.201   -61.397 1.00 29.93  ? 37   PHE B O   1 
ATOM   4435 C CB  . PHE B 2 37  ? 6.887   7.141   -59.687 1.00 33.27  ? 37   PHE B CB  1 
ATOM   4436 C CG  . PHE B 2 37  ? 7.462   6.408   -58.512 1.00 30.81  ? 37   PHE B CG  1 
ATOM   4437 C CD1 . PHE B 2 37  ? 8.777   6.615   -58.124 1.00 29.28  ? 37   PHE B CD1 1 
ATOM   4438 C CD2 . PHE B 2 37  ? 6.671   5.555   -57.751 1.00 31.69  ? 37   PHE B CD2 1 
ATOM   4439 C CE1 . PHE B 2 37  ? 9.307   5.966   -57.000 1.00 31.91  ? 37   PHE B CE1 1 
ATOM   4440 C CE2 . PHE B 2 37  ? 7.174   4.894   -56.625 1.00 29.91  ? 37   PHE B CE2 1 
ATOM   4441 C CZ  . PHE B 2 37  ? 8.517   5.096   -56.250 1.00 32.92  ? 37   PHE B CZ  1 
ATOM   4442 N N   . ALA B 2 38  ? 8.964   4.982   -61.530 1.00 33.47  ? 38   ALA B N   1 
ATOM   4443 C CA  . ALA B 2 38  ? 10.329  4.683   -61.893 1.00 35.53  ? 38   ALA B CA  1 
ATOM   4444 C C   . ALA B 2 38  ? 10.435  3.485   -62.849 1.00 38.69  ? 38   ALA B C   1 
ATOM   4445 O O   . ALA B 2 38  ? 9.558   2.608   -62.887 1.00 37.14  ? 38   ALA B O   1 
ATOM   4446 C CB  . ALA B 2 38  ? 11.139  4.430   -60.635 1.00 37.67  ? 38   ALA B CB  1 
ATOM   4447 N N   . GLU B 2 39  ? 11.527  3.432   -63.600 1.00 36.82  ? 39   GLU B N   1 
ATOM   4448 C CA  . GLU B 2 39  ? 11.877  2.195   -64.275 1.00 36.98  ? 39   GLU B CA  1 
ATOM   4449 C C   . GLU B 2 39  ? 12.030  1.075   -63.233 1.00 38.27  ? 39   GLU B C   1 
ATOM   4450 O O   . GLU B 2 39  ? 12.690  1.235   -62.219 1.00 37.93  ? 39   GLU B O   1 
ATOM   4451 C CB  . GLU B 2 39  ? 13.166  2.368   -65.077 1.00 32.24  ? 39   GLU B CB  1 
ATOM   4452 C CG  . GLU B 2 39  ? 13.027  3.323   -66.241 1.00 30.95  ? 39   GLU B CG  1 
ATOM   4453 C CD  . GLU B 2 39  ? 12.084  2.808   -67.316 1.00 39.97  ? 39   GLU B CD  1 
ATOM   4454 O OE1 . GLU B 2 39  ? 12.497  1.942   -68.124 1.00 41.12  ? 39   GLU B OE1 1 
ATOM   4455 O OE2 . GLU B 2 39  ? 10.924  3.275   -67.362 1.00 40.80  ? 39   GLU B OE2 1 
ATOM   4456 N N   . PRO B 2 40  ? 11.420  -0.073  -63.484 1.00 32.46  ? 40   PRO B N   1 
ATOM   4457 C CA  . PRO B 2 40  ? 11.580  -1.224  -62.582 1.00 34.09  ? 40   PRO B CA  1 
ATOM   4458 C C   . PRO B 2 40  ? 13.066  -1.494  -62.251 1.00 37.24  ? 40   PRO B C   1 
ATOM   4459 O O   . PRO B 2 40  ? 13.894  -1.640  -63.137 1.00 39.37  ? 40   PRO B O   1 
ATOM   4460 C CB  . PRO B 2 40  ? 11.022  -2.380  -63.402 1.00 30.82  ? 40   PRO B CB  1 
ATOM   4461 C CG  . PRO B 2 40  ? 10.045  -1.710  -64.359 1.00 31.51  ? 40   PRO B CG  1 
ATOM   4462 C CD  . PRO B 2 40  ? 10.692  -0.404  -64.713 1.00 32.47  ? 40   PRO B CD  1 
ATOM   4463 N N   . PRO B 2 41  ? 13.401  -1.568  -60.962 1.00 34.25  ? 41   PRO B N   1 
ATOM   4464 C CA  . PRO B 2 41  ? 14.826  -1.593  -60.593 1.00 35.14  ? 41   PRO B CA  1 
ATOM   4465 C C   . PRO B 2 41  ? 15.357  -3.014  -60.596 1.00 39.51  ? 41   PRO B C   1 
ATOM   4466 O O   . PRO B 2 41  ? 15.814  -3.489  -59.552 1.00 41.83  ? 41   PRO B O   1 
ATOM   4467 C CB  . PRO B 2 41  ? 14.809  -1.069  -59.167 1.00 34.70  ? 41   PRO B CB  1 
ATOM   4468 C CG  . PRO B 2 41  ? 13.426  -1.519  -58.662 1.00 34.27  ? 41   PRO B CG  1 
ATOM   4469 C CD  . PRO B 2 41  ? 12.526  -1.252  -59.823 1.00 27.59  ? 41   PRO B CD  1 
ATOM   4470 N N   . VAL B 2 42  ? 15.289  -3.675  -61.747 1.00 39.04  ? 42   VAL B N   1 
ATOM   4471 C CA  . VAL B 2 42  ? 15.576  -5.099  -61.828 1.00 41.42  ? 42   VAL B CA  1 
ATOM   4472 C C   . VAL B 2 42  ? 16.830  -5.391  -62.652 1.00 42.42  ? 42   VAL B C   1 
ATOM   4473 O O   . VAL B 2 42  ? 17.305  -4.549  -63.401 1.00 42.99  ? 42   VAL B O   1 
ATOM   4474 C CB  . VAL B 2 42  ? 14.398  -5.860  -62.453 1.00 40.63  ? 42   VAL B CB  1 
ATOM   4475 C CG1 . VAL B 2 42  ? 13.159  -5.778  -61.527 1.00 41.94  ? 42   VAL B CG1 1 
ATOM   4476 C CG2 . VAL B 2 42  ? 14.109  -5.313  -63.857 1.00 34.08  ? 42   VAL B CG2 1 
ATOM   4477 N N   . GLY B 2 43  ? 17.340  -6.609  -62.540 1.00 44.18  ? 43   GLY B N   1 
ATOM   4478 C CA  . GLY B 2 43  ? 18.523  -6.980  -63.295 1.00 38.81  ? 43   GLY B CA  1 
ATOM   4479 C C   . GLY B 2 43  ? 19.671  -6.103  -62.885 1.00 39.94  ? 43   GLY B C   1 
ATOM   4480 O O   . GLY B 2 43  ? 20.030  -6.048  -61.718 1.00 43.29  ? 43   GLY B O   1 
ATOM   4481 N N   . SER B 2 44  ? 20.254  -5.413  -63.854 1.00 45.03  ? 44   SER B N   1 
ATOM   4482 C CA  . SER B 2 44  ? 21.436  -4.589  -63.619 1.00 47.24  ? 44   SER B CA  1 
ATOM   4483 C C   . SER B 2 44  ? 21.097  -3.377  -62.759 1.00 49.25  ? 44   SER B C   1 
ATOM   4484 O O   . SER B 2 44  ? 21.990  -2.712  -62.222 1.00 48.80  ? 44   SER B O   1 
ATOM   4485 C CB  . SER B 2 44  ? 21.978  -4.086  -64.956 1.00 49.61  ? 44   SER B CB  1 
ATOM   4486 O OG  . SER B 2 44  ? 21.050  -3.153  -65.522 1.00 57.07  ? 44   SER B OG  1 
ATOM   4487 N N   . ARG B 2 45  ? 19.814  -3.046  -62.661 1.00 43.18  ? 45   ARG B N   1 
ATOM   4488 C CA  . ARG B 2 45  ? 19.443  -1.886  -61.858 1.00 45.71  ? 45   ARG B CA  1 
ATOM   4489 C C   . ARG B 2 45  ? 19.275  -2.184  -60.360 1.00 45.92  ? 45   ARG B C   1 
ATOM   4490 O O   . ARG B 2 45  ? 19.038  -1.268  -59.572 1.00 46.80  ? 45   ARG B O   1 
ATOM   4491 C CB  . ARG B 2 45  ? 18.189  -1.217  -62.397 1.00 35.05  ? 45   ARG B CB  1 
ATOM   4492 C CG  . ARG B 2 45  ? 18.278  -0.697  -63.830 1.00 42.85  ? 45   ARG B CG  1 
ATOM   4493 C CD  . ARG B 2 45  ? 16.959  0.007   -64.163 1.00 59.09  ? 45   ARG B CD  1 
ATOM   4494 N NE  . ARG B 2 45  ? 16.720  0.301   -65.576 1.00 74.20  ? 45   ARG B NE  1 
ATOM   4495 C CZ  . ARG B 2 45  ? 15.796  -0.303  -66.335 1.00 77.59  ? 45   ARG B CZ  1 
ATOM   4496 N NH1 . ARG B 2 45  ? 15.008  -1.272  -65.841 1.00 66.48  ? 45   ARG B NH1 1 
ATOM   4497 N NH2 . ARG B 2 45  ? 15.662  0.065   -67.607 1.00 79.10  ? 45   ARG B NH2 1 
ATOM   4498 N N   . ARG B 2 46  ? 19.397  -3.446  -59.965 1.00 38.95  ? 46   ARG B N   1 
ATOM   4499 C CA  . ARG B 2 46  ? 19.363  -3.767  -58.550 1.00 39.96  ? 46   ARG B CA  1 
ATOM   4500 C C   . ARG B 2 46  ? 20.489  -3.031  -57.818 1.00 46.46  ? 46   ARG B C   1 
ATOM   4501 O O   . ARG B 2 46  ? 21.631  -2.989  -58.300 1.00 45.72  ? 46   ARG B O   1 
ATOM   4502 C CB  . ARG B 2 46  ? 19.473  -5.275  -58.322 1.00 41.59  ? 46   ARG B CB  1 
ATOM   4503 C CG  . ARG B 2 46  ? 19.443  -5.657  -56.845 1.00 42.40  ? 46   ARG B CG  1 
ATOM   4504 C CD  . ARG B 2 46  ? 19.708  -7.139  -56.652 1.00 47.70  ? 46   ARG B CD  1 
ATOM   4505 N NE  . ARG B 2 46  ? 18.538  -7.993  -56.890 1.00 43.79  ? 46   ARG B NE  1 
ATOM   4506 C CZ  . ARG B 2 46  ? 18.593  -9.322  -56.887 1.00 46.65  ? 46   ARG B CZ  1 
ATOM   4507 N NH1 . ARG B 2 46  ? 19.759  -9.937  -56.674 1.00 46.39  ? 46   ARG B NH1 1 
ATOM   4508 N NH2 . ARG B 2 46  ? 17.504  -10.045 -57.095 1.00 35.64  ? 46   ARG B NH2 1 
ATOM   4509 N N   . PHE B 2 47  ? 20.144  -2.458  -56.660 1.00 44.92  ? 47   PHE B N   1 
ATOM   4510 C CA  . PHE B 2 47  ? 21.047  -1.675  -55.808 1.00 38.24  ? 47   PHE B CA  1 
ATOM   4511 C C   . PHE B 2 47  ? 21.326  -0.261  -56.337 1.00 35.31  ? 47   PHE B C   1 
ATOM   4512 O O   . PHE B 2 47  ? 21.919  0.536   -55.636 1.00 38.01  ? 47   PHE B O   1 
ATOM   4513 C CB  . PHE B 2 47  ? 22.384  -2.407  -55.545 1.00 42.56  ? 47   PHE B CB  1 
ATOM   4514 C CG  . PHE B 2 47  ? 22.220  -3.829  -55.053 1.00 43.61  ? 47   PHE B CG  1 
ATOM   4515 C CD1 . PHE B 2 47  ? 21.503  -4.099  -53.884 1.00 38.40  ? 47   PHE B CD1 1 
ATOM   4516 C CD2 . PHE B 2 47  ? 22.772  -4.898  -55.761 1.00 37.56  ? 47   PHE B CD2 1 
ATOM   4517 C CE1 . PHE B 2 47  ? 21.334  -5.412  -53.421 1.00 42.23  ? 47   PHE B CE1 1 
ATOM   4518 C CE2 . PHE B 2 47  ? 22.616  -6.219  -55.300 1.00 38.92  ? 47   PHE B CE2 1 
ATOM   4519 C CZ  . PHE B 2 47  ? 21.889  -6.478  -54.132 1.00 39.58  ? 47   PHE B CZ  1 
ATOM   4520 N N   . MET B 2 48  ? 20.929  0.037   -57.569 1.00 32.83  ? 48   MET B N   1 
ATOM   4521 C CA  . MET B 2 48  ? 21.184  1.354   -58.155 1.00 36.41  ? 48   MET B CA  1 
ATOM   4522 C C   . MET B 2 48  ? 20.061  2.374   -57.872 1.00 38.07  ? 48   MET B C   1 
ATOM   4523 O O   . MET B 2 48  ? 18.907  1.989   -57.648 1.00 34.12  ? 48   MET B O   1 
ATOM   4524 C CB  . MET B 2 48  ? 21.347  1.212   -59.666 1.00 38.68  ? 48   MET B CB  1 
ATOM   4525 C CG  . MET B 2 48  ? 22.360  0.142   -60.086 1.00 49.91  ? 48   MET B CG  1 
ATOM   4526 S SD  . MET B 2 48  ? 23.026  0.447   -61.753 1.00 63.83  ? 48   MET B SD  1 
ATOM   4527 C CE  . MET B 2 48  ? 24.259  1.669   -61.264 1.00 62.13  ? 48   MET B CE  1 
ATOM   4528 N N   . PRO B 2 49  ? 20.397  3.675   -57.902 1.00 37.91  ? 49   PRO B N   1 
ATOM   4529 C CA  . PRO B 2 49  ? 19.397  4.761   -57.765 1.00 37.03  ? 49   PRO B CA  1 
ATOM   4530 C C   . PRO B 2 49  ? 18.253  4.544   -58.750 1.00 41.03  ? 49   PRO B C   1 
ATOM   4531 O O   . PRO B 2 49  ? 18.506  3.968   -59.801 1.00 38.40  ? 49   PRO B O   1 
ATOM   4532 C CB  . PRO B 2 49  ? 20.169  6.021   -58.182 1.00 31.68  ? 49   PRO B CB  1 
ATOM   4533 C CG  . PRO B 2 49  ? 21.648  5.682   -57.864 1.00 38.69  ? 49   PRO B CG  1 
ATOM   4534 C CD  . PRO B 2 49  ? 21.774  4.179   -58.104 1.00 36.12  ? 49   PRO B CD  1 
ATOM   4535 N N   . PRO B 2 50  ? 17.018  5.015   -58.431 1.00 36.75  ? 50   PRO B N   1 
ATOM   4536 C CA  . PRO B 2 50  ? 15.919  4.828   -59.382 1.00 33.13  ? 50   PRO B CA  1 
ATOM   4537 C C   . PRO B 2 50  ? 16.092  5.733   -60.577 1.00 37.33  ? 50   PRO B C   1 
ATOM   4538 O O   . PRO B 2 50  ? 16.750  6.758   -60.456 1.00 40.26  ? 50   PRO B O   1 
ATOM   4539 C CB  . PRO B 2 50  ? 14.690  5.274   -58.587 1.00 28.51  ? 50   PRO B CB  1 
ATOM   4540 C CG  . PRO B 2 50  ? 15.254  6.273   -57.607 1.00 33.18  ? 50   PRO B CG  1 
ATOM   4541 C CD  . PRO B 2 50  ? 16.535  5.612   -57.171 1.00 31.07  ? 50   PRO B CD  1 
ATOM   4542 N N   . GLU B 2 51  ? 15.521  5.349   -61.711 1.00 34.24  ? 51   GLU B N   1 
ATOM   4543 C CA  . GLU B 2 51  ? 15.473  6.191   -62.889 1.00 38.71  ? 51   GLU B CA  1 
ATOM   4544 C C   . GLU B 2 51  ? 14.012  6.448   -63.167 1.00 37.88  ? 51   GLU B C   1 
ATOM   4545 O O   . GLU B 2 51  ? 13.152  5.612   -62.856 1.00 34.75  ? 51   GLU B O   1 
ATOM   4546 C CB  . GLU B 2 51  ? 16.099  5.486   -64.101 1.00 43.14  ? 51   GLU B CB  1 
ATOM   4547 C CG  . GLU B 2 51  ? 17.589  5.240   -63.970 1.00 58.65  ? 51   GLU B CG  1 
ATOM   4548 C CD  . GLU B 2 51  ? 18.139  4.400   -65.124 1.00 81.65  ? 51   GLU B CD  1 
ATOM   4549 O OE1 . GLU B 2 51  ? 17.331  3.790   -65.875 1.00 85.53  ? 51   GLU B OE1 1 
ATOM   4550 O OE2 . GLU B 2 51  ? 19.387  4.353   -65.287 1.00 91.57  ? 51   GLU B OE2 1 
ATOM   4551 N N   . PRO B 2 52  ? 13.721  7.607   -63.751 1.00 36.83  ? 52   PRO B N   1 
ATOM   4552 C CA  . PRO B 2 52  ? 12.344  8.039   -64.029 1.00 33.95  ? 52   PRO B CA  1 
ATOM   4553 C C   . PRO B 2 52  ? 11.663  7.085   -64.999 1.00 35.72  ? 52   PRO B C   1 
ATOM   4554 O O   . PRO B 2 52  ? 12.301  6.605   -65.951 1.00 38.36  ? 52   PRO B O   1 
ATOM   4555 C CB  . PRO B 2 52  ? 12.531  9.399   -64.710 1.00 38.55  ? 52   PRO B CB  1 
ATOM   4556 C CG  . PRO B 2 52  ? 13.914  9.902   -64.186 1.00 44.13  ? 52   PRO B CG  1 
ATOM   4557 C CD  . PRO B 2 52  ? 14.740  8.630   -64.055 1.00 39.23  ? 52   PRO B CD  1 
ATOM   4558 N N   . LYS B 2 53  ? 10.381  6.845   -64.777 1.00 34.67  ? 53   LYS B N   1 
ATOM   4559 C CA  . LYS B 2 53  ? 9.581   5.960   -65.633 1.00 39.86  ? 53   LYS B CA  1 
ATOM   4560 C C   . LYS B 2 53  ? 9.444   6.528   -67.031 1.00 39.99  ? 53   LYS B C   1 
ATOM   4561 O O   . LYS B 2 53  ? 9.121   7.705   -67.199 1.00 43.77  ? 53   LYS B O   1 
ATOM   4562 C CB  . LYS B 2 53  ? 8.186   5.738   -65.018 1.00 33.22  ? 53   LYS B CB  1 
ATOM   4563 C CG  . LYS B 2 53  ? 7.161   5.038   -65.928 1.00 35.18  ? 53   LYS B CG  1 
ATOM   4564 C CD  . LYS B 2 53  ? 7.477   3.525   -66.066 1.00 39.83  ? 53   LYS B CD  1 
ATOM   4565 C CE  . LYS B 2 53  ? 6.508   2.826   -67.015 1.00 40.34  ? 53   LYS B CE  1 
ATOM   4566 N NZ  . LYS B 2 53  ? 6.890   2.999   -68.442 1.00 42.65  ? 53   LYS B NZ  1 
ATOM   4567 N N   . ARG B 2 54  ? 9.703   5.700   -68.036 1.00 36.48  ? 54   ARG B N   1 
ATOM   4568 C CA  . ARG B 2 54  ? 9.545   6.125   -69.419 1.00 36.78  ? 54   ARG B CA  1 
ATOM   4569 C C   . ARG B 2 54  ? 8.059   6.315   -69.703 1.00 39.03  ? 54   ARG B C   1 
ATOM   4570 O O   . ARG B 2 54  ? 7.205   5.603   -69.157 1.00 39.24  ? 54   ARG B O   1 
ATOM   4571 C CB  . ARG B 2 54  ? 10.141  5.087   -70.390 1.00 39.00  ? 54   ARG B CB  1 
ATOM   4572 C CG  . ARG B 2 54  ? 11.671  4.912   -70.320 1.00 37.19  ? 54   ARG B CG  1 
ATOM   4573 C CD  . ARG B 2 54  ? 12.122  3.709   -71.192 1.00 37.06  ? 54   ARG B CD  1 
ATOM   4574 N NE  . ARG B 2 54  ? 11.444  2.492   -70.742 1.00 43.94  ? 54   ARG B NE  1 
ATOM   4575 C CZ  . ARG B 2 54  ? 10.625  1.732   -71.479 1.00 45.40  ? 54   ARG B CZ  1 
ATOM   4576 N NH1 . ARG B 2 54  ? 10.049  0.672   -70.918 1.00 43.04  ? 54   ARG B NH1 1 
ATOM   4577 N NH2 . ARG B 2 54  ? 10.404  1.994   -72.772 1.00 42.05  ? 54   ARG B NH2 1 
ATOM   4578 N N   . PRO B 2 55  ? 7.735   7.266   -70.576 1.00 45.31  ? 55   PRO B N   1 
ATOM   4579 C CA  . PRO B 2 55  ? 6.361   7.542   -71.047 1.00 42.20  ? 55   PRO B CA  1 
ATOM   4580 C C   . PRO B 2 55  ? 5.690   6.283   -71.611 1.00 39.32  ? 55   PRO B C   1 
ATOM   4581 O O   . PRO B 2 55  ? 6.379   5.434   -72.157 1.00 43.12  ? 55   PRO B O   1 
ATOM   4582 C CB  . PRO B 2 55  ? 6.584   8.545   -72.172 1.00 48.38  ? 55   PRO B CB  1 
ATOM   4583 C CG  . PRO B 2 55  ? 7.905   9.216   -71.818 1.00 50.75  ? 55   PRO B CG  1 
ATOM   4584 C CD  . PRO B 2 55  ? 8.741   8.141   -71.193 1.00 44.26  ? 55   PRO B CD  1 
ATOM   4585 N N   . TRP B 2 56  ? 4.384   6.135   -71.462 1.00 38.22  ? 56   TRP B N   1 
ATOM   4586 C CA  . TRP B 2 56  ? 3.704   4.941   -71.981 1.00 42.22  ? 56   TRP B CA  1 
ATOM   4587 C C   . TRP B 2 56  ? 2.638   5.356   -72.983 1.00 46.11  ? 56   TRP B C   1 
ATOM   4588 O O   . TRP B 2 56  ? 2.250   6.516   -73.021 1.00 47.68  ? 56   TRP B O   1 
ATOM   4589 C CB  . TRP B 2 56  ? 3.044   4.143   -70.858 1.00 35.84  ? 56   TRP B CB  1 
ATOM   4590 C CG  . TRP B 2 56  ? 2.149   4.977   -70.060 1.00 37.58  ? 56   TRP B CG  1 
ATOM   4591 C CD1 . TRP B 2 56  ? 0.844   5.269   -70.323 1.00 41.86  ? 56   TRP B CD1 1 
ATOM   4592 C CD2 . TRP B 2 56  ? 2.491   5.689   -68.851 1.00 34.24  ? 56   TRP B CD2 1 
ATOM   4593 N NE1 . TRP B 2 56  ? 0.351   6.124   -69.349 1.00 41.57  ? 56   TRP B NE1 1 
ATOM   4594 C CE2 . TRP B 2 56  ? 1.347   6.394   -68.441 1.00 39.09  ? 56   TRP B CE2 1 
ATOM   4595 C CE3 . TRP B 2 56  ? 3.655   5.795   -68.087 1.00 29.80  ? 56   TRP B CE3 1 
ATOM   4596 C CZ2 . TRP B 2 56  ? 1.324   7.183   -67.278 1.00 33.22  ? 56   TRP B CZ2 1 
ATOM   4597 C CZ3 . TRP B 2 56  ? 3.639   6.591   -66.954 1.00 36.68  ? 56   TRP B CZ3 1 
ATOM   4598 C CH2 . TRP B 2 56  ? 2.471   7.283   -66.567 1.00 35.63  ? 56   TRP B CH2 1 
ATOM   4599 N N   . SER B 2 57  ? 2.158   4.400   -73.781 1.00 46.80  ? 57   SER B N   1 
ATOM   4600 C CA  . SER B 2 57  ? 1.097   4.651   -74.756 1.00 43.64  ? 57   SER B CA  1 
ATOM   4601 C C   . SER B 2 57  ? -0.311  4.323   -74.217 1.00 44.63  ? 57   SER B C   1 
ATOM   4602 O O   . SER B 2 57  ? -0.459  3.640   -73.206 1.00 45.53  ? 57   SER B O   1 
ATOM   4603 C CB  . SER B 2 57  ? 1.370   3.838   -76.031 1.00 44.35  ? 57   SER B CB  1 
ATOM   4604 O OG  . SER B 2 57  ? 1.307   2.442   -75.757 1.00 45.52  ? 57   SER B OG  1 
ATOM   4605 N N   . GLY B 2 58  ? -1.346  4.794   -74.908 1.00 40.26  ? 58   GLY B N   1 
ATOM   4606 C CA  . GLY B 2 58  ? -2.713  4.550   -74.483 1.00 41.44  ? 58   GLY B CA  1 
ATOM   4607 C C   . GLY B 2 58  ? -3.048  4.966   -73.061 1.00 42.48  ? 58   GLY B C   1 
ATOM   4608 O O   . GLY B 2 58  ? -2.495  5.933   -72.511 1.00 37.56  ? 58   GLY B O   1 
ATOM   4609 N N   . VAL B 2 59  ? -3.959  4.220   -72.448 1.00 43.94  ? 59   VAL B N   1 
ATOM   4610 C CA  . VAL B 2 59  ? -4.397  4.533   -71.096 1.00 45.07  ? 59   VAL B CA  1 
ATOM   4611 C C   . VAL B 2 59  ? -3.915  3.456   -70.159 1.00 48.85  ? 59   VAL B C   1 
ATOM   4612 O O   . VAL B 2 59  ? -4.313  2.303   -70.289 1.00 50.04  ? 59   VAL B O   1 
ATOM   4613 C CB  . VAL B 2 59  ? -5.939  4.619   -71.008 1.00 44.94  ? 59   VAL B CB  1 
ATOM   4614 C CG1 . VAL B 2 59  ? -6.377  5.123   -69.617 1.00 37.69  ? 59   VAL B CG1 1 
ATOM   4615 C CG2 . VAL B 2 59  ? -6.497  5.527   -72.128 1.00 39.67  ? 59   VAL B CG2 1 
ATOM   4616 N N   . LEU B 2 60  ? -3.039  3.827   -69.226 1.00 49.29  ? 60   LEU B N   1 
ATOM   4617 C CA  . LEU B 2 60  ? -2.522  2.875   -68.231 1.00 45.43  ? 60   LEU B CA  1 
ATOM   4618 C C   . LEU B 2 60  ? -3.550  2.591   -67.133 1.00 38.60  ? 60   LEU B C   1 
ATOM   4619 O O   . LEU B 2 60  ? -4.086  3.497   -66.525 1.00 40.21  ? 60   LEU B O   1 
ATOM   4620 C CB  . LEU B 2 60  ? -1.218  3.397   -67.624 1.00 45.87  ? 60   LEU B CB  1 
ATOM   4621 C CG  . LEU B 2 60  ? -0.475  2.446   -66.678 1.00 50.31  ? 60   LEU B CG  1 
ATOM   4622 C CD1 . LEU B 2 60  ? 1.011   2.788   -66.568 1.00 46.64  ? 60   LEU B CD1 1 
ATOM   4623 C CD2 . LEU B 2 60  ? -1.108  2.486   -65.301 1.00 56.59  ? 60   LEU B CD2 1 
ATOM   4624 N N   . ASP B 2 61  ? -3.828  1.327   -66.884 1.00 38.92  ? 61   ASP B N   1 
ATOM   4625 C CA  . ASP B 2 61  ? -4.788  0.974   -65.865 1.00 44.79  ? 61   ASP B CA  1 
ATOM   4626 C C   . ASP B 2 61  ? -4.217  1.223   -64.453 1.00 41.80  ? 61   ASP B C   1 
ATOM   4627 O O   . ASP B 2 61  ? -3.243  0.610   -64.063 1.00 46.26  ? 61   ASP B O   1 
ATOM   4628 C CB  . ASP B 2 61  ? -5.193  -0.491  -66.041 1.00 53.71  ? 61   ASP B CB  1 
ATOM   4629 C CG  . ASP B 2 61  ? -6.064  -0.989  -64.914 1.00 65.39  ? 61   ASP B CG  1 
ATOM   4630 O OD1 . ASP B 2 61  ? -5.756  -2.055  -64.328 1.00 70.91  ? 61   ASP B OD1 1 
ATOM   4631 O OD2 . ASP B 2 61  ? -7.056  -0.305  -64.609 1.00 73.14  ? 61   ASP B OD2 1 
ATOM   4632 N N   . ALA B 2 62  ? -4.833  2.122   -63.696 1.00 43.48  ? 62   ALA B N   1 
ATOM   4633 C CA  . ALA B 2 62  ? -4.429  2.407   -62.315 1.00 38.42  ? 62   ALA B CA  1 
ATOM   4634 C C   . ALA B 2 62  ? -5.604  2.233   -61.364 1.00 41.91  ? 62   ALA B C   1 
ATOM   4635 O O   . ALA B 2 62  ? -6.005  3.176   -60.668 1.00 39.66  ? 62   ALA B O   1 
ATOM   4636 C CB  . ALA B 2 62  ? -3.889  3.812   -62.209 1.00 34.44  ? 62   ALA B CB  1 
ATOM   4637 N N   . THR B 2 63  ? -6.165  1.032   -61.361 1.00 36.25  ? 63   THR B N   1 
ATOM   4638 C CA  . THR B 2 63  ? -7.378  0.749   -60.610 1.00 41.39  ? 63   THR B CA  1 
ATOM   4639 C C   . THR B 2 63  ? -7.096  -0.288  -59.537 1.00 43.05  ? 63   THR B C   1 
ATOM   4640 O O   . THR B 2 63  ? -8.013  -0.704  -58.811 1.00 38.46  ? 63   THR B O   1 
ATOM   4641 C CB  . THR B 2 63  ? -8.508  0.200   -61.517 1.00 48.86  ? 63   THR B CB  1 
ATOM   4642 O OG1 . THR B 2 63  ? -8.099  -1.053  -62.075 1.00 48.28  ? 63   THR B OG1 1 
ATOM   4643 C CG2 . THR B 2 63  ? -8.814  1.178   -62.644 1.00 51.79  ? 63   THR B CG2 1 
ATOM   4644 N N   . THR B 2 64  ? -5.830  -0.703  -59.441 1.00 35.07  ? 64   THR B N   1 
ATOM   4645 C CA  . THR B 2 64  ? -5.452  -1.741  -58.506 1.00 35.03  ? 64   THR B CA  1 
ATOM   4646 C C   . THR B 2 64  ? -4.013  -1.535  -57.961 1.00 41.71  ? 64   THR B C   1 
ATOM   4647 O O   . THR B 2 64  ? -3.150  -1.055  -58.675 1.00 36.76  ? 64   THR B O   1 
ATOM   4648 C CB  . THR B 2 64  ? -5.551  -3.105  -59.211 1.00 46.05  ? 64   THR B CB  1 
ATOM   4649 O OG1 . THR B 2 64  ? -5.237  -4.128  -58.278 1.00 66.53  ? 64   THR B OG1 1 
ATOM   4650 C CG2 . THR B 2 64  ? -4.547  -3.203  -60.320 1.00 41.53  ? 64   THR B CG2 1 
ATOM   4651 N N   . PHE B 2 65  ? -3.772  -1.909  -56.705 1.00 35.84  ? 65   PHE B N   1 
ATOM   4652 C CA  . PHE B 2 65  ? -2.453  -1.811  -56.094 1.00 43.83  ? 65   PHE B CA  1 
ATOM   4653 C C   . PHE B 2 65  ? -1.442  -2.675  -56.839 1.00 44.69  ? 65   PHE B C   1 
ATOM   4654 O O   . PHE B 2 65  ? -1.734  -3.808  -57.215 1.00 40.34  ? 65   PHE B O   1 
ATOM   4655 C CB  . PHE B 2 65  ? -2.507  -2.269  -54.630 1.00 41.32  ? 65   PHE B CB  1 
ATOM   4656 C CG  . PHE B 2 65  ? -3.190  -1.298  -53.693 1.00 39.93  ? 65   PHE B CG  1 
ATOM   4657 C CD1 . PHE B 2 65  ? -2.673  -0.022  -53.487 1.00 37.76  ? 65   PHE B CD1 1 
ATOM   4658 C CD2 . PHE B 2 65  ? -4.320  -1.682  -52.979 1.00 39.37  ? 65   PHE B CD2 1 
ATOM   4659 C CE1 . PHE B 2 65  ? -3.296  0.867   -52.616 1.00 35.96  ? 65   PHE B CE1 1 
ATOM   4660 C CE2 . PHE B 2 65  ? -4.942  -0.807  -52.094 1.00 34.93  ? 65   PHE B CE2 1 
ATOM   4661 C CZ  . PHE B 2 65  ? -4.444  0.460   -51.920 1.00 34.94  ? 65   PHE B CZ  1 
ATOM   4662 N N   . GLN B 2 66  ? -0.244  -2.149  -57.040 1.00 44.61  ? 66   GLN B N   1 
ATOM   4663 C CA  . GLN B 2 66  ? 0.828   -2.936  -57.650 1.00 39.28  ? 66   GLN B CA  1 
ATOM   4664 C C   . GLN B 2 66  ? 1.538   -3.840  -56.629 1.00 40.39  ? 66   GLN B C   1 
ATOM   4665 O O   . GLN B 2 66  ? 1.156   -3.890  -55.441 1.00 37.74  ? 66   GLN B O   1 
ATOM   4666 C CB  . GLN B 2 66  ? 1.846   -2.019  -58.311 1.00 38.61  ? 66   GLN B CB  1 
ATOM   4667 C CG  . GLN B 2 66  ? 1.617   -1.788  -59.798 1.00 39.27  ? 66   GLN B CG  1 
ATOM   4668 C CD  . GLN B 2 66  ? 1.947   -3.007  -60.634 1.00 46.02  ? 66   GLN B CD  1 
ATOM   4669 O OE1 . GLN B 2 66  ? 2.599   -3.955  -60.157 1.00 49.31  ? 66   GLN B OE1 1 
ATOM   4670 N NE2 . GLN B 2 66  ? 1.514   -2.995  -61.889 1.00 45.41  ? 66   GLN B NE2 1 
ATOM   4671 N N   . ASN B 2 67  ? 2.579   -4.534  -57.098 1.00 36.20  ? 67   ASN B N   1 
ATOM   4672 C CA  . ASN B 2 67  ? 3.331   -5.464  -56.269 1.00 35.57  ? 67   ASN B CA  1 
ATOM   4673 C C   . ASN B 2 67  ? 4.040   -4.786  -55.115 1.00 35.40  ? 67   ASN B C   1 
ATOM   4674 O O   . ASN B 2 67  ? 4.280   -3.581  -55.127 1.00 41.45  ? 67   ASN B O   1 
ATOM   4675 C CB  . ASN B 2 67  ? 4.359   -6.221  -57.090 1.00 38.25  ? 67   ASN B CB  1 
ATOM   4676 C CG  . ASN B 2 67  ? 3.718   -7.150  -58.113 1.00 49.44  ? 67   ASN B CG  1 
ATOM   4677 O OD1 . ASN B 2 67  ? 2.585   -7.600  -57.929 1.00 48.41  ? 67   ASN B OD1 1 
ATOM   4678 N ND2 . ASN B 2 67  ? 4.444   -7.439  -59.194 1.00 43.27  ? 67   ASN B ND2 1 
ATOM   4679 N N   . VAL B 2 68  ? 4.371   -5.592  -54.120 1.00 27.46  ? 68   VAL B N   1 
ATOM   4680 C CA  . VAL B 2 68  ? 5.031   -5.155  -52.921 1.00 28.90  ? 68   VAL B CA  1 
ATOM   4681 C C   . VAL B 2 68  ? 6.511   -5.401  -53.119 1.00 34.09  ? 68   VAL B C   1 
ATOM   4682 O O   . VAL B 2 68  ? 6.914   -6.454  -53.640 1.00 35.83  ? 68   VAL B O   1 
ATOM   4683 C CB  . VAL B 2 68  ? 4.511   -5.961  -51.708 1.00 37.53  ? 68   VAL B CB  1 
ATOM   4684 C CG1 . VAL B 2 68  ? 5.467   -5.838  -50.489 1.00 35.59  ? 68   VAL B CG1 1 
ATOM   4685 C CG2 . VAL B 2 68  ? 3.097   -5.522  -51.354 1.00 32.82  ? 68   VAL B CG2 1 
ATOM   4686 N N   . CYS B 2 69  ? 7.318   -4.417  -52.748 1.00 33.46  ? 69   CYS B N   1 
ATOM   4687 C CA  . CYS B 2 69  ? 8.757   -4.527  -52.899 1.00 29.35  ? 69   CYS B CA  1 
ATOM   4688 C C   . CYS B 2 69  ? 9.226   -5.781  -52.188 1.00 37.59  ? 69   CYS B C   1 
ATOM   4689 O O   . CYS B 2 69  ? 8.725   -6.123  -51.105 1.00 40.29  ? 69   CYS B O   1 
ATOM   4690 C CB  . CYS B 2 69  ? 9.442   -3.276  -52.352 1.00 25.20  ? 69   CYS B CB  1 
ATOM   4691 S SG  . CYS B 2 69  ? 9.270   -1.756  -53.394 1.00 37.68  ? 69   CYS B SG  1 
ATOM   4692 N N   . TYR B 2 70  ? 10.170  -6.484  -52.803 1.00 43.91  ? 70   TYR B N   1 
ATOM   4693 C CA  . TYR B 2 70  ? 10.614  -7.772  -52.275 1.00 38.68  ? 70   TYR B CA  1 
ATOM   4694 C C   . TYR B 2 70  ? 11.163  -7.662  -50.851 1.00 40.78  ? 70   TYR B C   1 
ATOM   4695 O O   . TYR B 2 70  ? 12.020  -6.824  -50.563 1.00 35.61  ? 70   TYR B O   1 
ATOM   4696 C CB  . TYR B 2 70  ? 11.631  -8.450  -53.197 1.00 38.74  ? 70   TYR B CB  1 
ATOM   4697 C CG  . TYR B 2 70  ? 11.503  -9.941  -53.054 1.00 42.60  ? 70   TYR B CG  1 
ATOM   4698 C CD1 . TYR B 2 70  ? 10.671  -10.667 -53.892 1.00 43.13  ? 70   TYR B CD1 1 
ATOM   4699 C CD2 . TYR B 2 70  ? 12.132  -10.610 -52.014 1.00 42.66  ? 70   TYR B CD2 1 
ATOM   4700 C CE1 . TYR B 2 70  ? 10.506  -12.045 -53.725 1.00 44.87  ? 70   TYR B CE1 1 
ATOM   4701 C CE2 . TYR B 2 70  ? 11.969  -11.961 -51.838 1.00 46.00  ? 70   TYR B CE2 1 
ATOM   4702 C CZ  . TYR B 2 70  ? 11.155  -12.685 -52.703 1.00 43.98  ? 70   TYR B CZ  1 
ATOM   4703 O OH  . TYR B 2 70  ? 10.985  -14.040 -52.518 1.00 41.63  ? 70   TYR B OH  1 
ATOM   4704 N N   . GLN B 2 71  ? 10.677  -8.527  -49.960 1.00 41.11  ? 71   GLN B N   1 
ATOM   4705 C CA  . GLN B 2 71  ? 10.969  -8.375  -48.534 1.00 40.01  ? 71   GLN B CA  1 
ATOM   4706 C C   . GLN B 2 71  ? 10.709  -9.631  -47.753 1.00 42.32  ? 71   GLN B C   1 
ATOM   4707 O O   . GLN B 2 71  ? 9.966   -10.524 -48.178 1.00 44.43  ? 71   GLN B O   1 
ATOM   4708 C CB  . GLN B 2 71  ? 10.094  -7.264  -47.906 1.00 30.23  ? 71   GLN B CB  1 
ATOM   4709 C CG  . GLN B 2 71  ? 8.594   -7.606  -47.836 1.00 27.36  ? 71   GLN B CG  1 
ATOM   4710 C CD  . GLN B 2 71  ? 7.735   -6.353  -47.516 1.00 35.69  ? 71   GLN B CD  1 
ATOM   4711 O OE1 . GLN B 2 71  ? 7.129   -6.257  -46.462 1.00 36.43  ? 71   GLN B OE1 1 
ATOM   4712 N NE2 . GLN B 2 71  ? 7.739   -5.383  -48.418 1.00 32.16  ? 71   GLN B NE2 1 
ATOM   4713 N N   . TYR B 2 72  ? 11.298  -9.646  -46.572 1.00 45.26  ? 72   TYR B N   1 
ATOM   4714 C CA  . TYR B 2 72  ? 11.025  -10.638 -45.548 1.00 45.00  ? 72   TYR B CA  1 
ATOM   4715 C C   . TYR B 2 72  ? 9.561   -10.609 -45.103 1.00 44.05  ? 72   TYR B C   1 
ATOM   4716 O O   . TYR B 2 72  ? 8.938   -9.536  -44.968 1.00 41.08  ? 72   TYR B O   1 
ATOM   4717 C CB  . TYR B 2 72  ? 11.945  -10.368 -44.354 1.00 45.31  ? 72   TYR B CB  1 
ATOM   4718 C CG  . TYR B 2 72  ? 11.660  -11.239 -43.167 1.00 57.45  ? 72   TYR B CG  1 
ATOM   4719 C CD1 . TYR B 2 72  ? 10.947  -10.750 -42.070 1.00 62.44  ? 72   TYR B CD1 1 
ATOM   4720 C CD2 . TYR B 2 72  ? 12.084  -12.565 -43.140 1.00 54.49  ? 72   TYR B CD2 1 
ATOM   4721 C CE1 . TYR B 2 72  ? 10.676  -11.562 -40.978 1.00 58.57  ? 72   TYR B CE1 1 
ATOM   4722 C CE2 . TYR B 2 72  ? 11.826  -13.367 -42.057 1.00 53.35  ? 72   TYR B CE2 1 
ATOM   4723 C CZ  . TYR B 2 72  ? 11.126  -12.869 -40.987 1.00 54.89  ? 72   TYR B CZ  1 
ATOM   4724 O OH  . TYR B 2 72  ? 10.875  -13.692 -39.924 1.00 61.13  ? 72   TYR B OH  1 
ATOM   4725 N N   . VAL B 2 73  ? 9.003   -11.792 -44.888 1.00 41.83  ? 73   VAL B N   1 
ATOM   4726 C CA  . VAL B 2 73  ? 7.626   -11.922 -44.450 1.00 39.69  ? 73   VAL B CA  1 
ATOM   4727 C C   . VAL B 2 73  ? 7.625   -12.534 -43.051 1.00 51.46  ? 73   VAL B C   1 
ATOM   4728 O O   . VAL B 2 73  ? 8.218   -13.604 -42.814 1.00 49.49  ? 73   VAL B O   1 
ATOM   4729 C CB  . VAL B 2 73  ? 6.834   -12.819 -45.393 1.00 48.00  ? 73   VAL B CB  1 
ATOM   4730 C CG1 . VAL B 2 73  ? 5.470   -13.125 -44.817 1.00 46.89  ? 73   VAL B CG1 1 
ATOM   4731 C CG2 . VAL B 2 73  ? 6.717   -12.174 -46.770 1.00 52.38  ? 73   VAL B CG2 1 
ATOM   4732 N N   . ASP B 2 74  ? 6.965   -11.851 -42.123 1.00 53.31  ? 74   ASP B N   1 
ATOM   4733 C CA  . ASP B 2 74  ? 6.939   -12.283 -40.733 1.00 55.04  ? 74   ASP B CA  1 
ATOM   4734 C C   . ASP B 2 74  ? 6.103   -13.547 -40.525 1.00 55.66  ? 74   ASP B C   1 
ATOM   4735 O O   . ASP B 2 74  ? 4.965   -13.628 -40.974 1.00 58.54  ? 74   ASP B O   1 
ATOM   4736 C CB  . ASP B 2 74  ? 6.411   -11.158 -39.861 1.00 66.90  ? 74   ASP B CB  1 
ATOM   4737 C CG  . ASP B 2 74  ? 6.432   -11.506 -38.399 1.00 76.90  ? 74   ASP B CG  1 
ATOM   4738 O OD1 . ASP B 2 74  ? 5.513   -11.051 -37.691 1.00 80.20  ? 74   ASP B OD1 1 
ATOM   4739 O OD2 . ASP B 2 74  ? 7.361   -12.234 -37.966 1.00 80.98  ? 74   ASP B OD2 1 
ATOM   4740 N N   . THR B 2 75  ? 6.678   -14.527 -39.837 1.00 55.51  ? 75   THR B N   1 
ATOM   4741 C CA  . THR B 2 75  ? 6.021   -15.815 -39.623 1.00 66.97  ? 75   THR B CA  1 
ATOM   4742 C C   . THR B 2 75  ? 5.940   -16.171 -38.138 1.00 69.13  ? 75   THR B C   1 
ATOM   4743 O O   . THR B 2 75  ? 5.616   -17.305 -37.779 1.00 64.45  ? 75   THR B O   1 
ATOM   4744 C CB  . THR B 2 75  ? 6.766   -16.952 -40.362 1.00 69.77  ? 75   THR B CB  1 
ATOM   4745 O OG1 . THR B 2 75  ? 8.186   -16.777 -40.198 1.00 74.07  ? 75   THR B OG1 1 
ATOM   4746 C CG2 . THR B 2 75  ? 6.405   -16.958 -41.855 1.00 60.34  ? 75   THR B CG2 1 
ATOM   4747 N N   . LEU B 2 76  ? 6.228   -15.188 -37.286 1.00 73.92  ? 76   LEU B N   1 
ATOM   4748 C CA  . LEU B 2 76  ? 6.282   -15.395 -35.843 1.00 77.47  ? 76   LEU B CA  1 
ATOM   4749 C C   . LEU B 2 76  ? 4.978   -15.967 -35.273 1.00 79.33  ? 76   LEU B C   1 
ATOM   4750 O O   . LEU B 2 76  ? 5.002   -16.922 -34.495 1.00 85.52  ? 76   LEU B O   1 
ATOM   4751 C CB  . LEU B 2 76  ? 6.667   -14.098 -35.128 1.00 80.71  ? 76   LEU B CB  1 
ATOM   4752 C CG  . LEU B 2 76  ? 6.494   -14.107 -33.606 1.00 81.50  ? 76   LEU B CG  1 
ATOM   4753 C CD1 . LEU B 2 76  ? 7.338   -15.200 -32.976 1.00 78.06  ? 76   LEU B CD1 1 
ATOM   4754 C CD2 . LEU B 2 76  ? 6.814   -12.745 -33.007 1.00 79.01  ? 76   LEU B CD2 1 
ATOM   4755 N N   . TYR B 2 77  ? 3.841   -15.395 -35.652 1.00 73.06  ? 77   TYR B N   1 
ATOM   4756 C CA  . TYR B 2 77  ? 2.561   -15.974 -35.251 1.00 64.45  ? 77   TYR B CA  1 
ATOM   4757 C C   . TYR B 2 77  ? 1.678   -16.174 -36.476 1.00 66.34  ? 77   TYR B C   1 
ATOM   4758 O O   . TYR B 2 77  ? 0.807   -15.352 -36.761 1.00 58.40  ? 77   TYR B O   1 
ATOM   4759 C CB  . TYR B 2 77  ? 1.849   -15.082 -34.249 1.00 65.53  ? 77   TYR B CB  1 
ATOM   4760 C CG  . TYR B 2 77  ? 2.579   -14.867 -32.938 1.00 67.17  ? 77   TYR B CG  1 
ATOM   4761 C CD1 . TYR B 2 77  ? 2.609   -15.857 -31.960 1.00 66.51  ? 77   TYR B CD1 1 
ATOM   4762 C CD2 . TYR B 2 77  ? 3.199   -13.659 -32.661 1.00 64.00  ? 77   TYR B CD2 1 
ATOM   4763 C CE1 . TYR B 2 77  ? 3.264   -15.654 -30.751 1.00 67.01  ? 77   TYR B CE1 1 
ATOM   4764 C CE2 . TYR B 2 77  ? 3.851   -13.444 -31.459 1.00 68.76  ? 77   TYR B CE2 1 
ATOM   4765 C CZ  . TYR B 2 77  ? 3.883   -14.442 -30.508 1.00 70.08  ? 77   TYR B CZ  1 
ATOM   4766 O OH  . TYR B 2 77  ? 4.528   -14.217 -29.315 1.00 71.00  ? 77   TYR B OH  1 
ATOM   4767 N N   . PRO B 2 78  ? 1.893   -17.286 -37.199 1.00 72.03  ? 78   PRO B N   1 
ATOM   4768 C CA  . PRO B 2 78  ? 1.235   -17.565 -38.483 1.00 69.56  ? 78   PRO B CA  1 
ATOM   4769 C C   . PRO B 2 78  ? -0.282  -17.387 -38.412 1.00 69.40  ? 78   PRO B C   1 
ATOM   4770 O O   . PRO B 2 78  ? -0.919  -18.070 -37.609 1.00 70.74  ? 78   PRO B O   1 
ATOM   4771 C CB  . PRO B 2 78  ? 1.578   -19.038 -38.735 1.00 73.18  ? 78   PRO B CB  1 
ATOM   4772 C CG  . PRO B 2 78  ? 2.874   -19.248 -38.016 1.00 77.30  ? 78   PRO B CG  1 
ATOM   4773 C CD  . PRO B 2 78  ? 2.771   -18.392 -36.772 1.00 76.35  ? 78   PRO B CD  1 
ATOM   4774 N N   . GLY B 2 79  ? -0.840  -16.479 -39.217 1.00 62.66  ? 79   GLY B N   1 
ATOM   4775 C CA  . GLY B 2 79  ? -2.280  -16.290 -39.275 1.00 65.55  ? 79   GLY B CA  1 
ATOM   4776 C C   . GLY B 2 79  ? -2.919  -15.420 -38.201 1.00 69.38  ? 79   GLY B C   1 
ATOM   4777 O O   . GLY B 2 79  ? -4.144  -15.265 -38.181 1.00 71.32  ? 79   GLY B O   1 
ATOM   4778 N N   . PHE B 2 80  ? -2.098  -14.863 -37.311 1.00 62.56  ? 80   PHE B N   1 
ATOM   4779 C CA  . PHE B 2 80  ? -2.546  -13.950 -36.260 1.00 59.69  ? 80   PHE B CA  1 
ATOM   4780 C C   . PHE B 2 80  ? -2.761  -12.553 -36.867 1.00 59.77  ? 80   PHE B C   1 
ATOM   4781 O O   . PHE B 2 80  ? -1.895  -12.057 -37.587 1.00 55.22  ? 80   PHE B O   1 
ATOM   4782 C CB  . PHE B 2 80  ? -1.481  -13.929 -35.155 1.00 56.87  ? 80   PHE B CB  1 
ATOM   4783 C CG  . PHE B 2 80  ? -1.706  -12.897 -34.077 1.00 58.55  ? 80   PHE B CG  1 
ATOM   4784 C CD1 . PHE B 2 80  ? -2.899  -12.850 -33.366 1.00 54.40  ? 80   PHE B CD1 1 
ATOM   4785 C CD2 . PHE B 2 80  ? -0.690  -12.003 -33.741 1.00 59.17  ? 80   PHE B CD2 1 
ATOM   4786 C CE1 . PHE B 2 80  ? -3.093  -11.918 -32.356 1.00 58.89  ? 80   PHE B CE1 1 
ATOM   4787 C CE2 . PHE B 2 80  ? -0.870  -11.066 -32.729 1.00 61.46  ? 80   PHE B CE2 1 
ATOM   4788 C CZ  . PHE B 2 80  ? -2.077  -11.019 -32.033 1.00 60.84  ? 80   PHE B CZ  1 
ATOM   4789 N N   . GLU B 2 81  ? -3.911  -11.930 -36.603 1.00 58.38  ? 81   GLU B N   1 
ATOM   4790 C CA  . GLU B 2 81  ? -4.216  -10.630 -37.211 1.00 61.65  ? 81   GLU B CA  1 
ATOM   4791 C C   . GLU B 2 81  ? -3.190  -9.571  -36.824 1.00 60.89  ? 81   GLU B C   1 
ATOM   4792 O O   . GLU B 2 81  ? -2.808  -8.731  -37.632 1.00 58.21  ? 81   GLU B O   1 
ATOM   4793 C CB  . GLU B 2 81  ? -5.629  -10.145 -36.862 1.00 64.39  ? 81   GLU B CB  1 
ATOM   4794 C CG  . GLU B 2 81  ? -6.109  -8.971  -37.738 1.00 75.62  ? 81   GLU B CG  1 
ATOM   4795 C CD  . GLU B 2 81  ? -6.055  -9.268  -39.257 1.00 89.68  ? 81   GLU B CD  1 
ATOM   4796 O OE1 . GLU B 2 81  ? -6.761  -10.200 -39.715 1.00 96.30  ? 81   GLU B OE1 1 
ATOM   4797 O OE2 . GLU B 2 81  ? -5.321  -8.564  -40.002 1.00 88.80  ? 81   GLU B OE2 1 
ATOM   4798 N N   . GLY B 2 82  ? -2.745  -9.633  -35.577 1.00 62.16  ? 82   GLY B N   1 
ATOM   4799 C CA  . GLY B 2 82  ? -1.755  -8.710  -35.062 1.00 57.10  ? 82   GLY B CA  1 
ATOM   4800 C C   . GLY B 2 82  ? -0.477  -8.622  -35.867 1.00 48.88  ? 82   GLY B C   1 
ATOM   4801 O O   . GLY B 2 82  ? 0.110   -7.560  -35.964 1.00 45.37  ? 82   GLY B O   1 
ATOM   4802 N N   . THR B 2 83  ? -0.031  -9.725  -36.448 1.00 52.12  ? 83   THR B N   1 
ATOM   4803 C CA  . THR B 2 83  ? 1.207   -9.675  -37.218 1.00 51.60  ? 83   THR B CA  1 
ATOM   4804 C C   . THR B 2 83  ? 0.916   -9.590  -38.714 1.00 50.63  ? 83   THR B C   1 
ATOM   4805 O O   . THR B 2 83  ? 1.620   -8.895  -39.461 1.00 46.26  ? 83   THR B O   1 
ATOM   4806 C CB  . THR B 2 83  ? 2.162   -10.853 -36.881 1.00 67.63  ? 83   THR B CB  1 
ATOM   4807 O OG1 . THR B 2 83  ? 1.483   -12.101 -37.069 1.00 71.97  ? 83   THR B OG1 1 
ATOM   4808 C CG2 . THR B 2 83  ? 2.639   -10.757 -35.436 1.00 62.33  ? 83   THR B CG2 1 
ATOM   4809 N N   . GLU B 2 84  ? -0.152  -10.262 -39.132 1.00 49.15  ? 84   GLU B N   1 
ATOM   4810 C CA  . GLU B 2 84  ? -0.483  -10.376 -40.542 1.00 51.58  ? 84   GLU B CA  1 
ATOM   4811 C C   . GLU B 2 84  ? -0.846  -9.033  -41.164 1.00 52.81  ? 84   GLU B C   1 
ATOM   4812 O O   . GLU B 2 84  ? -0.588  -8.812  -42.352 1.00 50.10  ? 84   GLU B O   1 
ATOM   4813 C CB  . GLU B 2 84  ? -1.631  -11.360 -40.743 1.00 52.30  ? 84   GLU B CB  1 
ATOM   4814 C CG  . GLU B 2 84  ? -1.282  -12.782 -40.402 1.00 63.67  ? 84   GLU B CG  1 
ATOM   4815 C CD  . GLU B 2 84  ? -0.290  -13.406 -41.393 1.00 72.47  ? 84   GLU B CD  1 
ATOM   4816 O OE1 . GLU B 2 84  ? 0.015   -12.756 -42.435 1.00 68.22  ? 84   GLU B OE1 1 
ATOM   4817 O OE2 . GLU B 2 84  ? 0.176   -14.553 -41.126 1.00 71.44  ? 84   GLU B OE2 1 
ATOM   4818 N N   . MET B 2 85  ? -1.436  -8.139  -40.372 1.00 48.83  ? 85   MET B N   1 
ATOM   4819 C CA  . MET B 2 85  ? -1.908  -6.857  -40.905 1.00 46.18  ? 85   MET B CA  1 
ATOM   4820 C C   . MET B 2 85  ? -0.735  -6.008  -41.417 1.00 42.76  ? 85   MET B C   1 
ATOM   4821 O O   . MET B 2 85  ? -0.921  -5.043  -42.155 1.00 43.67  ? 85   MET B O   1 
ATOM   4822 C CB  . MET B 2 85  ? -2.714  -6.097  -39.855 1.00 44.82  ? 85   MET B CB  1 
ATOM   4823 C CG  . MET B 2 85  ? -1.913  -5.735  -38.601 1.00 54.09  ? 85   MET B CG  1 
ATOM   4824 S SD  . MET B 2 85  ? -2.801  -4.636  -37.446 1.00 57.59  ? 85   MET B SD  1 
ATOM   4825 C CE  . MET B 2 85  ? -2.864  -3.170  -38.433 1.00 29.33  ? 85   MET B CE  1 
ATOM   4826 N N   . TRP B 2 86  ? 0.469   -6.390  -41.021 1.00 34.90  ? 86   TRP B N   1 
ATOM   4827 C CA  . TRP B 2 86  ? 1.678   -5.727  -41.475 1.00 39.30  ? 86   TRP B CA  1 
ATOM   4828 C C   . TRP B 2 86  ? 2.346   -6.406  -42.670 1.00 46.41  ? 86   TRP B C   1 
ATOM   4829 O O   . TRP B 2 86  ? 3.210   -5.803  -43.308 1.00 40.10  ? 86   TRP B O   1 
ATOM   4830 C CB  . TRP B 2 86  ? 2.666   -5.637  -40.318 1.00 35.58  ? 86   TRP B CB  1 
ATOM   4831 C CG  . TRP B 2 86  ? 2.060   -4.941  -39.134 1.00 43.53  ? 86   TRP B CG  1 
ATOM   4832 C CD1 . TRP B 2 86  ? 1.750   -5.494  -37.928 1.00 44.47  ? 86   TRP B CD1 1 
ATOM   4833 C CD2 . TRP B 2 86  ? 1.658   -3.561  -39.060 1.00 38.24  ? 86   TRP B CD2 1 
ATOM   4834 N NE1 . TRP B 2 86  ? 1.215   -4.541  -37.095 1.00 42.08  ? 86   TRP B NE1 1 
ATOM   4835 C CE2 . TRP B 2 86  ? 1.136   -3.352  -37.765 1.00 41.49  ? 86   TRP B CE2 1 
ATOM   4836 C CE3 . TRP B 2 86  ? 1.709   -2.488  -39.952 1.00 40.19  ? 86   TRP B CE3 1 
ATOM   4837 C CZ2 . TRP B 2 86  ? 0.660   -2.090  -37.335 1.00 41.94  ? 86   TRP B CZ2 1 
ATOM   4838 C CZ3 . TRP B 2 86  ? 1.233   -1.228  -39.526 1.00 39.47  ? 86   TRP B CZ3 1 
ATOM   4839 C CH2 . TRP B 2 86  ? 0.714   -1.047  -38.228 1.00 37.19  ? 86   TRP B CH2 1 
ATOM   4840 N N   . ASN B 2 87  ? 1.949   -7.654  -42.955 1.00 44.17  ? 87   ASN B N   1 
ATOM   4841 C CA  . ASN B 2 87  ? 2.562   -8.462  -44.009 1.00 43.17  ? 87   ASN B CA  1 
ATOM   4842 C C   . ASN B 2 87  ? 2.080   -8.043  -45.404 1.00 41.91  ? 87   ASN B C   1 
ATOM   4843 O O   . ASN B 2 87  ? 0.997   -7.497  -45.544 1.00 41.16  ? 87   ASN B O   1 
ATOM   4844 C CB  . ASN B 2 87  ? 2.247   -9.946  -43.785 1.00 43.98  ? 87   ASN B CB  1 
ATOM   4845 C CG  . ASN B 2 87  ? 3.179   -10.616 -42.776 1.00 53.77  ? 87   ASN B CG  1 
ATOM   4846 O OD1 . ASN B 2 87  ? 4.362   -10.266 -42.646 1.00 53.35  ? 87   ASN B OD1 1 
ATOM   4847 N ND2 . ASN B 2 87  ? 2.646   -11.618 -42.072 1.00 53.95  ? 87   ASN B ND2 1 
ATOM   4848 N N   . PRO B 2 88  ? 2.876   -8.322  -46.445 1.00 40.73  ? 88   PRO B N   1 
ATOM   4849 C CA  . PRO B 2 88  ? 2.474   -7.978  -47.826 1.00 39.39  ? 88   PRO B CA  1 
ATOM   4850 C C   . PRO B 2 88  ? 1.081   -8.507  -48.144 1.00 43.48  ? 88   PRO B C   1 
ATOM   4851 O O   . PRO B 2 88  ? 0.765   -9.691  -47.837 1.00 42.80  ? 88   PRO B O   1 
ATOM   4852 C CB  . PRO B 2 88  ? 3.495   -8.717  -48.697 1.00 33.35  ? 88   PRO B CB  1 
ATOM   4853 C CG  . PRO B 2 88  ? 4.674   -8.948  -47.805 1.00 39.60  ? 88   PRO B CG  1 
ATOM   4854 C CD  . PRO B 2 88  ? 4.146   -9.065  -46.390 1.00 40.27  ? 88   PRO B CD  1 
ATOM   4855 N N   . ASN B 2 89  ? 0.257   -7.657  -48.756 1.00 38.84  ? 89   ASN B N   1 
ATOM   4856 C CA  . ASN B 2 89  ? -1.076  -8.066  -49.176 1.00 44.57  ? 89   ASN B CA  1 
ATOM   4857 C C   . ASN B 2 89  ? -1.212  -8.073  -50.710 1.00 47.06  ? 89   ASN B C   1 
ATOM   4858 O O   . ASN B 2 89  ? -2.327  -8.105  -51.247 1.00 46.64  ? 89   ASN B O   1 
ATOM   4859 C CB  . ASN B 2 89  ? -2.145  -7.182  -48.521 1.00 45.97  ? 89   ASN B CB  1 
ATOM   4860 C CG  . ASN B 2 89  ? -2.066  -5.745  -48.984 1.00 46.86  ? 89   ASN B CG  1 
ATOM   4861 O OD1 . ASN B 2 89  ? -3.036  -4.989  -48.890 1.00 52.94  ? 89   ASN B OD1 1 
ATOM   4862 N ND2 . ASN B 2 89  ? -0.918  -5.368  -49.521 1.00 35.76  ? 89   ASN B ND2 1 
ATOM   4863 N N   . ARG B 2 90  ? -0.077  -8.001  -51.408 1.00 39.44  ? 90   ARG B N   1 
ATOM   4864 C CA  . ARG B 2 90  ? -0.029  -8.230  -52.859 1.00 38.85  ? 90   ARG B CA  1 
ATOM   4865 C C   . ARG B 2 90  ? 1.200   -9.077  -53.137 1.00 43.90  ? 90   ARG B C   1 
ATOM   4866 O O   . ARG B 2 90  ? 1.973   -9.349  -52.225 1.00 40.89  ? 90   ARG B O   1 
ATOM   4867 C CB  . ARG B 2 90  ? 0.037   -6.920  -53.655 1.00 35.84  ? 90   ARG B CB  1 
ATOM   4868 C CG  . ARG B 2 90  ? -1.218  -6.045  -53.569 1.00 39.83  ? 90   ARG B CG  1 
ATOM   4869 C CD  . ARG B 2 90  ? -2.446  -6.798  -54.058 1.00 42.12  ? 90   ARG B CD  1 
ATOM   4870 N NE  . ARG B 2 90  ? -3.641  -5.966  -54.180 1.00 52.70  ? 90   ARG B NE  1 
ATOM   4871 C CZ  . ARG B 2 90  ? -4.498  -5.703  -53.187 1.00 56.95  ? 90   ARG B CZ  1 
ATOM   4872 N NH1 . ARG B 2 90  ? -4.278  -6.192  -51.969 1.00 55.66  ? 90   ARG B NH1 1 
ATOM   4873 N NH2 . ARG B 2 90  ? -5.578  -4.940  -53.408 1.00 52.76  ? 90   ARG B NH2 1 
ATOM   4874 N N   . GLU B 2 91  ? 1.390   -9.483  -54.386 1.00 51.22  ? 91   GLU B N   1 
ATOM   4875 C CA  . GLU B 2 91  ? 2.541   -10.318 -54.761 1.00 50.85  ? 91   GLU B CA  1 
ATOM   4876 C C   . GLU B 2 91  ? 3.854   -9.600  -54.537 1.00 42.36  ? 91   GLU B C   1 
ATOM   4877 O O   . GLU B 2 91  ? 3.953   -8.384  -54.726 1.00 40.79  ? 91   GLU B O   1 
ATOM   4878 C CB  . GLU B 2 91  ? 2.459   -10.724 -56.231 1.00 57.41  ? 91   GLU B CB  1 
ATOM   4879 C CG  . GLU B 2 91  ? 1.343   -11.702 -56.548 1.00 71.54  ? 91   GLU B CG  1 
ATOM   4880 C CD  . GLU B 2 91  ? 1.594   -13.098 -55.982 1.00 81.44  ? 91   GLU B CD  1 
ATOM   4881 O OE1 . GLU B 2 91  ? 2.713   -13.377 -55.487 1.00 76.93  ? 91   GLU B OE1 1 
ATOM   4882 O OE2 . GLU B 2 91  ? 0.659   -13.928 -56.049 1.00 94.39  ? 91   GLU B OE2 1 
ATOM   4883 N N   . LEU B 2 92  ? 4.864   -10.354 -54.133 1.00 41.99  ? 92   LEU B N   1 
ATOM   4884 C CA  . LEU B 2 92  ? 6.182   -9.795  -53.925 1.00 39.43  ? 92   LEU B CA  1 
ATOM   4885 C C   . LEU B 2 92  ? 6.904   -9.637  -55.263 1.00 45.89  ? 92   LEU B C   1 
ATOM   4886 O O   . LEU B 2 92  ? 6.863   -10.526 -56.110 1.00 47.79  ? 92   LEU B O   1 
ATOM   4887 C CB  . LEU B 2 92  ? 6.990   -10.717 -53.043 1.00 37.19  ? 92   LEU B CB  1 
ATOM   4888 C CG  . LEU B 2 92  ? 6.582   -10.982 -51.592 1.00 43.32  ? 92   LEU B CG  1 
ATOM   4889 C CD1 . LEU B 2 92  ? 7.742   -11.737 -50.918 1.00 37.15  ? 92   LEU B CD1 1 
ATOM   4890 C CD2 . LEU B 2 92  ? 6.274   -9.706  -50.846 1.00 41.30  ? 92   LEU B CD2 1 
ATOM   4891 N N   . SER B 2 93  ? 7.597   -8.526  -55.453 1.00 41.33  ? 93   SER B N   1 
ATOM   4892 C CA  . SER B 2 93  ? 8.387   -8.365  -56.661 1.00 35.53  ? 93   SER B CA  1 
ATOM   4893 C C   . SER B 2 93  ? 9.430   -7.270  -56.483 1.00 38.57  ? 93   SER B C   1 
ATOM   4894 O O   . SER B 2 93  ? 9.192   -6.304  -55.754 1.00 44.27  ? 93   SER B O   1 
ATOM   4895 C CB  . SER B 2 93  ? 7.455   -8.026  -57.823 1.00 32.77  ? 93   SER B CB  1 
ATOM   4896 O OG  . SER B 2 93  ? 8.157   -7.853  -59.032 1.00 31.63  ? 93   SER B OG  1 
ATOM   4897 N N   . GLU B 2 94  ? 10.570  -7.389  -57.162 1.00 34.75  ? 94   GLU B N   1 
ATOM   4898 C CA  . GLU B 2 94  ? 11.511  -6.263  -57.245 1.00 29.81  ? 94   GLU B CA  1 
ATOM   4899 C C   . GLU B 2 94  ? 10.980  -5.157  -58.123 1.00 34.27  ? 94   GLU B C   1 
ATOM   4900 O O   . GLU B 2 94  ? 11.417  -4.028  -58.040 1.00 35.62  ? 94   GLU B O   1 
ATOM   4901 C CB  . GLU B 2 94  ? 12.862  -6.709  -57.753 1.00 28.27  ? 94   GLU B CB  1 
ATOM   4902 C CG  . GLU B 2 94  ? 13.573  -7.528  -56.701 1.00 34.15  ? 94   GLU B CG  1 
ATOM   4903 C CD  . GLU B 2 94  ? 14.954  -7.968  -57.152 1.00 40.84  ? 94   GLU B CD  1 
ATOM   4904 O OE1 . GLU B 2 94  ? 15.869  -7.114  -57.212 1.00 37.33  ? 94   GLU B OE1 1 
ATOM   4905 O OE2 . GLU B 2 94  ? 15.105  -9.170  -57.462 1.00 40.93  ? 94   GLU B OE2 1 
ATOM   4906 N N   . ASP B 2 95  ? 10.036  -5.515  -58.982 1.00 32.35  ? 95   ASP B N   1 
ATOM   4907 C CA  . ASP B 2 95  ? 9.388   -4.562  -59.824 1.00 35.46  ? 95   ASP B CA  1 
ATOM   4908 C C   . ASP B 2 95  ? 8.238   -4.020  -58.988 1.00 34.69  ? 95   ASP B C   1 
ATOM   4909 O O   . ASP B 2 95  ? 7.132   -4.552  -59.007 1.00 36.92  ? 95   ASP B O   1 
ATOM   4910 C CB  . ASP B 2 95  ? 8.927   -5.260  -61.087 1.00 31.50  ? 95   ASP B CB  1 
ATOM   4911 C CG  . ASP B 2 95  ? 8.055   -4.396  -61.946 1.00 39.25  ? 95   ASP B CG  1 
ATOM   4912 O OD1 . ASP B 2 95  ? 7.872   -3.199  -61.617 1.00 35.15  ? 95   ASP B OD1 1 
ATOM   4913 O OD2 . ASP B 2 95  ? 7.527   -4.943  -62.945 1.00 42.44  ? 95   ASP B OD2 1 
ATOM   4914 N N   . CYS B 2 96  ? 8.526   -2.986  -58.200 1.00 30.98  ? 96   CYS B N   1 
ATOM   4915 C CA  . CYS B 2 96  ? 7.563   -2.510  -57.203 1.00 30.56  ? 96   CYS B CA  1 
ATOM   4916 C C   . CYS B 2 96  ? 7.496   -0.997  -57.048 1.00 33.18  ? 96   CYS B C   1 
ATOM   4917 O O   . CYS B 2 96  ? 6.901   -0.527  -56.083 1.00 31.61  ? 96   CYS B O   1 
ATOM   4918 C CB  . CYS B 2 96  ? 7.903   -3.074  -55.818 1.00 22.39  ? 96   CYS B CB  1 
ATOM   4919 S SG  . CYS B 2 96  ? 9.605   -2.629  -55.204 1.00 37.48  ? 96   CYS B SG  1 
ATOM   4920 N N   . LEU B 2 97  ? 8.112   -0.236  -57.952 1.00 29.67  ? 97   LEU B N   1 
ATOM   4921 C CA  . LEU B 2 97  ? 8.177   1.216   -57.737 1.00 32.30  ? 97   LEU B CA  1 
ATOM   4922 C C   . LEU B 2 97  ? 6.935   1.894   -58.330 1.00 35.97  ? 97   LEU B C   1 
ATOM   4923 O O   . LEU B 2 97  ? 6.951   2.438   -59.450 1.00 35.50  ? 97   LEU B O   1 
ATOM   4924 C CB  . LEU B 2 97  ? 9.484   1.809   -58.261 1.00 30.48  ? 97   LEU B CB  1 
ATOM   4925 C CG  . LEU B 2 97  ? 10.743  1.299   -57.517 1.00 32.22  ? 97   LEU B CG  1 
ATOM   4926 C CD1 . LEU B 2 97  ? 11.965  2.010   -58.015 1.00 29.55  ? 97   LEU B CD1 1 
ATOM   4927 C CD2 . LEU B 2 97  ? 10.617  1.469   -55.968 1.00 28.65  ? 97   LEU B CD2 1 
ATOM   4928 N N   . TYR B 2 98  ? 5.855   1.841   -57.555 1.00 34.31  ? 98   TYR B N   1 
ATOM   4929 C CA  . TYR B 2 98  ? 4.594   2.455   -57.944 1.00 34.41  ? 98   TYR B CA  1 
ATOM   4930 C C   . TYR B 2 98  ? 4.083   3.306   -56.790 1.00 36.30  ? 98   TYR B C   1 
ATOM   4931 O O   . TYR B 2 98  ? 4.453   3.085   -55.638 1.00 34.91  ? 98   TYR B O   1 
ATOM   4932 C CB  . TYR B 2 98  ? 3.569   1.381   -58.334 1.00 31.28  ? 98   TYR B CB  1 
ATOM   4933 C CG  . TYR B 2 98  ? 4.079   0.442   -59.432 1.00 38.15  ? 98   TYR B CG  1 
ATOM   4934 C CD1 . TYR B 2 98  ? 3.743   0.644   -60.775 1.00 42.20  ? 98   TYR B CD1 1 
ATOM   4935 C CD2 . TYR B 2 98  ? 4.893   -0.632  -59.127 1.00 38.02  ? 98   TYR B CD2 1 
ATOM   4936 C CE1 . TYR B 2 98  ? 4.221   -0.198  -61.778 1.00 40.39  ? 98   TYR B CE1 1 
ATOM   4937 C CE2 . TYR B 2 98  ? 5.382   -1.484  -60.121 1.00 43.21  ? 98   TYR B CE2 1 
ATOM   4938 C CZ  . TYR B 2 98  ? 5.033   -1.264  -61.446 1.00 49.25  ? 98   TYR B CZ  1 
ATOM   4939 O OH  . TYR B 2 98  ? 5.524   -2.095  -62.427 1.00 46.69  ? 98   TYR B OH  1 
ATOM   4940 N N   . LEU B 2 99  ? 3.229   4.276   -57.101 1.00 33.80  ? 99   LEU B N   1 
ATOM   4941 C CA  . LEU B 2 99  ? 2.618   5.063   -56.065 1.00 34.32  ? 99   LEU B CA  1 
ATOM   4942 C C   . LEU B 2 99  ? 1.089   5.117   -56.249 1.00 41.30  ? 99   LEU B C   1 
ATOM   4943 O O   . LEU B 2 99  ? 0.564   4.744   -57.291 1.00 38.55  ? 99   LEU B O   1 
ATOM   4944 C CB  . LEU B 2 99  ? 3.246   6.469   -55.993 1.00 28.22  ? 99   LEU B CB  1 
ATOM   4945 C CG  . LEU B 2 99  ? 3.243   7.361   -57.245 1.00 35.20  ? 99   LEU B CG  1 
ATOM   4946 C CD1 . LEU B 2 99  ? 1.839   7.860   -57.602 1.00 29.12  ? 99   LEU B CD1 1 
ATOM   4947 C CD2 . LEU B 2 99  ? 4.258   8.570   -57.101 1.00 35.22  ? 99   LEU B CD2 1 
ATOM   4948 N N   . ASN B 2 100 ? 0.396   5.607   -55.224 1.00 40.32  ? 100  ASN B N   1 
ATOM   4949 C CA  . ASN B 2 100 ? -1.043  5.629   -55.194 1.00 35.26  ? 100  ASN B CA  1 
ATOM   4950 C C   . ASN B 2 100 ? -1.520  7.035   -54.858 1.00 37.60  ? 100  ASN B C   1 
ATOM   4951 O O   . ASN B 2 100 ? -0.920  7.704   -54.026 1.00 34.61  ? 100  ASN B O   1 
ATOM   4952 C CB  . ASN B 2 100 ? -1.532  4.690   -54.104 1.00 32.20  ? 100  ASN B CB  1 
ATOM   4953 C CG  . ASN B 2 100 ? -0.852  3.329   -54.150 1.00 32.79  ? 100  ASN B CG  1 
ATOM   4954 O OD1 . ASN B 2 100 ? -0.983  2.571   -55.132 1.00 36.99  ? 100  ASN B OD1 1 
ATOM   4955 N ND2 . ASN B 2 100 ? -0.157  2.987   -53.060 1.00 28.43  ? 100  ASN B ND2 1 
ATOM   4956 N N   . VAL B 2 101 ? -2.603  7.475   -55.505 1.00 40.62  ? 101  VAL B N   1 
ATOM   4957 C CA  . VAL B 2 101 ? -3.194  8.777   -55.234 1.00 37.51  ? 101  VAL B CA  1 
ATOM   4958 C C   . VAL B 2 101 ? -4.696  8.620   -54.983 1.00 36.44  ? 101  VAL B C   1 
ATOM   4959 O O   . VAL B 2 101 ? -5.394  8.017   -55.781 1.00 37.25  ? 101  VAL B O   1 
ATOM   4960 C CB  . VAL B 2 101 ? -3.020  9.742   -56.438 1.00 43.55  ? 101  VAL B CB  1 
ATOM   4961 C CG1 . VAL B 2 101 ? -3.648  11.078  -56.136 1.00 35.95  ? 101  VAL B CG1 1 
ATOM   4962 C CG2 . VAL B 2 101 ? -1.514  9.920   -56.841 1.00 29.56  ? 101  VAL B CG2 1 
ATOM   4963 N N   . TRP B 2 102 ? -5.185  9.158   -53.874 1.00 34.66  ? 102  TRP B N   1 
ATOM   4964 C CA  . TRP B 2 102 ? -6.618  9.296   -53.653 1.00 34.95  ? 102  TRP B CA  1 
ATOM   4965 C C   . TRP B 2 102 ? -6.981  10.771  -53.699 1.00 40.75  ? 102  TRP B C   1 
ATOM   4966 O O   . TRP B 2 102 ? -6.254  11.591  -53.123 1.00 43.59  ? 102  TRP B O   1 
ATOM   4967 C CB  . TRP B 2 102 ? -6.975  8.820   -52.261 1.00 34.70  ? 102  TRP B CB  1 
ATOM   4968 C CG  . TRP B 2 102 ? -6.942  7.359   -52.069 1.00 34.54  ? 102  TRP B CG  1 
ATOM   4969 C CD1 . TRP B 2 102 ? -7.994  6.487   -52.215 1.00 35.24  ? 102  TRP B CD1 1 
ATOM   4970 C CD2 . TRP B 2 102 ? -5.821  6.580   -51.663 1.00 33.02  ? 102  TRP B CD2 1 
ATOM   4971 N NE1 . TRP B 2 102 ? -7.589  5.218   -51.910 1.00 39.58  ? 102  TRP B NE1 1 
ATOM   4972 C CE2 . TRP B 2 102 ? -6.255  5.242   -51.589 1.00 36.04  ? 102  TRP B CE2 1 
ATOM   4973 C CE3 . TRP B 2 102 ? -4.483  6.882   -51.364 1.00 32.10  ? 102  TRP B CE3 1 
ATOM   4974 C CZ2 . TRP B 2 102 ? -5.399  4.207   -51.224 1.00 30.72  ? 102  TRP B CZ2 1 
ATOM   4975 C CZ3 . TRP B 2 102 ? -3.640  5.861   -50.997 1.00 35.49  ? 102  TRP B CZ3 1 
ATOM   4976 C CH2 . TRP B 2 102 ? -4.096  4.539   -50.919 1.00 36.27  ? 102  TRP B CH2 1 
ATOM   4977 N N   . THR B 2 103 ? -8.094  11.121  -54.353 1.00 38.71  ? 103  THR B N   1 
ATOM   4978 C CA  . THR B 2 103 ? -8.587  12.504  -54.336 1.00 42.47  ? 103  THR B CA  1 
ATOM   4979 C C   . THR B 2 103 ? -10.079 12.488  -54.089 1.00 48.58  ? 103  THR B C   1 
ATOM   4980 O O   . THR B 2 103 ? -10.715 11.445  -54.249 1.00 50.40  ? 103  THR B O   1 
ATOM   4981 C CB  . THR B 2 103 ? -8.360  13.263  -55.664 1.00 45.13  ? 103  THR B CB  1 
ATOM   4982 O OG1 . THR B 2 103 ? -9.082  12.614  -56.716 1.00 57.63  ? 103  THR B OG1 1 
ATOM   4983 C CG2 . THR B 2 103 ? -6.928  13.260  -56.045 1.00 52.56  ? 103  THR B CG2 1 
ATOM   4984 N N   . PRO B 2 104 ? -10.646 13.647  -53.691 1.00 49.19  ? 104  PRO B N   1 
ATOM   4985 C CA  . PRO B 2 104 ? -12.097 13.822  -53.671 1.00 47.66  ? 104  PRO B CA  1 
ATOM   4986 C C   . PRO B 2 104 ? -12.676 13.536  -55.050 1.00 50.45  ? 104  PRO B C   1 
ATOM   4987 O O   . PRO B 2 104 ? -11.983 13.715  -56.051 1.00 56.33  ? 104  PRO B O   1 
ATOM   4988 C CB  . PRO B 2 104 ? -12.247 15.309  -53.349 1.00 44.44  ? 104  PRO B CB  1 
ATOM   4989 C CG  . PRO B 2 104 ? -11.051 15.619  -52.558 1.00 44.37  ? 104  PRO B CG  1 
ATOM   4990 C CD  . PRO B 2 104 ? -9.964  14.876  -53.259 1.00 42.00  ? 104  PRO B CD  1 
ATOM   4991 N N   . TYR B 2 105 ? -13.920 13.074  -55.074 1.00 51.24  ? 105  TYR B N   1 
ATOM   4992 C CA  . TYR B 2 105 ? -14.689 12.831  -56.283 1.00 51.06  ? 105  TYR B CA  1 
ATOM   4993 C C   . TYR B 2 105 ? -15.965 13.636  -56.123 1.00 54.27  ? 105  TYR B C   1 
ATOM   4994 O O   . TYR B 2 105 ? -16.747 13.359  -55.211 1.00 57.53  ? 105  TYR B O   1 
ATOM   4995 C CB  . TYR B 2 105 ? -15.074 11.351  -56.371 1.00 46.02  ? 105  TYR B CB  1 
ATOM   4996 C CG  . TYR B 2 105 ? -15.917 11.018  -57.580 1.00 48.46  ? 105  TYR B CG  1 
ATOM   4997 C CD1 . TYR B 2 105 ? -15.428 10.186  -58.578 1.00 49.84  ? 105  TYR B CD1 1 
ATOM   4998 C CD2 . TYR B 2 105 ? -17.189 11.559  -57.743 1.00 51.12  ? 105  TYR B CD2 1 
ATOM   4999 C CE1 . TYR B 2 105 ? -16.171 9.888   -59.692 1.00 53.40  ? 105  TYR B CE1 1 
ATOM   5000 C CE2 . TYR B 2 105 ? -17.947 11.265  -58.857 1.00 56.54  ? 105  TYR B CE2 1 
ATOM   5001 C CZ  . TYR B 2 105 ? -17.426 10.427  -59.834 1.00 61.36  ? 105  TYR B CZ  1 
ATOM   5002 O OH  . TYR B 2 105 ? -18.156 10.121  -60.953 1.00 64.14  ? 105  TYR B OH  1 
ATOM   5003 N N   . PRO B 2 106 ? -16.206 14.625  -57.002 1.00 57.28  ? 106  PRO B N   1 
ATOM   5004 C CA  . PRO B 2 106 ? -15.409 15.010  -58.173 1.00 57.15  ? 106  PRO B CA  1 
ATOM   5005 C C   . PRO B 2 106 ? -14.122 15.644  -57.699 1.00 55.40  ? 106  PRO B C   1 
ATOM   5006 O O   . PRO B 2 106 ? -14.033 15.973  -56.523 1.00 55.68  ? 106  PRO B O   1 
ATOM   5007 C CB  . PRO B 2 106 ? -16.282 16.066  -58.859 1.00 52.08  ? 106  PRO B CB  1 
ATOM   5008 C CG  . PRO B 2 106 ? -17.047 16.673  -57.749 1.00 50.75  ? 106  PRO B CG  1 
ATOM   5009 C CD  . PRO B 2 106 ? -17.284 15.593  -56.728 1.00 50.27  ? 106  PRO B CD  1 
ATOM   5010 N N   . ARG B 2 107 ? -13.159 15.832  -58.592 1.00 58.53  ? 107  ARG B N   1 
ATOM   5011 C CA  . ARG B 2 107 ? -11.833 16.248  -58.176 1.00 60.66  ? 107  ARG B CA  1 
ATOM   5012 C C   . ARG B 2 107 ? -11.785 17.724  -57.775 1.00 61.76  ? 107  ARG B C   1 
ATOM   5013 O O   . ARG B 2 107 ? -12.501 18.549  -58.331 1.00 65.17  ? 107  ARG B O   1 
ATOM   5014 C CB  . ARG B 2 107 ? -10.781 15.864  -59.231 1.00 66.41  ? 107  ARG B CB  1 
ATOM   5015 C CG  . ARG B 2 107 ? -10.356 16.926  -60.233 1.00 73.23  ? 107  ARG B CG  1 
ATOM   5016 C CD  . ARG B 2 107 ? -9.178  16.385  -61.060 1.00 78.09  ? 107  ARG B CD  1 
ATOM   5017 N NE  . ARG B 2 107 ? -9.463  15.027  -61.544 1.00 79.31  ? 107  ARG B NE  1 
ATOM   5018 C CZ  . ARG B 2 107 ? -9.350  14.616  -62.807 1.00 78.06  ? 107  ARG B CZ  1 
ATOM   5019 N NH1 . ARG B 2 107 ? -9.656  13.368  -63.119 1.00 77.66  ? 107  ARG B NH1 1 
ATOM   5020 N NH2 . ARG B 2 107 ? -8.910  15.431  -63.756 1.00 78.42  ? 107  ARG B NH2 1 
ATOM   5021 N N   . PRO B 2 108 ? -10.938 18.056  -56.796 1.00 58.60  ? 108  PRO B N   1 
ATOM   5022 C CA  . PRO B 2 108 ? -10.963 19.403  -56.221 1.00 61.83  ? 108  PRO B CA  1 
ATOM   5023 C C   . PRO B 2 108 ? -11.048 20.486  -57.303 1.00 67.96  ? 108  PRO B C   1 
ATOM   5024 O O   . PRO B 2 108 ? -10.330 20.426  -58.306 1.00 66.70  ? 108  PRO B O   1 
ATOM   5025 C CB  . PRO B 2 108 ? -9.622  19.500  -55.486 1.00 59.06  ? 108  PRO B CB  1 
ATOM   5026 C CG  . PRO B 2 108 ? -9.259  18.075  -55.160 1.00 57.39  ? 108  PRO B CG  1 
ATOM   5027 C CD  . PRO B 2 108 ? -9.815  17.244  -56.297 1.00 52.64  ? 108  PRO B CD  1 
ATOM   5028 N N   . ALA B 2 109 ? -11.922 21.464  -57.090 1.00 66.74  ? 109  ALA B N   1 
ATOM   5029 C CA  . ALA B 2 109 ? -12.030 22.603  -57.987 1.00 74.98  ? 109  ALA B CA  1 
ATOM   5030 C C   . ALA B 2 109 ? -10.862 23.564  -57.792 1.00 72.99  ? 109  ALA B C   1 
ATOM   5031 O O   . ALA B 2 109 ? -10.451 24.256  -58.723 1.00 73.58  ? 109  ALA B O   1 
ATOM   5032 C CB  . ALA B 2 109 ? -13.340 23.321  -57.760 1.00 80.47  ? 109  ALA B CB  1 
ATOM   5033 N N   . SER B 2 110 ? -10.337 23.624  -56.576 1.00 67.38  ? 110  SER B N   1 
ATOM   5034 C CA  . SER B 2 110 ? -9.163  24.450  -56.326 1.00 63.18  ? 110  SER B CA  1 
ATOM   5035 C C   . SER B 2 110 ? -8.045  23.589  -55.741 1.00 55.79  ? 110  SER B C   1 
ATOM   5036 O O   . SER B 2 110 ? -8.306  22.570  -55.119 1.00 61.77  ? 110  SER B O   1 
ATOM   5037 C CB  . SER B 2 110 ? -9.510  25.634  -55.417 1.00 61.42  ? 110  SER B CB  1 
ATOM   5038 O OG  . SER B 2 110 ? -10.119 25.196  -54.218 1.00 65.53  ? 110  SER B OG  1 
ATOM   5039 N N   . PRO B 2 111 ? -6.793  23.977  -55.978 1.00 48.58  ? 111  PRO B N   1 
ATOM   5040 C CA  . PRO B 2 111 ? -5.629  23.233  -55.485 1.00 47.88  ? 111  PRO B CA  1 
ATOM   5041 C C   . PRO B 2 111 ? -5.701  22.853  -54.000 1.00 47.29  ? 111  PRO B C   1 
ATOM   5042 O O   . PRO B 2 111 ? -5.798  23.710  -53.133 1.00 46.91  ? 111  PRO B O   1 
ATOM   5043 C CB  . PRO B 2 111 ? -4.480  24.210  -55.737 1.00 45.67  ? 111  PRO B CB  1 
ATOM   5044 C CG  . PRO B 2 111 ? -4.893  24.918  -56.986 1.00 44.12  ? 111  PRO B CG  1 
ATOM   5045 C CD  . PRO B 2 111 ? -6.394  25.106  -56.834 1.00 48.53  ? 111  PRO B CD  1 
ATOM   5046 N N   . THR B 2 112 ? -5.620  21.558  -53.717 1.00 48.21  ? 112  THR B N   1 
ATOM   5047 C CA  . THR B 2 112 ? -5.757  21.052  -52.355 1.00 47.59  ? 112  THR B CA  1 
ATOM   5048 C C   . THR B 2 112 ? -4.414  20.650  -51.728 1.00 40.58  ? 112  THR B C   1 
ATOM   5049 O O   . THR B 2 112 ? -3.609  20.054  -52.406 1.00 42.40  ? 112  THR B O   1 
ATOM   5050 C CB  . THR B 2 112 ? -6.614  19.785  -52.400 1.00 47.95  ? 112  THR B CB  1 
ATOM   5051 O OG1 . THR B 2 112 ? -7.703  20.025  -53.276 1.00 61.56  ? 112  THR B OG1 1 
ATOM   5052 C CG2 . THR B 2 112 ? -7.149  19.465  -51.047 1.00 43.77  ? 112  THR B CG2 1 
ATOM   5053 N N   . PRO B 2 113 ? -4.214  20.925  -50.422 1.00 35.63  ? 113  PRO B N   1 
ATOM   5054 C CA  . PRO B 2 113 ? -3.086  20.374  -49.657 1.00 36.68  ? 113  PRO B CA  1 
ATOM   5055 C C   . PRO B 2 113 ? -2.901  18.900  -49.947 1.00 37.45  ? 113  PRO B C   1 
ATOM   5056 O O   . PRO B 2 113 ? -3.890  18.169  -50.010 1.00 40.29  ? 113  PRO B O   1 
ATOM   5057 C CB  . PRO B 2 113 ? -3.523  20.538  -48.200 1.00 29.96  ? 113  PRO B CB  1 
ATOM   5058 C CG  . PRO B 2 113 ? -4.369  21.805  -48.252 1.00 40.17  ? 113  PRO B CG  1 
ATOM   5059 C CD  . PRO B 2 113 ? -5.052  21.823  -49.605 1.00 39.09  ? 113  PRO B CD  1 
ATOM   5060 N N   . VAL B 2 114 ? -1.651  18.489  -50.128 1.00 31.81  ? 114  VAL B N   1 
ATOM   5061 C CA  . VAL B 2 114 ? -1.310  17.096  -50.390 1.00 30.68  ? 114  VAL B CA  1 
ATOM   5062 C C   . VAL B 2 114 ? -0.631  16.459  -49.178 1.00 32.48  ? 114  VAL B C   1 
ATOM   5063 O O   . VAL B 2 114 ? 0.245   17.051  -48.578 1.00 34.48  ? 114  VAL B O   1 
ATOM   5064 C CB  . VAL B 2 114 ? -0.329  16.996  -51.572 1.00 34.16  ? 114  VAL B CB  1 
ATOM   5065 C CG1 . VAL B 2 114 ? -0.022  15.499  -51.904 1.00 28.48  ? 114  VAL B CG1 1 
ATOM   5066 C CG2 . VAL B 2 114 ? -0.895  17.734  -52.775 1.00 33.68  ? 114  VAL B CG2 1 
ATOM   5067 N N   . LEU B 2 115 ? -1.017  15.243  -48.826 1.00 32.41  ? 115  LEU B N   1 
ATOM   5068 C CA  . LEU B 2 115 ? -0.337  14.522  -47.769 1.00 29.34  ? 115  LEU B CA  1 
ATOM   5069 C C   . LEU B 2 115 ? 0.318   13.332  -48.463 1.00 39.64  ? 115  LEU B C   1 
ATOM   5070 O O   . LEU B 2 115 ? -0.337  12.644  -49.256 1.00 36.43  ? 115  LEU B O   1 
ATOM   5071 C CB  . LEU B 2 115 ? -1.336  14.019  -46.730 1.00 31.98  ? 115  LEU B CB  1 
ATOM   5072 C CG  . LEU B 2 115 ? -1.766  14.954  -45.595 1.00 44.74  ? 115  LEU B CG  1 
ATOM   5073 C CD1 . LEU B 2 115 ? -3.144  14.657  -45.130 1.00 48.05  ? 115  LEU B CD1 1 
ATOM   5074 C CD2 . LEU B 2 115 ? -0.852  14.802  -44.424 1.00 48.67  ? 115  LEU B CD2 1 
ATOM   5075 N N   . ILE B 2 116 ? 1.598   13.093  -48.171 1.00 32.10  ? 116  ILE B N   1 
ATOM   5076 C CA  . ILE B 2 116 ? 2.310   11.962  -48.739 1.00 32.31  ? 116  ILE B CA  1 
ATOM   5077 C C   . ILE B 2 116 ? 2.744   11.035  -47.620 1.00 34.09  ? 116  ILE B C   1 
ATOM   5078 O O   . ILE B 2 116 ? 3.450   11.462  -46.719 1.00 34.27  ? 116  ILE B O   1 
ATOM   5079 C CB  . ILE B 2 116 ? 3.573   12.432  -49.432 1.00 36.12  ? 116  ILE B CB  1 
ATOM   5080 C CG1 . ILE B 2 116 ? 3.233   13.565  -50.414 1.00 33.67  ? 116  ILE B CG1 1 
ATOM   5081 C CG2 . ILE B 2 116 ? 4.287   11.250  -50.103 1.00 22.44  ? 116  ILE B CG2 1 
ATOM   5082 C CD1 . ILE B 2 116 ? 4.302   13.868  -51.423 1.00 28.35  ? 116  ILE B CD1 1 
ATOM   5083 N N   . TRP B 2 117 ? 2.291   9.788   -47.668 1.00 30.98  ? 117  TRP B N   1 
ATOM   5084 C CA  . TRP B 2 117 ? 2.558   8.815   -46.640 1.00 27.64  ? 117  TRP B CA  1 
ATOM   5085 C C   . TRP B 2 117 ? 3.758   7.924   -46.973 1.00 32.40  ? 117  TRP B C   1 
ATOM   5086 O O   . TRP B 2 117 ? 3.883   7.430   -48.080 1.00 29.77  ? 117  TRP B O   1 
ATOM   5087 C CB  . TRP B 2 117 ? 1.356   7.910   -46.473 1.00 29.41  ? 117  TRP B CB  1 
ATOM   5088 C CG  . TRP B 2 117 ? 1.618   6.797   -45.529 1.00 31.48  ? 117  TRP B CG  1 
ATOM   5089 C CD1 . TRP B 2 117 ? 1.854   5.479   -45.840 1.00 31.92  ? 117  TRP B CD1 1 
ATOM   5090 C CD2 . TRP B 2 117 ? 1.696   6.900   -44.096 1.00 29.59  ? 117  TRP B CD2 1 
ATOM   5091 N NE1 . TRP B 2 117 ? 2.068   4.756   -44.675 1.00 36.53  ? 117  TRP B NE1 1 
ATOM   5092 C CE2 . TRP B 2 117 ? 1.975   5.605   -43.595 1.00 34.59  ? 117  TRP B CE2 1 
ATOM   5093 C CE3 . TRP B 2 117 ? 1.535   7.960   -43.187 1.00 27.43  ? 117  TRP B CE3 1 
ATOM   5094 C CZ2 . TRP B 2 117 ? 2.097   5.344   -42.231 1.00 26.93  ? 117  TRP B CZ2 1 
ATOM   5095 C CZ3 . TRP B 2 117 ? 1.654   7.698   -41.817 1.00 23.74  ? 117  TRP B CZ3 1 
ATOM   5096 C CH2 . TRP B 2 117 ? 1.931   6.394   -41.359 1.00 32.00  ? 117  TRP B CH2 1 
ATOM   5097 N N   . ILE B 2 118 ? 4.608   7.692   -45.986 1.00 29.98  ? 118  ILE B N   1 
ATOM   5098 C CA  . ILE B 2 118 ? 5.792   6.857   -46.161 1.00 31.69  ? 118  ILE B CA  1 
ATOM   5099 C C   . ILE B 2 118 ? 5.740   5.751   -45.100 1.00 28.92  ? 118  ILE B C   1 
ATOM   5100 O O   . ILE B 2 118 ? 5.947   5.994   -43.902 1.00 29.07  ? 118  ILE B O   1 
ATOM   5101 C CB  . ILE B 2 118 ? 7.084   7.685   -45.993 1.00 26.72  ? 118  ILE B CB  1 
ATOM   5102 C CG1 . ILE B 2 118 ? 7.095   8.862   -46.987 1.00 28.61  ? 118  ILE B CG1 1 
ATOM   5103 C CG2 . ILE B 2 118 ? 8.356   6.775   -46.190 1.00 28.03  ? 118  ILE B CG2 1 
ATOM   5104 C CD1 . ILE B 2 118 ? 8.404   9.735   -46.835 1.00 24.42  ? 118  ILE B CD1 1 
ATOM   5105 N N   . TYR B 2 119 ? 5.438   4.537   -45.521 1.00 28.33  ? 119  TYR B N   1 
ATOM   5106 C CA  . TYR B 2 119 ? 5.237   3.465   -44.540 1.00 32.06  ? 119  TYR B CA  1 
ATOM   5107 C C   . TYR B 2 119 ? 6.494   3.143   -43.762 1.00 28.56  ? 119  TYR B C   1 
ATOM   5108 O O   . TYR B 2 119 ? 7.583   3.472   -44.202 1.00 26.33  ? 119  TYR B O   1 
ATOM   5109 C CB  . TYR B 2 119 ? 4.721   2.185   -45.214 1.00 32.21  ? 119  TYR B CB  1 
ATOM   5110 C CG  . TYR B 2 119 ? 5.551   1.674   -46.376 1.00 27.58  ? 119  TYR B CG  1 
ATOM   5111 C CD1 . TYR B 2 119 ? 6.743   1.000   -46.155 1.00 35.92  ? 119  TYR B CD1 1 
ATOM   5112 C CD2 . TYR B 2 119 ? 5.116   1.822   -47.687 1.00 28.98  ? 119  TYR B CD2 1 
ATOM   5113 C CE1 . TYR B 2 119 ? 7.490   0.493   -47.213 1.00 39.05  ? 119  TYR B CE1 1 
ATOM   5114 C CE2 . TYR B 2 119 ? 5.868   1.360   -48.749 1.00 32.29  ? 119  TYR B CE2 1 
ATOM   5115 C CZ  . TYR B 2 119 ? 7.044   0.667   -48.506 1.00 35.95  ? 119  TYR B CZ  1 
ATOM   5116 O OH  . TYR B 2 119 ? 7.796   0.153   -49.547 1.00 37.97  ? 119  TYR B OH  1 
ATOM   5117 N N   . GLY B 2 120 ? 6.319   2.512   -42.605 1.00 30.35  ? 120  GLY B N   1 
ATOM   5118 C CA  . GLY B 2 120 ? 7.428   1.993   -41.823 1.00 36.28  ? 120  GLY B CA  1 
ATOM   5119 C C   . GLY B 2 120 ? 7.562   0.484   -42.013 1.00 34.64  ? 120  GLY B C   1 
ATOM   5120 O O   . GLY B 2 120 ? 7.019   -0.056  -42.982 1.00 36.06  ? 120  GLY B O   1 
ATOM   5121 N N   . GLY B 2 121 ? 8.250   -0.193  -41.092 1.00 34.83  ? 121  GLY B N   1 
ATOM   5122 C CA  . GLY B 2 121 ? 8.691   -1.582  -41.312 1.00 33.64  ? 121  GLY B CA  1 
ATOM   5123 C C   . GLY B 2 121 ? 10.200  -1.815  -41.215 1.00 34.04  ? 121  GLY B C   1 
ATOM   5124 O O   . GLY B 2 121 ? 10.753  -2.767  -41.812 1.00 40.41  ? 121  GLY B O   1 
ATOM   5125 N N   . GLY B 2 122 ? 10.885  -0.965  -40.445 1.00 35.27  ? 122  GLY B N   1 
ATOM   5126 C CA  . GLY B 2 122 ? 12.291  -1.187  -40.099 1.00 31.55  ? 122  GLY B CA  1 
ATOM   5127 C C   . GLY B 2 122 ? 13.257  -1.123  -41.274 1.00 34.40  ? 122  GLY B C   1 
ATOM   5128 O O   . GLY B 2 122 ? 14.404  -1.573  -41.174 1.00 37.22  ? 122  GLY B O   1 
ATOM   5129 N N   . PHE B 2 123 ? 12.786  -0.585  -42.401 1.00 29.65  ? 123  PHE B N   1 
ATOM   5130 C CA  . PHE B 2 123 ? 13.594  -0.502  -43.622 1.00 30.00  ? 123  PHE B CA  1 
ATOM   5131 C C   . PHE B 2 123 ? 13.819  -1.855  -44.261 1.00 34.17  ? 123  PHE B C   1 
ATOM   5132 O O   . PHE B 2 123 ? 14.570  -1.936  -45.220 1.00 40.16  ? 123  PHE B O   1 
ATOM   5133 C CB  . PHE B 2 123 ? 14.962  0.163   -43.379 1.00 25.28  ? 123  PHE B CB  1 
ATOM   5134 C CG  . PHE B 2 123 ? 14.882  1.663   -43.067 1.00 30.56  ? 123  PHE B CG  1 
ATOM   5135 C CD1 . PHE B 2 123 ? 14.437  2.569   -44.035 1.00 28.57  ? 123  PHE B CD1 1 
ATOM   5136 C CD2 . PHE B 2 123 ? 15.295  2.159   -41.821 1.00 30.51  ? 123  PHE B CD2 1 
ATOM   5137 C CE1 . PHE B 2 123 ? 14.348  3.935   -43.746 1.00 30.21  ? 123  PHE B CE1 1 
ATOM   5138 C CE2 . PHE B 2 123 ? 15.235  3.537   -41.531 1.00 29.53  ? 123  PHE B CE2 1 
ATOM   5139 C CZ  . PHE B 2 123 ? 14.771  4.418   -42.504 1.00 27.33  ? 123  PHE B CZ  1 
ATOM   5140 N N   . TYR B 2 124 ? 13.189  -2.904  -43.721 1.00 32.01  ? 124  TYR B N   1 
ATOM   5141 C CA  . TYR B 2 124 ? 13.254  -4.249  -44.295 1.00 32.21  ? 124  TYR B CA  1 
ATOM   5142 C C   . TYR B 2 124 ? 11.876  -4.759  -44.777 1.00 35.48  ? 124  TYR B C   1 
ATOM   5143 O O   . TYR B 2 124 ? 11.778  -5.840  -45.347 1.00 36.81  ? 124  TYR B O   1 
ATOM   5144 C CB  . TYR B 2 124 ? 13.867  -5.261  -43.302 1.00 37.67  ? 124  TYR B CB  1 
ATOM   5145 C CG  . TYR B 2 124 ? 12.953  -5.584  -42.128 1.00 40.35  ? 124  TYR B CG  1 
ATOM   5146 C CD1 . TYR B 2 124 ? 11.852  -6.420  -42.287 1.00 36.25  ? 124  TYR B CD1 1 
ATOM   5147 C CD2 . TYR B 2 124 ? 13.192  -5.042  -40.860 1.00 37.57  ? 124  TYR B CD2 1 
ATOM   5148 C CE1 . TYR B 2 124 ? 11.008  -6.706  -41.226 1.00 33.94  ? 124  TYR B CE1 1 
ATOM   5149 C CE2 . TYR B 2 124 ? 12.336  -5.308  -39.790 1.00 40.03  ? 124  TYR B CE2 1 
ATOM   5150 C CZ  . TYR B 2 124 ? 11.244  -6.138  -39.989 1.00 38.34  ? 124  TYR B CZ  1 
ATOM   5151 O OH  . TYR B 2 124 ? 10.412  -6.432  -38.937 1.00 39.38  ? 124  TYR B OH  1 
ATOM   5152 N N   . SER B 2 125 ? 10.826  -3.969  -44.581 1.00 32.95  ? 125  SER B N   1 
ATOM   5153 C CA  . SER B 2 125 ? 9.489   -4.417  -44.909 1.00 30.26  ? 125  SER B CA  1 
ATOM   5154 C C   . SER B 2 125 ? 8.518   -3.269  -45.085 1.00 29.59  ? 125  SER B C   1 
ATOM   5155 O O   . SER B 2 125 ? 8.846   -2.103  -44.816 1.00 30.21  ? 125  SER B O   1 
ATOM   5156 C CB  . SER B 2 125 ? 8.971   -5.378  -43.826 1.00 39.63  ? 125  SER B CB  1 
ATOM   5157 O OG  . SER B 2 125 ? 8.878   -4.743  -42.550 1.00 37.85  ? 125  SER B OG  1 
ATOM   5158 N N   . GLY B 2 126 ? 7.310   -3.594  -45.528 1.00 34.62  ? 126  GLY B N   1 
ATOM   5159 C CA  . GLY B 2 126 ? 6.236   -2.610  -45.619 1.00 31.53  ? 126  GLY B CA  1 
ATOM   5160 C C   . GLY B 2 126 ? 5.712   -2.426  -47.027 1.00 35.24  ? 126  GLY B C   1 
ATOM   5161 O O   . GLY B 2 126 ? 6.319   -2.945  -47.973 1.00 33.09  ? 126  GLY B O   1 
ATOM   5162 N N   . ALA B 2 127 ? 4.601   -1.679  -47.161 1.00 29.29  ? 127  ALA B N   1 
ATOM   5163 C CA  . ALA B 2 127 ? 3.937   -1.468  -48.438 1.00 31.32  ? 127  ALA B CA  1 
ATOM   5164 C C   . ALA B 2 127 ? 2.817   -0.432  -48.319 1.00 34.49  ? 127  ALA B C   1 
ATOM   5165 O O   . ALA B 2 127 ? 2.200   -0.297  -47.269 1.00 35.86  ? 127  ALA B O   1 
ATOM   5166 C CB  . ALA B 2 127 ? 3.335   -2.783  -48.929 1.00 34.49  ? 127  ALA B CB  1 
ATOM   5167 N N   . ALA B 2 128 ? 2.509   0.242   -49.419 1.00 31.48  ? 128  ALA B N   1 
ATOM   5168 C CA  . ALA B 2 128 ? 1.598   1.365   -49.378 1.00 30.46  ? 128  ALA B CA  1 
ATOM   5169 C C   . ALA B 2 128 ? 0.180   0.842   -49.567 1.00 38.76  ? 128  ALA B C   1 
ATOM   5170 O O   . ALA B 2 128 ? -0.782  1.583   -49.452 1.00 34.96  ? 128  ALA B O   1 
ATOM   5171 C CB  . ALA B 2 128 ? 1.982   2.427   -50.455 1.00 25.41  ? 128  ALA B CB  1 
ATOM   5172 N N   . SER B 2 129 ? 0.079   -0.463  -49.812 1.00 36.47  ? 129  SER B N   1 
ATOM   5173 C CA  . SER B 2 129 ? -1.186  -1.122  -50.076 1.00 35.42  ? 129  SER B CA  1 
ATOM   5174 C C   . SER B 2 129 ? -1.881  -1.710  -48.838 1.00 35.12  ? 129  SER B C   1 
ATOM   5175 O O   . SER B 2 129 ? -3.023  -2.174  -48.945 1.00 37.73  ? 129  SER B O   1 
ATOM   5176 C CB  . SER B 2 129 ? -1.019  -2.196  -51.181 1.00 38.07  ? 129  SER B CB  1 
ATOM   5177 O OG  . SER B 2 129 ? -0.112  -3.227  -50.820 1.00 35.72  ? 129  SER B OG  1 
ATOM   5178 N N   . LEU B 2 130 ? -1.221  -1.692  -47.678 1.00 28.26  ? 130  LEU B N   1 
ATOM   5179 C CA  . LEU B 2 130 ? -1.868  -2.202  -46.456 1.00 38.14  ? 130  LEU B CA  1 
ATOM   5180 C C   . LEU B 2 130 ? -3.175  -1.470  -46.165 1.00 42.70  ? 130  LEU B C   1 
ATOM   5181 O O   . LEU B 2 130 ? -3.284  -0.241  -46.421 1.00 36.36  ? 130  LEU B O   1 
ATOM   5182 C CB  . LEU B 2 130 ? -0.966  -2.058  -45.243 1.00 39.53  ? 130  LEU B CB  1 
ATOM   5183 C CG  . LEU B 2 130 ? 0.444   -2.610  -45.430 1.00 42.87  ? 130  LEU B CG  1 
ATOM   5184 C CD1 . LEU B 2 130 ? 1.174   -2.516  -44.121 1.00 41.05  ? 130  LEU B CD1 1 
ATOM   5185 C CD2 . LEU B 2 130 ? 0.372   -4.062  -45.944 1.00 35.47  ? 130  LEU B CD2 1 
ATOM   5186 N N   . ASP B 2 131 ? -4.158  -2.217  -45.645 1.00 37.73  ? 131  ASP B N   1 
ATOM   5187 C CA  . ASP B 2 131 ? -5.460  -1.644  -45.294 1.00 46.36  ? 131  ASP B CA  1 
ATOM   5188 C C   . ASP B 2 131 ? -5.355  -0.440  -44.329 1.00 43.91  ? 131  ASP B C   1 
ATOM   5189 O O   . ASP B 2 131 ? -6.091  0.512   -44.479 1.00 40.93  ? 131  ASP B O   1 
ATOM   5190 C CB  . ASP B 2 131 ? -6.395  -2.677  -44.667 1.00 50.07  ? 131  ASP B CB  1 
ATOM   5191 C CG  . ASP B 2 131 ? -6.723  -3.853  -45.593 1.00 56.35  ? 131  ASP B CG  1 
ATOM   5192 O OD1 . ASP B 2 131 ? -6.585  -3.772  -46.850 1.00 50.44  ? 131  ASP B OD1 1 
ATOM   5193 O OD2 . ASP B 2 131 ? -7.157  -4.883  -45.025 1.00 64.19  ? 131  ASP B OD2 1 
ATOM   5194 N N   . VAL B 2 132 ? -4.459  -0.474  -43.344 1.00 42.26  ? 132  VAL B N   1 
ATOM   5195 C CA  . VAL B 2 132 ? -4.369  0.660   -42.418 1.00 42.60  ? 132  VAL B CA  1 
ATOM   5196 C C   . VAL B 2 132 ? -3.830  1.946   -43.040 1.00 44.03  ? 132  VAL B C   1 
ATOM   5197 O O   . VAL B 2 132 ? -3.790  2.977   -42.362 1.00 49.78  ? 132  VAL B O   1 
ATOM   5198 C CB  . VAL B 2 132 ? -3.507  0.368   -41.192 1.00 41.45  ? 132  VAL B CB  1 
ATOM   5199 C CG1 . VAL B 2 132 ? -4.311  -0.377  -40.165 1.00 39.92  ? 132  VAL B CG1 1 
ATOM   5200 C CG2 . VAL B 2 132 ? -2.217  -0.375  -41.593 1.00 34.31  ? 132  VAL B CG2 1 
ATOM   5201 N N   . TYR B 2 133 ? -3.395  1.885   -44.302 1.00 40.80  ? 133  TYR B N   1 
ATOM   5202 C CA  . TYR B 2 133 ? -2.917  3.083   -45.000 1.00 42.60  ? 133  TYR B CA  1 
ATOM   5203 C C   . TYR B 2 133 ? -3.944  3.568   -46.029 1.00 37.85  ? 133  TYR B C   1 
ATOM   5204 O O   . TYR B 2 133 ? -3.653  4.404   -46.859 1.00 36.45  ? 133  TYR B O   1 
ATOM   5205 C CB  . TYR B 2 133 ? -1.569  2.836   -45.694 1.00 36.47  ? 133  TYR B CB  1 
ATOM   5206 C CG  . TYR B 2 133 ? -0.485  2.271   -44.790 1.00 33.74  ? 133  TYR B CG  1 
ATOM   5207 C CD1 . TYR B 2 133 ? -0.412  2.640   -43.454 1.00 33.89  ? 133  TYR B CD1 1 
ATOM   5208 C CD2 . TYR B 2 133 ? 0.484   1.391   -45.287 1.00 28.91  ? 133  TYR B CD2 1 
ATOM   5209 C CE1 . TYR B 2 133 ? 0.574   2.131   -42.625 1.00 30.76  ? 133  TYR B CE1 1 
ATOM   5210 C CE2 . TYR B 2 133 ? 1.473   0.871   -44.474 1.00 26.09  ? 133  TYR B CE2 1 
ATOM   5211 C CZ  . TYR B 2 133 ? 1.522   1.249   -43.146 1.00 33.35  ? 133  TYR B CZ  1 
ATOM   5212 O OH  . TYR B 2 133 ? 2.498   0.767   -42.307 1.00 27.86  ? 133  TYR B OH  1 
ATOM   5213 N N   . ASP B 2 134 ? -5.141  3.013   -45.983 1.00 37.36  ? 134  ASP B N   1 
ATOM   5214 C CA  . ASP B 2 134 ? -6.174  3.334   -46.956 1.00 31.61  ? 134  ASP B CA  1 
ATOM   5215 C C   . ASP B 2 134 ? -6.490  4.829   -46.932 1.00 36.88  ? 134  ASP B C   1 
ATOM   5216 O O   . ASP B 2 134 ? -6.989  5.356   -45.925 1.00 32.05  ? 134  ASP B O   1 
ATOM   5217 C CB  . ASP B 2 134 ? -7.410  2.551   -46.589 1.00 37.63  ? 134  ASP B CB  1 
ATOM   5218 C CG  . ASP B 2 134 ? -8.504  2.643   -47.637 1.00 46.58  ? 134  ASP B CG  1 
ATOM   5219 O OD1 . ASP B 2 134 ? -8.590  3.646   -48.377 1.00 43.16  ? 134  ASP B OD1 1 
ATOM   5220 O OD2 . ASP B 2 134 ? -9.306  1.697   -47.696 1.00 55.50  ? 134  ASP B OD2 1 
ATOM   5221 N N   . GLY B 2 135 ? -6.226  5.514   -48.041 1.00 33.29  ? 135  GLY B N   1 
ATOM   5222 C CA  . GLY B 2 135 ? -6.424  6.955   -48.098 1.00 34.46  ? 135  GLY B CA  1 
ATOM   5223 C C   . GLY B 2 135 ? -7.857  7.457   -48.369 1.00 32.69  ? 135  GLY B C   1 
ATOM   5224 O O   . GLY B 2 135 ? -8.075  8.661   -48.436 1.00 34.61  ? 135  GLY B O   1 
ATOM   5225 N N   . ARG B 2 136 ? -8.840  6.582   -48.550 1.00 33.62  ? 136  ARG B N   1 
ATOM   5226 C CA  . ARG B 2 136 ? -10.121 7.116   -49.018 1.00 41.19  ? 136  ARG B CA  1 
ATOM   5227 C C   . ARG B 2 136 ? -10.776 8.001   -47.960 1.00 46.81  ? 136  ARG B C   1 
ATOM   5228 O O   . ARG B 2 136 ? -11.525 8.927   -48.303 1.00 45.43  ? 136  ARG B O   1 
ATOM   5229 C CB  . ARG B 2 136 ? -11.088 6.022   -49.463 1.00 39.54  ? 136  ARG B CB  1 
ATOM   5230 C CG  . ARG B 2 136 ? -11.650 5.197   -48.324 1.00 38.71  ? 136  ARG B CG  1 
ATOM   5231 C CD  . ARG B 2 136 ? -11.445 3.729   -48.628 1.00 46.27  ? 136  ARG B CD  1 
ATOM   5232 N NE  . ARG B 2 136 ? -12.584 3.150   -49.280 1.00 56.55  ? 136  ARG B NE  1 
ATOM   5233 C CZ  . ARG B 2 136 ? -12.562 2.052   -50.044 1.00 59.25  ? 136  ARG B CZ  1 
ATOM   5234 N NH1 . ARG B 2 136 ? -11.432 1.380   -50.290 1.00 44.18  ? 136  ARG B NH1 1 
ATOM   5235 N NH2 . ARG B 2 136 ? -13.707 1.638   -50.578 1.00 54.20  ? 136  ARG B NH2 1 
ATOM   5236 N N   . PHE B 2 137 ? -10.489 7.732   -46.683 1.00 37.84  ? 137  PHE B N   1 
ATOM   5237 C CA  . PHE B 2 137 ? -11.212 8.417   -45.633 1.00 40.78  ? 137  PHE B CA  1 
ATOM   5238 C C   . PHE B 2 137 ? -10.764 9.859   -45.516 1.00 45.39  ? 137  PHE B C   1 
ATOM   5239 O O   . PHE B 2 137 ? -11.601 10.756  -45.350 1.00 43.14  ? 137  PHE B O   1 
ATOM   5240 C CB  . PHE B 2 137 ? -11.092 7.684   -44.295 1.00 40.30  ? 137  PHE B CB  1 
ATOM   5241 C CG  . PHE B 2 137 ? -11.567 6.272   -44.349 1.00 40.75  ? 137  PHE B CG  1 
ATOM   5242 C CD1 . PHE B 2 137 ? -12.926 5.989   -44.386 1.00 43.57  ? 137  PHE B CD1 1 
ATOM   5243 C CD2 . PHE B 2 137 ? -10.658 5.223   -44.373 1.00 39.29  ? 137  PHE B CD2 1 
ATOM   5244 C CE1 . PHE B 2 137 ? -13.367 4.676   -44.450 1.00 47.72  ? 137  PHE B CE1 1 
ATOM   5245 C CE2 . PHE B 2 137 ? -11.075 3.901   -44.444 1.00 46.11  ? 137  PHE B CE2 1 
ATOM   5246 C CZ  . PHE B 2 137 ? -12.429 3.614   -44.487 1.00 43.88  ? 137  PHE B CZ  1 
ATOM   5247 N N   . LEU B 2 138 ? -9.451  10.090  -45.585 1.00 40.72  ? 138  LEU B N   1 
ATOM   5248 C CA  . LEU B 2 138 ? -8.940  11.459  -45.506 1.00 45.63  ? 138  LEU B CA  1 
ATOM   5249 C C   . LEU B 2 138 ? -9.331  12.251  -46.750 1.00 42.69  ? 138  LEU B C   1 
ATOM   5250 O O   . LEU B 2 138 ? -9.587  13.436  -46.656 1.00 45.34  ? 138  LEU B O   1 
ATOM   5251 C CB  . LEU B 2 138 ? -7.414  11.490  -45.312 1.00 38.49  ? 138  LEU B CB  1 
ATOM   5252 C CG  . LEU B 2 138 ? -6.881  11.087  -43.934 1.00 33.68  ? 138  LEU B CG  1 
ATOM   5253 C CD1 . LEU B 2 138 ? -5.438  10.501  -44.014 1.00 23.92  ? 138  LEU B CD1 1 
ATOM   5254 C CD2 . LEU B 2 138 ? -6.920  12.267  -43.005 1.00 30.93  ? 138  LEU B CD2 1 
ATOM   5255 N N   . ALA B 2 139 ? -9.366  11.586  -47.906 1.00 40.11  ? 139  ALA B N   1 
ATOM   5256 C CA  . ALA B 2 139 ? -9.768  12.226  -49.153 1.00 43.54  ? 139  ALA B CA  1 
ATOM   5257 C C   . ALA B 2 139 ? -11.239 12.619  -49.090 1.00 45.59  ? 139  ALA B C   1 
ATOM   5258 O O   . ALA B 2 139 ? -11.616 13.743  -49.424 1.00 48.49  ? 139  ALA B O   1 
ATOM   5259 C CB  . ALA B 2 139 ? -9.514  11.293  -50.375 1.00 28.87  ? 139  ALA B CB  1 
ATOM   5260 N N   . GLN B 2 140 ? -12.072 11.687  -48.659 1.00 41.29  ? 140  GLN B N   1 
ATOM   5261 C CA  . GLN B 2 140 ? -13.505 11.946  -48.600 1.00 42.12  ? 140  GLN B CA  1 
ATOM   5262 C C   . GLN B 2 140 ? -13.876 12.960  -47.517 1.00 47.73  ? 140  GLN B C   1 
ATOM   5263 O O   . GLN B 2 140 ? -14.488 13.993  -47.799 1.00 49.32  ? 140  GLN B O   1 
ATOM   5264 C CB  . GLN B 2 140 ? -14.279 10.649  -48.392 1.00 40.47  ? 140  GLN B CB  1 
ATOM   5265 C CG  . GLN B 2 140 ? -15.695 10.711  -48.990 1.00 50.81  ? 140  GLN B CG  1 
ATOM   5266 C CD  . GLN B 2 140 ? -16.638 11.590  -48.187 1.00 53.03  ? 140  GLN B CD  1 
ATOM   5267 O OE1 . GLN B 2 140 ? -16.768 11.442  -46.971 1.00 50.57  ? 140  GLN B OE1 1 
ATOM   5268 N NE2 . GLN B 2 140 ? -17.302 12.508  -48.867 1.00 61.05  ? 140  GLN B NE2 1 
ATOM   5269 N N   . VAL B 2 141 ? -13.499 12.677  -46.280 1.00 47.39  ? 141  VAL B N   1 
ATOM   5270 C CA  . VAL B 2 141 ? -13.975 13.491  -45.173 1.00 48.43  ? 141  VAL B CA  1 
ATOM   5271 C C   . VAL B 2 141 ? -13.338 14.867  -45.126 1.00 51.01  ? 141  VAL B C   1 
ATOM   5272 O O   . VAL B 2 141 ? -14.043 15.849  -44.898 1.00 45.12  ? 141  VAL B O   1 
ATOM   5273 C CB  . VAL B 2 141 ? -13.794 12.786  -43.836 1.00 48.74  ? 141  VAL B CB  1 
ATOM   5274 C CG1 . VAL B 2 141 ? -14.190 13.737  -42.654 1.00 35.22  ? 141  VAL B CG1 1 
ATOM   5275 C CG2 . VAL B 2 141 ? -14.607 11.494  -43.838 1.00 45.90  ? 141  VAL B CG2 1 
ATOM   5276 N N   . GLU B 2 142 ? -12.025 14.931  -45.370 1.00 40.42  ? 142  GLU B N   1 
ATOM   5277 C CA  . GLU B 2 142 ? -11.282 16.183  -45.265 1.00 36.87  ? 142  GLU B CA  1 
ATOM   5278 C C   . GLU B 2 142 ? -10.925 16.843  -46.599 1.00 42.08  ? 142  GLU B C   1 
ATOM   5279 O O   . GLU B 2 142 ? -10.236 17.871  -46.629 1.00 41.68  ? 142  GLU B O   1 
ATOM   5280 C CB  . GLU B 2 142 ? -10.014 15.953  -44.458 1.00 33.53  ? 142  GLU B CB  1 
ATOM   5281 C CG  . GLU B 2 142 ? -10.300 15.600  -43.022 1.00 38.20  ? 142  GLU B CG  1 
ATOM   5282 C CD  . GLU B 2 142 ? -10.796 16.814  -42.261 1.00 52.51  ? 142  GLU B CD  1 
ATOM   5283 O OE1 . GLU B 2 142 ? -10.552 17.953  -42.736 1.00 58.87  ? 142  GLU B OE1 1 
ATOM   5284 O OE2 . GLU B 2 142 ? -11.431 16.641  -41.202 1.00 57.18  ? 142  GLU B OE2 1 
ATOM   5285 N N   . GLY B 2 143 ? -11.376 16.254  -47.700 1.00 42.31  ? 143  GLY B N   1 
ATOM   5286 C CA  . GLY B 2 143 ? -11.048 16.778  -49.011 1.00 43.93  ? 143  GLY B CA  1 
ATOM   5287 C C   . GLY B 2 143 ? -9.552  16.799  -49.341 1.00 47.49  ? 143  GLY B C   1 
ATOM   5288 O O   . GLY B 2 143 ? -9.121  17.583  -50.178 1.00 48.06  ? 143  GLY B O   1 
ATOM   5289 N N   . ALA B 2 144 ? -8.757  15.950  -48.694 1.00 44.00  ? 144  ALA B N   1 
ATOM   5290 C CA  . ALA B 2 144 ? -7.311  15.907  -48.963 1.00 43.18  ? 144  ALA B CA  1 
ATOM   5291 C C   . ALA B 2 144 ? -6.961  15.128  -50.231 1.00 43.17  ? 144  ALA B C   1 
ATOM   5292 O O   . ALA B 2 144 ? -7.698  14.213  -50.641 1.00 37.72  ? 144  ALA B O   1 
ATOM   5293 C CB  . ALA B 2 144 ? -6.574  15.294  -47.782 1.00 39.50  ? 144  ALA B CB  1 
ATOM   5294 N N   . VAL B 2 145 ? -5.840  15.496  -50.848 1.00 37.65  ? 145  VAL B N   1 
ATOM   5295 C CA  . VAL B 2 145 ? -5.204  14.628  -51.818 1.00 35.16  ? 145  VAL B CA  1 
ATOM   5296 C C   . VAL B 2 145 ? -4.142  13.794  -51.104 1.00 38.31  ? 145  VAL B C   1 
ATOM   5297 O O   . VAL B 2 145 ? -3.199  14.322  -50.481 1.00 36.70  ? 145  VAL B O   1 
ATOM   5298 C CB  . VAL B 2 145 ? -4.594  15.400  -52.982 1.00 35.85  ? 145  VAL B CB  1 
ATOM   5299 C CG1 . VAL B 2 145 ? -3.745  14.458  -53.860 1.00 29.20  ? 145  VAL B CG1 1 
ATOM   5300 C CG2 . VAL B 2 145 ? -5.686  16.031  -53.826 1.00 30.43  ? 145  VAL B CG2 1 
ATOM   5301 N N   . LEU B 2 146 ? -4.318  12.485  -51.149 1.00 34.61  ? 146  LEU B N   1 
ATOM   5302 C CA  . LEU B 2 146 ? -3.436  11.619  -50.412 1.00 33.73  ? 146  LEU B CA  1 
ATOM   5303 C C   . LEU B 2 146 ? -2.557  10.778  -51.348 1.00 40.70  ? 146  LEU B C   1 
ATOM   5304 O O   . LEU B 2 146 ? -3.063  10.119  -52.275 1.00 44.40  ? 146  LEU B O   1 
ATOM   5305 C CB  . LEU B 2 146 ? -4.225  10.758  -49.422 1.00 33.66  ? 146  LEU B CB  1 
ATOM   5306 C CG  . LEU B 2 146 ? -3.221  10.293  -48.371 1.00 46.79  ? 146  LEU B CG  1 
ATOM   5307 C CD1 . LEU B 2 146 ? -3.687  10.558  -46.980 1.00 43.57  ? 146  LEU B CD1 1 
ATOM   5308 C CD2 . LEU B 2 146 ? -2.762  8.807   -48.590 1.00 45.06  ? 146  LEU B CD2 1 
ATOM   5309 N N   . VAL B 2 147 ? -1.245  10.810  -51.111 1.00 36.46  ? 147  VAL B N   1 
ATOM   5310 C CA  . VAL B 2 147 ? -0.293  10.050  -51.934 1.00 31.52  ? 147  VAL B CA  1 
ATOM   5311 C C   . VAL B 2 147 ? 0.492   9.085   -51.058 1.00 33.21  ? 147  VAL B C   1 
ATOM   5312 O O   . VAL B 2 147 ? 0.900   9.445   -49.987 1.00 38.59  ? 147  VAL B O   1 
ATOM   5313 C CB  . VAL B 2 147 ? 0.687   10.979  -52.680 1.00 33.54  ? 147  VAL B CB  1 
ATOM   5314 C CG1 . VAL B 2 147 ? 1.700   10.182  -53.531 1.00 30.32  ? 147  VAL B CG1 1 
ATOM   5315 C CG2 . VAL B 2 147 ? -0.084  11.960  -53.553 1.00 39.83  ? 147  VAL B CG2 1 
ATOM   5316 N N   . SER B 2 148 ? 0.686   7.850   -51.511 1.00 30.94  ? 148  SER B N   1 
ATOM   5317 C CA  . SER B 2 148 ? 1.640   6.944   -50.879 1.00 32.81  ? 148  SER B CA  1 
ATOM   5318 C C   . SER B 2 148 ? 2.417   6.230   -51.982 1.00 35.11  ? 148  SER B C   1 
ATOM   5319 O O   . SER B 2 148 ? 1.849   5.948   -53.053 1.00 35.68  ? 148  SER B O   1 
ATOM   5320 C CB  . SER B 2 148 ? 0.933   5.888   -50.029 1.00 26.52  ? 148  SER B CB  1 
ATOM   5321 O OG  . SER B 2 148 ? 0.146   5.070   -50.883 1.00 31.35  ? 148  SER B OG  1 
ATOM   5322 N N   . MET B 2 149 ? 3.693   5.922   -51.718 1.00 28.99  ? 149  MET B N   1 
ATOM   5323 C CA  . MET B 2 149 ? 4.549   5.235   -52.699 1.00 31.48  ? 149  MET B CA  1 
ATOM   5324 C C   . MET B 2 149 ? 5.152   3.970   -52.093 1.00 33.70  ? 149  MET B C   1 
ATOM   5325 O O   . MET B 2 149 ? 5.374   3.908   -50.882 1.00 32.73  ? 149  MET B O   1 
ATOM   5326 C CB  . MET B 2 149 ? 5.703   6.162   -53.149 1.00 33.03  ? 149  MET B CB  1 
ATOM   5327 C CG  . MET B 2 149 ? 6.955   6.163   -52.207 1.00 29.13  ? 149  MET B CG  1 
ATOM   5328 S SD  . MET B 2 149 ? 6.693   6.917   -50.565 1.00 33.45  ? 149  MET B SD  1 
ATOM   5329 C CE  . MET B 2 149 ? 6.649   8.676   -51.026 1.00 26.94  ? 149  MET B CE  1 
ATOM   5330 N N   . ASN B 2 150 ? 5.424   2.960   -52.921 1.00 35.64  ? 150  ASN B N   1 
ATOM   5331 C CA  . ASN B 2 150 ? 6.332   1.895   -52.508 1.00 30.45  ? 150  ASN B CA  1 
ATOM   5332 C C   . ASN B 2 150 ? 7.784   2.366   -52.642 1.00 32.50  ? 150  ASN B C   1 
ATOM   5333 O O   . ASN B 2 150 ? 8.083   3.135   -53.533 1.00 31.24  ? 150  ASN B O   1 
ATOM   5334 C CB  . ASN B 2 150 ? 6.109   0.631   -53.336 1.00 34.20  ? 150  ASN B CB  1 
ATOM   5335 C CG  . ASN B 2 150 ? 4.855   -0.111  -52.929 1.00 39.85  ? 150  ASN B CG  1 
ATOM   5336 O OD1 . ASN B 2 150 ? 4.186   0.252   -51.950 1.00 38.79  ? 150  ASN B OD1 1 
ATOM   5337 N ND2 . ASN B 2 150 ? 4.522   -1.145  -53.679 1.00 37.72  ? 150  ASN B ND2 1 
ATOM   5338 N N   . TYR B 2 151 ? 8.670   1.915   -51.751 1.00 26.43  ? 151  TYR B N   1 
ATOM   5339 C CA  . TYR B 2 151 ? 10.094  2.167   -51.907 1.00 32.34  ? 151  TYR B CA  1 
ATOM   5340 C C   . TYR B 2 151 ? 10.822  0.885   -51.556 1.00 30.38  ? 151  TYR B C   1 
ATOM   5341 O O   . TYR B 2 151 ? 10.299  0.055   -50.815 1.00 35.80  ? 151  TYR B O   1 
ATOM   5342 C CB  . TYR B 2 151 ? 10.571  3.333   -51.038 1.00 31.65  ? 151  TYR B CB  1 
ATOM   5343 C CG  . TYR B 2 151 ? 10.364  3.138   -49.546 1.00 34.73  ? 151  TYR B CG  1 
ATOM   5344 C CD1 . TYR B 2 151 ? 9.171   3.529   -48.924 1.00 28.89  ? 151  TYR B CD1 1 
ATOM   5345 C CD2 . TYR B 2 151 ? 11.371  2.572   -48.753 1.00 26.02  ? 151  TYR B CD2 1 
ATOM   5346 C CE1 . TYR B 2 151 ? 8.997   3.368   -47.569 1.00 27.66  ? 151  TYR B CE1 1 
ATOM   5347 C CE2 . TYR B 2 151 ? 11.204  2.399   -47.405 1.00 27.66  ? 151  TYR B CE2 1 
ATOM   5348 C CZ  . TYR B 2 151 ? 10.014  2.796   -46.803 1.00 32.61  ? 151  TYR B CZ  1 
ATOM   5349 O OH  . TYR B 2 151 ? 9.856   2.616   -45.431 1.00 29.74  ? 151  TYR B OH  1 
ATOM   5350 N N   . ARG B 2 152 ? 12.004  0.705   -52.120 1.00 32.96  ? 152  ARG B N   1 
ATOM   5351 C CA  . ARG B 2 152 ? 12.771  -0.521  -51.908 1.00 33.28  ? 152  ARG B CA  1 
ATOM   5352 C C   . ARG B 2 152 ? 13.229  -0.672  -50.454 1.00 35.53  ? 152  ARG B C   1 
ATOM   5353 O O   . ARG B 2 152 ? 13.698  0.283   -49.836 1.00 35.11  ? 152  ARG B O   1 
ATOM   5354 C CB  . ARG B 2 152 ? 13.957  -0.559  -52.861 1.00 33.71  ? 152  ARG B CB  1 
ATOM   5355 C CG  . ARG B 2 152 ? 13.599  -1.071  -54.249 1.00 33.60  ? 152  ARG B CG  1 
ATOM   5356 C CD  . ARG B 2 152 ? 14.769  -0.941  -55.194 1.00 34.46  ? 152  ARG B CD  1 
ATOM   5357 N NE  . ARG B 2 152 ? 15.006  0.460   -55.543 1.00 37.85  ? 152  ARG B NE  1 
ATOM   5358 C CZ  . ARG B 2 152 ? 16.086  0.890   -56.185 1.00 36.08  ? 152  ARG B CZ  1 
ATOM   5359 N NH1 . ARG B 2 152 ? 17.041  0.018   -56.556 1.00 29.26  ? 152  ARG B NH1 1 
ATOM   5360 N NH2 . ARG B 2 152 ? 16.204  2.188   -56.458 1.00 26.44  ? 152  ARG B NH2 1 
ATOM   5361 N N   . VAL B 2 153 ? 13.056  -1.866  -49.905 1.00 26.63  ? 153  VAL B N   1 
ATOM   5362 C CA  . VAL B 2 153 ? 13.456  -2.155  -48.539 1.00 25.82  ? 153  VAL B CA  1 
ATOM   5363 C C   . VAL B 2 153 ? 14.549  -3.249  -48.544 1.00 39.80  ? 153  VAL B C   1 
ATOM   5364 O O   . VAL B 2 153 ? 14.888  -3.811  -49.610 1.00 35.78  ? 153  VAL B O   1 
ATOM   5365 C CB  . VAL B 2 153 ? 12.217  -2.618  -47.735 1.00 33.82  ? 153  VAL B CB  1 
ATOM   5366 C CG1 . VAL B 2 153 ? 11.201  -1.422  -47.557 1.00 25.92  ? 153  VAL B CG1 1 
ATOM   5367 C CG2 . VAL B 2 153 ? 11.502  -3.768  -48.467 1.00 28.35  ? 153  VAL B CG2 1 
ATOM   5368 N N   . GLY B 2 154 ? 15.102  -3.533  -47.363 1.00 39.68  ? 154  GLY B N   1 
ATOM   5369 C CA  . GLY B 2 154 ? 16.112  -4.556  -47.192 1.00 36.33  ? 154  GLY B CA  1 
ATOM   5370 C C   . GLY B 2 154 ? 17.357  -4.310  -48.044 1.00 40.11  ? 154  GLY B C   1 
ATOM   5371 O O   . GLY B 2 154 ? 17.732  -3.155  -48.317 1.00 35.75  ? 154  GLY B O   1 
ATOM   5372 N N   . THR B 2 155 ? 18.008  -5.394  -48.460 1.00 37.46  ? 155  THR B N   1 
ATOM   5373 C CA  . THR B 2 155 ? 19.169  -5.277  -49.331 1.00 41.18  ? 155  THR B CA  1 
ATOM   5374 C C   . THR B 2 155 ? 18.825  -4.484  -50.587 1.00 38.59  ? 155  THR B C   1 
ATOM   5375 O O   . THR B 2 155 ? 19.587  -3.606  -50.998 1.00 38.16  ? 155  THR B O   1 
ATOM   5376 C CB  . THR B 2 155 ? 19.764  -6.656  -49.719 1.00 40.10  ? 155  THR B CB  1 
ATOM   5377 O OG1 . THR B 2 155 ? 18.763  -7.431  -50.360 1.00 41.95  ? 155  THR B OG1 1 
ATOM   5378 C CG2 . THR B 2 155 ? 20.251  -7.410  -48.479 1.00 37.55  ? 155  THR B CG2 1 
ATOM   5379 N N   . PHE B 2 156 ? 17.665  -4.750  -51.178 1.00 37.38  ? 156  PHE B N   1 
ATOM   5380 C CA  . PHE B 2 156 ? 17.319  -4.093  -52.444 1.00 37.81  ? 156  PHE B CA  1 
ATOM   5381 C C   . PHE B 2 156 ? 17.329  -2.590  -52.312 1.00 36.50  ? 156  PHE B C   1 
ATOM   5382 O O   . PHE B 2 156 ? 17.693  -1.884  -53.245 1.00 35.84  ? 156  PHE B O   1 
ATOM   5383 C CB  . PHE B 2 156 ? 15.969  -4.605  -52.977 1.00 35.79  ? 156  PHE B CB  1 
ATOM   5384 C CG  . PHE B 2 156 ? 15.867  -6.079  -52.895 1.00 42.13  ? 156  PHE B CG  1 
ATOM   5385 C CD1 . PHE B 2 156 ? 16.509  -6.881  -53.852 1.00 39.06  ? 156  PHE B CD1 1 
ATOM   5386 C CD2 . PHE B 2 156 ? 15.258  -6.682  -51.797 1.00 35.57  ? 156  PHE B CD2 1 
ATOM   5387 C CE1 . PHE B 2 156 ? 16.481  -8.246  -53.743 1.00 42.45  ? 156  PHE B CE1 1 
ATOM   5388 C CE2 . PHE B 2 156 ? 15.229  -8.054  -51.682 1.00 41.96  ? 156  PHE B CE2 1 
ATOM   5389 C CZ  . PHE B 2 156 ? 15.850  -8.841  -52.649 1.00 45.25  ? 156  PHE B CZ  1 
ATOM   5390 N N   . GLY B 2 157 ? 16.932  -2.107  -51.142 1.00 33.17  ? 157  GLY B N   1 
ATOM   5391 C CA  . GLY B 2 157 ? 16.874  -0.683  -50.894 1.00 33.92  ? 157  GLY B CA  1 
ATOM   5392 C C   . GLY B 2 157 ? 18.064  -0.065  -50.170 1.00 33.80  ? 157  GLY B C   1 
ATOM   5393 O O   . GLY B 2 157 ? 18.308  1.132   -50.335 1.00 33.10  ? 157  GLY B O   1 
ATOM   5394 N N   . PHE B 2 158 ? 18.791  -0.846  -49.370 1.00 31.47  ? 158  PHE B N   1 
ATOM   5395 C CA  . PHE B 2 158 ? 19.805  -0.248  -48.483 1.00 38.18  ? 158  PHE B CA  1 
ATOM   5396 C C   . PHE B 2 158 ? 21.166  -0.934  -48.402 1.00 39.12  ? 158  PHE B C   1 
ATOM   5397 O O   . PHE B 2 158 ? 22.066  -0.466  -47.696 1.00 40.88  ? 158  PHE B O   1 
ATOM   5398 C CB  . PHE B 2 158 ? 19.215  0.042   -47.077 1.00 32.07  ? 158  PHE B CB  1 
ATOM   5399 C CG  . PHE B 2 158 ? 17.999  0.961   -47.127 1.00 31.63  ? 158  PHE B CG  1 
ATOM   5400 C CD1 . PHE B 2 158 ? 18.160  2.337   -47.204 1.00 30.04  ? 158  PHE B CD1 1 
ATOM   5401 C CD2 . PHE B 2 158 ? 16.705  0.440   -47.167 1.00 36.79  ? 158  PHE B CD2 1 
ATOM   5402 C CE1 . PHE B 2 158 ? 17.071  3.186   -47.290 1.00 30.55  ? 158  PHE B CE1 1 
ATOM   5403 C CE2 . PHE B 2 158 ? 15.564  1.307   -47.263 1.00 28.95  ? 158  PHE B CE2 1 
ATOM   5404 C CZ  . PHE B 2 158 ? 15.762  2.652   -47.342 1.00 35.29  ? 158  PHE B CZ  1 
ATOM   5405 N N   . LEU B 2 159 ? 21.354  -2.027  -49.126 1.00 38.27  ? 159  LEU B N   1 
ATOM   5406 C CA  . LEU B 2 159 ? 22.724  -2.543  -49.232 1.00 38.98  ? 159  LEU B CA  1 
ATOM   5407 C C   . LEU B 2 159 ? 23.620  -1.490  -49.892 1.00 46.21  ? 159  LEU B C   1 
ATOM   5408 O O   . LEU B 2 159 ? 23.297  -0.952  -50.954 1.00 50.07  ? 159  LEU B O   1 
ATOM   5409 C CB  . LEU B 2 159 ? 22.768  -3.840  -50.010 1.00 38.13  ? 159  LEU B CB  1 
ATOM   5410 C CG  . LEU B 2 159 ? 24.124  -4.531  -50.066 1.00 39.29  ? 159  LEU B CG  1 
ATOM   5411 C CD1 . LEU B 2 159 ? 23.971  -6.015  -49.796 1.00 40.93  ? 159  LEU B CD1 1 
ATOM   5412 C CD2 . LEU B 2 159 ? 24.707  -4.272  -51.440 1.00 38.40  ? 159  LEU B CD2 1 
ATOM   5413 N N   . ALA B 2 160 ? 24.744  -1.190  -49.256 1.00 45.76  ? 160  ALA B N   1 
ATOM   5414 C CA  . ALA B 2 160 ? 25.607  -0.120  -49.720 1.00 42.85  ? 160  ALA B CA  1 
ATOM   5415 C C   . ALA B 2 160 ? 27.061  -0.582  -49.668 1.00 42.73  ? 160  ALA B C   1 
ATOM   5416 O O   . ALA B 2 160 ? 27.520  -1.080  -48.656 1.00 43.90  ? 160  ALA B O   1 
ATOM   5417 C CB  . ALA B 2 160 ? 25.430  1.094   -48.828 1.00 38.00  ? 160  ALA B CB  1 
ATOM   5418 N N   . LEU B 2 161 ? 27.788  -0.418  -50.756 1.00 40.02  ? 161  LEU B N   1 
ATOM   5419 C CA  . LEU B 2 161 ? 29.237  -0.463  -50.628 1.00 45.45  ? 161  LEU B CA  1 
ATOM   5420 C C   . LEU B 2 161 ? 29.684  0.976   -50.772 1.00 38.03  ? 161  LEU B C   1 
ATOM   5421 O O   . LEU B 2 161 ? 29.885  1.458   -51.884 1.00 46.10  ? 161  LEU B O   1 
ATOM   5422 C CB  . LEU B 2 161 ? 29.856  -1.400  -51.676 1.00 48.33  ? 161  LEU B CB  1 
ATOM   5423 C CG  . LEU B 2 161 ? 29.574  -2.864  -51.322 1.00 48.21  ? 161  LEU B CG  1 
ATOM   5424 C CD1 . LEU B 2 161 ? 29.740  -3.722  -52.512 1.00 65.14  ? 161  LEU B CD1 1 
ATOM   5425 C CD2 . LEU B 2 161 ? 30.508  -3.354  -50.221 1.00 48.51  ? 161  LEU B CD2 1 
ATOM   5426 N N   . PRO B 2 162 ? 29.796  1.684   -49.644 1.00 39.70  ? 162  PRO B N   1 
ATOM   5427 C CA  . PRO B 2 162 ? 29.912  3.143   -49.742 1.00 47.28  ? 162  PRO B CA  1 
ATOM   5428 C C   . PRO B 2 162 ? 31.084  3.495   -50.615 1.00 52.41  ? 162  PRO B C   1 
ATOM   5429 O O   . PRO B 2 162 ? 32.159  2.905   -50.470 1.00 51.82  ? 162  PRO B O   1 
ATOM   5430 C CB  . PRO B 2 162 ? 30.165  3.578   -48.297 1.00 46.70  ? 162  PRO B CB  1 
ATOM   5431 C CG  . PRO B 2 162 ? 29.587  2.494   -47.474 1.00 45.48  ? 162  PRO B CG  1 
ATOM   5432 C CD  . PRO B 2 162 ? 29.810  1.222   -48.250 1.00 38.01  ? 162  PRO B CD  1 
ATOM   5433 N N   . GLY B 2 163 ? 30.876  4.417   -51.537 1.00 53.07  ? 163  GLY B N   1 
ATOM   5434 C CA  . GLY B 2 163 ? 31.934  4.775   -52.457 1.00 55.91  ? 163  GLY B CA  1 
ATOM   5435 C C   . GLY B 2 163 ? 31.781  4.101   -53.801 1.00 56.39  ? 163  GLY B C   1 
ATOM   5436 O O   . GLY B 2 163 ? 32.160  4.654   -54.827 1.00 60.17  ? 163  GLY B O   1 
ATOM   5437 N N   . SER B 2 164 ? 31.222  2.900   -53.803 1.00 56.29  ? 164  SER B N   1 
ATOM   5438 C CA  . SER B 2 164 ? 31.006  2.171   -55.049 1.00 53.41  ? 164  SER B CA  1 
ATOM   5439 C C   . SER B 2 164 ? 30.098  2.954   -55.991 1.00 54.28  ? 164  SER B C   1 
ATOM   5440 O O   . SER B 2 164 ? 29.351  3.840   -55.566 1.00 56.22  ? 164  SER B O   1 
ATOM   5441 C CB  . SER B 2 164 ? 30.371  0.825   -54.744 1.00 53.99  ? 164  SER B CB  1 
ATOM   5442 O OG  . SER B 2 164 ? 28.975  0.977   -54.528 1.00 49.18  ? 164  SER B OG  1 
ATOM   5443 N N   . ARG B 2 165 ? 30.153  2.642   -57.274 1.00 58.40  ? 165  ARG B N   1 
ATOM   5444 C CA  . ARG B 2 165 ? 29.289  3.334   -58.217 1.00 64.81  ? 165  ARG B CA  1 
ATOM   5445 C C   . ARG B 2 165 ? 27.952  2.614   -58.313 1.00 63.00  ? 165  ARG B C   1 
ATOM   5446 O O   . ARG B 2 165 ? 26.918  3.232   -58.572 1.00 64.22  ? 165  ARG B O   1 
ATOM   5447 C CB  . ARG B 2 165 ? 29.940  3.431   -59.596 1.00 72.28  ? 165  ARG B CB  1 
ATOM   5448 C CG  . ARG B 2 165 ? 29.206  4.357   -60.552 1.00 86.34  ? 165  ARG B CG  1 
ATOM   5449 C CD  . ARG B 2 165 ? 29.611  4.118   -62.006 1.00 102.15 ? 165  ARG B CD  1 
ATOM   5450 N NE  . ARG B 2 165 ? 28.821  4.934   -62.929 1.00 114.81 ? 165  ARG B NE  1 
ATOM   5451 C CZ  . ARG B 2 165 ? 27.587  4.629   -63.334 1.00 119.74 ? 165  ARG B CZ  1 
ATOM   5452 N NH1 . ARG B 2 165 ? 26.993  3.520   -62.900 1.00 118.77 ? 165  ARG B NH1 1 
ATOM   5453 N NH2 . ARG B 2 165 ? 26.945  5.433   -64.176 1.00 120.33 ? 165  ARG B NH2 1 
ATOM   5454 N N   . GLU B 2 166 ? 27.975  1.308   -58.069 1.00 57.37  ? 166  GLU B N   1 
ATOM   5455 C CA  . GLU B 2 166 ? 26.842  0.464   -58.418 1.00 58.21  ? 166  GLU B CA  1 
ATOM   5456 C C   . GLU B 2 166 ? 26.000  0.023   -57.217 1.00 50.78  ? 166  GLU B C   1 
ATOM   5457 O O   . GLU B 2 166 ? 24.951  -0.601  -57.394 1.00 48.84  ? 166  GLU B O   1 
ATOM   5458 C CB  . GLU B 2 166 ? 27.307  -0.734  -59.269 1.00 65.49  ? 166  GLU B CB  1 
ATOM   5459 C CG  . GLU B 2 166 ? 28.495  -1.484  -58.702 1.00 75.56  ? 166  GLU B CG  1 
ATOM   5460 C CD  . GLU B 2 166 ? 29.858  -0.955  -59.186 1.00 79.48  ? 166  GLU B CD  1 
ATOM   5461 O OE1 . GLU B 2 166 ? 30.140  -1.028  -60.407 1.00 77.04  ? 166  GLU B OE1 1 
ATOM   5462 O OE2 . GLU B 2 166 ? 30.656  -0.493  -58.332 1.00 77.83  ? 166  GLU B OE2 1 
ATOM   5463 N N   . ALA B 2 167 ? 26.466  0.362   -56.013 1.00 44.28  ? 167  ALA B N   1 
ATOM   5464 C CA  . ALA B 2 167 ? 25.699  0.208   -54.773 1.00 41.96  ? 167  ALA B CA  1 
ATOM   5465 C C   . ALA B 2 167 ? 26.044  1.327   -53.790 1.00 45.95  ? 167  ALA B C   1 
ATOM   5466 O O   . ALA B 2 167 ? 26.645  1.085   -52.729 1.00 48.40  ? 167  ALA B O   1 
ATOM   5467 C CB  . ALA B 2 167 ? 25.977  -1.134  -54.145 1.00 41.68  ? 167  ALA B CB  1 
ATOM   5468 N N   . PRO B 2 168 ? 25.695  2.563   -54.150 1.00 44.34  ? 168  PRO B N   1 
ATOM   5469 C CA  . PRO B 2 168 ? 26.012  3.772   -53.369 1.00 42.43  ? 168  PRO B CA  1 
ATOM   5470 C C   . PRO B 2 168 ? 25.303  3.836   -51.999 1.00 43.49  ? 168  PRO B C   1 
ATOM   5471 O O   . PRO B 2 168 ? 25.684  4.657   -51.152 1.00 41.94  ? 168  PRO B O   1 
ATOM   5472 C CB  . PRO B 2 168 ? 25.483  4.900   -54.263 1.00 37.33  ? 168  PRO B CB  1 
ATOM   5473 C CG  . PRO B 2 168 ? 24.348  4.216   -55.056 1.00 40.68  ? 168  PRO B CG  1 
ATOM   5474 C CD  . PRO B 2 168 ? 24.933  2.873   -55.374 1.00 41.55  ? 168  PRO B CD  1 
ATOM   5475 N N   . GLY B 2 169 ? 24.293  2.992   -51.784 1.00 39.52  ? 169  GLY B N   1 
ATOM   5476 C CA  . GLY B 2 169 ? 23.468  3.069   -50.584 1.00 39.10  ? 169  GLY B CA  1 
ATOM   5477 C C   . GLY B 2 169 ? 22.342  4.105   -50.666 1.00 33.94  ? 169  GLY B C   1 
ATOM   5478 O O   . GLY B 2 169 ? 22.319  4.953   -51.569 1.00 36.56  ? 169  GLY B O   1 
ATOM   5479 N N   . ASN B 2 170 ? 21.406  4.032   -49.724 1.00 34.94  ? 170  ASN B N   1 
ATOM   5480 C CA  . ASN B 2 170 ? 20.287  4.978   -49.643 1.00 34.49  ? 170  ASN B CA  1 
ATOM   5481 C C   . ASN B 2 170 ? 19.326  5.006   -50.864 1.00 37.70  ? 170  ASN B C   1 
ATOM   5482 O O   . ASN B 2 170 ? 18.532  5.951   -51.013 1.00 37.75  ? 170  ASN B O   1 
ATOM   5483 C CB  . ASN B 2 170 ? 20.807  6.389   -49.344 1.00 28.62  ? 170  ASN B CB  1 
ATOM   5484 C CG  . ASN B 2 170 ? 21.465  6.494   -47.981 1.00 33.89  ? 170  ASN B CG  1 
ATOM   5485 O OD1 . ASN B 2 170 ? 21.141  5.745   -47.066 1.00 35.85  ? 170  ASN B OD1 1 
ATOM   5486 N ND2 . ASN B 2 170 ? 22.407  7.441   -47.836 1.00 41.46  ? 170  ASN B ND2 1 
ATOM   5487 N N   . VAL B 2 171 ? 19.368  3.989   -51.725 1.00 36.00  ? 171  VAL B N   1 
ATOM   5488 C CA  . VAL B 2 171 ? 18.540  4.018   -52.932 1.00 34.64  ? 171  VAL B CA  1 
ATOM   5489 C C   . VAL B 2 171 ? 17.027  3.929   -52.631 1.00 37.33  ? 171  VAL B C   1 
ATOM   5490 O O   . VAL B 2 171 ? 16.194  4.416   -53.399 1.00 36.24  ? 171  VAL B O   1 
ATOM   5491 C CB  . VAL B 2 171 ? 18.962  2.962   -53.995 1.00 34.68  ? 171  VAL B CB  1 
ATOM   5492 C CG1 . VAL B 2 171 ? 20.481  3.033   -54.273 1.00 29.16  ? 171  VAL B CG1 1 
ATOM   5493 C CG2 . VAL B 2 171 ? 18.510  1.528   -53.606 1.00 26.29  ? 171  VAL B CG2 1 
ATOM   5494 N N   . GLY B 2 172 ? 16.669  3.310   -51.513 1.00 34.42  ? 172  GLY B N   1 
ATOM   5495 C CA  . GLY B 2 172 ? 15.287  3.332   -51.064 1.00 29.03  ? 172  GLY B CA  1 
ATOM   5496 C C   . GLY B 2 172 ? 14.834  4.736   -50.662 1.00 32.28  ? 172  GLY B C   1 
ATOM   5497 O O   . GLY B 2 172 ? 13.658  5.084   -50.832 1.00 33.81  ? 172  GLY B O   1 
ATOM   5498 N N   . LEU B 2 173 ? 15.748  5.565   -50.140 1.00 31.23  ? 173  LEU B N   1 
ATOM   5499 C CA  . LEU B 2 173 ? 15.384  6.955   -49.863 1.00 28.24  ? 173  LEU B CA  1 
ATOM   5500 C C   . LEU B 2 173 ? 15.275  7.724   -51.172 1.00 32.83  ? 173  LEU B C   1 
ATOM   5501 O O   . LEU B 2 173 ? 14.393  8.591   -51.342 1.00 32.56  ? 173  LEU B O   1 
ATOM   5502 C CB  . LEU B 2 173 ? 16.358  7.622   -48.878 1.00 25.55  ? 173  LEU B CB  1 
ATOM   5503 C CG  . LEU B 2 173 ? 16.378  7.087   -47.434 1.00 31.07  ? 173  LEU B CG  1 
ATOM   5504 C CD1 . LEU B 2 173 ? 17.505  7.696   -46.655 1.00 29.59  ? 173  LEU B CD1 1 
ATOM   5505 C CD2 . LEU B 2 173 ? 15.066  7.335   -46.708 1.00 29.00  ? 173  LEU B CD2 1 
ATOM   5506 N N   . LEU B 2 174 ? 16.155  7.389   -52.114 1.00 34.76  ? 174  LEU B N   1 
ATOM   5507 C CA  . LEU B 2 174 ? 16.058  7.950   -53.468 1.00 36.72  ? 174  LEU B CA  1 
ATOM   5508 C C   . LEU B 2 174 ? 14.720  7.567   -54.149 1.00 37.36  ? 174  LEU B C   1 
ATOM   5509 O O   . LEU B 2 174 ? 14.152  8.376   -54.891 1.00 29.73  ? 174  LEU B O   1 
ATOM   5510 C CB  . LEU B 2 174 ? 17.271  7.561   -54.335 1.00 34.52  ? 174  LEU B CB  1 
ATOM   5511 C CG  . LEU B 2 174 ? 18.589  8.217   -53.846 1.00 40.55  ? 174  LEU B CG  1 
ATOM   5512 C CD1 . LEU B 2 174 ? 19.815  7.717   -54.614 1.00 31.50  ? 174  LEU B CD1 1 
ATOM   5513 C CD2 . LEU B 2 174 ? 18.505  9.747   -53.914 1.00 32.05  ? 174  LEU B CD2 1 
ATOM   5514 N N   . ASP B 2 175 ? 14.210  6.354   -53.892 1.00 31.14  ? 175  ASP B N   1 
ATOM   5515 C CA  . ASP B 2 175 ? 12.909  5.999   -54.452 1.00 31.57  ? 175  ASP B CA  1 
ATOM   5516 C C   . ASP B 2 175 ? 11.853  6.980   -53.914 1.00 33.50  ? 175  ASP B C   1 
ATOM   5517 O O   . ASP B 2 175 ? 11.043  7.493   -54.668 1.00 32.67  ? 175  ASP B O   1 
ATOM   5518 C CB  . ASP B 2 175 ? 12.492  4.554   -54.106 1.00 28.96  ? 175  ASP B CB  1 
ATOM   5519 C CG  . ASP B 2 175 ? 13.454  3.500   -54.653 1.00 30.78  ? 175  ASP B CG  1 
ATOM   5520 O OD1 . ASP B 2 175 ? 14.219  3.786   -55.616 1.00 32.59  ? 175  ASP B OD1 1 
ATOM   5521 O OD2 . ASP B 2 175 ? 13.451  2.370   -54.098 1.00 31.84  ? 175  ASP B OD2 1 
ATOM   5522 N N   . GLN B 2 176 ? 11.881  7.242   -52.609 1.00 32.35  ? 176  GLN B N   1 
ATOM   5523 C CA  . GLN B 2 176 ? 10.917  8.127   -51.993 1.00 27.56  ? 176  GLN B CA  1 
ATOM   5524 C C   . GLN B 2 176 ? 11.014  9.509   -52.619 1.00 34.99  ? 176  GLN B C   1 
ATOM   5525 O O   . GLN B 2 176 ? 9.992   10.149  -52.940 1.00 35.43  ? 176  GLN B O   1 
ATOM   5526 C CB  . GLN B 2 176 ? 11.191  8.233   -50.503 1.00 29.64  ? 176  GLN B CB  1 
ATOM   5527 C CG  . GLN B 2 176 ? 10.833  6.977   -49.726 1.00 29.52  ? 176  GLN B CG  1 
ATOM   5528 C CD  . GLN B 2 176 ? 11.419  6.991   -48.343 1.00 29.97  ? 176  GLN B CD  1 
ATOM   5529 O OE1 . GLN B 2 176 ? 11.750  8.063   -47.827 1.00 30.12  ? 176  GLN B OE1 1 
ATOM   5530 N NE2 . GLN B 2 176 ? 11.544  5.803   -47.717 1.00 29.63  ? 176  GLN B NE2 1 
ATOM   5531 N N   . ARG B 2 177 ? 12.245  9.975   -52.767 1.00 27.74  ? 177  ARG B N   1 
ATOM   5532 C CA  . ARG B 2 177 ? 12.509  11.278  -53.355 1.00 31.39  ? 177  ARG B CA  1 
ATOM   5533 C C   . ARG B 2 177 ? 11.963  11.407  -54.778 1.00 37.99  ? 177  ARG B C   1 
ATOM   5534 O O   . ARG B 2 177 ? 11.337  12.440  -55.126 1.00 33.40  ? 177  ARG B O   1 
ATOM   5535 C CB  . ARG B 2 177 ? 14.009  11.595  -53.357 1.00 24.33  ? 177  ARG B CB  1 
ATOM   5536 C CG  . ARG B 2 177 ? 14.336  12.932  -54.000 1.00 33.06  ? 177  ARG B CG  1 
ATOM   5537 C CD  . ARG B 2 177 ? 15.826  13.213  -53.965 1.00 32.47  ? 177  ARG B CD  1 
ATOM   5538 N NE  . ARG B 2 177 ? 16.182  13.619  -52.619 1.00 41.76  ? 177  ARG B NE  1 
ATOM   5539 C CZ  . ARG B 2 177 ? 17.426  13.648  -52.136 1.00 46.01  ? 177  ARG B CZ  1 
ATOM   5540 N NH1 . ARG B 2 177 ? 18.465  13.300  -52.920 1.00 44.66  ? 177  ARG B NH1 1 
ATOM   5541 N NH2 . ARG B 2 177 ? 17.625  14.043  -50.881 1.00 33.20  ? 177  ARG B NH2 1 
ATOM   5542 N N   . LEU B 2 178 ? 12.211  10.375  -55.595 1.00 30.81  ? 178  LEU B N   1 
ATOM   5543 C CA  . LEU B 2 178 ? 11.741  10.371  -56.966 1.00 31.18  ? 178  LEU B CA  1 
ATOM   5544 C C   . LEU B 2 178 ? 10.206  10.485  -56.967 1.00 32.71  ? 178  LEU B C   1 
ATOM   5545 O O   . LEU B 2 178 ? 9.626   11.245  -57.764 1.00 38.42  ? 178  LEU B O   1 
ATOM   5546 C CB  . LEU B 2 178 ? 12.222  9.131   -57.717 1.00 28.13  ? 178  LEU B CB  1 
ATOM   5547 C CG  . LEU B 2 178 ? 11.788  9.137   -59.177 1.00 36.53  ? 178  LEU B CG  1 
ATOM   5548 C CD1 . LEU B 2 178 ? 12.335  10.386  -59.852 1.00 35.06  ? 178  LEU B CD1 1 
ATOM   5549 C CD2 . LEU B 2 178 ? 12.263  7.886   -59.907 1.00 36.67  ? 178  LEU B CD2 1 
ATOM   5550 N N   . ALA B 2 179 ? 9.549   9.781   -56.050 1.00 28.61  ? 179  ALA B N   1 
ATOM   5551 C CA  . ALA B 2 179 ? 8.078   9.926   -55.887 1.00 30.82  ? 179  ALA B CA  1 
ATOM   5552 C C   . ALA B 2 179 ? 7.666   11.348  -55.443 1.00 30.52  ? 179  ALA B C   1 
ATOM   5553 O O   . ALA B 2 179 ? 6.686   11.884  -55.915 1.00 35.66  ? 179  ALA B O   1 
ATOM   5554 C CB  . ALA B 2 179 ? 7.540   8.883   -54.915 1.00 26.62  ? 179  ALA B CB  1 
ATOM   5555 N N   . LEU B 2 180 ? 8.433   11.965  -54.555 1.00 32.51  ? 180  LEU B N   1 
ATOM   5556 C CA  . LEU B 2 180 ? 8.203   13.371  -54.183 1.00 33.67  ? 180  LEU B CA  1 
ATOM   5557 C C   . LEU B 2 180 ? 8.304   14.292  -55.417 1.00 35.43  ? 180  LEU B C   1 
ATOM   5558 O O   . LEU B 2 180 ? 7.488   15.213  -55.566 1.00 36.90  ? 180  LEU B O   1 
ATOM   5559 C CB  . LEU B 2 180 ? 9.158   13.820  -53.060 1.00 24.97  ? 180  LEU B CB  1 
ATOM   5560 C CG  . LEU B 2 180 ? 8.756   13.627  -51.589 1.00 29.83  ? 180  LEU B CG  1 
ATOM   5561 C CD1 . LEU B 2 180 ? 7.981   12.320  -51.324 1.00 32.66  ? 180  LEU B CD1 1 
ATOM   5562 C CD2 . LEU B 2 180 ? 9.926   13.785  -50.603 1.00 28.96  ? 180  LEU B CD2 1 
ATOM   5563 N N   . GLN B 2 181 ? 9.274   14.019  -56.300 1.00 35.08  ? 181  GLN B N   1 
ATOM   5564 C CA  . GLN B 2 181 ? 9.460   14.776  -57.553 1.00 35.78  ? 181  GLN B CA  1 
ATOM   5565 C C   . GLN B 2 181 ? 8.223   14.578  -58.433 1.00 35.42  ? 181  GLN B C   1 
ATOM   5566 O O   . GLN B 2 181 ? 7.678   15.531  -59.025 1.00 34.85  ? 181  GLN B O   1 
ATOM   5567 C CB  . GLN B 2 181 ? 10.712  14.316  -58.311 1.00 35.81  ? 181  GLN B CB  1 
ATOM   5568 C CG  . GLN B 2 181 ? 11.992  15.164  -58.054 1.00 86.62  ? 181  GLN B CG  1 
ATOM   5569 C CD  . GLN B 2 181 ? 13.328  14.344  -57.955 1.00 79.23  ? 181  GLN B CD  1 
ATOM   5570 O OE1 . GLN B 2 181 ? 13.392  13.147  -58.276 1.00 81.42  ? 181  GLN B OE1 1 
ATOM   5571 N NE2 . GLN B 2 181 ? 14.384  15.007  -57.492 1.00 70.24  ? 181  GLN B NE2 1 
ATOM   5572 N N   . TRP B 2 182 ? 7.775   13.332  -58.495 1.00 33.28  ? 182  TRP B N   1 
ATOM   5573 C CA  . TRP B 2 182 ? 6.630   12.981  -59.318 1.00 32.57  ? 182  TRP B CA  1 
ATOM   5574 C C   . TRP B 2 182 ? 5.437   13.789  -58.857 1.00 32.98  ? 182  TRP B C   1 
ATOM   5575 O O   . TRP B 2 182 ? 4.736   14.369  -59.686 1.00 39.02  ? 182  TRP B O   1 
ATOM   5576 C CB  . TRP B 2 182 ? 6.343   11.482  -59.252 1.00 30.27  ? 182  TRP B CB  1 
ATOM   5577 C CG  . TRP B 2 182 ? 5.280   11.037  -60.182 1.00 36.69  ? 182  TRP B CG  1 
ATOM   5578 C CD1 . TRP B 2 182 ? 5.443   10.497  -61.441 1.00 32.05  ? 182  TRP B CD1 1 
ATOM   5579 C CD2 . TRP B 2 182 ? 3.866   11.091  -59.950 1.00 39.28  ? 182  TRP B CD2 1 
ATOM   5580 N NE1 . TRP B 2 182 ? 4.217   10.196  -61.984 1.00 33.26  ? 182  TRP B NE1 1 
ATOM   5581 C CE2 . TRP B 2 182 ? 3.236   10.543  -61.088 1.00 36.97  ? 182  TRP B CE2 1 
ATOM   5582 C CE3 . TRP B 2 182 ? 3.075   11.535  -58.882 1.00 34.80  ? 182  TRP B CE3 1 
ATOM   5583 C CZ2 . TRP B 2 182 ? 1.856   10.440  -61.189 1.00 40.85  ? 182  TRP B CZ2 1 
ATOM   5584 C CZ3 . TRP B 2 182 ? 1.705   11.422  -58.973 1.00 35.48  ? 182  TRP B CZ3 1 
ATOM   5585 C CH2 . TRP B 2 182 ? 1.102   10.890  -60.119 1.00 40.99  ? 182  TRP B CH2 1 
ATOM   5586 N N   . VAL B 2 183 ? 5.245   13.878  -57.537 1.00 35.04  ? 183  VAL B N   1 
ATOM   5587 C CA  . VAL B 2 183 ? 4.179   14.712  -56.983 1.00 32.54  ? 183  VAL B CA  1 
ATOM   5588 C C   . VAL B 2 183 ? 4.291   16.201  -57.434 1.00 42.85  ? 183  VAL B C   1 
ATOM   5589 O O   . VAL B 2 183 ? 3.284   16.820  -57.883 1.00 34.57  ? 183  VAL B O   1 
ATOM   5590 C CB  . VAL B 2 183 ? 4.074   14.570  -55.458 1.00 31.77  ? 183  VAL B CB  1 
ATOM   5591 C CG1 . VAL B 2 183 ? 3.139   15.695  -54.842 1.00 25.98  ? 183  VAL B CG1 1 
ATOM   5592 C CG2 . VAL B 2 183 ? 3.561   13.174  -55.110 1.00 28.88  ? 183  VAL B CG2 1 
ATOM   5593 N N   . GLN B 2 184 ? 5.494   16.763  -57.348 1.00 30.36  ? 184  GLN B N   1 
ATOM   5594 C CA  . GLN B 2 184 ? 5.692   18.150  -57.801 1.00 36.50  ? 184  GLN B CA  1 
ATOM   5595 C C   . GLN B 2 184 ? 5.234   18.329  -59.243 1.00 39.89  ? 184  GLN B C   1 
ATOM   5596 O O   . GLN B 2 184 ? 4.515   19.284  -59.564 1.00 40.29  ? 184  GLN B O   1 
ATOM   5597 C CB  . GLN B 2 184 ? 7.160   18.594  -57.667 1.00 29.06  ? 184  GLN B CB  1 
ATOM   5598 C CG  . GLN B 2 184 ? 7.560   18.838  -56.242 1.00 35.49  ? 184  GLN B CG  1 
ATOM   5599 C CD  . GLN B 2 184 ? 6.667   19.884  -55.599 1.00 41.35  ? 184  GLN B CD  1 
ATOM   5600 O OE1 . GLN B 2 184 ? 6.584   21.011  -56.079 1.00 50.46  ? 184  GLN B OE1 1 
ATOM   5601 N NE2 . GLN B 2 184 ? 5.988   19.516  -54.526 1.00 37.17  ? 184  GLN B NE2 1 
ATOM   5602 N N   . GLU B 2 185 ? 5.632   17.393  -60.101 1.00 38.47  ? 185  GLU B N   1 
ATOM   5603 C CA  . GLU B 2 185 ? 5.403   17.534  -61.536 1.00 42.09  ? 185  GLU B CA  1 
ATOM   5604 C C   . GLU B 2 185 ? 3.978   17.182  -61.983 1.00 40.93  ? 185  GLU B C   1 
ATOM   5605 O O   . GLU B 2 185 ? 3.546   17.634  -63.045 1.00 42.82  ? 185  GLU B O   1 
ATOM   5606 C CB  . GLU B 2 185 ? 6.382   16.661  -62.327 1.00 46.01  ? 185  GLU B CB  1 
ATOM   5607 C CG  . GLU B 2 185 ? 7.842   16.913  -62.041 1.00 58.67  ? 185  GLU B CG  1 
ATOM   5608 C CD  . GLU B 2 185 ? 8.751   15.943  -62.794 1.00 68.88  ? 185  GLU B CD  1 
ATOM   5609 O OE1 . GLU B 2 185 ? 8.229   15.186  -63.652 1.00 72.37  ? 185  GLU B OE1 1 
ATOM   5610 O OE2 . GLU B 2 185 ? 9.981   15.934  -62.522 1.00 70.99  ? 185  GLU B OE2 1 
ATOM   5611 N N   . ASN B 2 186 ? 3.262   16.367  -61.206 1.00 39.00  ? 186  ASN B N   1 
ATOM   5612 C CA  . ASN B 2 186 ? 2.009   15.779  -61.688 1.00 35.88  ? 186  ASN B CA  1 
ATOM   5613 C C   . ASN B 2 186 ? 0.785   15.996  -60.803 1.00 36.53  ? 186  ASN B C   1 
ATOM   5614 O O   . ASN B 2 186 ? -0.343  15.796  -61.229 1.00 41.40  ? 186  ASN B O   1 
ATOM   5615 C CB  . ASN B 2 186 ? 2.200   14.268  -61.904 1.00 39.21  ? 186  ASN B CB  1 
ATOM   5616 C CG  . ASN B 2 186 ? 3.220   13.963  -62.983 1.00 42.72  ? 186  ASN B CG  1 
ATOM   5617 O OD1 . ASN B 2 186 ? 3.015   14.301  -64.135 1.00 45.13  ? 186  ASN B OD1 1 
ATOM   5618 N ND2 . ASN B 2 186 ? 4.343   13.364  -62.600 1.00 40.71  ? 186  ASN B ND2 1 
ATOM   5619 N N   . ILE B 2 187 ? 0.989   16.383  -59.557 1.00 38.65  ? 187  ILE B N   1 
ATOM   5620 C CA  . ILE B 2 187 ? -0.124  16.344  -58.615 1.00 37.58  ? 187  ILE B CA  1 
ATOM   5621 C C   . ILE B 2 187 ? -1.232  17.369  -58.937 1.00 38.01  ? 187  ILE B C   1 
ATOM   5622 O O   . ILE B 2 187 ? -2.398  17.141  -58.615 1.00 42.19  ? 187  ILE B O   1 
ATOM   5623 C CB  . ILE B 2 187 ? 0.348   16.479  -57.154 1.00 34.14  ? 187  ILE B CB  1 
ATOM   5624 C CG1 . ILE B 2 187 ? -0.580  15.678  -56.228 1.00 38.54  ? 187  ILE B CG1 1 
ATOM   5625 C CG2 . ILE B 2 187 ? 0.459   17.952  -56.762 1.00 33.83  ? 187  ILE B CG2 1 
ATOM   5626 C CD1 . ILE B 2 187 ? -0.670  14.166  -56.545 1.00 31.03  ? 187  ILE B CD1 1 
ATOM   5627 N N   . ALA B 2 188 ? -0.875  18.473  -59.587 1.00 34.62  ? 188  ALA B N   1 
ATOM   5628 C CA  . ALA B 2 188 ? -1.872  19.451  -60.021 1.00 36.91  ? 188  ALA B CA  1 
ATOM   5629 C C   . ALA B 2 188 ? -2.939  18.816  -60.934 1.00 42.23  ? 188  ALA B C   1 
ATOM   5630 O O   . ALA B 2 188 ? -4.101  19.224  -60.918 1.00 44.05  ? 188  ALA B O   1 
ATOM   5631 C CB  . ALA B 2 188 ? -1.203  20.608  -60.722 1.00 36.89  ? 188  ALA B CB  1 
ATOM   5632 N N   . ALA B 2 189 ? -2.555  17.800  -61.709 1.00 37.82  ? 189  ALA B N   1 
ATOM   5633 C CA  . ALA B 2 189 ? -3.496  17.151  -62.609 1.00 38.99  ? 189  ALA B CA  1 
ATOM   5634 C C   . ALA B 2 189 ? -4.605  16.454  -61.843 1.00 41.52  ? 189  ALA B C   1 
ATOM   5635 O O   . ALA B 2 189 ? -5.633  16.138  -62.411 1.00 48.64  ? 189  ALA B O   1 
ATOM   5636 C CB  . ALA B 2 189 ? -2.783  16.146  -63.500 1.00 40.60  ? 189  ALA B CB  1 
ATOM   5637 N N   . PHE B 2 190 ? -4.394  16.196  -60.558 1.00 43.02  ? 190  PHE B N   1 
ATOM   5638 C CA  . PHE B 2 190 ? -5.398  15.527  -59.737 1.00 38.81  ? 190  PHE B CA  1 
ATOM   5639 C C   . PHE B 2 190 ? -6.113  16.542  -58.856 1.00 39.48  ? 190  PHE B C   1 
ATOM   5640 O O   . PHE B 2 190 ? -6.918  16.179  -58.009 1.00 40.41  ? 190  PHE B O   1 
ATOM   5641 C CB  . PHE B 2 190 ? -4.746  14.472  -58.841 1.00 37.61  ? 190  PHE B CB  1 
ATOM   5642 C CG  . PHE B 2 190 ? -4.019  13.389  -59.604 1.00 40.94  ? 190  PHE B CG  1 
ATOM   5643 C CD1 . PHE B 2 190 ? -2.714  13.592  -60.074 1.00 36.40  ? 190  PHE B CD1 1 
ATOM   5644 C CD2 . PHE B 2 190 ? -4.622  12.171  -59.836 1.00 38.20  ? 190  PHE B CD2 1 
ATOM   5645 C CE1 . PHE B 2 190 ? -2.057  12.609  -60.784 1.00 35.00  ? 190  PHE B CE1 1 
ATOM   5646 C CE2 . PHE B 2 190 ? -3.961  11.175  -60.551 1.00 39.55  ? 190  PHE B CE2 1 
ATOM   5647 C CZ  . PHE B 2 190 ? -2.677  11.401  -61.024 1.00 37.06  ? 190  PHE B CZ  1 
ATOM   5648 N N   . GLY B 2 191 ? -5.782  17.815  -59.020 1.00 42.27  ? 191  GLY B N   1 
ATOM   5649 C CA  . GLY B 2 191 ? -6.280  18.832  -58.103 1.00 41.18  ? 191  GLY B CA  1 
ATOM   5650 C C   . GLY B 2 191 ? -5.435  19.052  -56.853 1.00 45.31  ? 191  GLY B C   1 
ATOM   5651 O O   . GLY B 2 191 ? -5.844  19.787  -55.959 1.00 44.98  ? 191  GLY B O   1 
ATOM   5652 N N   . GLY B 2 192 ? -4.261  18.423  -56.772 1.00 40.78  ? 192  GLY B N   1 
ATOM   5653 C CA  . GLY B 2 192 ? -3.396  18.606  -55.619 1.00 32.59  ? 192  GLY B CA  1 
ATOM   5654 C C   . GLY B 2 192 ? -2.634  19.894  -55.786 1.00 39.34  ? 192  GLY B C   1 
ATOM   5655 O O   . GLY B 2 192 ? -2.452  20.334  -56.902 1.00 53.94  ? 192  GLY B O   1 
ATOM   5656 N N   . ASP B 2 193 ? -2.204  20.514  -54.695 1.00 42.81  ? 193  ASP B N   1 
ATOM   5657 C CA  . ASP B 2 193 ? -1.428  21.751  -54.750 1.00 42.12  ? 193  ASP B CA  1 
ATOM   5658 C C   . ASP B 2 193 ? 0.033   21.427  -54.468 1.00 44.11  ? 193  ASP B C   1 
ATOM   5659 O O   . ASP B 2 193 ? 0.375   21.133  -53.338 1.00 46.92  ? 193  ASP B O   1 
ATOM   5660 C CB  . ASP B 2 193 ? -1.953  22.702  -53.680 1.00 48.72  ? 193  ASP B CB  1 
ATOM   5661 C CG  . ASP B 2 193 ? -1.162  24.027  -53.584 1.00 47.59  ? 193  ASP B CG  1 
ATOM   5662 O OD1 . ASP B 2 193 ? -0.238  24.266  -54.380 1.00 41.95  ? 193  ASP B OD1 1 
ATOM   5663 O OD2 . ASP B 2 193 ? -1.496  24.845  -52.691 1.00 48.41  ? 193  ASP B OD2 1 
ATOM   5664 N N   . PRO B 2 194 ? 0.909   21.482  -55.493 1.00 43.40  ? 194  PRO B N   1 
ATOM   5665 C CA  . PRO B 2 194 ? 2.303   21.085  -55.221 1.00 40.30  ? 194  PRO B CA  1 
ATOM   5666 C C   . PRO B 2 194 ? 2.992   22.090  -54.296 1.00 42.08  ? 194  PRO B C   1 
ATOM   5667 O O   . PRO B 2 194 ? 4.078   21.830  -53.767 1.00 41.20  ? 194  PRO B O   1 
ATOM   5668 C CB  . PRO B 2 194 ? 2.979   21.108  -56.604 1.00 38.67  ? 194  PRO B CB  1 
ATOM   5669 C CG  . PRO B 2 194 ? 1.904   21.544  -57.602 1.00 42.13  ? 194  PRO B CG  1 
ATOM   5670 C CD  . PRO B 2 194 ? 0.728   22.066  -56.838 1.00 37.76  ? 194  PRO B CD  1 
ATOM   5671 N N   . MET B 2 195 ? 2.361   23.240  -54.096 1.00 43.16  ? 195  MET B N   1 
ATOM   5672 C CA  . MET B 2 195 ? 2.909   24.217  -53.154 1.00 48.28  ? 195  MET B CA  1 
ATOM   5673 C C   . MET B 2 195 ? 2.472   23.987  -51.705 1.00 42.37  ? 195  MET B C   1 
ATOM   5674 O O   . MET B 2 195 ? 2.857   24.736  -50.812 1.00 45.23  ? 195  MET B O   1 
ATOM   5675 C CB  . MET B 2 195 ? 2.614   25.658  -53.599 1.00 43.61  ? 195  MET B CB  1 
ATOM   5676 C CG  . MET B 2 195 ? 3.405   26.079  -54.812 1.00 39.41  ? 195  MET B CG  1 
ATOM   5677 S SD  . MET B 2 195 ? 3.119   27.819  -55.184 1.00 67.90  ? 195  MET B SD  1 
ATOM   5678 C CE  . MET B 2 195 ? 1.378   27.798  -55.600 1.00 108.73 ? 195  MET B CE  1 
ATOM   5679 N N   . SER B 2 196 ? 1.674   22.955  -51.467 1.00 38.69  ? 196  SER B N   1 
ATOM   5680 C CA  . SER B 2 196 ? 1.425   22.543  -50.087 1.00 37.73  ? 196  SER B CA  1 
ATOM   5681 C C   . SER B 2 196 ? 1.487   21.037  -49.898 1.00 40.21  ? 196  SER B C   1 
ATOM   5682 O O   . SER B 2 196 ? 0.464   20.324  -50.010 1.00 35.44  ? 196  SER B O   1 
ATOM   5683 C CB  . SER B 2 196 ? 0.107   23.088  -49.550 1.00 40.32  ? 196  SER B CB  1 
ATOM   5684 O OG  . SER B 2 196 ? -0.100  22.610  -48.235 1.00 42.85  ? 196  SER B OG  1 
ATOM   5685 N N   . VAL B 2 197 ? 2.688   20.559  -49.581 1.00 31.81  ? 197  VAL B N   1 
ATOM   5686 C CA  . VAL B 2 197 ? 2.909   19.119  -49.469 1.00 26.87  ? 197  VAL B CA  1 
ATOM   5687 C C   . VAL B 2 197 ? 3.461   18.808  -48.101 1.00 30.84  ? 197  VAL B C   1 
ATOM   5688 O O   . VAL B 2 197 ? 4.443   19.414  -47.673 1.00 33.16  ? 197  VAL B O   1 
ATOM   5689 C CB  . VAL B 2 197 ? 3.903   18.589  -50.558 1.00 35.77  ? 197  VAL B CB  1 
ATOM   5690 C CG1 . VAL B 2 197 ? 4.317   17.134  -50.267 1.00 31.61  ? 197  VAL B CG1 1 
ATOM   5691 C CG2 . VAL B 2 197 ? 3.292   18.717  -51.955 1.00 32.26  ? 197  VAL B CG2 1 
ATOM   5692 N N   . THR B 2 198 ? 2.834   17.862  -47.422 1.00 27.15  ? 198  THR B N   1 
ATOM   5693 C CA  . THR B 2 198 ? 3.224   17.468  -46.095 1.00 23.62  ? 198  THR B CA  1 
ATOM   5694 C C   . THR B 2 198 ? 3.571   16.008  -46.179 1.00 33.78  ? 198  THR B C   1 
ATOM   5695 O O   . THR B 2 198 ? 2.743   15.211  -46.613 1.00 35.33  ? 198  THR B O   1 
ATOM   5696 C CB  . THR B 2 198 ? 2.016   17.617  -45.135 1.00 27.22  ? 198  THR B CB  1 
ATOM   5697 O OG1 . THR B 2 198 ? 1.618   18.992  -45.100 1.00 33.04  ? 198  THR B OG1 1 
ATOM   5698 C CG2 . THR B 2 198 ? 2.339   17.176  -43.706 1.00 20.39  ? 198  THR B CG2 1 
ATOM   5699 N N   . LEU B 2 199 ? 4.785   15.654  -45.766 1.00 27.10  ? 199  LEU B N   1 
ATOM   5700 C CA  . LEU B 2 199 ? 5.163   14.257  -45.618 1.00 28.49  ? 199  LEU B CA  1 
ATOM   5701 C C   . LEU B 2 199 ? 4.676   13.759  -44.272 1.00 31.02  ? 199  LEU B C   1 
ATOM   5702 O O   . LEU B 2 199 ? 4.786   14.463  -43.286 1.00 33.40  ? 199  LEU B O   1 
ATOM   5703 C CB  . LEU B 2 199 ? 6.685   14.121  -45.680 1.00 27.82  ? 199  LEU B CB  1 
ATOM   5704 C CG  . LEU B 2 199 ? 7.320   14.847  -46.856 1.00 28.82  ? 199  LEU B CG  1 
ATOM   5705 C CD1 . LEU B 2 199 ? 8.847   14.641  -46.798 1.00 31.37  ? 199  LEU B CD1 1 
ATOM   5706 C CD2 . LEU B 2 199 ? 6.708   14.304  -48.170 1.00 25.36  ? 199  LEU B CD2 1 
ATOM   5707 N N   . PHE B 2 200 ? 4.065   12.587  -44.213 1.00 29.68  ? 200  PHE B N   1 
ATOM   5708 C CA  . PHE B 2 200 ? 3.955   11.960  -42.902 1.00 27.61  ? 200  PHE B CA  1 
ATOM   5709 C C   . PHE B 2 200 ? 4.401   10.495  -43.003 1.00 32.81  ? 200  PHE B C   1 
ATOM   5710 O O   . PHE B 2 200 ? 4.340   9.908   -44.079 1.00 32.50  ? 200  PHE B O   1 
ATOM   5711 C CB  . PHE B 2 200 ? 2.591   12.198  -42.209 1.00 24.86  ? 200  PHE B CB  1 
ATOM   5712 C CG  . PHE B 2 200 ? 1.357   11.570  -42.909 1.00 33.26  ? 200  PHE B CG  1 
ATOM   5713 C CD1 . PHE B 2 200 ? 1.174   11.652  -44.282 1.00 31.71  ? 200  PHE B CD1 1 
ATOM   5714 C CD2 . PHE B 2 200 ? 0.364   10.951  -42.144 1.00 29.92  ? 200  PHE B CD2 1 
ATOM   5715 C CE1 . PHE B 2 200 ? 0.044   11.112  -44.888 1.00 35.10  ? 200  PHE B CE1 1 
ATOM   5716 C CE2 . PHE B 2 200 ? -0.764  10.405  -42.723 1.00 31.04  ? 200  PHE B CE2 1 
ATOM   5717 C CZ  . PHE B 2 200 ? -0.941  10.475  -44.103 1.00 35.37  ? 200  PHE B CZ  1 
ATOM   5718 N N   . GLY B 2 201 ? 4.895   9.945   -41.902 1.00 29.55  ? 201  GLY B N   1 
ATOM   5719 C CA  . GLY B 2 201 ? 5.332   8.555   -41.871 1.00 38.62  ? 201  GLY B CA  1 
ATOM   5720 C C   . GLY B 2 201 ? 5.443   8.061   -40.445 1.00 37.95  ? 201  GLY B C   1 
ATOM   5721 O O   . GLY B 2 201 ? 5.473   8.851   -39.527 1.00 44.29  ? 201  GLY B O   1 
ATOM   5722 N N   . GLU B 2 202 ? 5.461   6.758   -40.258 1.00 32.79  ? 202  GLU B N   1 
ATOM   5723 C CA  . GLU B 2 202 ? 5.489   6.171   -38.925 1.00 33.18  ? 202  GLU B CA  1 
ATOM   5724 C C   . GLU B 2 202 ? 6.681   5.217   -38.839 1.00 31.32  ? 202  GLU B C   1 
ATOM   5725 O O   . GLU B 2 202 ? 6.999   4.555   -39.813 1.00 31.36  ? 202  GLU B O   1 
ATOM   5726 C CB  . GLU B 2 202 ? 4.176   5.438   -38.616 1.00 26.29  ? 202  GLU B CB  1 
ATOM   5727 C CG  . GLU B 2 202 ? 4.052   4.941   -37.187 1.00 28.47  ? 202  GLU B CG  1 
ATOM   5728 C CD  . GLU B 2 202 ? 4.529   3.498   -37.037 1.00 40.73  ? 202  GLU B CD  1 
ATOM   5729 O OE1 . GLU B 2 202 ? 4.774   2.854   -38.084 1.00 41.44  ? 202  GLU B OE1 1 
ATOM   5730 O OE2 . GLU B 2 202 ? 4.653   3.007   -35.883 1.00 41.21  ? 202  GLU B OE2 1 
HETATM 5731 N N   . SGB B 2 203 ? 7.344   5.182   -37.684 1.00 30.97  ? 203  SGB B N   1 
HETATM 5732 C CA  . SGB B 2 203 ? 8.520   4.341   -37.458 1.00 31.37  ? 203  SGB B CA  1 
HETATM 5733 C C   . SGB B 2 203 ? 9.603   4.606   -38.489 1.00 33.48  ? 203  SGB B C   1 
HETATM 5734 O O   . SGB B 2 203 ? 10.012  5.731   -38.630 1.00 35.09  ? 203  SGB B O   1 
HETATM 5735 C CB  . SGB B 2 203 ? 8.075   2.887   -37.451 1.00 26.46  ? 203  SGB B CB  1 
HETATM 5736 O OG  . SGB B 2 203 ? 9.013   2.162   -36.711 1.00 34.59  ? 203  SGB B OG  1 
HETATM 5737 O O1  . SGB B 2 203 ? 9.654   0.733   -38.753 1.00 35.57  ? 203  SGB B O1  1 
HETATM 5738 P P1  . SGB B 2 203 ? 9.678   0.739   -37.250 1.00 47.65  ? 203  SGB B P1  1 
HETATM 5739 C C1  . SGB B 2 203 ? 11.112  0.653   -36.760 1.00 45.10  ? 203  SGB B C1  1 
HETATM 5740 O O2  . SGB B 2 203 ? 8.682   -0.483  -36.736 1.00 52.74  ? 203  SGB B O2  1 
HETATM 5741 C C2  . SGB B 2 203 ? 8.506   -1.779  -37.335 1.00 49.01  ? 203  SGB B C2  1 
HETATM 5742 C C4  . SGB B 2 203 ? 9.801   -2.587  -37.392 1.00 49.86  ? 203  SGB B C4  1 
HETATM 5743 C C3  . SGB B 2 203 ? 7.552   -2.562  -36.452 1.00 44.31  ? 203  SGB B C3  1 
ATOM   5744 N N   . ALA B 2 204 ? 10.061  3.586   -39.217 1.00 32.30  ? 204  ALA B N   1 
ATOM   5745 C CA  . ALA B 2 204 ? 11.016  3.839   -40.296 1.00 32.55  ? 204  ALA B CA  1 
ATOM   5746 C C   . ALA B 2 204 ? 10.484  4.864   -41.329 1.00 33.81  ? 204  ALA B C   1 
ATOM   5747 O O   . ALA B 2 204 ? 11.261  5.624   -41.909 1.00 29.35  ? 204  ALA B O   1 
ATOM   5748 C CB  . ALA B 2 204 ? 11.480  2.536   -40.973 1.00 31.74  ? 204  ALA B CB  1 
ATOM   5749 N N   . GLY B 2 205 ? 9.167   4.926   -41.527 1.00 26.76  ? 205  GLY B N   1 
ATOM   5750 C CA  . GLY B 2 205 ? 8.609   5.977   -42.374 1.00 26.57  ? 205  GLY B CA  1 
ATOM   5751 C C   . GLY B 2 205 ? 8.880   7.370   -41.776 1.00 27.30  ? 205  GLY B C   1 
ATOM   5752 O O   . GLY B 2 205 ? 9.142   8.344   -42.503 1.00 33.34  ? 205  GLY B O   1 
ATOM   5753 N N   . ALA B 2 206 ? 8.818   7.491   -40.449 1.00 28.42  ? 206  ALA B N   1 
ATOM   5754 C CA  . ALA B 2 206 ? 9.120   8.787   -39.795 1.00 23.93  ? 206  ALA B CA  1 
ATOM   5755 C C   . ALA B 2 206 ? 10.602  9.103   -39.904 1.00 31.90  ? 206  ALA B C   1 
ATOM   5756 O O   . ALA B 2 206 ? 10.980  10.248  -40.120 1.00 34.62  ? 206  ALA B O   1 
ATOM   5757 C CB  . ALA B 2 206 ? 8.699   8.763   -38.338 1.00 23.89  ? 206  ALA B CB  1 
ATOM   5758 N N   . ALA B 2 207 ? 11.455  8.095   -39.736 1.00 26.03  ? 207  ALA B N   1 
ATOM   5759 C CA  . ALA B 2 207 ? 12.905  8.343   -39.854 1.00 27.98  ? 207  ALA B CA  1 
ATOM   5760 C C   . ALA B 2 207 ? 13.210  8.787   -41.274 1.00 34.08  ? 207  ALA B C   1 
ATOM   5761 O O   . ALA B 2 207 ? 14.111  9.623   -41.488 1.00 26.24  ? 207  ALA B O   1 
ATOM   5762 C CB  . ALA B 2 207 ? 13.715  7.082   -39.507 1.00 23.32  ? 207  ALA B CB  1 
ATOM   5763 N N   . SER B 2 208 ? 12.435  8.253   -42.245 1.00 25.45  ? 208  SER B N   1 
ATOM   5764 C CA  . SER B 2 208 ? 12.584  8.671   -43.665 1.00 27.25  ? 208  SER B CA  1 
ATOM   5765 C C   . SER B 2 208 ? 12.194  10.128  -43.835 1.00 29.09  ? 208  SER B C   1 
ATOM   5766 O O   . SER B 2 208 ? 12.922  10.929  -44.426 1.00 29.52  ? 208  SER B O   1 
ATOM   5767 C CB  . SER B 2 208 ? 11.763  7.794   -44.628 1.00 25.56  ? 208  SER B CB  1 
ATOM   5768 O OG  . SER B 2 208 ? 12.154  6.419   -44.551 1.00 30.55  ? 208  SER B OG  1 
ATOM   5769 N N   . VAL B 2 209 ? 11.026  10.484  -43.334 1.00 29.97  ? 209  VAL B N   1 
ATOM   5770 C CA  . VAL B 2 209 ? 10.628  11.914  -43.313 1.00 28.49  ? 209  VAL B CA  1 
ATOM   5771 C C   . VAL B 2 209 ? 11.760  12.789  -42.742 1.00 27.34  ? 209  VAL B C   1 
ATOM   5772 O O   . VAL B 2 209 ? 12.156  13.776  -43.362 1.00 33.95  ? 209  VAL B O   1 
ATOM   5773 C CB  . VAL B 2 209 ? 9.333   12.094  -42.521 1.00 24.36  ? 209  VAL B CB  1 
ATOM   5774 C CG1 . VAL B 2 209 ? 8.971   13.598  -42.352 1.00 26.78  ? 209  VAL B CG1 1 
ATOM   5775 C CG2 . VAL B 2 209 ? 8.181   11.331  -43.268 1.00 25.66  ? 209  VAL B CG2 1 
ATOM   5776 N N   . GLY B 2 210 ? 12.314  12.396  -41.596 1.00 26.76  ? 210  GLY B N   1 
ATOM   5777 C CA  . GLY B 2 210 ? 13.422  13.134  -40.985 1.00 32.58  ? 210  GLY B CA  1 
ATOM   5778 C C   . GLY B 2 210 ? 14.638  13.239  -41.888 1.00 31.13  ? 210  GLY B C   1 
ATOM   5779 O O   . GLY B 2 210 ? 15.286  14.275  -42.010 1.00 34.50  ? 210  GLY B O   1 
ATOM   5780 N N   . MET B 2 211 ? 14.934  12.158  -42.579 1.00 30.12  ? 211  MET B N   1 
ATOM   5781 C CA  . MET B 2 211 ? 16.005  12.214  -43.533 1.00 33.09  ? 211  MET B CA  1 
ATOM   5782 C C   . MET B 2 211 ? 15.734  13.152  -44.713 1.00 38.43  ? 211  MET B C   1 
ATOM   5783 O O   . MET B 2 211 ? 16.654  13.821  -45.165 1.00 38.16  ? 211  MET B O   1 
ATOM   5784 C CB  . MET B 2 211 ? 16.426  10.809  -43.923 1.00 33.03  ? 211  MET B CB  1 
ATOM   5785 C CG  . MET B 2 211 ? 17.415  10.262  -42.839 1.00 39.92  ? 211  MET B CG  1 
ATOM   5786 S SD  . MET B 2 211 ? 17.352  8.498   -42.888 1.00 55.98  ? 211  MET B SD  1 
ATOM   5787 C CE  . MET B 2 211 ? 17.661  8.071   -41.193 1.00 41.37  ? 211  MET B CE  1 
ATOM   5788 N N   . HIS B 2 212 ? 14.491  13.248  -45.190 1.00 34.34  ? 212  HIS B N   1 
ATOM   5789 C CA  . HIS B 2 212 ? 14.218  14.247  -46.213 1.00 31.14  ? 212  HIS B CA  1 
ATOM   5790 C C   . HIS B 2 212 ? 14.390  15.674  -45.659 1.00 37.50  ? 212  HIS B C   1 
ATOM   5791 O O   . HIS B 2 212 ? 14.840  16.560  -46.375 1.00 33.15  ? 212  HIS B O   1 
ATOM   5792 C CB  . HIS B 2 212 ? 12.861  14.045  -46.900 1.00 27.17  ? 212  HIS B CB  1 
ATOM   5793 C CG  . HIS B 2 212 ? 12.774  12.756  -47.646 1.00 30.56  ? 212  HIS B CG  1 
ATOM   5794 N ND1 . HIS B 2 212 ? 13.460  12.531  -48.830 1.00 27.99  ? 212  HIS B ND1 1 
ATOM   5795 C CD2 . HIS B 2 212 ? 12.134  11.604  -47.358 1.00 28.00  ? 212  HIS B CD2 1 
ATOM   5796 C CE1 . HIS B 2 212 ? 13.217  11.303  -49.239 1.00 32.21  ? 212  HIS B CE1 1 
ATOM   5797 N NE2 . HIS B 2 212 ? 12.420  10.713  -48.362 1.00 32.17  ? 212  HIS B NE2 1 
ATOM   5798 N N   . ILE B 2 213 ? 14.038  15.883  -44.392 1.00 33.05  ? 213  ILE B N   1 
ATOM   5799 C CA  . ILE B 2 213 ? 14.327  17.150  -43.751 1.00 36.54  ? 213  ILE B CA  1 
ATOM   5800 C C   . ILE B 2 213 ? 15.836  17.468  -43.746 1.00 41.99  ? 213  ILE B C   1 
ATOM   5801 O O   . ILE B 2 213 ? 16.243  18.622  -43.954 1.00 38.89  ? 213  ILE B O   1 
ATOM   5802 C CB  . ILE B 2 213 ? 13.786  17.160  -42.301 1.00 36.18  ? 213  ILE B CB  1 
ATOM   5803 C CG1 . ILE B 2 213 ? 12.239  17.212  -42.329 1.00 31.70  ? 213  ILE B CG1 1 
ATOM   5804 C CG2 . ILE B 2 213 ? 14.399  18.340  -41.535 1.00 28.90  ? 213  ILE B CG2 1 
ATOM   5805 C CD1 . ILE B 2 213 ? 11.579  17.012  -40.997 1.00 32.10  ? 213  ILE B CD1 1 
ATOM   5806 N N   . LEU B 2 214 ? 16.663  16.442  -43.529 1.00 36.76  ? 214  LEU B N   1 
ATOM   5807 C CA  . LEU B 2 214 ? 18.101  16.639  -43.378 1.00 33.89  ? 214  LEU B CA  1 
ATOM   5808 C C   . LEU B 2 214 ? 18.896  16.537  -44.683 1.00 41.85  ? 214  LEU B C   1 
ATOM   5809 O O   . LEU B 2 214 ? 20.128  16.638  -44.677 1.00 39.52  ? 214  LEU B O   1 
ATOM   5810 C CB  . LEU B 2 214 ? 18.677  15.671  -42.340 1.00 26.87  ? 214  LEU B CB  1 
ATOM   5811 C CG  . LEU B 2 214 ? 17.984  15.794  -40.984 1.00 32.49  ? 214  LEU B CG  1 
ATOM   5812 C CD1 . LEU B 2 214 ? 18.544  14.807  -39.996 1.00 31.49  ? 214  LEU B CD1 1 
ATOM   5813 C CD2 . LEU B 2 214 ? 18.103  17.228  -40.426 1.00 35.01  ? 214  LEU B CD2 1 
ATOM   5814 N N   . SER B 2 215 ? 18.207  16.348  -45.801 1.00 41.47  ? 215  SER B N   1 
ATOM   5815 C CA  . SER B 2 215 ? 18.904  16.255  -47.074 1.00 37.08  ? 215  SER B CA  1 
ATOM   5816 C C   . SER B 2 215 ? 18.446  17.335  -48.061 1.00 41.97  ? 215  SER B C   1 
ATOM   5817 O O   . SER B 2 215 ? 17.283  17.404  -48.473 1.00 39.33  ? 215  SER B O   1 
ATOM   5818 C CB  . SER B 2 215 ? 18.755  14.857  -47.665 1.00 36.79  ? 215  SER B CB  1 
ATOM   5819 O OG  . SER B 2 215 ? 19.431  14.765  -48.917 1.00 38.72  ? 215  SER B OG  1 
ATOM   5820 N N   . LEU B 2 216 ? 19.377  18.196  -48.439 1.00 46.02  ? 216  LEU B N   1 
ATOM   5821 C CA  . LEU B 2 216 ? 19.017  19.384  -49.191 1.00 46.29  ? 216  LEU B CA  1 
ATOM   5822 C C   . LEU B 2 216 ? 18.158  19.113  -50.427 1.00 40.91  ? 216  LEU B C   1 
ATOM   5823 O O   . LEU B 2 216 ? 17.117  19.701  -50.599 1.00 40.29  ? 216  LEU B O   1 
ATOM   5824 C CB  . LEU B 2 216 ? 20.261  20.155  -49.585 1.00 56.77  ? 216  LEU B CB  1 
ATOM   5825 C CG  . LEU B 2 216 ? 20.109  21.625  -49.216 1.00 68.77  ? 216  LEU B CG  1 
ATOM   5826 C CD1 . LEU B 2 216 ? 20.352  21.782  -47.696 1.00 68.30  ? 216  LEU B CD1 1 
ATOM   5827 C CD2 . LEU B 2 216 ? 21.057  22.502  -50.062 1.00 64.18  ? 216  LEU B CD2 1 
ATOM   5828 N N   . PRO B 2 217 ? 18.603  18.235  -51.314 1.00 40.02  ? 217  PRO B N   1 
ATOM   5829 C CA  . PRO B 2 217 ? 17.744  18.070  -52.494 1.00 44.20  ? 217  PRO B CA  1 
ATOM   5830 C C   . PRO B 2 217 ? 16.281  17.675  -52.201 1.00 45.47  ? 217  PRO B C   1 
ATOM   5831 O O   . PRO B 2 217 ? 15.442  17.891  -53.059 1.00 46.48  ? 217  PRO B O   1 
ATOM   5832 C CB  . PRO B 2 217 ? 18.466  16.969  -53.297 1.00 38.67  ? 217  PRO B CB  1 
ATOM   5833 C CG  . PRO B 2 217 ? 19.903  17.058  -52.805 1.00 28.87  ? 217  PRO B CG  1 
ATOM   5834 C CD  . PRO B 2 217 ? 19.786  17.358  -51.353 1.00 29.36  ? 217  PRO B CD  1 
ATOM   5835 N N   . SER B 2 218 ? 15.964  17.120  -51.035 1.00 43.84  ? 218  SER B N   1 
ATOM   5836 C CA  . SER B 2 218 ? 14.561  16.818  -50.750 1.00 37.31  ? 218  SER B CA  1 
ATOM   5837 C C   . SER B 2 218 ? 13.769  18.044  -50.340 1.00 39.08  ? 218  SER B C   1 
ATOM   5838 O O   . SER B 2 218 ? 12.552  18.058  -50.457 1.00 37.31  ? 218  SER B O   1 
ATOM   5839 C CB  . SER B 2 218 ? 14.435  15.764  -49.664 1.00 35.99  ? 218  SER B CB  1 
ATOM   5840 O OG  . SER B 2 218 ? 14.789  14.483  -50.151 1.00 38.04  ? 218  SER B OG  1 
ATOM   5841 N N   . ARG B 2 219 ? 14.459  19.076  -49.857 1.00 44.14  ? 219  ARG B N   1 
ATOM   5842 C CA  . ARG B 2 219 ? 13.796  20.198  -49.182 1.00 44.88  ? 219  ARG B CA  1 
ATOM   5843 C C   . ARG B 2 219 ? 12.905  21.038  -50.076 1.00 40.28  ? 219  ARG B C   1 
ATOM   5844 O O   . ARG B 2 219 ? 11.971  21.658  -49.599 1.00 43.29  ? 219  ARG B O   1 
ATOM   5845 C CB  . ARG B 2 219 ? 14.811  21.074  -48.445 1.00 45.17  ? 219  ARG B CB  1 
ATOM   5846 C CG  . ARG B 2 219 ? 15.408  20.364  -47.232 1.00 45.49  ? 219  ARG B CG  1 
ATOM   5847 C CD  . ARG B 2 219 ? 14.338  20.037  -46.224 1.00 50.65  ? 219  ARG B CD  1 
ATOM   5848 N NE  . ARG B 2 219 ? 13.697  21.232  -45.685 1.00 53.19  ? 219  ARG B NE  1 
ATOM   5849 C CZ  . ARG B 2 219 ? 14.158  21.905  -44.629 1.00 63.05  ? 219  ARG B CZ  1 
ATOM   5850 N NH1 . ARG B 2 219 ? 15.270  21.492  -44.015 1.00 60.31  ? 219  ARG B NH1 1 
ATOM   5851 N NH2 . ARG B 2 219 ? 13.530  22.997  -44.188 1.00 63.86  ? 219  ARG B NH2 1 
ATOM   5852 N N   . SER B 2 220 ? 13.178  21.039  -51.370 1.00 38.33  ? 220  SER B N   1 
ATOM   5853 C CA  . SER B 2 220 ? 12.337  21.757  -52.301 1.00 43.98  ? 220  SER B CA  1 
ATOM   5854 C C   . SER B 2 220 ? 11.090  20.955  -52.649 1.00 42.96  ? 220  SER B C   1 
ATOM   5855 O O   . SER B 2 220 ? 10.242  21.409  -53.433 1.00 46.79  ? 220  SER B O   1 
ATOM   5856 C CB  . SER B 2 220 ? 13.116  22.037  -53.585 1.00 51.02  ? 220  SER B CB  1 
ATOM   5857 O OG  . SER B 2 220 ? 13.383  20.821  -54.286 1.00 56.77  ? 220  SER B OG  1 
ATOM   5858 N N   . LEU B 2 221 ? 10.963  19.757  -52.104 1.00 36.19  ? 221  LEU B N   1 
ATOM   5859 C CA  . LEU B 2 221 ? 9.854   18.896  -52.541 1.00 38.20  ? 221  LEU B CA  1 
ATOM   5860 C C   . LEU B 2 221 ? 8.697   18.807  -51.554 1.00 37.47  ? 221  LEU B C   1 
ATOM   5861 O O   . LEU B 2 221 ? 7.739   18.062  -51.771 1.00 44.01  ? 221  LEU B O   1 
ATOM   5862 C CB  . LEU B 2 221 ? 10.370  17.499  -52.905 1.00 35.11  ? 221  LEU B CB  1 
ATOM   5863 C CG  . LEU B 2 221 ? 11.598  17.485  -53.830 1.00 38.09  ? 221  LEU B CG  1 
ATOM   5864 C CD1 . LEU B 2 221 ? 12.213  16.098  -53.978 1.00 36.90  ? 221  LEU B CD1 1 
ATOM   5865 C CD2 . LEU B 2 221 ? 11.246  18.054  -55.197 1.00 32.93  ? 221  LEU B CD2 1 
ATOM   5866 N N   . PHE B 2 222 ? 8.785   19.557  -50.464 1.00 38.43  ? 222  PHE B N   1 
ATOM   5867 C CA  . PHE B 2 222 ? 7.761   19.513  -49.413 1.00 35.85  ? 222  PHE B CA  1 
ATOM   5868 C C   . PHE B 2 222 ? 7.894   20.687  -48.476 1.00 35.60  ? 222  PHE B C   1 
ATOM   5869 O O   . PHE B 2 222 ? 8.915   21.375  -48.471 1.00 40.28  ? 222  PHE B O   1 
ATOM   5870 C CB  . PHE B 2 222 ? 7.814   18.186  -48.616 1.00 34.33  ? 222  PHE B CB  1 
ATOM   5871 C CG  . PHE B 2 222 ? 9.037   18.041  -47.723 1.00 34.26  ? 222  PHE B CG  1 
ATOM   5872 C CD1 . PHE B 2 222 ? 10.256  17.655  -48.257 1.00 31.17  ? 222  PHE B CD1 1 
ATOM   5873 C CD2 . PHE B 2 222 ? 8.942   18.265  -46.348 1.00 34.79  ? 222  PHE B CD2 1 
ATOM   5874 C CE1 . PHE B 2 222 ? 11.362  17.512  -47.451 1.00 43.37  ? 222  PHE B CE1 1 
ATOM   5875 C CE2 . PHE B 2 222 ? 10.032  18.119  -45.530 1.00 35.76  ? 222  PHE B CE2 1 
ATOM   5876 C CZ  . PHE B 2 222 ? 11.259  17.751  -46.082 1.00 46.44  ? 222  PHE B CZ  1 
ATOM   5877 N N   . HIS B 2 223 ? 6.875   20.897  -47.652 1.00 39.45  ? 223  HIS B N   1 
ATOM   5878 C CA  . HIS B 2 223 ? 6.788   22.108  -46.842 1.00 36.93  ? 223  HIS B CA  1 
ATOM   5879 C C   . HIS B 2 223 ? 6.663   21.857  -45.349 1.00 34.39  ? 223  HIS B C   1 
ATOM   5880 O O   . HIS B 2 223 ? 7.028   22.712  -44.558 1.00 42.36  ? 223  HIS B O   1 
ATOM   5881 C CB  . HIS B 2 223 ? 5.643   22.966  -47.350 1.00 34.29  ? 223  HIS B CB  1 
ATOM   5882 C CG  . HIS B 2 223 ? 5.606   23.037  -48.840 1.00 43.29  ? 223  HIS B CG  1 
ATOM   5883 N ND1 . HIS B 2 223 ? 6.288   24.002  -49.558 1.00 43.88  ? 223  HIS B ND1 1 
ATOM   5884 C CD2 . HIS B 2 223 ? 5.026   22.220  -49.756 1.00 37.71  ? 223  HIS B CD2 1 
ATOM   5885 C CE1 . HIS B 2 223 ? 6.110   23.787  -50.849 1.00 45.99  ? 223  HIS B CE1 1 
ATOM   5886 N NE2 . HIS B 2 223 ? 5.349   22.712  -50.995 1.00 43.15  ? 223  HIS B NE2 1 
ATOM   5887 N N   . ARG B 2 224 ? 6.185   20.679  -44.966 1.00 32.13  ? 224  ARG B N   1 
ATOM   5888 C CA  . ARG B 2 224 ? 5.911   20.380  -43.558 1.00 32.73  ? 224  ARG B CA  1 
ATOM   5889 C C   . ARG B 2 224 ? 6.069   18.883  -43.427 1.00 28.84  ? 224  ARG B C   1 
ATOM   5890 O O   . ARG B 2 224 ? 6.024   18.197  -44.436 1.00 27.93  ? 224  ARG B O   1 
ATOM   5891 C CB  . ARG B 2 224 ? 4.464   20.751  -43.209 1.00 37.71  ? 224  ARG B CB  1 
ATOM   5892 C CG  . ARG B 2 224 ? 4.225   22.212  -43.216 1.00 45.26  ? 224  ARG B CG  1 
ATOM   5893 C CD  . ARG B 2 224 ? 2.797   22.568  -42.882 1.00 41.62  ? 224  ARG B CD  1 
ATOM   5894 N NE  . ARG B 2 224 ? 2.034   22.688  -44.092 1.00 45.57  ? 224  ARG B NE  1 
ATOM   5895 C CZ  . ARG B 2 224 ? 2.202   23.654  -44.989 1.00 56.43  ? 224  ARG B CZ  1 
ATOM   5896 N NH1 . ARG B 2 224 ? 3.125   24.590  -44.803 1.00 49.01  ? 224  ARG B NH1 1 
ATOM   5897 N NH2 . ARG B 2 224 ? 1.450   23.673  -46.090 1.00 61.67  ? 224  ARG B NH2 1 
ATOM   5898 N N   . ALA B 2 225 ? 6.241   18.393  -42.199 1.00 26.81  ? 225  ALA B N   1 
ATOM   5899 C CA  . ALA B 2 225 ? 6.483   16.980  -41.956 1.00 33.43  ? 225  ALA B CA  1 
ATOM   5900 C C   . ALA B 2 225 ? 5.800   16.518  -40.672 1.00 33.22  ? 225  ALA B C   1 
ATOM   5901 O O   . ALA B 2 225 ? 5.586   17.295  -39.733 1.00 31.00  ? 225  ALA B O   1 
ATOM   5902 C CB  . ALA B 2 225 ? 7.980   16.755  -41.846 1.00 31.38  ? 225  ALA B CB  1 
ATOM   5903 N N   . VAL B 2 226 ? 5.478   15.239  -40.631 1.00 32.09  ? 226  VAL B N   1 
ATOM   5904 C CA  . VAL B 2 226 ? 4.915   14.630  -39.449 1.00 29.06  ? 226  VAL B CA  1 
ATOM   5905 C C   . VAL B 2 226 ? 5.734   13.378  -39.227 1.00 32.04  ? 226  VAL B C   1 
ATOM   5906 O O   . VAL B 2 226 ? 5.835   12.565  -40.126 1.00 32.02  ? 226  VAL B O   1 
ATOM   5907 C CB  . VAL B 2 226 ? 3.441   14.231  -39.662 1.00 27.48  ? 226  VAL B CB  1 
ATOM   5908 C CG1 . VAL B 2 226 ? 2.861   13.589  -38.372 1.00 27.63  ? 226  VAL B CG1 1 
ATOM   5909 C CG2 . VAL B 2 226 ? 2.594   15.460  -40.130 1.00 32.08  ? 226  VAL B CG2 1 
ATOM   5910 N N   . LEU B 2 227 ? 6.344   13.256  -38.049 1.00 32.18  ? 227  LEU B N   1 
ATOM   5911 C CA  . LEU B 2 227 ? 7.078   12.063  -37.681 1.00 35.23  ? 227  LEU B CA  1 
ATOM   5912 C C   . LEU B 2 227 ? 6.338   11.350  -36.558 1.00 35.57  ? 227  LEU B C   1 
ATOM   5913 O O   . LEU B 2 227 ? 6.279   11.831  -35.428 1.00 35.26  ? 227  LEU B O   1 
ATOM   5914 C CB  . LEU B 2 227 ? 8.501   12.405  -37.250 1.00 32.30  ? 227  LEU B CB  1 
ATOM   5915 C CG  . LEU B 2 227 ? 9.396   12.852  -38.415 1.00 31.42  ? 227  LEU B CG  1 
ATOM   5916 C CD1 . LEU B 2 227 ? 9.163   14.336  -38.721 1.00 26.05  ? 227  LEU B CD1 1 
ATOM   5917 C CD2 . LEU B 2 227 ? 10.893  12.624  -38.103 1.00 25.87  ? 227  LEU B CD2 1 
ATOM   5918 N N   . GLN B 2 228 ? 5.748   10.208  -36.881 1.00 26.62  ? 228  GLN B N   1 
ATOM   5919 C CA  . GLN B 2 228 ? 5.065   9.387   -35.880 1.00 28.48  ? 228  GLN B CA  1 
ATOM   5920 C C   . GLN B 2 228 ? 5.980   8.244   -35.442 1.00 33.44  ? 228  GLN B C   1 
ATOM   5921 O O   . GLN B 2 228 ? 6.327   7.393   -36.258 1.00 37.84  ? 228  GLN B O   1 
ATOM   5922 C CB  . GLN B 2 228 ? 3.772   8.807   -36.475 1.00 24.29  ? 228  GLN B CB  1 
ATOM   5923 C CG  . GLN B 2 228 ? 2.917   9.881   -37.134 1.00 27.40  ? 228  GLN B CG  1 
ATOM   5924 C CD  . GLN B 2 228 ? 1.704   9.320   -37.902 1.00 33.07  ? 228  GLN B CD  1 
ATOM   5925 O OE1 . GLN B 2 228 ? 1.207   8.214   -37.620 1.00 33.58  ? 228  GLN B OE1 1 
ATOM   5926 N NE2 . GLN B 2 228 ? 1.224   10.089  -38.867 1.00 26.31  ? 228  GLN B NE2 1 
ATOM   5927 N N   . SER B 2 229 ? 6.389   8.243   -34.171 1.00 27.92  ? 229  SER B N   1 
ATOM   5928 C CA  . SER B 2 229 ? 7.109   7.126   -33.593 1.00 29.31  ? 229  SER B CA  1 
ATOM   5929 C C   . SER B 2 229 ? 8.388   6.793   -34.362 1.00 31.99  ? 229  SER B C   1 
ATOM   5930 O O   . SER B 2 229 ? 8.714   5.621   -34.577 1.00 29.95  ? 229  SER B O   1 
ATOM   5931 C CB  . SER B 2 229 ? 6.216   5.875   -33.543 1.00 30.76  ? 229  SER B CB  1 
ATOM   5932 O OG  . SER B 2 229 ? 5.105   6.057   -32.689 1.00 33.31  ? 229  SER B OG  1 
ATOM   5933 N N   . GLY B 2 230 ? 9.134   7.809   -34.763 1.00 28.79  ? 230  GLY B N   1 
ATOM   5934 C CA  . GLY B 2 230 ? 10.353  7.550   -35.496 1.00 24.61  ? 230  GLY B CA  1 
ATOM   5935 C C   . GLY B 2 230 ? 11.140  8.798   -35.771 1.00 29.31  ? 230  GLY B C   1 
ATOM   5936 O O   . GLY B 2 230 ? 10.572  9.892   -35.897 1.00 28.34  ? 230  GLY B O   1 
ATOM   5937 N N   . THR B 2 231 ? 12.450  8.638   -35.886 1.00 22.78  ? 231  THR B N   1 
ATOM   5938 C CA  . THR B 2 231 ? 13.329  9.774   -36.078 1.00 27.21  ? 231  THR B CA  1 
ATOM   5939 C C   . THR B 2 231 ? 14.547  9.380   -36.854 1.00 29.83  ? 231  THR B C   1 
ATOM   5940 O O   . THR B 2 231 ? 14.917  8.202   -36.873 1.00 27.69  ? 231  THR B O   1 
ATOM   5941 C CB  . THR B 2 231 ? 13.834  10.356  -34.718 1.00 40.71  ? 231  THR B CB  1 
ATOM   5942 O OG1 . THR B 2 231 ? 14.456  9.318   -33.957 1.00 36.19  ? 231  THR B OG1 1 
ATOM   5943 C CG2 . THR B 2 231 ? 12.691  10.981  -33.909 1.00 29.86  ? 231  THR B CG2 1 
ATOM   5944 N N   . PRO B 2 232 ? 15.198  10.370  -37.489 1.00 31.06  ? 232  PRO B N   1 
ATOM   5945 C CA  . PRO B 2 232 ? 16.411  10.034  -38.239 1.00 31.00  ? 232  PRO B CA  1 
ATOM   5946 C C   . PRO B 2 232 ? 17.584  9.883   -37.285 1.00 33.08  ? 232  PRO B C   1 
ATOM   5947 O O   . PRO B 2 232 ? 18.503  9.160   -37.591 1.00 40.92  ? 232  PRO B O   1 
ATOM   5948 C CB  . PRO B 2 232 ? 16.593  11.236  -39.194 1.00 27.15  ? 232  PRO B CB  1 
ATOM   5949 C CG  . PRO B 2 232 ? 15.877  12.384  -38.504 1.00 31.01  ? 232  PRO B CG  1 
ATOM   5950 C CD  . PRO B 2 232 ? 14.743  11.757  -37.724 1.00 31.57  ? 232  PRO B CD  1 
ATOM   5951 N N   . ASN B 2 233 ? 17.540  10.555  -36.147 1.00 35.92  ? 233  ASN B N   1 
ATOM   5952 C CA  . ASN B 2 233 ? 18.569  10.432  -35.127 1.00 35.67  ? 233  ASN B CA  1 
ATOM   5953 C C   . ASN B 2 233 ? 18.249  9.199   -34.322 1.00 40.97  ? 233  ASN B C   1 
ATOM   5954 O O   . ASN B 2 233 ? 17.153  8.638   -34.474 1.00 31.49  ? 233  ASN B O   1 
ATOM   5955 C CB  . ASN B 2 233 ? 18.607  11.665  -34.211 1.00 30.25  ? 233  ASN B CB  1 
ATOM   5956 C CG  . ASN B 2 233 ? 17.221  12.062  -33.694 1.00 31.33  ? 233  ASN B CG  1 
ATOM   5957 O OD1 . ASN B 2 233 ? 16.339  12.408  -34.471 1.00 31.99  ? 233  ASN B OD1 1 
ATOM   5958 N ND2 . ASN B 2 233 ? 17.036  12.027  -32.383 1.00 27.92  ? 233  ASN B ND2 1 
ATOM   5959 N N   . GLY B 2 234 ? 19.190  8.763   -33.475 1.00 38.29  ? 234  GLY B N   1 
ATOM   5960 C CA  . GLY B 2 234 ? 18.927  7.597   -32.646 1.00 34.79  ? 234  GLY B CA  1 
ATOM   5961 C C   . GLY B 2 234 ? 19.639  6.324   -33.084 1.00 39.20  ? 234  GLY B C   1 
ATOM   5962 O O   . GLY B 2 234 ? 20.364  6.304   -34.073 1.00 42.11  ? 234  GLY B O   1 
ATOM   5963 N N   . PRO B 2 235 ? 19.416  5.242   -32.351 1.00 38.82  ? 235  PRO B N   1 
ATOM   5964 C CA  . PRO B 2 235 ? 20.290  4.070   -32.410 1.00 45.71  ? 235  PRO B CA  1 
ATOM   5965 C C   . PRO B 2 235 ? 20.050  3.141   -33.603 1.00 47.30  ? 235  PRO B C   1 
ATOM   5966 O O   . PRO B 2 235 ? 20.947  2.344   -33.904 1.00 44.83  ? 235  PRO B O   1 
ATOM   5967 C CB  . PRO B 2 235 ? 19.961  3.319   -31.111 1.00 49.54  ? 235  PRO B CB  1 
ATOM   5968 C CG  . PRO B 2 235 ? 18.854  4.103   -30.439 1.00 48.05  ? 235  PRO B CG  1 
ATOM   5969 C CD  . PRO B 2 235 ? 18.297  5.062   -31.422 1.00 42.79  ? 235  PRO B CD  1 
ATOM   5970 N N   . TRP B 2 236 ? 18.893  3.214   -34.271 1.00 34.74  ? 236  TRP B N   1 
ATOM   5971 C CA  . TRP B 2 236 ? 18.612  2.187   -35.287 1.00 31.63  ? 236  TRP B CA  1 
ATOM   5972 C C   . TRP B 2 236 ? 18.492  2.702   -36.719 1.00 36.03  ? 236  TRP B C   1 
ATOM   5973 O O   . TRP B 2 236 ? 18.520  1.905   -37.646 1.00 38.81  ? 236  TRP B O   1 
ATOM   5974 C CB  . TRP B 2 236 ? 17.325  1.432   -34.938 1.00 29.59  ? 236  TRP B CB  1 
ATOM   5975 C CG  . TRP B 2 236 ? 16.174  2.388   -34.673 1.00 35.48  ? 236  TRP B CG  1 
ATOM   5976 C CD1 . TRP B 2 236 ? 15.834  2.958   -33.457 1.00 34.86  ? 236  TRP B CD1 1 
ATOM   5977 C CD2 . TRP B 2 236 ? 15.231  2.899   -35.630 1.00 32.90  ? 236  TRP B CD2 1 
ATOM   5978 N NE1 . TRP B 2 236 ? 14.726  3.765   -33.608 1.00 36.51  ? 236  TRP B NE1 1 
ATOM   5979 C CE2 . TRP B 2 236 ? 14.338  3.754   -34.932 1.00 31.93  ? 236  TRP B CE2 1 
ATOM   5980 C CE3 . TRP B 2 236 ? 15.026  2.690   -37.007 1.00 38.14  ? 236  TRP B CE3 1 
ATOM   5981 C CZ2 . TRP B 2 236 ? 13.279  4.423   -35.559 1.00 30.28  ? 236  TRP B CZ2 1 
ATOM   5982 C CZ3 . TRP B 2 236 ? 13.962  3.362   -37.652 1.00 32.73  ? 236  TRP B CZ3 1 
ATOM   5983 C CH2 . TRP B 2 236 ? 13.111  4.226   -36.918 1.00 34.40  ? 236  TRP B CH2 1 
ATOM   5984 N N   . ALA B 2 237 ? 18.305  4.012   -36.909 1.00 35.28  ? 237  ALA B N   1 
ATOM   5985 C CA  . ALA B 2 237 ? 17.848  4.505   -38.217 1.00 36.21  ? 237  ALA B CA  1 
ATOM   5986 C C   . ALA B 2 237 ? 18.965  4.702   -39.221 1.00 36.39  ? 237  ALA B C   1 
ATOM   5987 O O   . ALA B 2 237 ? 18.691  4.771   -40.410 1.00 41.60  ? 237  ALA B O   1 
ATOM   5988 C CB  . ALA B 2 237 ? 16.966  5.814   -38.096 1.00 27.60  ? 237  ALA B CB  1 
ATOM   5989 N N   . THR B 2 238 ? 20.212  4.785   -38.758 1.00 34.01  ? 238  THR B N   1 
ATOM   5990 C CA  . THR B 2 238 ? 21.331  4.855   -39.680 1.00 38.49  ? 238  THR B CA  1 
ATOM   5991 C C   . THR B 2 238 ? 22.476  3.925   -39.264 1.00 40.66  ? 238  THR B C   1 
ATOM   5992 O O   . THR B 2 238 ? 22.545  3.461   -38.135 1.00 43.17  ? 238  THR B O   1 
ATOM   5993 C CB  . THR B 2 238 ? 21.928  6.257   -39.757 1.00 38.06  ? 238  THR B CB  1 
ATOM   5994 O OG1 . THR B 2 238 ? 22.342  6.632   -38.443 1.00 40.00  ? 238  THR B OG1 1 
ATOM   5995 C CG2 . THR B 2 238 ? 20.916  7.265   -40.260 1.00 38.31  ? 238  THR B CG2 1 
ATOM   5996 N N   . VAL B 2 239 ? 23.370  3.650   -40.199 1.00 35.25  ? 239  VAL B N   1 
ATOM   5997 C CA  . VAL B 2 239 ? 24.666  3.095   -39.861 1.00 35.71  ? 239  VAL B CA  1 
ATOM   5998 C C   . VAL B 2 239 ? 25.733  3.931   -40.545 1.00 37.32  ? 239  VAL B C   1 
ATOM   5999 O O   . VAL B 2 239 ? 25.465  4.647   -41.521 1.00 39.66  ? 239  VAL B O   1 
ATOM   6000 C CB  . VAL B 2 239 ? 24.799  1.635   -40.314 1.00 31.54  ? 239  VAL B CB  1 
ATOM   6001 C CG1 . VAL B 2 239 ? 23.809  0.768   -39.532 1.00 35.35  ? 239  VAL B CG1 1 
ATOM   6002 C CG2 . VAL B 2 239 ? 24.571  1.528   -41.814 1.00 31.42  ? 239  VAL B CG2 1 
ATOM   6003 N N   . SER B 2 240 ? 26.944  3.847   -40.023 1.00 37.63  ? 240  SER B N   1 
ATOM   6004 C CA  . SER B 2 240 ? 28.085  4.484   -40.651 1.00 43.96  ? 240  SER B CA  1 
ATOM   6005 C C   . SER B 2 240 ? 28.474  3.697   -41.896 1.00 45.21  ? 240  SER B C   1 
ATOM   6006 O O   . SER B 2 240 ? 28.052  2.538   -42.085 1.00 40.75  ? 240  SER B O   1 
ATOM   6007 C CB  . SER B 2 240 ? 29.269  4.428   -39.698 1.00 44.45  ? 240  SER B CB  1 
ATOM   6008 O OG  . SER B 2 240 ? 29.576  3.070   -39.477 1.00 43.15  ? 240  SER B OG  1 
ATOM   6009 N N   . ALA B 2 241 ? 29.316  4.314   -42.721 1.00 41.03  ? 241  ALA B N   1 
ATOM   6010 C CA  . ALA B 2 241 ? 29.780  3.670   -43.944 1.00 41.76  ? 241  ALA B CA  1 
ATOM   6011 C C   . ALA B 2 241 ? 30.516  2.367   -43.676 1.00 53.88  ? 241  ALA B C   1 
ATOM   6012 O O   . ALA B 2 241 ? 30.309  1.374   -44.395 1.00 58.43  ? 241  ALA B O   1 
ATOM   6013 C CB  . ALA B 2 241 ? 30.627  4.596   -44.728 1.00 40.51  ? 241  ALA B CB  1 
ATOM   6014 N N   . GLY B 2 242 ? 31.363  2.359   -42.643 1.00 52.61  ? 242  GLY B N   1 
ATOM   6015 C CA  . GLY B 2 242 ? 32.123  1.171   -42.295 1.00 43.59  ? 242  GLY B CA  1 
ATOM   6016 C C   . GLY B 2 242 ? 31.217  0.031   -41.882 1.00 47.25  ? 242  GLY B C   1 
ATOM   6017 O O   . GLY B 2 242 ? 31.410  -1.122  -42.288 1.00 48.17  ? 242  GLY B O   1 
ATOM   6018 N N   . GLU B 2 243 ? 30.203  0.326   -41.074 1.00 46.38  ? 243  GLU B N   1 
ATOM   6019 C CA  . GLU B 2 243 ? 29.337  -0.765  -40.661 1.00 45.48  ? 243  GLU B CA  1 
ATOM   6020 C C   . GLU B 2 243 ? 28.496  -1.308  -41.843 1.00 48.61  ? 243  GLU B C   1 
ATOM   6021 O O   . GLU B 2 243 ? 28.256  -2.519  -41.926 1.00 48.42  ? 243  GLU B O   1 
ATOM   6022 C CB  . GLU B 2 243 ? 28.516  -0.385  -39.431 1.00 45.54  ? 243  GLU B CB  1 
ATOM   6023 C CG  . GLU B 2 243 ? 27.460  -1.407  -39.016 1.00 43.88  ? 243  GLU B CG  1 
ATOM   6024 C CD  . GLU B 2 243 ? 28.058  -2.684  -38.461 1.00 51.54  ? 243  GLU B CD  1 
ATOM   6025 O OE1 . GLU B 2 243 ? 27.267  -3.538  -37.980 1.00 46.17  ? 243  GLU B OE1 1 
ATOM   6026 O OE2 . GLU B 2 243 ? 29.308  -2.831  -38.505 1.00 47.83  ? 243  GLU B OE2 1 
ATOM   6027 N N   . ALA B 2 244 ? 28.093  -0.428  -42.769 1.00 47.49  ? 244  ALA B N   1 
ATOM   6028 C CA  . ALA B 2 244 ? 27.341  -0.832  -43.976 1.00 41.77  ? 244  ALA B CA  1 
ATOM   6029 C C   . ALA B 2 244 ? 28.187  -1.756  -44.843 1.00 48.38  ? 244  ALA B C   1 
ATOM   6030 O O   . ALA B 2 244 ? 27.731  -2.820  -45.297 1.00 38.64  ? 244  ALA B O   1 
ATOM   6031 C CB  . ALA B 2 244 ? 26.943  0.379   -44.795 1.00 34.73  ? 244  ALA B CB  1 
ATOM   6032 N N   . ARG B 2 245 ? 29.426  -1.321  -45.079 1.00 45.02  ? 245  ARG B N   1 
ATOM   6033 C CA  . ARG B 2 245 ? 30.350  -2.061  -45.911 1.00 46.17  ? 245  ARG B CA  1 
ATOM   6034 C C   . ARG B 2 245 ? 30.555  -3.443  -45.288 1.00 49.16  ? 245  ARG B C   1 
ATOM   6035 O O   . ARG B 2 245 ? 30.643  -4.461  -45.983 1.00 51.59  ? 245  ARG B O   1 
ATOM   6036 C CB  . ARG B 2 245 ? 31.684  -1.306  -46.010 1.00 49.64  ? 245  ARG B CB  1 
ATOM   6037 C CG  . ARG B 2 245 ? 32.826  -2.119  -46.637 1.00 49.52  ? 245  ARG B CG  1 
ATOM   6038 C CD  . ARG B 2 245 ? 33.935  -1.218  -47.127 1.00 45.85  ? 245  ARG B CD  1 
ATOM   6039 N NE  . ARG B 2 245 ? 33.496  -0.335  -48.200 1.00 51.53  ? 245  ARG B NE  1 
ATOM   6040 C CZ  . ARG B 2 245 ? 33.462  -0.692  -49.482 1.00 60.66  ? 245  ARG B CZ  1 
ATOM   6041 N NH1 . ARG B 2 245 ? 33.056  0.169   -50.408 1.00 61.68  ? 245  ARG B NH1 1 
ATOM   6042 N NH2 . ARG B 2 245 ? 33.835  -1.917  -49.844 1.00 64.15  ? 245  ARG B NH2 1 
ATOM   6043 N N   . ARG B 2 246 ? 30.615  -3.467  -43.965 1.00 45.87  ? 246  ARG B N   1 
ATOM   6044 C CA  . ARG B 2 246 ? 30.869  -4.691  -43.239 1.00 51.34  ? 246  ARG B CA  1 
ATOM   6045 C C   . ARG B 2 246 ? 29.706  -5.634  -43.483 1.00 52.42  ? 246  ARG B C   1 
ATOM   6046 O O   . ARG B 2 246 ? 29.902  -6.807  -43.856 1.00 47.20  ? 246  ARG B O   1 
ATOM   6047 C CB  . ARG B 2 246 ? 31.004  -4.372  -41.754 1.00 51.54  ? 246  ARG B CB  1 
ATOM   6048 C CG  . ARG B 2 246 ? 31.724  -5.400  -40.920 1.00 52.75  ? 246  ARG B CG  1 
ATOM   6049 C CD  . ARG B 2 246 ? 31.122  -5.451  -39.499 1.00 58.85  ? 246  ARG B CD  1 
ATOM   6050 N NE  . ARG B 2 246 ? 30.473  -6.745  -39.302 1.00 64.00  ? 246  ARG B NE  1 
ATOM   6051 C CZ  . ARG B 2 246 ? 29.213  -6.953  -38.927 1.00 57.34  ? 246  ARG B CZ  1 
ATOM   6052 N NH1 . ARG B 2 246 ? 28.393  -5.947  -38.649 1.00 42.48  ? 246  ARG B NH1 1 
ATOM   6053 N NH2 . ARG B 2 246 ? 28.786  -8.210  -38.807 1.00 61.86  ? 246  ARG B NH2 1 
ATOM   6054 N N   . ARG B 2 247 ? 28.494  -5.096  -43.302 1.00 47.58  ? 247  ARG B N   1 
ATOM   6055 C CA  . ARG B 2 247 ? 27.261  -5.864  -43.474 1.00 46.03  ? 247  ARG B CA  1 
ATOM   6056 C C   . ARG B 2 247 ? 27.060  -6.364  -44.902 1.00 43.06  ? 247  ARG B C   1 
ATOM   6057 O O   . ARG B 2 247 ? 26.641  -7.503  -45.114 1.00 46.13  ? 247  ARG B O   1 
ATOM   6058 C CB  . ARG B 2 247 ? 26.047  -5.047  -43.007 1.00 50.20  ? 247  ARG B CB  1 
ATOM   6059 C CG  . ARG B 2 247 ? 26.027  -4.814  -41.492 1.00 45.29  ? 247  ARG B CG  1 
ATOM   6060 C CD  . ARG B 2 247 ? 24.899  -3.914  -41.092 1.00 42.70  ? 247  ARG B CD  1 
ATOM   6061 N NE  . ARG B 2 247 ? 25.022  -3.510  -39.703 1.00 44.43  ? 247  ARG B NE  1 
ATOM   6062 C CZ  . ARG B 2 247 ? 24.015  -3.058  -38.950 1.00 43.76  ? 247  ARG B CZ  1 
ATOM   6063 N NH1 . ARG B 2 247 ? 22.786  -2.979  -39.465 1.00 35.50  ? 247  ARG B NH1 1 
ATOM   6064 N NH2 . ARG B 2 247 ? 24.247  -2.698  -37.670 1.00 35.24  ? 247  ARG B NH2 1 
ATOM   6065 N N   . ALA B 2 248 ? 27.389  -5.532  -45.882 1.00 38.42  ? 248  ALA B N   1 
ATOM   6066 C CA  . ALA B 2 248 ? 27.230  -5.927  -47.279 1.00 39.89  ? 248  ALA B CA  1 
ATOM   6067 C C   . ALA B 2 248 ? 28.212  -7.049  -47.615 1.00 51.20  ? 248  ALA B C   1 
ATOM   6068 O O   . ALA B 2 248 ? 27.833  -8.049  -48.231 1.00 51.60  ? 248  ALA B O   1 
ATOM   6069 C CB  . ALA B 2 248 ? 27.450  -4.737  -48.197 1.00 34.01  ? 248  ALA B CB  1 
ATOM   6070 N N   . THR B 2 249 ? 29.474  -6.860  -47.214 1.00 50.60  ? 249  THR B N   1 
ATOM   6071 C CA  . THR B 2 249 ? 30.540  -7.840  -47.448 1.00 48.46  ? 249  THR B CA  1 
ATOM   6072 C C   . THR B 2 249 ? 30.211  -9.147  -46.763 1.00 48.06  ? 249  THR B C   1 
ATOM   6073 O O   . THR B 2 249 ? 30.382  -10.200 -47.343 1.00 51.60  ? 249  THR B O   1 
ATOM   6074 C CB  . THR B 2 249 ? 31.871  -7.346  -46.902 1.00 53.36  ? 249  THR B CB  1 
ATOM   6075 O OG1 . THR B 2 249 ? 32.134  -6.051  -47.448 1.00 55.16  ? 249  THR B OG1 1 
ATOM   6076 C CG2 . THR B 2 249 ? 33.041  -8.342  -47.244 1.00 40.61  ? 249  THR B CG2 1 
ATOM   6077 N N   . LEU B 2 250 ? 29.720  -9.077  -45.527 1.00 49.16  ? 250  LEU B N   1 
ATOM   6078 C CA  . LEU B 2 250 ? 29.287  -10.286 -44.846 1.00 44.86  ? 250  LEU B CA  1 
ATOM   6079 C C   . LEU B 2 250 ? 28.168  -10.988 -45.617 1.00 53.90  ? 250  LEU B C   1 
ATOM   6080 O O   . LEU B 2 250 ? 28.215  -12.215 -45.866 1.00 52.03  ? 250  LEU B O   1 
ATOM   6081 C CB  . LEU B 2 250 ? 28.859  -9.986  -43.412 1.00 41.98  ? 250  LEU B CB  1 
ATOM   6082 C CG  . LEU B 2 250 ? 28.514  -11.255 -42.622 1.00 47.12  ? 250  LEU B CG  1 
ATOM   6083 C CD1 . LEU B 2 250 ? 29.593  -12.306 -42.811 1.00 48.89  ? 250  LEU B CD1 1 
ATOM   6084 C CD2 . LEU B 2 250 ? 28.334  -10.945 -41.158 1.00 42.73  ? 250  LEU B CD2 1 
ATOM   6085 N N   . LEU B 2 251 ? 27.157  -10.213 -46.006 1.00 50.00  ? 251  LEU B N   1 
ATOM   6086 C CA  . LEU B 2 251 ? 26.044  -10.796 -46.749 1.00 46.11  ? 251  LEU B CA  1 
ATOM   6087 C C   . LEU B 2 251 ? 26.515  -11.447 -48.061 1.00 44.60  ? 251  LEU B C   1 
ATOM   6088 O O   . LEU B 2 251 ? 26.164  -12.585 -48.363 1.00 47.85  ? 251  LEU B O   1 
ATOM   6089 C CB  . LEU B 2 251 ? 24.963  -9.757  -47.018 1.00 45.07  ? 251  LEU B CB  1 
ATOM   6090 C CG  . LEU B 2 251 ? 23.865  -10.442 -47.817 1.00 50.43  ? 251  LEU B CG  1 
ATOM   6091 C CD1 . LEU B 2 251 ? 22.678  -10.737 -46.917 1.00 53.17  ? 251  LEU B CD1 1 
ATOM   6092 C CD2 . LEU B 2 251 ? 23.472  -9.578  -48.996 1.00 51.50  ? 251  LEU B CD2 1 
ATOM   6093 N N   . ALA B 2 252 ? 27.317  -10.730 -48.838 1.00 48.71  ? 252  ALA B N   1 
ATOM   6094 C CA  . ALA B 2 252 ? 27.840  -11.282 -50.078 1.00 50.38  ? 252  ALA B CA  1 
ATOM   6095 C C   . ALA B 2 252 ? 28.554  -12.591 -49.754 1.00 55.46  ? 252  ALA B C   1 
ATOM   6096 O O   . ALA B 2 252 ? 28.303  -13.609 -50.381 1.00 56.92  ? 252  ALA B O   1 
ATOM   6097 C CB  . ALA B 2 252 ? 28.785  -10.309 -50.734 1.00 49.68  ? 252  ALA B CB  1 
ATOM   6098 N N   . ARG B 2 253 ? 29.418  -12.567 -48.751 1.00 52.31  ? 253  ARG B N   1 
ATOM   6099 C CA  . ARG B 2 253 ? 30.080  -13.795 -48.328 1.00 61.96  ? 253  ARG B CA  1 
ATOM   6100 C C   . ARG B 2 253 ? 29.071  -14.907 -48.028 1.00 64.21  ? 253  ARG B C   1 
ATOM   6101 O O   . ARG B 2 253 ? 29.258  -16.041 -48.453 1.00 60.60  ? 253  ARG B O   1 
ATOM   6102 C CB  . ARG B 2 253 ? 30.964  -13.538 -47.119 1.00 59.53  ? 253  ARG B CB  1 
ATOM   6103 C CG  . ARG B 2 253 ? 31.685  -14.748 -46.616 1.00 75.24  ? 253  ARG B CG  1 
ATOM   6104 C CD  . ARG B 2 253 ? 32.751  -14.328 -45.633 1.00 89.19  ? 253  ARG B CD  1 
ATOM   6105 N NE  . ARG B 2 253 ? 33.458  -15.471 -45.077 1.00 105.48 ? 253  ARG B NE  1 
ATOM   6106 C CZ  . ARG B 2 253 ? 33.011  -16.190 -44.053 1.00 110.42 ? 253  ARG B CZ  1 
ATOM   6107 N NH1 . ARG B 2 253 ? 31.847  -15.876 -43.488 1.00 103.17 ? 253  ARG B NH1 1 
ATOM   6108 N NH2 . ARG B 2 253 ? 33.723  -17.224 -43.600 1.00 112.05 ? 253  ARG B NH2 1 
ATOM   6109 N N   . LEU B 2 254 ? 27.987  -14.583 -47.325 1.00 61.40  ? 254  LEU B N   1 
ATOM   6110 C CA  . LEU B 2 254 ? 26.995  -15.604 -46.979 1.00 58.75  ? 254  LEU B CA  1 
ATOM   6111 C C   . LEU B 2 254 ? 26.285  -16.240 -48.179 1.00 61.01  ? 254  LEU B C   1 
ATOM   6112 O O   . LEU B 2 254 ? 25.814  -17.374 -48.087 1.00 61.63  ? 254  LEU B O   1 
ATOM   6113 C CB  . LEU B 2 254 ? 25.949  -15.060 -46.013 1.00 59.74  ? 254  LEU B CB  1 
ATOM   6114 C CG  . LEU B 2 254 ? 26.434  -14.680 -44.619 1.00 61.01  ? 254  LEU B CG  1 
ATOM   6115 C CD1 . LEU B 2 254 ? 25.319  -13.998 -43.832 1.00 57.14  ? 254  LEU B CD1 1 
ATOM   6116 C CD2 . LEU B 2 254 ? 26.941  -15.934 -43.915 1.00 53.79  ? 254  LEU B CD2 1 
ATOM   6117 N N   . VAL B 2 255 ? 26.170  -15.518 -49.291 1.00 54.50  ? 255  VAL B N   1 
ATOM   6118 C CA  . VAL B 2 255 ? 25.486  -16.094 -50.439 1.00 52.61  ? 255  VAL B CA  1 
ATOM   6119 C C   . VAL B 2 255 ? 26.452  -16.491 -51.538 1.00 57.22  ? 255  VAL B C   1 
ATOM   6120 O O   . VAL B 2 255 ? 26.041  -16.711 -52.675 1.00 58.67  ? 255  VAL B O   1 
ATOM   6121 C CB  . VAL B 2 255 ? 24.390  -15.158 -51.012 1.00 48.04  ? 255  VAL B CB  1 
ATOM   6122 C CG1 . VAL B 2 255 ? 23.428  -14.762 -49.915 1.00 44.94  ? 255  VAL B CG1 1 
ATOM   6123 C CG2 . VAL B 2 255 ? 25.004  -13.923 -51.666 1.00 47.55  ? 255  VAL B CG2 1 
ATOM   6124 N N   . GLY B 2 256 ? 27.738  -16.555 -51.200 1.00 59.33  ? 256  GLY B N   1 
ATOM   6125 C CA  . GLY B 2 256 ? 28.748  -17.040 -52.123 1.00 62.03  ? 256  GLY B CA  1 
ATOM   6126 C C   . GLY B 2 256 ? 29.410  -16.021 -53.032 1.00 63.50  ? 256  GLY B C   1 
ATOM   6127 O O   . GLY B 2 256 ? 29.868  -16.368 -54.103 1.00 68.70  ? 256  GLY B O   1 
ATOM   6128 N N   . CYS B 2 257 ? 29.502  -14.772 -52.607 1.00 64.59  ? 257  CYS B N   1 
ATOM   6129 C CA  . CYS B 2 257 ? 30.106  -13.753 -53.457 1.00 67.26  ? 257  CYS B CA  1 
ATOM   6130 C C   . CYS B 2 257 ? 31.382  -13.170 -52.837 1.00 74.79  ? 257  CYS B C   1 
ATOM   6131 O O   . CYS B 2 257 ? 32.481  -13.334 -53.388 1.00 85.76  ? 257  CYS B O   1 
ATOM   6132 C CB  . CYS B 2 257 ? 29.087  -12.645 -53.773 1.00 60.49  ? 257  CYS B CB  1 
ATOM   6133 S SG  . CYS B 2 257 ? 27.659  -13.193 -54.731 1.00 65.49  ? 257  CYS B SG  1 
ATOM   6134 N N   . ASN B 2 265 ? 37.174  -6.412  -54.820 1.00 84.48  ? 265  ASN B N   1 
ATOM   6135 C CA  . ASN B 2 265 ? 36.741  -5.154  -55.431 1.00 84.11  ? 265  ASN B CA  1 
ATOM   6136 C C   . ASN B 2 265 ? 35.220  -5.043  -55.560 1.00 73.36  ? 265  ASN B C   1 
ATOM   6137 O O   . ASN B 2 265 ? 34.540  -6.012  -55.902 1.00 77.16  ? 265  ASN B O   1 
ATOM   6138 C CB  . ASN B 2 265 ? 37.378  -4.977  -56.802 1.00 91.09  ? 265  ASN B CB  1 
ATOM   6139 C CG  . ASN B 2 265 ? 36.856  -5.974  -57.806 1.00 99.59  ? 265  ASN B CG  1 
ATOM   6140 O OD1 . ASN B 2 265 ? 36.019  -5.645  -58.650 1.00 96.23  ? 265  ASN B OD1 1 
ATOM   6141 N ND2 . ASN B 2 265 ? 37.332  -7.218  -57.706 1.00 106.11 ? 265  ASN B ND2 1 
ATOM   6142 N N   . ASP B 2 266 ? 34.695  -3.850  -55.313 1.00 58.98  ? 266  ASP B N   1 
ATOM   6143 C CA  . ASP B 2 266 ? 33.244  -3.649  -55.222 1.00 55.65  ? 266  ASP B CA  1 
ATOM   6144 C C   . ASP B 2 266 ? 32.476  -4.187  -56.429 1.00 59.02  ? 266  ASP B C   1 
ATOM   6145 O O   . ASP B 2 266 ? 31.499  -4.913  -56.270 1.00 57.92  ? 266  ASP B O   1 
ATOM   6146 C CB  . ASP B 2 266 ? 32.918  -2.178  -54.998 1.00 47.54  ? 266  ASP B CB  1 
ATOM   6147 C CG  . ASP B 2 266 ? 33.265  -1.717  -53.595 1.00 55.62  ? 266  ASP B CG  1 
ATOM   6148 O OD1 . ASP B 2 266 ? 33.309  -2.574  -52.684 1.00 59.54  ? 266  ASP B OD1 1 
ATOM   6149 O OD2 . ASP B 2 266 ? 33.498  -0.501  -53.391 1.00 61.93  ? 266  ASP B OD2 1 
ATOM   6150 N N   . THR B 2 267 ? 32.941  -3.845  -57.628 1.00 61.77  ? 267  THR B N   1 
ATOM   6151 C CA  . THR B 2 267 ? 32.268  -4.210  -58.865 1.00 57.85  ? 267  THR B CA  1 
ATOM   6152 C C   . THR B 2 267 ? 32.020  -5.711  -59.003 1.00 63.51  ? 267  THR B C   1 
ATOM   6153 O O   . THR B 2 267 ? 30.907  -6.140  -59.328 1.00 65.08  ? 267  THR B O   1 
ATOM   6154 C CB  . THR B 2 267 ? 33.012  -3.655  -60.077 1.00 59.61  ? 267  THR B CB  1 
ATOM   6155 O OG1 . THR B 2 267 ? 32.815  -2.239  -60.113 1.00 65.97  ? 267  THR B OG1 1 
ATOM   6156 C CG2 . THR B 2 267 ? 32.479  -4.257  -61.369 1.00 53.87  ? 267  THR B CG2 1 
ATOM   6157 N N   . GLU B 2 268 ? 33.029  -6.519  -58.731 1.00 61.03  ? 268  GLU B N   1 
ATOM   6158 C CA  . GLU B 2 268 ? 32.817  -7.958  -58.831 1.00 62.18  ? 268  GLU B CA  1 
ATOM   6159 C C   . GLU B 2 268 ? 31.842  -8.423  -57.756 1.00 53.06  ? 268  GLU B C   1 
ATOM   6160 O O   . GLU B 2 268 ? 30.966  -9.241  -58.010 1.00 53.40  ? 268  GLU B O   1 
ATOM   6161 C CB  . GLU B 2 268 ? 34.139  -8.742  -58.733 1.00 61.17  ? 268  GLU B CB  1 
ATOM   6162 N N   . LEU B 2 269 ? 31.987  -7.907  -56.548 1.00 47.07  ? 269  LEU B N   1 
ATOM   6163 C CA  . LEU B 2 269 ? 31.128  -8.365  -55.475 1.00 44.83  ? 269  LEU B CA  1 
ATOM   6164 C C   . LEU B 2 269 ? 29.652  -7.988  -55.792 1.00 55.76  ? 269  LEU B C   1 
ATOM   6165 O O   . LEU B 2 269 ? 28.736  -8.799  -55.642 1.00 56.56  ? 269  LEU B O   1 
ATOM   6166 C CB  . LEU B 2 269 ? 31.629  -7.818  -54.140 1.00 43.99  ? 269  LEU B CB  1 
ATOM   6167 C CG  . LEU B 2 269 ? 30.748  -8.088  -52.924 1.00 51.25  ? 269  LEU B CG  1 
ATOM   6168 C CD1 . LEU B 2 269 ? 31.515  -7.938  -51.636 1.00 46.05  ? 269  LEU B CD1 1 
ATOM   6169 C CD2 . LEU B 2 269 ? 29.571  -7.135  -52.927 1.00 49.37  ? 269  LEU B CD2 1 
ATOM   6170 N N   . ILE B 2 270 ? 29.430  -6.784  -56.297 1.00 50.50  ? 270  ILE B N   1 
ATOM   6171 C CA  . ILE B 2 270 ? 28.070  -6.340  -56.589 1.00 50.41  ? 270  ILE B CA  1 
ATOM   6172 C C   . ILE B 2 270 ? 27.528  -7.046  -57.819 1.00 55.71  ? 270  ILE B C   1 
ATOM   6173 O O   . ILE B 2 270 ? 26.316  -7.301  -57.921 1.00 47.44  ? 270  ILE B O   1 
ATOM   6174 C CB  . ILE B 2 270 ? 28.020  -4.833  -56.777 1.00 54.92  ? 270  ILE B CB  1 
ATOM   6175 C CG1 . ILE B 2 270 ? 28.426  -4.154  -55.468 1.00 56.64  ? 270  ILE B CG1 1 
ATOM   6176 C CG2 . ILE B 2 270 ? 26.639  -4.389  -57.164 1.00 53.51  ? 270  ILE B CG2 1 
ATOM   6177 C CD1 . ILE B 2 270 ? 28.774  -2.702  -55.622 1.00 61.04  ? 270  ILE B CD1 1 
ATOM   6178 N N   . ALA B 2 271 ? 28.423  -7.413  -58.741 1.00 52.55  ? 271  ALA B N   1 
ATOM   6179 C CA  . ALA B 2 271 ? 27.960  -8.113  -59.927 1.00 51.29  ? 271  ALA B CA  1 
ATOM   6180 C C   . ALA B 2 271 ? 27.451  -9.480  -59.518 1.00 51.06  ? 271  ALA B C   1 
ATOM   6181 O O   . ALA B 2 271 ? 26.392  -9.935  -59.981 1.00 51.79  ? 271  ALA B O   1 
ATOM   6182 C CB  . ALA B 2 271 ? 29.032  -8.221  -60.966 1.00 49.86  ? 271  ALA B CB  1 
ATOM   6183 N N   . CYS B 2 272 ? 28.177  -10.117 -58.612 1.00 46.84  ? 272  CYS B N   1 
ATOM   6184 C CA  . CYS B 2 272 ? 27.771  -11.434 -58.139 1.00 54.06  ? 272  CYS B CA  1 
ATOM   6185 C C   . CYS B 2 272 ? 26.451  -11.368 -57.354 1.00 52.84  ? 272  CYS B C   1 
ATOM   6186 O O   . CYS B 2 272 ? 25.567  -12.209 -57.549 1.00 60.24  ? 272  CYS B O   1 
ATOM   6187 C CB  . CYS B 2 272 ? 28.890  -12.126 -57.335 1.00 51.57  ? 272  CYS B CB  1 
ATOM   6188 S SG  . CYS B 2 272 ? 28.392  -13.707 -56.587 1.00 63.60  ? 272  CYS B SG  1 
ATOM   6189 N N   . LEU B 2 273 ? 26.310  -10.364 -56.494 1.00 51.39  ? 273  LEU B N   1 
ATOM   6190 C CA  . LEU B 2 273 ? 25.049  -10.152 -55.769 1.00 46.35  ? 273  LEU B CA  1 
ATOM   6191 C C   . LEU B 2 273 ? 23.882  -9.933  -56.713 1.00 49.07  ? 273  LEU B C   1 
ATOM   6192 O O   . LEU B 2 273 ? 22.746  -10.289 -56.406 1.00 52.05  ? 273  LEU B O   1 
ATOM   6193 C CB  . LEU B 2 273 ? 25.137  -8.958  -54.803 1.00 42.85  ? 273  LEU B CB  1 
ATOM   6194 C CG  . LEU B 2 273 ? 25.912  -9.170  -53.503 1.00 42.63  ? 273  LEU B CG  1 
ATOM   6195 C CD1 . LEU B 2 273 ? 26.238  -7.838  -52.809 1.00 42.66  ? 273  LEU B CD1 1 
ATOM   6196 C CD2 . LEU B 2 273 ? 25.159  -10.093 -52.575 1.00 46.89  ? 273  LEU B CD2 1 
ATOM   6197 N N   . ARG B 2 274 ? 24.144  -9.340  -57.866 1.00 50.21  ? 274  ARG B N   1 
ATOM   6198 C CA  . ARG B 2 274 ? 23.050  -9.103  -58.795 1.00 43.79  ? 274  ARG B CA  1 
ATOM   6199 C C   . ARG B 2 274 ? 22.567  -10.382 -59.481 1.00 45.03  ? 274  ARG B C   1 
ATOM   6200 O O   . ARG B 2 274 ? 21.453  -10.418 -60.003 1.00 41.50  ? 274  ARG B O   1 
ATOM   6201 C CB  . ARG B 2 274 ? 23.402  -8.013  -59.803 1.00 46.81  ? 274  ARG B CB  1 
ATOM   6202 C CG  . ARG B 2 274 ? 23.474  -6.598  -59.160 1.00 39.00  ? 274  ARG B CG  1 
ATOM   6203 C CD  . ARG B 2 274 ? 23.367  -5.541  -60.239 1.00 40.60  ? 274  ARG B CD  1 
ATOM   6204 N NE  . ARG B 2 274 ? 24.327  -5.867  -61.263 1.00 51.03  ? 274  ARG B NE  1 
ATOM   6205 C CZ  . ARG B 2 274 ? 25.471  -5.217  -61.418 1.00 60.99  ? 274  ARG B CZ  1 
ATOM   6206 N NH1 . ARG B 2 274 ? 25.745  -4.164  -60.639 1.00 56.16  ? 274  ARG B NH1 1 
ATOM   6207 N NH2 . ARG B 2 274 ? 26.323  -5.606  -62.360 1.00 59.69  ? 274  ARG B NH2 1 
ATOM   6208 N N   . THR B 2 275 ? 23.375  -11.446 -59.445 1.00 43.40  ? 275  THR B N   1 
ATOM   6209 C CA  . THR B 2 275 ? 22.931  -12.708 -60.019 1.00 44.40  ? 275  THR B CA  1 
ATOM   6210 C C   . THR B 2 275 ? 22.012  -13.464 -59.061 1.00 50.18  ? 275  THR B C   1 
ATOM   6211 O O   . THR B 2 275 ? 21.373  -14.429 -59.454 1.00 55.56  ? 275  THR B O   1 
ATOM   6212 C CB  . THR B 2 275 ? 24.105  -13.650 -60.395 1.00 47.89  ? 275  THR B CB  1 
ATOM   6213 O OG1 . THR B 2 275 ? 24.766  -14.109 -59.198 1.00 49.47  ? 275  THR B OG1 1 
ATOM   6214 C CG2 . THR B 2 275 ? 25.104  -12.944 -61.312 1.00 36.80  ? 275  THR B CG2 1 
ATOM   6215 N N   . ARG B 2 276 ? 21.940  -13.052 -57.803 1.00 44.60  ? 276  ARG B N   1 
ATOM   6216 C CA  . ARG B 2 276 ? 21.194  -13.858 -56.836 1.00 45.88  ? 276  ARG B CA  1 
ATOM   6217 C C   . ARG B 2 276 ? 19.661  -13.679 -56.852 1.00 49.97  ? 276  ARG B C   1 
ATOM   6218 O O   . ARG B 2 276 ? 19.133  -12.553 -56.828 1.00 47.94  ? 276  ARG B O   1 
ATOM   6219 C CB  . ARG B 2 276 ? 21.744  -13.635 -55.415 1.00 49.57  ? 276  ARG B CB  1 
ATOM   6220 C CG  . ARG B 2 276 ? 23.206  -14.121 -55.221 1.00 56.76  ? 276  ARG B CG  1 
ATOM   6221 C CD  . ARG B 2 276 ? 23.351  -15.614 -55.461 1.00 53.35  ? 276  ARG B CD  1 
ATOM   6222 N NE  . ARG B 2 276 ? 24.678  -16.096 -55.082 1.00 59.73  ? 276  ARG B NE  1 
ATOM   6223 C CZ  . ARG B 2 276 ? 25.612  -16.524 -55.936 1.00 62.33  ? 276  ARG B CZ  1 
ATOM   6224 N NH1 . ARG B 2 276 ? 25.377  -16.544 -57.241 1.00 59.32  ? 276  ARG B NH1 1 
ATOM   6225 N NH2 . ARG B 2 276 ? 26.792  -16.934 -55.483 1.00 59.55  ? 276  ARG B NH2 1 
ATOM   6226 N N   . PRO B 2 277 ? 18.936  -14.803 -56.850 1.00 52.00  ? 277  PRO B N   1 
ATOM   6227 C CA  . PRO B 2 277 ? 17.482  -14.718 -56.686 1.00 46.75  ? 277  PRO B CA  1 
ATOM   6228 C C   . PRO B 2 277 ? 17.121  -13.916 -55.417 1.00 49.15  ? 277  PRO B C   1 
ATOM   6229 O O   . PRO B 2 277 ? 17.821  -13.986 -54.384 1.00 45.75  ? 277  PRO B O   1 
ATOM   6230 C CB  . PRO B 2 277 ? 17.056  -16.192 -56.555 1.00 44.34  ? 277  PRO B CB  1 
ATOM   6231 C CG  . PRO B 2 277 ? 18.154  -16.974 -57.224 1.00 47.47  ? 277  PRO B CG  1 
ATOM   6232 C CD  . PRO B 2 277 ? 19.420  -16.192 -56.994 1.00 45.44  ? 277  PRO B CD  1 
ATOM   6233 N N   . ALA B 2 278 ? 16.035  -13.150 -55.497 1.00 45.36  ? 278  ALA B N   1 
ATOM   6234 C CA  . ALA B 2 278 ? 15.683  -12.243 -54.414 1.00 35.47  ? 278  ALA B CA  1 
ATOM   6235 C C   . ALA B 2 278 ? 15.576  -12.987 -53.090 1.00 42.44  ? 278  ALA B C   1 
ATOM   6236 O O   . ALA B 2 278 ? 16.113  -12.526 -52.091 1.00 46.69  ? 278  ALA B O   1 
ATOM   6237 C CB  . ALA B 2 278 ? 14.386  -11.498 -54.717 1.00 30.45  ? 278  ALA B CB  1 
ATOM   6238 N N   . GLN B 2 279 ? 14.909  -14.145 -53.065 1.00 45.66  ? 279  GLN B N   1 
ATOM   6239 C CA  . GLN B 2 279 ? 14.752  -14.853 -51.792 1.00 47.59  ? 279  GLN B CA  1 
ATOM   6240 C C   . GLN B 2 279 ? 16.094  -15.261 -51.155 1.00 47.38  ? 279  GLN B C   1 
ATOM   6241 O O   . GLN B 2 279 ? 16.171  -15.430 -49.940 1.00 46.88  ? 279  GLN B O   1 
ATOM   6242 C CB  . GLN B 2 279 ? 13.814  -16.060 -51.909 1.00 48.38  ? 279  GLN B CB  1 
ATOM   6243 C CG  . GLN B 2 279 ? 13.378  -16.632 -50.558 1.00 48.65  ? 279  GLN B CG  1 
ATOM   6244 C CD  . GLN B 2 279 ? 12.798  -15.574 -49.594 1.00 50.33  ? 279  GLN B CD  1 
ATOM   6245 O OE1 . GLN B 2 279 ? 12.057  -14.680 -50.000 1.00 44.79  ? 279  GLN B OE1 1 
ATOM   6246 N NE2 . GLN B 2 279 ? 13.132  -15.696 -48.308 1.00 44.21  ? 279  GLN B NE2 1 
ATOM   6247 N N   . ASP B 2 280 ? 17.148  -15.404 -51.958 1.00 48.58  ? 280  ASP B N   1 
ATOM   6248 C CA  . ASP B 2 280 ? 18.465  -15.730 -51.389 1.00 51.66  ? 280  ASP B CA  1 
ATOM   6249 C C   . ASP B 2 280 ? 18.993  -14.588 -50.521 1.00 51.07  ? 280  ASP B C   1 
ATOM   6250 O O   . ASP B 2 280 ? 19.565  -14.819 -49.464 1.00 57.10  ? 280  ASP B O   1 
ATOM   6251 C CB  . ASP B 2 280 ? 19.496  -16.112 -52.468 1.00 55.13  ? 280  ASP B CB  1 
ATOM   6252 C CG  . ASP B 2 280 ? 19.188  -17.458 -53.139 1.00 66.39  ? 280  ASP B CG  1 
ATOM   6253 O OD1 . ASP B 2 280 ? 18.150  -18.081 -52.805 1.00 68.85  ? 280  ASP B OD1 1 
ATOM   6254 O OD2 . ASP B 2 280 ? 19.982  -17.896 -54.012 1.00 68.55  ? 280  ASP B OD2 1 
ATOM   6255 N N   . LEU B 2 281 ? 18.800  -13.352 -50.961 1.00 53.63  ? 281  LEU B N   1 
ATOM   6256 C CA  . LEU B 2 281 ? 19.241  -12.196 -50.185 1.00 46.45  ? 281  LEU B CA  1 
ATOM   6257 C C   . LEU B 2 281 ? 18.417  -12.120 -48.910 1.00 43.02  ? 281  LEU B C   1 
ATOM   6258 O O   . LEU B 2 281 ? 18.946  -12.071 -47.807 1.00 43.03  ? 281  LEU B O   1 
ATOM   6259 C CB  . LEU B 2 281 ? 19.092  -10.915 -51.008 1.00 49.48  ? 281  LEU B CB  1 
ATOM   6260 C CG  . LEU B 2 281 ? 20.265  -10.589 -51.944 1.00 52.13  ? 281  LEU B CG  1 
ATOM   6261 C CD1 . LEU B 2 281 ? 21.125  -11.796 -52.208 1.00 47.46  ? 281  LEU B CD1 1 
ATOM   6262 C CD2 . LEU B 2 281 ? 19.815  -9.926  -53.231 1.00 45.92  ? 281  LEU B CD2 1 
ATOM   6263 N N   . VAL B 2 282 ? 17.103  -12.126 -49.061 1.00 46.25  ? 282  VAL B N   1 
ATOM   6264 C CA  . VAL B 2 282 ? 16.236  -12.111 -47.903 1.00 44.22  ? 282  VAL B CA  1 
ATOM   6265 C C   . VAL B 2 282 ? 16.604  -13.215 -46.874 1.00 54.53  ? 282  VAL B C   1 
ATOM   6266 O O   . VAL B 2 282 ? 16.641  -12.959 -45.658 1.00 51.35  ? 282  VAL B O   1 
ATOM   6267 C CB  . VAL B 2 282 ? 14.775  -12.193 -48.339 1.00 40.94  ? 282  VAL B CB  1 
ATOM   6268 C CG1 . VAL B 2 282 ? 13.869  -12.317 -47.129 1.00 42.69  ? 282  VAL B CG1 1 
ATOM   6269 C CG2 . VAL B 2 282 ? 14.414  -10.945 -49.119 1.00 40.81  ? 282  VAL B CG2 1 
ATOM   6270 N N   . ASP B 2 283 ? 16.890  -14.430 -47.358 1.00 47.50  ? 283  ASP B N   1 
ATOM   6271 C CA  . ASP B 2 283 ? 17.249  -15.529 -46.463 1.00 47.61  ? 283  ASP B CA  1 
ATOM   6272 C C   . ASP B 2 283 ? 18.403  -15.220 -45.507 1.00 45.38  ? 283  ASP B C   1 
ATOM   6273 O O   . ASP B 2 283 ? 18.482  -15.814 -44.438 1.00 46.97  ? 283  ASP B O   1 
ATOM   6274 C CB  . ASP B 2 283 ? 17.623  -16.792 -47.256 1.00 52.77  ? 283  ASP B CB  1 
ATOM   6275 C CG  . ASP B 2 283 ? 16.422  -17.516 -47.808 1.00 56.16  ? 283  ASP B CG  1 
ATOM   6276 O OD1 . ASP B 2 283 ? 15.304  -17.237 -47.330 1.00 54.61  ? 283  ASP B OD1 1 
ATOM   6277 O OD2 . ASP B 2 283 ? 16.602  -18.379 -48.709 1.00 62.22  ? 283  ASP B OD2 1 
ATOM   6278 N N   . HIS B 2 284 ? 19.315  -14.331 -45.888 1.00 46.30  ? 284  HIS B N   1 
ATOM   6279 C CA  . HIS B 2 284 ? 20.510  -14.100 -45.069 1.00 47.15  ? 284  HIS B CA  1 
ATOM   6280 C C   . HIS B 2 284 ? 20.661  -12.681 -44.550 1.00 48.21  ? 284  HIS B C   1 
ATOM   6281 O O   . HIS B 2 284 ? 21.606  -12.379 -43.827 1.00 44.95  ? 284  HIS B O   1 
ATOM   6282 C CB  . HIS B 2 284 ? 21.766  -14.437 -45.860 1.00 55.93  ? 284  HIS B CB  1 
ATOM   6283 C CG  . HIS B 2 284 ? 21.963  -15.898 -46.080 1.00 61.53  ? 284  HIS B CG  1 
ATOM   6284 N ND1 . HIS B 2 284 ? 22.346  -16.755 -45.068 1.00 60.87  ? 284  HIS B ND1 1 
ATOM   6285 C CD2 . HIS B 2 284 ? 21.834  -16.655 -47.194 1.00 61.53  ? 284  HIS B CD2 1 
ATOM   6286 C CE1 . HIS B 2 284 ? 22.446  -17.979 -45.555 1.00 63.15  ? 284  HIS B CE1 1 
ATOM   6287 N NE2 . HIS B 2 284 ? 22.145  -17.948 -46.841 1.00 63.31  ? 284  HIS B NE2 1 
ATOM   6288 N N   . GLU B 2 285 ? 19.738  -11.802 -44.913 1.00 49.83  ? 285  GLU B N   1 
ATOM   6289 C CA  . GLU B 2 285 ? 19.890  -10.409 -44.547 1.00 46.92  ? 285  GLU B CA  1 
ATOM   6290 C C   . GLU B 2 285 ? 19.953  -10.236 -43.017 1.00 49.30  ? 285  GLU B C   1 
ATOM   6291 O O   . GLU B 2 285 ? 20.704  -9.417  -42.496 1.00 46.34  ? 285  GLU B O   1 
ATOM   6292 C CB  . GLU B 2 285 ? 18.772  -9.571  -45.175 1.00 44.37  ? 285  GLU B CB  1 
ATOM   6293 C CG  . GLU B 2 285 ? 17.410  -9.776  -44.564 1.00 44.61  ? 285  GLU B CG  1 
ATOM   6294 C CD  . GLU B 2 285 ? 16.400  -8.754  -45.084 1.00 56.04  ? 285  GLU B CD  1 
ATOM   6295 O OE1 . GLU B 2 285 ? 15.200  -8.872  -44.750 1.00 57.77  ? 285  GLU B OE1 1 
ATOM   6296 O OE2 . GLU B 2 285 ? 16.810  -7.830  -45.825 1.00 55.47  ? 285  GLU B OE2 1 
ATOM   6297 N N   . TRP B 2 286 ? 19.184  -11.036 -42.296 1.00 47.56  ? 286  TRP B N   1 
ATOM   6298 C CA  . TRP B 2 286 ? 19.043  -10.815 -40.872 1.00 51.54  ? 286  TRP B CA  1 
ATOM   6299 C C   . TRP B 2 286 ? 20.232  -11.384 -40.091 1.00 60.14  ? 286  TRP B C   1 
ATOM   6300 O O   . TRP B 2 286 ? 20.391  -11.095 -38.912 1.00 70.15  ? 286  TRP B O   1 
ATOM   6301 C CB  . TRP B 2 286 ? 17.692  -11.358 -40.408 1.00 59.13  ? 286  TRP B CB  1 
ATOM   6302 C CG  . TRP B 2 286 ? 17.197  -10.841 -39.097 1.00 70.81  ? 286  TRP B CG  1 
ATOM   6303 C CD1 . TRP B 2 286 ? 17.760  -9.869  -38.321 1.00 69.60  ? 286  TRP B CD1 1 
ATOM   6304 C CD2 . TRP B 2 286 ? 16.008  -11.262 -38.410 1.00 79.29  ? 286  TRP B CD2 1 
ATOM   6305 N NE1 . TRP B 2 286 ? 17.013  -9.675  -37.182 1.00 68.25  ? 286  TRP B NE1 1 
ATOM   6306 C CE2 . TRP B 2 286 ? 15.931  -10.518 -37.213 1.00 76.69  ? 286  TRP B CE2 1 
ATOM   6307 C CE3 . TRP B 2 286 ? 15.006  -12.198 -38.689 1.00 83.43  ? 286  TRP B CE3 1 
ATOM   6308 C CZ2 . TRP B 2 286 ? 14.891  -10.690 -36.289 1.00 81.46  ? 286  TRP B CZ2 1 
ATOM   6309 C CZ3 . TRP B 2 286 ? 13.974  -12.364 -37.774 1.00 87.25  ? 286  TRP B CZ3 1 
ATOM   6310 C CH2 . TRP B 2 286 ? 13.927  -11.615 -36.587 1.00 84.98  ? 286  TRP B CH2 1 
ATOM   6311 N N   . HIS B 2 287 ? 21.101  -12.134 -40.768 1.00 53.30  ? 287  HIS B N   1 
ATOM   6312 C CA  . HIS B 2 287 ? 22.253  -12.741 -40.129 1.00 51.09  ? 287  HIS B CA  1 
ATOM   6313 C C   . HIS B 2 287 ? 23.476  -11.827 -40.059 1.00 56.76  ? 287  HIS B C   1 
ATOM   6314 O O   . HIS B 2 287 ? 24.565  -12.286 -39.693 1.00 57.79  ? 287  HIS B O   1 
ATOM   6315 C CB  . HIS B 2 287 ? 22.680  -14.023 -40.863 1.00 58.78  ? 287  HIS B CB  1 
ATOM   6316 C CG  . HIS B 2 287 ? 21.626  -15.080 -40.916 1.00 69.48  ? 287  HIS B CG  1 
ATOM   6317 N ND1 . HIS B 2 287 ? 21.579  -16.035 -41.915 1.00 74.68  ? 287  HIS B ND1 1 
ATOM   6318 C CD2 . HIS B 2 287 ? 20.575  -15.335 -40.100 1.00 73.46  ? 287  HIS B CD2 1 
ATOM   6319 C CE1 . HIS B 2 287 ? 20.552  -16.837 -41.704 1.00 77.58  ? 287  HIS B CE1 1 
ATOM   6320 N NE2 . HIS B 2 287 ? 19.923  -16.430 -40.611 1.00 81.77  ? 287  HIS B NE2 1 
ATOM   6321 N N   . VAL B 2 288 ? 23.339  -10.559 -40.430 1.00 52.04  ? 288  VAL B N   1 
ATOM   6322 C CA  . VAL B 2 288 ? 24.521  -9.682  -40.420 1.00 51.15  ? 288  VAL B CA  1 
ATOM   6323 C C   . VAL B 2 288 ? 24.593  -8.672  -39.269 1.00 48.03  ? 288  VAL B C   1 
ATOM   6324 O O   . VAL B 2 288 ? 25.554  -7.914  -39.183 1.00 48.66  ? 288  VAL B O   1 
ATOM   6325 C CB  . VAL B 2 288 ? 24.733  -8.949  -41.770 1.00 48.67  ? 288  VAL B CB  1 
ATOM   6326 C CG1 . VAL B 2 288 ? 24.912  -9.960  -42.896 1.00 51.56  ? 288  VAL B CG1 1 
ATOM   6327 C CG2 . VAL B 2 288 ? 23.582  -8.001  -42.058 1.00 47.22  ? 288  VAL B CG2 1 
ATOM   6328 N N   . LEU B 2 289 ? 23.580  -8.636  -38.407 1.00 44.60  ? 289  LEU B N   1 
ATOM   6329 C CA  . LEU B 2 289 ? 23.673  -7.822  -37.207 1.00 46.63  ? 289  LEU B CA  1 
ATOM   6330 C C   . LEU B 2 289 ? 24.848  -8.287  -36.326 1.00 58.43  ? 289  LEU B C   1 
ATOM   6331 O O   . LEU B 2 289 ? 25.089  -9.493  -36.166 1.00 58.73  ? 289  LEU B O   1 
ATOM   6332 C CB  . LEU B 2 289 ? 22.353  -7.836  -36.433 1.00 45.98  ? 289  LEU B CB  1 
ATOM   6333 C CG  . LEU B 2 289 ? 21.225  -7.090  -37.165 1.00 46.96  ? 289  LEU B CG  1 
ATOM   6334 C CD1 . LEU B 2 289 ? 19.832  -7.405  -36.619 1.00 40.46  ? 289  LEU B CD1 1 
ATOM   6335 C CD2 . LEU B 2 289 ? 21.516  -5.580  -37.201 1.00 43.68  ? 289  LEU B CD2 1 
ATOM   6336 N N   . PRO B 2 290 ? 25.577  -7.320  -35.742 1.00 58.11  ? 290  PRO B N   1 
ATOM   6337 C CA  . PRO B 2 290 ? 26.705  -7.539  -34.829 1.00 54.12  ? 290  PRO B CA  1 
ATOM   6338 C C   . PRO B 2 290 ? 26.310  -8.271  -33.532 1.00 57.51  ? 290  PRO B C   1 
ATOM   6339 O O   . PRO B 2 290 ? 27.097  -9.074  -33.024 1.00 59.46  ? 290  PRO B O   1 
ATOM   6340 C CB  . PRO B 2 290 ? 27.167  -6.124  -34.481 1.00 49.36  ? 290  PRO B CB  1 
ATOM   6341 C CG  . PRO B 2 290 ? 26.400  -5.208  -35.339 1.00 54.73  ? 290  PRO B CG  1 
ATOM   6342 C CD  . PRO B 2 290 ? 25.175  -5.911  -35.797 1.00 53.55  ? 290  PRO B CD  1 
ATOM   6343 N N   . GLN B 2 291 ? 25.120  -8.008  -33.001 1.00 47.03  ? 291  GLN B N   1 
ATOM   6344 C CA  . GLN B 2 291 ? 24.725  -8.627  -31.738 1.00 50.25  ? 291  GLN B CA  1 
ATOM   6345 C C   . GLN B 2 291 ? 23.300  -9.169  -31.788 1.00 51.65  ? 291  GLN B C   1 
ATOM   6346 O O   . GLN B 2 291 ? 22.513  -8.821  -32.680 1.00 50.81  ? 291  GLN B O   1 
ATOM   6347 C CB  . GLN B 2 291 ? 24.864  -7.632  -30.561 1.00 55.54  ? 291  GLN B CB  1 
ATOM   6348 C CG  . GLN B 2 291 ? 26.255  -6.972  -30.396 1.00 61.63  ? 291  GLN B CG  1 
ATOM   6349 C CD  . GLN B 2 291 ? 26.388  -5.637  -31.142 1.00 66.95  ? 291  GLN B CD  1 
ATOM   6350 O OE1 . GLN B 2 291 ? 27.486  -5.073  -31.262 1.00 64.42  ? 291  GLN B OE1 1 
ATOM   6351 N NE2 . GLN B 2 291 ? 25.266  -5.128  -31.640 1.00 68.20  ? 291  GLN B NE2 1 
ATOM   6352 N N   . GLU B 2 292 ? 22.978  -10.051 -30.843 1.00 55.05  ? 292  GLU B N   1 
ATOM   6353 C CA  . GLU B 2 292 ? 21.599  -10.436 -30.632 1.00 55.03  ? 292  GLU B CA  1 
ATOM   6354 C C   . GLU B 2 292 ? 20.910  -9.144  -30.214 1.00 54.52  ? 292  GLU B C   1 
ATOM   6355 O O   . GLU B 2 292 ? 21.374  -8.454  -29.302 1.00 55.94  ? 292  GLU B O   1 
ATOM   6356 C CB  . GLU B 2 292 ? 21.460  -11.482 -29.528 1.00 57.90  ? 292  GLU B CB  1 
ATOM   6357 C CG  . GLU B 2 292 ? 20.117  -12.212 -29.610 1.00 70.65  ? 292  GLU B CG  1 
ATOM   6358 C CD  . GLU B 2 292 ? 19.730  -12.965 -28.335 1.00 85.36  ? 292  GLU B CD  1 
ATOM   6359 O OE1 . GLU B 2 292 ? 20.617  -13.252 -27.490 1.00 85.62  ? 292  GLU B OE1 1 
ATOM   6360 O OE2 . GLU B 2 292 ? 18.521  -13.283 -28.193 1.00 89.46  ? 292  GLU B OE2 1 
ATOM   6361 N N   . SER B 2 293 ? 19.822  -8.794  -30.878 1.00 48.29  ? 293  SER B N   1 
ATOM   6362 C CA  . SER B 2 293 ? 19.186  -7.552  -30.549 1.00 49.78  ? 293  SER B CA  1 
ATOM   6363 C C   . SER B 2 293 ? 17.704  -7.500  -30.908 1.00 48.95  ? 293  SER B C   1 
ATOM   6364 O O   . SER B 2 293 ? 17.157  -8.418  -31.502 1.00 46.25  ? 293  SER B O   1 
ATOM   6365 C CB  . SER B 2 293 ? 19.967  -6.386  -31.169 1.00 53.37  ? 293  SER B CB  1 
ATOM   6366 O OG  . SER B 2 293 ? 20.375  -6.677  -32.484 1.00 50.46  ? 293  SER B OG  1 
ATOM   6367 N N   . ILE B 2 294 ? 17.051  -6.432  -30.479 1.00 47.51  ? 294  ILE B N   1 
ATOM   6368 C CA  . ILE B 2 294 ? 15.736  -6.122  -30.984 1.00 48.52  ? 294  ILE B CA  1 
ATOM   6369 C C   . ILE B 2 294 ? 15.744  -4.651  -31.360 1.00 43.42  ? 294  ILE B C   1 
ATOM   6370 O O   . ILE B 2 294 ? 16.591  -3.899  -30.901 1.00 41.13  ? 294  ILE B O   1 
ATOM   6371 C CB  . ILE B 2 294 ? 14.623  -6.426  -29.964 1.00 52.57  ? 294  ILE B CB  1 
ATOM   6372 C CG1 . ILE B 2 294 ? 14.896  -5.732  -28.630 1.00 46.83  ? 294  ILE B CG1 1 
ATOM   6373 C CG2 . ILE B 2 294 ? 14.476  -7.933  -29.758 1.00 47.26  ? 294  ILE B CG2 1 
ATOM   6374 C CD1 . ILE B 2 294 ? 13.695  -5.786  -27.715 1.00 44.64  ? 294  ILE B CD1 1 
ATOM   6375 N N   . PHE B 2 295 ? 14.834  -4.261  -32.241 1.00 42.76  ? 295  PHE B N   1 
ATOM   6376 C CA  . PHE B 2 295 ? 14.738  -2.881  -32.672 1.00 36.77  ? 295  PHE B CA  1 
ATOM   6377 C C   . PHE B 2 295 ? 16.055  -2.494  -33.314 1.00 38.23  ? 295  PHE B C   1 
ATOM   6378 O O   . PHE B 2 295 ? 16.580  -1.387  -33.107 1.00 40.61  ? 295  PHE B O   1 
ATOM   6379 C CB  . PHE B 2 295 ? 14.388  -1.939  -31.513 1.00 31.44  ? 295  PHE B CB  1 
ATOM   6380 C CG  . PHE B 2 295 ? 13.434  -0.825  -31.912 1.00 36.72  ? 295  PHE B CG  1 
ATOM   6381 C CD1 . PHE B 2 295 ? 13.671  -0.063  -33.042 1.00 32.85  ? 295  PHE B CD1 1 
ATOM   6382 C CD2 . PHE B 2 295 ? 12.279  -0.583  -31.181 1.00 39.02  ? 295  PHE B CD2 1 
ATOM   6383 C CE1 . PHE B 2 295 ? 12.776  0.909   -33.438 1.00 39.61  ? 295  PHE B CE1 1 
ATOM   6384 C CE2 . PHE B 2 295 ? 11.377  0.419   -31.559 1.00 35.76  ? 295  PHE B CE2 1 
ATOM   6385 C CZ  . PHE B 2 295 ? 11.629  1.166   -32.681 1.00 37.38  ? 295  PHE B CZ  1 
ATOM   6386 N N   . ARG B 2 296 ? 16.564  -3.421  -34.108 1.00 36.74  ? 296  ARG B N   1 
ATOM   6387 C CA  . ARG B 2 296 ? 17.800  -3.241  -34.855 1.00 38.95  ? 296  ARG B CA  1 
ATOM   6388 C C   . ARG B 2 296 ? 17.649  -3.895  -36.223 1.00 40.31  ? 296  ARG B C   1 
ATOM   6389 O O   . ARG B 2 296 ? 17.100  -4.996  -36.337 1.00 43.00  ? 296  ARG B O   1 
ATOM   6390 C CB  . ARG B 2 296 ? 18.932  -3.897  -34.116 1.00 44.07  ? 296  ARG B CB  1 
ATOM   6391 C CG  . ARG B 2 296 ? 20.225  -3.240  -34.347 1.00 54.30  ? 296  ARG B CG  1 
ATOM   6392 C CD  . ARG B 2 296 ? 20.631  -2.420  -33.157 1.00 50.49  ? 296  ARG B CD  1 
ATOM   6393 N NE  . ARG B 2 296 ? 19.526  -1.702  -32.595 1.00 48.09  ? 296  ARG B NE  1 
ATOM   6394 C CZ  . ARG B 2 296 ? 19.677  -0.689  -31.747 1.00 50.52  ? 296  ARG B CZ  1 
ATOM   6395 N NH1 . ARG B 2 296 ? 20.895  -0.309  -31.410 1.00 50.69  ? 296  ARG B NH1 1 
ATOM   6396 N NH2 . ARG B 2 296 ? 18.622  -0.051  -31.256 1.00 36.69  ? 296  ARG B NH2 1 
ATOM   6397 N N   . PHE B 2 297 ? 18.137  -3.233  -37.265 1.00 40.10  ? 297  PHE B N   1 
ATOM   6398 C CA  . PHE B 2 297 ? 17.817  -3.657  -38.624 1.00 40.89  ? 297  PHE B CA  1 
ATOM   6399 C C   . PHE B 2 297 ? 19.049  -3.685  -39.504 1.00 46.61  ? 297  PHE B C   1 
ATOM   6400 O O   . PHE B 2 297 ? 19.911  -2.806  -39.394 1.00 37.46  ? 297  PHE B O   1 
ATOM   6401 C CB  . PHE B 2 297 ? 16.740  -2.744  -39.194 1.00 35.33  ? 297  PHE B CB  1 
ATOM   6402 C CG  . PHE B 2 297 ? 15.619  -2.496  -38.229 1.00 38.78  ? 297  PHE B CG  1 
ATOM   6403 C CD1 . PHE B 2 297 ? 14.761  -3.532  -37.857 1.00 36.84  ? 297  PHE B CD1 1 
ATOM   6404 C CD2 . PHE B 2 297 ? 15.438  -1.237  -37.657 1.00 38.66  ? 297  PHE B CD2 1 
ATOM   6405 C CE1 . PHE B 2 297 ? 13.722  -3.293  -36.937 1.00 36.20  ? 297  PHE B CE1 1 
ATOM   6406 C CE2 . PHE B 2 297 ? 14.405  -0.991  -36.744 1.00 32.62  ? 297  PHE B CE2 1 
ATOM   6407 C CZ  . PHE B 2 297 ? 13.549  -2.025  -36.390 1.00 35.60  ? 297  PHE B CZ  1 
ATOM   6408 N N   . SER B 2 298 ? 19.133  -4.700  -40.369 1.00 44.44  ? 298  SER B N   1 
ATOM   6409 C CA  . SER B 2 298 ? 20.387  -4.985  -41.064 1.00 49.97  ? 298  SER B CA  1 
ATOM   6410 C C   . SER B 2 298 ? 20.758  -3.957  -42.111 1.00 44.83  ? 298  SER B C   1 
ATOM   6411 O O   . SER B 2 298 ? 21.905  -3.483  -42.151 1.00 49.15  ? 298  SER B O   1 
ATOM   6412 C CB  . SER B 2 298 ? 20.337  -6.361  -41.714 1.00 51.53  ? 298  SER B CB  1 
ATOM   6413 O OG  . SER B 2 298 ? 20.185  -7.340  -40.720 1.00 53.72  ? 298  SER B OG  1 
ATOM   6414 N N   . PHE B 2 299 ? 19.797  -3.615  -42.961 1.00 33.12  ? 299  PHE B N   1 
ATOM   6415 C CA  . PHE B 2 299 ? 20.070  -2.691  -44.053 1.00 35.67  ? 299  PHE B CA  1 
ATOM   6416 C C   . PHE B 2 299 ? 19.193  -1.449  -43.932 1.00 34.94  ? 299  PHE B C   1 
ATOM   6417 O O   . PHE B 2 299 ? 18.004  -1.497  -44.192 1.00 41.92  ? 299  PHE B O   1 
ATOM   6418 C CB  . PHE B 2 299 ? 19.950  -3.419  -45.407 1.00 29.52  ? 299  PHE B CB  1 
ATOM   6419 C CG  . PHE B 2 299 ? 20.922  -4.565  -45.521 1.00 38.00  ? 299  PHE B CG  1 
ATOM   6420 C CD1 . PHE B 2 299 ? 22.241  -4.334  -45.883 1.00 32.09  ? 299  PHE B CD1 1 
ATOM   6421 C CD2 . PHE B 2 299 ? 20.544  -5.855  -45.141 1.00 39.57  ? 299  PHE B CD2 1 
ATOM   6422 C CE1 . PHE B 2 299 ? 23.155  -5.383  -45.919 1.00 38.65  ? 299  PHE B CE1 1 
ATOM   6423 C CE2 . PHE B 2 299 ? 21.445  -6.892  -45.162 1.00 42.17  ? 299  PHE B CE2 1 
ATOM   6424 C CZ  . PHE B 2 299 ? 22.758  -6.660  -45.558 1.00 37.33  ? 299  PHE B CZ  1 
ATOM   6425 N N   . VAL B 2 300 ? 19.808  -0.347  -43.524 1.00 37.56  ? 300  VAL B N   1 
ATOM   6426 C CA  . VAL B 2 300 ? 19.118  0.906   -43.222 1.00 28.39  ? 300  VAL B CA  1 
ATOM   6427 C C   . VAL B 2 300 ? 19.917  2.034   -43.881 1.00 32.25  ? 300  VAL B C   1 
ATOM   6428 O O   . VAL B 2 300 ? 20.946  1.768   -44.469 1.00 37.01  ? 300  VAL B O   1 
ATOM   6429 C CB  . VAL B 2 300 ? 19.039  1.140   -41.694 1.00 27.49  ? 300  VAL B CB  1 
ATOM   6430 C CG1 . VAL B 2 300 ? 18.357  -0.045  -40.984 1.00 25.45  ? 300  VAL B CG1 1 
ATOM   6431 C CG2 . VAL B 2 300 ? 20.430  1.348   -41.149 1.00 29.85  ? 300  VAL B CG2 1 
ATOM   6432 N N   . PRO B 2 301 ? 19.410  3.284   -43.850 1.00 34.65  ? 301  PRO B N   1 
ATOM   6433 C CA  . PRO B 2 301 ? 20.131  4.413   -44.442 1.00 31.23  ? 301  PRO B CA  1 
ATOM   6434 C C   . PRO B 2 301 ? 21.569  4.505   -43.904 1.00 39.02  ? 301  PRO B C   1 
ATOM   6435 O O   . PRO B 2 301 ? 21.830  4.189   -42.733 1.00 36.42  ? 301  PRO B O   1 
ATOM   6436 C CB  . PRO B 2 301 ? 19.315  5.618   -43.962 1.00 30.49  ? 301  PRO B CB  1 
ATOM   6437 C CG  . PRO B 2 301 ? 17.881  5.090   -44.009 1.00 32.24  ? 301  PRO B CG  1 
ATOM   6438 C CD  . PRO B 2 301 ? 17.997  3.629   -43.548 1.00 31.28  ? 301  PRO B CD  1 
ATOM   6439 N N   . VAL B 2 302 ? 22.494  4.908   -44.768 1.00 35.60  ? 302  VAL B N   1 
ATOM   6440 C CA  . VAL B 2 302 ? 23.901  4.893   -44.415 1.00 36.67  ? 302  VAL B CA  1 
ATOM   6441 C C   . VAL B 2 302 ? 24.433  6.309   -44.491 1.00 34.23  ? 302  VAL B C   1 
ATOM   6442 O O   . VAL B 2 302 ? 24.110  7.044   -45.417 1.00 38.88  ? 302  VAL B O   1 
ATOM   6443 C CB  . VAL B 2 302 ? 24.725  3.968   -45.344 1.00 34.60  ? 302  VAL B CB  1 
ATOM   6444 C CG1 . VAL B 2 302 ? 24.485  4.329   -46.816 1.00 32.68  ? 302  VAL B CG1 1 
ATOM   6445 C CG2 . VAL B 2 302 ? 26.227  4.061   -44.993 1.00 38.01  ? 302  VAL B CG2 1 
ATOM   6446 N N   . VAL B 2 303 ? 25.209  6.713   -43.494 1.00 37.35  ? 303  VAL B N   1 
ATOM   6447 C CA  . VAL B 2 303 ? 25.810  8.042   -43.533 1.00 37.52  ? 303  VAL B CA  1 
ATOM   6448 C C   . VAL B 2 303 ? 26.872  8.019   -44.627 1.00 39.66  ? 303  VAL B C   1 
ATOM   6449 O O   . VAL B 2 303 ? 27.987  7.593   -44.414 1.00 46.07  ? 303  VAL B O   1 
ATOM   6450 C CB  . VAL B 2 303 ? 26.361  8.440   -42.163 1.00 40.53  ? 303  VAL B CB  1 
ATOM   6451 C CG1 . VAL B 2 303 ? 26.933  9.845   -42.196 1.00 42.96  ? 303  VAL B CG1 1 
ATOM   6452 C CG2 . VAL B 2 303 ? 25.243  8.342   -41.137 1.00 34.92  ? 303  VAL B CG2 1 
ATOM   6453 N N   . ASP B 2 304 ? 26.478  8.453   -45.818 1.00 40.87  ? 304  ASP B N   1 
ATOM   6454 C CA  . ASP B 2 304 ? 27.293  8.339   -47.028 1.00 42.79  ? 304  ASP B CA  1 
ATOM   6455 C C   . ASP B 2 304 ? 28.091  9.616   -47.357 1.00 39.15  ? 304  ASP B C   1 
ATOM   6456 O O   . ASP B 2 304 ? 28.928  9.607   -48.223 1.00 46.13  ? 304  ASP B O   1 
ATOM   6457 C CB  . ASP B 2 304 ? 26.379  8.007   -48.217 1.00 36.81  ? 304  ASP B CB  1 
ATOM   6458 C CG  . ASP B 2 304 ? 25.267  9.048   -48.409 1.00 41.67  ? 304  ASP B CG  1 
ATOM   6459 O OD1 . ASP B 2 304 ? 25.076  9.888   -47.501 1.00 37.91  ? 304  ASP B OD1 1 
ATOM   6460 O OD2 . ASP B 2 304 ? 24.570  9.019   -49.452 1.00 43.65  ? 304  ASP B OD2 1 
ATOM   6461 N N   . GLY B 2 305 ? 27.810  10.715  -46.680 1.00 43.23  ? 305  GLY B N   1 
ATOM   6462 C CA  . GLY B 2 305 ? 28.416  11.989  -47.029 1.00 44.69  ? 305  GLY B CA  1 
ATOM   6463 C C   . GLY B 2 305 ? 27.815  12.566  -48.298 1.00 49.12  ? 305  GLY B C   1 
ATOM   6464 O O   . GLY B 2 305 ? 28.364  13.507  -48.876 1.00 50.45  ? 305  GLY B O   1 
ATOM   6465 N N   . ASP B 2 306 ? 26.687  11.997  -48.733 1.00 41.40  ? 306  ASP B N   1 
ATOM   6466 C CA  . ASP B 2 306 ? 25.999  12.431  -49.938 1.00 40.20  ? 306  ASP B CA  1 
ATOM   6467 C C   . ASP B 2 306 ? 24.506  12.690  -49.601 1.00 42.52  ? 306  ASP B C   1 
ATOM   6468 O O   . ASP B 2 306 ? 24.136  13.819  -49.274 1.00 42.26  ? 306  ASP B O   1 
ATOM   6469 C CB  . ASP B 2 306 ? 26.181  11.393  -51.060 1.00 41.81  ? 306  ASP B CB  1 
ATOM   6470 C CG  . ASP B 2 306 ? 25.573  11.837  -52.391 1.00 56.77  ? 306  ASP B CG  1 
ATOM   6471 O OD1 . ASP B 2 306 ? 25.078  12.987  -52.495 1.00 60.36  ? 306  ASP B OD1 1 
ATOM   6472 O OD2 . ASP B 2 306 ? 25.581  11.024  -53.346 1.00 58.28  ? 306  ASP B OD2 1 
ATOM   6473 N N   . PHE B 2 307 ? 23.651  11.668  -49.660 1.00 41.23  ? 307  PHE B N   1 
ATOM   6474 C CA  . PHE B 2 307 ? 22.272  11.851  -49.165 1.00 42.95  ? 307  PHE B CA  1 
ATOM   6475 C C   . PHE B 2 307 ? 22.309  12.487  -47.769 1.00 40.22  ? 307  PHE B C   1 
ATOM   6476 O O   . PHE B 2 307 ? 21.762  13.567  -47.553 1.00 37.73  ? 307  PHE B O   1 
ATOM   6477 C CB  . PHE B 2 307 ? 21.424  10.559  -49.168 1.00 37.82  ? 307  PHE B CB  1 
ATOM   6478 C CG  . PHE B 2 307 ? 19.927  10.829  -49.122 1.00 37.83  ? 307  PHE B CG  1 
ATOM   6479 C CD1 . PHE B 2 307 ? 19.311  11.179  -47.930 1.00 37.77  ? 307  PHE B CD1 1 
ATOM   6480 C CD2 . PHE B 2 307 ? 19.153  10.782  -50.274 1.00 35.58  ? 307  PHE B CD2 1 
ATOM   6481 C CE1 . PHE B 2 307 ? 17.960  11.457  -47.875 1.00 32.46  ? 307  PHE B CE1 1 
ATOM   6482 C CE2 . PHE B 2 307 ? 17.805  11.054  -50.226 1.00 37.06  ? 307  PHE B CE2 1 
ATOM   6483 C CZ  . PHE B 2 307 ? 17.206  11.401  -49.017 1.00 34.36  ? 307  PHE B CZ  1 
ATOM   6484 N N   . LEU B 2 308 ? 22.961  11.802  -46.831 1.00 39.03  ? 308  LEU B N   1 
ATOM   6485 C CA  . LEU B 2 308 ? 23.262  12.365  -45.519 1.00 38.05  ? 308  LEU B CA  1 
ATOM   6486 C C   . LEU B 2 308 ? 24.703  12.851  -45.535 1.00 44.58  ? 308  LEU B C   1 
ATOM   6487 O O   . LEU B 2 308 ? 25.643  12.040  -45.569 1.00 50.24  ? 308  LEU B O   1 
ATOM   6488 C CB  . LEU B 2 308 ? 23.106  11.309  -44.432 1.00 28.74  ? 308  LEU B CB  1 
ATOM   6489 C CG  . LEU B 2 308 ? 21.693  10.720  -44.358 1.00 34.51  ? 308  LEU B CG  1 
ATOM   6490 C CD1 . LEU B 2 308 ? 21.615  9.606   -43.305 1.00 30.71  ? 308  LEU B CD1 1 
ATOM   6491 C CD2 . LEU B 2 308 ? 20.684  11.872  -44.056 1.00 32.31  ? 308  LEU B CD2 1 
ATOM   6492 N N   . SER B 2 309 ? 24.889  14.158  -45.497 1.00 39.52  ? 309  SER B N   1 
ATOM   6493 C CA  . SER B 2 309 ? 26.246  14.712  -45.536 1.00 48.27  ? 309  SER B CA  1 
ATOM   6494 C C   . SER B 2 309 ? 27.017  14.521  -44.218 1.00 51.66  ? 309  SER B C   1 
ATOM   6495 O O   . SER B 2 309 ? 28.232  14.673  -44.177 1.00 55.21  ? 309  SER B O   1 
ATOM   6496 C CB  . SER B 2 309 ? 26.187  16.196  -45.873 1.00 43.21  ? 309  SER B CB  1 
ATOM   6497 O OG  . SER B 2 309 ? 25.792  16.903  -44.724 1.00 48.75  ? 309  SER B OG  1 
ATOM   6498 N N   . ASP B 2 310 ? 26.307  14.190  -43.147 1.00 48.93  ? 310  ASP B N   1 
ATOM   6499 C CA  . ASP B 2 310 ? 26.931  13.895  -41.853 1.00 49.86  ? 310  ASP B CA  1 
ATOM   6500 C C   . ASP B 2 310 ? 25.901  13.073  -41.070 1.00 46.21  ? 310  ASP B C   1 
ATOM   6501 O O   . ASP B 2 310 ? 24.831  12.785  -41.588 1.00 46.92  ? 310  ASP B O   1 
ATOM   6502 C CB  . ASP B 2 310 ? 27.296  15.200  -41.125 1.00 48.10  ? 310  ASP B CB  1 
ATOM   6503 C CG  . ASP B 2 310 ? 28.413  15.030  -40.069 1.00 54.56  ? 310  ASP B CG  1 
ATOM   6504 O OD1 . ASP B 2 310 ? 28.739  13.906  -39.640 1.00 56.75  ? 310  ASP B OD1 1 
ATOM   6505 O OD2 . ASP B 2 310 ? 28.977  16.056  -39.655 1.00 57.23  ? 310  ASP B OD2 1 
ATOM   6506 N N   . THR B 2 311 ? 26.211  12.680  -39.845 1.00 44.81  ? 311  THR B N   1 
ATOM   6507 C CA  . THR B 2 311 ? 25.256  11.940  -39.036 1.00 41.18  ? 311  THR B CA  1 
ATOM   6508 C C   . THR B 2 311 ? 24.017  12.807  -38.807 1.00 47.39  ? 311  THR B C   1 
ATOM   6509 O O   . THR B 2 311 ? 24.108  14.041  -38.781 1.00 47.29  ? 311  THR B O   1 
ATOM   6510 C CB  . THR B 2 311 ? 25.827  11.611  -37.657 1.00 41.04  ? 311  THR B CB  1 
ATOM   6511 O OG1 . THR B 2 311 ? 26.006  12.829  -36.943 1.00 49.18  ? 311  THR B OG1 1 
ATOM   6512 C CG2 . THR B 2 311 ? 27.175  10.904  -37.767 1.00 41.29  ? 311  THR B CG2 1 
ATOM   6513 N N   . PRO B 2 312 ? 22.851  12.168  -38.657 1.00 43.46  ? 312  PRO B N   1 
ATOM   6514 C CA  . PRO B 2 312 ? 21.635  12.901  -38.294 1.00 44.97  ? 312  PRO B CA  1 
ATOM   6515 C C   . PRO B 2 312 ? 21.864  13.740  -37.039 1.00 44.11  ? 312  PRO B C   1 
ATOM   6516 O O   . PRO B 2 312 ? 21.338  14.851  -36.964 1.00 43.49  ? 312  PRO B O   1 
ATOM   6517 C CB  . PRO B 2 312 ? 20.632  11.783  -38.013 1.00 40.26  ? 312  PRO B CB  1 
ATOM   6518 C CG  . PRO B 2 312 ? 21.037  10.710  -38.935 1.00 39.25  ? 312  PRO B CG  1 
ATOM   6519 C CD  . PRO B 2 312 ? 22.559  10.772  -39.020 1.00 37.48  ? 312  PRO B CD  1 
ATOM   6520 N N   . GLU B 2 313 ? 22.624  13.219  -36.080 1.00 42.43  ? 313  GLU B N   1 
ATOM   6521 C CA  A GLU B 2 313 ? 22.936  13.969  -34.875 0.50 47.99  ? 313  GLU B CA  1 
ATOM   6522 C CA  B GLU B 2 313 ? 22.958  13.976  -34.863 0.50 48.20  ? 313  GLU B CA  1 
ATOM   6523 C C   . GLU B 2 313 ? 23.643  15.295  -35.193 1.00 48.06  ? 313  GLU B C   1 
ATOM   6524 O O   . GLU B 2 313 ? 23.242  16.342  -34.713 1.00 48.01  ? 313  GLU B O   1 
ATOM   6525 C CB  A GLU B 2 313 ? 23.770  13.103  -33.938 0.50 49.39  ? 313  GLU B CB  1 
ATOM   6526 C CB  B GLU B 2 313 ? 23.859  13.184  -33.906 0.50 49.43  ? 313  GLU B CB  1 
ATOM   6527 C CG  A GLU B 2 313 ? 22.917  12.147  -33.114 0.50 48.77  ? 313  GLU B CG  1 
ATOM   6528 C CG  B GLU B 2 313 ? 23.229  12.936  -32.537 0.50 53.56  ? 313  GLU B CG  1 
ATOM   6529 C CD  A GLU B 2 313 ? 22.471  10.888  -33.857 0.50 36.32  ? 313  GLU B CD  1 
ATOM   6530 C CD  B GLU B 2 313 ? 24.180  13.223  -31.366 0.50 55.71  ? 313  GLU B CD  1 
ATOM   6531 O OE1 A GLU B 2 313 ? 22.929  10.613  -35.007 0.50 31.64  ? 313  GLU B OE1 1 
ATOM   6532 O OE1 B GLU B 2 313 ? 25.409  12.994  -31.505 0.50 45.99  ? 313  GLU B OE1 1 
ATOM   6533 O OE2 A GLU B 2 313 ? 21.669  10.161  -33.244 0.50 20.67  ? 313  GLU B OE2 1 
ATOM   6534 O OE2 B GLU B 2 313 ? 23.678  13.674  -30.298 0.50 58.72  ? 313  GLU B OE2 1 
ATOM   6535 N N   . ALA B 2 314 ? 24.684  15.237  -36.018 1.00 44.65  ? 314  ALA B N   1 
ATOM   6536 C CA  . ALA B 2 314 ? 25.392  16.448  -36.394 1.00 51.30  ? 314  ALA B CA  1 
ATOM   6537 C C   . ALA B 2 314 ? 24.458  17.379  -37.141 1.00 52.94  ? 314  ALA B C   1 
ATOM   6538 O O   . ALA B 2 314 ? 24.485  18.594  -36.932 1.00 53.81  ? 314  ALA B O   1 
ATOM   6539 C CB  . ALA B 2 314 ? 26.664  16.136  -37.258 1.00 31.31  ? 314  ALA B CB  1 
ATOM   6540 N N   . LEU B 2 315 ? 23.627  16.810  -38.012 1.00 49.07  ? 315  LEU B N   1 
ATOM   6541 C CA  . LEU B 2 315 ? 22.779  17.628  -38.875 1.00 40.56  ? 315  LEU B CA  1 
ATOM   6542 C C   . LEU B 2 315 ? 21.650  18.360  -38.136 1.00 43.64  ? 315  LEU B C   1 
ATOM   6543 O O   . LEU B 2 315 ? 21.350  19.511  -38.475 1.00 44.68  ? 315  LEU B O   1 
ATOM   6544 C CB  . LEU B 2 315 ? 22.259  16.827  -40.076 1.00 42.74  ? 315  LEU B CB  1 
ATOM   6545 C CG  . LEU B 2 315 ? 23.323  16.276  -41.030 1.00 45.11  ? 315  LEU B CG  1 
ATOM   6546 C CD1 . LEU B 2 315 ? 22.682  15.478  -42.171 1.00 40.42  ? 315  LEU B CD1 1 
ATOM   6547 C CD2 . LEU B 2 315 ? 24.193  17.408  -41.577 1.00 41.48  ? 315  LEU B CD2 1 
ATOM   6548 N N   . ILE B 2 316 ? 21.034  17.727  -37.131 1.00 43.83  ? 316  ILE B N   1 
ATOM   6549 C CA  . ILE B 2 316 ? 20.000  18.413  -36.346 1.00 45.48  ? 316  ILE B CA  1 
ATOM   6550 C C   . ILE B 2 316 ? 20.582  19.423  -35.345 1.00 58.68  ? 316  ILE B C   1 
ATOM   6551 O O   . ILE B 2 316 ? 19.893  20.360  -34.963 1.00 63.09  ? 316  ILE B O   1 
ATOM   6552 C CB  . ILE B 2 316 ? 19.032  17.459  -35.591 1.00 42.73  ? 316  ILE B CB  1 
ATOM   6553 C CG1 . ILE B 2 316 ? 19.699  16.853  -34.357 1.00 49.62  ? 316  ILE B CG1 1 
ATOM   6554 C CG2 . ILE B 2 316 ? 18.459  16.372  -36.504 1.00 42.32  ? 316  ILE B CG2 1 
ATOM   6555 C CD1 . ILE B 2 316 ? 18.852  15.790  -33.654 1.00 50.16  ? 316  ILE B CD1 1 
ATOM   6556 N N   . ASN B 2 317 ? 21.836  19.232  -34.916 1.00 63.34  ? 317  ASN B N   1 
ATOM   6557 C CA  . ASN B 2 317 ? 22.488  20.178  -34.003 1.00 55.45  ? 317  ASN B CA  1 
ATOM   6558 C C   . ASN B 2 317 ? 22.858  21.453  -34.730 1.00 56.59  ? 317  ASN B C   1 
ATOM   6559 O O   . ASN B 2 317 ? 22.938  22.506  -34.126 1.00 62.30  ? 317  ASN B O   1 
ATOM   6560 C CB  . ASN B 2 317 ? 23.767  19.605  -33.379 1.00 58.18  ? 317  ASN B CB  1 
ATOM   6561 C CG  . ASN B 2 317 ? 23.502  18.453  -32.419 1.00 65.61  ? 317  ASN B CG  1 
ATOM   6562 O OD1 . ASN B 2 317 ? 22.362  18.197  -32.035 1.00 74.30  ? 317  ASN B OD1 1 
ATOM   6563 N ND2 . ASN B 2 317 ? 24.565  17.749  -32.026 1.00 62.28  ? 317  ASN B ND2 1 
ATOM   6564 N N   . THR B 2 318 ? 23.090  21.369  -36.031 1.00 57.16  ? 318  THR B N   1 
ATOM   6565 C CA  . THR B 2 318 ? 23.635  22.519  -36.735 1.00 63.97  ? 318  THR B CA  1 
ATOM   6566 C C   . THR B 2 318 ? 22.738  23.098  -37.812 1.00 62.84  ? 318  THR B C   1 
ATOM   6567 O O   . THR B 2 318 ? 23.040  24.150  -38.369 1.00 69.15  ? 318  THR B O   1 
ATOM   6568 C CB  . THR B 2 318 ? 24.995  22.186  -37.363 1.00 69.86  ? 318  THR B CB  1 
ATOM   6569 O OG1 . THR B 2 318 ? 24.834  21.119  -38.312 1.00 69.97  ? 318  THR B OG1 1 
ATOM   6570 C CG2 . THR B 2 318 ? 25.966  21.768  -36.273 1.00 72.54  ? 318  THR B CG2 1 
ATOM   6571 N N   . GLY B 2 319 ? 21.642  22.424  -38.114 1.00 57.99  ? 319  GLY B N   1 
ATOM   6572 C CA  . GLY B 2 319 ? 20.773  22.878  -39.184 1.00 56.91  ? 319  GLY B CA  1 
ATOM   6573 C C   . GLY B 2 319 ? 20.043  24.174  -38.879 1.00 59.61  ? 319  GLY B C   1 
ATOM   6574 O O   . GLY B 2 319 ? 19.984  24.619  -37.731 1.00 56.98  ? 319  GLY B O   1 
ATOM   6575 N N   . ASP B 2 320 ? 19.494  24.778  -39.928 1.00 63.14  ? 320  ASP B N   1 
ATOM   6576 C CA  . ASP B 2 320 ? 18.628  25.946  -39.814 1.00 70.40  ? 320  ASP B CA  1 
ATOM   6577 C C   . ASP B 2 320 ? 17.205  25.526  -40.202 1.00 65.31  ? 320  ASP B C   1 
ATOM   6578 O O   . ASP B 2 320 ? 16.945  25.172  -41.360 1.00 63.07  ? 320  ASP B O   1 
ATOM   6579 C CB  . ASP B 2 320 ? 19.118  27.055  -40.749 1.00 77.17  ? 320  ASP B CB  1 
ATOM   6580 C CG  . ASP B 2 320 ? 18.349  28.356  -40.575 1.00 80.59  ? 320  ASP B CG  1 
ATOM   6581 O OD1 . ASP B 2 320 ? 17.202  28.324  -40.083 1.00 75.50  ? 320  ASP B OD1 1 
ATOM   6582 O OD2 . ASP B 2 320 ? 18.904  29.418  -40.930 1.00 87.19  ? 320  ASP B OD2 1 
ATOM   6583 N N   . PHE B 2 321 ? 16.286  25.550  -39.240 1.00 57.53  ? 321  PHE B N   1 
ATOM   6584 C CA  . PHE B 2 321 ? 14.955  25.024  -39.512 1.00 54.92  ? 321  PHE B CA  1 
ATOM   6585 C C   . PHE B 2 321 ? 13.851  26.066  -39.409 1.00 57.42  ? 321  PHE B C   1 
ATOM   6586 O O   . PHE B 2 321 ? 12.695  25.727  -39.148 1.00 59.87  ? 321  PHE B O   1 
ATOM   6587 C CB  . PHE B 2 321 ? 14.682  23.816  -38.619 1.00 50.58  ? 321  PHE B CB  1 
ATOM   6588 C CG  . PHE B 2 321 ? 15.680  22.707  -38.790 1.00 42.56  ? 321  PHE B CG  1 
ATOM   6589 C CD1 . PHE B 2 321 ? 15.706  21.948  -39.950 1.00 43.40  ? 321  PHE B CD1 1 
ATOM   6590 C CD2 . PHE B 2 321 ? 16.591  22.422  -37.802 1.00 44.28  ? 321  PHE B CD2 1 
ATOM   6591 C CE1 . PHE B 2 321 ? 16.625  20.921  -40.113 1.00 42.26  ? 321  PHE B CE1 1 
ATOM   6592 C CE2 . PHE B 2 321 ? 17.515  21.394  -37.971 1.00 44.83  ? 321  PHE B CE2 1 
ATOM   6593 C CZ  . PHE B 2 321 ? 17.523  20.648  -39.132 1.00 39.96  ? 321  PHE B CZ  1 
ATOM   6594 N N   . GLN B 2 322 ? 14.217  27.325  -39.660 1.00 57.88  ? 322  GLN B N   1 
ATOM   6595 C CA  . GLN B 2 322 ? 13.317  28.462  -39.525 1.00 63.05  ? 322  GLN B CA  1 
ATOM   6596 C C   . GLN B 2 322 ? 11.965  28.281  -40.228 1.00 66.66  ? 322  GLN B C   1 
ATOM   6597 O O   . GLN B 2 322 ? 10.907  28.515  -39.618 1.00 75.04  ? 322  GLN B O   1 
ATOM   6598 C CB  . GLN B 2 322 ? 13.993  29.751  -40.007 1.00 73.67  ? 322  GLN B CB  1 
ATOM   6599 C CG  . GLN B 2 322 ? 15.121  30.280  -39.108 1.00 86.24  ? 322  GLN B CG  1 
ATOM   6600 C CD  . GLN B 2 322 ? 14.612  30.975  -37.855 1.00 99.86  ? 322  GLN B CD  1 
ATOM   6601 O OE1 . GLN B 2 322 ? 13.403  31.035  -37.615 1.00 107.65 ? 322  GLN B OE1 1 
ATOM   6602 N NE2 . GLN B 2 322 ? 15.534  31.503  -37.046 1.00 100.12 ? 322  GLN B NE2 1 
ATOM   6603 N N   . ASP B 2 323 ? 11.970  27.860  -41.488 1.00 53.86  ? 323  ASP B N   1 
ATOM   6604 C CA  . ASP B 2 323 ? 10.699  27.798  -42.217 1.00 55.82  ? 323  ASP B CA  1 
ATOM   6605 C C   . ASP B 2 323 ? 10.022  26.429  -42.161 1.00 57.50  ? 323  ASP B C   1 
ATOM   6606 O O   . ASP B 2 323 ? 9.212   26.102  -43.028 1.00 61.83  ? 323  ASP B O   1 
ATOM   6607 C CB  . ASP B 2 323 ? 10.860  28.231  -43.681 1.00 62.58  ? 323  ASP B CB  1 
ATOM   6608 N N   . LEU B 2 324 ? 10.340  25.645  -41.136 1.00 48.93  ? 324  LEU B N   1 
ATOM   6609 C CA  . LEU B 2 324 ? 9.832   24.289  -41.030 1.00 44.12  ? 324  LEU B CA  1 
ATOM   6610 C C   . LEU B 2 324 ? 8.757   24.171  -39.936 1.00 37.77  ? 324  LEU B C   1 
ATOM   6611 O O   . LEU B 2 324 ? 8.912   24.694  -38.826 1.00 42.41  ? 324  LEU B O   1 
ATOM   6612 C CB  . LEU B 2 324 ? 10.996  23.342  -40.722 1.00 40.93  ? 324  LEU B CB  1 
ATOM   6613 C CG  . LEU B 2 324 ? 10.616  21.881  -40.861 1.00 42.70  ? 324  LEU B CG  1 
ATOM   6614 C CD1 . LEU B 2 324 ? 9.989   21.679  -42.234 1.00 45.70  ? 324  LEU B CD1 1 
ATOM   6615 C CD2 . LEU B 2 324 ? 11.812  20.971  -40.641 1.00 47.39  ? 324  LEU B CD2 1 
ATOM   6616 N N   . GLN B 2 325 ? 7.665   23.502  -40.256 1.00 33.45  ? 325  GLN B N   1 
ATOM   6617 C CA  . GLN B 2 325 ? 6.726   23.074  -39.225 1.00 35.36  ? 325  GLN B CA  1 
ATOM   6618 C C   . GLN B 2 325 ? 6.721   21.561  -39.162 1.00 35.32  ? 325  GLN B C   1 
ATOM   6619 O O   . GLN B 2 325 ? 6.702   20.923  -40.200 1.00 32.07  ? 325  GLN B O   1 
ATOM   6620 C CB  . GLN B 2 325 ? 5.316   23.568  -39.510 1.00 36.36  ? 325  GLN B CB  1 
ATOM   6621 C CG  . GLN B 2 325 ? 5.221   25.076  -39.676 1.00 38.99  ? 325  GLN B CG  1 
ATOM   6622 C CD  . GLN B 2 325 ? 5.111   25.465  -41.123 1.00 43.42  ? 325  GLN B CD  1 
ATOM   6623 O OE1 . GLN B 2 325 ? 4.540   24.743  -41.946 1.00 50.79  ? 325  GLN B OE1 1 
ATOM   6624 N NE2 . GLN B 2 325 ? 5.667   26.587  -41.453 1.00 47.87  ? 325  GLN B NE2 1 
ATOM   6625 N N   . VAL B 2 326 ? 6.688   21.014  -37.944 1.00 34.98  ? 326  VAL B N   1 
ATOM   6626 C CA  . VAL B 2 326 ? 6.813   19.579  -37.709 1.00 36.02  ? 326  VAL B CA  1 
ATOM   6627 C C   . VAL B 2 326 ? 5.870   19.159  -36.615 1.00 31.52  ? 326  VAL B C   1 
ATOM   6628 O O   . VAL B 2 326 ? 5.742   19.846  -35.615 1.00 36.96  ? 326  VAL B O   1 
ATOM   6629 C CB  . VAL B 2 326 ? 8.250   19.198  -37.248 1.00 41.25  ? 326  VAL B CB  1 
ATOM   6630 C CG1 . VAL B 2 326 ? 8.382   17.712  -37.192 1.00 42.95  ? 326  VAL B CG1 1 
ATOM   6631 C CG2 . VAL B 2 326 ? 9.266   19.730  -38.209 1.00 40.61  ? 326  VAL B CG2 1 
ATOM   6632 N N   . LEU B 2 327 ? 5.174   18.055  -36.841 1.00 29.96  ? 327  LEU B N   1 
ATOM   6633 C CA  . LEU B 2 327 ? 4.351   17.417  -35.831 1.00 29.66  ? 327  LEU B CA  1 
ATOM   6634 C C   . LEU B 2 327 ? 5.063   16.096  -35.514 1.00 29.78  ? 327  LEU B C   1 
ATOM   6635 O O   . LEU B 2 327 ? 5.447   15.389  -36.430 1.00 32.50  ? 327  LEU B O   1 
ATOM   6636 C CB  . LEU B 2 327 ? 2.938   17.176  -36.387 1.00 32.24  ? 327  LEU B CB  1 
ATOM   6637 C CG  . LEU B 2 327 ? 2.047   16.266  -35.528 1.00 33.86  ? 327  LEU B CG  1 
ATOM   6638 C CD1 . LEU B 2 327 ? 1.775   16.929  -34.205 1.00 35.93  ? 327  LEU B CD1 1 
ATOM   6639 C CD2 . LEU B 2 327 ? 0.710   15.984  -36.240 1.00 41.43  ? 327  LEU B CD2 1 
ATOM   6640 N N   . VAL B 2 328 ? 5.332   15.810  -34.244 1.00 30.25  ? 328  VAL B N   1 
ATOM   6641 C CA  . VAL B 2 328 ? 6.012   14.581  -33.862 1.00 31.06  ? 328  VAL B CA  1 
ATOM   6642 C C   . VAL B 2 328 ? 5.312   14.023  -32.627 1.00 34.84  ? 328  VAL B C   1 
ATOM   6643 O O   . VAL B 2 328 ? 4.730   14.776  -31.820 1.00 33.46  ? 328  VAL B O   1 
ATOM   6644 C CB  . VAL B 2 328 ? 7.481   14.788  -33.469 1.00 36.65  ? 328  VAL B CB  1 
ATOM   6645 C CG1 . VAL B 2 328 ? 8.280   15.300  -34.614 1.00 41.76  ? 328  VAL B CG1 1 
ATOM   6646 C CG2 . VAL B 2 328 ? 7.557   15.782  -32.323 1.00 38.82  ? 328  VAL B CG2 1 
ATOM   6647 N N   . GLY B 2 329 ? 5.365   12.703  -32.484 1.00 29.83  ? 329  GLY B N   1 
ATOM   6648 C CA  . GLY B 2 329 ? 4.811   12.080  -31.305 1.00 32.95  ? 329  GLY B CA  1 
ATOM   6649 C C   . GLY B 2 329 ? 5.128   10.610  -31.212 1.00 32.47  ? 329  GLY B C   1 
ATOM   6650 O O   . GLY B 2 329 ? 5.751   10.056  -32.106 1.00 32.30  ? 329  GLY B O   1 
ATOM   6651 N N   . VAL B 2 330 ? 4.664   9.995   -30.128 1.00 31.94  ? 330  VAL B N   1 
ATOM   6652 C CA  . VAL B 2 330 ? 4.942   8.607   -29.801 1.00 32.83  ? 330  VAL B CA  1 
ATOM   6653 C C   . VAL B 2 330 ? 3.642   8.007   -29.301 1.00 32.84  ? 330  VAL B C   1 
ATOM   6654 O O   . VAL B 2 330 ? 2.705   8.750   -29.025 1.00 37.21  ? 330  VAL B O   1 
ATOM   6655 C CB  . VAL B 2 330 ? 6.021   8.532   -28.693 1.00 33.03  ? 330  VAL B CB  1 
ATOM   6656 C CG1 . VAL B 2 330 ? 7.269   9.282   -29.145 1.00 33.07  ? 330  VAL B CG1 1 
ATOM   6657 C CG2 . VAL B 2 330 ? 5.522   9.152   -27.381 1.00 27.28  ? 330  VAL B CG2 1 
ATOM   6658 N N   . VAL B 2 331 ? 3.557   6.679   -29.211 1.00 32.30  ? 331  VAL B N   1 
ATOM   6659 C CA  . VAL B 2 331 ? 2.431   6.051   -28.522 1.00 37.60  ? 331  VAL B CA  1 
ATOM   6660 C C   . VAL B 2 331 ? 2.842   5.731   -27.084 1.00 42.58  ? 331  VAL B C   1 
ATOM   6661 O O   . VAL B 2 331 ? 4.022   5.820   -26.746 1.00 37.06  ? 331  VAL B O   1 
ATOM   6662 C CB  . VAL B 2 331 ? 1.940   4.765   -29.222 1.00 37.78  ? 331  VAL B CB  1 
ATOM   6663 C CG1 . VAL B 2 331 ? 1.437   5.085   -30.634 1.00 31.16  ? 331  VAL B CG1 1 
ATOM   6664 C CG2 . VAL B 2 331 ? 3.053   3.649   -29.224 1.00 20.64  ? 331  VAL B CG2 1 
ATOM   6665 N N   . LYS B 2 332 ? 1.875   5.343   -26.251 1.00 36.94  ? 332  LYS B N   1 
ATOM   6666 C CA  . LYS B 2 332 ? 2.162   5.155   -24.840 1.00 40.62  ? 332  LYS B CA  1 
ATOM   6667 C C   . LYS B 2 332 ? 3.100   3.973   -24.550 1.00 36.23  ? 332  LYS B C   1 
ATOM   6668 O O   . LYS B 2 332 ? 3.883   4.025   -23.613 1.00 35.58  ? 332  LYS B O   1 
ATOM   6669 C CB  . LYS B 2 332 ? 0.870   5.041   -24.044 1.00 39.20  ? 332  LYS B CB  1 
ATOM   6670 C CG  . LYS B 2 332 ? 1.033   4.883   -22.551 1.00 35.55  ? 332  LYS B CG  1 
ATOM   6671 C CD  . LYS B 2 332 ? -0.374  4.746   -21.901 1.00 67.25  ? 332  LYS B CD  1 
ATOM   6672 C CE  . LYS B 2 332 ? -0.448  3.617   -20.854 1.00 73.45  ? 332  LYS B CE  1 
ATOM   6673 N NZ  . LYS B 2 332 ? -0.689  2.220   -21.439 1.00 70.52  ? 332  LYS B NZ  1 
ATOM   6674 N N   . ASP B 2 333 ? 3.047   2.931   -25.360 1.00 32.42  ? 333  ASP B N   1 
ATOM   6675 C CA  . ASP B 2 333 ? 3.845   1.738   -25.071 1.00 36.06  ? 333  ASP B CA  1 
ATOM   6676 C C   . ASP B 2 333 ? 4.712   1.344   -26.267 1.00 36.68  ? 333  ASP B C   1 
ATOM   6677 O O   . ASP B 2 333 ? 4.545   0.275   -26.837 1.00 38.75  ? 333  ASP B O   1 
ATOM   6678 C CB  . ASP B 2 333 ? 2.917   0.596   -24.621 1.00 36.84  ? 333  ASP B CB  1 
ATOM   6679 C CG  . ASP B 2 333 ? 2.121   0.971   -23.375 1.00 39.08  ? 333  ASP B CG  1 
ATOM   6680 O OD1 . ASP B 2 333 ? 0.952   1.377   -23.501 1.00 43.16  ? 333  ASP B OD1 1 
ATOM   6681 O OD2 . ASP B 2 333 ? 2.675   0.924   -22.260 1.00 44.23  ? 333  ASP B OD2 1 
ATOM   6682 N N   . GLU B 2 334 ? 5.647   2.223   -26.644 1.00 38.74  ? 334  GLU B N   1 
ATOM   6683 C CA  . GLU B 2 334 ? 6.446   2.008   -27.859 1.00 37.41  ? 334  GLU B CA  1 
ATOM   6684 C C   . GLU B 2 334 ? 7.168   0.674   -27.890 1.00 32.19  ? 334  GLU B C   1 
ATOM   6685 O O   . GLU B 2 334 ? 7.333   0.099   -28.958 1.00 35.85  ? 334  GLU B O   1 
ATOM   6686 C CB  . GLU B 2 334 ? 7.498   3.103   -28.064 1.00 35.55  ? 334  GLU B CB  1 
ATOM   6687 C CG  . GLU B 2 334 ? 6.946   4.453   -28.486 1.00 33.84  ? 334  GLU B CG  1 
ATOM   6688 C CD  . GLU B 2 334 ? 6.468   4.489   -29.916 1.00 39.83  ? 334  GLU B CD  1 
ATOM   6689 O OE1 . GLU B 2 334 ? 6.915   3.642   -30.729 1.00 38.94  ? 334  GLU B OE1 1 
ATOM   6690 O OE2 . GLU B 2 334 ? 5.648   5.387   -30.233 1.00 40.00  ? 334  GLU B OE2 1 
ATOM   6691 N N   . GLY B 2 335 ? 7.595   0.180   -26.734 1.00 26.98  ? 335  GLY B N   1 
ATOM   6692 C CA  . GLY B 2 335 ? 8.519   -0.939  -26.727 1.00 29.42  ? 335  GLY B CA  1 
ATOM   6693 C C   . GLY B 2 335 ? 7.884   -2.323  -26.700 1.00 36.12  ? 335  GLY B C   1 
ATOM   6694 O O   . GLY B 2 335 ? 8.526   -3.302  -27.056 1.00 43.08  ? 335  GLY B O   1 
ATOM   6695 N N   . SER B 2 336 ? 6.626   -2.411  -26.282 1.00 35.11  ? 336  SER B N   1 
ATOM   6696 C CA  . SER B 2 336 ? 6.042   -3.695  -25.906 1.00 39.03  ? 336  SER B CA  1 
ATOM   6697 C C   . SER B 2 336 ? 6.012   -4.696  -27.079 1.00 46.33  ? 336  SER B C   1 
ATOM   6698 O O   . SER B 2 336 ? 6.332   -5.872  -26.919 1.00 54.27  ? 336  SER B O   1 
ATOM   6699 C CB  . SER B 2 336 ? 4.635   -3.462  -25.358 1.00 38.02  ? 336  SER B CB  1 
ATOM   6700 O OG  . SER B 2 336 ? 3.780   -3.037  -26.410 1.00 35.66  ? 336  SER B OG  1 
ATOM   6701 N N   . TYR B 2 337 ? 5.646   -4.204  -28.255 1.00 41.83  ? 337  TYR B N   1 
ATOM   6702 C CA  . TYR B 2 337 ? 5.599   -4.977  -29.489 1.00 41.41  ? 337  TYR B CA  1 
ATOM   6703 C C   . TYR B 2 337 ? 6.892   -5.734  -29.804 1.00 46.14  ? 337  TYR B C   1 
ATOM   6704 O O   . TYR B 2 337 ? 6.839   -6.848  -30.315 1.00 47.05  ? 337  TYR B O   1 
ATOM   6705 C CB  . TYR B 2 337 ? 5.238   -4.022  -30.639 1.00 49.59  ? 337  TYR B CB  1 
ATOM   6706 C CG  . TYR B 2 337 ? 4.947   -4.639  -31.973 1.00 53.23  ? 337  TYR B CG  1 
ATOM   6707 C CD1 . TYR B 2 337 ? 3.662   -4.975  -32.322 1.00 65.40  ? 337  TYR B CD1 1 
ATOM   6708 C CD2 . TYR B 2 337 ? 5.947   -4.842  -32.905 1.00 58.75  ? 337  TYR B CD2 1 
ATOM   6709 C CE1 . TYR B 2 337 ? 3.374   -5.534  -33.555 1.00 71.69  ? 337  TYR B CE1 1 
ATOM   6710 C CE2 . TYR B 2 337 ? 5.674   -5.400  -34.139 1.00 63.40  ? 337  TYR B CE2 1 
ATOM   6711 C CZ  . TYR B 2 337 ? 4.384   -5.746  -34.463 1.00 71.20  ? 337  TYR B CZ  1 
ATOM   6712 O OH  . TYR B 2 337 ? 4.075   -6.309  -35.694 1.00 76.52  ? 337  TYR B OH  1 
ATOM   6713 N N   . PHE B 2 338 ? 8.043   -5.137  -29.499 1.00 41.44  ? 338  PHE B N   1 
ATOM   6714 C CA  . PHE B 2 338 ? 9.325   -5.685  -29.913 1.00 41.90  ? 338  PHE B CA  1 
ATOM   6715 C C   . PHE B 2 338 ? 9.834   -6.759  -28.952 1.00 49.58  ? 338  PHE B C   1 
ATOM   6716 O O   . PHE B 2 338 ? 10.730  -7.537  -29.298 1.00 53.68  ? 338  PHE B O   1 
ATOM   6717 C CB  . PHE B 2 338 ? 10.375  -4.562  -30.036 1.00 43.50  ? 338  PHE B CB  1 
ATOM   6718 C CG  . PHE B 2 338 ? 10.024  -3.523  -31.059 1.00 47.50  ? 338  PHE B CG  1 
ATOM   6719 C CD1 . PHE B 2 338 ? 9.213   -2.443  -30.716 1.00 41.51  ? 338  PHE B CD1 1 
ATOM   6720 C CD2 . PHE B 2 338 ? 10.465  -3.645  -32.378 1.00 43.04  ? 338  PHE B CD2 1 
ATOM   6721 C CE1 . PHE B 2 338 ? 8.870   -1.486  -31.658 1.00 42.61  ? 338  PHE B CE1 1 
ATOM   6722 C CE2 . PHE B 2 338 ? 10.111  -2.697  -33.333 1.00 40.09  ? 338  PHE B CE2 1 
ATOM   6723 C CZ  . PHE B 2 338 ? 9.310   -1.612  -32.964 1.00 43.31  ? 338  PHE B CZ  1 
ATOM   6724 N N   . LEU B 2 339 ? 9.283   -6.784  -27.741 1.00 49.23  ? 339  LEU B N   1 
ATOM   6725 C CA  . LEU B 2 339 ? 9.735   -7.733  -26.727 1.00 53.37  ? 339  LEU B CA  1 
ATOM   6726 C C   . LEU B 2 339 ? 9.447   -9.184  -27.153 1.00 55.87  ? 339  LEU B C   1 
ATOM   6727 O O   . LEU B 2 339 ? 10.283  -10.081 -26.948 1.00 55.89  ? 339  LEU B O   1 
ATOM   6728 C CB  . LEU B 2 339 ? 9.098   -7.424  -25.360 1.00 46.79  ? 339  LEU B CB  1 
ATOM   6729 C CG  . LEU B 2 339 ? 9.405   -6.032  -24.805 1.00 39.54  ? 339  LEU B CG  1 
ATOM   6730 C CD1 . LEU B 2 339 ? 8.930   -5.844  -23.351 1.00 34.35  ? 339  LEU B CD1 1 
ATOM   6731 C CD2 . LEU B 2 339 ? 10.896  -5.778  -24.903 1.00 42.03  ? 339  LEU B CD2 1 
ATOM   6732 N N   . VAL B 2 340 ? 8.274   -9.399  -27.751 1.00 54.13  ? 340  VAL B N   1 
ATOM   6733 C CA  . VAL B 2 340 ? 7.846   -10.732 -28.170 1.00 59.44  ? 340  VAL B CA  1 
ATOM   6734 C C   . VAL B 2 340 ? 8.642   -11.320 -29.352 1.00 64.08  ? 340  VAL B C   1 
ATOM   6735 O O   . VAL B 2 340 ? 8.399   -12.446 -29.752 1.00 69.48  ? 340  VAL B O   1 
ATOM   6736 C CB  . VAL B 2 340 ? 6.347   -10.750 -28.552 1.00 58.88  ? 340  VAL B CB  1 
ATOM   6737 C CG1 . VAL B 2 340 ? 5.488   -10.106 -27.465 1.00 53.46  ? 340  VAL B CG1 1 
ATOM   6738 C CG2 . VAL B 2 340 ? 6.135   -10.044 -29.876 1.00 57.64  ? 340  VAL B CG2 1 
ATOM   6739 N N   . TYR B 2 341 ? 9.586   -10.567 -29.905 1.00 69.06  ? 341  TYR B N   1 
ATOM   6740 C CA  . TYR B 2 341 ? 10.292  -10.994 -31.116 1.00 74.86  ? 341  TYR B CA  1 
ATOM   6741 C C   . TYR B 2 341 ? 11.762  -11.281 -30.860 1.00 80.80  ? 341  TYR B C   1 
ATOM   6742 O O   . TYR B 2 341 ? 12.581  -11.170 -31.781 1.00 85.21  ? 341  TYR B O   1 
ATOM   6743 C CB  . TYR B 2 341 ? 10.263  -9.889  -32.173 1.00 72.49  ? 341  TYR B CB  1 
ATOM   6744 C CG  . TYR B 2 341 ? 9.042   -9.838  -33.055 1.00 70.59  ? 341  TYR B CG  1 
ATOM   6745 C CD1 . TYR B 2 341 ? 7.977   -8.990  -32.753 1.00 63.63  ? 341  TYR B CD1 1 
ATOM   6746 C CD2 . TYR B 2 341 ? 8.968   -10.609 -34.216 1.00 67.63  ? 341  TYR B CD2 1 
ATOM   6747 C CE1 . TYR B 2 341 ? 6.866   -8.924  -33.566 1.00 64.60  ? 341  TYR B CE1 1 
ATOM   6748 C CE2 . TYR B 2 341 ? 7.862   -10.542 -35.041 1.00 67.14  ? 341  TYR B CE2 1 
ATOM   6749 C CZ  . TYR B 2 341 ? 6.814   -9.700  -34.709 1.00 65.75  ? 341  TYR B CZ  1 
ATOM   6750 O OH  . TYR B 2 341 ? 5.713   -9.637  -35.519 1.00 69.27  ? 341  TYR B OH  1 
ATOM   6751 N N   . GLY B 2 342 ? 12.127  -11.603 -29.627 1.00 76.55  ? 342  GLY B N   1 
ATOM   6752 C CA  . GLY B 2 342 ? 13.534  -11.807 -29.351 1.00 79.78  ? 342  GLY B CA  1 
ATOM   6753 C C   . GLY B 2 342 ? 13.973  -11.736 -27.900 1.00 80.01  ? 342  GLY B C   1 
ATOM   6754 O O   . GLY B 2 342 ? 15.130  -12.058 -27.589 1.00 83.38  ? 342  GLY B O   1 
ATOM   6755 N N   . VAL B 2 343 ? 13.071  -11.322 -27.009 1.00 69.15  ? 343  VAL B N   1 
ATOM   6756 C CA  . VAL B 2 343 ? 13.389  -11.313 -25.586 1.00 56.96  ? 343  VAL B CA  1 
ATOM   6757 C C   . VAL B 2 343 ? 12.763  -12.481 -24.817 1.00 56.01  ? 343  VAL B C   1 
ATOM   6758 O O   . VAL B 2 343 ? 11.540  -12.641 -24.775 1.00 59.74  ? 343  VAL B O   1 
ATOM   6759 C CB  . VAL B 2 343 ? 13.035  -9.983  -24.925 1.00 50.20  ? 343  VAL B CB  1 
ATOM   6760 C CG1 . VAL B 2 343 ? 13.451  -10.027 -23.480 1.00 45.77  ? 343  VAL B CG1 1 
ATOM   6761 C CG2 . VAL B 2 343 ? 13.734  -8.828  -25.658 1.00 46.53  ? 343  VAL B CG2 1 
ATOM   6762 N N   . PRO B 2 344 ? 13.608  -13.319 -24.216 1.00 54.05  ? 344  PRO B N   1 
ATOM   6763 C CA  . PRO B 2 344 ? 13.068  -14.485 -23.512 1.00 59.77  ? 344  PRO B CA  1 
ATOM   6764 C C   . PRO B 2 344 ? 12.164  -14.107 -22.335 1.00 61.76  ? 344  PRO B C   1 
ATOM   6765 O O   . PRO B 2 344 ? 12.466  -13.153 -21.602 1.00 58.77  ? 344  PRO B O   1 
ATOM   6766 C CB  . PRO B 2 344 ? 14.329  -15.219 -23.036 1.00 60.06  ? 344  PRO B CB  1 
ATOM   6767 C CG  . PRO B 2 344 ? 15.357  -14.852 -24.057 1.00 59.77  ? 344  PRO B CG  1 
ATOM   6768 C CD  . PRO B 2 344 ? 15.068  -13.394 -24.373 1.00 54.40  ? 344  PRO B CD  1 
ATOM   6769 N N   . GLY B 2 345 ? 11.068  -14.850 -22.178 1.00 55.94  ? 345  GLY B N   1 
ATOM   6770 C CA  . GLY B 2 345 ? 10.118  -14.613 -21.112 1.00 55.11  ? 345  GLY B CA  1 
ATOM   6771 C C   . GLY B 2 345 ? 8.908   -13.858 -21.619 1.00 54.24  ? 345  GLY B C   1 
ATOM   6772 O O   . GLY B 2 345 ? 7.900   -13.754 -20.925 1.00 63.52  ? 345  GLY B O   1 
ATOM   6773 N N   . PHE B 2 346 ? 9.004   -13.339 -22.836 1.00 46.43  ? 346  PHE B N   1 
ATOM   6774 C CA  . PHE B 2 346 ? 7.951   -12.502 -23.407 1.00 47.26  ? 346  PHE B CA  1 
ATOM   6775 C C   . PHE B 2 346 ? 7.109   -13.208 -24.472 1.00 56.10  ? 346  PHE B C   1 
ATOM   6776 O O   . PHE B 2 346 ? 7.630   -13.916 -25.347 1.00 58.62  ? 346  PHE B O   1 
ATOM   6777 C CB  . PHE B 2 346 ? 8.544   -11.205 -23.958 1.00 41.33  ? 346  PHE B CB  1 
ATOM   6778 C CG  . PHE B 2 346 ? 8.990   -10.254 -22.867 1.00 45.83  ? 346  PHE B CG  1 
ATOM   6779 C CD1 . PHE B 2 346 ? 10.267  -10.347 -22.323 1.00 43.71  ? 346  PHE B CD1 1 
ATOM   6780 C CD2 . PHE B 2 346 ? 8.115   -9.312  -22.355 1.00 39.52  ? 346  PHE B CD2 1 
ATOM   6781 C CE1 . PHE B 2 346 ? 10.669  -9.500  -21.313 1.00 43.20  ? 346  PHE B CE1 1 
ATOM   6782 C CE2 . PHE B 2 346 ? 8.503   -8.472  -21.344 1.00 40.41  ? 346  PHE B CE2 1 
ATOM   6783 C CZ  . PHE B 2 346 ? 9.788   -8.567  -20.819 1.00 44.79  ? 346  PHE B CZ  1 
ATOM   6784 N N   . SER B 2 347 ? 5.798   -13.019 -24.389 1.00 53.96  ? 347  SER B N   1 
ATOM   6785 C CA  . SER B 2 347 ? 4.891   -13.710 -25.288 1.00 54.86  ? 347  SER B CA  1 
ATOM   6786 C C   . SER B 2 347 ? 3.564   -12.996 -25.343 1.00 54.65  ? 347  SER B C   1 
ATOM   6787 O O   . SER B 2 347 ? 3.060   -12.523 -24.328 1.00 58.42  ? 347  SER B O   1 
ATOM   6788 C CB  . SER B 2 347 ? 4.671   -15.154 -24.821 1.00 58.86  ? 347  SER B CB  1 
ATOM   6789 O OG  . SER B 2 347 ? 3.510   -15.712 -25.428 1.00 58.54  ? 347  SER B OG  1 
ATOM   6790 N N   . LYS B 2 348 ? 2.999   -12.921 -26.539 1.00 52.45  ? 348  LYS B N   1 
ATOM   6791 C CA  . LYS B 2 348 ? 1.663   -12.400 -26.708 1.00 52.06  ? 348  LYS B CA  1 
ATOM   6792 C C   . LYS B 2 348 ? 0.612   -13.293 -26.027 1.00 57.18  ? 348  LYS B C   1 
ATOM   6793 O O   . LYS B 2 348 ? -0.502  -12.842 -25.751 1.00 57.82  ? 348  LYS B O   1 
ATOM   6794 C CB  . LYS B 2 348 ? 1.352   -12.257 -28.198 1.00 51.50  ? 348  LYS B CB  1 
ATOM   6795 C CG  . LYS B 2 348 ? 0.735   -13.483 -28.843 1.00 52.39  ? 348  LYS B CG  1 
ATOM   6796 C CD  . LYS B 2 348 ? 0.272   -13.180 -30.272 1.00 53.44  ? 348  LYS B CD  1 
ATOM   6797 C CE  . LYS B 2 348 ? -0.449  -14.376 -30.884 1.00 56.85  ? 348  LYS B CE  1 
ATOM   6798 N NZ  . LYS B 2 348 ? -1.712  -14.664 -30.137 1.00 61.61  ? 348  LYS B NZ  1 
ATOM   6799 N N   . ASP B 2 349 ? 0.976   -14.548 -25.744 1.00 57.61  ? 349  ASP B N   1 
ATOM   6800 C CA  . ASP B 2 349 ? 0.012   -15.558 -25.297 1.00 59.22  ? 349  ASP B CA  1 
ATOM   6801 C C   . ASP B 2 349 ? -0.059  -15.779 -23.788 1.00 61.19  ? 349  ASP B C   1 
ATOM   6802 O O   . ASP B 2 349 ? -0.843  -16.611 -23.324 1.00 59.87  ? 349  ASP B O   1 
ATOM   6803 C CB  . ASP B 2 349 ? 0.265   -16.893 -26.013 1.00 57.75  ? 349  ASP B CB  1 
ATOM   6804 C CG  . ASP B 2 349 ? -0.072  -16.826 -27.487 1.00 59.28  ? 349  ASP B CG  1 
ATOM   6805 O OD1 . ASP B 2 349 ? -1.077  -16.162 -27.832 1.00 58.50  ? 349  ASP B OD1 1 
ATOM   6806 O OD2 . ASP B 2 349 ? 0.667   -17.426 -28.300 1.00 64.06  ? 349  ASP B OD2 1 
ATOM   6807 N N   . ASN B 2 350 ? 0.786   -15.075 -23.038 1.00 58.83  ? 350  ASN B N   1 
ATOM   6808 C CA  . ASN B 2 350 ? 0.685   -15.022 -21.577 1.00 61.41  ? 350  ASN B CA  1 
ATOM   6809 C C   . ASN B 2 350 ? 1.037   -13.618 -21.064 1.00 63.87  ? 350  ASN B C   1 
ATOM   6810 O O   . ASN B 2 350 ? 1.400   -12.732 -21.841 1.00 58.75  ? 350  ASN B O   1 
ATOM   6811 C CB  . ASN B 2 350 ? 1.508   -16.133 -20.878 1.00 62.95  ? 350  ASN B CB  1 
ATOM   6812 C CG  . ASN B 2 350 ? 3.025   -16.069 -21.176 1.00 74.21  ? 350  ASN B CG  1 
ATOM   6813 O OD1 . ASN B 2 350 ? 3.630   -14.989 -21.203 1.00 66.98  ? 350  ASN B OD1 1 
ATOM   6814 N ND2 . ASN B 2 350 ? 3.645   -17.259 -21.344 1.00 79.86  ? 350  ASN B ND2 1 
ATOM   6815 N N   . GLU B 2 351 ? 0.921   -13.406 -19.764 1.00 65.75  ? 351  GLU B N   1 
ATOM   6816 C CA  . GLU B 2 351 ? 1.150   -12.075 -19.213 1.00 66.64  ? 351  GLU B CA  1 
ATOM   6817 C C   . GLU B 2 351 ? 2.623   -11.641 -19.128 1.00 55.94  ? 351  GLU B C   1 
ATOM   6818 O O   . GLU B 2 351 ? 2.929   -10.537 -18.698 1.00 55.25  ? 351  GLU B O   1 
ATOM   6819 C CB  . GLU B 2 351 ? 0.421   -11.914 -17.886 1.00 70.25  ? 351  GLU B CB  1 
ATOM   6820 C CG  . GLU B 2 351 ? -1.059  -11.718 -18.090 1.00 82.52  ? 351  GLU B CG  1 
ATOM   6821 C CD  . GLU B 2 351 ? -1.756  -11.209 -16.849 1.00 104.13 ? 351  GLU B CD  1 
ATOM   6822 O OE1 . GLU B 2 351 ? -2.862  -10.638 -16.994 1.00 112.57 ? 351  GLU B OE1 1 
ATOM   6823 O OE2 . GLU B 2 351 ? -1.201  -11.372 -15.731 1.00 109.73 ? 351  GLU B OE2 1 
ATOM   6824 N N   . SER B 2 352 ? 3.518   -12.505 -19.575 1.00 51.33  ? 352  SER B N   1 
ATOM   6825 C CA  . SER B 2 352 ? 4.920   -12.162 -19.702 1.00 51.03  ? 352  SER B CA  1 
ATOM   6826 C C   . SER B 2 352 ? 5.489   -11.585 -18.402 1.00 56.55  ? 352  SER B C   1 
ATOM   6827 O O   . SER B 2 352 ? 6.125   -10.518 -18.398 1.00 54.80  ? 352  SER B O   1 
ATOM   6828 C CB  . SER B 2 352 ? 5.130   -11.182 -20.858 1.00 48.56  ? 352  SER B CB  1 
ATOM   6829 O OG  . SER B 2 352 ? 4.797   -11.770 -22.103 1.00 48.83  ? 352  SER B OG  1 
ATOM   6830 N N   . LEU B 2 353 ? 5.262   -12.299 -17.303 1.00 54.75  ? 353  LEU B N   1 
ATOM   6831 C CA  . LEU B 2 353 ? 5.789   -11.901 -16.012 1.00 57.87  ? 353  LEU B CA  1 
ATOM   6832 C C   . LEU B 2 353 ? 7.214   -12.429 -15.866 1.00 62.67  ? 353  LEU B C   1 
ATOM   6833 O O   . LEU B 2 353 ? 7.420   -13.619 -15.690 1.00 67.85  ? 353  LEU B O   1 
ATOM   6834 C CB  . LEU B 2 353 ? 4.881   -12.406 -14.890 1.00 57.38  ? 353  LEU B CB  1 
ATOM   6835 C CG  . LEU B 2 353 ? 3.461   -11.828 -14.932 1.00 58.40  ? 353  LEU B CG  1 
ATOM   6836 C CD1 . LEU B 2 353 ? 2.707   -12.163 -13.667 1.00 56.25  ? 353  LEU B CD1 1 
ATOM   6837 C CD2 . LEU B 2 353 ? 3.531   -10.318 -15.080 1.00 57.35  ? 353  LEU B CD2 1 
ATOM   6838 N N   . ILE B 2 354 ? 8.202   -11.544 -15.927 1.00 59.43  ? 354  ILE B N   1 
ATOM   6839 C CA  . ILE B 2 354 ? 9.588   -12.000 -16.021 1.00 59.44  ? 354  ILE B CA  1 
ATOM   6840 C C   . ILE B 2 354 ? 10.368  -11.934 -14.690 1.00 57.16  ? 354  ILE B C   1 
ATOM   6841 O O   . ILE B 2 354 ? 9.947   -11.279 -13.742 1.00 50.87  ? 354  ILE B O   1 
ATOM   6842 C CB  . ILE B 2 354 ? 10.339  -11.248 -17.144 1.00 53.91  ? 354  ILE B CB  1 
ATOM   6843 C CG1 . ILE B 2 354 ? 10.282  -9.739  -16.906 1.00 46.72  ? 354  ILE B CG1 1 
ATOM   6844 C CG2 . ILE B 2 354 ? 9.724   -11.583 -18.485 1.00 53.72  ? 354  ILE B CG2 1 
ATOM   6845 C CD1 . ILE B 2 354 ? 11.355  -8.956  -17.636 1.00 46.85  ? 354  ILE B CD1 1 
ATOM   6846 N N   . SER B 2 355 ? 11.487  -12.649 -14.614 1.00 54.56  ? 355  SER B N   1 
ATOM   6847 C CA  . SER B 2 355 ? 12.338  -12.559 -13.436 1.00 57.32  ? 355  SER B CA  1 
ATOM   6848 C C   . SER B 2 355 ? 13.322  -11.403 -13.573 1.00 59.65  ? 355  SER B C   1 
ATOM   6849 O O   . SER B 2 355 ? 13.488  -10.834 -14.661 1.00 56.91  ? 355  SER B O   1 
ATOM   6850 C CB  . SER B 2 355 ? 13.144  -13.827 -13.271 1.00 56.47  ? 355  SER B CB  1 
ATOM   6851 O OG  . SER B 2 355 ? 13.932  -14.044 -14.432 1.00 63.96  ? 355  SER B OG  1 
ATOM   6852 N N   . ARG B 2 356 ? 13.991  -11.090 -12.467 1.00 55.23  ? 356  ARG B N   1 
ATOM   6853 C CA  . ARG B 2 356 ? 15.081  -10.127 -12.459 1.00 56.44  ? 356  ARG B CA  1 
ATOM   6854 C C   . ARG B 2 356 ? 16.136  -10.519 -13.500 1.00 60.24  ? 356  ARG B C   1 
ATOM   6855 O O   . ARG B 2 356 ? 16.608  -9.676  -14.278 1.00 59.63  ? 356  ARG B O   1 
ATOM   6856 C CB  . ARG B 2 356 ? 15.709  -10.050 -11.066 1.00 49.41  ? 356  ARG B CB  1 
ATOM   6857 C CG  . ARG B 2 356 ? 16.724  -8.943  -10.922 1.00 55.76  ? 356  ARG B CG  1 
ATOM   6858 C CD  . ARG B 2 356 ? 16.338  -7.878  -9.894  1.00 59.44  ? 356  ARG B CD  1 
ATOM   6859 N NE  . ARG B 2 356 ? 17.349  -6.822  -9.869  1.00 61.14  ? 356  ARG B NE  1 
ATOM   6860 C CZ  . ARG B 2 356 ? 17.197  -5.624  -10.435 1.00 59.86  ? 356  ARG B CZ  1 
ATOM   6861 N NH1 . ARG B 2 356 ? 16.062  -5.314  -11.036 1.00 52.97  ? 356  ARG B NH1 1 
ATOM   6862 N NH2 . ARG B 2 356 ? 18.176  -4.726  -10.386 1.00 64.14  ? 356  ARG B NH2 1 
ATOM   6863 N N   . ALA B 2 357 ? 16.467  -11.811 -13.534 1.00 54.42  ? 357  ALA B N   1 
ATOM   6864 C CA  . ALA B 2 357 ? 17.530  -12.321 -14.396 1.00 47.27  ? 357  ALA B CA  1 
ATOM   6865 C C   . ALA B 2 357 ? 17.186  -12.114 -15.833 1.00 46.44  ? 357  ALA B C   1 
ATOM   6866 O O   . ALA B 2 357 ? 18.052  -11.770 -16.624 1.00 50.66  ? 357  ALA B O   1 
ATOM   6867 C CB  . ALA B 2 357 ? 17.789  -13.820 -14.132 1.00 50.19  ? 357  ALA B CB  1 
ATOM   6868 N N   . GLN B 2 358 ? 15.917  -12.354 -16.167 1.00 47.31  ? 358  GLN B N   1 
ATOM   6869 C CA  . GLN B 2 358 ? 15.402  -12.177 -17.521 1.00 43.89  ? 358  GLN B CA  1 
ATOM   6870 C C   . GLN B 2 358 ? 15.360  -10.688 -17.887 1.00 47.02  ? 358  GLN B C   1 
ATOM   6871 O O   . GLN B 2 358 ? 15.411  -10.321 -19.071 1.00 45.29  ? 358  GLN B O   1 
ATOM   6872 C CB  . GLN B 2 358 ? 14.001  -12.776 -17.620 1.00 45.61  ? 358  GLN B CB  1 
ATOM   6873 C CG  . GLN B 2 358 ? 13.957  -14.290 -17.437 1.00 56.36  ? 358  GLN B CG  1 
ATOM   6874 C CD  . GLN B 2 358 ? 12.578  -14.869 -17.716 1.00 60.99  ? 358  GLN B CD  1 
ATOM   6875 O OE1 . GLN B 2 358 ? 11.593  -14.474 -17.087 1.00 69.60  ? 358  GLN B OE1 1 
ATOM   6876 N NE2 . GLN B 2 358 ? 12.500  -15.808 -18.659 1.00 59.26  ? 358  GLN B NE2 1 
ATOM   6877 N N   . PHE B 2 359 ? 15.260  -9.838  -16.867 1.00 45.05  ? 359  PHE B N   1 
ATOM   6878 C CA  . PHE B 2 359 ? 15.261  -8.392  -17.097 1.00 49.53  ? 359  PHE B CA  1 
ATOM   6879 C C   . PHE B 2 359 ? 16.666  -7.921  -17.477 1.00 49.81  ? 359  PHE B C   1 
ATOM   6880 O O   . PHE B 2 359 ? 16.816  -7.183  -18.451 1.00 46.18  ? 359  PHE B O   1 
ATOM   6881 C CB  . PHE B 2 359 ? 14.685  -7.615  -15.901 1.00 45.91  ? 359  PHE B CB  1 
ATOM   6882 C CG  . PHE B 2 359 ? 14.840  -6.115  -16.013 1.00 49.63  ? 359  PHE B CG  1 
ATOM   6883 C CD1 . PHE B 2 359 ? 15.527  -5.404  -15.047 1.00 49.92  ? 359  PHE B CD1 1 
ATOM   6884 C CD2 . PHE B 2 359 ? 14.308  -5.419  -17.092 1.00 50.73  ? 359  PHE B CD2 1 
ATOM   6885 C CE1 . PHE B 2 359 ? 15.670  -4.020  -15.134 1.00 51.90  ? 359  PHE B CE1 1 
ATOM   6886 C CE2 . PHE B 2 359 ? 14.448  -4.023  -17.193 1.00 54.93  ? 359  PHE B CE2 1 
ATOM   6887 C CZ  . PHE B 2 359 ? 15.131  -3.326  -16.205 1.00 51.94  ? 359  PHE B CZ  1 
ATOM   6888 N N   . LEU B 2 360 ? 17.692  -8.384  -16.753 1.00 51.51  ? 360  LEU B N   1 
ATOM   6889 C CA  . LEU B 2 360 ? 19.064  -8.018  -17.100 1.00 53.76  ? 360  LEU B CA  1 
ATOM   6890 C C   . LEU B 2 360 ? 19.403  -8.570  -18.475 1.00 56.55  ? 360  LEU B C   1 
ATOM   6891 O O   . LEU B 2 360 ? 20.149  -7.962  -19.234 1.00 54.74  ? 360  LEU B O   1 
ATOM   6892 C CB  . LEU B 2 360 ? 20.083  -8.573  -16.103 1.00 56.18  ? 360  LEU B CB  1 
ATOM   6893 C CG  . LEU B 2 360 ? 19.907  -8.400  -14.595 1.00 62.84  ? 360  LEU B CG  1 
ATOM   6894 C CD1 . LEU B 2 360 ? 21.270  -8.499  -13.926 1.00 61.29  ? 360  LEU B CD1 1 
ATOM   6895 C CD2 . LEU B 2 360 ? 19.217  -7.100  -14.202 1.00 60.90  ? 360  LEU B CD2 1 
ATOM   6896 N N   . ALA B 2 361 ? 18.864  -9.743  -18.788 1.00 55.35  ? 361  ALA B N   1 
ATOM   6897 C CA  . ALA B 2 361 ? 19.186  -10.373 -20.049 1.00 54.65  ? 361  ALA B CA  1 
ATOM   6898 C C   . ALA B 2 361 ? 18.489  -9.605  -21.148 1.00 50.71  ? 361  ALA B C   1 
ATOM   6899 O O   . ALA B 2 361 ? 19.072  -9.325  -22.190 1.00 51.82  ? 361  ALA B O   1 
ATOM   6900 C CB  . ALA B 2 361 ? 18.786  -11.865 -20.052 1.00 51.70  ? 361  ALA B CB  1 
ATOM   6901 N N   . GLY B 2 362 ? 17.236  -9.247  -20.905 1.00 52.75  ? 362  GLY B N   1 
ATOM   6902 C CA  . GLY B 2 362 ? 16.492  -8.447  -21.859 1.00 48.63  ? 362  GLY B CA  1 
ATOM   6903 C C   . GLY B 2 362 ? 17.185  -7.134  -22.164 1.00 51.67  ? 362  GLY B C   1 
ATOM   6904 O O   . GLY B 2 362 ? 17.117  -6.634  -23.292 1.00 50.31  ? 362  GLY B O   1 
ATOM   6905 N N   . VAL B 2 363 ? 17.852  -6.559  -21.163 1.00 52.34  ? 363  VAL B N   1 
ATOM   6906 C CA  . VAL B 2 363 ? 18.509  -5.249  -21.341 1.00 46.88  ? 363  VAL B CA  1 
ATOM   6907 C C   . VAL B 2 363 ? 19.723  -5.313  -22.280 1.00 47.35  ? 363  VAL B C   1 
ATOM   6908 O O   . VAL B 2 363 ? 19.890  -4.443  -23.113 1.00 47.13  ? 363  VAL B O   1 
ATOM   6909 C CB  . VAL B 2 363 ? 18.876  -4.616  -19.987 1.00 43.57  ? 363  VAL B CB  1 
ATOM   6910 C CG1 . VAL B 2 363 ? 19.844  -3.464  -20.156 1.00 40.98  ? 363  VAL B CG1 1 
ATOM   6911 C CG2 . VAL B 2 363 ? 17.605  -4.171  -19.265 1.00 41.44  ? 363  VAL B CG2 1 
ATOM   6912 N N   . ARG B 2 364 ? 20.550  -6.355  -22.168 1.00 49.35  ? 364  ARG B N   1 
ATOM   6913 C CA  . ARG B 2 364 ? 21.659  -6.550  -23.106 1.00 46.94  ? 364  ARG B CA  1 
ATOM   6914 C C   . ARG B 2 364 ? 21.153  -6.688  -24.528 1.00 49.73  ? 364  ARG B C   1 
ATOM   6915 O O   . ARG B 2 364 ? 21.888  -6.413  -25.477 1.00 50.65  ? 364  ARG B O   1 
ATOM   6916 C CB  . ARG B 2 364 ? 22.441  -7.810  -22.786 1.00 52.52  ? 364  ARG B CB  1 
ATOM   6917 C CG  . ARG B 2 364 ? 22.881  -7.939  -21.348 1.00 62.77  ? 364  ARG B CG  1 
ATOM   6918 C CD  . ARG B 2 364 ? 23.457  -6.636  -20.838 1.00 64.91  ? 364  ARG B CD  1 
ATOM   6919 N NE  . ARG B 2 364 ? 24.588  -6.173  -21.636 1.00 69.64  ? 364  ARG B NE  1 
ATOM   6920 C CZ  . ARG B 2 364 ? 25.856  -6.251  -21.235 1.00 68.91  ? 364  ARG B CZ  1 
ATOM   6921 N NH1 . ARG B 2 364 ? 26.138  -6.782  -20.046 1.00 64.63  ? 364  ARG B NH1 1 
ATOM   6922 N NH2 . ARG B 2 364 ? 26.833  -5.796  -22.018 1.00 61.43  ? 364  ARG B NH2 1 
ATOM   6923 N N   . ILE B 2 365 ? 19.904  -7.133  -24.677 1.00 43.67  ? 365  ILE B N   1 
ATOM   6924 C CA  . ILE B 2 365 ? 19.357  -7.389  -25.997 1.00 41.96  ? 365  ILE B CA  1 
ATOM   6925 C C   . ILE B 2 365 ? 18.722  -6.148  -26.598 1.00 43.72  ? 365  ILE B C   1 
ATOM   6926 O O   . ILE B 2 365 ? 18.779  -5.927  -27.822 1.00 45.50  ? 365  ILE B O   1 
ATOM   6927 C CB  . ILE B 2 365 ? 18.336  -8.545  -25.977 1.00 44.09  ? 365  ILE B CB  1 
ATOM   6928 C CG1 . ILE B 2 365 ? 19.048  -9.858  -25.645 1.00 45.94  ? 365  ILE B CG1 1 
ATOM   6929 C CG2 . ILE B 2 365 ? 17.647  -8.672  -27.328 1.00 39.84  ? 365  ILE B CG2 1 
ATOM   6930 C CD1 . ILE B 2 365 ? 18.125  -11.055 -25.641 1.00 47.90  ? 365  ILE B CD1 1 
ATOM   6931 N N   . GLY B 2 366 ? 18.119  -5.337  -25.737 1.00 39.68  ? 366  GLY B N   1 
ATOM   6932 C CA  . GLY B 2 366 ? 17.447  -4.134  -26.180 1.00 39.56  ? 366  GLY B CA  1 
ATOM   6933 C C   . GLY B 2 366 ? 18.408  -2.970  -26.256 1.00 42.65  ? 366  GLY B C   1 
ATOM   6934 O O   . GLY B 2 366 ? 18.105  -1.941  -26.860 1.00 43.19  ? 366  GLY B O   1 
ATOM   6935 N N   . VAL B 2 367 ? 19.566  -3.111  -25.613 1.00 38.23  ? 367  VAL B N   1 
ATOM   6936 C CA  . VAL B 2 367 ? 20.595  -2.086  -25.735 1.00 41.42  ? 367  VAL B CA  1 
ATOM   6937 C C   . VAL B 2 367 ? 21.876  -2.774  -26.095 1.00 40.88  ? 367  VAL B C   1 
ATOM   6938 O O   . VAL B 2 367 ? 22.814  -2.761  -25.325 1.00 39.36  ? 367  VAL B O   1 
ATOM   6939 C CB  . VAL B 2 367 ? 20.838  -1.302  -24.426 1.00 42.51  ? 367  VAL B CB  1 
ATOM   6940 C CG1 . VAL B 2 367 ? 21.737  -0.121  -24.699 1.00 33.57  ? 367  VAL B CG1 1 
ATOM   6941 C CG2 . VAL B 2 367 ? 19.517  -0.854  -23.810 1.00 45.34  ? 367  VAL B CG2 1 
ATOM   6942 N N   . PRO B 2 368 ? 21.914  -3.348  -27.292 1.00 46.01  ? 368  PRO B N   1 
ATOM   6943 C CA  . PRO B 2 368 ? 22.941  -4.282  -27.770 1.00 48.60  ? 368  PRO B CA  1 
ATOM   6944 C C   . PRO B 2 368 ? 24.305  -3.628  -27.838 1.00 52.03  ? 368  PRO B C   1 
ATOM   6945 O O   . PRO B 2 368 ? 25.305  -4.326  -27.887 1.00 46.92  ? 368  PRO B O   1 
ATOM   6946 C CB  . PRO B 2 368 ? 22.494  -4.608  -29.195 1.00 46.47  ? 368  PRO B CB  1 
ATOM   6947 C CG  . PRO B 2 368 ? 21.181  -3.909  -29.396 1.00 46.74  ? 368  PRO B CG  1 
ATOM   6948 C CD  . PRO B 2 368 ? 21.004  -2.896  -28.359 1.00 39.22  ? 368  PRO B CD  1 
ATOM   6949 N N   . GLN B 2 369 ? 24.343  -2.298  -27.865 1.00 51.86  ? 369  GLN B N   1 
ATOM   6950 C CA  . GLN B 2 369 ? 25.613  -1.588  -28.025 1.00 50.86  ? 369  GLN B CA  1 
ATOM   6951 C C   . GLN B 2 369 ? 26.244  -1.310  -26.671 1.00 51.70  ? 369  GLN B C   1 
ATOM   6952 O O   . GLN B 2 369 ? 27.394  -0.875  -26.593 1.00 50.12  ? 369  GLN B O   1 
ATOM   6953 C CB  . GLN B 2 369 ? 25.406  -0.266  -28.773 1.00 52.17  ? 369  GLN B CB  1 
ATOM   6954 C CG  . GLN B 2 369 ? 24.698  0.828   -27.922 1.00 51.51  ? 369  GLN B CG  1 
ATOM   6955 C CD  . GLN B 2 369 ? 23.170  0.790   -28.027 1.00 52.71  ? 369  GLN B CD  1 
ATOM   6956 O OE1 . GLN B 2 369 ? 22.502  1.810   -27.862 1.00 62.23  ? 369  GLN B OE1 1 
ATOM   6957 N NE2 . GLN B 2 369 ? 22.622  -0.373  -28.317 1.00 40.11  ? 369  GLN B NE2 1 
ATOM   6958 N N   . ALA B 2 370 ? 25.504  -1.577  -25.599 1.00 48.07  ? 370  ALA B N   1 
ATOM   6959 C CA  . ALA B 2 370 ? 25.970  -1.208  -24.268 1.00 48.65  ? 370  ALA B CA  1 
ATOM   6960 C C   . ALA B 2 370 ? 27.125  -2.053  -23.749 1.00 53.22  ? 370  ALA B C   1 
ATOM   6961 O O   . ALA B 2 370 ? 27.115  -3.285  -23.848 1.00 54.30  ? 370  ALA B O   1 
ATOM   6962 C CB  . ALA B 2 370 ? 24.821  -1.249  -23.277 1.00 50.66  ? 370  ALA B CB  1 
ATOM   6963 N N   . SER B 2 371 ? 28.110  -1.369  -23.172 1.00 51.64  ? 371  SER B N   1 
ATOM   6964 C CA  . SER B 2 371 ? 29.117  -1.992  -22.331 1.00 47.56  ? 371  SER B CA  1 
ATOM   6965 C C   . SER B 2 371 ? 28.454  -2.493  -21.048 1.00 52.94  ? 371  SER B C   1 
ATOM   6966 O O   . SER B 2 371 ? 27.319  -2.112  -20.731 1.00 52.73  ? 371  SER B O   1 
ATOM   6967 C CB  . SER B 2 371 ? 30.184  -0.962  -21.975 1.00 50.56  ? 371  SER B CB  1 
ATOM   6968 O OG  . SER B 2 371 ? 29.642  0.115   -21.213 1.00 49.09  ? 371  SER B OG  1 
ATOM   6969 N N   . ASP B 2 372 ? 29.159  -3.340  -20.311 1.00 50.01  ? 372  ASP B N   1 
ATOM   6970 C CA  . ASP B 2 372 ? 28.634  -3.901  -19.078 1.00 52.04  ? 372  ASP B CA  1 
ATOM   6971 C C   . ASP B 2 372 ? 28.139  -2.823  -18.141 1.00 54.02  ? 372  ASP B C   1 
ATOM   6972 O O   . ASP B 2 372 ? 27.085  -2.965  -17.515 1.00 57.06  ? 372  ASP B O   1 
ATOM   6973 C CB  . ASP B 2 372 ? 29.711  -4.701  -18.355 1.00 63.00  ? 372  ASP B CB  1 
ATOM   6974 C CG  . ASP B 2 372 ? 29.882  -6.086  -18.936 1.00 73.03  ? 372  ASP B CG  1 
ATOM   6975 O OD1 . ASP B 2 372 ? 28.947  -6.539  -19.634 1.00 71.17  ? 372  ASP B OD1 1 
ATOM   6976 O OD2 . ASP B 2 372 ? 30.941  -6.712  -18.699 1.00 74.42  ? 372  ASP B OD2 1 
ATOM   6977 N N   . LEU B 2 373 ? 28.909  -1.749  -18.029 1.00 49.66  ? 373  LEU B N   1 
ATOM   6978 C CA  . LEU B 2 373 ? 28.601  -0.730  -17.046 1.00 47.23  ? 373  LEU B CA  1 
ATOM   6979 C C   . LEU B 2 373 ? 27.418  0.107   -17.500 1.00 48.18  ? 373  LEU B C   1 
ATOM   6980 O O   . LEU B 2 373 ? 26.626  0.556   -16.672 1.00 50.85  ? 373  LEU B O   1 
ATOM   6981 C CB  . LEU B 2 373 ? 29.807  0.156   -16.780 1.00 43.42  ? 373  LEU B CB  1 
ATOM   6982 C CG  . LEU B 2 373 ? 29.540  1.303   -15.803 1.00 46.98  ? 373  LEU B CG  1 
ATOM   6983 C CD1 . LEU B 2 373 ? 29.281  0.811   -14.390 1.00 43.11  ? 373  LEU B CD1 1 
ATOM   6984 C CD2 . LEU B 2 373 ? 30.755  2.205   -15.802 1.00 52.33  ? 373  LEU B CD2 1 
ATOM   6985 N N   . ALA B 2 374 ? 27.308  0.314   -18.813 1.00 46.74  ? 374  ALA B N   1 
ATOM   6986 C CA  . ALA B 2 374 ? 26.162  1.026   -19.373 1.00 48.50  ? 374  ALA B CA  1 
ATOM   6987 C C   . ALA B 2 374 ? 24.895  0.223   -19.145 1.00 44.42  ? 374  ALA B C   1 
ATOM   6988 O O   . ALA B 2 374 ? 23.878  0.795   -18.785 1.00 40.40  ? 374  ALA B O   1 
ATOM   6989 C CB  . ALA B 2 374 ? 26.351  1.339   -20.875 1.00 41.01  ? 374  ALA B CB  1 
ATOM   6990 N N   . ALA B 2 375 ? 24.969  -1.096  -19.343 1.00 42.71  ? 375  ALA B N   1 
ATOM   6991 C CA  . ALA B 2 375 ? 23.806  -1.974  -19.178 1.00 44.12  ? 375  ALA B CA  1 
ATOM   6992 C C   . ALA B 2 375 ? 23.399  -1.936  -17.726 1.00 48.00  ? 375  ALA B C   1 
ATOM   6993 O O   . ALA B 2 375 ? 22.221  -1.930  -17.398 1.00 50.06  ? 375  ALA B O   1 
ATOM   6994 C CB  . ALA B 2 375 ? 24.133  -3.390  -19.590 1.00 44.19  ? 375  ALA B CB  1 
ATOM   6995 N N   . GLU B 2 376 ? 24.395  -1.869  -16.852 1.00 44.66  ? 376  GLU B N   1 
ATOM   6996 C CA  . GLU B 2 376 ? 24.148  -1.771  -15.427 1.00 43.22  ? 376  GLU B CA  1 
ATOM   6997 C C   . GLU B 2 376 ? 23.448  -0.433  -15.061 1.00 49.75  ? 376  GLU B C   1 
ATOM   6998 O O   . GLU B 2 376 ? 22.470  -0.410  -14.291 1.00 46.02  ? 376  GLU B O   1 
ATOM   6999 C CB  . GLU B 2 376 ? 25.469  -1.909  -14.696 1.00 50.68  ? 376  GLU B CB  1 
ATOM   7000 C CG  . GLU B 2 376 ? 25.363  -2.477  -13.320 1.00 71.64  ? 376  GLU B CG  1 
ATOM   7001 C CD  . GLU B 2 376 ? 26.610  -3.280  -12.955 1.00 88.17  ? 376  GLU B CD  1 
ATOM   7002 O OE1 . GLU B 2 376 ? 26.742  -3.646  -11.766 1.00 97.43  ? 376  GLU B OE1 1 
ATOM   7003 O OE2 . GLU B 2 376 ? 27.449  -3.549  -13.855 1.00 83.30  ? 376  GLU B OE2 1 
ATOM   7004 N N   . ALA B 2 377 ? 23.938  0.673   -15.613 1.00 40.01  ? 377  ALA B N   1 
ATOM   7005 C CA  . ALA B 2 377 ? 23.229  1.943   -15.441 1.00 43.19  ? 377  ALA B CA  1 
ATOM   7006 C C   . ALA B 2 377 ? 21.749  1.816   -15.831 1.00 45.39  ? 377  ALA B C   1 
ATOM   7007 O O   . ALA B 2 377 ? 20.885  2.351   -15.134 1.00 40.84  ? 377  ALA B O   1 
ATOM   7008 C CB  . ALA B 2 377 ? 23.882  3.054   -16.229 1.00 33.64  ? 377  ALA B CB  1 
ATOM   7009 N N   . VAL B 2 378 ? 21.454  1.117   -16.932 1.00 42.09  ? 378  VAL B N   1 
ATOM   7010 C CA  . VAL B 2 378 ? 20.078  1.067   -17.424 1.00 38.91  ? 378  VAL B CA  1 
ATOM   7011 C C   . VAL B 2 378 ? 19.199  0.323   -16.423 1.00 41.41  ? 378  VAL B C   1 
ATOM   7012 O O   . VAL B 2 378 ? 18.135  0.793   -16.018 1.00 38.79  ? 378  VAL B O   1 
ATOM   7013 C CB  . VAL B 2 378 ? 19.971  0.401   -18.797 1.00 38.60  ? 378  VAL B CB  1 
ATOM   7014 C CG1 . VAL B 2 378 ? 18.504  0.089   -19.120 1.00 32.87  ? 378  VAL B CG1 1 
ATOM   7015 C CG2 . VAL B 2 378 ? 20.581  1.310   -19.859 1.00 35.46  ? 378  VAL B CG2 1 
ATOM   7016 N N   . VAL B 2 379 ? 19.686  -0.841  -16.020 1.00 47.24  ? 379  VAL B N   1 
ATOM   7017 C CA  . VAL B 2 379 ? 19.036  -1.679  -15.033 1.00 43.71  ? 379  VAL B CA  1 
ATOM   7018 C C   . VAL B 2 379 ? 18.773  -0.897  -13.750 1.00 46.17  ? 379  VAL B C   1 
ATOM   7019 O O   . VAL B 2 379 ? 17.660  -0.903  -13.242 1.00 46.46  ? 379  VAL B O   1 
ATOM   7020 C CB  . VAL B 2 379 ? 19.910  -2.897  -14.733 1.00 40.93  ? 379  VAL B CB  1 
ATOM   7021 C CG1 . VAL B 2 379 ? 19.381  -3.670  -13.529 1.00 40.43  ? 379  VAL B CG1 1 
ATOM   7022 C CG2 . VAL B 2 379 ? 20.021  -3.776  -15.980 1.00 37.79  ? 379  VAL B CG2 1 
ATOM   7023 N N   . LEU B 2 380 ? 19.787  -0.203  -13.243 1.00 45.07  ? 380  LEU B N   1 
ATOM   7024 C CA  . LEU B 2 380 ? 19.624  0.530   -11.996 1.00 46.89  ? 380  LEU B CA  1 
ATOM   7025 C C   . LEU B 2 380 ? 18.631  1.695   -12.115 1.00 48.50  ? 380  LEU B C   1 
ATOM   7026 O O   . LEU B 2 380 ? 17.900  1.979   -11.177 1.00 49.88  ? 380  LEU B O   1 
ATOM   7027 C CB  . LEU B 2 380 ? 20.970  0.992   -11.446 1.00 54.19  ? 380  LEU B CB  1 
ATOM   7028 C CG  . LEU B 2 380 ? 21.968  -0.157  -11.230 1.00 67.73  ? 380  LEU B CG  1 
ATOM   7029 C CD1 . LEU B 2 380 ? 23.213  0.313   -10.490 1.00 72.37  ? 380  LEU B CD1 1 
ATOM   7030 C CD2 . LEU B 2 380 ? 21.343  -1.367  -10.510 1.00 69.80  ? 380  LEU B CD2 1 
ATOM   7031 N N   . HIS B 2 381 ? 18.582  2.344   -13.275 1.00 46.44  ? 381  HIS B N   1 
ATOM   7032 C CA  . HIS B 2 381 ? 17.613  3.418   -13.531 1.00 40.20  ? 381  HIS B CA  1 
ATOM   7033 C C   . HIS B 2 381 ? 16.181  2.914   -13.600 1.00 42.03  ? 381  HIS B C   1 
ATOM   7034 O O   . HIS B 2 381 ? 15.268  3.538   -13.082 1.00 49.12  ? 381  HIS B O   1 
ATOM   7035 C CB  . HIS B 2 381 ? 17.921  4.085   -14.869 1.00 35.24  ? 381  HIS B CB  1 
ATOM   7036 C CG  . HIS B 2 381 ? 17.061  5.260   -15.157 1.00 38.14  ? 381  HIS B CG  1 
ATOM   7037 N ND1 . HIS B 2 381 ? 17.306  6.508   -14.615 1.00 42.34  ? 381  HIS B ND1 1 
ATOM   7038 C CD2 . HIS B 2 381 ? 15.950  5.391   -15.917 1.00 41.83  ? 381  HIS B CD2 1 
ATOM   7039 C CE1 . HIS B 2 381 ? 16.377  7.351   -15.025 1.00 45.97  ? 381  HIS B CE1 1 
ATOM   7040 N NE2 . HIS B 2 381 ? 15.540  6.701   -15.820 1.00 44.51  ? 381  HIS B NE2 1 
ATOM   7041 N N   . TYR B 2 382 ? 15.981  1.798   -14.284 1.00 40.26  ? 382  TYR B N   1 
ATOM   7042 C CA  . TYR B 2 382 ? 14.641  1.290   -14.536 1.00 41.92  ? 382  TYR B CA  1 
ATOM   7043 C C   . TYR B 2 382 ? 14.131  0.305   -13.493 1.00 43.20  ? 382  TYR B C   1 
ATOM   7044 O O   . TYR B 2 382 ? 12.946  0.000   -13.465 1.00 54.84  ? 382  TYR B O   1 
ATOM   7045 C CB  . TYR B 2 382 ? 14.569  0.640   -15.913 1.00 43.31  ? 382  TYR B CB  1 
ATOM   7046 C CG  . TYR B 2 382 ? 14.435  1.640   -17.028 1.00 38.05  ? 382  TYR B CG  1 
ATOM   7047 C CD1 . TYR B 2 382 ? 15.555  2.235   -17.572 1.00 30.52  ? 382  TYR B CD1 1 
ATOM   7048 C CD2 . TYR B 2 382 ? 13.184  1.974   -17.545 1.00 36.26  ? 382  TYR B CD2 1 
ATOM   7049 C CE1 . TYR B 2 382 ? 15.456  3.135   -18.602 1.00 33.33  ? 382  TYR B CE1 1 
ATOM   7050 C CE2 . TYR B 2 382 ? 13.058  2.893   -18.592 1.00 35.84  ? 382  TYR B CE2 1 
ATOM   7051 C CZ  . TYR B 2 382 ? 14.207  3.463   -19.116 1.00 39.48  ? 382  TYR B CZ  1 
ATOM   7052 O OH  . TYR B 2 382 ? 14.139  4.355   -20.150 1.00 36.09  ? 382  TYR B OH  1 
ATOM   7053 N N   . THR B 2 383 ? 15.016  -0.200  -12.647 1.00 45.90  ? 383  THR B N   1 
ATOM   7054 C CA  . THR B 2 383 ? 14.587  -1.030  -11.532 1.00 44.12  ? 383  THR B CA  1 
ATOM   7055 C C   . THR B 2 383 ? 13.819  -0.162  -10.554 1.00 46.05  ? 383  THR B C   1 
ATOM   7056 O O   . THR B 2 383 ? 14.236  0.971   -10.258 1.00 42.11  ? 383  THR B O   1 
ATOM   7057 C CB  . THR B 2 383 ? 15.794  -1.644  -10.822 1.00 40.66  ? 383  THR B CB  1 
ATOM   7058 O OG1 . THR B 2 383 ? 16.354  -2.664  -11.652 1.00 42.01  ? 383  THR B OG1 1 
ATOM   7059 C CG2 . THR B 2 383 ? 15.421  -2.222  -9.451  1.00 41.91  ? 383  THR B CG2 1 
ATOM   7060 N N   . ASP B 2 384 ? 12.675  -0.675  -10.091 1.00 50.00  ? 384  ASP B N   1 
ATOM   7061 C CA  . ASP B 2 384 ? 11.944  -0.064  -8.979  1.00 49.31  ? 384  ASP B CA  1 
ATOM   7062 C C   . ASP B 2 384 ? 12.468  -0.645  -7.659  1.00 49.62  ? 384  ASP B C   1 
ATOM   7063 O O   . ASP B 2 384 ? 12.188  -1.804  -7.322  1.00 43.17  ? 384  ASP B O   1 
ATOM   7064 C CB  . ASP B 2 384 ? 10.438  -0.274  -9.104  1.00 51.02  ? 384  ASP B CB  1 
ATOM   7065 C CG  . ASP B 2 384 ? 9.644   0.469   -8.008  1.00 64.37  ? 384  ASP B CG  1 
ATOM   7066 O OD1 . ASP B 2 384 ? 10.137  0.554   -6.858  1.00 58.67  ? 384  ASP B OD1 1 
ATOM   7067 O OD2 . ASP B 2 384 ? 8.521   0.959   -8.293  1.00 71.44  ? 384  ASP B OD2 1 
ATOM   7068 N N   . TRP B 2 385 ? 13.234  0.171   -6.928  1.00 49.56  ? 385  TRP B N   1 
ATOM   7069 C CA  . TRP B 2 385 ? 13.962  -0.297  -5.746  1.00 50.95  ? 385  TRP B CA  1 
ATOM   7070 C C   . TRP B 2 385 ? 13.067  -0.598  -4.535  1.00 53.11  ? 385  TRP B C   1 
ATOM   7071 O O   . TRP B 2 385 ? 13.475  -1.295  -3.600  1.00 51.34  ? 385  TRP B O   1 
ATOM   7072 C CB  . TRP B 2 385 ? 15.169  0.624   -5.438  1.00 53.62  ? 385  TRP B CB  1 
ATOM   7073 C CG  . TRP B 2 385 ? 16.171  0.481   -6.534  1.00 48.23  ? 385  TRP B CG  1 
ATOM   7074 C CD1 . TRP B 2 385 ? 16.372  1.335   -7.591  1.00 44.39  ? 385  TRP B CD1 1 
ATOM   7075 C CD2 . TRP B 2 385 ? 17.016  -0.642  -6.761  1.00 40.11  ? 385  TRP B CD2 1 
ATOM   7076 N NE1 . TRP B 2 385 ? 17.321  0.821   -8.432  1.00 40.80  ? 385  TRP B NE1 1 
ATOM   7077 C CE2 . TRP B 2 385 ? 17.739  -0.388  -7.946  1.00 42.43  ? 385  TRP B CE2 1 
ATOM   7078 C CE3 . TRP B 2 385 ? 17.245  -1.836  -6.069  1.00 44.94  ? 385  TRP B CE3 1 
ATOM   7079 C CZ2 . TRP B 2 385 ? 18.684  -1.289  -8.461  1.00 47.59  ? 385  TRP B CZ2 1 
ATOM   7080 C CZ3 . TRP B 2 385 ? 18.194  -2.739  -6.579  1.00 46.34  ? 385  TRP B CZ3 1 
ATOM   7081 C CH2 . TRP B 2 385 ? 18.900  -2.456  -7.762  1.00 47.79  ? 385  TRP B CH2 1 
ATOM   7082 N N   . LEU B 2 386 ? 11.827  -0.122  -4.592  1.00 55.70  ? 386  LEU B N   1 
ATOM   7083 C CA  . LEU B 2 386 ? 10.787  -0.599  -3.675  1.00 66.38  ? 386  LEU B CA  1 
ATOM   7084 C C   . LEU B 2 386 ? 10.309  -2.018  -4.004  1.00 63.62  ? 386  LEU B C   1 
ATOM   7085 O O   . LEU B 2 386 ? 9.982   -2.788  -3.107  1.00 64.59  ? 386  LEU B O   1 
ATOM   7086 C CB  . LEU B 2 386 ? 9.605   0.358   -3.675  1.00 68.18  ? 386  LEU B CB  1 
ATOM   7087 C CG  . LEU B 2 386 ? 9.942   1.573   -2.825  1.00 71.42  ? 386  LEU B CG  1 
ATOM   7088 C CD1 . LEU B 2 386 ? 8.982   2.721   -3.108  1.00 71.76  ? 386  LEU B CD1 1 
ATOM   7089 C CD2 . LEU B 2 386 ? 9.937   1.144   -1.357  1.00 73.05  ? 386  LEU B CD2 1 
ATOM   7090 N N   . HIS B 2 387 ? 10.280  -2.352  -5.295  1.00 60.94  ? 387  HIS B N   1 
ATOM   7091 C CA  . HIS B 2 387 ? 9.811   -3.659  -5.758  1.00 61.56  ? 387  HIS B CA  1 
ATOM   7092 C C   . HIS B 2 387 ? 10.793  -4.252  -6.776  1.00 56.14  ? 387  HIS B C   1 
ATOM   7093 O O   . HIS B 2 387 ? 10.430  -4.515  -7.915  1.00 55.90  ? 387  HIS B O   1 
ATOM   7094 C CB  . HIS B 2 387 ? 8.408   -3.523  -6.371  1.00 61.67  ? 387  HIS B CB  1 
ATOM   7095 C CG  . HIS B 2 387 ? 7.467   -2.704  -5.541  1.00 69.63  ? 387  HIS B CG  1 
ATOM   7096 N ND1 . HIS B 2 387 ? 7.205   -1.373  -5.801  1.00 75.50  ? 387  HIS B ND1 1 
ATOM   7097 C CD2 . HIS B 2 387 ? 6.757   -3.015  -4.429  1.00 74.32  ? 387  HIS B CD2 1 
ATOM   7098 C CE1 . HIS B 2 387 ? 6.366   -0.903  -4.896  1.00 75.47  ? 387  HIS B CE1 1 
ATOM   7099 N NE2 . HIS B 2 387 ? 6.081   -1.880  -4.049  1.00 81.35  ? 387  HIS B NE2 1 
ATOM   7100 N N   . PRO B 2 388 ? 12.050  -4.454  -6.361  1.00 55.50  ? 388  PRO B N   1 
ATOM   7101 C CA  . PRO B 2 388 ? 13.136  -4.797  -7.288  1.00 53.15  ? 388  PRO B CA  1 
ATOM   7102 C C   . PRO B 2 388 ? 12.918  -6.101  -8.034  1.00 53.82  ? 388  PRO B C   1 
ATOM   7103 O O   . PRO B 2 388 ? 13.499  -6.296  -9.105  1.00 55.77  ? 388  PRO B O   1 
ATOM   7104 C CB  . PRO B 2 388 ? 14.350  -4.940  -6.359  1.00 54.96  ? 388  PRO B CB  1 
ATOM   7105 C CG  . PRO B 2 388 ? 13.752  -5.158  -4.983  1.00 52.59  ? 388  PRO B CG  1 
ATOM   7106 C CD  . PRO B 2 388 ? 12.547  -4.288  -4.983  1.00 53.13  ? 388  PRO B CD  1 
ATOM   7107 N N   . GLU B 2 389 ? 12.102  -6.985  -7.473  1.00 57.91  ? 389  GLU B N   1 
ATOM   7108 C CA  . GLU B 2 389 ? 11.961  -8.342  -8.000  1.00 58.43  ? 389  GLU B CA  1 
ATOM   7109 C C   . GLU B 2 389 ? 10.565  -8.579  -8.554  1.00 57.97  ? 389  GLU B C   1 
ATOM   7110 O O   . GLU B 2 389 ? 10.238  -9.682  -9.021  1.00 59.15  ? 389  GLU B O   1 
ATOM   7111 C CB  . GLU B 2 389 ? 12.247  -9.363  -6.894  1.00 57.08  ? 389  GLU B CB  1 
ATOM   7112 C CG  . GLU B 2 389 ? 13.699  -9.424  -6.456  1.00 72.71  ? 389  GLU B CG  1 
ATOM   7113 C CD  . GLU B 2 389 ? 14.480  -10.509 -7.179  1.00 91.82  ? 389  GLU B CD  1 
ATOM   7114 O OE1 . GLU B 2 389 ? 13.904  -11.151 -8.092  1.00 101.72 ? 389  GLU B OE1 1 
ATOM   7115 O OE2 . GLU B 2 389 ? 15.665  -10.734 -6.835  1.00 95.27  ? 389  GLU B OE2 1 
ATOM   7116 N N   . ASP B 2 390 ? 9.729   -7.552  -8.475  1.00 52.62  ? 390  ASP B N   1 
ATOM   7117 C CA  . ASP B 2 390 ? 8.353   -7.697  -8.896  1.00 54.88  ? 390  ASP B CA  1 
ATOM   7118 C C   . ASP B 2 390 ? 8.245   -7.854  -10.413 1.00 54.46  ? 390  ASP B C   1 
ATOM   7119 O O   . ASP B 2 390 ? 8.635   -6.971  -11.161 1.00 55.82  ? 390  ASP B O   1 
ATOM   7120 C CB  . ASP B 2 390 ? 7.509   -6.522  -8.440  1.00 55.35  ? 390  ASP B CB  1 
ATOM   7121 C CG  . ASP B 2 390 ? 6.084   -6.650  -8.910  1.00 65.55  ? 390  ASP B CG  1 
ATOM   7122 O OD1 . ASP B 2 390 ? 5.421   -7.632  -8.479  1.00 71.04  ? 390  ASP B OD1 1 
ATOM   7123 O OD2 . ASP B 2 390 ? 5.639   -5.813  -9.732  1.00 61.47  ? 390  ASP B OD2 1 
ATOM   7124 N N   . PRO B 2 391 ? 7.708   -8.990  -10.866 1.00 54.75  ? 391  PRO B N   1 
ATOM   7125 C CA  . PRO B 2 391 ? 7.691   -9.308  -12.297 1.00 50.48  ? 391  PRO B CA  1 
ATOM   7126 C C   . PRO B 2 391 ? 6.793   -8.400  -13.161 1.00 47.99  ? 391  PRO B C   1 
ATOM   7127 O O   . PRO B 2 391 ? 7.068   -8.279  -14.341 1.00 51.15  ? 391  PRO B O   1 
ATOM   7128 C CB  . PRO B 2 391 ? 7.205   -10.777 -12.333 1.00 48.25  ? 391  PRO B CB  1 
ATOM   7129 C CG  . PRO B 2 391 ? 7.455   -11.297 -10.939 1.00 51.72  ? 391  PRO B CG  1 
ATOM   7130 C CD  . PRO B 2 391 ? 7.202   -10.106 -10.046 1.00 53.45  ? 391  PRO B CD  1 
ATOM   7131 N N   . THR B 2 392 ? 5.737   -7.813  -12.611 1.00 52.40  ? 392  THR B N   1 
ATOM   7132 C CA  . THR B 2 392 ? 4.907   -6.865  -13.368 1.00 50.24  ? 392  THR B CA  1 
ATOM   7133 C C   . THR B 2 392 ? 5.722   -5.582  -13.616 1.00 51.19  ? 392  THR B C   1 
ATOM   7134 O O   . THR B 2 392 ? 5.707   -5.031  -14.720 1.00 50.19  ? 392  THR B O   1 
ATOM   7135 C CB  . THR B 2 392 ? 3.546   -6.549  -12.628 1.00 52.52  ? 392  THR B CB  1 
ATOM   7136 O OG1 . THR B 2 392 ? 2.677   -7.698  -12.666 1.00 58.89  ? 392  THR B OG1 1 
ATOM   7137 C CG2 . THR B 2 392 ? 2.821   -5.385  -13.255 1.00 43.15  ? 392  THR B CG2 1 
ATOM   7138 N N   . HIS B 2 393 ? 6.442   -5.113  -12.595 1.00 52.64  ? 393  HIS B N   1 
ATOM   7139 C CA  . HIS B 2 393 ? 7.313   -3.950  -12.770 1.00 55.56  ? 393  HIS B CA  1 
ATOM   7140 C C   . HIS B 2 393 ? 8.416   -4.312  -13.751 1.00 52.42  ? 393  HIS B C   1 
ATOM   7141 O O   . HIS B 2 393 ? 8.738   -3.534  -14.651 1.00 51.54  ? 393  HIS B O   1 
ATOM   7142 C CB  . HIS B 2 393 ? 7.943   -3.477  -11.457 1.00 56.20  ? 393  HIS B CB  1 
ATOM   7143 C CG  . HIS B 2 393 ? 6.999   -2.750  -10.555 1.00 65.68  ? 393  HIS B CG  1 
ATOM   7144 N ND1 . HIS B 2 393 ? 6.222   -3.394  -9.613  1.00 72.60  ? 393  HIS B ND1 1 
ATOM   7145 C CD2 . HIS B 2 393 ? 6.725   -1.432  -10.428 1.00 69.85  ? 393  HIS B CD2 1 
ATOM   7146 C CE1 . HIS B 2 393 ? 5.502   -2.503  -8.952  1.00 71.98  ? 393  HIS B CE1 1 
ATOM   7147 N NE2 . HIS B 2 393 ? 5.791   -1.303  -9.424  1.00 71.04  ? 393  HIS B NE2 1 
ATOM   7148 N N   . LEU B 2 394 ? 8.985   -5.501  -13.593 1.00 44.17  ? 394  LEU B N   1 
ATOM   7149 C CA  . LEU B 2 394 ? 10.122  -5.857  -14.427 1.00 47.18  ? 394  LEU B CA  1 
ATOM   7150 C C   . LEU B 2 394 ? 9.701   -5.944  -15.892 1.00 50.40  ? 394  LEU B C   1 
ATOM   7151 O O   . LEU B 2 394 ? 10.471  -5.611  -16.786 1.00 51.11  ? 394  LEU B O   1 
ATOM   7152 C CB  . LEU B 2 394 ? 10.794  -7.142  -13.938 1.00 47.07  ? 394  LEU B CB  1 
ATOM   7153 C CG  . LEU B 2 394 ? 11.469  -6.965  -12.576 1.00 50.18  ? 394  LEU B CG  1 
ATOM   7154 C CD1 . LEU B 2 394 ? 11.861  -8.316  -11.945 1.00 51.05  ? 394  LEU B CD1 1 
ATOM   7155 C CD2 . LEU B 2 394 ? 12.666  -6.020  -12.675 1.00 43.97  ? 394  LEU B CD2 1 
ATOM   7156 N N   . ARG B 2 395 ? 8.462   -6.364  -16.123 1.00 49.76  ? 395  ARG B N   1 
ATOM   7157 C CA  . ARG B 2 395 ? 7.946   -6.532  -17.473 1.00 45.98  ? 395  ARG B CA  1 
ATOM   7158 C C   . ARG B 2 395 ? 7.719   -5.144  -18.101 1.00 45.41  ? 395  ARG B C   1 
ATOM   7159 O O   . ARG B 2 395 ? 8.172   -4.865  -19.214 1.00 43.07  ? 395  ARG B O   1 
ATOM   7160 C CB  . ARG B 2 395 ? 6.662   -7.361  -17.434 1.00 41.98  ? 395  ARG B CB  1 
ATOM   7161 C CG  . ARG B 2 395 ? 5.923   -7.507  -18.765 1.00 45.88  ? 395  ARG B CG  1 
ATOM   7162 C CD  . ARG B 2 395 ? 4.609   -6.751  -18.709 1.00 52.72  ? 395  ARG B CD  1 
ATOM   7163 N NE  . ARG B 2 395 ? 3.553   -7.582  -18.175 1.00 55.78  ? 395  ARG B NE  1 
ATOM   7164 C CZ  . ARG B 2 395 ? 2.476   -7.136  -17.528 1.00 54.93  ? 395  ARG B CZ  1 
ATOM   7165 N NH1 . ARG B 2 395 ? 2.280   -5.838  -17.322 1.00 39.47  ? 395  ARG B NH1 1 
ATOM   7166 N NH2 . ARG B 2 395 ? 1.584   -8.018  -17.089 1.00 60.74  ? 395  ARG B NH2 1 
ATOM   7167 N N   . ASP B 2 396 ? 7.066   -4.261  -17.357 1.00 39.96  ? 396  ASP B N   1 
ATOM   7168 C CA  . ASP B 2 396 ? 6.802   -2.918  -17.849 1.00 42.18  ? 396  ASP B CA  1 
ATOM   7169 C C   . ASP B 2 396 ? 8.087   -2.099  -18.007 1.00 43.20  ? 396  ASP B C   1 
ATOM   7170 O O   . ASP B 2 396 ? 8.185   -1.292  -18.915 1.00 47.03  ? 396  ASP B O   1 
ATOM   7171 C CB  . ASP B 2 396 ? 5.796   -2.220  -16.942 1.00 45.89  ? 396  ASP B CB  1 
ATOM   7172 C CG  . ASP B 2 396 ? 4.440   -2.941  -16.907 1.00 56.16  ? 396  ASP B CG  1 
ATOM   7173 O OD1 . ASP B 2 396 ? 4.129   -3.731  -17.835 1.00 54.93  ? 396  ASP B OD1 1 
ATOM   7174 O OD2 . ASP B 2 396 ? 3.681   -2.715  -15.945 1.00 61.61  ? 396  ASP B OD2 1 
ATOM   7175 N N   . ALA B 2 397 ? 9.082   -2.325  -17.149 1.00 39.95  ? 397  ALA B N   1 
ATOM   7176 C CA  . ALA B 2 397 ? 10.350  -1.618  -17.277 1.00 36.76  ? 397  ALA B CA  1 
ATOM   7177 C C   . ALA B 2 397 ? 11.090  -2.074  -18.533 1.00 40.01  ? 397  ALA B C   1 
ATOM   7178 O O   . ALA B 2 397 ? 11.712  -1.263  -19.215 1.00 36.79  ? 397  ALA B O   1 
ATOM   7179 C CB  . ALA B 2 397 ? 11.224  -1.816  -16.039 1.00 36.89  ? 397  ALA B CB  1 
ATOM   7180 N N   . MET B 2 398 ? 11.018  -3.370  -18.845 1.00 39.85  ? 398  MET B N   1 
ATOM   7181 C CA  . MET B 2 398 ? 11.687  -3.879  -20.037 1.00 37.18  ? 398  MET B CA  1 
ATOM   7182 C C   . MET B 2 398 ? 11.112  -3.206  -21.274 1.00 39.48  ? 398  MET B C   1 
ATOM   7183 O O   . MET B 2 398 ? 11.843  -2.830  -22.200 1.00 40.74  ? 398  MET B O   1 
ATOM   7184 C CB  . MET B 2 398 ? 11.518  -5.393  -20.145 1.00 39.63  ? 398  MET B CB  1 
ATOM   7185 C CG  . MET B 2 398 ? 12.336  -6.049  -21.257 1.00 43.98  ? 398  MET B CG  1 
ATOM   7186 S SD  . MET B 2 398 ? 14.110  -5.794  -21.057 1.00 47.91  ? 398  MET B SD  1 
ATOM   7187 C CE  . MET B 2 398 ? 14.473  -4.767  -22.469 1.00 42.00  ? 398  MET B CE  1 
ATOM   7188 N N   . SER B 2 399 ? 9.791   -3.078  -21.295 1.00 33.44  ? 399  SER B N   1 
ATOM   7189 C CA  . SER B 2 399 ? 9.105   -2.404  -22.374 1.00 38.87  ? 399  SER B CA  1 
ATOM   7190 C C   . SER B 2 399 ? 9.533   -0.931  -22.446 1.00 38.85  ? 399  SER B C   1 
ATOM   7191 O O   . SER B 2 399 ? 9.812   -0.423  -23.524 1.00 36.84  ? 399  SER B O   1 
ATOM   7192 C CB  . SER B 2 399 ? 7.601   -2.448  -22.127 1.00 40.80  ? 399  SER B CB  1 
ATOM   7193 O OG  . SER B 2 399 ? 6.952   -1.643  -23.085 1.00 35.95  ? 399  SER B OG  1 
ATOM   7194 N N   . ALA B 2 400 ? 9.571   -0.254  -21.297 1.00 38.60  ? 400  ALA B N   1 
ATOM   7195 C CA  . ALA B 2 400 ? 9.969   1.172   -21.257 1.00 38.48  ? 400  ALA B CA  1 
ATOM   7196 C C   . ALA B 2 400 ? 11.409  1.369   -21.727 1.00 37.73  ? 400  ALA B C   1 
ATOM   7197 O O   . ALA B 2 400 ? 11.700  2.307   -22.472 1.00 38.55  ? 400  ALA B O   1 
ATOM   7198 C CB  . ALA B 2 400 ? 9.785   1.748   -19.864 1.00 33.77  ? 400  ALA B CB  1 
ATOM   7199 N N   . VAL B 2 401 ? 12.318  0.493   -21.300 1.00 34.85  ? 401  VAL B N   1 
ATOM   7200 C CA  . VAL B 2 401 ? 13.703  0.599   -21.765 1.00 35.58  ? 401  VAL B CA  1 
ATOM   7201 C C   . VAL B 2 401 ? 13.745  0.625   -23.296 1.00 36.77  ? 401  VAL B C   1 
ATOM   7202 O O   . VAL B 2 401 ? 14.429  1.451   -23.913 1.00 36.15  ? 401  VAL B O   1 
ATOM   7203 C CB  . VAL B 2 401 ? 14.570  -0.592  -21.273 1.00 33.74  ? 401  VAL B CB  1 
ATOM   7204 C CG1 . VAL B 2 401 ? 15.841  -0.695  -22.101 1.00 29.66  ? 401  VAL B CG1 1 
ATOM   7205 C CG2 . VAL B 2 401 ? 14.853  -0.497  -19.767 1.00 27.35  ? 401  VAL B CG2 1 
ATOM   7206 N N   . VAL B 2 402 ? 13.004  -0.287  -23.918 1.00 41.42  ? 402  VAL B N   1 
ATOM   7207 C CA  . VAL B 2 402 ? 13.042  -0.429  -25.364 1.00 37.26  ? 402  VAL B CA  1 
ATOM   7208 C C   . VAL B 2 402 ? 12.370  0.767   -26.046 1.00 37.91  ? 402  VAL B C   1 
ATOM   7209 O O   . VAL B 2 402 ? 12.917  1.368   -26.990 1.00 33.39  ? 402  VAL B O   1 
ATOM   7210 C CB  . VAL B 2 402 ? 12.367  -1.761  -25.813 1.00 43.16  ? 402  VAL B CB  1 
ATOM   7211 C CG1 . VAL B 2 402 ? 12.095  -1.770  -27.337 1.00 31.77  ? 402  VAL B CG1 1 
ATOM   7212 C CG2 . VAL B 2 402 ? 13.211  -2.972  -25.352 1.00 35.10  ? 402  VAL B CG2 1 
ATOM   7213 N N   . GLY B 2 403 ? 11.178  1.107   -25.578 1.00 36.52  ? 403  GLY B N   1 
ATOM   7214 C CA  . GLY B 2 403 ? 10.449  2.233   -26.141 1.00 34.97  ? 403  GLY B CA  1 
ATOM   7215 C C   . GLY B 2 403 ? 11.193  3.563   -25.970 1.00 35.80  ? 403  GLY B C   1 
ATOM   7216 O O   . GLY B 2 403 ? 11.212  4.376   -26.898 1.00 31.28  ? 403  GLY B O   1 
ATOM   7217 N N   . ASP B 2 404 ? 11.794  3.786   -24.793 1.00 34.80  ? 404  ASP B N   1 
ATOM   7218 C CA  . ASP B 2 404 ? 12.466  5.056   -24.506 1.00 36.38  ? 404  ASP B CA  1 
ATOM   7219 C C   . ASP B 2 404 ? 13.741  5.183   -25.319 1.00 36.83  ? 404  ASP B C   1 
ATOM   7220 O O   . ASP B 2 404 ? 14.018  6.227   -25.921 1.00 38.19  ? 404  ASP B O   1 
ATOM   7221 C CB  . ASP B 2 404 ? 12.811  5.208   -23.009 1.00 34.32  ? 404  ASP B CB  1 
ATOM   7222 C CG  . ASP B 2 404 ? 11.589  5.260   -22.115 1.00 38.63  ? 404  ASP B CG  1 
ATOM   7223 O OD1 . ASP B 2 404 ? 10.487  5.545   -22.635 1.00 37.87  ? 404  ASP B OD1 1 
ATOM   7224 O OD2 . ASP B 2 404 ? 11.727  5.029   -20.880 1.00 37.12  ? 404  ASP B OD2 1 
ATOM   7225 N N   . HIS B 2 405 ? 14.548  4.132   -25.302 1.00 37.11  ? 405  HIS B N   1 
ATOM   7226 C CA  . HIS B 2 405 ? 15.854  4.168   -25.982 1.00 34.42  ? 405  HIS B CA  1 
ATOM   7227 C C   . HIS B 2 405 ? 15.657  4.334   -27.489 1.00 36.94  ? 405  HIS B C   1 
ATOM   7228 O O   . HIS B 2 405 ? 16.392  5.086   -28.131 1.00 34.60  ? 405  HIS B O   1 
ATOM   7229 C CB  . HIS B 2 405 ? 16.621  2.865   -25.697 1.00 32.16  ? 405  HIS B CB  1 
ATOM   7230 C CG  . HIS B 2 405 ? 17.892  2.711   -26.464 1.00 34.76  ? 405  HIS B CG  1 
ATOM   7231 N ND1 . HIS B 2 405 ? 18.801  3.739   -26.626 1.00 38.48  ? 405  HIS B ND1 1 
ATOM   7232 C CD2 . HIS B 2 405 ? 18.445  1.621   -27.052 1.00 39.77  ? 405  HIS B CD2 1 
ATOM   7233 C CE1 . HIS B 2 405 ? 19.844  3.291   -27.303 1.00 37.98  ? 405  HIS B CE1 1 
ATOM   7234 N NE2 . HIS B 2 405 ? 19.656  2.008   -27.566 1.00 35.49  ? 405  HIS B NE2 1 
ATOM   7235 N N   . ASN B 2 406 ? 14.645  3.660   -28.048 1.00 27.14  ? 406  ASN B N   1 
ATOM   7236 C CA  . ASN B 2 406 ? 14.497  3.639   -29.502 1.00 26.14  ? 406  ASN B CA  1 
ATOM   7237 C C   . ASN B 2 406 ? 13.604  4.720   -30.088 1.00 34.53  ? 406  ASN B C   1 
ATOM   7238 O O   . ASN B 2 406 ? 13.813  5.133   -31.224 1.00 34.55  ? 406  ASN B O   1 
ATOM   7239 C CB  . ASN B 2 406 ? 14.040  2.261   -29.984 1.00 30.65  ? 406  ASN B CB  1 
ATOM   7240 C CG  . ASN B 2 406 ? 15.111  1.189   -29.752 1.00 38.95  ? 406  ASN B CG  1 
ATOM   7241 O OD1 . ASN B 2 406 ? 16.234  1.297   -30.278 1.00 31.11  ? 406  ASN B OD1 1 
ATOM   7242 N ND2 . ASN B 2 406 ? 14.786  0.182   -28.906 1.00 38.41  ? 406  ASN B ND2 1 
ATOM   7243 N N   . VAL B 2 407 ? 12.600  5.159   -29.328 1.00 31.63  ? 407  VAL B N   1 
ATOM   7244 C CA  . VAL B 2 407 ? 11.627  6.082   -29.860 1.00 29.25  ? 407  VAL B CA  1 
ATOM   7245 C C   . VAL B 2 407 ? 11.462  7.344   -29.008 1.00 33.22  ? 407  VAL B C   1 
ATOM   7246 O O   . VAL B 2 407 ? 11.785  8.427   -29.467 1.00 34.67  ? 407  VAL B O   1 
ATOM   7247 C CB  . VAL B 2 407 ? 10.262  5.406   -30.093 1.00 34.09  ? 407  VAL B CB  1 
ATOM   7248 C CG1 . VAL B 2 407 ? 9.250   6.427   -30.665 1.00 30.60  ? 407  VAL B CG1 1 
ATOM   7249 C CG2 . VAL B 2 407 ? 10.409  4.221   -31.024 1.00 33.33  ? 407  VAL B CG2 1 
ATOM   7250 N N   . VAL B 2 408 ? 11.000  7.205   -27.768 1.00 32.75  ? 408  VAL B N   1 
ATOM   7251 C CA  . VAL B 2 408 ? 10.610  8.374   -26.990 1.00 30.07  ? 408  VAL B CA  1 
ATOM   7252 C C   . VAL B 2 408 ? 11.752  9.368   -26.794 1.00 32.84  ? 408  VAL B C   1 
ATOM   7253 O O   . VAL B 2 408 ? 11.579  10.556  -26.999 1.00 24.94  ? 408  VAL B O   1 
ATOM   7254 C CB  . VAL B 2 408 ? 10.042  8.011   -25.602 1.00 30.36  ? 408  VAL B CB  1 
ATOM   7255 C CG1 . VAL B 2 408 ? 9.551   9.288   -24.868 1.00 34.96  ? 408  VAL B CG1 1 
ATOM   7256 C CG2 . VAL B 2 408 ? 8.935   7.023   -25.733 1.00 26.94  ? 408  VAL B CG2 1 
ATOM   7257 N N   . CYS B 2 409 ? 12.933  8.899   -26.423 1.00 29.34  ? 409  CYS B N   1 
ATOM   7258 C CA  . CYS B 2 409 ? 13.973  9.866   -26.141 1.00 22.74  ? 409  CYS B CA  1 
ATOM   7259 C C   . CYS B 2 409 ? 14.553  10.463  -27.427 1.00 29.58  ? 409  CYS B C   1 
ATOM   7260 O O   . CYS B 2 409 ? 14.797  11.692  -27.474 1.00 38.84  ? 409  CYS B O   1 
ATOM   7261 C CB  . CYS B 2 409 ? 15.007  9.296   -25.157 1.00 26.46  ? 409  CYS B CB  1 
ATOM   7262 S SG  . CYS B 2 409 ? 14.265  8.944   -23.540 1.00 34.06  ? 409  CYS B SG  1 
ATOM   7263 N N   . PRO B 2 410 ? 14.766  9.627   -28.476 1.00 29.57  ? 410  PRO B N   1 
ATOM   7264 C CA  . PRO B 2 410 ? 15.137  10.230  -29.761 1.00 31.04  ? 410  PRO B CA  1 
ATOM   7265 C C   . PRO B 2 410 ? 14.096  11.245  -30.264 1.00 35.70  ? 410  PRO B C   1 
ATOM   7266 O O   . PRO B 2 410 ? 14.525  12.266  -30.855 1.00 28.48  ? 410  PRO B O   1 
ATOM   7267 C CB  . PRO B 2 410 ? 15.223  9.037   -30.713 1.00 32.01  ? 410  PRO B CB  1 
ATOM   7268 C CG  . PRO B 2 410 ? 15.592  7.884   -29.813 1.00 28.82  ? 410  PRO B CG  1 
ATOM   7269 C CD  . PRO B 2 410 ? 14.901  8.147   -28.505 1.00 32.27  ? 410  PRO B CD  1 
ATOM   7270 N N   . VAL B 2 411 ? 12.788  11.005  -30.042 1.00 30.11  ? 411  VAL B N   1 
ATOM   7271 C CA  . VAL B 2 411 ? 11.775  11.992  -30.446 1.00 23.79  ? 411  VAL B CA  1 
ATOM   7272 C C   . VAL B 2 411 ? 11.938  13.303  -29.615 1.00 32.37  ? 411  VAL B C   1 
ATOM   7273 O O   . VAL B 2 411 ? 11.945  14.409  -30.161 1.00 33.43  ? 411  VAL B O   1 
ATOM   7274 C CB  . VAL B 2 411 ? 10.307  11.429  -30.377 1.00 28.29  ? 411  VAL B CB  1 
ATOM   7275 C CG1 . VAL B 2 411 ? 9.292   12.575  -30.254 1.00 27.83  ? 411  VAL B CG1 1 
ATOM   7276 C CG2 . VAL B 2 411 ? 10.004  10.573  -31.587 1.00 24.30  ? 411  VAL B CG2 1 
ATOM   7277 N N   . ALA B 2 412 ? 12.122  13.162  -28.305 1.00 30.48  ? 412  ALA B N   1 
ATOM   7278 C CA  . ALA B 2 412 ? 12.314  14.316  -27.414 1.00 35.19  ? 412  ALA B CA  1 
ATOM   7279 C C   . ALA B 2 412 ? 13.552  15.133  -27.811 1.00 30.77  ? 412  ALA B C   1 
ATOM   7280 O O   . ALA B 2 412 ? 13.518  16.370  -27.875 1.00 37.51  ? 412  ALA B O   1 
ATOM   7281 C CB  . ALA B 2 412 ? 12.396  13.859  -25.938 1.00 33.94  ? 412  ALA B CB  1 
ATOM   7282 N N   . GLN B 2 413 ? 14.626  14.441  -28.145 1.00 31.73  ? 413  GLN B N   1 
ATOM   7283 C CA  . GLN B 2 413 ? 15.825  15.109  -28.643 1.00 28.69  ? 413  GLN B CA  1 
ATOM   7284 C C   . GLN B 2 413 ? 15.597  15.830  -29.964 1.00 29.18  ? 413  GLN B C   1 
ATOM   7285 O O   . GLN B 2 413 ? 15.955  16.998  -30.114 1.00 34.40  ? 413  GLN B O   1 
ATOM   7286 C CB  . GLN B 2 413 ? 16.969  14.114  -28.790 1.00 35.71  ? 413  GLN B CB  1 
ATOM   7287 C CG  . GLN B 2 413 ? 18.210  14.678  -29.394 1.00 41.00  ? 413  GLN B CG  1 
ATOM   7288 C CD  . GLN B 2 413 ? 19.308  13.631  -29.459 1.00 55.19  ? 413  GLN B CD  1 
ATOM   7289 O OE1 . GLN B 2 413 ? 20.311  13.721  -28.744 1.00 62.15  ? 413  GLN B OE1 1 
ATOM   7290 N NE2 . GLN B 2 413 ? 19.107  12.609  -30.291 1.00 50.96  ? 413  GLN B NE2 1 
ATOM   7291 N N   . LEU B 2 414 ? 15.014  15.145  -30.936 1.00 29.34  ? 414  LEU B N   1 
ATOM   7292 C CA  . LEU B 2 414 ? 14.688  15.810  -32.189 1.00 30.28  ? 414  LEU B CA  1 
ATOM   7293 C C   . LEU B 2 414 ? 13.790  17.064  -31.993 1.00 33.57  ? 414  LEU B C   1 
ATOM   7294 O O   . LEU B 2 414 ? 14.063  18.135  -32.560 1.00 32.59  ? 414  LEU B O   1 
ATOM   7295 C CB  . LEU B 2 414 ? 14.046  14.821  -33.160 1.00 24.87  ? 414  LEU B CB  1 
ATOM   7296 C CG  . LEU B 2 414 ? 13.624  15.484  -34.472 1.00 30.72  ? 414  LEU B CG  1 
ATOM   7297 C CD1 . LEU B 2 414 ? 14.829  15.694  -35.419 1.00 27.36  ? 414  LEU B CD1 1 
ATOM   7298 C CD2 . LEU B 2 414 ? 12.549  14.629  -35.161 1.00 30.73  ? 414  LEU B CD2 1 
ATOM   7299 N N   . ALA B 2 415 ? 12.725  16.927  -31.194 1.00 32.15  ? 415  ALA B N   1 
ATOM   7300 C CA  . ALA B 2 415 ? 11.798  18.030  -30.941 1.00 31.70  ? 415  ALA B CA  1 
ATOM   7301 C C   . ALA B 2 415 ? 12.512  19.259  -30.376 1.00 34.59  ? 415  ALA B C   1 
ATOM   7302 O O   . ALA B 2 415 ? 12.307  20.383  -30.835 1.00 41.64  ? 415  ALA B O   1 
ATOM   7303 C CB  . ALA B 2 415 ? 10.692  17.590  -29.993 1.00 32.20  ? 415  ALA B CB  1 
ATOM   7304 N N   . GLY B 2 416 ? 13.331  19.047  -29.358 1.00 32.86  ? 416  GLY B N   1 
ATOM   7305 C CA  . GLY B 2 416 ? 14.020  20.155  -28.735 1.00 29.72  ? 416  GLY B CA  1 
ATOM   7306 C C   . GLY B 2 416 ? 15.036  20.778  -29.676 1.00 37.50  ? 416  GLY B C   1 
ATOM   7307 O O   . GLY B 2 416 ? 15.168  21.998  -29.709 1.00 36.23  ? 416  GLY B O   1 
ATOM   7308 N N   . ARG B 2 417 ? 15.760  19.957  -30.441 1.00 34.22  ? 417  ARG B N   1 
ATOM   7309 C CA  . ARG B 2 417 ? 16.718  20.501  -31.403 1.00 36.11  ? 417  ARG B CA  1 
ATOM   7310 C C   . ARG B 2 417 ? 16.025  21.276  -32.534 1.00 39.22  ? 417  ARG B C   1 
ATOM   7311 O O   . ARG B 2 417 ? 16.451  22.376  -32.874 1.00 41.51  ? 417  ARG B O   1 
ATOM   7312 C CB  . ARG B 2 417 ? 17.656  19.425  -31.970 1.00 36.71  ? 417  ARG B CB  1 
ATOM   7313 C CG  . ARG B 2 417 ? 18.523  18.751  -30.934 1.00 41.65  ? 417  ARG B CG  1 
ATOM   7314 C CD  . ARG B 2 417 ? 19.776  19.526  -30.628 1.00 60.69  ? 417  ARG B CD  1 
ATOM   7315 N NE  . ARG B 2 417 ? 19.528  20.698  -29.787 1.00 80.27  ? 417  ARG B NE  1 
ATOM   7316 C CZ  . ARG B 2 417 ? 20.258  21.817  -29.818 1.00 86.30  ? 417  ARG B CZ  1 
ATOM   7317 N NH1 . ARG B 2 417 ? 21.276  21.929  -30.672 1.00 85.14  ? 417  ARG B NH1 1 
ATOM   7318 N NH2 . ARG B 2 417 ? 19.955  22.831  -29.009 1.00 85.18  ? 417  ARG B NH2 1 
ATOM   7319 N N   . LEU B 2 418 ? 14.965  20.715  -33.111 1.00 35.03  ? 418  LEU B N   1 
ATOM   7320 C CA  . LEU B 2 418 ? 14.187  21.445  -34.114 1.00 39.88  ? 418  LEU B CA  1 
ATOM   7321 C C   . LEU B 2 418 ? 13.635  22.764  -33.553 1.00 38.58  ? 418  LEU B C   1 
ATOM   7322 O O   . LEU B 2 418 ? 13.691  23.802  -34.226 1.00 44.22  ? 418  LEU B O   1 
ATOM   7323 C CB  . LEU B 2 418 ? 13.046  20.576  -34.647 1.00 41.57  ? 418  LEU B CB  1 
ATOM   7324 C CG  . LEU B 2 418 ? 13.479  19.339  -35.427 1.00 38.21  ? 418  LEU B CG  1 
ATOM   7325 C CD1 . LEU B 2 418 ? 12.286  18.606  -35.975 1.00 41.09  ? 418  LEU B CD1 1 
ATOM   7326 C CD2 . LEU B 2 418 ? 14.400  19.747  -36.537 1.00 44.27  ? 418  LEU B CD2 1 
ATOM   7327 N N   . ALA B 2 419 ? 13.144  22.742  -32.312 1.00 32.04  ? 419  ALA B N   1 
ATOM   7328 C CA  . ALA B 2 419 ? 12.597  23.962  -31.720 1.00 37.58  ? 419  ALA B CA  1 
ATOM   7329 C C   . ALA B 2 419 ? 13.653  25.043  -31.487 1.00 43.72  ? 419  ALA B C   1 
ATOM   7330 O O   . ALA B 2 419 ? 13.399  26.219  -31.755 1.00 45.58  ? 419  ALA B O   1 
ATOM   7331 C CB  . ALA B 2 419 ? 11.824  23.667  -30.432 1.00 37.03  ? 419  ALA B CB  1 
ATOM   7332 N N   . ALA B 2 420 ? 14.827  24.648  -30.993 1.00 42.93  ? 420  ALA B N   1 
ATOM   7333 C CA  . ALA B 2 420 ? 15.917  25.589  -30.686 1.00 44.01  ? 420  ALA B CA  1 
ATOM   7334 C C   . ALA B 2 420 ? 16.509  26.209  -31.954 1.00 51.62  ? 420  ALA B C   1 
ATOM   7335 O O   . ALA B 2 420 ? 16.988  27.342  -31.931 1.00 54.74  ? 420  ALA B O   1 
ATOM   7336 C CB  . ALA B 2 420 ? 17.017  24.894  -29.898 1.00 38.18  ? 420  ALA B CB  1 
ATOM   7337 N N   . GLN B 2 421 ? 16.484  25.459  -33.051 1.00 46.93  ? 421  GLN B N   1 
ATOM   7338 C CA  . GLN B 2 421 ? 16.988  25.937  -34.320 1.00 42.35  ? 421  GLN B CA  1 
ATOM   7339 C C   . GLN B 2 421 ? 15.913  26.557  -35.219 1.00 42.22  ? 421  GLN B C   1 
ATOM   7340 O O   . GLN B 2 421 ? 16.029  26.500  -36.452 1.00 41.25  ? 421  GLN B O   1 
ATOM   7341 C CB  . GLN B 2 421 ? 17.659  24.790  -35.073 1.00 49.39  ? 421  GLN B CB  1 
ATOM   7342 C CG  . GLN B 2 421 ? 19.172  24.748  -34.948 1.00 65.11  ? 421  GLN B CG  1 
ATOM   7343 C CD  . GLN B 2 421 ? 19.644  24.018  -33.719 1.00 73.24  ? 421  GLN B CD  1 
ATOM   7344 O OE1 . GLN B 2 421 ? 20.140  24.630  -32.771 1.00 82.72  ? 421  GLN B OE1 1 
ATOM   7345 N NE2 . GLN B 2 421 ? 19.495  22.703  -33.720 1.00 68.70  ? 421  GLN B NE2 1 
ATOM   7346 N N   . GLY B 2 422 ? 14.862  27.126  -34.631 1.00 41.28  ? 422  GLY B N   1 
ATOM   7347 C CA  . GLY B 2 422 ? 13.872  27.850  -35.419 1.00 38.01  ? 422  GLY B CA  1 
ATOM   7348 C C   . GLY B 2 422 ? 12.625  27.148  -35.964 1.00 49.47  ? 422  GLY B C   1 
ATOM   7349 O O   . GLY B 2 422 ? 11.754  27.811  -36.538 1.00 50.87  ? 422  GLY B O   1 
ATOM   7350 N N   . ALA B 2 423 ? 12.514  25.826  -35.821 1.00 46.29  ? 423  ALA B N   1 
ATOM   7351 C CA  . ALA B 2 423 ? 11.327  25.128  -36.324 1.00 36.36  ? 423  ALA B CA  1 
ATOM   7352 C C   . ALA B 2 423 ? 10.080  25.374  -35.465 1.00 38.91  ? 423  ALA B C   1 
ATOM   7353 O O   . ALA B 2 423 ? 10.168  25.510  -34.251 1.00 43.25  ? 423  ALA B O   1 
ATOM   7354 C CB  . ALA B 2 423 ? 11.588  23.635  -36.414 1.00 33.37  ? 423  ALA B CB  1 
ATOM   7355 N N   . ARG B 2 424 ? 8.910   25.383  -36.087 1.00 31.04  ? 424  ARG B N   1 
ATOM   7356 C CA  . ARG B 2 424 ? 7.678   25.330  -35.319 1.00 35.41  ? 424  ARG B CA  1 
ATOM   7357 C C   . ARG B 2 424 ? 7.324   23.856  -35.065 1.00 35.82  ? 424  ARG B C   1 
ATOM   7358 O O   . ARG B 2 424 ? 7.151   23.082  -36.001 1.00 35.42  ? 424  ARG B O   1 
ATOM   7359 C CB  . ARG B 2 424 ? 6.562   26.027  -36.088 1.00 42.49  ? 424  ARG B CB  1 
ATOM   7360 C CG  . ARG B 2 424 ? 5.184   25.942  -35.456 1.00 56.02  ? 424  ARG B CG  1 
ATOM   7361 C CD  . ARG B 2 424 ? 4.128   26.627  -36.375 1.00 74.31  ? 424  ARG B CD  1 
ATOM   7362 N NE  . ARG B 2 424 ? 3.223   27.508  -35.632 1.00 69.85  ? 424  ARG B NE  1 
ATOM   7363 C CZ  . ARG B 2 424 ? 3.580   28.309  -34.624 1.00 54.95  ? 424  ARG B CZ  1 
ATOM   7364 N NH1 . ARG B 2 424 ? 4.850   28.408  -34.224 1.00 52.59  ? 424  ARG B NH1 1 
ATOM   7365 N NH2 . ARG B 2 424 ? 2.651   29.028  -34.030 1.00 43.27  ? 424  ARG B NH2 1 
ATOM   7366 N N   . VAL B 2 425 ? 7.212   23.465  -33.805 1.00 34.54  ? 425  VAL B N   1 
ATOM   7367 C CA  . VAL B 2 425 ? 7.069   22.043  -33.482 1.00 32.31  ? 425  VAL B CA  1 
ATOM   7368 C C   . VAL B 2 425 ? 5.809   21.768  -32.661 1.00 32.01  ? 425  VAL B C   1 
ATOM   7369 O O   . VAL B 2 425 ? 5.487   22.540  -31.779 1.00 34.59  ? 425  VAL B O   1 
ATOM   7370 C CB  . VAL B 2 425 ? 8.290   21.531  -32.667 1.00 29.92  ? 425  VAL B CB  1 
ATOM   7371 C CG1 . VAL B 2 425 ? 8.178   20.009  -32.394 1.00 31.83  ? 425  VAL B CG1 1 
ATOM   7372 C CG2 . VAL B 2 425 ? 9.589   21.861  -33.407 1.00 30.53  ? 425  VAL B CG2 1 
ATOM   7373 N N   . TYR B 2 426 ? 5.111   20.671  -32.961 1.00 29.18  ? 426  TYR B N   1 
ATOM   7374 C CA  . TYR B 2 426 ? 3.995   20.193  -32.134 1.00 31.01  ? 426  TYR B CA  1 
ATOM   7375 C C   . TYR B 2 426 ? 4.243   18.720  -31.796 1.00 31.01  ? 426  TYR B C   1 
ATOM   7376 O O   . TYR B 2 426 ? 4.633   17.946  -32.658 1.00 32.66  ? 426  TYR B O   1 
ATOM   7377 C CB  . TYR B 2 426 ? 2.651   20.339  -32.858 1.00 29.74  ? 426  TYR B CB  1 
ATOM   7378 C CG  . TYR B 2 426 ? 2.259   21.775  -33.159 1.00 32.72  ? 426  TYR B CG  1 
ATOM   7379 C CD1 . TYR B 2 426 ? 2.616   22.360  -34.360 1.00 27.41  ? 426  TYR B CD1 1 
ATOM   7380 C CD2 . TYR B 2 426 ? 1.518   22.539  -32.240 1.00 25.96  ? 426  TYR B CD2 1 
ATOM   7381 C CE1 . TYR B 2 426 ? 2.279   23.673  -34.644 1.00 30.13  ? 426  TYR B CE1 1 
ATOM   7382 C CE2 . TYR B 2 426 ? 1.183   23.848  -32.513 1.00 28.60  ? 426  TYR B CE2 1 
ATOM   7383 C CZ  . TYR B 2 426 ? 1.574   24.407  -33.720 1.00 31.57  ? 426  TYR B CZ  1 
ATOM   7384 O OH  . TYR B 2 426 ? 1.252   25.693  -34.020 1.00 33.89  ? 426  TYR B OH  1 
ATOM   7385 N N   . ALA B 2 427 ? 4.030   18.346  -30.546 1.00 31.13  ? 427  ALA B N   1 
ATOM   7386 C CA  . ALA B 2 427 ? 4.357   17.014  -30.085 1.00 32.89  ? 427  ALA B CA  1 
ATOM   7387 C C   . ALA B 2 427 ? 3.156   16.420  -29.359 1.00 34.40  ? 427  ALA B C   1 
ATOM   7388 O O   . ALA B 2 427 ? 2.357   17.148  -28.731 1.00 29.30  ? 427  ALA B O   1 
ATOM   7389 C CB  . ALA B 2 427 ? 5.562   17.064  -29.147 1.00 29.38  ? 427  ALA B CB  1 
ATOM   7390 N N   . TYR B 2 428 ? 3.042   15.100  -29.423 1.00 25.67  ? 428  TYR B N   1 
ATOM   7391 C CA  . TYR B 2 428 ? 1.905   14.417  -28.804 1.00 30.27  ? 428  TYR B CA  1 
ATOM   7392 C C   . TYR B 2 428 ? 2.359   13.076  -28.226 1.00 36.02  ? 428  TYR B C   1 
ATOM   7393 O O   . TYR B 2 428 ? 3.413   12.539  -28.607 1.00 32.65  ? 428  TYR B O   1 
ATOM   7394 C CB  . TYR B 2 428 ? 0.765   14.174  -29.830 1.00 27.58  ? 428  TYR B CB  1 
ATOM   7395 C CG  . TYR B 2 428 ? 1.170   13.161  -30.910 1.00 34.35  ? 428  TYR B CG  1 
ATOM   7396 C CD1 . TYR B 2 428 ? 1.095   11.781  -30.685 1.00 30.40  ? 428  TYR B CD1 1 
ATOM   7397 C CD2 . TYR B 2 428 ? 1.688   13.598  -32.128 1.00 30.82  ? 428  TYR B CD2 1 
ATOM   7398 C CE1 . TYR B 2 428 ? 1.532   10.880  -31.663 1.00 31.01  ? 428  TYR B CE1 1 
ATOM   7399 C CE2 . TYR B 2 428 ? 2.105   12.735  -33.089 1.00 30.25  ? 428  TYR B CE2 1 
ATOM   7400 C CZ  . TYR B 2 428 ? 2.023   11.372  -32.872 1.00 33.29  ? 428  TYR B CZ  1 
ATOM   7401 O OH  . TYR B 2 428 ? 2.489   10.537  -33.874 1.00 30.24  ? 428  TYR B OH  1 
ATOM   7402 N N   . ILE B 2 429 ? 1.565   12.547  -27.298 1.00 35.24  ? 429  ILE B N   1 
ATOM   7403 C CA  . ILE B 2 429 ? 1.625   11.130  -26.960 1.00 35.88  ? 429  ILE B CA  1 
ATOM   7404 C C   . ILE B 2 429 ? 0.223   10.571  -27.175 1.00 35.09  ? 429  ILE B C   1 
ATOM   7405 O O   . ILE B 2 429 ? -0.768  11.173  -26.760 1.00 36.03  ? 429  ILE B O   1 
ATOM   7406 C CB  . ILE B 2 429 ? 2.086   10.890  -25.521 1.00 41.57  ? 429  ILE B CB  1 
ATOM   7407 C CG1 . ILE B 2 429 ? 2.188   9.390   -25.240 1.00 41.93  ? 429  ILE B CG1 1 
ATOM   7408 C CG2 . ILE B 2 429 ? 1.137   11.547  -24.523 1.00 45.30  ? 429  ILE B CG2 1 
ATOM   7409 C CD1 . ILE B 2 429 ? 2.726   9.089   -23.836 1.00 41.50  ? 429  ILE B CD1 1 
ATOM   7410 N N   . PHE B 2 430 ? 0.140   9.444   -27.871 1.00 33.85  ? 430  PHE B N   1 
ATOM   7411 C CA  . PHE B 2 430 ? -1.143  8.847   -28.233 1.00 33.08  ? 430  PHE B CA  1 
ATOM   7412 C C   . PHE B 2 430 ? -1.426  7.694   -27.253 1.00 35.33  ? 430  PHE B C   1 
ATOM   7413 O O   . PHE B 2 430 ? -0.599  6.793   -27.090 1.00 37.58  ? 430  PHE B O   1 
ATOM   7414 C CB  . PHE B 2 430 ? -1.033  8.365   -29.664 1.00 30.74  ? 430  PHE B CB  1 
ATOM   7415 C CG  . PHE B 2 430 ? -2.257  7.681   -30.188 1.00 32.73  ? 430  PHE B CG  1 
ATOM   7416 C CD1 . PHE B 2 430 ? -2.491  6.342   -29.904 1.00 37.01  ? 430  PHE B CD1 1 
ATOM   7417 C CD2 . PHE B 2 430 ? -3.140  8.355   -31.017 1.00 31.79  ? 430  PHE B CD2 1 
ATOM   7418 C CE1 . PHE B 2 430 ? -3.619  5.688   -30.424 1.00 40.81  ? 430  PHE B CE1 1 
ATOM   7419 C CE2 . PHE B 2 430 ? -4.265  7.709   -31.539 1.00 41.25  ? 430  PHE B CE2 1 
ATOM   7420 C CZ  . PHE B 2 430 ? -4.506  6.373   -31.236 1.00 35.64  ? 430  PHE B CZ  1 
ATOM   7421 N N   . GLU B 2 431 ? -2.563  7.740   -26.570 1.00 32.06  ? 431  GLU B N   1 
ATOM   7422 C CA  . GLU B 2 431 ? -2.759  6.887   -25.402 1.00 38.21  ? 431  GLU B CA  1 
ATOM   7423 C C   . GLU B 2 431 ? -4.001  6.047   -25.504 1.00 42.42  ? 431  GLU B C   1 
ATOM   7424 O O   . GLU B 2 431 ? -4.400  5.406   -24.540 1.00 46.83  ? 431  GLU B O   1 
ATOM   7425 C CB  . GLU B 2 431 ? -2.851  7.696   -24.096 1.00 36.26  ? 431  GLU B CB  1 
ATOM   7426 C CG  . GLU B 2 431 ? -1.607  8.460   -23.747 1.00 34.07  ? 431  GLU B CG  1 
ATOM   7427 C CD  . GLU B 2 431 ? -1.698  9.197   -22.429 1.00 39.05  ? 431  GLU B CD  1 
ATOM   7428 O OE1 . GLU B 2 431 ? -2.745  9.816   -22.143 1.00 47.53  ? 431  GLU B OE1 1 
ATOM   7429 O OE2 . GLU B 2 431 ? -0.711  9.149   -21.665 1.00 45.93  ? 431  GLU B OE2 1 
ATOM   7430 N N   . HIS B 2 432 ? -4.643  6.054   -26.655 1.00 42.53  ? 432  HIS B N   1 
ATOM   7431 C CA  . HIS B 2 432 ? -5.848  5.249   -26.756 1.00 39.82  ? 432  HIS B CA  1 
ATOM   7432 C C   . HIS B 2 432 ? -5.561  3.852   -27.309 1.00 40.31  ? 432  HIS B C   1 
ATOM   7433 O O   . HIS B 2 432 ? -4.993  3.724   -28.396 1.00 37.17  ? 432  HIS B O   1 
ATOM   7434 C CB  . HIS B 2 432 ? -6.872  5.920   -27.635 1.00 33.89  ? 432  HIS B CB  1 
ATOM   7435 C CG  . HIS B 2 432 ? -8.082  5.081   -27.839 1.00 43.62  ? 432  HIS B CG  1 
ATOM   7436 N ND1 . HIS B 2 432 ? -8.952  4.785   -26.814 1.00 49.78  ? 432  HIS B ND1 1 
ATOM   7437 C CD2 . HIS B 2 432 ? -8.543  4.428   -28.934 1.00 43.71  ? 432  HIS B CD2 1 
ATOM   7438 C CE1 . HIS B 2 432 ? -9.921  4.011   -27.279 1.00 54.62  ? 432  HIS B CE1 1 
ATOM   7439 N NE2 . HIS B 2 432 ? -9.695  3.782   -28.561 1.00 51.30  ? 432  HIS B NE2 1 
ATOM   7440 N N   . ARG B 2 433 ? -5.972  2.823   -26.565 1.00 44.78  ? 433  ARG B N   1 
ATOM   7441 C CA  . ARG B 2 433 ? -5.913  1.419   -27.023 1.00 50.27  ? 433  ARG B CA  1 
ATOM   7442 C C   . ARG B 2 433 ? -7.154  0.998   -27.820 1.00 50.86  ? 433  ARG B C   1 
ATOM   7443 O O   . ARG B 2 433 ? -8.259  0.972   -27.285 1.00 50.75  ? 433  ARG B O   1 
ATOM   7444 C CB  . ARG B 2 433 ? -5.766  0.472   -25.833 1.00 51.55  ? 433  ARG B CB  1 
ATOM   7445 C CG  . ARG B 2 433 ? -5.507  -0.970  -26.244 1.00 55.96  ? 433  ARG B CG  1 
ATOM   7446 C CD  . ARG B 2 433 ? -5.433  -1.875  -25.028 1.00 56.44  ? 433  ARG B CD  1 
ATOM   7447 N NE  . ARG B 2 433 ? -5.755  -3.270  -25.346 1.00 52.47  ? 433  ARG B NE  1 
ATOM   7448 C CZ  . ARG B 2 433 ? -4.848  -4.215  -25.570 1.00 53.15  ? 433  ARG B CZ  1 
ATOM   7449 N NH1 . ARG B 2 433 ? -3.546  -3.915  -25.510 1.00 42.52  ? 433  ARG B NH1 1 
ATOM   7450 N NH2 . ARG B 2 433 ? -5.241  -5.469  -25.841 1.00 52.85  ? 433  ARG B NH2 1 
ATOM   7451 N N   . ALA B 2 434 ? -6.964  0.670   -29.095 1.00 47.46  ? 434  ALA B N   1 
ATOM   7452 C CA  . ALA B 2 434 ? -8.078  0.288   -29.970 1.00 47.44  ? 434  ALA B CA  1 
ATOM   7453 C C   . ALA B 2 434 ? -8.898  -0.809  -29.335 1.00 51.69  ? 434  ALA B C   1 
ATOM   7454 O O   . ALA B 2 434 ? -8.356  -1.811  -28.866 1.00 49.59  ? 434  ALA B O   1 
ATOM   7455 C CB  . ALA B 2 434 ? -7.550  -0.185  -31.339 1.00 43.80  ? 434  ALA B CB  1 
ATOM   7456 N N   . SER B 2 435 ? -10.210 -0.624  -29.340 1.00 55.26  ? 435  SER B N   1 
ATOM   7457 C CA  . SER B 2 435 ? -11.115 -1.600  -28.781 1.00 53.63  ? 435  SER B CA  1 
ATOM   7458 C C   . SER B 2 435 ? -10.947 -2.942  -29.516 1.00 54.61  ? 435  SER B C   1 
ATOM   7459 O O   . SER B 2 435 ? -11.176 -3.995  -28.937 1.00 56.07  ? 435  SER B O   1 
ATOM   7460 C CB  . SER B 2 435 ? -12.560 -1.094  -28.868 1.00 53.08  ? 435  SER B CB  1 
ATOM   7461 O OG  . SER B 2 435 ? -13.007 -1.046  -30.221 1.00 57.04  ? 435  SER B OG  1 
ATOM   7462 N N   . THR B 2 436 ? -10.515 -2.893  -30.775 1.00 51.80  ? 436  THR B N   1 
ATOM   7463 C CA  . THR B 2 436 ? -10.383 -4.097  -31.599 1.00 51.55  ? 436  THR B CA  1 
ATOM   7464 C C   . THR B 2 436 ? -9.001  -4.764  -31.599 1.00 53.18  ? 436  THR B C   1 
ATOM   7465 O O   . THR B 2 436 ? -8.783  -5.719  -32.350 1.00 56.49  ? 436  THR B O   1 
ATOM   7466 C CB  . THR B 2 436 ? -10.763 -3.812  -33.068 1.00 49.17  ? 436  THR B CB  1 
ATOM   7467 O OG1 . THR B 2 436 ? -9.903  -2.795  -33.584 1.00 55.96  ? 436  THR B OG1 1 
ATOM   7468 C CG2 . THR B 2 436 ? -12.199 -3.338  -33.166 1.00 52.83  ? 436  THR B CG2 1 
ATOM   7469 N N   . LEU B 2 437 ? -8.080  -4.281  -30.765 1.00 52.07  ? 437  LEU B N   1 
ATOM   7470 C CA  . LEU B 2 437 ? -6.700  -4.773  -30.751 1.00 51.28  ? 437  LEU B CA  1 
ATOM   7471 C C   . LEU B 2 437 ? -6.591  -6.265  -30.404 1.00 55.49  ? 437  LEU B C   1 
ATOM   7472 O O   . LEU B 2 437 ? -7.197  -6.733  -29.439 1.00 53.03  ? 437  LEU B O   1 
ATOM   7473 C CB  . LEU B 2 437 ? -5.873  -3.957  -29.750 1.00 61.45  ? 437  LEU B CB  1 
ATOM   7474 C CG  . LEU B 2 437 ? -4.354  -3.869  -29.949 1.00 72.07  ? 437  LEU B CG  1 
ATOM   7475 C CD1 . LEU B 2 437 ? -4.035  -2.923  -31.080 1.00 70.87  ? 437  LEU B CD1 1 
ATOM   7476 C CD2 . LEU B 2 437 ? -3.636  -3.413  -28.674 1.00 74.98  ? 437  LEU B CD2 1 
ATOM   7477 N N   . THR B 2 438 ? -5.792  -7.007  -31.167 1.00 53.23  ? 438  THR B N   1 
ATOM   7478 C CA  . THR B 2 438 ? -5.683  -8.448  -30.932 1.00 62.80  ? 438  THR B CA  1 
ATOM   7479 C C   . THR B 2 438 ? -4.510  -8.862  -30.040 1.00 64.18  ? 438  THR B C   1 
ATOM   7480 O O   . THR B 2 438 ? -4.459  -10.008 -29.588 1.00 65.18  ? 438  THR B O   1 
ATOM   7481 C CB  . THR B 2 438 ? -5.660  -9.244  -32.253 1.00 64.47  ? 438  THR B CB  1 
ATOM   7482 O OG1 . THR B 2 438 ? -4.582  -8.773  -33.079 1.00 65.66  ? 438  THR B OG1 1 
ATOM   7483 C CG2 . THR B 2 438 ? -6.996  -9.061  -32.991 1.00 54.38  ? 438  THR B CG2 1 
ATOM   7484 N N   . TRP B 2 439 ? -3.573  -7.939  -29.800 1.00 55.02  ? 439  TRP B N   1 
ATOM   7485 C CA  . TRP B 2 439 ? -2.504  -8.149  -28.824 1.00 47.50  ? 439  TRP B CA  1 
ATOM   7486 C C   . TRP B 2 439 ? -3.068  -8.090  -27.409 1.00 52.87  ? 439  TRP B C   1 
ATOM   7487 O O   . TRP B 2 439 ? -4.107  -7.460  -27.180 1.00 58.54  ? 439  TRP B O   1 
ATOM   7488 C CB  . TRP B 2 439 ? -1.397  -7.095  -28.982 1.00 45.24  ? 439  TRP B CB  1 
ATOM   7489 C CG  . TRP B 2 439 ? -0.754  -7.079  -30.330 1.00 40.50  ? 439  TRP B CG  1 
ATOM   7490 C CD1 . TRP B 2 439 ? -1.085  -6.266  -31.383 1.00 42.96  ? 439  TRP B CD1 1 
ATOM   7491 C CD2 . TRP B 2 439 ? 0.318   -7.922  -30.790 1.00 38.86  ? 439  TRP B CD2 1 
ATOM   7492 N NE1 . TRP B 2 439 ? -0.277  -6.550  -32.466 1.00 46.39  ? 439  TRP B NE1 1 
ATOM   7493 C CE2 . TRP B 2 439 ? 0.596   -7.557  -32.123 1.00 44.07  ? 439  TRP B CE2 1 
ATOM   7494 C CE3 . TRP B 2 439 ? 1.078   -8.939  -30.199 1.00 48.70  ? 439  TRP B CE3 1 
ATOM   7495 C CZ2 . TRP B 2 439 ? 1.608   -8.176  -32.884 1.00 50.07  ? 439  TRP B CZ2 1 
ATOM   7496 C CZ3 . TRP B 2 439 ? 2.088   -9.554  -30.951 1.00 51.00  ? 439  TRP B CZ3 1 
ATOM   7497 C CH2 . TRP B 2 439 ? 2.345   -9.162  -32.280 1.00 51.93  ? 439  TRP B CH2 1 
ATOM   7498 N N   . PRO B 2 440 ? -2.386  -8.740  -26.449 1.00 50.88  ? 440  PRO B N   1 
ATOM   7499 C CA  . PRO B 2 440 ? -2.818  -8.777  -25.039 1.00 48.92  ? 440  PRO B CA  1 
ATOM   7500 C C   . PRO B 2 440 ? -2.722  -7.413  -24.357 1.00 51.59  ? 440  PRO B C   1 
ATOM   7501 O O   . PRO B 2 440 ? -1.979  -6.537  -24.827 1.00 54.34  ? 440  PRO B O   1 
ATOM   7502 C CB  . PRO B 2 440 ? -1.820  -9.751  -24.393 1.00 47.30  ? 440  PRO B CB  1 
ATOM   7503 C CG  . PRO B 2 440 ? -0.613  -9.661  -25.272 1.00 50.34  ? 440  PRO B CG  1 
ATOM   7504 C CD  . PRO B 2 440 ? -1.163  -9.532  -26.668 1.00 46.68  ? 440  PRO B CD  1 
ATOM   7505 N N   . LEU B 2 441 ? -3.440  -7.252  -23.248 1.00 47.38  ? 441  LEU B N   1 
ATOM   7506 C CA  . LEU B 2 441 ? -3.495  -5.993  -22.531 1.00 53.27  ? 441  LEU B CA  1 
ATOM   7507 C C   . LEU B 2 441 ? -2.137  -5.486  -22.016 1.00 55.23  ? 441  LEU B C   1 
ATOM   7508 O O   . LEU B 2 441 ? -1.911  -4.266  -21.924 1.00 55.43  ? 441  LEU B O   1 
ATOM   7509 C CB  . LEU B 2 441 ? -4.480  -6.090  -21.362 1.00 60.46  ? 441  LEU B CB  1 
ATOM   7510 C CG  . LEU B 2 441 ? -5.957  -6.171  -21.762 1.00 74.15  ? 441  LEU B CG  1 
ATOM   7511 C CD1 . LEU B 2 441 ? -6.858  -6.788  -20.651 1.00 71.30  ? 441  LEU B CD1 1 
ATOM   7512 C CD2 . LEU B 2 441 ? -6.458  -4.785  -22.211 1.00 73.51  ? 441  LEU B CD2 1 
ATOM   7513 N N   . TRP B 2 442 ? -1.241  -6.400  -21.652 1.00 52.13  ? 442  TRP B N   1 
ATOM   7514 C CA  . TRP B 2 442 ? -0.011  -5.964  -20.988 1.00 52.02  ? 442  TRP B CA  1 
ATOM   7515 C C   . TRP B 2 442 ? 0.845   -5.133  -21.961 1.00 51.04  ? 442  TRP B C   1 
ATOM   7516 O O   . TRP B 2 442 ? 1.694   -4.366  -21.538 1.00 52.33  ? 442  TRP B O   1 
ATOM   7517 C CB  . TRP B 2 442 ? 0.775   -7.136  -20.375 1.00 45.92  ? 442  TRP B CB  1 
ATOM   7518 C CG  . TRP B 2 442 ? 1.478   -8.023  -21.377 1.00 46.93  ? 442  TRP B CG  1 
ATOM   7519 C CD1 . TRP B 2 442 ? 1.089   -9.274  -21.782 1.00 51.54  ? 442  TRP B CD1 1 
ATOM   7520 C CD2 . TRP B 2 442 ? 2.684   -7.728  -22.102 1.00 48.35  ? 442  TRP B CD2 1 
ATOM   7521 N NE1 . TRP B 2 442 ? 1.969   -9.764  -22.720 1.00 48.04  ? 442  TRP B NE1 1 
ATOM   7522 C CE2 . TRP B 2 442 ? 2.955   -8.837  -22.933 1.00 46.86  ? 442  TRP B CE2 1 
ATOM   7523 C CE3 . TRP B 2 442 ? 3.562   -6.633  -22.125 1.00 50.39  ? 442  TRP B CE3 1 
ATOM   7524 C CZ2 . TRP B 2 442 ? 4.066   -8.893  -23.770 1.00 47.53  ? 442  TRP B CZ2 1 
ATOM   7525 C CZ3 . TRP B 2 442 ? 4.664   -6.691  -22.956 1.00 51.61  ? 442  TRP B CZ3 1 
ATOM   7526 C CH2 . TRP B 2 442 ? 4.904   -7.822  -23.776 1.00 51.62  ? 442  TRP B CH2 1 
ATOM   7527 N N   . MET B 2 443 ? 0.602   -5.283  -23.262 1.00 48.08  ? 443  MET B N   1 
ATOM   7528 C CA  . MET B 2 443 ? 1.327   -4.507  -24.256 1.00 43.82  ? 443  MET B CA  1 
ATOM   7529 C C   . MET B 2 443 ? 0.796   -3.071  -24.378 1.00 44.65  ? 443  MET B C   1 
ATOM   7530 O O   . MET B 2 443 ? 1.411   -2.253  -25.052 1.00 40.96  ? 443  MET B O   1 
ATOM   7531 C CB  . MET B 2 443 ? 1.324   -5.192  -25.623 1.00 38.57  ? 443  MET B CB  1 
ATOM   7532 C CG  . MET B 2 443 ? 1.879   -6.589  -25.581 1.00 46.44  ? 443  MET B CG  1 
ATOM   7533 S SD  . MET B 2 443 ? 1.916   -7.373  -27.198 1.00 51.90  ? 443  MET B SD  1 
ATOM   7534 C CE  . MET B 2 443 ? 3.119   -6.402  -28.071 1.00 58.13  ? 443  MET B CE  1 
ATOM   7535 N N   . GLY B 2 444 ? -0.339  -2.781  -23.742 1.00 42.00  ? 444  GLY B N   1 
ATOM   7536 C CA  . GLY B 2 444 ? -0.861  -1.418  -23.678 1.00 40.23  ? 444  GLY B CA  1 
ATOM   7537 C C   . GLY B 2 444 ? -1.288  -0.826  -25.020 1.00 44.47  ? 444  GLY B C   1 
ATOM   7538 O O   . GLY B 2 444 ? -2.080  -1.420  -25.758 1.00 42.43  ? 444  GLY B O   1 
ATOM   7539 N N   . VAL B 2 445 ? -0.773  0.357   -25.341 1.00 39.10  ? 445  VAL B N   1 
ATOM   7540 C CA  . VAL B 2 445 ? -1.000  0.931   -26.660 1.00 41.73  ? 445  VAL B CA  1 
ATOM   7541 C C   . VAL B 2 445 ? 0.265   0.736   -27.470 1.00 39.89  ? 445  VAL B C   1 
ATOM   7542 O O   . VAL B 2 445 ? 1.176   1.551   -27.366 1.00 43.34  ? 445  VAL B O   1 
ATOM   7543 C CB  . VAL B 2 445 ? -1.245  2.455   -26.600 1.00 37.32  ? 445  VAL B CB  1 
ATOM   7544 C CG1 . VAL B 2 445 ? -1.570  2.966   -27.980 1.00 36.70  ? 445  VAL B CG1 1 
ATOM   7545 C CG2 . VAL B 2 445 ? -2.325  2.813   -25.579 1.00 35.09  ? 445  VAL B CG2 1 
ATOM   7546 N N   . PRO B 2 446 ? 0.329   -0.325  -28.291 1.00 34.66  ? 446  PRO B N   1 
ATOM   7547 C CA  . PRO B 2 446 ? 1.629   -0.657  -28.894 1.00 35.98  ? 446  PRO B CA  1 
ATOM   7548 C C   . PRO B 2 446 ? 1.945   0.143   -30.139 1.00 37.22  ? 446  PRO B C   1 
ATOM   7549 O O   . PRO B 2 446 ? 1.064   0.675   -30.812 1.00 33.54  ? 446  PRO B O   1 
ATOM   7550 C CB  . PRO B 2 446 ? 1.491   -2.154  -29.283 1.00 29.04  ? 446  PRO B CB  1 
ATOM   7551 C CG  . PRO B 2 446 ? 0.087   -2.606  -28.718 1.00 33.87  ? 446  PRO B CG  1 
ATOM   7552 C CD  . PRO B 2 446 ? -0.704  -1.316  -28.632 1.00 30.75  ? 446  PRO B CD  1 
ATOM   7553 N N   . HIS B 2 447 ? 3.235   0.178   -30.439 1.00 32.35  ? 447  HIS B N   1 
ATOM   7554 C CA  . HIS B 2 447 ? 3.785   0.722   -31.677 1.00 35.72  ? 447  HIS B CA  1 
ATOM   7555 C C   . HIS B 2 447 ? 2.920   0.448   -32.922 1.00 39.29  ? 447  HIS B C   1 
ATOM   7556 O O   . HIS B 2 447 ? 2.499   -0.680  -33.153 1.00 41.39  ? 447  HIS B O   1 
ATOM   7557 C CB  . HIS B 2 447 ? 5.176   0.103   -31.837 1.00 31.17  ? 447  HIS B CB  1 
ATOM   7558 C CG  . HIS B 2 447 ? 5.950   0.630   -32.986 1.00 39.45  ? 447  HIS B CG  1 
ATOM   7559 N ND1 . HIS B 2 447 ? 6.653   1.822   -32.926 1.00 40.24  ? 447  HIS B ND1 1 
ATOM   7560 C CD2 . HIS B 2 447 ? 6.159   0.123   -34.228 1.00 38.71  ? 447  HIS B CD2 1 
ATOM   7561 C CE1 . HIS B 2 447 ? 7.255   2.027   -34.085 1.00 43.12  ? 447  HIS B CE1 1 
ATOM   7562 N NE2 . HIS B 2 447 ? 6.967   1.013   -34.894 1.00 43.02  ? 447  HIS B NE2 1 
ATOM   7563 N N   . GLY B 2 448 ? 2.642   1.474   -33.725 1.00 38.82  ? 448  GLY B N   1 
ATOM   7564 C CA  . GLY B 2 448 ? 1.887   1.263   -34.965 1.00 32.05  ? 448  GLY B CA  1 
ATOM   7565 C C   . GLY B 2 448 ? 0.373   1.426   -34.844 1.00 35.82  ? 448  GLY B C   1 
ATOM   7566 O O   . GLY B 2 448 ? -0.311  1.665   -35.853 1.00 35.06  ? 448  GLY B O   1 
ATOM   7567 N N   . TYR B 2 449 ? -0.156  1.356   -33.622 1.00 33.92  ? 449  TYR B N   1 
ATOM   7568 C CA  . TYR B 2 449 ? -1.626  1.294   -33.413 1.00 33.57  ? 449  TYR B CA  1 
ATOM   7569 C C   . TYR B 2 449 ? -2.386  2.639   -33.244 1.00 34.16  ? 449  TYR B C   1 
ATOM   7570 O O   . TYR B 2 449 ? -3.570  2.659   -32.873 1.00 37.21  ? 449  TYR B O   1 
ATOM   7571 C CB  . TYR B 2 449 ? -1.969  0.230   -32.344 1.00 35.28  ? 449  TYR B CB  1 
ATOM   7572 C CG  . TYR B 2 449 ? -1.655  -1.143  -32.902 1.00 34.65  ? 449  TYR B CG  1 
ATOM   7573 C CD1 . TYR B 2 449 ? -0.400  -1.711  -32.746 1.00 34.26  ? 449  TYR B CD1 1 
ATOM   7574 C CD2 . TYR B 2 449 ? -2.583  -1.811  -33.698 1.00 39.74  ? 449  TYR B CD2 1 
ATOM   7575 C CE1 . TYR B 2 449 ? -0.083  -2.951  -33.325 1.00 36.34  ? 449  TYR B CE1 1 
ATOM   7576 C CE2 . TYR B 2 449 ? -2.290  -3.027  -34.274 1.00 40.34  ? 449  TYR B CE2 1 
ATOM   7577 C CZ  . TYR B 2 449 ? -1.046  -3.605  -34.082 1.00 39.85  ? 449  TYR B CZ  1 
ATOM   7578 O OH  . TYR B 2 449 ? -0.775  -4.825  -34.663 1.00 44.53  ? 449  TYR B OH  1 
ATOM   7579 N N   . GLU B 2 450 ? -1.714  3.743   -33.575 1.00 31.59  ? 450  GLU B N   1 
ATOM   7580 C CA  . GLU B 2 450 ? -2.368  5.036   -33.760 1.00 30.96  ? 450  GLU B CA  1 
ATOM   7581 C C   . GLU B 2 450 ? -2.713  5.225   -35.259 1.00 34.46  ? 450  GLU B C   1 
ATOM   7582 O O   . GLU B 2 450 ? -3.541  6.057   -35.628 1.00 34.09  ? 450  GLU B O   1 
ATOM   7583 C CB  . GLU B 2 450 ? -1.455  6.187   -33.295 1.00 26.20  ? 450  GLU B CB  1 
ATOM   7584 C CG  . GLU B 2 450 ? -0.551  6.728   -34.409 1.00 27.33  ? 450  GLU B CG  1 
ATOM   7585 C CD  . GLU B 2 450 ? 0.719   5.839   -34.619 1.00 45.15  ? 450  GLU B CD  1 
ATOM   7586 O OE1 . GLU B 2 450 ? 0.657   4.616   -34.258 1.00 38.44  ? 450  GLU B OE1 1 
ATOM   7587 O OE2 . GLU B 2 450 ? 1.761   6.363   -35.125 1.00 30.54  ? 450  GLU B OE2 1 
ATOM   7588 N N   . ILE B 2 451 ? -2.062  4.456   -36.124 1.00 32.81  ? 451  ILE B N   1 
ATOM   7589 C CA  . ILE B 2 451 ? -2.159  4.711   -37.550 1.00 30.77  ? 451  ILE B CA  1 
ATOM   7590 C C   . ILE B 2 451 ? -3.585  4.547   -38.097 1.00 36.94  ? 451  ILE B C   1 
ATOM   7591 O O   . ILE B 2 451 ? -4.060  5.378   -38.848 1.00 44.32  ? 451  ILE B O   1 
ATOM   7592 C CB  . ILE B 2 451 ? -1.211  3.818   -38.334 1.00 33.01  ? 451  ILE B CB  1 
ATOM   7593 C CG1 . ILE B 2 451 ? 0.256   4.071   -37.933 1.00 35.55  ? 451  ILE B CG1 1 
ATOM   7594 C CG2 . ILE B 2 451 ? -1.399  4.023   -39.806 1.00 25.77  ? 451  ILE B CG2 1 
ATOM   7595 C CD1 . ILE B 2 451 ? 1.228   3.247   -38.762 1.00 32.16  ? 451  ILE B CD1 1 
ATOM   7596 N N   . GLU B 2 452 ? -4.254  3.469   -37.727 1.00 35.64  ? 452  GLU B N   1 
ATOM   7597 C CA  . GLU B 2 452 ? -5.627  3.246   -38.163 1.00 41.82  ? 452  GLU B CA  1 
ATOM   7598 C C   . GLU B 2 452 ? -6.559  4.405   -37.783 1.00 37.01  ? 452  GLU B C   1 
ATOM   7599 O O   . GLU B 2 452 ? -7.533  4.648   -38.482 1.00 43.81  ? 452  GLU B O   1 
ATOM   7600 C CB  . GLU B 2 452 ? -6.159  1.927   -37.602 1.00 37.21  ? 452  GLU B CB  1 
ATOM   7601 C CG  . GLU B 2 452 ? -6.088  1.804   -36.084 1.00 41.86  ? 452  GLU B CG  1 
ATOM   7602 C CD  . GLU B 2 452 ? -5.968  0.349   -35.635 1.00 51.34  ? 452  GLU B CD  1 
ATOM   7603 O OE1 . GLU B 2 452 ? -6.895  -0.173  -34.962 1.00 52.22  ? 452  GLU B OE1 1 
ATOM   7604 O OE2 . GLU B 2 452 ? -4.946  -0.283  -35.984 1.00 48.08  ? 452  GLU B OE2 1 
ATOM   7605 N N   . PHE B 2 453 ? -6.248  5.104   -36.689 1.00 35.84  ? 453  PHE B N   1 
ATOM   7606 C CA  . PHE B 2 453 ? -7.022  6.283   -36.252 1.00 35.93  ? 453  PHE B CA  1 
ATOM   7607 C C   . PHE B 2 453 ? -6.761  7.520   -37.083 1.00 34.72  ? 453  PHE B C   1 
ATOM   7608 O O   . PHE B 2 453 ? -7.707  8.153   -37.534 1.00 37.34  ? 453  PHE B O   1 
ATOM   7609 C CB  . PHE B 2 453 ? -6.837  6.554   -34.750 1.00 35.19  ? 453  PHE B CB  1 
ATOM   7610 C CG  . PHE B 2 453 ? -7.472  5.500   -33.895 1.00 40.87  ? 453  PHE B CG  1 
ATOM   7611 C CD1 . PHE B 2 453 ? -8.833  5.528   -33.649 1.00 38.91  ? 453  PHE B CD1 1 
ATOM   7612 C CD2 . PHE B 2 453 ? -6.731  4.430   -33.421 1.00 39.21  ? 453  PHE B CD2 1 
ATOM   7613 C CE1 . PHE B 2 453 ? -9.438  4.534   -32.907 1.00 41.13  ? 453  PHE B CE1 1 
ATOM   7614 C CE2 . PHE B 2 453 ? -7.328  3.432   -32.677 1.00 38.72  ? 453  PHE B CE2 1 
ATOM   7615 C CZ  . PHE B 2 453 ? -8.686  3.491   -32.416 1.00 45.88  ? 453  PHE B CZ  1 
ATOM   7616 N N   . ILE B 2 454 ? -5.489  7.836   -37.329 1.00 32.00  ? 454  ILE B N   1 
ATOM   7617 C CA  . ILE B 2 454 ? -5.131  8.959   -38.190 1.00 34.68  ? 454  ILE B CA  1 
ATOM   7618 C C   . ILE B 2 454 ? -5.703  8.777   -39.608 1.00 41.59  ? 454  ILE B C   1 
ATOM   7619 O O   . ILE B 2 454 ? -6.123  9.755   -40.241 1.00 33.19  ? 454  ILE B O   1 
ATOM   7620 C CB  . ILE B 2 454 ? -3.624  9.083   -38.376 1.00 39.27  ? 454  ILE B CB  1 
ATOM   7621 C CG1 . ILE B 2 454 ? -2.886  9.251   -37.031 1.00 46.76  ? 454  ILE B CG1 1 
ATOM   7622 C CG2 . ILE B 2 454 ? -3.315  10.207  -39.363 1.00 38.22  ? 454  ILE B CG2 1 
ATOM   7623 C CD1 . ILE B 2 454 ? -3.415  10.353  -36.181 1.00 51.86  ? 454  ILE B CD1 1 
ATOM   7624 N N   . PHE B 2 455 ? -5.672  7.541   -40.123 1.00 36.30  ? 455  PHE B N   1 
ATOM   7625 C CA  . PHE B 2 455 ? -6.157  7.296   -41.489 1.00 35.82  ? 455  PHE B CA  1 
ATOM   7626 C C   . PHE B 2 455 ? -7.675  7.252   -41.546 1.00 35.13  ? 455  PHE B C   1 
ATOM   7627 O O   . PHE B 2 455 ? -8.257  7.269   -42.623 1.00 37.84  ? 455  PHE B O   1 
ATOM   7628 C CB  . PHE B 2 455 ? -5.527  6.048   -42.130 1.00 30.13  ? 455  PHE B CB  1 
ATOM   7629 C CG  . PHE B 2 455 ? -4.200  6.345   -42.852 1.00 37.63  ? 455  PHE B CG  1 
ATOM   7630 C CD1 . PHE B 2 455 ? -3.008  6.397   -42.149 1.00 27.90  ? 455  PHE B CD1 1 
ATOM   7631 C CD2 . PHE B 2 455 ? -4.181  6.604   -44.220 1.00 34.43  ? 455  PHE B CD2 1 
ATOM   7632 C CE1 . PHE B 2 455 ? -1.813  6.688   -42.804 1.00 35.48  ? 455  PHE B CE1 1 
ATOM   7633 C CE2 . PHE B 2 455 ? -3.005  6.893   -44.882 1.00 31.62  ? 455  PHE B CE2 1 
ATOM   7634 C CZ  . PHE B 2 455 ? -1.801  6.923   -44.173 1.00 32.43  ? 455  PHE B CZ  1 
ATOM   7635 N N   . GLY B 2 456 ? -8.301  7.169   -40.374 1.00 37.24  ? 456  GLY B N   1 
ATOM   7636 C CA  . GLY B 2 456 ? -9.754  7.258   -40.267 1.00 35.17  ? 456  GLY B CA  1 
ATOM   7637 C C   . GLY B 2 456 ? -10.567 5.980   -40.437 1.00 43.62  ? 456  GLY B C   1 
ATOM   7638 O O   . GLY B 2 456 ? -11.783 6.034   -40.667 1.00 38.68  ? 456  GLY B O   1 
ATOM   7639 N N   . LEU B 2 457 ? -9.917  4.826   -40.307 1.00 44.88  ? 457  LEU B N   1 
ATOM   7640 C CA  . LEU B 2 457 ? -10.616 3.555   -40.490 1.00 41.34  ? 457  LEU B CA  1 
ATOM   7641 C C   . LEU B 2 457 ? -11.858 3.380   -39.587 1.00 48.04  ? 457  LEU B C   1 
ATOM   7642 O O   . LEU B 2 457 ? -12.814 2.698   -39.968 1.00 50.01  ? 457  LEU B O   1 
ATOM   7643 C CB  . LEU B 2 457 ? -9.653  2.383   -40.309 1.00 42.37  ? 457  LEU B CB  1 
ATOM   7644 C CG  . LEU B 2 457 ? -8.851  1.958   -41.551 1.00 41.69  ? 457  LEU B CG  1 
ATOM   7645 C CD1 . LEU B 2 457 ? -7.826  3.029   -42.031 1.00 30.83  ? 457  LEU B CD1 1 
ATOM   7646 C CD2 . LEU B 2 457 ? -8.165  0.664   -41.229 1.00 37.88  ? 457  LEU B CD2 1 
ATOM   7647 N N   . PRO B 2 458 ? -11.851 3.965   -38.378 1.00 38.15  ? 458  PRO B N   1 
ATOM   7648 C CA  . PRO B 2 458 ? -13.080 3.700   -37.623 1.00 40.08  ? 458  PRO B CA  1 
ATOM   7649 C C   . PRO B 2 458 ? -14.322 4.279   -38.293 1.00 44.66  ? 458  PRO B C   1 
ATOM   7650 O O   . PRO B 2 458 ? -15.446 3.952   -37.893 1.00 54.11  ? 458  PRO B O   1 
ATOM   7651 C CB  . PRO B 2 458 ? -12.823 4.384   -36.283 1.00 40.66  ? 458  PRO B CB  1 
ATOM   7652 C CG  . PRO B 2 458 ? -11.312 4.300   -36.126 1.00 41.76  ? 458  PRO B CG  1 
ATOM   7653 C CD  . PRO B 2 458 ? -10.739 4.408   -37.521 1.00 37.49  ? 458  PRO B CD  1 
ATOM   7654 N N   . LEU B 2 459 ? -14.145 5.112   -39.308 1.00 44.55  ? 459  LEU B N   1 
ATOM   7655 C CA  . LEU B 2 459 ? -15.299 5.693   -39.980 1.00 49.24  ? 459  LEU B CA  1 
ATOM   7656 C C   . LEU B 2 459 ? -16.039 4.619   -40.797 1.00 52.32  ? 459  LEU B C   1 
ATOM   7657 O O   . LEU B 2 459 ? -17.161 4.812   -41.225 1.00 54.70  ? 459  LEU B O   1 
ATOM   7658 C CB  . LEU B 2 459 ? -14.880 6.865   -40.864 1.00 43.81  ? 459  LEU B CB  1 
ATOM   7659 C CG  . LEU B 2 459 ? -14.942 8.263   -40.244 1.00 51.48  ? 459  LEU B CG  1 
ATOM   7660 C CD1 . LEU B 2 459 ? -14.064 8.372   -39.010 1.00 57.56  ? 459  LEU B CD1 1 
ATOM   7661 C CD2 . LEU B 2 459 ? -14.515 9.297   -41.270 1.00 45.82  ? 459  LEU B CD2 1 
ATOM   7662 N N   . ASP B 2 460 ? -15.382 3.489   -41.013 1.00 55.88  ? 460  ASP B N   1 
ATOM   7663 C CA  . ASP B 2 460 ? -15.952 2.377   -41.752 1.00 60.13  ? 460  ASP B CA  1 
ATOM   7664 C C   . ASP B 2 460 ? -16.718 1.528   -40.752 1.00 64.90  ? 460  ASP B C   1 
ATOM   7665 O O   . ASP B 2 460 ? -16.104 0.823   -39.944 1.00 57.27  ? 460  ASP B O   1 
ATOM   7666 C CB  . ASP B 2 460 ? -14.823 1.562   -42.372 1.00 64.27  ? 460  ASP B CB  1 
ATOM   7667 C CG  . ASP B 2 460 ? -15.319 0.355   -43.147 1.00 71.81  ? 460  ASP B CG  1 
ATOM   7668 O OD1 . ASP B 2 460 ? -16.488 -0.066  -42.956 1.00 67.80  ? 460  ASP B OD1 1 
ATOM   7669 O OD2 . ASP B 2 460 ? -14.513 -0.173  -43.950 1.00 73.18  ? 460  ASP B OD2 1 
ATOM   7670 N N   . PRO B 2 461 ? -18.066 1.586   -40.804 1.00 70.50  ? 461  PRO B N   1 
ATOM   7671 C CA  . PRO B 2 461 ? -18.905 0.966   -39.758 1.00 72.27  ? 461  PRO B CA  1 
ATOM   7672 C C   . PRO B 2 461 ? -18.648 -0.534  -39.656 1.00 67.28  ? 461  PRO B C   1 
ATOM   7673 O O   . PRO B 2 461 ? -18.604 -1.072  -38.552 1.00 67.52  ? 461  PRO B O   1 
ATOM   7674 C CB  . PRO B 2 461 ? -20.348 1.233   -40.229 1.00 67.55  ? 461  PRO B CB  1 
ATOM   7675 C CG  . PRO B 2 461 ? -20.236 2.247   -41.337 1.00 69.81  ? 461  PRO B CG  1 
ATOM   7676 C CD  . PRO B 2 461 ? -18.864 2.059   -41.946 1.00 70.70  ? 461  PRO B CD  1 
ATOM   7677 N N   . SER B 2 462 ? -18.455 -1.184  -40.800 1.00 59.95  ? 462  SER B N   1 
ATOM   7678 C CA  . SER B 2 462 ? -18.175 -2.618  -40.844 1.00 61.51  ? 462  SER B CA  1 
ATOM   7679 C C   . SER B 2 462 ? -16.926 -3.087  -40.090 1.00 67.29  ? 462  SER B C   1 
ATOM   7680 O O   . SER B 2 462 ? -16.707 -4.297  -40.006 1.00 65.58  ? 462  SER B O   1 
ATOM   7681 C CB  . SER B 2 462 ? -18.036 -3.067  -42.299 1.00 65.28  ? 462  SER B CB  1 
ATOM   7682 O OG  . SER B 2 462 ? -16.766 -2.700  -42.815 1.00 70.44  ? 462  SER B OG  1 
ATOM   7683 N N   . LEU B 2 463 ? -16.093 -2.164  -39.581 1.00 57.96  ? 463  LEU B N   1 
ATOM   7684 C CA  . LEU B 2 463 ? -14.899 -2.573  -38.843 1.00 52.21  ? 463  LEU B CA  1 
ATOM   7685 C C   . LEU B 2 463 ? -15.098 -2.699  -37.318 1.00 55.95  ? 463  LEU B C   1 
ATOM   7686 O O   . LEU B 2 463 ? -14.194 -3.124  -36.604 1.00 64.47  ? 463  LEU B O   1 
ATOM   7687 C CB  . LEU B 2 463 ? -13.693 -1.678  -39.168 1.00 54.71  ? 463  LEU B CB  1 
ATOM   7688 C CG  . LEU B 2 463 ? -13.139 -1.651  -40.605 1.00 55.54  ? 463  LEU B CG  1 
ATOM   7689 C CD1 . LEU B 2 463 ? -11.999 -0.629  -40.781 1.00 52.29  ? 463  LEU B CD1 1 
ATOM   7690 C CD2 . LEU B 2 463 ? -12.684 -3.027  -41.029 1.00 49.61  ? 463  LEU B CD2 1 
ATOM   7691 N N   . ASN B 2 464 ? -16.262 -2.330  -36.811 1.00 56.03  ? 464  ASN B N   1 
ATOM   7692 C CA  . ASN B 2 464 ? -16.583 -2.598  -35.397 1.00 64.73  ? 464  ASN B CA  1 
ATOM   7693 C C   . ASN B 2 464 ? -15.915 -1.716  -34.336 1.00 58.95  ? 464  ASN B C   1 
ATOM   7694 O O   . ASN B 2 464 ? -15.926 -2.054  -33.147 1.00 52.26  ? 464  ASN B O   1 
ATOM   7695 C CB  . ASN B 2 464 ? -16.328 -4.073  -35.035 1.00 74.55  ? 464  ASN B CB  1 
ATOM   7696 C CG  . ASN B 2 464 ? -17.057 -5.036  -35.954 1.00 84.27  ? 464  ASN B CG  1 
ATOM   7697 O OD1 . ASN B 2 464 ? -18.209 -4.796  -36.345 1.00 81.93  ? 464  ASN B OD1 1 
ATOM   7698 N ND2 . ASN B 2 464 ? -16.379 -6.133  -36.318 1.00 86.94  ? 464  ASN B ND2 1 
ATOM   7699 N N   . TYR B 2 465 ? -15.313 -0.607  -34.745 1.00 55.17  ? 465  TYR B N   1 
ATOM   7700 C CA  . TYR B 2 465 ? -14.851 0.354   -33.762 1.00 51.06  ? 465  TYR B CA  1 
ATOM   7701 C C   . TYR B 2 465 ? -16.065 0.945   -33.049 1.00 51.50  ? 465  TYR B C   1 
ATOM   7702 O O   . TYR B 2 465 ? -17.148 1.007   -33.611 1.00 51.10  ? 465  TYR B O   1 
ATOM   7703 C CB  . TYR B 2 465 ? -14.065 1.464   -34.448 1.00 49.15  ? 465  TYR B CB  1 
ATOM   7704 C CG  . TYR B 2 465 ? -12.727 1.053   -35.007 1.00 42.30  ? 465  TYR B CG  1 
ATOM   7705 C CD1 . TYR B 2 465 ? -11.586 1.085   -34.207 1.00 48.63  ? 465  TYR B CD1 1 
ATOM   7706 C CD2 . TYR B 2 465 ? -12.591 0.672   -36.333 1.00 37.29  ? 465  TYR B CD2 1 
ATOM   7707 C CE1 . TYR B 2 465 ? -10.330 0.742   -34.717 1.00 47.18  ? 465  TYR B CE1 1 
ATOM   7708 C CE2 . TYR B 2 465 ? -11.353 0.325   -36.855 1.00 38.36  ? 465  TYR B CE2 1 
ATOM   7709 C CZ  . TYR B 2 465 ? -10.230 0.359   -36.038 1.00 45.95  ? 465  TYR B CZ  1 
ATOM   7710 O OH  . TYR B 2 465 ? -8.994  0.044   -36.536 1.00 47.21  ? 465  TYR B OH  1 
ATOM   7711 N N   . THR B 2 466 ? -15.893 1.369   -31.807 1.00 53.87  ? 466  THR B N   1 
ATOM   7712 C CA  . THR B 2 466 ? -16.980 2.008   -31.081 1.00 54.21  ? 466  THR B CA  1 
ATOM   7713 C C   . THR B 2 466 ? -17.264 3.388   -31.664 1.00 59.90  ? 466  THR B C   1 
ATOM   7714 O O   . THR B 2 466 ? -16.433 3.939   -32.389 1.00 57.35  ? 466  THR B O   1 
ATOM   7715 C CB  . THR B 2 466 ? -16.624 2.201   -29.612 1.00 52.73  ? 466  THR B CB  1 
ATOM   7716 O OG1 . THR B 2 466 ? -15.516 3.114   -29.510 1.00 55.22  ? 466  THR B OG1 1 
ATOM   7717 C CG2 . THR B 2 466 ? -16.279 0.862   -28.973 1.00 44.96  ? 466  THR B CG2 1 
ATOM   7718 N N   . THR B 2 467 ? -18.429 3.951   -31.337 1.00 60.30  ? 467  THR B N   1 
ATOM   7719 C CA  . THR B 2 467 ? -18.766 5.289   -31.814 1.00 58.78  ? 467  THR B CA  1 
ATOM   7720 C C   . THR B 2 467 ? -17.838 6.367   -31.242 1.00 56.05  ? 467  THR B C   1 
ATOM   7721 O O   . THR B 2 467 ? -17.567 7.355   -31.924 1.00 60.10  ? 467  THR B O   1 
ATOM   7722 C CB  . THR B 2 467 ? -20.232 5.675   -31.533 1.00 54.85  ? 467  THR B CB  1 
ATOM   7723 O OG1 . THR B 2 467 ? -20.367 5.982   -30.156 1.00 56.82  ? 467  THR B OG1 1 
ATOM   7724 C CG2 . THR B 2 467 ? -21.165 4.529   -31.870 1.00 60.95  ? 467  THR B CG2 1 
ATOM   7725 N N   . GLU B 2 468 ? -17.348 6.182   -30.015 1.00 54.35  ? 468  GLU B N   1 
ATOM   7726 C CA  . GLU B 2 468 ? -16.393 7.132   -29.432 1.00 54.63  ? 468  GLU B CA  1 
ATOM   7727 C C   . GLU B 2 468 ? -15.103 7.115   -30.252 1.00 55.67  ? 468  GLU B C   1 
ATOM   7728 O O   . GLU B 2 468 ? -14.413 8.129   -30.423 1.00 50.01  ? 468  GLU B O   1 
ATOM   7729 C CB  . GLU B 2 468 ? -16.074 6.792   -27.967 1.00 63.48  ? 468  GLU B CB  1 
ATOM   7730 C CG  . GLU B 2 468 ? -17.181 7.073   -26.953 1.00 78.98  ? 468  GLU B CG  1 
ATOM   7731 C CD  . GLU B 2 468 ? -18.258 5.978   -26.927 1.00 95.67  ? 468  GLU B CD  1 
ATOM   7732 O OE1 . GLU B 2 468 ? -17.928 4.785   -27.146 1.00 99.38  ? 468  GLU B OE1 1 
ATOM   7733 O OE2 . GLU B 2 468 ? -19.440 6.309   -26.680 1.00 100.35 ? 468  GLU B OE2 1 
ATOM   7734 N N   . GLU B 2 469 ? -14.763 5.943   -30.757 1.00 53.32  ? 469  GLU B N   1 
ATOM   7735 C CA  . GLU B 2 469 ? -13.560 5.840   -31.553 1.00 51.42  ? 469  GLU B CA  1 
ATOM   7736 C C   . GLU B 2 469 ? -13.706 6.532   -32.905 1.00 49.16  ? 469  GLU B C   1 
ATOM   7737 O O   . GLU B 2 469 ? -12.741 7.126   -33.412 1.00 48.44  ? 469  GLU B O   1 
ATOM   7738 C CB  . GLU B 2 469 ? -13.144 4.385   -31.705 1.00 43.66  ? 469  GLU B CB  1 
ATOM   7739 C CG  . GLU B 2 469 ? -12.323 3.908   -30.541 1.00 43.58  ? 469  GLU B CG  1 
ATOM   7740 C CD  . GLU B 2 469 ? -12.197 2.411   -30.552 1.00 52.19  ? 469  GLU B CD  1 
ATOM   7741 O OE1 . GLU B 2 469 ? -13.126 1.773   -31.093 1.00 51.64  ? 469  GLU B OE1 1 
ATOM   7742 O OE2 . GLU B 2 469 ? -11.189 1.879   -30.025 1.00 47.10  ? 469  GLU B OE2 1 
ATOM   7743 N N   . ARG B 2 470 ? -14.904 6.452   -33.477 1.00 39.93  ? 470  ARG B N   1 
ATOM   7744 C CA  . ARG B 2 470 ? -15.205 7.136   -34.716 1.00 45.32  ? 470  ARG B CA  1 
ATOM   7745 C C   . ARG B 2 470 ? -15.024 8.648   -34.533 1.00 46.24  ? 470  ARG B C   1 
ATOM   7746 O O   . ARG B 2 470 ? -14.310 9.293   -35.303 1.00 46.61  ? 470  ARG B O   1 
ATOM   7747 C CB  . ARG B 2 470 ? -16.630 6.803   -35.157 1.00 54.95  ? 470  ARG B CB  1 
ATOM   7748 C CG  . ARG B 2 470 ? -16.923 7.095   -36.606 1.00 69.30  ? 470  ARG B CG  1 
ATOM   7749 C CD  . ARG B 2 470 ? -17.780 8.334   -36.757 1.00 83.96  ? 470  ARG B CD  1 
ATOM   7750 N NE  . ARG B 2 470 ? -19.068 8.168   -36.081 1.00 92.09  ? 470  ARG B NE  1 
ATOM   7751 C CZ  . ARG B 2 470 ? -19.884 9.170   -35.771 1.00 90.96  ? 470  ARG B CZ  1 
ATOM   7752 N NH1 . ARG B 2 470 ? -19.552 10.416  -36.087 1.00 87.63  ? 470  ARG B NH1 1 
ATOM   7753 N NH2 . ARG B 2 470 ? -21.028 8.924   -35.142 1.00 91.33  ? 470  ARG B NH2 1 
ATOM   7754 N N   . ILE B 2 471 ? -15.668 9.204   -33.506 1.00 42.83  ? 471  ILE B N   1 
ATOM   7755 C CA  . ILE B 2 471 ? -15.456 10.599  -33.071 1.00 41.04  ? 471  ILE B CA  1 
ATOM   7756 C C   . ILE B 2 471 ? -13.961 10.956  -32.827 1.00 50.71  ? 471  ILE B C   1 
ATOM   7757 O O   . ILE B 2 471 ? -13.488 12.021  -33.243 1.00 50.65  ? 471  ILE B O   1 
ATOM   7758 C CB  . ILE B 2 471 ? -16.289 10.881  -31.793 1.00 44.94  ? 471  ILE B CB  1 
ATOM   7759 C CG1 . ILE B 2 471 ? -17.795 10.765  -32.109 1.00 45.28  ? 471  ILE B CG1 1 
ATOM   7760 C CG2 . ILE B 2 471 ? -15.931 12.212  -31.156 1.00 34.13  ? 471  ILE B CG2 1 
ATOM   7761 C CD1 . ILE B 2 471 ? -18.587 10.479  -30.885 1.00 48.27  ? 471  ILE B CD1 1 
ATOM   7762 N N   . PHE B 2 472 ? -13.228 10.063  -32.166 1.00 42.67  ? 472  PHE B N   1 
ATOM   7763 C CA  . PHE B 2 472 ? -11.816 10.281  -31.882 1.00 41.91  ? 472  PHE B CA  1 
ATOM   7764 C C   . PHE B 2 472 ? -11.021 10.308  -33.187 1.00 44.96  ? 472  PHE B C   1 
ATOM   7765 O O   . PHE B 2 472 ? -10.178 11.187  -33.370 1.00 44.05  ? 472  PHE B O   1 
ATOM   7766 C CB  . PHE B 2 472 ? -11.310 9.192   -30.950 1.00 44.65  ? 472  PHE B CB  1 
ATOM   7767 C CG  . PHE B 2 472 ? -9.820  9.240   -30.637 1.00 44.89  ? 472  PHE B CG  1 
ATOM   7768 C CD1 . PHE B 2 472 ? -9.213  10.386  -30.172 1.00 39.62  ? 472  PHE B CD1 1 
ATOM   7769 C CD2 . PHE B 2 472 ? -9.055  8.078   -30.721 1.00 37.66  ? 472  PHE B CD2 1 
ATOM   7770 C CE1 . PHE B 2 472 ? -7.837  10.387  -29.841 1.00 35.45  ? 472  PHE B CE1 1 
ATOM   7771 C CE2 . PHE B 2 472 ? -7.726  8.077   -30.391 1.00 38.82  ? 472  PHE B CE2 1 
ATOM   7772 C CZ  . PHE B 2 472 ? -7.122  9.241   -29.941 1.00 35.04  ? 472  PHE B CZ  1 
ATOM   7773 N N   . ALA B 2 473 ? -11.313 9.383   -34.103 1.00 40.76  ? 473  ALA B N   1 
ATOM   7774 C CA  . ALA B 2 473 ? -10.631 9.366   -35.391 1.00 38.16  ? 473  ALA B CA  1 
ATOM   7775 C C   . ALA B 2 473 ? -10.946 10.642  -36.179 1.00 44.54  ? 473  ALA B C   1 
ATOM   7776 O O   . ALA B 2 473 ? -10.062 11.232  -36.818 1.00 44.77  ? 473  ALA B O   1 
ATOM   7777 C CB  . ALA B 2 473 ? -10.999 8.126   -36.193 1.00 36.07  ? 473  ALA B CB  1 
ATOM   7778 N N   . GLN B 2 474 ? -12.195 11.094  -36.130 1.00 37.77  ? 474  GLN B N   1 
ATOM   7779 C CA  . GLN B 2 474 ? -12.494 12.357  -36.785 1.00 44.50  ? 474  GLN B CA  1 
ATOM   7780 C C   . GLN B 2 474 ? -11.690 13.531  -36.197 1.00 44.38  ? 474  GLN B C   1 
ATOM   7781 O O   . GLN B 2 474 ? -11.271 14.416  -36.942 1.00 48.81  ? 474  GLN B O   1 
ATOM   7782 C CB  . GLN B 2 474 ? -13.996 12.662  -36.788 1.00 47.67  ? 474  GLN B CB  1 
ATOM   7783 C CG  . GLN B 2 474 ? -14.831 11.550  -37.396 1.00 55.97  ? 474  GLN B CG  1 
ATOM   7784 C CD  . GLN B 2 474 ? -16.287 11.948  -37.577 1.00 65.68  ? 474  GLN B CD  1 
ATOM   7785 O OE1 . GLN B 2 474 ? -17.119 11.697  -36.707 1.00 66.23  ? 474  GLN B OE1 1 
ATOM   7786 N NE2 . GLN B 2 474 ? -16.596 12.586  -38.712 1.00 70.43  ? 474  GLN B NE2 1 
ATOM   7787 N N   . ARG B 2 475 ? -11.471 13.544  -34.881 1.00 38.94  ? 475  ARG B N   1 
ATOM   7788 C CA  . ARG B 2 475 ? -10.640 14.580  -34.279 1.00 43.42  ? 475  ARG B CA  1 
ATOM   7789 C C   . ARG B 2 475 ? -9.233  14.543  -34.856 1.00 42.44  ? 475  ARG B C   1 
ATOM   7790 O O   . ARG B 2 475 ? -8.664  15.590  -35.202 1.00 43.04  ? 475  ARG B O   1 
ATOM   7791 C CB  . ARG B 2 475 ? -10.565 14.451  -32.757 1.00 47.33  ? 475  ARG B CB  1 
ATOM   7792 C CG  . ARG B 2 475 ? -11.807 14.965  -32.034 1.00 56.66  ? 475  ARG B CG  1 
ATOM   7793 C CD  . ARG B 2 475 ? -11.701 14.780  -30.503 1.00 53.92  ? 475  ARG B CD  1 
ATOM   7794 N NE  . ARG B 2 475 ? -10.428 15.278  -30.016 1.00 47.72  ? 475  ARG B NE  1 
ATOM   7795 C CZ  . ARG B 2 475 ? -9.717  14.710  -29.047 1.00 44.40  ? 475  ARG B CZ  1 
ATOM   7796 N NH1 . ARG B 2 475 ? -10.162 13.613  -28.431 1.00 35.09  ? 475  ARG B NH1 1 
ATOM   7797 N NH2 . ARG B 2 475 ? -8.545  15.250  -28.702 1.00 39.85  ? 475  ARG B NH2 1 
ATOM   7798 N N   . LEU B 2 476 ? -8.676  13.337  -34.961 1.00 34.87  ? 476  LEU B N   1 
ATOM   7799 C CA  . LEU B 2 476 ? -7.276  13.179  -35.367 1.00 34.17  ? 476  LEU B CA  1 
ATOM   7800 C C   . LEU B 2 476 ? -7.059  13.536  -36.833 1.00 36.47  ? 476  LEU B C   1 
ATOM   7801 O O   . LEU B 2 476 ? -6.068  14.164  -37.186 1.00 40.89  ? 476  LEU B O   1 
ATOM   7802 C CB  . LEU B 2 476 ? -6.790  11.761  -35.078 1.00 37.43  ? 476  LEU B CB  1 
ATOM   7803 C CG  . LEU B 2 476 ? -6.762  11.396  -33.584 1.00 42.20  ? 476  LEU B CG  1 
ATOM   7804 C CD1 . LEU B 2 476 ? -6.099  10.058  -33.400 1.00 52.93  ? 476  LEU B CD1 1 
ATOM   7805 C CD2 . LEU B 2 476 ? -6.021  12.417  -32.779 1.00 40.74  ? 476  LEU B CD2 1 
ATOM   7806 N N   . MET B 2 477 ? -8.015  13.159  -37.678 1.00 35.07  ? 477  MET B N   1 
ATOM   7807 C CA  . MET B 2 477 ? -7.965  13.480  -39.080 1.00 31.86  ? 477  MET B CA  1 
ATOM   7808 C C   . MET B 2 477 ? -7.950  14.982  -39.270 1.00 36.15  ? 477  MET B C   1 
ATOM   7809 O O   . MET B 2 477 ? -7.256  15.493  -40.152 1.00 41.57  ? 477  MET B O   1 
ATOM   7810 C CB  . MET B 2 477 ? -9.170  12.867  -39.808 1.00 32.44  ? 477  MET B CB  1 
ATOM   7811 C CG  . MET B 2 477 ? -9.118  11.308  -39.969 1.00 46.08  ? 477  MET B CG  1 
ATOM   7812 S SD  . MET B 2 477 ? -10.727 10.683  -40.551 1.00 54.70  ? 477  MET B SD  1 
ATOM   7813 C CE  . MET B 2 477 ? -10.611 11.035  -42.282 1.00 29.60  ? 477  MET B CE  1 
ATOM   7814 N N   . LYS B 2 478 ? -8.730  15.675  -38.441 1.00 36.88  ? 478  LYS B N   1 
ATOM   7815 C CA  . LYS B 2 478 ? -8.765  17.143  -38.390 1.00 36.26  ? 478  LYS B CA  1 
ATOM   7816 C C   . LYS B 2 478 ? -7.442  17.773  -37.936 1.00 32.81  ? 478  LYS B C   1 
ATOM   7817 O O   . LYS B 2 478 ? -6.962  18.714  -38.568 1.00 36.17  ? 478  LYS B O   1 
ATOM   7818 C CB  . LYS B 2 478 ? -9.889  17.627  -37.470 1.00 37.75  ? 478  LYS B CB  1 
ATOM   7819 C CG  . LYS B 2 478 ? -11.040 18.236  -38.191 1.00 59.12  ? 478  LYS B CG  1 
ATOM   7820 C CD  . LYS B 2 478 ? -10.744 19.663  -38.643 1.00 69.59  ? 478  LYS B CD  1 
ATOM   7821 C CE  . LYS B 2 478 ? -11.925 20.220  -39.486 1.00 78.57  ? 478  LYS B CE  1 
ATOM   7822 N NZ  . LYS B 2 478 ? -12.344 19.355  -40.651 1.00 71.84  ? 478  LYS B NZ  1 
ATOM   7823 N N   . TYR B 2 479 ? -6.852  17.280  -36.850 1.00 35.24  ? 479  TYR B N   1 
ATOM   7824 C CA  . TYR B 2 479 ? -5.517  17.791  -36.459 1.00 35.62  ? 479  TYR B CA  1 
ATOM   7825 C C   . TYR B 2 479 ? -4.499  17.627  -37.602 1.00 37.66  ? 479  TYR B C   1 
ATOM   7826 O O   . TYR B 2 479 ? -3.873  18.590  -38.023 1.00 40.97  ? 479  TYR B O   1 
ATOM   7827 C CB  . TYR B 2 479 ? -4.966  17.094  -35.229 1.00 26.29  ? 479  TYR B CB  1 
ATOM   7828 C CG  . TYR B 2 479 ? -5.712  17.285  -33.942 1.00 31.62  ? 479  TYR B CG  1 
ATOM   7829 C CD1 . TYR B 2 479 ? -6.170  18.532  -33.548 1.00 30.40  ? 479  TYR B CD1 1 
ATOM   7830 C CD2 . TYR B 2 479 ? -5.921  16.204  -33.084 1.00 33.83  ? 479  TYR B CD2 1 
ATOM   7831 C CE1 . TYR B 2 479 ? -6.838  18.696  -32.346 1.00 31.73  ? 479  TYR B CE1 1 
ATOM   7832 C CE2 . TYR B 2 479 ? -6.581  16.355  -31.880 1.00 28.46  ? 479  TYR B CE2 1 
ATOM   7833 C CZ  . TYR B 2 479 ? -7.027  17.598  -31.513 1.00 37.57  ? 479  TYR B CZ  1 
ATOM   7834 O OH  . TYR B 2 479 ? -7.691  17.728  -30.310 1.00 47.51  ? 479  TYR B OH  1 
ATOM   7835 N N   . TRP B 2 480 ? -4.344  16.405  -38.103 1.00 41.17  ? 480  TRP B N   1 
ATOM   7836 C CA  . TRP B 2 480 ? -3.378  16.138  -39.181 1.00 38.17  ? 480  TRP B CA  1 
ATOM   7837 C C   . TRP B 2 480 ? -3.630  17.012  -40.432 1.00 39.11  ? 480  TRP B C   1 
ATOM   7838 O O   . TRP B 2 480 ? -2.678  17.587  -40.988 1.00 30.01  ? 480  TRP B O   1 
ATOM   7839 C CB  . TRP B 2 480 ? -3.365  14.645  -39.555 1.00 34.41  ? 480  TRP B CB  1 
ATOM   7840 C CG  . TRP B 2 480 ? -2.260  13.830  -38.887 1.00 31.68  ? 480  TRP B CG  1 
ATOM   7841 C CD1 . TRP B 2 480 ? -1.265  13.096  -39.515 1.00 32.57  ? 480  TRP B CD1 1 
ATOM   7842 C CD2 . TRP B 2 480 ? -2.077  13.623  -37.483 1.00 28.09  ? 480  TRP B CD2 1 
ATOM   7843 N NE1 . TRP B 2 480 ? -0.462  12.480  -38.572 1.00 29.75  ? 480  TRP B NE1 1 
ATOM   7844 C CE2 . TRP B 2 480 ? -0.949  12.781  -37.323 1.00 29.06  ? 480  TRP B CE2 1 
ATOM   7845 C CE3 . TRP B 2 480 ? -2.740  14.086  -36.346 1.00 32.31  ? 480  TRP B CE3 1 
ATOM   7846 C CZ2 . TRP B 2 480 ? -0.471  12.411  -36.063 1.00 26.66  ? 480  TRP B CZ2 1 
ATOM   7847 C CZ3 . TRP B 2 480 ? -2.285  13.681  -35.101 1.00 35.67  ? 480  TRP B CZ3 1 
ATOM   7848 C CH2 . TRP B 2 480 ? -1.161  12.847  -34.974 1.00 32.35  ? 480  TRP B CH2 1 
ATOM   7849 N N   . THR B 2 481 ? -4.899  17.127  -40.863 1.00 30.54  ? 481  THR B N   1 
ATOM   7850 C CA  . THR B 2 481 ? -5.169  17.892  -42.074 1.00 31.49  ? 481  THR B CA  1 
ATOM   7851 C C   . THR B 2 481 ? -5.097  19.416  -41.821 1.00 37.26  ? 481  THR B C   1 
ATOM   7852 O O   . THR B 2 481 ? -4.653  20.160  -42.688 1.00 41.68  ? 481  THR B O   1 
ATOM   7853 C CB  . THR B 2 481 ? -6.447  17.443  -42.818 1.00 32.98  ? 481  THR B CB  1 
ATOM   7854 O OG1 . THR B 2 481 ? -7.572  17.470  -41.920 1.00 38.07  ? 481  THR B OG1 1 
ATOM   7855 C CG2 . THR B 2 481 ? -6.263  16.007  -43.358 1.00 35.34  ? 481  THR B CG2 1 
ATOM   7856 N N   . ASN B 2 482 ? -5.483  19.881  -40.633 1.00 39.21  ? 482  ASN B N   1 
ATOM   7857 C CA  . ASN B 2 482 ? -5.206  21.274  -40.288 1.00 37.21  ? 482  ASN B CA  1 
ATOM   7858 C C   . ASN B 2 482 ? -3.717  21.471  -40.303 1.00 34.20  ? 482  ASN B C   1 
ATOM   7859 O O   . ASN B 2 482 ? -3.227  22.498  -40.752 1.00 35.08  ? 482  ASN B O   1 
ATOM   7860 C CB  . ASN B 2 482 ? -5.706  21.664  -38.905 1.00 33.70  ? 482  ASN B CB  1 
ATOM   7861 C CG  . ASN B 2 482 ? -7.216  21.825  -38.861 1.00 36.52  ? 482  ASN B CG  1 
ATOM   7862 O OD1 . ASN B 2 482 ? -7.856  22.036  -39.880 1.00 36.92  ? 482  ASN B OD1 1 
ATOM   7863 N ND2 . ASN B 2 482 ? -7.780  21.734  -37.664 1.00 41.77  ? 482  ASN B ND2 1 
ATOM   7864 N N   . PHE B 2 483 ? -2.988  20.507  -39.768 1.00 28.91  ? 483  PHE B N   1 
ATOM   7865 C CA  . PHE B 2 483 ? -1.549  20.690  -39.787 1.00 33.84  ? 483  PHE B CA  1 
ATOM   7866 C C   . PHE B 2 483 ? -1.070  20.812  -41.242 1.00 36.15  ? 483  PHE B C   1 
ATOM   7867 O O   . PHE B 2 483 ? -0.323  21.733  -41.573 1.00 40.15  ? 483  PHE B O   1 
ATOM   7868 C CB  . PHE B 2 483 ? -0.789  19.606  -39.017 1.00 32.52  ? 483  PHE B CB  1 
ATOM   7869 C CG  . PHE B 2 483 ? 0.701   19.761  -39.094 1.00 32.79  ? 483  PHE B CG  1 
ATOM   7870 C CD1 . PHE B 2 483 ? 1.364   20.716  -38.301 1.00 32.95  ? 483  PHE B CD1 1 
ATOM   7871 C CD2 . PHE B 2 483 ? 1.444   19.001  -40.001 1.00 28.88  ? 483  PHE B CD2 1 
ATOM   7872 C CE1 . PHE B 2 483 ? 2.761   20.877  -38.377 1.00 36.33  ? 483  PHE B CE1 1 
ATOM   7873 C CE2 . PHE B 2 483 ? 2.862   19.141  -40.085 1.00 31.79  ? 483  PHE B CE2 1 
ATOM   7874 C CZ  . PHE B 2 483 ? 3.520   20.078  -39.272 1.00 33.95  ? 483  PHE B CZ  1 
ATOM   7875 N N   . ALA B 2 484 ? -1.532  19.930  -42.121 1.00 33.32  ? 484  ALA B N   1 
ATOM   7876 C CA  . ALA B 2 484 ? -1.085  19.976  -43.514 1.00 30.22  ? 484  ALA B CA  1 
ATOM   7877 C C   . ALA B 2 484 ? -1.416  21.297  -44.202 1.00 39.19  ? 484  ALA B C   1 
ATOM   7878 O O   . ALA B 2 484 ? -0.607  21.831  -44.976 1.00 37.04  ? 484  ALA B O   1 
ATOM   7879 C CB  . ALA B 2 484 ? -1.695  18.849  -44.278 1.00 33.27  ? 484  ALA B CB  1 
ATOM   7880 N N   . ARG B 2 485 ? -2.624  21.797  -43.945 1.00 33.21  ? 485  ARG B N   1 
ATOM   7881 C CA  . ARG B 2 485 ? -3.102  23.025  -44.563 1.00 44.09  ? 485  ARG B CA  1 
ATOM   7882 C C   . ARG B 2 485 ? -2.331  24.255  -44.087 1.00 45.14  ? 485  ARG B C   1 
ATOM   7883 O O   . ARG B 2 485 ? -2.102  25.171  -44.881 1.00 42.25  ? 485  ARG B O   1 
ATOM   7884 C CB  . ARG B 2 485 ? -4.623  23.255  -44.285 1.00 30.71  ? 485  ARG B CB  1 
ATOM   7885 C CG  . ARG B 2 485 ? -5.612  22.334  -45.054 1.00 65.34  ? 485  ARG B CG  1 
ATOM   7886 C CD  . ARG B 2 485 ? -7.126  22.648  -44.750 1.00 61.73  ? 485  ARG B CD  1 
ATOM   7887 N NE  . ARG B 2 485 ? -7.563  22.042  -43.488 1.00 63.32  ? 485  ARG B NE  1 
ATOM   7888 C CZ  . ARG B 2 485 ? -8.293  20.928  -43.370 1.00 65.09  ? 485  ARG B CZ  1 
ATOM   7889 N NH1 . ARG B 2 485 ? -8.743  20.278  -44.451 1.00 61.61  ? 485  ARG B NH1 1 
ATOM   7890 N NH2 . ARG B 2 485 ? -8.586  20.466  -42.151 1.00 55.41  ? 485  ARG B NH2 1 
ATOM   7891 N N   . THR B 2 486 ? -1.942  24.273  -42.804 1.00 39.87  ? 486  THR B N   1 
ATOM   7892 C CA  . THR B 2 486 ? -1.542  25.519  -42.160 1.00 37.94  ? 486  THR B CA  1 
ATOM   7893 C C   . THR B 2 486 ? -0.280  25.471  -41.347 1.00 41.39  ? 486  THR B C   1 
ATOM   7894 O O   . THR B 2 486 ? 0.209   26.517  -40.920 1.00 40.74  ? 486  THR B O   1 
ATOM   7895 C CB  . THR B 2 486 ? -2.645  26.078  -41.209 1.00 44.68  ? 486  THR B CB  1 
ATOM   7896 O OG1 . THR B 2 486 ? -2.785  25.226  -40.056 1.00 41.33  ? 486  THR B OG1 1 
ATOM   7897 C CG2 . THR B 2 486 ? -3.960  26.209  -41.948 1.00 39.19  ? 486  THR B CG2 1 
ATOM   7898 N N   . GLY B 2 487 ? 0.254   24.280  -41.100 1.00 38.43  ? 487  GLY B N   1 
ATOM   7899 C CA  . GLY B 2 487 ? 1.410   24.185  -40.240 1.00 26.95  ? 487  GLY B CA  1 
ATOM   7900 C C   . GLY B 2 487 ? 1.015   24.212  -38.783 1.00 38.86  ? 487  GLY B C   1 
ATOM   7901 O O   . GLY B 2 487 ? 1.890   24.189  -37.900 1.00 40.09  ? 487  GLY B O   1 
ATOM   7902 N N   . ASP B 2 488 ? -0.298  24.232  -38.519 1.00 38.19  ? 488  ASP B N   1 
ATOM   7903 C CA  . ASP B 2 488 ? -0.794  24.305  -37.151 1.00 33.17  ? 488  ASP B CA  1 
ATOM   7904 C C   . ASP B 2 488 ? -1.988  23.360  -36.982 1.00 36.27  ? 488  ASP B C   1 
ATOM   7905 O O   . ASP B 2 488 ? -2.991  23.520  -37.634 1.00 35.24  ? 488  ASP B O   1 
ATOM   7906 C CB  . ASP B 2 488 ? -1.195  25.751  -36.877 1.00 32.18  ? 488  ASP B CB  1 
ATOM   7907 C CG  . ASP B 2 488 ? -1.752  25.981  -35.481 1.00 39.14  ? 488  ASP B CG  1 
ATOM   7908 O OD1 . ASP B 2 488 ? -2.154  25.033  -34.791 1.00 50.18  ? 488  ASP B OD1 1 
ATOM   7909 O OD2 . ASP B 2 488 ? -1.807  27.151  -35.076 1.00 41.84  ? 488  ASP B OD2 1 
ATOM   7910 N N   . PRO B 2 489 ? -1.897  22.393  -36.073 1.00 38.63  ? 489  PRO B N   1 
ATOM   7911 C CA  . PRO B 2 489 ? -2.994  21.425  -35.990 1.00 36.14  ? 489  PRO B CA  1 
ATOM   7912 C C   . PRO B 2 489 ? -4.291  21.959  -35.350 1.00 40.85  ? 489  PRO B C   1 
ATOM   7913 O O   . PRO B 2 489 ? -5.290  21.256  -35.381 1.00 49.83  ? 489  PRO B O   1 
ATOM   7914 C CB  . PRO B 2 489 ? -2.392  20.335  -35.106 1.00 24.20  ? 489  PRO B CB  1 
ATOM   7915 C CG  . PRO B 2 489 ? -1.665  21.119  -34.112 1.00 31.94  ? 489  PRO B CG  1 
ATOM   7916 C CD  . PRO B 2 489 ? -0.907  22.147  -35.011 1.00 40.42  ? 489  PRO B CD  1 
ATOM   7917 N N   . ASN B 2 490 ? -4.285  23.141  -34.748 1.00 38.90  ? 490  ASN B N   1 
ATOM   7918 C CA  . ASN B 2 490 ? -5.516  23.686  -34.157 1.00 37.58  ? 490  ASN B CA  1 
ATOM   7919 C C   . ASN B 2 490 ? -6.524  24.182  -35.189 1.00 43.82  ? 490  ASN B C   1 
ATOM   7920 O O   . ASN B 2 490 ? -6.150  24.664  -36.263 1.00 41.01  ? 490  ASN B O   1 
ATOM   7921 C CB  . ASN B 2 490 ? -5.203  24.828  -33.181 1.00 37.75  ? 490  ASN B CB  1 
ATOM   7922 C CG  . ASN B 2 490 ? -4.408  24.365  -31.977 1.00 41.96  ? 490  ASN B CG  1 
ATOM   7923 O OD1 . ASN B 2 490 ? -4.957  23.740  -31.061 1.00 46.43  ? 490  ASN B OD1 1 
ATOM   7924 N ND2 . ASN B 2 490 ? -3.115  24.679  -31.960 1.00 27.80  ? 490  ASN B ND2 1 
ATOM   7925 N N   . ASP B 2 491 ? -7.805  24.062  -34.860 1.00 54.21  ? 491  ASP B N   1 
ATOM   7926 C CA  . ASP B 2 491 ? -8.891  24.465  -35.757 1.00 63.46  ? 491  ASP B CA  1 
ATOM   7927 C C   . ASP B 2 491 ? -8.919  25.990  -35.806 1.00 64.89  ? 491  ASP B C   1 
ATOM   7928 O O   . ASP B 2 491 ? -8.926  26.625  -34.760 1.00 68.23  ? 491  ASP B O   1 
ATOM   7929 C CB  . ASP B 2 491 ? -10.226 23.927  -35.206 1.00 76.20  ? 491  ASP B CB  1 
ATOM   7930 C CG  . ASP B 2 491 ? -11.171 23.402  -36.302 1.00 88.67  ? 491  ASP B CG  1 
ATOM   7931 O OD1 . ASP B 2 491 ? -11.557 24.175  -37.220 1.00 95.90  ? 491  ASP B OD1 1 
ATOM   7932 O OD2 . ASP B 2 491 ? -11.553 22.214  -36.225 1.00 86.02  ? 491  ASP B OD2 1 
ATOM   7933 N N   . PRO B 2 492 ? -8.924  26.591  -37.011 1.00 69.27  ? 492  PRO B N   1 
ATOM   7934 C CA  . PRO B 2 492 ? -8.961  28.065  -37.058 1.00 75.22  ? 492  PRO B CA  1 
ATOM   7935 C C   . PRO B 2 492 ? -10.329 28.658  -36.677 1.00 85.15  ? 492  PRO B C   1 
ATOM   7936 O O   . PRO B 2 492 ? -10.469 29.878  -36.661 1.00 88.46  ? 492  PRO B O   1 
ATOM   7937 C CB  . PRO B 2 492 ? -8.602  28.399  -38.516 1.00 75.43  ? 492  PRO B CB  1 
ATOM   7938 C CG  . PRO B 2 492 ? -8.159  27.068  -39.152 1.00 71.05  ? 492  PRO B CG  1 
ATOM   7939 C CD  . PRO B 2 492 ? -8.821  25.989  -38.352 1.00 68.97  ? 492  PRO B CD  1 
ATOM   7940 N N   . ARG B 2 493 ? -11.308 27.806  -36.374 1.00 93.43  ? 493  ARG B N   1 
ATOM   7941 C CA  . ARG B 2 493 ? -12.583 28.239  -35.794 1.00 105.14 ? 493  ARG B CA  1 
ATOM   7942 C C   . ARG B 2 493 ? -12.912 27.375  -34.575 1.00 109.25 ? 493  ARG B C   1 
ATOM   7943 O O   . ARG B 2 493 ? -12.928 26.144  -34.678 1.00 111.49 ? 493  ARG B O   1 
ATOM   7944 C CB  . ARG B 2 493 ? -13.710 28.136  -36.823 1.00 111.83 ? 493  ARG B CB  1 
ATOM   7945 N N   . ASP B 2 494 ? -13.180 28.020  -33.439 1.00 109.83 ? 494  ASP B N   1 
ATOM   7946 C CA  . ASP B 2 494 ? -13.296 27.344  -32.143 1.00 111.00 ? 494  ASP B CA  1 
ATOM   7947 C C   . ASP B 2 494 ? -12.570 28.156  -31.065 1.00 108.76 ? 494  ASP B C   1 
ATOM   7948 O O   . ASP B 2 494 ? -13.188 28.709  -30.144 1.00 105.58 ? 494  ASP B O   1 
ATOM   7949 C CB  . ASP B 2 494 ? -12.727 25.917  -32.225 1.00 115.10 ? 494  ASP B CB  1 
ATOM   7950 C CG  . ASP B 2 494 ? -12.539 25.259  -30.861 1.00 120.73 ? 494  ASP B CG  1 
ATOM   7951 O OD1 . ASP B 2 494 ? -12.541 25.957  -29.819 1.00 122.97 ? 494  ASP B OD1 1 
ATOM   7952 O OD2 . ASP B 2 494 ? -12.374 24.019  -30.839 1.00 120.12 ? 494  ASP B OD2 1 
ATOM   7953 N N   . PRO B 2 498 ? -9.403  23.225  -25.488 1.00 70.43  ? 498  PRO B N   1 
ATOM   7954 C CA  . PRO B 2 498 ? -8.048  23.677  -25.134 1.00 68.54  ? 498  PRO B CA  1 
ATOM   7955 C C   . PRO B 2 498 ? -7.159  23.601  -26.378 1.00 58.00  ? 498  PRO B C   1 
ATOM   7956 O O   . PRO B 2 498 ? -7.297  22.666  -27.164 1.00 58.83  ? 498  PRO B O   1 
ATOM   7957 C CB  . PRO B 2 498 ? -7.590  22.639  -24.086 1.00 74.07  ? 498  PRO B CB  1 
ATOM   7958 C CG  . PRO B 2 498 ? -8.659  21.483  -24.135 1.00 63.36  ? 498  PRO B CG  1 
ATOM   7959 C CD  . PRO B 2 498 ? -9.548  21.766  -25.328 1.00 66.60  ? 498  PRO B CD  1 
ATOM   7960 N N   . ASP B 2 499 ? -6.272  24.568  -26.576 1.00 51.59  ? 499  ASP B N   1 
ATOM   7961 C CA  . ASP B 2 499 ? -5.486  24.577  -27.803 1.00 45.93  ? 499  ASP B CA  1 
ATOM   7962 C C   . ASP B 2 499 ? -4.203  23.725  -27.635 1.00 38.04  ? 499  ASP B C   1 
ATOM   7963 O O   . ASP B 2 499 ? -3.709  23.530  -26.530 1.00 34.23  ? 499  ASP B O   1 
ATOM   7964 C CB  . ASP B 2 499 ? -5.259  26.024  -28.339 1.00 38.80  ? 499  ASP B CB  1 
ATOM   7965 C CG  . ASP B 2 499 ? -6.548  26.614  -29.062 1.00 62.48  ? 499  ASP B CG  1 
ATOM   7966 O OD1 . ASP B 2 499 ? -7.553  26.847  -28.372 1.00 69.18  ? 499  ASP B OD1 1 
ATOM   7967 O OD2 . ASP B 2 499 ? -6.597  26.826  -30.303 1.00 48.85  ? 499  ASP B OD2 1 
ATOM   7968 N N   . TRP B 2 500 ? -3.727  23.163  -28.730 1.00 32.46  ? 500  TRP B N   1 
ATOM   7969 C CA  . TRP B 2 500 ? -2.475  22.406  -28.730 1.00 37.17  ? 500  TRP B CA  1 
ATOM   7970 C C   . TRP B 2 500 ? -1.318  23.411  -28.849 1.00 30.28  ? 500  TRP B C   1 
ATOM   7971 O O   . TRP B 2 500 ? -1.148  24.020  -29.892 1.00 32.06  ? 500  TRP B O   1 
ATOM   7972 C CB  . TRP B 2 500 ? -2.494  21.487  -29.945 1.00 29.13  ? 500  TRP B CB  1 
ATOM   7973 C CG  . TRP B 2 500 ? -1.404  20.470  -30.036 1.00 32.91  ? 500  TRP B CG  1 
ATOM   7974 C CD1 . TRP B 2 500 ? -0.158  20.519  -29.464 1.00 34.57  ? 500  TRP B CD1 1 
ATOM   7975 C CD2 . TRP B 2 500 ? -1.447  19.272  -30.801 1.00 28.25  ? 500  TRP B CD2 1 
ATOM   7976 N NE1 . TRP B 2 500 ? 0.568   19.407  -29.823 1.00 31.98  ? 500  TRP B NE1 1 
ATOM   7977 C CE2 . TRP B 2 500 ? -0.201  18.631  -30.649 1.00 37.95  ? 500  TRP B CE2 1 
ATOM   7978 C CE3 . TRP B 2 500 ? -2.417  18.677  -31.607 1.00 34.77  ? 500  TRP B CE3 1 
ATOM   7979 C CZ2 . TRP B 2 500 ? 0.086   17.408  -31.267 1.00 38.20  ? 500  TRP B CZ2 1 
ATOM   7980 C CZ3 . TRP B 2 500 ? -2.130  17.469  -32.224 1.00 32.79  ? 500  TRP B CZ3 1 
ATOM   7981 C CH2 . TRP B 2 500 ? -0.896  16.851  -32.048 1.00 37.00  ? 500  TRP B CH2 1 
ATOM   7982 N N   . PRO B 2 501 ? -0.538  23.605  -27.781 1.00 27.37  ? 501  PRO B N   1 
ATOM   7983 C CA  . PRO B 2 501 ? 0.484   24.649  -27.896 1.00 26.02  ? 501  PRO B CA  1 
ATOM   7984 C C   . PRO B 2 501 ? 1.761   24.079  -28.548 1.00 32.03  ? 501  PRO B C   1 
ATOM   7985 O O   . PRO B 2 501 ? 1.951   22.860  -28.474 1.00 30.20  ? 501  PRO B O   1 
ATOM   7986 C CB  . PRO B 2 501 ? 0.755   25.014  -26.436 1.00 23.38  ? 501  PRO B CB  1 
ATOM   7987 C CG  . PRO B 2 501 ? 0.597   23.704  -25.700 1.00 29.41  ? 501  PRO B CG  1 
ATOM   7988 C CD  . PRO B 2 501 ? -0.571  23.008  -26.426 1.00 31.21  ? 501  PRO B CD  1 
ATOM   7989 N N   . PRO B 2 502 ? 2.590   24.934  -29.189 1.00 29.92  ? 502  PRO B N   1 
ATOM   7990 C CA  . PRO B 2 502 ? 3.874   24.508  -29.778 1.00 36.69  ? 502  PRO B CA  1 
ATOM   7991 C C   . PRO B 2 502 ? 4.832   23.987  -28.713 1.00 41.53  ? 502  PRO B C   1 
ATOM   7992 O O   . PRO B 2 502 ? 4.861   24.525  -27.608 1.00 39.24  ? 502  PRO B O   1 
ATOM   7993 C CB  . PRO B 2 502 ? 4.436   25.797  -30.375 1.00 32.91  ? 502  PRO B CB  1 
ATOM   7994 C CG  . PRO B 2 502 ? 3.171   26.636  -30.670 1.00 30.43  ? 502  PRO B CG  1 
ATOM   7995 C CD  . PRO B 2 502 ? 2.300   26.350  -29.475 1.00 28.38  ? 502  PRO B CD  1 
ATOM   7996 N N   . TYR B 2 503 ? 5.564   22.926  -29.045 1.00 35.88  ? 503  TYR B N   1 
ATOM   7997 C CA  . TYR B 2 503 ? 6.620   22.414  -28.204 1.00 35.17  ? 503  TYR B CA  1 
ATOM   7998 C C   . TYR B 2 503 ? 7.815   23.365  -28.276 1.00 32.09  ? 503  TYR B C   1 
ATOM   7999 O O   . TYR B 2 503 ? 8.233   23.750  -29.364 1.00 33.66  ? 503  TYR B O   1 
ATOM   8000 C CB  . TYR B 2 503 ? 7.049   21.028  -28.705 1.00 32.56  ? 503  TYR B CB  1 
ATOM   8001 C CG  . TYR B 2 503 ? 8.100   20.360  -27.847 1.00 34.14  ? 503  TYR B CG  1 
ATOM   8002 C CD1 . TYR B 2 503 ? 9.458   20.629  -28.035 1.00 37.31  ? 503  TYR B CD1 1 
ATOM   8003 C CD2 . TYR B 2 503 ? 7.735   19.453  -26.838 1.00 32.32  ? 503  TYR B CD2 1 
ATOM   8004 C CE1 . TYR B 2 503 ? 10.420  20.021  -27.237 1.00 35.95  ? 503  TYR B CE1 1 
ATOM   8005 C CE2 . TYR B 2 503 ? 8.688   18.836  -26.035 1.00 30.22  ? 503  TYR B CE2 1 
ATOM   8006 C CZ  . TYR B 2 503 ? 10.026  19.122  -26.237 1.00 35.08  ? 503  TYR B CZ  1 
ATOM   8007 O OH  . TYR B 2 503 ? 10.966  18.502  -25.442 1.00 36.61  ? 503  TYR B OH  1 
ATOM   8008 N N   . THR B 2 504 ? 8.377   23.715  -27.124 1.00 29.76  ? 504  THR B N   1 
ATOM   8009 C CA  . THR B 2 504 ? 9.531   24.609  -27.070 1.00 38.13  ? 504  THR B CA  1 
ATOM   8010 C C   . THR B 2 504 ? 10.537  24.034  -26.093 1.00 37.33  ? 504  THR B C   1 
ATOM   8011 O O   . THR B 2 504 ? 10.192  23.227  -25.243 1.00 36.26  ? 504  THR B O   1 
ATOM   8012 C CB  . THR B 2 504 ? 9.100   25.978  -26.558 1.00 38.21  ? 504  THR B CB  1 
ATOM   8013 O OG1 . THR B 2 504 ? 8.593   25.808  -25.232 1.00 36.21  ? 504  THR B OG1 1 
ATOM   8014 C CG2 . THR B 2 504 ? 7.966   26.571  -27.469 1.00 31.28  ? 504  THR B CG2 1 
ATOM   8015 N N   . THR B 2 505 ? 11.788  24.439  -26.187 1.00 44.95  ? 505  THR B N   1 
ATOM   8016 C CA  . THR B 2 505 ? 12.763  23.914  -25.222 1.00 48.86  ? 505  THR B CA  1 
ATOM   8017 C C   . THR B 2 505 ? 12.469  24.488  -23.837 1.00 45.17  ? 505  THR B C   1 
ATOM   8018 O O   . THR B 2 505 ? 12.703  23.833  -22.842 1.00 44.58  ? 505  THR B O   1 
ATOM   8019 C CB  . THR B 2 505 ? 14.247  24.203  -25.628 1.00 44.68  ? 505  THR B CB  1 
ATOM   8020 O OG1 . THR B 2 505 ? 14.413  25.603  -25.871 1.00 46.96  ? 505  THR B OG1 1 
ATOM   8021 C CG2 . THR B 2 505 ? 14.615  23.449  -26.883 1.00 35.36  ? 505  THR B CG2 1 
ATOM   8022 N N   . ALA B 2 506 ? 11.931  25.705  -23.786 1.00 37.53  ? 506  ALA B N   1 
ATOM   8023 C CA  . ALA B 2 506 ? 11.618  26.326  -22.503 1.00 42.61  ? 506  ALA B CA  1 
ATOM   8024 C C   . ALA B 2 506 ? 10.487  25.630  -21.711 1.00 52.36  ? 506  ALA B C   1 
ATOM   8025 O O   . ALA B 2 506 ? 10.680  25.300  -20.545 1.00 57.20  ? 506  ALA B O   1 
ATOM   8026 C CB  . ALA B 2 506 ? 11.326  27.827  -22.678 1.00 36.64  ? 506  ALA B CB  1 
ATOM   8027 N N   . ALA B 2 507 ? 9.315   25.402  -22.312 1.00 42.08  ? 507  ALA B N   1 
ATOM   8028 C CA  . ALA B 2 507 ? 8.233   24.799  -21.530 1.00 36.29  ? 507  ALA B CA  1 
ATOM   8029 C C   . ALA B 2 507 ? 7.985   23.327  -21.845 1.00 32.37  ? 507  ALA B C   1 
ATOM   8030 O O   . ALA B 2 507 ? 7.274   22.652  -21.121 1.00 40.27  ? 507  ALA B O   1 
ATOM   8031 C CB  . ALA B 2 507 ? 6.946   25.607  -21.649 1.00 35.94  ? 507  ALA B CB  1 
ATOM   8032 N N   . GLN B 2 508 ? 8.533   22.843  -22.942 1.00 29.45  ? 508  GLN B N   1 
ATOM   8033 C CA  . GLN B 2 508 ? 8.370   21.433  -23.301 1.00 32.66  ? 508  GLN B CA  1 
ATOM   8034 C C   . GLN B 2 508 ? 6.924   20.878  -23.320 1.00 35.04  ? 508  GLN B C   1 
ATOM   8035 O O   . GLN B 2 508 ? 6.667   19.723  -22.911 1.00 35.16  ? 508  GLN B O   1 
ATOM   8036 C CB  . GLN B 2 508 ? 9.266   20.596  -22.392 1.00 32.35  ? 508  GLN B CB  1 
ATOM   8037 C CG  . GLN B 2 508 ? 10.730  20.993  -22.533 1.00 38.05  ? 508  GLN B CG  1 
ATOM   8038 C CD  . GLN B 2 508 ? 11.624  20.312  -21.517 1.00 40.26  ? 508  GLN B CD  1 
ATOM   8039 O OE1 . GLN B 2 508 ? 11.718  19.093  -21.486 1.00 42.65  ? 508  GLN B OE1 1 
ATOM   8040 N NE2 . GLN B 2 508 ? 12.277  21.097  -20.682 1.00 41.88  ? 508  GLN B NE2 1 
ATOM   8041 N N   . GLN B 2 509 ? 5.983   21.677  -23.817 1.00 34.56  ? 509  GLN B N   1 
ATOM   8042 C CA  . GLN B 2 509 ? 4.584   21.235  -23.840 1.00 35.05  ? 509  GLN B CA  1 
ATOM   8043 C C   . GLN B 2 509 ? 4.243   20.250  -24.956 1.00 29.97  ? 509  GLN B C   1 
ATOM   8044 O O   . GLN B 2 509 ? 4.684   20.394  -26.096 1.00 32.61  ? 509  GLN B O   1 
ATOM   8045 C CB  . GLN B 2 509 ? 3.646   22.442  -23.880 1.00 26.71  ? 509  GLN B CB  1 
ATOM   8046 C CG  . GLN B 2 509 ? 3.761   23.275  -22.633 1.00 28.59  ? 509  GLN B CG  1 
ATOM   8047 C CD  . GLN B 2 509 ? 3.156   24.644  -22.839 1.00 39.79  ? 509  GLN B CD  1 
ATOM   8048 O OE1 . GLN B 2 509 ? 3.626   25.434  -23.676 1.00 38.47  ? 509  GLN B OE1 1 
ATOM   8049 N NE2 . GLN B 2 509 ? 2.094   24.928  -22.099 1.00 33.15  ? 509  GLN B NE2 1 
ATOM   8050 N N   . TYR B 2 510 ? 3.455   19.248  -24.607 1.00 26.96  ? 510  TYR B N   1 
ATOM   8051 C CA  . TYR B 2 510 ? 2.915   18.298  -25.582 1.00 28.38  ? 510  TYR B CA  1 
ATOM   8052 C C   . TYR B 2 510 ? 1.498   17.872  -25.136 1.00 30.34  ? 510  TYR B C   1 
ATOM   8053 O O   . TYR B 2 510 ? 1.082   18.155  -24.017 1.00 31.70  ? 510  TYR B O   1 
ATOM   8054 C CB  . TYR B 2 510 ? 3.845   17.077  -25.729 1.00 25.29  ? 510  TYR B CB  1 
ATOM   8055 C CG  . TYR B 2 510 ? 3.912   16.233  -24.474 1.00 31.19  ? 510  TYR B CG  1 
ATOM   8056 C CD1 . TYR B 2 510 ? 4.713   16.610  -23.389 1.00 30.36  ? 510  TYR B CD1 1 
ATOM   8057 C CD2 . TYR B 2 510 ? 3.161   15.066  -24.359 1.00 34.98  ? 510  TYR B CD2 1 
ATOM   8058 C CE1 . TYR B 2 510 ? 4.762   15.836  -22.224 1.00 32.22  ? 510  TYR B CE1 1 
ATOM   8059 C CE2 . TYR B 2 510 ? 3.201   14.288  -23.203 1.00 26.43  ? 510  TYR B CE2 1 
ATOM   8060 C CZ  . TYR B 2 510 ? 3.996   14.658  -22.163 1.00 31.98  ? 510  TYR B CZ  1 
ATOM   8061 O OH  . TYR B 2 510 ? 3.980   13.888  -21.036 1.00 35.08  ? 510  TYR B OH  1 
ATOM   8062 N N   . VAL B 2 511 ? 0.743   17.203  -25.995 1.00 29.91  ? 511  VAL B N   1 
ATOM   8063 C CA  . VAL B 2 511 ? -0.626  16.877  -25.607 1.00 30.63  ? 511  VAL B CA  1 
ATOM   8064 C C   . VAL B 2 511 ? -0.879  15.366  -25.627 1.00 36.07  ? 511  VAL B C   1 
ATOM   8065 O O   . VAL B 2 511 ? -0.237  14.632  -26.364 1.00 26.23  ? 511  VAL B O   1 
ATOM   8066 C CB  . VAL B 2 511 ? -1.609  17.556  -26.534 1.00 30.22  ? 511  VAL B CB  1 
ATOM   8067 C CG1 . VAL B 2 511 ? -1.384  19.083  -26.499 1.00 27.04  ? 511  VAL B CG1 1 
ATOM   8068 C CG2 . VAL B 2 511 ? -1.443  16.995  -27.943 1.00 26.52  ? 511  VAL B CG2 1 
ATOM   8069 N N   . SER B 2 512 ? -1.807  14.904  -24.804 1.00 35.40  ? 512  SER B N   1 
ATOM   8070 C CA  . SER B 2 512 ? -2.214  13.526  -24.899 1.00 36.96  ? 512  SER B CA  1 
ATOM   8071 C C   . SER B 2 512 ? -3.371  13.426  -25.906 1.00 40.09  ? 512  SER B C   1 
ATOM   8072 O O   . SER B 2 512 ? -4.370  14.170  -25.827 1.00 34.54  ? 512  SER B O   1 
ATOM   8073 C CB  . SER B 2 512 ? -2.639  13.025  -23.533 1.00 34.21  ? 512  SER B CB  1 
ATOM   8074 O OG  . SER B 2 512 ? -3.454  14.021  -22.939 1.00 46.00  ? 512  SER B OG  1 
ATOM   8075 N N   . LEU B 2 513 ? -3.229  12.513  -26.864 1.00 36.05  ? 513  LEU B N   1 
ATOM   8076 C CA  . LEU B 2 513 ? -4.331  12.182  -27.767 1.00 34.26  ? 513  LEU B CA  1 
ATOM   8077 C C   . LEU B 2 513 ? -5.028  10.936  -27.226 1.00 38.98  ? 513  LEU B C   1 
ATOM   8078 O O   . LEU B 2 513 ? -4.447  9.848   -27.200 1.00 37.23  ? 513  LEU B O   1 
ATOM   8079 C CB  . LEU B 2 513 ? -3.786  11.916  -29.163 1.00 32.61  ? 513  LEU B CB  1 
ATOM   8080 C CG  . LEU B 2 513 ? -3.109  13.168  -29.711 1.00 36.81  ? 513  LEU B CG  1 
ATOM   8081 C CD1 . LEU B 2 513 ? -2.448  12.879  -31.070 1.00 34.23  ? 513  LEU B CD1 1 
ATOM   8082 C CD2 . LEU B 2 513 ? -4.216  14.273  -29.818 1.00 27.30  ? 513  LEU B CD2 1 
ATOM   8083 N N   . ASN B 2 514 ? -6.253  11.112  -26.751 1.00 37.09  ? 514  ASN B N   1 
ATOM   8084 C CA  . ASN B 2 514 ? -7.072  10.001  -26.293 1.00 36.29  ? 514  ASN B CA  1 
ATOM   8085 C C   . ASN B 2 514 ? -8.556  10.408  -26.392 1.00 42.66  ? 514  ASN B C   1 
ATOM   8086 O O   . ASN B 2 514 ? -8.870  11.437  -27.026 1.00 37.90  ? 514  ASN B O   1 
ATOM   8087 C CB  . ASN B 2 514 ? -6.669  9.542   -24.880 1.00 39.50  ? 514  ASN B CB  1 
ATOM   8088 C CG  . ASN B 2 514 ? -6.750  10.656  -23.842 1.00 45.55  ? 514  ASN B CG  1 
ATOM   8089 O OD1 . ASN B 2 514 ? -7.726  11.412  -23.809 1.00 53.08  ? 514  ASN B OD1 1 
ATOM   8090 N ND2 . ASN B 2 514 ? -5.742  10.736  -22.958 1.00 42.10  ? 514  ASN B ND2 1 
ATOM   8091 N N   . LEU B 2 515 ? -9.459  9.627   -25.797 1.00 38.08  ? 515  LEU B N   1 
ATOM   8092 C CA  . LEU B 2 515 ? -10.882 9.900   -25.974 1.00 44.14  ? 515  LEU B CA  1 
ATOM   8093 C C   . LEU B 2 515 ? -11.324 11.186  -25.291 1.00 45.64  ? 515  LEU B C   1 
ATOM   8094 O O   . LEU B 2 515 ? -12.266 11.820  -25.740 1.00 55.79  ? 515  LEU B O   1 
ATOM   8095 C CB  . LEU B 2 515 ? -11.764 8.715   -25.551 1.00 46.24  ? 515  LEU B CB  1 
ATOM   8096 C CG  . LEU B 2 515 ? -11.514 7.397   -26.297 1.00 46.93  ? 515  LEU B CG  1 
ATOM   8097 C CD1 . LEU B 2 515 ? -12.359 6.306   -25.696 1.00 53.27  ? 515  LEU B CD1 1 
ATOM   8098 C CD2 . LEU B 2 515 ? -11.778 7.514   -27.801 1.00 41.51  ? 515  LEU B CD2 1 
ATOM   8099 N N   . LYS B 2 516 ? -10.633 11.574  -24.225 1.00 48.67  ? 516  LYS B N   1 
ATOM   8100 C CA  . LYS B 2 516 ? -10.899 12.842  -23.516 1.00 50.14  ? 516  LYS B CA  1 
ATOM   8101 C C   . LYS B 2 516 ? -10.327 14.038  -24.289 1.00 49.46  ? 516  LYS B C   1 
ATOM   8102 O O   . LYS B 2 516 ? -9.510  13.877  -25.181 1.00 43.34  ? 516  LYS B O   1 
ATOM   8103 C CB  . LYS B 2 516 ? -10.279 12.790  -22.113 1.00 51.97  ? 516  LYS B CB  1 
ATOM   8104 C CG  . LYS B 2 516 ? -10.770 11.616  -21.275 1.00 56.86  ? 516  LYS B CG  1 
ATOM   8105 C CD  . LYS B 2 516 ? -9.959  11.444  -19.993 1.00 70.24  ? 516  LYS B CD  1 
ATOM   8106 C CE  . LYS B 2 516 ? -8.751  10.531  -20.227 1.00 84.23  ? 516  LYS B CE  1 
ATOM   8107 N NZ  . LYS B 2 516 ? -7.721  10.570  -19.117 1.00 91.34  ? 516  LYS B NZ  1 
ATOM   8108 N N   . PRO B 2 517 ? -10.763 15.255  -23.965 1.00 52.82  ? 517  PRO B N   1 
ATOM   8109 C CA  . PRO B 2 517 ? -10.168 16.409  -24.662 1.00 46.40  ? 517  PRO B CA  1 
ATOM   8110 C C   . PRO B 2 517 ? -8.657  16.569  -24.447 1.00 48.71  ? 517  PRO B C   1 
ATOM   8111 O O   . PRO B 2 517 ? -8.068  16.065  -23.478 1.00 50.94  ? 517  PRO B O   1 
ATOM   8112 C CB  . PRO B 2 517 ? -10.909 17.604  -24.053 1.00 50.00  ? 517  PRO B CB  1 
ATOM   8113 C CG  . PRO B 2 517 ? -12.223 17.021  -23.549 1.00 47.79  ? 517  PRO B CG  1 
ATOM   8114 C CD  . PRO B 2 517 ? -11.915 15.622  -23.124 1.00 49.54  ? 517  PRO B CD  1 
ATOM   8115 N N   . LEU B 2 518 ? -8.027  17.279  -25.375 1.00 43.06  ? 518  LEU B N   1 
ATOM   8116 C CA  . LEU B 2 518 ? -6.621  17.559  -25.276 1.00 40.85  ? 518  LEU B CA  1 
ATOM   8117 C C   . LEU B 2 518 ? -6.247  17.985  -23.873 1.00 39.38  ? 518  LEU B C   1 
ATOM   8118 O O   . LEU B 2 518 ? -6.823  18.900  -23.314 1.00 38.42  ? 518  LEU B O   1 
ATOM   8119 C CB  . LEU B 2 518 ? -6.243  18.706  -26.203 1.00 40.79  ? 518  LEU B CB  1 
ATOM   8120 C CG  . LEU B 2 518 ? -6.086  18.495  -27.688 1.00 39.42  ? 518  LEU B CG  1 
ATOM   8121 C CD1 . LEU B 2 518 ? -5.292  19.677  -28.219 1.00 40.83  ? 518  LEU B CD1 1 
ATOM   8122 C CD2 . LEU B 2 518 ? -5.367  17.193  -27.981 1.00 35.48  ? 518  LEU B CD2 1 
ATOM   8123 N N   . GLU B 2 519 ? -5.231  17.353  -23.328 1.00 37.81  ? 519  GLU B N   1 
ATOM   8124 C CA  . GLU B 2 519 ? -4.681  17.812  -22.082 1.00 41.88  ? 519  GLU B CA  1 
ATOM   8125 C C   . GLU B 2 519 ? -3.219  18.162  -22.369 1.00 42.33  ? 519  GLU B C   1 
ATOM   8126 O O   . GLU B 2 519 ? -2.523  17.419  -23.073 1.00 40.00  ? 519  GLU B O   1 
ATOM   8127 C CB  . GLU B 2 519 ? -4.825  16.707  -21.048 1.00 44.21  ? 519  GLU B CB  1 
ATOM   8128 C CG  . GLU B 2 519 ? -3.777  16.638  -19.970 1.00 54.38  ? 519  GLU B CG  1 
ATOM   8129 C CD  . GLU B 2 519 ? -4.052  15.468  -19.026 1.00 61.96  ? 519  GLU B CD  1 
ATOM   8130 O OE1 . GLU B 2 519 ? -5.258  15.227  -18.728 1.00 67.84  ? 519  GLU B OE1 1 
ATOM   8131 O OE2 . GLU B 2 519 ? -3.085  14.793  -18.600 1.00 56.45  ? 519  GLU B OE2 1 
ATOM   8132 N N   . VAL B 2 520 ? -2.765  19.297  -21.848 1.00 34.38  ? 520  VAL B N   1 
ATOM   8133 C CA  . VAL B 2 520 ? -1.393  19.730  -22.066 1.00 32.11  ? 520  VAL B CA  1 
ATOM   8134 C C   . VAL B 2 520 ? -0.449  19.176  -20.974 1.00 35.42  ? 520  VAL B C   1 
ATOM   8135 O O   . VAL B 2 520 ? -0.756  19.228  -19.805 1.00 36.93  ? 520  VAL B O   1 
ATOM   8136 C CB  . VAL B 2 520 ? -1.325  21.287  -22.099 1.00 30.45  ? 520  VAL B CB  1 
ATOM   8137 C CG1 . VAL B 2 520 ? 0.143   21.762  -22.281 1.00 30.10  ? 520  VAL B CG1 1 
ATOM   8138 C CG2 . VAL B 2 520 ? -2.235  21.837  -23.231 1.00 25.40  ? 520  VAL B CG2 1 
ATOM   8139 N N   . ARG B 2 521 ? 0.708   18.652  -21.347 1.00 38.34  ? 521  ARG B N   1 
ATOM   8140 C CA  . ARG B 2 521 ? 1.658   18.143  -20.349 1.00 34.82  ? 521  ARG B CA  1 
ATOM   8141 C C   . ARG B 2 521 ? 3.011   18.745  -20.638 1.00 31.71  ? 521  ARG B C   1 
ATOM   8142 O O   . ARG B 2 521 ? 3.250   19.267  -21.731 1.00 33.82  ? 521  ARG B O   1 
ATOM   8143 C CB  . ARG B 2 521 ? 1.751   16.611  -20.408 1.00 36.82  ? 521  ARG B CB  1 
ATOM   8144 C CG  . ARG B 2 521 ? 0.475   15.911  -19.977 1.00 38.10  ? 521  ARG B CG  1 
ATOM   8145 C CD  . ARG B 2 521 ? 0.544   14.391  -20.070 1.00 38.82  ? 521  ARG B CD  1 
ATOM   8146 N NE  . ARG B 2 521 ? -0.803  13.800  -19.950 1.00 39.54  ? 521  ARG B NE  1 
ATOM   8147 C CZ  . ARG B 2 521 ? -1.094  12.541  -20.291 1.00 41.12  ? 521  ARG B CZ  1 
ATOM   8148 N NH1 . ARG B 2 521 ? -0.132  11.760  -20.758 1.00 35.98  ? 521  ARG B NH1 1 
ATOM   8149 N NH2 . ARG B 2 521 ? -2.335  12.059  -20.166 1.00 39.83  ? 521  ARG B NH2 1 
ATOM   8150 N N   . ARG B 2 522 ? 3.896   18.704  -19.659 1.00 28.17  ? 522  ARG B N   1 
ATOM   8151 C CA  . ARG B 2 522 ? 5.199   19.322  -19.825 1.00 33.70  ? 522  ARG B CA  1 
ATOM   8152 C C   . ARG B 2 522 ? 6.258   18.262  -19.604 1.00 33.48  ? 522  ARG B C   1 
ATOM   8153 O O   . ARG B 2 522 ? 6.236   17.565  -18.602 1.00 33.57  ? 522  ARG B O   1 
ATOM   8154 C CB  . ARG B 2 522 ? 5.372   20.546  -18.906 1.00 31.09  ? 522  ARG B CB  1 
ATOM   8155 C CG  . ARG B 2 522 ? 4.416   21.667  -19.317 1.00 42.36  ? 522  ARG B CG  1 
ATOM   8156 C CD  . ARG B 2 522 ? 4.481   22.934  -18.426 1.00 41.82  ? 522  ARG B CD  1 
ATOM   8157 N NE  . ARG B 2 522 ? 5.828   23.502  -18.344 1.00 46.63  ? 522  ARG B NE  1 
ATOM   8158 C CZ  . ARG B 2 522 ? 6.112   24.668  -17.757 1.00 50.21  ? 522  ARG B CZ  1 
ATOM   8159 N NH1 . ARG B 2 522 ? 5.130   25.399  -17.210 1.00 42.47  ? 522  ARG B NH1 1 
ATOM   8160 N NH2 . ARG B 2 522 ? 7.374   25.103  -17.723 1.00 43.79  ? 522  ARG B NH2 1 
ATOM   8161 N N   . GLY B 2 523 ? 7.140   18.098  -20.576 1.00 33.16  ? 523  GLY B N   1 
ATOM   8162 C CA  . GLY B 2 523 ? 8.301   17.271  -20.357 1.00 36.00  ? 523  GLY B CA  1 
ATOM   8163 C C   . GLY B 2 523 ? 8.000   15.862  -20.764 1.00 36.18  ? 523  GLY B C   1 
ATOM   8164 O O   . GLY B 2 523 ? 7.232   15.180  -20.115 1.00 47.35  ? 523  GLY B O   1 
ATOM   8165 N N   . LEU B 2 524 ? 8.606   15.446  -21.864 1.00 32.96  ? 524  LEU B N   1 
ATOM   8166 C CA  . LEU B 2 524 ? 8.384   14.142  -22.437 1.00 37.55  ? 524  LEU B CA  1 
ATOM   8167 C C   . LEU B 2 524 ? 9.420   13.209  -21.822 1.00 36.95  ? 524  LEU B C   1 
ATOM   8168 O O   . LEU B 2 524 ? 10.550  13.114  -22.307 1.00 44.70  ? 524  LEU B O   1 
ATOM   8169 C CB  . LEU B 2 524 ? 8.557   14.258  -23.950 1.00 43.56  ? 524  LEU B CB  1 
ATOM   8170 C CG  . LEU B 2 524 ? 8.026   13.170  -24.879 1.00 56.93  ? 524  LEU B CG  1 
ATOM   8171 C CD1 . LEU B 2 524 ? 6.703   12.598  -24.381 1.00 59.34  ? 524  LEU B CD1 1 
ATOM   8172 C CD2 . LEU B 2 524 ? 7.865   13.770  -26.270 1.00 58.22  ? 524  LEU B CD2 1 
ATOM   8173 N N   . ARG B 2 525 ? 9.040   12.572  -20.720 1.00 37.87  ? 525  ARG B N   1 
ATOM   8174 C CA  . ARG B 2 525 ? 9.962   11.799  -19.878 1.00 42.43  ? 525  ARG B CA  1 
ATOM   8175 C C   . ARG B 2 525 ? 11.297  12.511  -19.692 1.00 39.20  ? 525  ARG B C   1 
ATOM   8176 O O   . ARG B 2 525 ? 12.357  11.933  -19.984 1.00 35.85  ? 525  ARG B O   1 
ATOM   8177 C CB  . ARG B 2 525 ? 10.239  10.425  -20.493 1.00 40.08  ? 525  ARG B CB  1 
ATOM   8178 C CG  . ARG B 2 525 ? 9.168   9.962   -21.377 1.00 49.60  ? 525  ARG B CG  1 
ATOM   8179 C CD  . ARG B 2 525 ? 8.209   9.126   -20.629 1.00 57.39  ? 525  ARG B CD  1 
ATOM   8180 N NE  . ARG B 2 525 ? 8.437   7.719   -20.891 1.00 60.87  ? 525  ARG B NE  1 
ATOM   8181 C CZ  . ARG B 2 525 ? 7.524   6.937   -21.448 1.00 66.47  ? 525  ARG B CZ  1 
ATOM   8182 N NH1 . ARG B 2 525 ? 6.350   7.459   -21.784 1.00 77.88  ? 525  ARG B NH1 1 
ATOM   8183 N NH2 . ARG B 2 525 ? 7.769   5.643   -21.657 1.00 59.94  ? 525  ARG B NH2 1 
ATOM   8184 N N   . ALA B 2 526 ? 11.259  13.737  -19.178 1.00 39.95  ? 526  ALA B N   1 
ATOM   8185 C CA  . ALA B 2 526 ? 12.447  14.567  -19.194 1.00 34.23  ? 526  ALA B CA  1 
ATOM   8186 C C   . ALA B 2 526 ? 13.613  13.962  -18.425 1.00 35.10  ? 526  ALA B C   1 
ATOM   8187 O O   . ALA B 2 526 ? 14.718  13.968  -18.948 1.00 33.46  ? 526  ALA B O   1 
ATOM   8188 C CB  . ALA B 2 526 ? 12.151  16.007  -18.749 1.00 40.74  ? 526  ALA B CB  1 
ATOM   8189 N N   . GLN B 2 527 ? 13.370  13.410  -17.226 1.00 35.71  ? 527  GLN B N   1 
ATOM   8190 C CA  . GLN B 2 527 ? 14.466  12.847  -16.406 1.00 35.28  ? 527  GLN B CA  1 
ATOM   8191 C C   . GLN B 2 527 ? 15.119  11.654  -17.058 1.00 37.19  ? 527  GLN B C   1 
ATOM   8192 O O   . GLN B 2 527 ? 16.343  11.583  -17.154 1.00 43.12  ? 527  GLN B O   1 
ATOM   8193 C CB  . GLN B 2 527 ? 14.025  12.456  -14.983 1.00 31.35  ? 527  GLN B CB  1 
ATOM   8194 C CG  . GLN B 2 527 ? 13.623  13.618  -14.115 1.00 38.26  ? 527  GLN B CG  1 
ATOM   8195 C CD  . GLN B 2 527 ? 14.743  14.661  -13.973 1.00 42.80  ? 527  GLN B CD  1 
ATOM   8196 O OE1 . GLN B 2 527 ? 15.748  14.439  -13.272 1.00 48.61  ? 527  GLN B OE1 1 
ATOM   8197 N NE2 . GLN B 2 527 ? 14.564  15.805  -14.623 1.00 37.09  ? 527  GLN B NE2 1 
ATOM   8198 N N   . THR B 2 528 ? 14.297  10.712  -17.502 1.00 33.88  ? 528  THR B N   1 
ATOM   8199 C CA  . THR B 2 528 ? 14.805  9.500   -18.106 1.00 34.14  ? 528  THR B CA  1 
ATOM   8200 C C   . THR B 2 528 ? 15.475  9.798   -19.441 1.00 36.29  ? 528  THR B C   1 
ATOM   8201 O O   . THR B 2 528 ? 16.483  9.180   -19.777 1.00 42.11  ? 528  THR B O   1 
ATOM   8202 C CB  . THR B 2 528 ? 13.659  8.469   -18.264 1.00 45.17  ? 528  THR B CB  1 
ATOM   8203 O OG1 . THR B 2 528 ? 13.310  7.964   -16.966 1.00 48.81  ? 528  THR B OG1 1 
ATOM   8204 C CG2 . THR B 2 528 ? 14.047  7.314   -19.187 1.00 41.73  ? 528  THR B CG2 1 
ATOM   8205 N N   . CYS B 2 529 ? 14.942  10.750  -20.201 1.00 30.90  ? 529  CYS B N   1 
ATOM   8206 C CA  . CYS B 2 529 ? 15.524  11.010  -21.500 1.00 30.24  ? 529  CYS B CA  1 
ATOM   8207 C C   . CYS B 2 529 ? 16.827  11.761  -21.325 1.00 33.95  ? 529  CYS B C   1 
ATOM   8208 O O   . CYS B 2 529 ? 17.690  11.702  -22.185 1.00 33.25  ? 529  CYS B O   1 
ATOM   8209 C CB  . CYS B 2 529 ? 14.539  11.732  -22.452 1.00 27.61  ? 529  CYS B CB  1 
ATOM   8210 S SG  . CYS B 2 529 ? 13.188  10.627  -23.075 1.00 35.43  ? 529  CYS B SG  1 
ATOM   8211 N N   . ALA B 2 530 ? 16.974  12.466  -20.202 1.00 28.84  ? 530  ALA B N   1 
ATOM   8212 C CA  . ALA B 2 530 ? 18.260  13.077  -19.898 1.00 37.34  ? 530  ALA B CA  1 
ATOM   8213 C C   . ALA B 2 530 ? 19.358  11.985  -19.716 1.00 35.31  ? 530  ALA B C   1 
ATOM   8214 O O   . ALA B 2 530 ? 20.491  12.135  -20.185 1.00 36.86  ? 530  ALA B O   1 
ATOM   8215 C CB  . ALA B 2 530 ? 18.149  13.995  -18.666 1.00 31.45  ? 530  ALA B CB  1 
ATOM   8216 N N   . PHE B 2 531 ? 18.995  10.897  -19.044 1.00 29.92  ? 531  PHE B N   1 
ATOM   8217 C CA  . PHE B 2 531 ? 19.824  9.699   -18.972 1.00 36.00  ? 531  PHE B CA  1 
ATOM   8218 C C   . PHE B 2 531 ? 20.247  9.154   -20.354 1.00 38.74  ? 531  PHE B C   1 
ATOM   8219 O O   . PHE B 2 531 ? 21.445  8.987   -20.626 1.00 41.46  ? 531  PHE B O   1 
ATOM   8220 C CB  . PHE B 2 531 ? 19.114  8.597   -18.162 1.00 33.71  ? 531  PHE B CB  1 
ATOM   8221 C CG  . PHE B 2 531 ? 19.788  7.255   -18.255 1.00 35.92  ? 531  PHE B CG  1 
ATOM   8222 C CD1 . PHE B 2 531 ? 20.904  6.965   -17.475 1.00 42.25  ? 531  PHE B CD1 1 
ATOM   8223 C CD2 . PHE B 2 531 ? 19.325  6.291   -19.126 1.00 37.89  ? 531  PHE B CD2 1 
ATOM   8224 C CE1 . PHE B 2 531 ? 21.533  5.737   -17.565 1.00 41.30  ? 531  PHE B CE1 1 
ATOM   8225 C CE2 . PHE B 2 531 ? 19.951  5.063   -19.224 1.00 40.23  ? 531  PHE B CE2 1 
ATOM   8226 C CZ  . PHE B 2 531 ? 21.065  4.787   -18.433 1.00 43.18  ? 531  PHE B CZ  1 
ATOM   8227 N N   . TRP B 2 532 ? 19.282  8.877   -21.228 1.00 34.48  ? 532  TRP B N   1 
ATOM   8228 C CA  . TRP B 2 532 ? 19.616  8.381   -22.573 1.00 39.09  ? 532  TRP B CA  1 
ATOM   8229 C C   . TRP B 2 532 ? 20.343  9.387   -23.454 1.00 43.56  ? 532  TRP B C   1 
ATOM   8230 O O   . TRP B 2 532 ? 21.326  9.034   -24.100 1.00 39.81  ? 532  TRP B O   1 
ATOM   8231 C CB  . TRP B 2 532 ? 18.393  7.879   -23.323 1.00 38.91  ? 532  TRP B CB  1 
ATOM   8232 C CG  . TRP B 2 532 ? 17.718  6.703   -22.692 1.00 36.60  ? 532  TRP B CG  1 
ATOM   8233 C CD1 . TRP B 2 532 ? 16.602  6.732   -21.924 1.00 36.94  ? 532  TRP B CD1 1 
ATOM   8234 C CD2 . TRP B 2 532 ? 18.127  5.330   -22.760 1.00 31.55  ? 532  TRP B CD2 1 
ATOM   8235 N NE1 . TRP B 2 532 ? 16.267  5.457   -21.524 1.00 39.78  ? 532  TRP B NE1 1 
ATOM   8236 C CE2 . TRP B 2 532 ? 17.183  4.577   -22.032 1.00 31.30  ? 532  TRP B CE2 1 
ATOM   8237 C CE3 . TRP B 2 532 ? 19.197  4.659   -23.377 1.00 32.33  ? 532  TRP B CE3 1 
ATOM   8238 C CZ2 . TRP B 2 532 ? 17.273  3.190   -21.893 1.00 34.63  ? 532  TRP B CZ2 1 
ATOM   8239 C CZ3 . TRP B 2 532 ? 19.271  3.277   -23.267 1.00 32.24  ? 532  TRP B CZ3 1 
ATOM   8240 C CH2 . TRP B 2 532 ? 18.320  2.559   -22.521 1.00 34.99  ? 532  TRP B CH2 1 
ATOM   8241 N N   . ASN B 2 533 ? 19.881  10.637  -23.448 1.00 38.59  ? 533  ASN B N   1 
ATOM   8242 C CA  . ASN B 2 533 ? 20.369  11.632  -24.399 1.00 41.18  ? 533  ASN B CA  1 
ATOM   8243 C C   . ASN B 2 533 ? 21.661  12.313  -23.978 1.00 44.64  ? 533  ASN B C   1 
ATOM   8244 O O   . ASN B 2 533 ? 22.503  12.642  -24.822 1.00 43.51  ? 533  ASN B O   1 
ATOM   8245 C CB  . ASN B 2 533 ? 19.287  12.685  -24.696 1.00 37.60  ? 533  ASN B CB  1 
ATOM   8246 C CG  . ASN B 2 533 ? 18.078  12.083  -25.374 1.00 38.01  ? 533  ASN B CG  1 
ATOM   8247 O OD1 . ASN B 2 533 ? 18.132  10.946  -25.831 1.00 39.50  ? 533  ASN B OD1 1 
ATOM   8248 N ND2 . ASN B 2 533 ? 16.969  12.803  -25.383 1.00 32.53  ? 533  ASN B ND2 1 
ATOM   8249 N N   . ARG B 2 534 ? 21.830  12.496  -22.673 1.00 44.04  ? 534  ARG B N   1 
ATOM   8250 C CA  . ARG B 2 534 ? 23.019  13.171  -22.157 1.00 47.43  ? 534  ARG B CA  1 
ATOM   8251 C C   . ARG B 2 534 ? 24.025  12.248  -21.467 1.00 46.98  ? 534  ARG B C   1 
ATOM   8252 O O   . ARG B 2 534 ? 25.208  12.314  -21.748 1.00 51.35  ? 534  ARG B O   1 
ATOM   8253 C CB  . ARG B 2 534 ? 22.623  14.301  -21.215 1.00 41.95  ? 534  ARG B CB  1 
ATOM   8254 C CG  . ARG B 2 534 ? 21.828  15.419  -21.892 1.00 49.41  ? 534  ARG B CG  1 
ATOM   8255 C CD  . ARG B 2 534 ? 21.226  16.341  -20.854 1.00 50.36  ? 534  ARG B CD  1 
ATOM   8256 N NE  . ARG B 2 534 ? 20.149  17.140  -21.426 1.00 58.76  ? 534  ARG B NE  1 
ATOM   8257 C CZ  . ARG B 2 534 ? 20.278  18.427  -21.765 1.00 60.87  ? 534  ARG B CZ  1 
ATOM   8258 N NH1 . ARG B 2 534 ? 21.448  19.062  -21.574 1.00 50.27  ? 534  ARG B NH1 1 
ATOM   8259 N NH2 . ARG B 2 534 ? 19.235  19.075  -22.288 1.00 55.29  ? 534  ARG B NH2 1 
ATOM   8260 N N   . PHE B 2 535 ? 23.567  11.407  -20.548 1.00 47.37  ? 535  PHE B N   1 
ATOM   8261 C CA  . PHE B 2 535 ? 24.502  10.576  -19.813 1.00 43.00  ? 535  PHE B CA  1 
ATOM   8262 C C   . PHE B 2 535 ? 24.997  9.333   -20.560 1.00 41.76  ? 535  PHE B C   1 
ATOM   8263 O O   . PHE B 2 535 ? 26.187  9.083   -20.599 1.00 45.26  ? 535  PHE B O   1 
ATOM   8264 C CB  . PHE B 2 535 ? 23.964  10.164  -18.461 1.00 35.85  ? 535  PHE B CB  1 
ATOM   8265 C CG  . PHE B 2 535 ? 25.009  9.542   -17.584 1.00 37.06  ? 535  PHE B CG  1 
ATOM   8266 C CD1 . PHE B 2 535 ? 26.062  10.298  -17.118 1.00 32.85  ? 535  PHE B CD1 1 
ATOM   8267 C CD2 . PHE B 2 535 ? 24.954  8.204   -17.257 1.00 40.22  ? 535  PHE B CD2 1 
ATOM   8268 C CE1 . PHE B 2 535 ? 27.012  9.743   -16.321 1.00 41.53  ? 535  PHE B CE1 1 
ATOM   8269 C CE2 . PHE B 2 535 ? 25.906  7.652   -16.450 1.00 40.41  ? 535  PHE B CE2 1 
ATOM   8270 C CZ  . PHE B 2 535 ? 26.934  8.420   -15.987 1.00 41.58  ? 535  PHE B CZ  1 
ATOM   8271 N N   . LEU B 2 536 ? 24.100  8.553   -21.145 1.00 40.93  ? 536  LEU B N   1 
ATOM   8272 C CA  . LEU B 2 536 ? 24.532  7.323   -21.821 1.00 41.68  ? 536  LEU B CA  1 
ATOM   8273 C C   . LEU B 2 536 ? 25.740  7.532   -22.779 1.00 50.21  ? 536  LEU B C   1 
ATOM   8274 O O   . LEU B 2 536 ? 26.714  6.796   -22.716 1.00 45.49  ? 536  LEU B O   1 
ATOM   8275 C CB  . LEU B 2 536 ? 23.355  6.704   -22.561 1.00 44.61  ? 536  LEU B CB  1 
ATOM   8276 C CG  . LEU B 2 536 ? 23.067  5.212   -22.401 1.00 55.64  ? 536  LEU B CG  1 
ATOM   8277 C CD1 . LEU B 2 536 ? 23.204  4.483   -23.743 1.00 54.04  ? 536  LEU B CD1 1 
ATOM   8278 C CD2 . LEU B 2 536 ? 23.931  4.593   -21.299 1.00 64.11  ? 536  LEU B CD2 1 
ATOM   8279 N N   . PRO B 2 537 ? 25.677  8.544   -23.664 1.00 51.08  ? 537  PRO B N   1 
ATOM   8280 C CA  . PRO B 2 537 ? 26.796  8.768   -24.576 1.00 52.61  ? 537  PRO B CA  1 
ATOM   8281 C C   . PRO B 2 537 ? 28.145  8.948   -23.860 1.00 53.68  ? 537  PRO B C   1 
ATOM   8282 O O   . PRO B 2 537 ? 29.111  8.328   -24.292 1.00 56.60  ? 537  PRO B O   1 
ATOM   8283 C CB  . PRO B 2 537 ? 26.387  10.057  -25.317 1.00 53.63  ? 537  PRO B CB  1 
ATOM   8284 C CG  . PRO B 2 537 ? 24.941  10.050  -25.300 1.00 47.98  ? 537  PRO B CG  1 
ATOM   8285 C CD  . PRO B 2 537 ? 24.556  9.452   -23.958 1.00 47.79  ? 537  PRO B CD  1 
ATOM   8286 N N   . LYS B 2 538 ? 28.226  9.763   -22.808 1.00 53.01  ? 538  LYS B N   1 
ATOM   8287 C CA  . LYS B 2 538 ? 29.490  9.921   -22.084 1.00 48.84  ? 538  LYS B CA  1 
ATOM   8288 C C   . LYS B 2 538 ? 29.927  8.574   -21.500 1.00 52.62  ? 538  LYS B C   1 
ATOM   8289 O O   . LYS B 2 538 ? 31.079  8.185   -21.564 1.00 59.48  ? 538  LYS B O   1 
ATOM   8290 C CB  . LYS B 2 538 ? 29.356  10.927  -20.947 1.00 45.59  ? 538  LYS B CB  1 
ATOM   8291 C CG  . LYS B 2 538 ? 28.649  12.202  -21.295 1.00 56.14  ? 538  LYS B CG  1 
ATOM   8292 C CD  . LYS B 2 538 ? 29.570  13.405  -21.375 1.00 63.37  ? 538  LYS B CD  1 
ATOM   8293 C CE  . LYS B 2 538 ? 28.799  14.695  -21.041 1.00 71.13  ? 538  LYS B CE  1 
ATOM   8294 N NZ  . LYS B 2 538 ? 28.262  14.696  -19.629 1.00 75.43  ? 538  LYS B NZ  1 
ATOM   8295 N N   . LEU B 2 539 ? 28.989  7.864   -20.915 1.00 52.34  ? 539  LEU B N   1 
ATOM   8296 C CA  . LEU B 2 539 ? 29.310  6.618   -20.245 1.00 53.90  ? 539  LEU B CA  1 
ATOM   8297 C C   . LEU B 2 539 ? 29.894  5.614   -21.213 1.00 58.54  ? 539  LEU B C   1 
ATOM   8298 O O   . LEU B 2 539 ? 30.873  4.964   -20.892 1.00 66.67  ? 539  LEU B O   1 
ATOM   8299 C CB  . LEU B 2 539 ? 28.062  6.042   -19.587 1.00 49.26  ? 539  LEU B CB  1 
ATOM   8300 C CG  . LEU B 2 539 ? 28.244  4.725   -18.869 1.00 55.54  ? 539  LEU B CG  1 
ATOM   8301 C CD1 . LEU B 2 539 ? 29.312  4.884   -17.817 1.00 58.63  ? 539  LEU B CD1 1 
ATOM   8302 C CD2 . LEU B 2 539 ? 26.923  4.317   -18.241 1.00 60.85  ? 539  LEU B CD2 1 
ATOM   8303 N N   . LEU B 2 540 ? 29.294  5.484   -22.398 1.00 62.14  ? 540  LEU B N   1 
ATOM   8304 C CA  . LEU B 2 540 ? 29.782  4.549   -23.413 1.00 57.63  ? 540  LEU B CA  1 
ATOM   8305 C C   . LEU B 2 540 ? 31.206  4.895   -23.883 1.00 61.10  ? 540  LEU B C   1 
ATOM   8306 O O   . LEU B 2 540 ? 32.031  4.003   -24.039 1.00 61.41  ? 540  LEU B O   1 
ATOM   8307 C CB  . LEU B 2 540 ? 28.817  4.464   -24.594 1.00 54.81  ? 540  LEU B CB  1 
ATOM   8308 C CG  . LEU B 2 540 ? 27.557  3.620   -24.342 1.00 55.33  ? 540  LEU B CG  1 
ATOM   8309 C CD1 . LEU B 2 540 ? 26.477  3.822   -25.433 1.00 48.74  ? 540  LEU B CD1 1 
ATOM   8310 C CD2 . LEU B 2 540 ? 27.900  2.148   -24.177 1.00 51.30  ? 540  LEU B CD2 1 
ATOM   8311 N N   . SER B 2 541 ? 31.511  6.172   -24.098 1.00 58.50  ? 541  SER B N   1 
ATOM   8312 C CA  . SER B 2 541 ? 32.904  6.550   -24.320 1.00 64.42  ? 541  SER B CA  1 
ATOM   8313 C C   . SER B 2 541 ? 33.842  5.972   -23.255 1.00 71.41  ? 541  SER B C   1 
ATOM   8314 O O   . SER B 2 541 ? 34.745  5.194   -23.577 1.00 78.42  ? 541  SER B O   1 
ATOM   8315 C CB  . SER B 2 541 ? 33.046  8.056   -24.360 1.00 65.08  ? 541  SER B CB  1 
ATOM   8316 O OG  . SER B 2 541 ? 32.081  8.563   -25.247 1.00 67.95  ? 541  SER B OG  1 
ATOM   8317 N N   . ALA B 2 542 ? 33.622  6.342   -21.994 1.00 68.97  ? 542  ALA B N   1 
ATOM   8318 C CA  . ALA B 2 542 ? 34.466  5.891   -20.872 1.00 70.74  ? 542  ALA B CA  1 
ATOM   8319 C C   . ALA B 2 542 ? 34.806  4.381   -20.850 1.00 68.81  ? 542  ALA B C   1 
ATOM   8320 O O   . ALA B 2 542 ? 33.961  3.515   -21.153 1.00 70.51  ? 542  ALA B O   1 
ATOM   8321 C CB  . ALA B 2 542 ? 33.828  6.315   -19.536 1.00 70.65  ? 542  ALA B CB  1 
HETATM 8322 C C1  . NAG C 3 .   ? 23.552  35.483  -0.473  0.70 56.11  ? 601  NAG A C1  1 
HETATM 8323 C C2  . NAG C 3 .   ? 23.685  35.840  -1.954  0.70 60.76  ? 601  NAG A C2  1 
HETATM 8324 C C3  . NAG C 3 .   ? 24.932  35.225  -2.570  0.70 66.73  ? 601  NAG A C3  1 
HETATM 8325 C C4  . NAG C 3 .   ? 26.161  35.635  -1.784  0.70 63.88  ? 601  NAG A C4  1 
HETATM 8326 C C5  . NAG C 3 .   ? 25.958  35.240  -0.327  0.70 59.55  ? 601  NAG A C5  1 
HETATM 8327 C C6  . NAG C 3 .   ? 27.159  35.625  0.536   0.70 56.85  ? 601  NAG A C6  1 
HETATM 8328 C C7  . NAG C 3 .   ? 21.980  36.277  -3.615  0.70 69.95  ? 601  NAG A C7  1 
HETATM 8329 C C8  . NAG C 3 .   ? 21.180  35.671  -4.742  0.70 68.64  ? 601  NAG A C8  1 
HETATM 8330 N N2  . NAG C 3 .   ? 22.518  35.445  -2.721  0.70 64.18  ? 601  NAG A N2  1 
HETATM 8331 O O3  . NAG C 3 .   ? 25.085  35.654  -3.906  0.70 73.09  ? 601  NAG A O3  1 
HETATM 8332 O O4  . NAG C 3 .   ? 27.286  35.012  -2.361  0.70 60.13  ? 601  NAG A O4  1 
HETATM 8333 O O5  . NAG C 3 .   ? 24.763  35.822  0.186   0.70 56.27  ? 601  NAG A O5  1 
HETATM 8334 O O6  . NAG C 3 .   ? 27.096  36.970  0.964   0.70 60.07  ? 601  NAG A O6  1 
HETATM 8335 O O7  . NAG C 3 .   ? 22.126  37.498  -3.541  0.70 70.39  ? 601  NAG A O7  1 
HETATM 8336 C C1  . NAG D 3 .   ? 11.614  33.885  25.896  0.50 71.33  ? 701  NAG A C1  1 
HETATM 8337 C C2  . NAG D 3 .   ? 13.014  34.470  25.693  0.50 69.74  ? 701  NAG A C2  1 
HETATM 8338 C C3  . NAG D 3 .   ? 13.278  35.643  26.632  0.50 74.46  ? 701  NAG A C3  1 
HETATM 8339 C C4  . NAG D 3 .   ? 12.186  36.687  26.418  0.50 73.40  ? 701  NAG A C4  1 
HETATM 8340 C C5  . NAG D 3 .   ? 10.814  36.045  26.607  0.50 73.53  ? 701  NAG A C5  1 
HETATM 8341 C C6  . NAG D 3 .   ? 9.702   37.066  26.354  0.50 76.58  ? 701  NAG A C6  1 
HETATM 8342 C C7  . NAG D 3 .   ? 14.487  32.869  24.726  0.50 61.44  ? 701  NAG A C7  1 
HETATM 8343 C C8  . NAG D 3 .   ? 15.714  32.013  24.850  0.50 54.24  ? 701  NAG A C8  1 
HETATM 8344 N N2  . NAG D 3 .   ? 14.028  33.446  25.830  0.50 62.40  ? 701  NAG A N2  1 
HETATM 8345 O O3  . NAG D 3 .   ? 14.556  36.197  26.384  0.50 75.09  ? 701  NAG A O3  1 
HETATM 8346 O O4  . NAG D 3 .   ? 12.339  37.758  27.324  0.50 71.96  ? 701  NAG A O4  1 
HETATM 8347 O O5  . NAG D 3 .   ? 10.641  34.910  25.768  0.50 71.18  ? 701  NAG A O5  1 
HETATM 8348 O O6  . NAG D 3 .   ? 9.981   37.815  25.190  0.50 77.37  ? 701  NAG A O6  1 
HETATM 8349 O O7  . NAG D 3 .   ? 13.926  33.024  23.639  0.50 63.93  ? 701  NAG A O7  1 
HETATM 8350 O O3  . HI6 E 4 .   ? 38.214  18.718  9.485   1.00 47.02  ? 1543 HI6 A O3  1 
HETATM 8351 C C14 . HI6 E 4 .   ? 38.231  19.789  10.072  1.00 50.47  ? 1543 HI6 A C14 1 
HETATM 8352 N N4  . HI6 E 4 .   ? 39.191  20.070  10.953  1.00 47.56  ? 1543 HI6 A N4  1 
HETATM 8353 C C11 . HI6 E 4 .   ? 37.142  20.818  9.865   1.00 51.72  ? 1543 HI6 A C11 1 
HETATM 8354 C C10 . HI6 E 4 .   ? 37.148  21.965  10.654  1.00 47.87  ? 1543 HI6 A C10 1 
HETATM 8355 C C9  . HI6 E 4 .   ? 36.152  22.916  10.497  1.00 53.33  ? 1543 HI6 A C9  1 
HETATM 8356 N N3  . HI6 E 4 .   ? 35.177  22.743  9.600   1.00 57.95  ? 1543 HI6 A N3  1 
HETATM 8357 C C13 . HI6 E 4 .   ? 35.136  21.639  8.826   1.00 56.07  ? 1543 HI6 A C13 1 
HETATM 8358 C C12 . HI6 E 4 .   ? 36.118  20.648  8.929   1.00 54.34  ? 1543 HI6 A C12 1 
HETATM 8359 C C8  . HI6 E 4 .   ? 34.140  23.767  9.462   1.00 66.36  ? 1543 HI6 A C8  1 
HETATM 8360 O O2  . HI6 E 4 .   ? 32.978  23.028  9.106   1.00 80.08  ? 1543 HI6 A O2  1 
HETATM 8361 C C7  . HI6 E 4 .   ? 31.783  23.795  9.081   1.00 81.60  ? 1543 HI6 A C7  1 
HETATM 8362 N N2  . HI6 E 4 .   ? 30.941  23.294  10.161  1.00 80.22  ? 1543 HI6 A N2  1 
HETATM 8363 C C2  . HI6 E 4 .   ? 30.201  22.204  9.954   1.00 84.86  ? 1543 HI6 A C2  1 
HETATM 8364 C C3  . HI6 E 4 .   ? 29.405  21.724  10.985  1.00 90.87  ? 1543 HI6 A C3  1 
HETATM 8365 C C4  . HI6 E 4 .   ? 29.370  22.375  12.219  1.00 87.47  ? 1543 HI6 A C4  1 
HETATM 8366 C C5  . HI6 E 4 .   ? 30.142  23.508  12.397  1.00 80.45  ? 1543 HI6 A C5  1 
HETATM 8367 C C6  . HI6 E 4 .   ? 30.926  23.940  11.334  1.00 78.66  ? 1543 HI6 A C6  1 
HETATM 8368 C C   . CO3 F 5 .   ? 39.313  25.393  5.038   1.00 72.05  ? 1544 CO3 A C   1 
HETATM 8369 O O1  . CO3 F 5 .   ? 38.148  25.471  4.439   1.00 68.06  ? 1544 CO3 A O1  1 
HETATM 8370 O O2  . CO3 F 5 .   ? 40.210  24.553  4.577   1.00 72.18  ? 1544 CO3 A O2  1 
HETATM 8371 O O3  . CO3 F 5 .   ? 39.569  26.143  6.089   1.00 66.29  ? 1544 CO3 A O3  1 
HETATM 8372 C C1  . NAG G 3 .   ? 4.978   -17.211 -21.925 0.70 86.49  ? 601  NAG B C1  1 
HETATM 8373 C C2  . NAG G 3 .   ? 6.044   -17.492 -20.862 0.70 90.03  ? 601  NAG B C2  1 
HETATM 8374 C C3  . NAG G 3 .   ? 7.421   -17.850 -21.419 0.70 86.34  ? 601  NAG B C3  1 
HETATM 8375 C C4  . NAG G 3 .   ? 7.329   -18.845 -22.556 0.70 91.70  ? 601  NAG B C4  1 
HETATM 8376 C C5  . NAG G 3 .   ? 6.359   -18.323 -23.612 0.70 90.08  ? 601  NAG B C5  1 
HETATM 8377 C C6  . NAG G 3 .   ? 6.230   -19.285 -24.802 0.70 81.36  ? 601  NAG B C6  1 
HETATM 8378 C C7  . NAG G 3 .   ? 6.478   -16.380 -18.741 0.70 96.04  ? 601  NAG B C7  1 
HETATM 8379 C C8  . NAG G 3 .   ? 7.339   -15.271 -18.205 0.70 80.93  ? 601  NAG B C8  1 
HETATM 8380 N N2  . NAG G 3 .   ? 6.169   -16.307 -20.032 0.70 97.13  ? 601  NAG B N2  1 
HETATM 8381 O O3  . NAG G 3 .   ? 8.231   -18.406 -20.406 0.70 82.57  ? 601  NAG B O3  1 
HETATM 8382 O O4  . NAG G 3 .   ? 8.625   -19.027 -23.091 0.70 93.09  ? 601  NAG B O4  1 
HETATM 8383 O O5  . NAG G 3 .   ? 5.081   -18.096 -23.033 0.70 93.23  ? 601  NAG B O5  1 
HETATM 8384 O O6  . NAG G 3 .   ? 5.094   -20.116 -24.684 0.70 77.16  ? 601  NAG B O6  1 
HETATM 8385 O O7  . NAG G 3 .   ? 6.087   -17.307 -18.024 0.70 101.98 ? 601  NAG B O7  1 
HETATM 8386 O O3  . HI6 H 4 .   ? 16.961  -6.244  -40.086 1.00 75.13  ? 1543 HI6 B O3  1 
HETATM 8387 C C14 . HI6 H 4 .   ? 16.384  -7.280  -40.392 1.00 70.17  ? 1543 HI6 B C14 1 
HETATM 8388 N N4  . HI6 H 4 .   ? 16.689  -7.985  -41.483 1.00 69.35  ? 1543 HI6 B N4  1 
HETATM 8389 C C11 . HI6 H 4 .   ? 15.262  -7.782  -39.544 1.00 63.60  ? 1543 HI6 B C11 1 
HETATM 8390 C C10 . HI6 H 4 .   ? 14.390  -8.709  -40.108 1.00 65.38  ? 1543 HI6 B C10 1 
HETATM 8391 C C9  . HI6 H 4 .   ? 13.327  -9.206  -39.373 1.00 58.54  ? 1543 HI6 B C9  1 
HETATM 8392 N N3  . HI6 H 4 .   ? 13.143  -8.783  -38.127 1.00 58.13  ? 1543 HI6 B N3  1 
HETATM 8393 C C13 . HI6 H 4 .   ? 13.977  -7.889  -37.549 1.00 59.51  ? 1543 HI6 B C13 1 
HETATM 8394 C C12 . HI6 H 4 .   ? 15.068  -7.356  -38.236 1.00 56.77  ? 1543 HI6 B C12 1 
HETATM 8395 C C8  . HI6 H 4 .   ? 12.020  -9.305  -37.362 1.00 67.92  ? 1543 HI6 B C8  1 
HETATM 8396 O O2  . HI6 H 4 .   ? 11.794  -8.289  -36.397 1.00 77.87  ? 1543 HI6 B O2  1 
HETATM 8397 C C7  . HI6 H 4 .   ? 10.786  -8.611  -35.458 1.00 80.83  ? 1543 HI6 B C7  1 
HETATM 8398 N N2  . HI6 H 4 .   ? 9.692   -7.715  -35.787 1.00 83.17  ? 1543 HI6 B N2  1 
HETATM 8399 C C2  . HI6 H 4 .   ? 9.667   -6.493  -35.252 1.00 78.87  ? 1543 HI6 B C2  1 
HETATM 8400 C C3  . HI6 H 4 .   ? 8.629   -5.637  -35.577 1.00 79.41  ? 1543 HI6 B C3  1 
HETATM 8401 C C4  . HI6 H 4 .   ? 7.627   -6.047  -36.449 1.00 78.87  ? 1543 HI6 B C4  1 
HETATM 8402 C C5  . HI6 H 4 .   ? 7.683   -7.321  -36.986 1.00 81.97  ? 1543 HI6 B C5  1 
HETATM 8403 C C6  . HI6 H 4 .   ? 8.748   -8.141  -36.636 1.00 83.42  ? 1543 HI6 B C6  1 
HETATM 8404 C C1  . PEG I 6 .   ? 31.517  10.293  -45.561 1.00 67.20  ? 1544 PEG B C1  1 
HETATM 8405 O O1  . PEG I 6 .   ? 31.780  8.930   -45.934 1.00 67.50  ? 1544 PEG B O1  1 
HETATM 8406 C C2  . PEG I 6 .   ? 31.184  10.336  -44.074 1.00 71.86  ? 1544 PEG B C2  1 
HETATM 8407 O O2  . PEG I 6 .   ? 30.652  11.614  -43.732 1.00 79.90  ? 1544 PEG B O2  1 
HETATM 8408 C C3  . PEG I 6 .   ? 31.173  12.154  -42.515 1.00 82.40  ? 1544 PEG B C3  1 
HETATM 8409 C C4  . PEG I 6 .   ? 31.790  13.520  -42.814 1.00 84.75  ? 1544 PEG B C4  1 
HETATM 8410 O O4  . PEG I 6 .   ? 32.104  14.186  -41.584 1.00 84.53  ? 1544 PEG B O4  1 
HETATM 8411 C C2  . P6G J 7 .   ? 20.942  10.970  -15.259 1.00 57.95  ? 1545 P6G B C2  1 
HETATM 8412 C C3  . P6G J 7 .   ? 22.079  10.273  -15.086 1.00 62.83  ? 1545 P6G B C3  1 
HETATM 8413 O O4  . P6G J 7 .   ? 22.248  9.199   -14.089 1.00 60.26  ? 1545 P6G B O4  1 
HETATM 8414 C C5  . P6G J 7 .   ? 23.328  8.245   -14.297 1.00 56.97  ? 1545 P6G B C5  1 
HETATM 8415 C C6  . P6G J 7 .   ? 23.359  6.989   -13.874 1.00 46.97  ? 1545 P6G B C6  1 
HETATM 8416 O O7  . P6G J 7 .   ? 22.281  6.415   -13.097 1.00 56.07  ? 1545 P6G B O7  1 
HETATM 8417 C C8  . P6G J 7 .   ? 22.057  5.013   -13.189 1.00 61.25  ? 1545 P6G B C8  1 
HETATM 8418 C C9  . P6G J 7 .   ? 21.653  4.429   -11.839 1.00 68.96  ? 1545 P6G B C9  1 
HETATM 8419 O O10 . P6G J 7 .   ? 20.466  5.078   -11.403 1.00 74.19  ? 1545 P6G B O10 1 
HETATM 8420 C C11 . P6G J 7 .   ? 19.747  4.597   -10.232 1.00 72.32  ? 1545 P6G B C11 1 
HETATM 8421 C C12 . P6G J 7 .   ? 18.707  5.295   -9.770  1.00 69.62  ? 1545 P6G B C12 1 
HETATM 8422 O O13 . P6G J 7 .   ? 18.297  6.534   -10.423 1.00 73.33  ? 1545 P6G B O13 1 
HETATM 8423 C C14 . P6G J 7 .   ? 17.160  6.566   -11.339 1.00 73.05  ? 1545 P6G B C14 1 
HETATM 8424 C C15 . P6G J 7 .   ? 15.936  6.262   -10.913 1.00 71.58  ? 1545 P6G B C15 1 
HETATM 8425 O O16 . P6G J 7 .   ? 14.892  6.294   -11.737 1.00 74.72  ? 1545 P6G B O16 1 
HETATM 8426 O O   . HOH K 8 .   ? 33.786  15.029  53.346  1.00 59.39  ? 2001 HOH A O   1 
HETATM 8427 O O   . HOH K 8 .   ? 29.736  18.018  55.778  1.00 59.55  ? 2002 HOH A O   1 
HETATM 8428 O O   . HOH K 8 .   ? 28.309  8.642   52.214  1.00 58.75  ? 2003 HOH A O   1 
HETATM 8429 O O   . HOH K 8 .   ? 46.665  2.464   40.548  1.00 60.42  ? 2004 HOH A O   1 
HETATM 8430 O O   . HOH K 8 .   ? 45.216  3.557   44.945  1.00 53.81  ? 2005 HOH A O   1 
HETATM 8431 O O   . HOH K 8 .   ? 28.791  20.243  50.448  1.00 68.53  ? 2006 HOH A O   1 
HETATM 8432 O O   . HOH K 8 .   ? 31.525  14.381  51.779  1.00 70.42  ? 2007 HOH A O   1 
HETATM 8433 O O   . HOH K 8 .   ? 44.723  1.436   43.345  1.00 47.09  ? 2008 HOH A O   1 
HETATM 8434 O O   . HOH K 8 .   ? 37.836  3.300   37.958  0.50 23.57  ? 2009 HOH A O   1 
HETATM 8435 O O   . HOH K 8 .   ? 24.059  19.778  50.661  1.00 57.14  ? 2010 HOH A O   1 
HETATM 8436 O O   . HOH K 8 .   ? 21.089  19.149  48.000  1.00 48.53  ? 2011 HOH A O   1 
HETATM 8437 O O   . HOH K 8 .   ? 27.103  22.049  45.458  1.00 63.77  ? 2012 HOH A O   1 
HETATM 8438 O O   . HOH K 8 .   ? 19.861  18.403  52.374  1.00 51.18  ? 2013 HOH A O   1 
HETATM 8439 O O   . HOH K 8 .   ? 25.323  9.367   52.365  1.00 42.72  ? 2014 HOH A O   1 
HETATM 8440 O O   . HOH K 8 .   ? 13.703  23.853  35.343  1.00 58.94  ? 2015 HOH A O   1 
HETATM 8441 O O   . HOH K 8 .   ? 37.524  29.371  8.037   1.00 66.66  ? 2016 HOH A O   1 
HETATM 8442 O O   . HOH K 8 .   ? 23.960  8.709   48.211  1.00 36.71  ? 2017 HOH A O   1 
HETATM 8443 O O   . HOH K 8 .   ? 39.109  4.774   48.995  1.00 50.32  ? 2018 HOH A O   1 
HETATM 8444 O O   . HOH K 8 .   ? 29.589  2.369   45.817  1.00 30.79  ? 2019 HOH A O   1 
HETATM 8445 O O   . HOH K 8 .   ? 28.153  4.335   46.958  1.00 34.35  ? 2020 HOH A O   1 
HETATM 8446 O O   . HOH K 8 .   ? 39.219  15.660  38.896  1.00 44.28  ? 2021 HOH A O   1 
HETATM 8447 O O   . HOH K 8 .   ? 36.520  2.950   45.850  1.00 45.19  ? 2022 HOH A O   1 
HETATM 8448 O O   . HOH K 8 .   ? 42.316  0.648   44.734  1.00 32.52  ? 2023 HOH A O   1 
HETATM 8449 O O   . HOH K 8 .   ? 43.682  0.447   41.208  1.00 42.46  ? 2024 HOH A O   1 
HETATM 8450 O O   . HOH K 8 .   ? 41.555  1.264   39.639  1.00 48.84  ? 2025 HOH A O   1 
HETATM 8451 O O   . HOH K 8 .   ? 39.345  3.601   45.235  1.00 40.98  ? 2026 HOH A O   1 
HETATM 8452 O O   . HOH K 8 .   ? 32.929  1.170   44.113  1.00 41.42  ? 2027 HOH A O   1 
HETATM 8453 O O   . HOH K 8 .   ? 36.261  5.147   39.024  1.00 41.94  ? 2028 HOH A O   1 
HETATM 8454 O O   . HOH K 8 .   ? 52.662  23.798  25.509  1.00 67.52  ? 2029 HOH A O   1 
HETATM 8455 O O   . HOH K 8 .   ? 53.695  19.828  25.760  1.00 65.06  ? 2030 HOH A O   1 
HETATM 8456 O O   . HOH K 8 .   ? 49.973  2.544   24.635  1.00 69.12  ? 2031 HOH A O   1 
HETATM 8457 O O   . HOH K 8 .   ? 30.975  10.656  48.895  1.00 48.22  ? 2032 HOH A O   1 
HETATM 8458 O O   . HOH K 8 .   ? 26.195  19.555  46.276  1.00 53.99  ? 2033 HOH A O   1 
HETATM 8459 O O   . HOH K 8 .   ? 36.708  20.601  39.756  1.00 57.74  ? 2034 HOH A O   1 
HETATM 8460 O O   . HOH K 8 .   ? 48.476  0.128   20.080  1.00 64.43  ? 2035 HOH A O   1 
HETATM 8461 O O   . HOH K 8 .   ? 23.086  19.991  45.903  1.00 40.71  ? 2036 HOH A O   1 
HETATM 8462 O O   . HOH K 8 .   ? 13.260  21.225  42.931  1.00 65.71  ? 2037 HOH A O   1 
HETATM 8463 O O   . HOH K 8 .   ? 28.392  24.964  41.133  1.00 74.87  ? 2038 HOH A O   1 
HETATM 8464 O O   . HOH K 8 .   ? 37.521  22.679  36.833  1.00 81.31  ? 2039 HOH A O   1 
HETATM 8465 O O   . HOH K 8 .   ? 39.903  22.502  35.779  1.00 69.69  ? 2040 HOH A O   1 
HETATM 8466 O O   . HOH K 8 .   ? 32.480  -6.072  30.608  1.00 56.07  ? 2041 HOH A O   1 
HETATM 8467 O O   . HOH K 8 .   ? 19.346  23.649  38.700  1.00 43.48  ? 2042 HOH A O   1 
HETATM 8468 O O   . HOH K 8 .   ? 16.604  24.808  36.089  1.00 70.90  ? 2043 HOH A O   1 
HETATM 8469 O O   . HOH K 8 .   ? 15.485  -6.602  26.908  1.00 61.15  ? 2044 HOH A O   1 
HETATM 8470 O O   . HOH K 8 .   ? 34.561  28.073  7.894   1.00 71.47  ? 2045 HOH A O   1 
HETATM 8471 O O   . HOH K 8 .   ? 8.407   21.279  40.793  1.00 75.85  ? 2046 HOH A O   1 
HETATM 8472 O O   . HOH K 8 .   ? 12.102  14.299  40.602  1.00 47.92  ? 2047 HOH A O   1 
HETATM 8473 O O   . HOH K 8 .   ? 21.383  25.259  23.412  1.00 53.19  ? 2048 HOH A O   1 
HETATM 8474 O O   . HOH K 8 .   ? 51.928  11.605  -0.398  1.00 62.15  ? 2049 HOH A O   1 
HETATM 8475 O O   . HOH K 8 .   ? 44.384  8.269   -3.965  1.00 68.51  ? 2050 HOH A O   1 
HETATM 8476 O O   . HOH K 8 .   ? 53.576  7.400   -0.310  1.00 80.52  ? 2051 HOH A O   1 
HETATM 8477 O O   . HOH K 8 .   ? 36.727  16.577  38.292  1.00 42.99  ? 2052 HOH A O   1 
HETATM 8478 O O   . HOH K 8 .   ? 47.719  17.878  37.473  1.00 75.63  ? 2053 HOH A O   1 
HETATM 8479 O O   . HOH K 8 .   ? 37.297  6.845   37.645  1.00 56.91  ? 2054 HOH A O   1 
HETATM 8480 O O   . HOH K 8 .   ? 38.333  4.443   34.531  1.00 52.15  ? 2055 HOH A O   1 
HETATM 8481 O O   . HOH K 8 .   ? 41.208  26.053  -1.867  1.00 62.88  ? 2056 HOH A O   1 
HETATM 8482 O O   . HOH K 8 .   ? 40.188  24.617  0.263   1.00 64.93  ? 2057 HOH A O   1 
HETATM 8483 O O   . HOH K 8 .   ? 40.693  12.604  33.386  1.00 29.15  ? 2058 HOH A O   1 
HETATM 8484 O O   . HOH K 8 .   ? 45.487  10.862  38.007  1.00 61.82  ? 2059 HOH A O   1 
HETATM 8485 O O   . HOH K 8 .   ? 48.637  11.991  32.739  1.00 54.04  ? 2060 HOH A O   1 
HETATM 8486 O O   . HOH K 8 .   ? 51.059  12.547  31.417  1.00 54.10  ? 2061 HOH A O   1 
HETATM 8487 O O   . HOH K 8 .   ? 50.440  17.740  25.939  1.00 50.54  ? 2062 HOH A O   1 
HETATM 8488 O O   . HOH K 8 .   ? 53.424  8.022   28.591  1.00 61.42  ? 2063 HOH A O   1 
HETATM 8489 O O   . HOH K 8 .   ? 49.559  6.852   28.019  1.00 61.62  ? 2064 HOH A O   1 
HETATM 8490 O O   . HOH K 8 .   ? 33.447  28.390  -7.325  1.00 49.41  ? 2065 HOH A O   1 
HETATM 8491 O O   . HOH K 8 .   ? 51.628  20.939  25.537  1.00 73.07  ? 2066 HOH A O   1 
HETATM 8492 O O   . HOH K 8 .   ? 34.178  27.381  -9.889  1.00 54.07  ? 2067 HOH A O   1 
HETATM 8493 O O   . HOH K 8 .   ? 23.843  20.474  30.987  1.00 40.78  ? 2068 HOH A O   1 
HETATM 8494 O O   . HOH K 8 .   ? 22.112  28.824  22.122  1.00 66.30  ? 2069 HOH A O   1 
HETATM 8495 O O   . HOH K 8 .   ? 46.778  8.531   27.002  1.00 47.97  ? 2070 HOH A O   1 
HETATM 8496 O O   . HOH K 8 .   ? 48.763  4.559   26.923  1.00 51.32  ? 2071 HOH A O   1 
HETATM 8497 O O   . HOH K 8 .   ? 21.127  24.999  31.972  1.00 71.79  ? 2072 HOH A O   1 
HETATM 8498 O O   . HOH K 8 .   ? 45.232  8.147   29.490  1.00 32.30  ? 2073 HOH A O   1 
HETATM 8499 O O   . HOH K 8 .   ? 41.931  13.439  35.950  1.00 44.95  ? 2074 HOH A O   1 
HETATM 8500 O O   . HOH K 8 .   ? 39.904  3.858   39.414  0.50 30.46  ? 2075 HOH A O   1 
HETATM 8501 O O   . HOH K 8 .   ? 16.244  16.519  -6.854  1.00 50.66  ? 2076 HOH A O   1 
HETATM 8502 O O   . HOH K 8 .   ? 15.535  17.514  -4.920  1.00 48.96  ? 2077 HOH A O   1 
HETATM 8503 O O   . HOH K 8 .   ? 44.628  9.814   40.765  1.00 62.48  ? 2078 HOH A O   1 
HETATM 8504 O O   . HOH K 8 .   ? 39.945  5.825   46.384  1.00 44.10  ? 2079 HOH A O   1 
HETATM 8505 O O   . HOH K 8 .   ? 40.022  14.608  45.207  1.00 61.81  ? 2080 HOH A O   1 
HETATM 8506 O O   . HOH K 8 .   ? 11.487  25.090  0.538   1.00 78.27  ? 2081 HOH A O   1 
HETATM 8507 O O   . HOH K 8 .   ? 12.502  23.707  2.473   1.00 57.16  ? 2082 HOH A O   1 
HETATM 8508 O O   . HOH K 8 .   ? 38.140  8.525   47.550  1.00 46.65  ? 2083 HOH A O   1 
HETATM 8509 O O   . HOH K 8 .   ? 39.583  16.162  46.803  1.00 51.00  ? 2084 HOH A O   1 
HETATM 8510 O O   . HOH K 8 .   ? 37.519  14.955  50.987  1.00 56.43  ? 2085 HOH A O   1 
HETATM 8511 O O   . HOH K 8 .   ? 50.035  -2.631  14.539  1.00 71.29  ? 2086 HOH A O   1 
HETATM 8512 O O   . HOH K 8 .   ? 36.393  18.067  40.682  1.00 54.49  ? 2087 HOH A O   1 
HETATM 8513 O O   . HOH K 8 .   ? 37.621  17.537  43.968  1.00 50.50  ? 2088 HOH A O   1 
HETATM 8514 O O   . HOH K 8 .   ? 33.685  18.080  38.622  1.00 47.96  ? 2089 HOH A O   1 
HETATM 8515 O O   . HOH K 8 .   ? 33.626  20.214  40.217  1.00 55.59  ? 2090 HOH A O   1 
HETATM 8516 O O   . HOH K 8 .   ? 45.941  0.851   20.339  1.00 54.17  ? 2091 HOH A O   1 
HETATM 8517 O O   . HOH K 8 .   ? 26.184  23.769  38.893  1.00 70.74  ? 2092 HOH A O   1 
HETATM 8518 O O   . HOH K 8 .   ? 35.347  20.670  37.318  1.00 65.17  ? 2093 HOH A O   1 
HETATM 8519 O O   . HOH K 8 .   ? 29.156  23.228  35.302  1.00 51.45  ? 2094 HOH A O   1 
HETATM 8520 O O   . HOH K 8 .   ? 40.830  19.810  35.516  1.00 68.43  ? 2095 HOH A O   1 
HETATM 8521 O O   . HOH K 8 .   ? 32.416  17.042  32.531  1.00 27.83  ? 2096 HOH A O   1 
HETATM 8522 O O   . HOH K 8 .   ? 34.969  -3.602  30.986  1.00 52.82  ? 2097 HOH A O   1 
HETATM 8523 O O   . HOH K 8 .   ? 33.779  -4.619  35.228  1.00 54.07  ? 2098 HOH A O   1 
HETATM 8524 O O   . HOH K 8 .   ? 38.802  0.095   33.365  1.00 60.26  ? 2099 HOH A O   1 
HETATM 8525 O O   . HOH K 8 .   ? 41.902  23.573  33.504  1.00 57.18  ? 2100 HOH A O   1 
HETATM 8526 O O   . HOH K 8 .   ? 27.149  -6.809  35.068  1.00 45.97  ? 2101 HOH A O   1 
HETATM 8527 O O   . HOH K 8 .   ? 4.031   6.949   -3.610  1.00 81.73  ? 2102 HOH A O   1 
HETATM 8528 O O   . HOH K 8 .   ? 8.992   9.532   -2.438  1.00 71.50  ? 2103 HOH A O   1 
HETATM 8529 O O   . HOH K 8 .   ? 40.773  17.010  21.601  1.00 29.60  ? 2104 HOH A O   1 
HETATM 8530 O O   . HOH K 8 .   ? 42.333  17.459  23.873  1.00 43.14  ? 2105 HOH A O   1 
HETATM 8531 O O   . HOH K 8 .   ? 41.479  19.304  17.960  1.00 29.65  ? 2106 HOH A O   1 
HETATM 8532 O O   . HOH K 8 .   ? 24.702  -6.892  37.102  1.00 50.31  ? 2107 HOH A O   1 
HETATM 8533 O O   . HOH K 8 .   ? 34.015  23.558  18.718  1.00 34.76  ? 2108 HOH A O   1 
HETATM 8534 O O   . HOH K 8 .   ? 40.726  26.615  19.352  1.00 39.23  ? 2109 HOH A O   1 
HETATM 8535 O O   . HOH K 8 .   ? 17.046  -5.702  29.930  1.00 51.44  ? 2110 HOH A O   1 
HETATM 8536 O O   . HOH K 8 .   ? 40.005  27.693  17.056  1.00 40.53  ? 2111 HOH A O   1 
HETATM 8537 O O   . HOH K 8 .   ? 26.122  19.479  15.264  0.50 37.09  ? 2112 HOH A O   1 
HETATM 8538 O O   . HOH K 8 .   ? 34.006  27.519  10.720  1.00 62.44  ? 2113 HOH A O   1 
HETATM 8539 O O   . HOH K 8 .   ? 29.354  25.901  15.569  1.00 51.82  ? 2114 HOH A O   1 
HETATM 8540 O O   . HOH K 8 .   ? 31.612  24.040  16.606  1.00 52.02  ? 2115 HOH A O   1 
HETATM 8541 O O   . HOH K 8 .   ? 21.541  34.634  17.567  1.00 58.01  ? 2116 HOH A O   1 
HETATM 8542 O O   . HOH K 8 .   ? 25.633  28.566  23.519  1.00 71.43  ? 2117 HOH A O   1 
HETATM 8543 O O   . HOH K 8 .   ? 38.801  9.094   2.503   1.00 40.87  ? 2118 HOH A O   1 
HETATM 8544 O O   . HOH K 8 .   ? 24.029  23.898  23.602  1.00 44.45  ? 2119 HOH A O   1 
HETATM 8545 O O   . HOH K 8 .   ? 31.894  21.858  21.631  1.00 40.35  ? 2120 HOH A O   1 
HETATM 8546 O O   . HOH K 8 .   ? 29.556  20.733  19.153  1.00 26.11  ? 2121 HOH A O   1 
HETATM 8547 O O   . HOH K 8 .   ? 27.510  25.930  23.808  1.00 50.10  ? 2122 HOH A O   1 
HETATM 8548 O O   . HOH K 8 .   ? 41.416  0.519   4.446   0.50 22.69  ? 2123 HOH A O   1 
HETATM 8549 O O   . HOH K 8 .   ? 45.588  -0.396  4.626   1.00 58.56  ? 2124 HOH A O   1 
HETATM 8550 O O   . HOH K 8 .   ? 44.351  2.446   0.654   1.00 63.62  ? 2125 HOH A O   1 
HETATM 8551 O O   . HOH K 8 .   ? 51.404  5.154   2.653   1.00 61.10  ? 2126 HOH A O   1 
HETATM 8552 O O   . HOH K 8 .   ? 50.133  9.218   -0.308  1.00 57.47  ? 2127 HOH A O   1 
HETATM 8553 O O   . HOH K 8 .   ? 43.365  10.528  -4.137  1.00 55.78  ? 2128 HOH A O   1 
HETATM 8554 O O   . HOH K 8 .   ? 47.140  9.434   -1.024  1.00 49.20  ? 2129 HOH A O   1 
HETATM 8555 O O   . HOH K 8 .   ? 50.464  3.295   4.565   1.00 59.82  ? 2130 HOH A O   1 
HETATM 8556 O O   . HOH K 8 .   ? 52.900  11.576  2.251   1.00 42.76  ? 2131 HOH A O   1 
HETATM 8557 O O   . HOH K 8 .   ? 56.815  9.083   2.467   1.00 60.68  ? 2132 HOH A O   1 
HETATM 8558 O O   . HOH K 8 .   ? 35.736  27.449  25.835  1.00 40.18  ? 2133 HOH A O   1 
HETATM 8559 O O   . HOH K 8 .   ? 39.345  28.864  32.286  1.00 37.14  ? 2134 HOH A O   1 
HETATM 8560 O O   . HOH K 8 .   ? 36.039  25.252  32.760  1.00 60.73  ? 2135 HOH A O   1 
HETATM 8561 O O   . HOH K 8 .   ? 39.442  24.768  34.470  1.00 64.20  ? 2136 HOH A O   1 
HETATM 8562 O O   . HOH K 8 .   ? 39.148  28.099  26.773  1.00 44.68  ? 2137 HOH A O   1 
HETATM 8563 O O   . HOH K 8 .   ? 44.489  23.578  29.776  1.00 76.02  ? 2138 HOH A O   1 
HETATM 8564 O O   . HOH K 8 .   ? 44.085  22.403  32.409  1.00 64.67  ? 2139 HOH A O   1 
HETATM 8565 O O   . HOH K 8 .   ? 48.012  21.356  26.279  1.00 42.41  ? 2140 HOH A O   1 
HETATM 8566 O O   . HOH K 8 .   ? 45.811  21.552  27.835  1.00 48.56  ? 2141 HOH A O   1 
HETATM 8567 O O   . HOH K 8 .   ? 45.919  15.070  24.277  1.00 30.81  ? 2142 HOH A O   1 
HETATM 8568 O O   . HOH K 8 .   ? 43.367  15.559  24.875  1.00 33.33  ? 2143 HOH A O   1 
HETATM 8569 O O   . HOH K 8 .   ? 43.405  20.412  34.398  1.00 75.82  ? 2144 HOH A O   1 
HETATM 8570 O O   . HOH K 8 .   ? 43.563  16.550  36.318  1.00 56.08  ? 2145 HOH A O   1 
HETATM 8571 O O   . HOH K 8 .   ? 41.799  13.974  31.420  1.00 26.89  ? 2146 HOH A O   1 
HETATM 8572 O O   . HOH K 8 .   ? 55.673  16.050  26.021  1.00 72.42  ? 2147 HOH A O   1 
HETATM 8573 O O   . HOH K 8 .   ? 56.304  26.409  21.101  1.00 64.43  ? 2148 HOH A O   1 
HETATM 8574 O O   . HOH K 8 .   ? 41.109  17.411  37.401  1.00 48.37  ? 2149 HOH A O   1 
HETATM 8575 O O   . HOH K 8 .   ? 42.349  23.030  -1.185  0.50 35.95  ? 2150 HOH A O   1 
HETATM 8576 O O   . HOH K 8 .   ? 13.735  12.045  39.884  1.00 53.06  ? 2151 HOH A O   1 
HETATM 8577 O O   . HOH K 8 .   ? 11.786  13.488  44.428  1.00 54.66  ? 2152 HOH A O   1 
HETATM 8578 O O   . HOH K 8 .   ? 12.909  8.977   42.215  1.00 62.20  ? 2153 HOH A O   1 
HETATM 8579 O O   . HOH K 8 .   ? 46.191  -6.303  14.979  1.00 65.51  ? 2154 HOH A O   1 
HETATM 8580 O O   . HOH K 8 .   ? 42.819  -3.855  6.782   1.00 51.70  ? 2155 HOH A O   1 
HETATM 8581 O O   . HOH K 8 .   ? 46.722  -2.401  8.133   1.00 67.83  ? 2156 HOH A O   1 
HETATM 8582 O O   . HOH K 8 .   ? 20.566  5.789   46.944  1.00 55.46  ? 2157 HOH A O   1 
HETATM 8583 O O   . HOH K 8 .   ? 22.443  4.524   44.295  1.00 53.38  ? 2158 HOH A O   1 
HETATM 8584 O O   . HOH K 8 .   ? 19.425  9.359   46.336  1.00 55.35  ? 2159 HOH A O   1 
HETATM 8585 O O   . HOH K 8 .   ? 22.932  3.920   47.186  1.00 49.25  ? 2160 HOH A O   1 
HETATM 8586 O O   . HOH K 8 .   ? 33.281  3.752   -3.628  1.00 62.21  ? 2161 HOH A O   1 
HETATM 8587 O O   . HOH K 8 .   ? 29.248  12.583  24.643  1.00 25.86  ? 2162 HOH A O   1 
HETATM 8588 O O   . HOH K 8 .   ? 30.673  28.926  -7.307  1.00 47.08  ? 2163 HOH A O   1 
HETATM 8589 O O   . HOH K 8 .   ? 30.824  21.347  16.767  1.00 43.48  ? 2164 HOH A O   1 
HETATM 8590 O O   . HOH K 8 .   ? 32.919  14.868  17.169  1.00 25.28  ? 2165 HOH A O   1 
HETATM 8591 O O   . HOH K 8 .   ? 35.223  17.581  24.516  1.00 28.73  ? 2166 HOH A O   1 
HETATM 8592 O O   . HOH K 8 .   ? 29.913  25.598  -15.229 0.50 27.75  ? 2167 HOH A O   1 
HETATM 8593 O O   . HOH K 8 .   ? 32.243  27.960  -11.563 1.00 48.77  ? 2168 HOH A O   1 
HETATM 8594 O O   . HOH K 8 .   ? 26.051  31.799  -14.267 1.00 53.81  ? 2169 HOH A O   1 
HETATM 8595 O O   . HOH K 8 .   ? 29.730  31.721  -10.632 1.00 55.15  ? 2170 HOH A O   1 
HETATM 8596 O O   . HOH K 8 .   ? 34.309  24.110  -9.791  1.00 43.17  ? 2171 HOH A O   1 
HETATM 8597 O O   . HOH K 8 .   ? 34.892  25.616  -13.490 1.00 67.90  ? 2172 HOH A O   1 
HETATM 8598 O O   . HOH K 8 .   ? 32.788  19.335  29.203  1.00 34.56  ? 2173 HOH A O   1 
HETATM 8599 O O   . HOH K 8 .   ? 25.013  18.671  28.938  1.00 28.33  ? 2174 HOH A O   1 
HETATM 8600 O O   . HOH K 8 .   ? 22.868  27.360  24.540  1.00 80.33  ? 2175 HOH A O   1 
HETATM 8601 O O   . HOH K 8 .   ? 25.799  24.714  25.568  1.00 45.74  ? 2176 HOH A O   1 
HETATM 8602 O O   . HOH K 8 .   ? 19.715  22.450  28.852  1.00 49.15  ? 2177 HOH A O   1 
HETATM 8603 O O   . HOH K 8 .   ? 25.011  22.768  30.005  1.00 37.01  ? 2178 HOH A O   1 
HETATM 8604 O O   . HOH K 8 .   ? 28.774  18.227  19.941  1.00 24.31  ? 2179 HOH A O   1 
HETATM 8605 O O   . HOH K 8 .   ? 25.837  15.509  18.467  1.00 24.73  ? 2180 HOH A O   1 
HETATM 8606 O O   . HOH K 8 .   ? 17.469  15.018  29.131  1.00 29.74  ? 2181 HOH A O   1 
HETATM 8607 O O   . HOH K 8 .   ? 22.667  19.488  33.595  1.00 53.32  ? 2182 HOH A O   1 
HETATM 8608 O O   . HOH K 8 .   ? 18.680  25.458  34.272  1.00 77.96  ? 2183 HOH A O   1 
HETATM 8609 O O   . HOH K 8 .   ? 21.764  23.709  36.283  1.00 56.46  ? 2184 HOH A O   1 
HETATM 8610 O O   . HOH K 8 .   ? 24.846  22.037  35.125  1.00 50.43  ? 2185 HOH A O   1 
HETATM 8611 O O   . HOH K 8 .   ? 9.237   30.789  -4.259  1.00 58.45  ? 2186 HOH A O   1 
HETATM 8612 O O   . HOH K 8 .   ? 10.861  17.455  34.497  1.00 46.78  ? 2187 HOH A O   1 
HETATM 8613 O O   . HOH K 8 .   ? 12.360  10.357  37.918  1.00 60.37  ? 2188 HOH A O   1 
HETATM 8614 O O   . HOH K 8 .   ? 9.412   7.426   35.954  1.00 66.59  ? 2189 HOH A O   1 
HETATM 8615 O O   . HOH K 8 .   ? 7.379   7.025   32.653  1.00 62.05  ? 2190 HOH A O   1 
HETATM 8616 O O   . HOH K 8 .   ? 8.118   11.460  27.994  1.00 57.27  ? 2191 HOH A O   1 
HETATM 8617 O O   . HOH K 8 .   ? 13.953  4.976   37.333  1.00 56.31  ? 2192 HOH A O   1 
HETATM 8618 O O   . HOH K 8 .   ? 16.095  13.841  -6.287  1.00 71.61  ? 2193 HOH A O   1 
HETATM 8619 O O   . HOH K 8 .   ? 25.671  15.206  28.056  1.00 32.99  ? 2194 HOH A O   1 
HETATM 8620 O O   . HOH K 8 .   ? 31.689  16.885  29.770  1.00 23.69  ? 2195 HOH A O   1 
HETATM 8621 O O   . HOH K 8 .   ? 15.241  -7.763  23.840  1.00 57.60  ? 2196 HOH A O   1 
HETATM 8622 O O   . HOH K 8 .   ? 4.495   22.315  9.213   1.00 69.12  ? 2197 HOH A O   1 
HETATM 8623 O O   . HOH K 8 .   ? 43.767  18.824  16.302  1.00 32.25  ? 2198 HOH A O   1 
HETATM 8624 O O   . HOH K 8 .   ? 45.940  12.751  22.451  1.00 34.67  ? 2199 HOH A O   1 
HETATM 8625 O O   . HOH K 8 .   ? 42.875  9.858   11.101  1.00 28.72  ? 2200 HOH A O   1 
HETATM 8626 O O   . HOH K 8 .   ? 42.436  7.732   13.917  1.00 26.00  ? 2201 HOH A O   1 
HETATM 8627 O O   . HOH K 8 .   ? 13.562  22.216  0.764   1.00 75.17  ? 2202 HOH A O   1 
HETATM 8628 O O   . HOH K 8 .   ? 47.885  1.507   13.911  1.00 43.84  ? 2203 HOH A O   1 
HETATM 8629 O O   . HOH K 8 .   ? 49.673  0.196   15.753  1.00 59.10  ? 2204 HOH A O   1 
HETATM 8630 O O   . HOH K 8 .   ? 52.526  9.561   21.554  1.00 35.02  ? 2205 HOH A O   1 
HETATM 8631 O O   . HOH K 8 .   ? 56.840  3.151   15.579  1.00 55.32  ? 2206 HOH A O   1 
HETATM 8632 O O   . HOH K 8 .   ? 4.828   30.669  20.105  1.00 70.06  ? 2207 HOH A O   1 
HETATM 8633 O O   . HOH K 8 .   ? 18.999  25.689  25.135  1.00 57.90  ? 2208 HOH A O   1 
HETATM 8634 O O   . HOH K 8 .   ? 6.147   25.228  14.941  1.00 65.39  ? 2209 HOH A O   1 
HETATM 8635 O O   . HOH K 8 .   ? 43.841  1.820   18.274  1.00 43.75  ? 2210 HOH A O   1 
HETATM 8636 O O   . HOH K 8 .   ? 47.027  7.766   17.717  1.00 29.97  ? 2211 HOH A O   1 
HETATM 8637 O O   . HOH K 8 .   ? 1.350   12.456  22.625  1.00 60.67  ? 2212 HOH A O   1 
HETATM 8638 O O   . HOH K 8 .   ? 39.918  1.859   25.841  1.00 48.19  ? 2213 HOH A O   1 
HETATM 8639 O O   . HOH K 8 .   ? 40.293  -1.875  23.481  1.00 44.66  ? 2214 HOH A O   1 
HETATM 8640 O O   . HOH K 8 .   ? 34.714  -2.578  33.222  1.00 40.13  ? 2215 HOH A O   1 
HETATM 8641 O O   . HOH K 8 .   ? 40.279  -0.675  30.978  1.00 57.75  ? 2216 HOH A O   1 
HETATM 8642 O O   . HOH K 8 .   ? 10.241  -9.067  6.166   1.00 66.56  ? 2217 HOH A O   1 
HETATM 8643 O O   . HOH K 8 .   ? 14.246  -11.709 7.288   1.00 66.49  ? 2218 HOH A O   1 
HETATM 8644 O O   . HOH K 8 .   ? 36.849  1.770   34.299  1.00 53.34  ? 2219 HOH A O   1 
HETATM 8645 O O   . HOH K 8 .   ? 0.355   1.195   8.731   1.00 70.62  ? 2220 HOH A O   1 
HETATM 8646 O O   . HOH K 8 .   ? 7.811   10.841  1.359   1.00 73.95  ? 2221 HOH A O   1 
HETATM 8647 O O   . HOH K 8 .   ? 27.799  -1.364  37.407  1.00 30.75  ? 2222 HOH A O   1 
HETATM 8648 O O   . HOH K 8 .   ? 29.265  -5.282  35.909  1.00 49.68  ? 2223 HOH A O   1 
HETATM 8649 O O   . HOH K 8 .   ? 26.776  -6.411  32.330  1.00 47.47  ? 2224 HOH A O   1 
HETATM 8650 O O   . HOH K 8 .   ? 34.067  -1.428  41.509  1.00 38.96  ? 2225 HOH A O   1 
HETATM 8651 O O   . HOH K 8 .   ? 36.798  -1.873  34.743  1.00 53.99  ? 2226 HOH A O   1 
HETATM 8652 O O   . HOH K 8 .   ? 0.529   12.987  19.012  0.50 31.06  ? 2227 HOH A O   1 
HETATM 8653 O O   . HOH K 8 .   ? -0.052  10.518  18.805  0.50 37.27  ? 2228 HOH A O   1 
HETATM 8654 O O   . HOH K 8 .   ? 32.080  0.585   41.687  1.00 36.17  ? 2229 HOH A O   1 
HETATM 8655 O O   . HOH K 8 .   ? 36.445  1.854   36.982  0.50 18.41  ? 2230 HOH A O   1 
HETATM 8656 O O   . HOH K 8 .   ? 6.258   7.945   1.003   1.00 64.73  ? 2231 HOH A O   1 
HETATM 8657 O O   . HOH K 8 .   ? 7.195   7.610   -1.901  1.00 71.94  ? 2232 HOH A O   1 
HETATM 8658 O O   . HOH K 8 .   ? 25.425  4.182   46.062  1.00 35.35  ? 2233 HOH A O   1 
HETATM 8659 O O   . HOH K 8 .   ? 22.296  -2.387  39.397  1.00 62.21  ? 2234 HOH A O   1 
HETATM 8660 O O   . HOH K 8 .   ? 22.150  -6.011  36.702  1.00 63.04  ? 2235 HOH A O   1 
HETATM 8661 O O   . HOH K 8 .   ? 16.810  -2.598  34.263  1.00 55.85  ? 2236 HOH A O   1 
HETATM 8662 O O   . HOH K 8 .   ? 19.198  -5.599  28.201  1.00 43.40  ? 2237 HOH A O   1 
HETATM 8663 O O   . HOH K 8 .   ? 21.857  -8.574  29.158  1.00 59.48  ? 2238 HOH A O   1 
HETATM 8664 O O   . HOH K 8 .   ? 43.388  6.633   -12.773 1.00 73.10  ? 2239 HOH A O   1 
HETATM 8665 O O   . HOH K 8 .   ? 19.358  0.819   28.030  1.00 34.59  ? 2240 HOH A O   1 
HETATM 8666 O O   . HOH K 8 .   ? 26.319  17.085  14.588  0.50 23.17  ? 2241 HOH A O   1 
HETATM 8667 O O   . HOH K 8 .   ? 36.500  -4.552  13.847  1.00 32.19  ? 2242 HOH A O   1 
HETATM 8668 O O   . HOH K 8 .   ? 32.609  -6.960  13.542  1.00 54.15  ? 2243 HOH A O   1 
HETATM 8669 O O   . HOH K 8 .   ? 36.602  -6.316  15.888  1.00 52.78  ? 2244 HOH A O   1 
HETATM 8670 O O   . HOH K 8 .   ? 26.360  -5.732  21.453  1.00 47.40  ? 2245 HOH A O   1 
HETATM 8671 O O   . HOH K 8 .   ? 26.861  -7.562  29.312  1.00 78.75  ? 2246 HOH A O   1 
HETATM 8672 O O   . HOH K 8 .   ? 28.627  0.013   29.450  1.00 32.21  ? 2247 HOH A O   1 
HETATM 8673 O O   . HOH K 8 .   ? 26.270  -7.421  25.404  1.00 55.17  ? 2248 HOH A O   1 
HETATM 8674 O O   . HOH K 8 .   ? 20.834  15.261  13.114  1.00 33.54  ? 2249 HOH A O   1 
HETATM 8675 O O   . HOH K 8 .   ? 30.449  8.244   6.487   1.00 36.77  ? 2250 HOH A O   1 
HETATM 8676 O O   . HOH K 8 .   ? 31.362  2.886   3.331   1.00 48.12  ? 2251 HOH A O   1 
HETATM 8677 O O   . HOH K 8 .   ? 35.225  9.742   0.733   1.00 47.81  ? 2252 HOH A O   1 
HETATM 8678 O O   . HOH K 8 .   ? 31.434  6.137   0.671   1.00 47.24  ? 2253 HOH A O   1 
HETATM 8679 O O   . HOH K 8 .   ? 36.814  9.837   4.273   1.00 34.61  ? 2254 HOH A O   1 
HETATM 8680 O O   . HOH K 8 .   ? 37.039  3.197   4.931   1.00 62.39  ? 2255 HOH A O   1 
HETATM 8681 O O   . HOH K 8 .   ? 33.487  5.092   6.385   1.00 34.80  ? 2256 HOH A O   1 
HETATM 8682 O O   . HOH K 8 .   ? 42.509  6.714   0.052   1.00 46.59  ? 2257 HOH A O   1 
HETATM 8683 O O   . HOH K 8 .   ? 40.775  7.307   2.948   1.00 37.32  ? 2258 HOH A O   1 
HETATM 8684 O O   . HOH K 8 .   ? 43.501  0.965   5.739   0.50 15.92  ? 2259 HOH A O   1 
HETATM 8685 O O   . HOH K 8 .   ? 45.670  2.296   2.922   1.00 44.71  ? 2260 HOH A O   1 
HETATM 8686 O O   . HOH K 8 .   ? 50.343  7.637   2.542   1.00 45.05  ? 2261 HOH A O   1 
HETATM 8687 O O   . HOH K 8 .   ? 44.473  11.422  -1.110  1.00 48.57  ? 2262 HOH A O   1 
HETATM 8688 O O   . HOH K 8 .   ? 46.147  10.718  10.658  1.00 36.02  ? 2263 HOH A O   1 
HETATM 8689 O O   . HOH K 8 .   ? 55.952  3.079   8.574   1.00 58.07  ? 2264 HOH A O   1 
HETATM 8690 O O   . HOH K 8 .   ? 50.454  3.282   7.147   1.00 43.98  ? 2265 HOH A O   1 
HETATM 8691 O O   . HOH K 8 .   ? 46.505  18.126  1.100   1.00 49.99  ? 2266 HOH A O   1 
HETATM 8692 O O   . HOH K 8 .   ? 52.320  9.313   3.516   1.00 60.80  ? 2267 HOH A O   1 
HETATM 8693 O O   . HOH K 8 .   ? 46.152  13.805  -1.766  1.00 44.64  ? 2268 HOH A O   1 
HETATM 8694 O O   . HOH K 8 .   ? 50.462  15.093  1.253   1.00 50.43  ? 2269 HOH A O   1 
HETATM 8695 O O   . HOH K 8 .   ? 40.093  11.492  1.180   1.00 40.74  ? 2270 HOH A O   1 
HETATM 8696 O O   . HOH K 8 .   ? 38.050  13.627  1.912   1.00 37.89  ? 2271 HOH A O   1 
HETATM 8697 O O   . HOH K 8 .   ? 38.018  12.328  4.569   1.00 31.90  ? 2272 HOH A O   1 
HETATM 8698 O O   . HOH K 8 .   ? 51.917  13.832  3.356   1.00 36.94  ? 2273 HOH A O   1 
HETATM 8699 O O   . HOH K 8 .   ? 58.340  21.362  8.150   1.00 39.88  ? 2274 HOH A O   1 
HETATM 8700 O O   . HOH K 8 .   ? 60.326  18.754  9.475   1.00 67.87  ? 2275 HOH A O   1 
HETATM 8701 O O   . HOH K 8 .   ? 62.676  10.519  8.787   1.00 72.10  ? 2276 HOH A O   1 
HETATM 8702 O O   . HOH K 8 .   ? 63.250  4.437   15.894  1.00 73.78  ? 2277 HOH A O   1 
HETATM 8703 O O   . HOH K 8 .   ? 59.682  4.101   11.580  1.00 70.86  ? 2278 HOH A O   1 
HETATM 8704 O O   . HOH K 8 .   ? 57.764  4.524   9.606   1.00 64.79  ? 2279 HOH A O   1 
HETATM 8705 O O   . HOH K 8 .   ? 56.090  2.671   13.078  1.00 55.80  ? 2280 HOH A O   1 
HETATM 8706 O O   . HOH K 8 .   ? 59.985  4.467   14.315  1.00 58.01  ? 2281 HOH A O   1 
HETATM 8707 O O   . HOH K 8 .   ? 58.506  14.592  22.849  1.00 58.22  ? 2282 HOH A O   1 
HETATM 8708 O O   . HOH K 8 .   ? 52.336  16.491  24.293  1.00 32.72  ? 2283 HOH A O   1 
HETATM 8709 O O   . HOH K 8 .   ? 59.035  7.901   21.905  1.00 52.30  ? 2284 HOH A O   1 
HETATM 8710 O O   . HOH K 8 .   ? 57.388  8.939   20.046  1.00 46.42  ? 2285 HOH A O   1 
HETATM 8711 O O   . HOH K 8 .   ? 56.555  13.856  25.228  1.00 49.21  ? 2286 HOH A O   1 
HETATM 8712 O O   . HOH K 8 .   ? 53.817  21.711  24.283  1.00 62.66  ? 2287 HOH A O   1 
HETATM 8713 O O   . HOH K 8 .   ? 56.505  25.116  18.146  1.00 55.82  ? 2288 HOH A O   1 
HETATM 8714 O O   . HOH K 8 .   ? 49.700  23.201  24.776  1.00 37.76  ? 2289 HOH A O   1 
HETATM 8715 O O   . HOH K 8 .   ? 41.392  27.859  21.363  1.00 51.30  ? 2290 HOH A O   1 
HETATM 8716 O O   . HOH K 8 .   ? 48.065  25.647  23.027  1.00 40.21  ? 2291 HOH A O   1 
HETATM 8717 O O   . HOH K 8 .   ? 52.982  28.438  15.080  1.00 43.26  ? 2292 HOH A O   1 
HETATM 8718 O O   . HOH K 8 .   ? 42.409  24.226  11.303  1.00 59.65  ? 2293 HOH A O   1 
HETATM 8719 O O   . HOH K 8 .   ? 42.323  27.942  15.071  1.00 55.54  ? 2294 HOH A O   1 
HETATM 8720 O O   . HOH K 8 .   ? 39.846  22.622  12.405  1.00 45.73  ? 2295 HOH A O   1 
HETATM 8721 O O   . HOH K 8 .   ? 40.245  17.293  12.569  1.00 40.08  ? 2296 HOH A O   1 
HETATM 8722 O O   . HOH K 8 .   ? 39.571  20.499  16.422  1.00 24.96  ? 2297 HOH A O   1 
HETATM 8723 O O   . HOH K 8 .   ? 42.708  21.262  3.153   1.00 62.46  ? 2298 HOH A O   1 
HETATM 8724 O O   . HOH K 8 .   ? 44.212  23.669  2.436   1.00 54.96  ? 2299 HOH A O   1 
HETATM 8725 O O   . HOH K 8 .   ? 42.166  26.491  7.623   1.00 65.79  ? 2300 HOH A O   1 
HETATM 8726 O O   . HOH K 8 .   ? 43.641  20.992  -1.055  0.50 34.01  ? 2301 HOH A O   1 
HETATM 8727 O O   . HOH K 8 .   ? 38.204  12.772  -1.518  1.00 51.03  ? 2302 HOH A O   1 
HETATM 8728 O O   . HOH K 8 .   ? 40.446  20.936  -4.624  1.00 60.08  ? 2303 HOH A O   1 
HETATM 8729 O O   . HOH K 8 .   ? 36.588  19.610  -4.640  1.00 48.52  ? 2304 HOH A O   1 
HETATM 8730 O O   . HOH K 8 .   ? 38.503  16.048  0.836   1.00 29.48  ? 2305 HOH A O   1 
HETATM 8731 O O   . HOH K 8 .   ? 38.073  22.305  2.351   1.00 58.22  ? 2306 HOH A O   1 
HETATM 8732 O O   . HOH K 8 .   ? 31.970  20.769  6.500   1.00 23.91  ? 2307 HOH A O   1 
HETATM 8733 O O   . HOH K 8 .   ? 35.146  19.693  4.909   1.00 59.05  ? 2308 HOH A O   1 
HETATM 8734 O O   . HOH K 8 .   ? 36.088  12.242  -0.142  1.00 41.54  ? 2309 HOH A O   1 
HETATM 8735 O O   . HOH K 8 .   ? 36.137  12.985  6.576   1.00 27.84  ? 2310 HOH A O   1 
HETATM 8736 O O   . HOH K 8 .   ? 43.839  11.607  9.145   1.00 32.62  ? 2311 HOH A O   1 
HETATM 8737 O O   . HOH K 8 .   ? 38.167  15.694  12.521  1.00 29.24  ? 2312 HOH A O   1 
HETATM 8738 O O   . HOH K 8 .   ? 46.989  -3.748  13.294  1.00 65.10  ? 2313 HOH A O   1 
HETATM 8739 O O   . HOH K 8 .   ? 44.935  1.307   15.994  1.00 47.79  ? 2314 HOH A O   1 
HETATM 8740 O O   . HOH K 8 .   ? 47.355  0.105   11.565  1.00 55.09  ? 2315 HOH A O   1 
HETATM 8741 O O   . HOH K 8 .   ? 44.478  -2.549  7.756   1.00 50.46  ? 2316 HOH A O   1 
HETATM 8742 O O   . HOH K 8 .   ? 42.435  -0.485  19.059  1.00 48.82  ? 2317 HOH A O   1 
HETATM 8743 O O   . HOH K 8 .   ? 40.722  -6.922  14.989  1.00 63.66  ? 2318 HOH A O   1 
HETATM 8744 O O   . HOH K 8 .   ? 38.917  -4.955  17.133  1.00 51.87  ? 2319 HOH A O   1 
HETATM 8745 O O   . HOH K 8 .   ? 35.320  -7.505  13.052  1.00 70.01  ? 2320 HOH A O   1 
HETATM 8746 O O   . HOH K 8 .   ? 37.314  -7.450  2.745   1.00 62.69  ? 2321 HOH A O   1 
HETATM 8747 O O   . HOH K 8 .   ? 35.131  -1.959  1.549   1.00 65.02  ? 2322 HOH A O   1 
HETATM 8748 O O   . HOH K 8 .   ? 33.203  1.902   4.378   1.00 46.92  ? 2323 HOH A O   1 
HETATM 8749 O O   . HOH K 8 .   ? 31.710  1.809   -2.145  1.00 74.48  ? 2324 HOH A O   1 
HETATM 8750 O O   . HOH K 8 .   ? 32.869  -9.792  9.973   1.00 58.30  ? 2325 HOH A O   1 
HETATM 8751 O O   . HOH K 8 .   ? 22.313  -13.764 9.144   1.00 71.02  ? 2326 HOH A O   1 
HETATM 8752 O O   . HOH K 8 .   ? 10.827  22.525  7.018   1.00 46.62  ? 2327 HOH A O   1 
HETATM 8753 O O   . HOH K 8 .   ? 21.451  20.381  7.479   1.00 29.77  ? 2328 HOH A O   1 
HETATM 8754 O O   . HOH K 8 .   ? 18.040  14.942  4.275   1.00 36.25  ? 2329 HOH A O   1 
HETATM 8755 O O   . HOH K 8 .   ? 19.312  17.982  2.742   1.00 42.22  ? 2330 HOH A O   1 
HETATM 8756 O O   . HOH K 8 .   ? 29.061  27.421  -5.881  1.00 34.23  ? 2331 HOH A O   1 
HETATM 8757 O O   . HOH K 8 .   ? 17.518  36.340  -1.538  1.00 59.22  ? 2332 HOH A O   1 
HETATM 8758 O O   . HOH K 8 .   ? 14.681  31.309  4.030   1.00 66.80  ? 2333 HOH A O   1 
HETATM 8759 O O   . HOH K 8 .   ? 11.431  28.569  1.910   1.00 70.47  ? 2334 HOH A O   1 
HETATM 8760 O O   . HOH K 8 .   ? 18.675  34.718  -2.898  1.00 55.84  ? 2335 HOH A O   1 
HETATM 8761 O O   . HOH K 8 .   ? 24.571  20.702  -17.013 1.00 58.22  ? 2336 HOH A O   1 
HETATM 8762 O O   . HOH K 8 .   ? 22.289  22.397  -19.476 1.00 75.16  ? 2337 HOH A O   1 
HETATM 8763 O O   . HOH K 8 .   ? 30.732  25.871  -12.482 1.00 42.36  ? 2338 HOH A O   1 
HETATM 8764 O O   . HOH K 8 .   ? 25.077  29.444  -14.584 1.00 38.76  ? 2339 HOH A O   1 
HETATM 8765 O O   . HOH K 8 .   ? 30.268  29.181  -10.041 1.00 43.40  ? 2340 HOH A O   1 
HETATM 8766 O O   . HOH K 8 .   ? 26.820  26.160  -16.041 1.00 68.90  ? 2341 HOH A O   1 
HETATM 8767 O O   . HOH K 8 .   ? 29.742  31.898  -6.885  1.00 48.26  ? 2342 HOH A O   1 
HETATM 8768 O O   . HOH K 8 .   ? 23.666  33.764  -8.327  1.00 51.02  ? 2343 HOH A O   1 
HETATM 8769 O O   . HOH K 8 .   ? 30.288  19.731  -11.438 1.00 48.49  ? 2344 HOH A O   1 
HETATM 8770 O O   . HOH K 8 .   ? 34.011  23.758  -7.294  1.00 40.56  ? 2345 HOH A O   1 
HETATM 8771 O O   . HOH K 8 .   ? 32.405  23.761  -11.529 1.00 42.24  ? 2346 HOH A O   1 
HETATM 8772 O O   . HOH K 8 .   ? 34.962  16.347  -7.577  1.00 41.43  ? 2347 HOH A O   1 
HETATM 8773 O O   . HOH K 8 .   ? 29.887  16.426  1.093   1.00 37.72  ? 2348 HOH A O   1 
HETATM 8774 O O   . HOH K 8 .   ? 32.153  7.652   -2.623  1.00 66.70  ? 2349 HOH A O   1 
HETATM 8775 O O   . HOH K 8 .   ? 38.326  12.872  -13.320 1.00 62.96  ? 2350 HOH A O   1 
HETATM 8776 O O   . HOH K 8 .   ? 35.749  11.114  -15.424 1.00 51.89  ? 2351 HOH A O   1 
HETATM 8777 O O   . HOH K 8 .   ? 17.394  10.142  -12.936 1.00 62.32  ? 2352 HOH A O   1 
HETATM 8778 O O   . HOH K 8 .   ? 14.897  16.099  -9.638  1.00 56.96  ? 2353 HOH A O   1 
HETATM 8779 O O   . HOH K 8 .   ? 17.375  22.195  -12.036 1.00 43.33  ? 2354 HOH A O   1 
HETATM 8780 O O   . HOH K 8 .   ? 15.131  26.434  -16.131 1.00 51.65  ? 2355 HOH A O   1 
HETATM 8781 O O   . HOH K 8 .   ? 10.858  26.651  -8.368  1.00 55.91  ? 2356 HOH A O   1 
HETATM 8782 O O   . HOH K 8 .   ? 13.484  29.859  -8.594  1.00 40.09  ? 2357 HOH A O   1 
HETATM 8783 O O   . HOH K 8 .   ? 13.210  29.723  -13.140 1.00 57.52  ? 2358 HOH A O   1 
HETATM 8784 O O   . HOH K 8 .   ? 11.869  30.213  -3.973  1.00 50.00  ? 2359 HOH A O   1 
HETATM 8785 O O   . HOH K 8 .   ? 16.406  19.404  -0.528  1.00 40.47  ? 2360 HOH A O   1 
HETATM 8786 O O   . HOH K 8 .   ? 17.146  21.189  1.873   1.00 42.26  ? 2361 HOH A O   1 
HETATM 8787 O O   . HOH K 8 .   ? 16.748  13.406  -3.022  1.00 47.10  ? 2362 HOH A O   1 
HETATM 8788 O O   . HOH K 8 .   ? 19.261  15.019  2.027   1.00 39.98  ? 2363 HOH A O   1 
HETATM 8789 O O   . HOH K 8 .   ? 26.928  8.038   -0.421  1.00 40.58  ? 2364 HOH A O   1 
HETATM 8790 O O   . HOH K 8 .   ? 29.536  7.182   -1.104  1.00 55.01  ? 2365 HOH A O   1 
HETATM 8791 O O   . HOH K 8 .   ? 26.453  9.075   7.576   1.00 34.00  ? 2366 HOH A O   1 
HETATM 8792 O O   . HOH K 8 .   ? 23.632  -0.989  -0.343  1.00 63.89  ? 2367 HOH A O   1 
HETATM 8793 O O   . HOH K 8 .   ? 27.718  3.664   2.285   1.00 46.73  ? 2368 HOH A O   1 
HETATM 8794 O O   . HOH K 8 .   ? 28.341  1.841   -1.281  1.00 60.67  ? 2369 HOH A O   1 
HETATM 8795 O O   . HOH K 8 .   ? 25.216  -8.755  -0.248  1.00 76.64  ? 2370 HOH A O   1 
HETATM 8796 O O   . HOH K 8 .   ? 16.897  -12.129 8.139   1.00 61.61  ? 2371 HOH A O   1 
HETATM 8797 O O   . HOH K 8 .   ? 16.275  -8.408  10.606  1.00 58.33  ? 2372 HOH A O   1 
HETATM 8798 O O   . HOH K 8 .   ? 14.101  -9.757  22.274  1.00 70.15  ? 2373 HOH A O   1 
HETATM 8799 O O   . HOH K 8 .   ? 7.903   -3.486  16.751  1.00 48.61  ? 2374 HOH A O   1 
HETATM 8800 O O   . HOH K 8 .   ? 11.158  1.404   10.961  1.00 39.35  ? 2375 HOH A O   1 
HETATM 8801 O O   . HOH K 8 .   ? 10.491  14.214  4.127   1.00 81.05  ? 2376 HOH A O   1 
HETATM 8802 O O   . HOH K 8 .   ? 7.874   19.080  7.217   1.00 62.97  ? 2377 HOH A O   1 
HETATM 8803 O O   . HOH K 8 .   ? 8.814   21.120  8.484   0.50 33.33  ? 2378 HOH A O   1 
HETATM 8804 O O   . HOH K 8 .   ? 14.058  21.180  14.415  1.00 43.72  ? 2379 HOH A O   1 
HETATM 8805 O O   . HOH K 8 .   ? 5.768   20.075  12.360  1.00 60.65  ? 2380 HOH A O   1 
HETATM 8806 O O   . HOH K 8 .   ? 10.822  27.824  12.797  1.00 53.57  ? 2381 HOH A O   1 
HETATM 8807 O O   . HOH K 8 .   ? 8.001   21.763  10.670  0.50 28.68  ? 2382 HOH A O   1 
HETATM 8808 O O   . HOH K 8 .   ? 15.598  25.694  18.012  1.00 61.42  ? 2383 HOH A O   1 
HETATM 8809 O O   . HOH K 8 .   ? 19.645  33.041  10.392  1.00 50.41  ? 2384 HOH A O   1 
HETATM 8810 O O   . HOH K 8 .   ? 18.920  27.854  16.812  1.00 53.94  ? 2385 HOH A O   1 
HETATM 8811 O O   . HOH K 8 .   ? 16.792  23.691  1.000   1.00 45.24  ? 2386 HOH A O   1 
HETATM 8812 O O   . HOH K 8 .   ? 24.688  20.740  13.341  1.00 50.71  ? 2387 HOH A O   1 
HETATM 8813 O O   . HOH K 8 .   ? 18.469  12.271  13.448  1.00 26.76  ? 2388 HOH A O   1 
HETATM 8814 O O   . HOH K 8 .   ? 18.889  20.363  18.667  1.00 31.14  ? 2389 HOH A O   1 
HETATM 8815 O O   . HOH K 8 .   ? 6.278   24.370  27.099  1.00 73.27  ? 2390 HOH A O   1 
HETATM 8816 O O   . HOH K 8 .   ? 7.195   21.092  31.897  1.00 55.12  ? 2391 HOH A O   1 
HETATM 8817 O O   . HOH K 8 .   ? 9.852   25.416  26.224  1.00 50.65  ? 2392 HOH A O   1 
HETATM 8818 O O   . HOH K 8 .   ? 17.615  23.650  32.299  1.00 64.69  ? 2393 HOH A O   1 
HETATM 8819 O O   . HOH K 8 .   ? 15.486  23.318  33.599  1.00 47.68  ? 2394 HOH A O   1 
HETATM 8820 O O   . HOH K 8 .   ? 8.323   29.370  20.111  1.00 54.09  ? 2395 HOH A O   1 
HETATM 8821 O O   . HOH K 8 .   ? 16.978  24.977  22.950  1.00 58.46  ? 2396 HOH A O   1 
HETATM 8822 O O   . HOH K 8 .   ? 5.015   24.210  17.266  1.00 48.21  ? 2397 HOH A O   1 
HETATM 8823 O O   . HOH K 8 .   ? 2.540   17.617  19.658  1.00 45.47  ? 2398 HOH A O   1 
HETATM 8824 O O   . HOH K 8 .   ? 2.395   23.986  17.247  1.00 55.18  ? 2399 HOH A O   1 
HETATM 8825 O O   . HOH K 8 .   ? 3.354   13.046  24.800  1.00 61.01  ? 2400 HOH A O   1 
HETATM 8826 O O   . HOH K 8 .   ? 5.155   11.739  14.383  1.00 37.54  ? 2401 HOH A O   1 
HETATM 8827 O O   . HOH K 8 .   ? 6.210   9.137   31.595  1.00 66.84  ? 2402 HOH A O   1 
HETATM 8828 O O   . HOH K 8 .   ? 5.994   12.650  29.425  1.00 56.88  ? 2403 HOH A O   1 
HETATM 8829 O O   . HOH K 8 .   ? 2.939   6.646   18.489  1.00 45.07  ? 2404 HOH A O   1 
HETATM 8830 O O   . HOH K 8 .   ? 9.226   4.044   33.479  1.00 77.58  ? 2405 HOH A O   1 
HETATM 8831 O O   . HOH K 8 .   ? 16.134  -3.177  29.781  1.00 35.49  ? 2406 HOH A O   1 
HETATM 8832 O O   . HOH K 8 .   ? 13.813  4.171   32.786  1.00 54.05  ? 2407 HOH A O   1 
HETATM 8833 O O   . HOH K 8 .   ? -1.088  3.649   23.131  1.00 60.63  ? 2408 HOH A O   1 
HETATM 8834 O O   . HOH K 8 .   ? -3.837  3.178   18.044  1.00 70.05  ? 2409 HOH A O   1 
HETATM 8835 O O   . HOH K 8 .   ? 3.248   -2.716  13.191  1.00 63.40  ? 2410 HOH A O   1 
HETATM 8836 O O   . HOH K 8 .   ? 8.123   -4.912  9.816   1.00 56.69  ? 2411 HOH A O   1 
HETATM 8837 O O   . HOH K 8 .   ? 14.517  -5.363  11.403  1.00 45.56  ? 2412 HOH A O   1 
HETATM 8838 O O   . HOH K 8 .   ? 14.913  2.142   1.836   1.00 38.74  ? 2413 HOH A O   1 
HETATM 8839 O O   . HOH K 8 .   ? 9.625   -3.004  6.845   1.00 44.67  ? 2414 HOH A O   1 
HETATM 8840 O O   . HOH K 8 .   ? 8.292   -6.665  6.417   1.00 58.18  ? 2415 HOH A O   1 
HETATM 8841 O O   . HOH K 8 .   ? 12.599  -8.543  4.653   1.00 53.05  ? 2416 HOH A O   1 
HETATM 8842 O O   . HOH K 8 .   ? 13.952  -6.118  -1.679  1.00 56.56  ? 2417 HOH A O   1 
HETATM 8843 O O   . HOH K 8 .   ? 15.053  -7.664  6.286   1.00 52.25  ? 2418 HOH A O   1 
HETATM 8844 O O   . HOH K 8 .   ? 12.230  -4.477  -1.335  1.00 68.12  ? 2419 HOH A O   1 
HETATM 8845 O O   . HOH K 8 .   ? 3.381   0.367   5.075   1.00 46.09  ? 2420 HOH A O   1 
HETATM 8846 O O   . HOH K 8 .   ? 2.488   -0.953  8.919   1.00 66.26  ? 2421 HOH A O   1 
HETATM 8847 O O   . HOH K 8 .   ? 9.706   10.766  3.518   1.00 47.35  ? 2422 HOH A O   1 
HETATM 8848 O O   . HOH K 8 .   ? 4.193   18.429  11.467  1.00 67.45  ? 2423 HOH A O   1 
HETATM 8849 O O   . HOH K 8 .   ? -0.456  14.279  17.404  1.00 72.42  ? 2424 HOH A O   1 
HETATM 8850 O O   . HOH K 8 .   ? 2.657   15.298  18.773  1.00 55.04  ? 2425 HOH A O   1 
HETATM 8851 O O   . HOH K 8 .   ? 3.637   11.882  11.462  1.00 43.89  ? 2426 HOH A O   1 
HETATM 8852 O O   . HOH K 8 .   ? 1.584   8.479   17.026  1.00 51.32  ? 2427 HOH A O   1 
HETATM 8853 O O   . HOH K 8 .   ? 0.648   4.842   8.425   1.00 58.26  ? 2428 HOH A O   1 
HETATM 8854 O O   . HOH K 8 .   ? 6.627   13.524  2.820   1.00 74.21  ? 2429 HOH A O   1 
HETATM 8855 O O   . HOH K 8 .   ? 7.269   4.883   -1.029  1.00 63.50  ? 2430 HOH A O   1 
HETATM 8856 O O   . HOH K 8 .   ? 5.504   5.680   1.317   1.00 48.24  ? 2431 HOH A O   1 
HETATM 8857 O O   . HOH K 8 .   ? 9.105   7.098   0.982   1.00 47.54  ? 2432 HOH A O   1 
HETATM 8858 O O   . HOH K 8 .   ? 11.479  6.165   -1.665  1.00 61.81  ? 2433 HOH A O   1 
HETATM 8859 O O   . HOH K 8 .   ? 16.796  3.135   0.331   1.00 39.57  ? 2434 HOH A O   1 
HETATM 8860 O O   . HOH K 8 .   ? 11.601  8.826   0.293   1.00 50.49  ? 2435 HOH A O   1 
HETATM 8861 O O   . HOH K 8 .   ? 14.088  14.756  2.898   1.00 77.82  ? 2436 HOH A O   1 
HETATM 8862 O O   . HOH K 8 .   ? 11.957  12.183  2.278   1.00 51.60  ? 2437 HOH A O   1 
HETATM 8863 O O   . HOH K 8 .   ? 16.601  16.984  0.965   1.00 51.53  ? 2438 HOH A O   1 
HETATM 8864 O O   . HOH K 8 .   ? 18.119  1.745   -2.572  1.00 51.53  ? 2439 HOH A O   1 
HETATM 8865 O O   . HOH K 8 .   ? 14.502  8.472   -4.298  1.00 39.54  ? 2440 HOH A O   1 
HETATM 8866 O O   . HOH K 8 .   ? 21.099  0.696   -0.440  0.50 32.07  ? 2441 HOH A O   1 
HETATM 8867 O O   . HOH K 8 .   ? 26.292  5.466   0.841   1.00 45.82  ? 2442 HOH A O   1 
HETATM 8868 O O   . HOH K 8 .   ? 20.463  0.672   -2.809  0.50 30.43  ? 2443 HOH A O   1 
HETATM 8869 O O   . HOH K 8 .   ? 22.905  -3.531  -7.587  1.00 62.81  ? 2444 HOH A O   1 
HETATM 8870 O O   . HOH K 8 .   ? 19.661  -6.600  -6.993  1.00 62.69  ? 2445 HOH A O   1 
HETATM 8871 O O   . HOH K 8 .   ? 31.047  5.282   -4.043  1.00 67.88  ? 2446 HOH A O   1 
HETATM 8872 O O   . HOH K 8 .   ? 34.450  2.610   -6.125  1.00 58.99  ? 2447 HOH A O   1 
HETATM 8873 O O   . HOH K 8 .   ? 38.749  6.607   -13.006 1.00 58.77  ? 2448 HOH A O   1 
HETATM 8874 O O   . HOH K 8 .   ? 29.384  33.082  -1.019  1.00 61.90  ? 2449 HOH A O   1 
HETATM 8875 O O   . HOH K 8 .   ? 29.822  34.236  -3.418  1.00 70.02  ? 2450 HOH A O   1 
HETATM 8876 O O   . HOH K 8 .   ? 23.019  33.159  -3.931  1.00 48.21  ? 2451 HOH A O   1 
HETATM 8877 O O   . HOH K 8 .   ? 25.259  38.140  2.236   1.00 65.78  ? 2452 HOH A O   1 
HETATM 8878 O O   . HOH L 8 .   ? -17.453 6.418   -76.900 1.00 78.09  ? 2001 HOH B O   1 
HETATM 8879 O O   . HOH L 8 .   ? 1.521   16.879  -69.714 1.00 65.38  ? 2002 HOH B O   1 
HETATM 8880 O O   . HOH L 8 .   ? -17.265 5.936   -72.210 1.00 91.06  ? 2003 HOH B O   1 
HETATM 8881 O O   . HOH L 8 .   ? 0.165   16.586  -67.668 1.00 65.53  ? 2004 HOH B O   1 
HETATM 8882 O O   . HOH L 8 .   ? 1.100   13.000  -71.389 1.00 49.83  ? 2005 HOH B O   1 
HETATM 8883 O O   . HOH L 8 .   ? 0.457   9.879   -74.652 1.00 65.39  ? 2006 HOH B O   1 
HETATM 8884 O O   . HOH L 8 .   ? 1.616   -0.519  -64.715 1.00 51.11  ? 2007 HOH B O   1 
HETATM 8885 O O   . HOH L 8 .   ? 4.543   19.819  -64.590 1.00 59.22  ? 2008 HOH B O   1 
HETATM 8886 O O   . HOH L 8 .   ? 3.495   11.367  -72.364 1.00 52.17  ? 2009 HOH B O   1 
HETATM 8887 O O   . HOH L 8 .   ? 8.200   -0.699  -66.949 1.00 39.53  ? 2010 HOH B O   1 
HETATM 8888 O O   . HOH L 8 .   ? 4.454   10.750  -65.195 1.00 43.30  ? 2011 HOH B O   1 
HETATM 8889 O O   . HOH L 8 .   ? -6.362  0.824   -70.097 1.00 69.47  ? 2012 HOH B O   1 
HETATM 8890 O O   . HOH L 8 .   ? -8.004  1.500   -72.844 1.00 52.71  ? 2013 HOH B O   1 
HETATM 8891 O O   . HOH L 8 .   ? 14.280  4.948   -74.202 0.50 25.65  ? 2014 HOH B O   1 
HETATM 8892 O O   . HOH L 8 .   ? -12.476 2.671   -63.189 1.00 63.75  ? 2015 HOH B O   1 
HETATM 8893 O O   . HOH L 8 .   ? -14.867 2.981   -61.326 1.00 52.22  ? 2016 HOH B O   1 
HETATM 8894 O O   . HOH L 8 .   ? -0.474  -6.156  -60.559 1.00 70.60  ? 2017 HOH B O   1 
HETATM 8895 O O   . HOH L 8 .   ? 6.538   -15.121 -49.201 1.00 60.91  ? 2018 HOH B O   1 
HETATM 8896 O O   . HOH L 8 .   ? -20.302 6.299   -53.112 1.00 62.14  ? 2019 HOH B O   1 
HETATM 8897 O O   . HOH L 8 .   ? 30.467  -3.430  -28.622 1.00 66.01  ? 2020 HOH B O   1 
HETATM 8898 O O   . HOH L 8 .   ? 0.296   -0.516  -62.829 1.00 64.39  ? 2021 HOH B O   1 
HETATM 8899 O O   . HOH L 8 .   ? 4.906   8.208   -64.125 1.00 39.72  ? 2022 HOH B O   1 
HETATM 8900 O O   . HOH L 8 .   ? 3.865   0.132   -65.718 1.00 50.27  ? 2023 HOH B O   1 
HETATM 8901 O O   . HOH L 8 .   ? 8.893   9.352   -62.589 1.00 46.71  ? 2024 HOH B O   1 
HETATM 8902 O O   . HOH L 8 .   ? 7.640   1.181   -61.903 1.00 35.91  ? 2025 HOH B O   1 
HETATM 8903 O O   . HOH L 8 .   ? 12.300  -0.951  -68.203 1.00 41.54  ? 2026 HOH B O   1 
HETATM 8904 O O   . HOH L 8 .   ? 14.965  2.625   -68.998 1.00 58.20  ? 2027 HOH B O   1 
HETATM 8905 O O   . HOH L 8 .   ? 9.254   1.465   -68.400 1.00 36.57  ? 2028 HOH B O   1 
HETATM 8906 O O   . HOH L 8 .   ? 16.774  -7.845  -60.041 1.00 44.99  ? 2029 HOH B O   1 
HETATM 8907 O O   . HOH L 8 .   ? 21.563  -6.350  -66.396 1.00 70.92  ? 2030 HOH B O   1 
HETATM 8908 O O   . HOH L 8 .   ? 0.306   -1.385  -19.633 1.00 62.10  ? 2031 HOH B O   1 
HETATM 8909 O O   . HOH L 8 .   ? 24.626  -13.756 -17.120 1.00 58.09  ? 2032 HOH B O   1 
HETATM 8910 O O   . HOH L 8 .   ? 17.617  -2.682  -55.826 1.00 36.82  ? 2033 HOH B O   1 
HETATM 8911 O O   . HOH L 8 .   ? 20.395  4.337   -61.778 1.00 51.58  ? 2034 HOH B O   1 
HETATM 8912 O O   . HOH L 8 .   ? 17.360  1.416   -60.527 1.00 45.70  ? 2035 HOH B O   1 
HETATM 8913 O O   . HOH L 8 .   ? 10.207  3.921   -10.108 1.00 56.93  ? 2036 HOH B O   1 
HETATM 8914 O O   . HOH L 8 .   ? 15.064  2.643   -61.825 1.00 35.94  ? 2037 HOH B O   1 
HETATM 8915 O O   . HOH L 8 .   ? 19.897  2.323   -63.391 1.00 62.54  ? 2038 HOH B O   1 
HETATM 8916 O O   . HOH L 8 .   ? -15.050 17.833  -48.240 1.00 63.51  ? 2039 HOH B O   1 
HETATM 8917 O O   . HOH L 8 .   ? 7.447   9.481   -64.904 1.00 48.16  ? 2040 HOH B O   1 
HETATM 8918 O O   . HOH L 8 .   ? 4.529   1.211   -69.155 1.00 33.21  ? 2041 HOH B O   1 
HETATM 8919 O O   . HOH L 8 .   ? 10.763  10.094  -68.198 1.00 58.66  ? 2042 HOH B O   1 
HETATM 8920 O O   . HOH L 8 .   ? 11.994  3.730   -74.559 1.00 40.18  ? 2043 HOH B O   1 
HETATM 8921 O O   . HOH L 8 .   ? 7.380   3.133   -71.393 1.00 51.70  ? 2044 HOH B O   1 
HETATM 8922 O O   . HOH L 8 .   ? 5.431   5.306   -75.404 1.00 60.53  ? 2045 HOH B O   1 
HETATM 8923 O O   . HOH L 8 .   ? 2.708   9.154   -73.425 1.00 42.95  ? 2046 HOH B O   1 
HETATM 8924 O O   . HOH L 8 .   ? -0.387  7.578   -72.826 1.00 38.13  ? 2047 HOH B O   1 
HETATM 8925 O O   . HOH L 8 .   ? -0.823  6.927   -76.812 1.00 52.48  ? 2048 HOH B O   1 
HETATM 8926 O O   . HOH L 8 .   ? -4.957  1.646   -73.689 1.00 49.98  ? 2049 HOH B O   1 
HETATM 8927 O O   . HOH L 8 .   ? -1.492  -1.634  -64.466 1.00 58.77  ? 2050 HOH B O   1 
HETATM 8928 O O   . HOH L 8 .   ? 23.186  7.804   -55.671 1.00 58.51  ? 2051 HOH B O   1 
HETATM 8929 O O   . HOH L 8 .   ? -9.003  -1.996  -56.071 1.00 68.25  ? 2052 HOH B O   1 
HETATM 8930 O O   . HOH L 8 .   ? -9.997  -2.773  -61.318 1.00 70.07  ? 2053 HOH B O   1 
HETATM 8931 O O   . HOH L 8 .   ? -2.628  -0.521  -61.311 1.00 51.14  ? 2054 HOH B O   1 
HETATM 8932 O O   . HOH L 8 .   ? -1.576  -3.387  -60.637 1.00 54.79  ? 2055 HOH B O   1 
HETATM 8933 O O   . HOH L 8 .   ? -0.147  -6.706  -57.659 1.00 61.29  ? 2056 HOH B O   1 
HETATM 8934 O O   . HOH L 8 .   ? 0.388   19.614  -64.423 1.00 67.64  ? 2057 HOH B O   1 
HETATM 8935 O O   . HOH L 8 .   ? 3.447   10.886  -14.312 1.00 77.19  ? 2058 HOH B O   1 
HETATM 8936 O O   . HOH L 8 .   ? -8.362  20.095  -61.757 1.00 66.34  ? 2059 HOH B O   1 
HETATM 8937 O O   . HOH L 8 .   ? 2.010   21.648  -61.515 1.00 49.57  ? 2060 HOH B O   1 
HETATM 8938 O O   . HOH L 8 .   ? 12.744  -4.403  -51.648 1.00 36.62  ? 2061 HOH B O   1 
HETATM 8939 O O   . HOH L 8 .   ? 14.377  -7.286  -48.669 1.00 36.35  ? 2062 HOH B O   1 
HETATM 8940 O O   . HOH L 8 .   ? 12.532  -5.067  -54.154 1.00 51.17  ? 2063 HOH B O   1 
HETATM 8941 O O   . HOH L 8 .   ? 4.391   -5.316  -46.110 1.00 38.76  ? 2064 HOH B O   1 
HETATM 8942 O O   . HOH L 8 .   ? 10.029  -13.288 -48.530 1.00 46.62  ? 2065 HOH B O   1 
HETATM 8943 O O   . HOH L 8 .   ? 0.112   26.984  -48.770 1.00 53.64  ? 2066 HOH B O   1 
HETATM 8944 O O   . HOH L 8 .   ? 6.607   -8.193  -44.532 1.00 45.96  ? 2067 HOH B O   1 
HETATM 8945 O O   . HOH L 8 .   ? 4.548   -8.192  -39.321 1.00 53.24  ? 2068 HOH B O   1 
HETATM 8946 O O   . HOH L 8 .   ? -1.586  -10.774 -45.069 1.00 70.40  ? 2069 HOH B O   1 
HETATM 8947 O O   . HOH L 8 .   ? 25.719  2.129   -33.312 1.00 61.39  ? 2070 HOH B O   1 
HETATM 8948 O O   . HOH L 8 .   ? 4.520   -3.479  -42.633 1.00 35.43  ? 2071 HOH B O   1 
HETATM 8949 O O   . HOH L 8 .   ? 25.091  1.261   -35.823 1.00 49.32  ? 2072 HOH B O   1 
HETATM 8950 O O   . HOH L 8 .   ? 29.766  1.008   -35.989 1.00 45.04  ? 2073 HOH B O   1 
HETATM 8951 O O   . HOH L 8 .   ? 6.102   -7.746  -41.530 1.00 48.47  ? 2074 HOH B O   1 
HETATM 8952 O O   . HOH L 8 .   ? -1.611  -7.089  -44.751 1.00 44.56  ? 2075 HOH B O   1 
HETATM 8953 O O   . HOH L 8 .   ? 28.891  7.872   -39.527 1.00 60.02  ? 2076 HOH B O   1 
HETATM 8954 O O   . HOH L 8 .   ? 30.387  -3.167  -32.755 1.00 80.10  ? 2077 HOH B O   1 
HETATM 8955 O O   . HOH L 8 .   ? 32.466  -2.187  -33.676 1.00 73.05  ? 2078 HOH B O   1 
HETATM 8956 O O   . HOH L 8 .   ? -0.661  -12.158 -49.990 1.00 68.95  ? 2079 HOH B O   1 
HETATM 8957 O O   . HOH L 8 .   ? 33.265  5.390   -47.524 1.00 55.29  ? 2080 HOH B O   1 
HETATM 8958 O O   . HOH L 8 .   ? 34.861  -7.033  -40.163 1.00 58.59  ? 2081 HOH B O   1 
HETATM 8959 O O   . HOH L 8 .   ? 31.861  -11.989 -39.560 1.00 58.95  ? 2082 HOH B O   1 
HETATM 8960 O O   . HOH L 8 .   ? 34.487  -7.133  -43.178 1.00 51.03  ? 2083 HOH B O   1 
HETATM 8961 O O   . HOH L 8 .   ? 2.865   -11.597 -50.920 1.00 55.76  ? 2084 HOH B O   1 
HETATM 8962 O O   . HOH L 8 .   ? -6.088  -3.298  -55.539 1.00 47.23  ? 2085 HOH B O   1 
HETATM 8963 O O   . HOH L 8 .   ? -3.710  -5.638  -56.692 1.00 57.43  ? 2086 HOH B O   1 
HETATM 8964 O O   . HOH L 8 .   ? -6.738  -4.113  -50.838 1.00 56.59  ? 2087 HOH B O   1 
HETATM 8965 O O   . HOH L 8 .   ? 4.497   -13.230 -53.325 1.00 50.68  ? 2088 HOH B O   1 
HETATM 8966 O O   . HOH L 8 .   ? 1.035   -16.427 -57.728 1.00 76.51  ? 2089 HOH B O   1 
HETATM 8967 O O   . HOH L 8 .   ? 15.615  -4.532  -56.877 1.00 38.61  ? 2090 HOH B O   1 
HETATM 8968 O O   . HOH L 8 .   ? 13.245  -3.755  -55.932 1.00 40.29  ? 2091 HOH B O   1 
HETATM 8969 O O   . HOH L 8 .   ? 13.542  -10.982 -58.771 1.00 52.94  ? 2092 HOH B O   1 
HETATM 8970 O O   . HOH L 8 .   ? 5.265   -5.379  -60.661 1.00 48.27  ? 2093 HOH B O   1 
HETATM 8971 O O   . HOH L 8 .   ? 8.910   -0.844  -60.719 1.00 27.74  ? 2094 HOH B O   1 
HETATM 8972 O O   . HOH L 8 .   ? 10.310  -6.019  -64.218 1.00 33.72  ? 2095 HOH B O   1 
HETATM 8973 O O   . HOH L 8 .   ? 6.526   0.000   -64.538 1.00 42.20  ? 2096 HOH B O   1 
HETATM 8974 O O   . HOH L 8 .   ? 0.488   0.361   -55.866 1.00 34.38  ? 2097 HOH B O   1 
HETATM 8975 O O   . HOH L 8 .   ? -8.300  2.625   -51.143 1.00 52.71  ? 2098 HOH B O   1 
HETATM 8976 O O   . HOH L 8 .   ? 18.579  -12.858 -35.802 1.00 70.25  ? 2099 HOH B O   1 
HETATM 8977 O O   . HOH L 8 .   ? -9.852  13.128  -60.080 1.00 62.34  ? 2100 HOH B O   1 
HETATM 8978 O O   . HOH L 8 .   ? -12.232 16.628  -64.212 1.00 74.93  ? 2101 HOH B O   1 
HETATM 8979 O O   . HOH L 8 .   ? 23.583  9.833   -29.039 1.00 69.50  ? 2102 HOH B O   1 
HETATM 8980 O O   . HOH L 8 .   ? -13.297 21.782  -54.859 1.00 73.75  ? 2103 HOH B O   1 
HETATM 8981 O O   . HOH L 8 .   ? -7.008  24.244  -47.986 1.00 60.23  ? 2104 HOH B O   1 
HETATM 8982 O O   . HOH L 8 .   ? 2.400   0.115   -18.570 1.00 67.27  ? 2105 HOH B O   1 
HETATM 8983 O O   . HOH L 8 .   ? 4.349   4.679   -48.319 1.00 29.19  ? 2106 HOH B O   1 
HETATM 8984 O O   . HOH L 8 .   ? 4.140   2.498   -40.937 1.00 36.67  ? 2107 HOH B O   1 
HETATM 8985 O O   . HOH L 8 .   ? 13.299  -7.717  -46.219 1.00 38.10  ? 2108 HOH B O   1 
HETATM 8986 O O   . HOH L 8 .   ? 8.590   -8.663  -39.520 1.00 59.64  ? 2109 HOH B O   1 
HETATM 8987 O O   . HOH L 8 .   ? 6.307   -4.939  -41.380 1.00 45.91  ? 2110 HOH B O   1 
HETATM 8988 O O   . HOH L 8 .   ? 10.279  0.042   -43.910 1.00 28.31  ? 2111 HOH B O   1 
HETATM 8989 O O   . HOH L 8 .   ? 6.646   -2.216  -50.612 1.00 34.91  ? 2112 HOH B O   1 
HETATM 8990 O O   . HOH L 8 .   ? 22.301  -11.134 -18.144 1.00 56.77  ? 2113 HOH B O   1 
HETATM 8991 O O   . HOH L 8 .   ? 18.032  -19.332 -19.503 1.00 73.48  ? 2114 HOH B O   1 
HETATM 8992 O O   . HOH L 8 .   ? 23.948  -9.137  -18.206 1.00 61.94  ? 2115 HOH B O   1 
HETATM 8993 O O   . HOH L 8 .   ? 22.617  -12.306 -20.897 1.00 57.05  ? 2116 HOH B O   1 
HETATM 8994 O O   . HOH L 8 .   ? 1.748   -2.452  -52.876 1.00 33.97  ? 2117 HOH B O   1 
HETATM 8995 O O   . HOH L 8 .   ? -3.621  1.332   -48.470 1.00 33.67  ? 2118 HOH B O   1 
HETATM 8996 O O   . HOH L 8 .   ? -5.752  -2.335  -48.976 1.00 43.51  ? 2119 HOH B O   1 
HETATM 8997 O O   . HOH L 8 .   ? -5.495  -6.470  -47.236 1.00 59.52  ? 2120 HOH B O   1 
HETATM 8998 O O   . HOH L 8 .   ? -3.478  -5.095  -45.056 1.00 44.90  ? 2121 HOH B O   1 
HETATM 8999 O O   . HOH L 8 .   ? -3.393  -3.253  -42.596 1.00 49.98  ? 2122 HOH B O   1 
HETATM 9000 O O   . HOH L 8 .   ? 4.208   -0.760  -43.393 1.00 33.03  ? 2123 HOH B O   1 
HETATM 9001 O O   . HOH L 8 .   ? -9.129  -0.001  -45.328 1.00 54.14  ? 2124 HOH B O   1 
HETATM 9002 O O   . HOH L 8 .   ? -6.309  0.645   -49.242 1.00 54.13  ? 2125 HOH B O   1 
HETATM 9003 O O   . HOH L 8 .   ? -15.389 0.525   -52.957 1.00 48.53  ? 2126 HOH B O   1 
HETATM 9004 O O   . HOH L 8 .   ? -13.168 -0.938  -52.041 1.00 63.68  ? 2127 HOH B O   1 
HETATM 9005 O O   . HOH L 8 .   ? 9.252   2.344   -15.983 1.00 57.13  ? 2128 HOH B O   1 
HETATM 9006 O O   . HOH L 8 .   ? 11.844  4.926   -14.129 1.00 70.23  ? 2129 HOH B O   1 
HETATM 9007 O O   . HOH L 8 .   ? 11.589  3.700   -11.962 1.00 57.97  ? 2130 HOH B O   1 
HETATM 9008 O O   . HOH L 8 .   ? -16.531 9.103   -45.544 1.00 55.89  ? 2131 HOH B O   1 
HETATM 9009 O O   . HOH L 8 .   ? -16.985 15.842  -47.197 1.00 64.29  ? 2132 HOH B O   1 
HETATM 9010 O O   . HOH L 8 .   ? -13.876 19.007  -46.603 1.00 56.58  ? 2133 HOH B O   1 
HETATM 9011 O O   . HOH L 8 .   ? -8.505  20.113  -47.529 1.00 60.27  ? 2134 HOH B O   1 
HETATM 9012 O O   . HOH L 8 .   ? -12.377 14.773  -39.569 1.00 60.86  ? 2135 HOH B O   1 
HETATM 9013 O O   . HOH L 8 .   ? -1.274  4.191   -48.770 1.00 39.40  ? 2136 HOH B O   1 
HETATM 9014 O O   . HOH L 8 .   ? 1.437   0.287   -53.114 1.00 37.71  ? 2137 HOH B O   1 
HETATM 9015 O O   . HOH L 8 .   ? 10.263  27.287  -30.026 1.00 61.27  ? 2138 HOH B O   1 
HETATM 9016 O O   . HOH L 8 .   ? 7.000   28.291  -31.239 1.00 57.10  ? 2139 HOH B O   1 
HETATM 9017 O O   . HOH L 8 .   ? -6.503  6.912   -21.499 1.00 67.37  ? 2140 HOH B O   1 
HETATM 9018 O O   . HOH L 8 .   ? 21.842  2.304   -47.422 1.00 36.70  ? 2141 HOH B O   1 
HETATM 9019 O O   . HOH L 8 .   ? 22.875  0.660   -53.063 1.00 39.79  ? 2142 HOH B O   1 
HETATM 9020 O O   . HOH L 8 .   ? 25.135  -2.260  -46.567 1.00 43.62  ? 2143 HOH B O   1 
HETATM 9021 O O   . HOH L 8 .   ? 4.637   -1.895  -38.125 0.50 39.87  ? 2144 HOH B O   1 
HETATM 9022 O O   . HOH L 8 .   ? 25.288  5.736   -58.478 1.00 62.65  ? 2145 HOH B O   1 
HETATM 9023 O O   . HOH L 8 .   ? 28.171  5.669   -51.291 1.00 41.85  ? 2146 HOH B O   1 
HETATM 9024 O O   . HOH L 8 .   ? 25.017  7.110   -51.221 1.00 50.48  ? 2147 HOH B O   1 
HETATM 9025 O O   . HOH L 8 .   ? 22.767  7.391   -52.810 1.00 56.69  ? 2148 HOH B O   1 
HETATM 9026 O O   . HOH L 8 .   ? 15.645  10.131  -56.567 1.00 39.14  ? 2149 HOH B O   1 
HETATM 9027 O O   . HOH L 8 .   ? 18.876  12.844  -55.582 1.00 48.23  ? 2150 HOH B O   1 
HETATM 9028 O O   . HOH L 8 .   ? 21.016  13.315  -51.875 1.00 46.75  ? 2151 HOH B O   1 
HETATM 9029 O O   . HOH L 8 .   ? 15.938  16.962  -56.004 1.00 49.31  ? 2152 HOH B O   1 
HETATM 9030 O O   . HOH L 8 .   ? 5.957   28.903  -28.745 1.00 46.77  ? 2153 HOH B O   1 
HETATM 9031 O O   . HOH L 8 .   ? 9.815   30.096  -25.627 1.00 63.40  ? 2154 HOH B O   1 
HETATM 9032 O O   . HOH L 8 .   ? 13.446  30.317  -29.870 1.00 70.54  ? 2155 HOH B O   1 
HETATM 9033 O O   . HOH L 8 .   ? 2.069   11.953  -17.554 1.00 59.89  ? 2156 HOH B O   1 
HETATM 9034 O O   . HOH L 8 .   ? 1.072   17.390  -65.430 1.00 54.91  ? 2157 HOH B O   1 
HETATM 9035 O O   . HOH L 8 .   ? 6.764   12.798  -64.319 1.00 50.57  ? 2158 HOH B O   1 
HETATM 9036 O O   . HOH L 8 .   ? 8.864   12.802  -61.975 1.00 65.88  ? 2159 HOH B O   1 
HETATM 9037 O O   . HOH L 8 .   ? 12.076  13.096  -62.302 1.00 61.99  ? 2160 HOH B O   1 
HETATM 9038 O O   . HOH L 8 .   ? 1.917   20.324  -16.477 0.50 33.75  ? 2161 HOH B O   1 
HETATM 9039 O O   . HOH L 8 .   ? -0.028  17.766  -16.227 1.00 65.22  ? 2162 HOH B O   1 
HETATM 9040 O O   . HOH L 8 .   ? 1.718   19.407  -60.178 1.00 39.28  ? 2163 HOH B O   1 
HETATM 9041 O O   . HOH L 8 .   ? -6.226  20.298  -63.374 1.00 64.30  ? 2164 HOH B O   1 
HETATM 9042 O O   . HOH L 8 .   ? 6.828   11.703  -15.485 1.00 75.96  ? 2165 HOH B O   1 
HETATM 9043 O O   . HOH L 8 .   ? 7.963   9.283   -16.737 1.00 67.08  ? 2166 HOH B O   1 
HETATM 9044 O O   . HOH L 8 .   ? 9.667   9.360   -11.446 1.00 77.69  ? 2167 HOH B O   1 
HETATM 9045 O O   . HOH L 8 .   ? -1.776  23.784  -58.923 1.00 59.35  ? 2168 HOH B O   1 
HETATM 9046 O O   . HOH L 8 .   ? -3.817  24.313  -51.293 1.00 44.01  ? 2169 HOH B O   1 
HETATM 9047 O O   . HOH L 8 .   ? 2.280   25.717  -48.085 1.00 55.54  ? 2170 HOH B O   1 
HETATM 9048 O O   . HOH L 8 .   ? 0.076   19.768  -47.249 1.00 40.36  ? 2171 HOH B O   1 
HETATM 9049 O O   . HOH L 8 .   ? 3.368   4.299   -33.897 1.00 33.14  ? 2172 HOH B O   1 
HETATM 9050 O O   . HOH L 8 .   ? 22.407  15.810  -45.832 1.00 39.85  ? 2173 HOH B O   1 
HETATM 9051 O O   . HOH L 8 .   ? 22.307  17.575  -47.816 1.00 46.04  ? 2174 HOH B O   1 
HETATM 9052 O O   . HOH L 8 .   ? 11.428  21.856  -46.909 1.00 41.18  ? 2175 HOH B O   1 
HETATM 9053 O O   . HOH L 8 .   ? 9.800   24.200  -50.146 1.00 55.60  ? 2176 HOH B O   1 
HETATM 9054 O O   . HOH L 8 .   ? 11.250  23.917  -45.425 1.00 60.63  ? 2177 HOH B O   1 
HETATM 9055 O O   . HOH L 8 .   ? 6.146   16.918  -53.619 1.00 31.29  ? 2178 HOH B O   1 
HETATM 9056 O O   . HOH L 8 .   ? 20.467  7.624   -36.700 1.00 45.46  ? 2179 HOH B O   1 
HETATM 9057 O O   . HOH L 8 .   ? 17.005  5.791   -34.706 1.00 36.47  ? 2180 HOH B O   1 
HETATM 9058 O O   . HOH L 8 .   ? 23.714  5.700   -34.875 1.00 69.58  ? 2181 HOH B O   1 
HETATM 9059 O O   . HOH L 8 .   ? 21.416  6.816   -30.236 1.00 51.83  ? 2182 HOH B O   1 
HETATM 9060 O O   . HOH L 8 .   ? 23.264  1.778   -32.301 1.00 38.42  ? 2183 HOH B O   1 
HETATM 9061 O O   . HOH L 8 .   ? 22.422  1.488   -36.173 1.00 39.35  ? 2184 HOH B O   1 
HETATM 9062 O O   . HOH L 8 .   ? 26.956  1.928   -37.503 1.00 42.95  ? 2185 HOH B O   1 
HETATM 9063 O O   . HOH L 8 .   ? 31.605  1.911   -37.266 1.00 63.06  ? 2186 HOH B O   1 
HETATM 9064 O O   . HOH L 8 .   ? 29.731  7.113   -42.102 1.00 45.11  ? 2187 HOH B O   1 
HETATM 9065 O O   . HOH L 8 .   ? 32.257  -1.674  -38.291 1.00 60.65  ? 2188 HOH B O   1 
HETATM 9066 O O   . HOH L 8 .   ? 30.982  -3.428  -35.821 1.00 71.24  ? 2189 HOH B O   1 
HETATM 9067 O O   . HOH L 8 .   ? 33.328  2.582   -46.914 1.00 59.39  ? 2190 HOH B O   1 
HETATM 9068 O O   . HOH L 8 .   ? 32.135  -8.409  -42.961 1.00 47.52  ? 2191 HOH B O   1 
HETATM 9069 O O   . HOH L 8 .   ? 31.916  -9.166  -40.458 1.00 62.86  ? 2192 HOH B O   1 
HETATM 9070 O O   . HOH L 8 .   ? 23.146  -2.794  -34.355 1.00 38.88  ? 2193 HOH B O   1 
HETATM 9071 O O   . HOH L 8 .   ? 25.806  -1.539  -35.423 1.00 56.90  ? 2194 HOH B O   1 
HETATM 9072 O O   . HOH L 8 .   ? 22.009  -1.178  -36.614 1.00 40.01  ? 2195 HOH B O   1 
HETATM 9073 O O   . HOH L 8 .   ? 32.747  -13.012 -42.496 1.00 69.31  ? 2196 HOH B O   1 
HETATM 9074 O O   . HOH L 8 .   ? 37.722  -9.145  -53.406 1.00 71.13  ? 2197 HOH B O   1 
HETATM 9075 O O   . HOH L 8 .   ? 36.616  -1.371  -55.548 1.00 67.32  ? 2198 HOH B O   1 
HETATM 9076 O O   . HOH L 8 .   ? 23.782  -6.743  -64.457 1.00 53.27  ? 2199 HOH B O   1 
HETATM 9077 O O   . HOH L 8 .   ? 19.612  -8.337  -60.144 1.00 54.88  ? 2200 HOH B O   1 
HETATM 9078 O O   . HOH L 8 .   ? 24.341  -2.819  -59.161 1.00 48.17  ? 2201 HOH B O   1 
HETATM 9079 O O   . HOH L 8 .   ? 25.894  -20.101 -54.313 1.00 71.31  ? 2202 HOH B O   1 
HETATM 9080 O O   . HOH L 8 .   ? 14.489  -13.431 -57.909 1.00 39.68  ? 2203 HOH B O   1 
HETATM 9081 O O   . HOH L 8 .   ? 18.159  -19.879 -55.012 1.00 62.98  ? 2204 HOH B O   1 
HETATM 9082 O O   . HOH L 8 .   ? 20.988  -19.522 -57.048 1.00 66.79  ? 2205 HOH B O   1 
HETATM 9083 O O   . HOH L 8 .   ? 16.863  -18.276 -43.698 1.00 74.77  ? 2206 HOH B O   1 
HETATM 9084 O O   . HOH L 8 .   ? 14.673  -10.767 -42.141 1.00 64.90  ? 2207 HOH B O   1 
HETATM 9085 O O   . HOH L 8 .   ? 16.940  -7.930  -48.431 1.00 40.59  ? 2208 HOH B O   1 
HETATM 9086 O O   . HOH L 8 .   ? 25.086  -2.579  -31.541 1.00 60.25  ? 2209 HOH B O   1 
HETATM 9087 O O   . HOH L 8 .   ? 19.200  -10.415 -33.673 1.00 65.79  ? 2210 HOH B O   1 
HETATM 9088 O O   . HOH L 8 .   ? 22.809  -5.218  -33.277 1.00 43.83  ? 2211 HOH B O   1 
HETATM 9089 O O   . HOH L 8 .   ? 13.120  -6.131  -33.652 1.00 38.05  ? 2212 HOH B O   1 
HETATM 9090 O O   . HOH L 8 .   ? 23.320  -0.816  -31.746 1.00 41.71  ? 2213 HOH B O   1 
HETATM 9091 O O   . HOH L 8 .   ? 16.642  -6.606  -34.186 1.00 59.31  ? 2214 HOH B O   1 
HETATM 9092 O O   . HOH L 8 .   ? 20.321  0.085   -29.493 1.00 49.60  ? 2215 HOH B O   1 
HETATM 9093 O O   . HOH L 8 .   ? 19.141  -0.840  -37.054 1.00 44.60  ? 2216 HOH B O   1 
HETATM 9094 O O   . HOH L 8 .   ? 24.181  -2.271  -43.899 1.00 37.39  ? 2217 HOH B O   1 
HETATM 9095 O O   . HOH L 8 .   ? 17.461  -5.527  -43.737 1.00 54.88  ? 2218 HOH B O   1 
HETATM 9096 O O   . HOH L 8 .   ? 16.525  -3.078  -42.857 1.00 31.65  ? 2219 HOH B O   1 
HETATM 9097 O O   . HOH L 8 .   ? 22.951  -0.035  -45.044 1.00 44.55  ? 2220 HOH B O   1 
HETATM 9098 O O   . HOH L 8 .   ? 29.596  7.113   -49.361 1.00 57.92  ? 2221 HOH B O   1 
HETATM 9099 O O   . HOH L 8 .   ? 25.130  11.608  -55.835 1.00 57.50  ? 2222 HOH B O   1 
HETATM 9100 O O   . HOH L 8 .   ? 22.426  15.741  -50.269 1.00 63.92  ? 2223 HOH B O   1 
HETATM 9101 O O   . HOH L 8 .   ? 22.268  10.389  -52.975 1.00 55.50  ? 2224 HOH B O   1 
HETATM 9102 O O   . HOH L 8 .   ? 26.046  8.537   -53.094 1.00 58.14  ? 2225 HOH B O   1 
HETATM 9103 O O   . HOH L 8 .   ? 25.823  10.863  -29.518 1.00 74.36  ? 2226 HOH B O   1 
HETATM 9104 O O   . HOH L 8 .   ? 7.852   28.045  -39.526 1.00 59.76  ? 2227 HOH B O   1 
HETATM 9105 O O   . HOH L 8 .   ? 14.858  30.952  -34.138 1.00 71.61  ? 2228 HOH B O   1 
HETATM 9106 O O   . HOH L 8 .   ? 13.260  26.386  -42.907 1.00 67.81  ? 2229 HOH B O   1 
HETATM 9107 O O   . HOH L 8 .   ? 6.196   4.724   -25.008 1.00 39.30  ? 2230 HOH B O   1 
HETATM 9108 O O   . HOH L 8 .   ? -3.346  0.747   -22.371 1.00 58.54  ? 2231 HOH B O   1 
HETATM 9109 O O   . HOH L 8 .   ? 2.454   2.683   -20.247 1.00 62.23  ? 2232 HOH B O   1 
HETATM 9110 O O   . HOH L 8 .   ? 4.937   -1.589  -28.929 1.00 45.40  ? 2233 HOH B O   1 
HETATM 9111 O O   . HOH L 8 .   ? 13.747  -9.252  -33.513 1.00 66.73  ? 2234 HOH B O   1 
HETATM 9112 O O   . HOH L 8 .   ? 12.178  -18.097 -22.269 1.00 79.02  ? 2235 HOH B O   1 
HETATM 9113 O O   . HOH L 8 .   ? 3.496   -15.069 -17.346 1.00 54.62  ? 2236 HOH B O   1 
HETATM 9114 O O   . HOH L 8 .   ? 14.401  -16.891 -14.847 1.00 60.71  ? 2237 HOH B O   1 
HETATM 9115 O O   . HOH L 8 .   ? 20.691  -5.670  -10.513 1.00 62.22  ? 2238 HOH B O   1 
HETATM 9116 O O   . HOH L 8 .   ? 20.514  -12.342 -16.395 1.00 59.10  ? 2239 HOH B O   1 
HETATM 9117 O O   . HOH L 8 .   ? 15.529  -12.475 -21.031 1.00 54.31  ? 2240 HOH B O   1 
HETATM 9118 O O   . HOH L 8 .   ? 14.551  -17.115 -19.890 1.00 60.90  ? 2241 HOH B O   1 
HETATM 9119 O O   . HOH L 8 .   ? 22.413  -6.501  -17.780 1.00 60.84  ? 2242 HOH B O   1 
HETATM 9120 O O   . HOH L 8 .   ? 21.003  -11.390 -23.010 1.00 57.46  ? 2243 HOH B O   1 
HETATM 9121 O O   . HOH L 8 .   ? 24.564  -5.117  -24.143 1.00 47.71  ? 2244 HOH B O   1 
HETATM 9122 O O   . HOH L 8 .   ? 23.076  -8.346  -27.008 1.00 51.97  ? 2245 HOH B O   1 
HETATM 9123 O O   . HOH L 8 .   ? 16.439  -1.892  -28.787 1.00 46.90  ? 2246 HOH B O   1 
HETATM 9124 O O   . HOH L 8 .   ? 31.938  -4.495  -21.323 1.00 55.73  ? 2247 HOH B O   1 
HETATM 9125 O O   . HOH L 8 .   ? 31.598  -1.953  -18.738 1.00 46.79  ? 2248 HOH B O   1 
HETATM 9126 O O   . HOH L 8 .   ? 10.871  1.876   -14.138 1.00 60.40  ? 2249 HOH B O   1 
HETATM 9127 O O   . HOH L 8 .   ? 11.107  -2.139  -12.527 1.00 57.56  ? 2250 HOH B O   1 
HETATM 9128 O O   . HOH L 8 .   ? 11.694  -3.469  -10.341 1.00 51.72  ? 2251 HOH B O   1 
HETATM 9129 O O   . HOH L 8 .   ? 10.018  -7.113  -5.034  1.00 47.39  ? 2252 HOH B O   1 
HETATM 9130 O O   . HOH L 8 .   ? 18.466  -10.196 -7.357  1.00 76.53  ? 2253 HOH B O   1 
HETATM 9131 O O   . HOH L 8 .   ? 8.891   -0.631  -12.633 1.00 54.62  ? 2254 HOH B O   1 
HETATM 9132 O O   . HOH L 8 .   ? 6.103   0.223   -19.657 1.00 44.35  ? 2255 HOH B O   1 
HETATM 9133 O O   . HOH L 8 .   ? 7.283   1.185   -23.918 1.00 48.78  ? 2256 HOH B O   1 
HETATM 9134 O O   . HOH L 8 .   ? 4.702   -0.947  -21.914 1.00 42.78  ? 2257 HOH B O   1 
HETATM 9135 O O   . HOH L 8 .   ? 8.629   3.956   -24.072 1.00 43.76  ? 2258 HOH B O   1 
HETATM 9136 O O   . HOH L 8 .   ? 10.235  5.651   -18.725 1.00 48.34  ? 2259 HOH B O   1 
HETATM 9137 O O   . HOH L 8 .   ? 18.169  6.680   -26.903 1.00 34.33  ? 2260 HOH B O   1 
HETATM 9138 O O   . HOH L 8 .   ? 13.295  6.881   -33.225 1.00 32.89  ? 2261 HOH B O   1 
HETATM 9139 O O   . HOH L 8 .   ? 19.037  10.255  -30.231 1.00 42.88  ? 2262 HOH B O   1 
HETATM 9140 O O   . HOH L 8 .   ? 22.075  11.678  -27.782 1.00 59.12  ? 2263 HOH B O   1 
HETATM 9141 O O   . HOH L 8 .   ? 19.771  15.927  -26.372 1.00 68.97  ? 2264 HOH B O   1 
HETATM 9142 O O   . HOH L 8 .   ? 17.926  21.534  -27.262 1.00 62.67  ? 2265 HOH B O   1 
HETATM 9143 O O   . HOH L 8 .   ? 18.638  24.997  -26.624 1.00 60.18  ? 2266 HOH B O   1 
HETATM 9144 O O   . HOH L 8 .   ? 11.220  27.545  -32.504 1.00 54.54  ? 2267 HOH B O   1 
HETATM 9145 O O   . HOH L 8 .   ? 7.801   29.841  -33.918 1.00 72.24  ? 2268 HOH B O   1 
HETATM 9146 O O   . HOH L 8 .   ? 4.213   31.704  -37.822 1.00 69.15  ? 2269 HOH B O   1 
HETATM 9147 O O   . HOH L 8 .   ? 2.964   7.947   -33.205 1.00 31.91  ? 2270 HOH B O   1 
HETATM 9148 O O   . HOH L 8 .   ? 1.569   7.978   -20.685 1.00 68.09  ? 2271 HOH B O   1 
HETATM 9149 O O   . HOH L 8 .   ? -0.823  8.602   -19.049 1.00 72.71  ? 2272 HOH B O   1 
HETATM 9150 O O   . HOH L 8 .   ? -8.448  5.426   -24.029 1.00 63.30  ? 2273 HOH B O   1 
HETATM 9151 O O   . HOH L 8 .   ? -8.200  -3.455  -26.628 1.00 55.78  ? 2274 HOH B O   1 
HETATM 9152 O O   . HOH L 8 .   ? -6.762  3.235   -23.829 1.00 54.14  ? 2275 HOH B O   1 
HETATM 9153 O O   . HOH L 8 .   ? -2.739  -11.837 -28.639 1.00 64.30  ? 2276 HOH B O   1 
HETATM 9154 O O   . HOH L 8 .   ? -4.769  -9.838  -22.608 1.00 64.98  ? 2277 HOH B O   1 
HETATM 9155 O O   . HOH L 8 .   ? -1.809  -9.148  -20.526 1.00 61.88  ? 2278 HOH B O   1 
HETATM 9156 O O   . HOH L 8 .   ? 4.159   -3.261  -20.740 1.00 43.75  ? 2279 HOH B O   1 
HETATM 9157 O O   . HOH L 8 .   ? 3.892   -2.598  -35.497 1.00 56.04  ? 2280 HOH B O   1 
HETATM 9158 O O   . HOH L 8 .   ? -4.500  1.833   -30.447 1.00 47.53  ? 2281 HOH B O   1 
HETATM 9159 O O   . HOH L 8 .   ? -2.976  1.218   -36.818 1.00 31.38  ? 2282 HOH B O   1 
HETATM 9160 O O   . HOH L 8 .   ? -7.970  7.843   -45.224 1.00 40.34  ? 2283 HOH B O   1 
HETATM 9161 O O   . HOH L 8 .   ? -19.891 -0.865  -36.198 1.00 76.64  ? 2284 HOH B O   1 
HETATM 9162 O O   . HOH L 8 .   ? -14.517 -7.111  -38.807 1.00 64.69  ? 2285 HOH B O   1 
HETATM 9163 O O   . HOH L 8 .   ? -15.355 -2.586  -30.953 1.00 50.09  ? 2286 HOH B O   1 
HETATM 9164 O O   . HOH L 8 .   ? -14.645 3.483   -27.115 1.00 64.18  ? 2287 HOH B O   1 
HETATM 9165 O O   . HOH L 8 .   ? -14.518 10.163  -28.602 1.00 55.67  ? 2288 HOH B O   1 
HETATM 9166 O O   . HOH L 8 .   ? -9.390  18.432  -34.208 1.00 45.87  ? 2289 HOH B O   1 
HETATM 9167 O O   . HOH L 8 .   ? -8.805  19.998  -29.551 1.00 57.24  ? 2290 HOH B O   1 
HETATM 9168 O O   . HOH L 8 .   ? -6.733  24.622  -41.032 1.00 50.49  ? 2291 HOH B O   1 
HETATM 9169 O O   . HOH L 8 .   ? -1.434  25.022  -47.471 1.00 43.44  ? 2292 HOH B O   1 
HETATM 9170 O O   . HOH L 8 .   ? -5.285  25.046  -38.291 1.00 43.31  ? 2293 HOH B O   1 
HETATM 9171 O O   . HOH L 8 .   ? -11.678 23.147  -27.915 1.00 78.86  ? 2294 HOH B O   1 
HETATM 9172 O O   . HOH L 8 .   ? -9.833  26.589  -24.775 1.00 56.16  ? 2295 HOH B O   1 
HETATM 9173 O O   . HOH L 8 .   ? -4.228  27.605  -30.977 1.00 52.24  ? 2296 HOH B O   1 
HETATM 9174 O O   . HOH L 8 .   ? -4.274  24.579  -24.264 1.00 56.84  ? 2297 HOH B O   1 
HETATM 9175 O O   . HOH L 8 .   ? -1.683  27.014  -29.857 1.00 40.76  ? 2298 HOH B O   1 
HETATM 9176 O O   . HOH L 8 .   ? 3.167   20.475  -28.519 1.00 33.17  ? 2299 HOH B O   1 
HETATM 9177 O O   . HOH L 8 .   ? 4.675   27.262  -27.030 1.00 29.69  ? 2300 HOH B O   1 
HETATM 9178 O O   . HOH L 8 .   ? 6.068   24.345  -24.989 1.00 33.66  ? 2301 HOH B O   1 
HETATM 9179 O O   . HOH L 8 .   ? 7.976   25.084  -31.670 1.00 34.70  ? 2302 HOH B O   1 
HETATM 9180 O O   . HOH L 8 .   ? 13.648  18.440  -25.735 1.00 59.12  ? 2303 HOH B O   1 
HETATM 9181 O O   . HOH L 8 .   ? 8.124   28.309  -24.026 1.00 54.93  ? 2304 HOH B O   1 
HETATM 9182 O O   . HOH L 8 .   ? 12.101  26.719  -28.345 1.00 40.83  ? 2305 HOH B O   1 
HETATM 9183 O O   . HOH L 8 .   ? 11.912  27.892  -25.618 1.00 54.46  ? 2306 HOH B O   1 
HETATM 9184 O O   . HOH L 8 .   ? 9.592   23.835  -18.661 1.00 53.94  ? 2307 HOH B O   1 
HETATM 9185 O O   . HOH L 8 .   ? 10.712  17.257  -22.989 1.00 32.37  ? 2308 HOH B O   1 
HETATM 9186 O O   . HOH L 8 .   ? 1.330   23.719  -19.662 1.00 43.61  ? 2309 HOH B O   1 
HETATM 9187 O O   . HOH L 8 .   ? 1.058   27.487  -23.669 1.00 59.74  ? 2310 HOH B O   1 
HETATM 9188 O O   . HOH L 8 .   ? 2.719   11.675  -20.434 1.00 39.52  ? 2311 HOH B O   1 
HETATM 9189 O O   . HOH L 8 .   ? -9.146  7.602   -23.295 1.00 66.44  ? 2312 HOH B O   1 
HETATM 9190 O O   . HOH L 8 .   ? -7.273  14.024  -26.660 1.00 33.99  ? 2313 HOH B O   1 
HETATM 9191 O O   . HOH L 8 .   ? -6.233  13.985  -23.215 1.00 54.80  ? 2314 HOH B O   1 
HETATM 9192 O O   . HOH L 8 .   ? -9.902  18.587  -27.465 1.00 48.89  ? 2315 HOH B O   1 
HETATM 9193 O O   . HOH L 8 .   ? -5.512  13.024  -20.562 1.00 60.34  ? 2316 HOH B O   1 
HETATM 9194 O O   . HOH L 8 .   ? -4.528  21.260  -20.533 1.00 47.26  ? 2317 HOH B O   1 
HETATM 9195 O O   . HOH L 8 .   ? 1.036   21.469  -18.494 0.50 28.36  ? 2318 HOH B O   1 
HETATM 9196 O O   . HOH L 8 .   ? 2.670   17.602  -16.824 1.00 44.04  ? 2319 HOH B O   1 
HETATM 9197 O O   . HOH L 8 .   ? 5.146   18.260  -15.723 1.00 62.94  ? 2320 HOH B O   1 
HETATM 9198 O O   . HOH L 8 .   ? 5.227   14.922  -18.531 1.00 46.15  ? 2321 HOH B O   1 
HETATM 9199 O O   . HOH L 8 .   ? 12.589  15.286  -22.734 1.00 36.89  ? 2322 HOH B O   1 
HETATM 9200 O O   . HOH L 8 .   ? 6.505   12.151  -18.866 1.00 58.21  ? 2323 HOH B O   1 
HETATM 9201 O O   . HOH L 8 .   ? 4.614   9.336   -20.308 1.00 52.32  ? 2324 HOH B O   1 
HETATM 9202 O O   . HOH L 8 .   ? 6.268   3.083   -21.689 1.00 51.52  ? 2325 HOH B O   1 
HETATM 9203 O O   . HOH L 8 .   ? 8.864   14.168  -17.855 1.00 34.64  ? 2326 HOH B O   1 
HETATM 9204 O O   . HOH L 8 .   ? 15.398  15.706  -20.873 1.00 41.60  ? 2327 HOH B O   1 
HETATM 9205 O O   . HOH L 8 .   ? 10.555  13.063  -16.104 1.00 44.70  ? 2328 HOH B O   1 
HETATM 9206 O O   . HOH L 8 .   ? 12.212  17.037  -14.487 1.00 50.18  ? 2329 HOH B O   1 
HETATM 9207 O O   . HOH L 8 .   ? 16.243  11.907  -11.803 1.00 51.19  ? 2330 HOH B O   1 
HETATM 9208 O O   . HOH L 8 .   ? 18.014  11.605  -14.701 1.00 63.77  ? 2331 HOH B O   1 
HETATM 9209 O O   . HOH L 8 .   ? 11.159  10.768  -16.784 1.00 37.27  ? 2332 HOH B O   1 
HETATM 9210 O O   . HOH L 8 .   ? 13.019  8.639   -13.545 1.00 77.38  ? 2333 HOH B O   1 
HETATM 9211 O O   . HOH L 8 .   ? 10.632  6.901   -16.215 1.00 77.09  ? 2334 HOH B O   1 
HETATM 9212 O O   . HOH L 8 .   ? 18.272  9.208   -27.901 1.00 36.74  ? 2335 HOH B O   1 
HETATM 9213 O O   . HOH L 8 .   ? 17.331  15.825  -25.035 1.00 58.48  ? 2336 HOH B O   1 
HETATM 9214 O O   . HOH L 8 .   ? 17.707  15.771  -22.190 1.00 47.18  ? 2337 HOH B O   1 
HETATM 9215 O O   . HOH L 8 .   ? 24.127  17.758  -20.239 1.00 72.40  ? 2338 HOH B O   1 
HETATM 9216 O O   . HOH L 8 .   ? 30.688  11.202  -25.511 1.00 71.63  ? 2339 HOH B O   1 
HETATM 9217 O O   . HOH L 8 .   ? 10.390  -21.432 -23.392 1.00 68.43  ? 2340 HOH B O   1 
HETATM 9218 O O   . HOH L 8 .   ? 19.944  7.729   -12.714 1.00 71.16  ? 2341 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.3166 1.2057 1.1071 0.0784  -0.0431 0.0070  1    GLU A N   
2    C CA  . GLU A 1   ? 1.2322 1.1243 1.0150 0.0793  -0.0364 0.0121  1    GLU A CA  
3    C C   . GLU A 1   ? 1.1667 1.0544 0.9305 0.0848  -0.0371 0.0106  1    GLU A C   
4    O O   . GLU A 1   ? 1.1155 0.9969 0.8712 0.0864  -0.0440 0.0092  1    GLU A O   
5    C CB  . GLU A 1   ? 1.1042 0.9964 0.8918 0.0757  -0.0367 0.0178  1    GLU A CB  
6    C CG  . GLU A 1   ? 0.9764 0.8691 0.7535 0.0761  -0.0308 0.0234  1    GLU A CG  
7    C CD  . GLU A 1   ? 0.9544 0.8483 0.7392 0.0712  -0.0273 0.0294  1    GLU A CD  
8    O OE1 . GLU A 1   ? 0.8612 0.7584 0.6427 0.0692  -0.0199 0.0338  1    GLU A OE1 
9    O OE2 . GLU A 1   ? 0.9528 0.8444 0.7462 0.0694  -0.0321 0.0298  1    GLU A OE2 
10   N N   . GLY A 2   ? 1.0773 0.9695 0.8343 0.0878  -0.0297 0.0110  2    GLY A N   
11   C CA  . GLY A 2   ? 0.9387 0.8282 0.6773 0.0938  -0.0286 0.0093  2    GLY A CA  
12   C C   . GLY A 2   ? 0.9513 0.8469 0.6896 0.0975  -0.0221 0.0069  2    GLY A C   
13   O O   . GLY A 2   ? 0.8687 0.7726 0.6032 0.0986  -0.0138 0.0105  2    GLY A O   
14   N N   . ARG A 3   ? 1.0677 0.9597 0.8108 0.0990  -0.0259 0.0010  3    ARG A N   
15   C CA  . ARG A 3   ? 1.0496 0.9454 0.7919 0.1039  -0.0213 -0.0025 3    ARG A CA  
16   C C   . ARG A 3   ? 0.9663 0.8697 0.7269 0.0997  -0.0181 -0.0011 3    ARG A C   
17   O O   . ARG A 3   ? 1.0041 0.9110 0.7664 0.1036  -0.0149 -0.0039 3    ARG A O   
18   C CB  . ARG A 3   ? 1.1141 0.9976 0.8463 0.1090  -0.0284 -0.0104 3    ARG A CB  
19   C CG  . ARG A 3   ? 1.2109 1.0908 0.9224 0.1176  -0.0268 -0.0137 3    ARG A CG  
20   C CD  . ARG A 3   ? 1.2155 1.0899 0.9138 0.1176  -0.0307 -0.0124 3    ARG A CD  
21   N NE  . ARG A 3   ? 1.2019 1.0785 0.8823 0.1247  -0.0253 -0.0123 3    ARG A NE  
22   C CZ  . ARG A 3   ? 1.0920 0.9804 0.7716 0.1284  -0.0154 -0.0099 3    ARG A CZ  
23   N NH1 . ARG A 3   ? 1.0953 0.9943 0.7911 0.1256  -0.0098 -0.0074 3    ARG A NH1 
24   N NH2 . ARG A 3   ? 0.9154 0.8061 0.5780 0.1348  -0.0109 -0.0098 3    ARG A NH2 
25   N N   . GLU A 4   ? 0.9360 0.8418 0.7097 0.0924  -0.0189 0.0032  4    GLU A N   
26   C CA  . GLU A 4   ? 0.8441 0.7556 0.6353 0.0877  -0.0173 0.0044  4    GLU A CA  
27   C C   . GLU A 4   ? 0.7748 0.6992 0.5712 0.0858  -0.0081 0.0096  4    GLU A C   
28   O O   . GLU A 4   ? 0.8142 0.7424 0.6019 0.0864  -0.0035 0.0132  4    GLU A O   
29   C CB  . GLU A 4   ? 0.9696 0.8777 0.7706 0.0812  -0.0224 0.0068  4    GLU A CB  
30   C CG  . GLU A 4   ? 1.1364 1.0422 0.9501 0.0783  -0.0271 0.0039  4    GLU A CG  
31   C CD  . GLU A 4   ? 1.2307 1.1294 1.0460 0.0755  -0.0355 0.0031  4    GLU A CD  
32   O OE1 . GLU A 4   ? 1.2358 1.1354 1.0521 0.0729  -0.0358 0.0073  4    GLU A OE1 
33   O OE2 . GLU A 4   ? 1.2621 1.1544 1.0772 0.0759  -0.0419 -0.0016 4    GLU A OE2 
34   N N   . ASP A 5   ? 0.7036 0.6349 0.5140 0.0827  -0.0055 0.0103  5    ASP A N   
35   C CA  . ASP A 5   ? 0.6207 0.5654 0.4377 0.0798  0.0028  0.0152  5    ASP A CA  
36   C C   . ASP A 5   ? 0.6488 0.5932 0.4699 0.0722  0.0034  0.0212  5    ASP A C   
37   O O   . ASP A 5   ? 0.6298 0.5703 0.4607 0.0675  -0.0002 0.0216  5    ASP A O   
38   C CB  . ASP A 5   ? 0.5432 0.4944 0.3737 0.0789  0.0042  0.0138  5    ASP A CB  
39   C CG  . ASP A 5   ? 0.6049 0.5708 0.4439 0.0746  0.0118  0.0189  5    ASP A CG  
40   O OD1 . ASP A 5   ? 0.6576 0.6271 0.4934 0.0705  0.0154  0.0240  5    ASP A OD1 
41   O OD2 . ASP A 5   ? 0.6236 0.5976 0.4722 0.0750  0.0140  0.0180  5    ASP A OD2 
42   N N   . PRO A 6   ? 0.7850 0.7331 0.5977 0.0711  0.0083  0.0259  6    PRO A N   
43   C CA  . PRO A 6   ? 0.7800 0.7246 0.5933 0.0644  0.0085  0.0317  6    PRO A CA  
44   C C   . PRO A 6   ? 0.7096 0.6594 0.5373 0.0570  0.0110  0.0348  6    PRO A C   
45   O O   . PRO A 6   ? 0.6430 0.5870 0.4731 0.0517  0.0096  0.0384  6    PRO A O   
46   C CB  . PRO A 6   ? 0.8291 0.7789 0.6301 0.0649  0.0147  0.0361  6    PRO A CB  
47   C CG  . PRO A 6   ? 0.7803 0.7431 0.5822 0.0695  0.0202  0.0338  6    PRO A CG  
48   C CD  . PRO A 6   ? 0.7784 0.7342 0.5800 0.0761  0.0141  0.0264  6    PRO A CD  
49   N N   . GLN A 7   ? 0.6928 0.6532 0.5295 0.0571  0.0145  0.0335  7    GLN A N   
50   C CA  . GLN A 7   ? 0.6519 0.6179 0.5018 0.0500  0.0167  0.0363  7    GLN A CA  
51   C C   . GLN A 7   ? 0.6432 0.6022 0.5035 0.0484  0.0109  0.0335  7    GLN A C   
52   O O   . GLN A 7   ? 0.6789 0.6406 0.5490 0.0426  0.0121  0.0356  7    GLN A O   
53   C CB  . GLN A 7   ? 0.8549 0.8367 0.7114 0.0501  0.0227  0.0366  7    GLN A CB  
54   C CG  . GLN A 7   ? 1.0306 1.0232 0.8862 0.0439  0.0298  0.0431  7    GLN A CG  
55   C CD  . GLN A 7   ? 1.0860 1.0880 0.9311 0.0486  0.0351  0.0443  7    GLN A CD  
56   O OE1 . GLN A 7   ? 1.0882 1.0912 0.9252 0.0449  0.0386  0.0494  7    GLN A OE1 
57   N NE2 . GLN A 7   ? 0.9927 1.0013 0.8372 0.0571  0.0359  0.0396  7    GLN A NE2 
58   N N   . LEU A 8   ? 0.5809 0.5312 0.4388 0.0531  0.0046  0.0288  8    LEU A N   
59   C CA  . LEU A 8   ? 0.5874 0.5329 0.4555 0.0517  -0.0008 0.0260  8    LEU A CA  
60   C C   . LEU A 8   ? 0.5862 0.5211 0.4525 0.0507  -0.0068 0.0263  8    LEU A C   
61   O O   . LEU A 8   ? 0.6041 0.5356 0.4776 0.0504  -0.0119 0.0238  8    LEU A O   
62   C CB  . LEU A 8   ? 0.5717 0.5167 0.4409 0.0571  -0.0037 0.0202  8    LEU A CB  
63   C CG  . LEU A 8   ? 0.5619 0.5175 0.4346 0.0594  0.0014  0.0194  8    LEU A CG  
64   C CD1 . LEU A 8   ? 0.5005 0.4522 0.3699 0.0661  -0.0017 0.0136  8    LEU A CD1 
65   C CD2 . LEU A 8   ? 0.4466 0.4096 0.3333 0.0536  0.0039  0.0217  8    LEU A CD2 
66   N N   . LEU A 9   ? 0.5340 0.4647 0.3905 0.0506  -0.0063 0.0297  9    LEU A N   
67   C CA  . LEU A 9   ? 0.5122 0.4338 0.3662 0.0508  -0.0121 0.0302  9    LEU A CA  
68   C C   . LEU A 9   ? 0.5511 0.4705 0.4076 0.0458  -0.0097 0.0353  9    LEU A C   
69   O O   . LEU A 9   ? 0.5482 0.4687 0.3986 0.0433  -0.0047 0.0394  9    LEU A O   
70   C CB  . LEU A 9   ? 0.5344 0.4507 0.3738 0.0553  -0.0144 0.0299  9    LEU A CB  
71   C CG  . LEU A 9   ? 0.7267 0.6437 0.5601 0.0608  -0.0162 0.0246  9    LEU A CG  
72   C CD1 . LEU A 9   ? 0.6404 0.5530 0.4568 0.0653  -0.0169 0.0248  9    LEU A CD1 
73   C CD2 . LEU A 9   ? 0.5516 0.4652 0.3918 0.0617  -0.0233 0.0196  9    LEU A CD2 
74   N N   . VAL A 10  ? 0.5377 0.4537 0.4024 0.0442  -0.0134 0.0350  10   VAL A N   
75   C CA  . VAL A 10  ? 0.5174 0.4294 0.3843 0.0400  -0.0118 0.0391  10   VAL A CA  
76   C C   . VAL A 10  ? 0.6023 0.5076 0.4707 0.0424  -0.0179 0.0388  10   VAL A C   
77   O O   . VAL A 10  ? 0.6048 0.5119 0.4785 0.0451  -0.0229 0.0351  10   VAL A O   
78   C CB  . VAL A 10  ? 0.5826 0.5007 0.4614 0.0352  -0.0083 0.0389  10   VAL A CB  
79   C CG1 . VAL A 10  ? 0.6236 0.5358 0.5038 0.0310  -0.0074 0.0424  10   VAL A CG1 
80   C CG2 . VAL A 10  ? 0.5870 0.5139 0.4649 0.0331  -0.0023 0.0398  10   VAL A CG2 
81   N N   . ARG A 11  ? 0.5074 0.4050 0.3706 0.0413  -0.0174 0.0428  11   ARG A N   
82   C CA  . ARG A 11  ? 0.5005 0.3923 0.3643 0.0445  -0.0226 0.0431  11   ARG A CA  
83   C C   . ARG A 11  ? 0.5739 0.4632 0.4449 0.0415  -0.0212 0.0444  11   ARG A C   
84   O O   . ARG A 11  ? 0.5890 0.4744 0.4567 0.0371  -0.0166 0.0475  11   ARG A O   
85   C CB  . ARG A 11  ? 0.4887 0.3714 0.3383 0.0475  -0.0240 0.0467  11   ARG A CB  
86   C CG  . ARG A 11  ? 0.5238 0.4009 0.3741 0.0516  -0.0291 0.0475  11   ARG A CG  
87   C CD  . ARG A 11  ? 0.5485 0.4169 0.3848 0.0559  -0.0317 0.0508  11   ARG A CD  
88   N NE  . ARG A 11  ? 0.5399 0.4119 0.3710 0.0595  -0.0354 0.0486  11   ARG A NE  
89   C CZ  . ARG A 11  ? 0.6307 0.5060 0.4647 0.0641  -0.0421 0.0462  11   ARG A CZ  
90   N NH1 . ARG A 11  ? 0.6635 0.5409 0.4910 0.0667  -0.0455 0.0442  11   ARG A NH1 
91   N NH2 . ARG A 11  ? 0.5808 0.4582 0.4242 0.0659  -0.0454 0.0457  11   ARG A NH2 
92   N N   . VAL A 12  ? 0.5163 0.4081 0.3967 0.0437  -0.0251 0.0421  12   VAL A N   
93   C CA  . VAL A 12  ? 0.4164 0.3050 0.3022 0.0424  -0.0243 0.0431  12   VAL A CA  
94   C C   . VAL A 12  ? 0.5220 0.4060 0.4057 0.0482  -0.0292 0.0439  12   VAL A C   
95   O O   . VAL A 12  ? 0.5153 0.3995 0.3941 0.0525  -0.0332 0.0437  12   VAL A O   
96   C CB  . VAL A 12  ? 0.4411 0.3386 0.3409 0.0395  -0.0235 0.0399  12   VAL A CB  
97   C CG1 . VAL A 12  ? 0.4537 0.3554 0.3547 0.0344  -0.0185 0.0399  12   VAL A CG1 
98   C CG2 . VAL A 12  ? 0.4545 0.3604 0.3623 0.0424  -0.0283 0.0362  12   VAL A CG2 
99   N N   . ARG A 13  ? 0.4877 0.3674 0.3742 0.0487  -0.0287 0.0447  13   ARG A N   
100  C CA  . ARG A 13  ? 0.5867 0.4616 0.4703 0.0552  -0.0326 0.0459  13   ARG A CA  
101  C C   . ARG A 13  ? 0.5437 0.4292 0.4340 0.0598  -0.0384 0.0435  13   ARG A C   
102  O O   . ARG A 13  ? 0.5792 0.4624 0.4635 0.0653  -0.0424 0.0448  13   ARG A O   
103  C CB  . ARG A 13  ? 0.5016 0.3727 0.3893 0.0556  -0.0313 0.0460  13   ARG A CB  
104  C CG  . ARG A 13  ? 0.5991 0.4670 0.4849 0.0636  -0.0352 0.0469  13   ARG A CG  
105  C CD  . ARG A 13  ? 0.6697 0.5211 0.5390 0.0672  -0.0353 0.0510  13   ARG A CD  
106  N NE  . ARG A 13  ? 0.7407 0.5953 0.6077 0.0749  -0.0407 0.0515  13   ARG A NE  
107  C CZ  . ARG A 13  ? 0.7232 0.5798 0.5928 0.0826  -0.0441 0.0515  13   ARG A CZ  
108  N NH1 . ARG A 13  ? 0.9843 0.8383 0.8575 0.0841  -0.0423 0.0508  13   ARG A NH1 
109  N NH2 . ARG A 13  ? 0.6961 0.5577 0.5643 0.0891  -0.0492 0.0520  13   ARG A NH2 
110  N N   . GLY A 14  ? 0.5124 0.4093 0.4144 0.0571  -0.0391 0.0401  14   GLY A N   
111  C CA  . GLY A 14  ? 0.5742 0.4809 0.4826 0.0599  -0.0448 0.0379  14   GLY A CA  
112  C C   . GLY A 14  ? 0.6068 0.5146 0.5093 0.0599  -0.0476 0.0366  14   GLY A C   
113  O O   . GLY A 14  ? 0.5790 0.4938 0.4851 0.0617  -0.0531 0.0348  14   GLY A O   
114  N N   . GLY A 15  ? 0.6187 0.5204 0.5120 0.0576  -0.0438 0.0375  15   GLY A N   
115  C CA  . GLY A 15  ? 0.5989 0.5010 0.4850 0.0583  -0.0460 0.0362  15   GLY A CA  
116  C C   . GLY A 15  ? 0.5836 0.4855 0.4667 0.0545  -0.0415 0.0351  15   GLY A C   
117  O O   . GLY A 15  ? 0.5651 0.4657 0.4497 0.0509  -0.0359 0.0363  15   GLY A O   
118  N N   . GLN A 16  ? 0.6027 0.5063 0.4811 0.0556  -0.0441 0.0325  16   GLN A N   
119  C CA  . GLN A 16  ? 0.6042 0.5079 0.4777 0.0539  -0.0400 0.0313  16   GLN A CA  
120  C C   . GLN A 16  ? 0.5834 0.4931 0.4671 0.0513  -0.0396 0.0275  16   GLN A C   
121  O O   . GLN A 16  ? 0.6260 0.5392 0.5169 0.0513  -0.0447 0.0248  16   GLN A O   
122  C CB  . GLN A 16  ? 0.5662 0.4670 0.4272 0.0573  -0.0428 0.0303  16   GLN A CB  
123  C CG  . GLN A 16  ? 0.6544 0.5486 0.5022 0.0589  -0.0402 0.0347  16   GLN A CG  
124  C CD  . GLN A 16  ? 0.7331 0.6247 0.5679 0.0626  -0.0432 0.0337  16   GLN A CD  
125  O OE1 . GLN A 16  ? 0.8030 0.6947 0.6368 0.0654  -0.0501 0.0317  16   GLN A OE1 
126  N NE2 . GLN A 16  ? 0.6566 0.5463 0.4810 0.0625  -0.0381 0.0352  16   GLN A NE2 
127  N N   . LEU A 17  ? 0.5252 0.4365 0.4090 0.0490  -0.0338 0.0277  17   LEU A N   
128  C CA  . LEU A 17  ? 0.5353 0.4518 0.4277 0.0471  -0.0327 0.0245  17   LEU A CA  
129  C C   . LEU A 17  ? 0.5507 0.4678 0.4355 0.0487  -0.0300 0.0227  17   LEU A C   
130  O O   . LEU A 17  ? 0.5525 0.4686 0.4282 0.0494  -0.0259 0.0251  17   LEU A O   
131  C CB  . LEU A 17  ? 0.4870 0.4067 0.3883 0.0431  -0.0279 0.0264  17   LEU A CB  
132  C CG  . LEU A 17  ? 0.5297 0.4494 0.4396 0.0416  -0.0295 0.0277  17   LEU A CG  
133  C CD1 . LEU A 17  ? 0.5161 0.4376 0.4316 0.0377  -0.0243 0.0294  17   LEU A CD1 
134  C CD2 . LEU A 17  ? 0.5770 0.5007 0.4961 0.0418  -0.0347 0.0245  17   LEU A CD2 
135  N N   . ARG A 18  ? 0.5094 0.4281 0.3974 0.0494  -0.0319 0.0186  18   ARG A N   
136  C CA  . ARG A 18  ? 0.4733 0.3932 0.3553 0.0518  -0.0287 0.0166  18   ARG A CA  
137  C C   . ARG A 18  ? 0.5247 0.4496 0.4167 0.0500  -0.0261 0.0152  18   ARG A C   
138  O O   . ARG A 18  ? 0.5237 0.4477 0.4227 0.0490  -0.0302 0.0127  18   ARG A O   
139  C CB  . ARG A 18  ? 0.5297 0.4443 0.4021 0.0558  -0.0338 0.0125  18   ARG A CB  
140  C CG  . ARG A 18  ? 0.5420 0.4571 0.4079 0.0596  -0.0306 0.0096  18   ARG A CG  
141  C CD  . ARG A 18  ? 0.6849 0.5926 0.5380 0.0641  -0.0355 0.0054  18   ARG A CD  
142  N NE  . ARG A 18  ? 0.7935 0.6963 0.6509 0.0620  -0.0433 0.0026  18   ARG A NE  
143  C CZ  . ARG A 18  ? 0.8391 0.7380 0.6925 0.0617  -0.0496 0.0023  18   ARG A CZ  
144  N NH1 . ARG A 18  ? 0.7460 0.6434 0.5890 0.0641  -0.0494 0.0042  18   ARG A NH1 
145  N NH2 . ARG A 18  ? 0.8587 0.7555 0.7181 0.0587  -0.0565 0.0001  18   ARG A NH2 
146  N N   . GLY A 19  ? 0.4107 0.3414 0.3030 0.0496  -0.0196 0.0170  19   GLY A N   
147  C CA  . GLY A 19  ? 0.4189 0.3554 0.3205 0.0482  -0.0170 0.0162  19   GLY A CA  
148  C C   . GLY A 19  ? 0.5598 0.4975 0.4563 0.0532  -0.0159 0.0128  19   GLY A C   
149  O O   . GLY A 19  ? 0.5456 0.4779 0.4313 0.0577  -0.0183 0.0102  19   GLY A O   
150  N N   . ILE A 20  ? 0.5035 0.4478 0.4069 0.0530  -0.0125 0.0127  20   ILE A N   
151  C CA  . ILE A 20  ? 0.4776 0.4232 0.3767 0.0586  -0.0113 0.0095  20   ILE A CA  
152  C C   . ILE A 20  ? 0.5124 0.4706 0.4150 0.0591  -0.0042 0.0119  20   ILE A C   
153  O O   . ILE A 20  ? 0.5078 0.4730 0.4198 0.0537  -0.0014 0.0151  20   ILE A O   
154  C CB  . ILE A 20  ? 0.5442 0.4839 0.4480 0.0592  -0.0162 0.0059  20   ILE A CB  
155  C CG1 . ILE A 20  ? 0.5290 0.4669 0.4256 0.0664  -0.0157 0.0022  20   ILE A CG1 
156  C CG2 . ILE A 20  ? 0.4578 0.4033 0.3752 0.0542  -0.0149 0.0080  20   ILE A CG2 
157  C CD1 . ILE A 20  ? 0.5233 0.4539 0.4232 0.0669  -0.0202 -0.0009 20   ILE A CD1 
158  N N   . ARG A 21  ? 0.4989 0.4605 0.3935 0.0655  -0.0013 0.0103  21   ARG A N   
159  C CA  . ARG A 21  ? 0.4876 0.4635 0.3858 0.0668  0.0053  0.0123  21   ARG A CA  
160  C C   . ARG A 21  ? 0.5310 0.5089 0.4357 0.0699  0.0045  0.0098  21   ARG A C   
161  O O   . ARG A 21  ? 0.5694 0.5390 0.4676 0.0763  0.0013  0.0054  21   ARG A O   
162  C CB  . ARG A 21  ? 0.5239 0.5036 0.4101 0.0734  0.0090  0.0117  21   ARG A CB  
163  C CG  . ARG A 21  ? 0.5441 0.5416 0.4328 0.0735  0.0168  0.0154  21   ARG A CG  
164  C CD  . ARG A 21  ? 0.5670 0.5684 0.4430 0.0822  0.0203  0.0138  21   ARG A CD  
165  N NE  . ARG A 21  ? 0.7783 0.7891 0.6566 0.0895  0.0230  0.0116  21   ARG A NE  
166  C CZ  . ARG A 21  ? 0.8626 0.8905 0.7401 0.0936  0.0298  0.0136  21   ARG A CZ  
167  N NH1 . ARG A 21  ? 0.8860 0.9234 0.7598 0.0905  0.0349  0.0179  21   ARG A NH1 
168  N NH2 . ARG A 21  ? 0.8563 0.8924 0.7365 0.1011  0.0316  0.0114  21   ARG A NH2 
169  N N   . LEU A 22  ? 0.4802 0.4680 0.3964 0.0655  0.0071  0.0124  22   LEU A N   
170  C CA  . LEU A 22  ? 0.4393 0.4293 0.3618 0.0684  0.0063  0.0106  22   LEU A CA  
171  C C   . LEU A 22  ? 0.5484 0.5551 0.4734 0.0720  0.0123  0.0122  22   LEU A C   
172  O O   . LEU A 22  ? 0.5971 0.6156 0.5237 0.0686  0.0173  0.0159  22   LEU A O   
173  C CB  . LEU A 22  ? 0.4976 0.4869 0.4318 0.0611  0.0041  0.0122  22   LEU A CB  
174  C CG  . LEU A 22  ? 0.5101 0.4857 0.4444 0.0570  -0.0018 0.0111  22   LEU A CG  
175  C CD1 . LEU A 22  ? 0.4804 0.4581 0.4264 0.0505  -0.0026 0.0130  22   LEU A CD1 
176  C CD2 . LEU A 22  ? 0.4401 0.4029 0.3674 0.0622  -0.0071 0.0065  22   LEU A CD2 
177  N N   . LYS A 23  ? 0.5168 0.5249 0.4427 0.0786  0.0118  0.0096  23   LYS A N   
178  C CA  . LYS A 23  ? 0.5868 0.6125 0.5163 0.0830  0.0172  0.0111  23   LYS A CA  
179  C C   . LYS A 23  ? 0.5381 0.5731 0.4812 0.0771  0.0177  0.0138  23   LYS A C   
180  O O   . LYS A 23  ? 0.5659 0.5925 0.5127 0.0768  0.0136  0.0121  23   LYS A O   
181  C CB  . LYS A 23  ? 0.7186 0.7401 0.6401 0.0950  0.0163  0.0067  23   LYS A CB  
182  C CG  . LYS A 23  ? 0.9576 0.9982 0.8786 0.1024  0.0227  0.0078  23   LYS A CG  
183  C CD  . LYS A 23  ? 1.0948 1.1329 1.0111 0.1146  0.0217  0.0040  23   LYS A CD  
184  C CE  . LYS A 23  ? 1.1021 1.1639 1.0214 0.1215  0.0285  0.0060  23   LYS A CE  
185  N NZ  . LYS A 23  ? 1.0414 1.1241 0.9750 0.1117  0.0326  0.0118  23   LYS A NZ  
186  N N   . ALA A 24  ? 0.4843 0.5363 0.4343 0.0718  0.0226  0.0181  24   ALA A N   
187  C CA  . ALA A 24  ? 0.4611 0.5249 0.4229 0.0680  0.0235  0.0203  24   ALA A CA  
188  C C   . ALA A 24  ? 0.5054 0.5881 0.4685 0.0755  0.0282  0.0209  24   ALA A C   
189  O O   . ALA A 24  ? 0.5317 0.6190 0.4871 0.0817  0.0314  0.0204  24   ALA A O   
190  C CB  . ALA A 24  ? 0.4178 0.4872 0.3866 0.0560  0.0251  0.0246  24   ALA A CB  
191  N N   . PRO A 25  ? 0.5549 0.6496 0.5275 0.0755  0.0287  0.0221  25   PRO A N   
192  C CA  . PRO A 25  ? 0.4988 0.6116 0.4724 0.0849  0.0325  0.0222  25   PRO A CA  
193  C C   . PRO A 25  ? 0.5252 0.6580 0.4990 0.0837  0.0390  0.0257  25   PRO A C   
194  O O   . PRO A 25  ? 0.6156 0.7580 0.5843 0.0939  0.0423  0.0246  25   PRO A O   
195  C CB  . PRO A 25  ? 0.4573 0.5804 0.4425 0.0822  0.0315  0.0239  25   PRO A CB  
196  C CG  . PRO A 25  ? 0.5060 0.6094 0.4928 0.0756  0.0259  0.0226  25   PRO A CG  
197  C CD  . PRO A 25  ? 0.5175 0.6105 0.4997 0.0679  0.0258  0.0234  25   PRO A CD  
198  N N   . GLY A 26  ? 0.5346 0.6731 0.5132 0.0715  0.0407  0.0299  26   GLY A N   
199  C CA  . GLY A 26  ? 0.4907 0.6478 0.4695 0.0681  0.0468  0.0340  26   GLY A CA  
200  C C   . GLY A 26  ? 0.5551 0.7018 0.5226 0.0671  0.0481  0.0342  26   GLY A C   
201  O O   . GLY A 26  ? 0.4754 0.6357 0.4419 0.0632  0.0531  0.0381  26   GLY A O   
202  N N   . GLY A 27  ? 0.6038 0.7269 0.5626 0.0703  0.0435  0.0302  27   GLY A N   
203  C CA  . GLY A 27  ? 0.5617 0.6743 0.5093 0.0698  0.0440  0.0301  27   GLY A CA  
204  C C   . GLY A 27  ? 0.6445 0.7322 0.5872 0.0670  0.0379  0.0275  27   GLY A C   
205  O O   . GLY A 27  ? 0.6305 0.7086 0.5785 0.0654  0.0333  0.0255  27   GLY A O   
206  N N   . PRO A 28  ? 0.6049 0.6827 0.5374 0.0662  0.0378  0.0276  28   PRO A N   
207  C CA  . PRO A 28  ? 0.4508 0.5065 0.3786 0.0645  0.0317  0.0250  28   PRO A CA  
208  C C   . PRO A 28  ? 0.5161 0.5666 0.4499 0.0530  0.0300  0.0283  28   PRO A C   
209  O O   . PRO A 28  ? 0.4747 0.5362 0.4125 0.0457  0.0340  0.0330  28   PRO A O   
210  C CB  . PRO A 28  ? 0.4467 0.4958 0.3609 0.0687  0.0324  0.0242  28   PRO A CB  
211  C CG  . PRO A 28  ? 0.5417 0.6112 0.4543 0.0696  0.0401  0.0281  28   PRO A CG  
212  C CD  . PRO A 28  ? 0.5435 0.6311 0.4691 0.0658  0.0432  0.0309  28   PRO A CD  
213  N N   . VAL A 29  ? 0.4331 0.4672 0.3672 0.0514  0.0242  0.0259  29   VAL A N   
214  C CA  . VAL A 29  ? 0.4649 0.4916 0.4023 0.0424  0.0223  0.0284  29   VAL A CA  
215  C C   . VAL A 29  ? 0.5004 0.5098 0.4303 0.0439  0.0174  0.0262  29   VAL A C   
216  O O   . VAL A 29  ? 0.5273 0.5296 0.4516 0.0507  0.0144  0.0222  29   VAL A O   
217  C CB  . VAL A 29  ? 0.5208 0.5486 0.4699 0.0376  0.0204  0.0285  29   VAL A CB  
218  C CG1 . VAL A 29  ? 0.5223 0.5681 0.4792 0.0354  0.0247  0.0310  29   VAL A CG1 
219  C CG2 . VAL A 29  ? 0.4424 0.4616 0.3932 0.0426  0.0156  0.0242  29   VAL A CG2 
220  N N   . SER A 30  ? 0.4798 0.4821 0.4089 0.0376  0.0163  0.0288  30   SER A N   
221  C CA  . SER A 30  ? 0.5123 0.4999 0.4355 0.0387  0.0113  0.0271  30   SER A CA  
222  C C   . SER A 30  ? 0.5015 0.4825 0.4330 0.0363  0.0067  0.0255  30   SER A C   
223  O O   . SER A 30  ? 0.4386 0.4226 0.3776 0.0307  0.0077  0.0275  30   SER A O   
224  C CB  . SER A 30  ? 0.5601 0.5433 0.4771 0.0341  0.0125  0.0311  30   SER A CB  
225  O OG  . SER A 30  ? 0.6400 0.6305 0.5496 0.0349  0.0175  0.0337  30   SER A OG  
226  N N   . ALA A 31  ? 0.5353 0.5075 0.4651 0.0401  0.0015  0.0218  31   ALA A N   
227  C CA  . ALA A 31  ? 0.4901 0.4568 0.4274 0.0373  -0.0027 0.0209  31   ALA A CA  
228  C C   . ALA A 31  ? 0.5611 0.5176 0.4939 0.0377  -0.0077 0.0201  31   ALA A C   
229  O O   . ALA A 31  ? 0.5895 0.5411 0.5139 0.0419  -0.0100 0.0180  31   ALA A O   
230  C CB  . ALA A 31  ? 0.4188 0.3862 0.3611 0.0401  -0.0048 0.0177  31   ALA A CB  
231  N N   . PHE A 32  ? 0.4977 0.4514 0.4359 0.0337  -0.0093 0.0216  32   PHE A N   
232  C CA  . PHE A 32  ? 0.4069 0.3532 0.3433 0.0342  -0.0143 0.0211  32   PHE A CA  
233  C C   . PHE A 32  ? 0.4604 0.4068 0.4067 0.0321  -0.0172 0.0200  32   PHE A C   
234  O O   . PHE A 32  ? 0.4817 0.4300 0.4341 0.0287  -0.0156 0.0220  32   PHE A O   
235  C CB  . PHE A 32  ? 0.4393 0.3822 0.3710 0.0324  -0.0130 0.0245  32   PHE A CB  
236  C CG  . PHE A 32  ? 0.4684 0.4112 0.3895 0.0338  -0.0098 0.0263  32   PHE A CG  
237  C CD1 . PHE A 32  ? 0.3767 0.3255 0.2973 0.0311  -0.0041 0.0289  32   PHE A CD1 
238  C CD2 . PHE A 32  ? 0.4726 0.4100 0.3842 0.0377  -0.0127 0.0254  32   PHE A CD2 
239  C CE1 . PHE A 32  ? 0.4586 0.4085 0.3695 0.0321  -0.0008 0.0309  32   PHE A CE1 
240  C CE2 . PHE A 32  ? 0.5105 0.4480 0.4117 0.0392  -0.0096 0.0271  32   PHE A CE2 
241  C CZ  . PHE A 32  ? 0.4668 0.4108 0.3677 0.0364  -0.0034 0.0300  32   PHE A CZ  
242  N N   . LEU A 33  ? 0.3878 0.3320 0.3351 0.0340  -0.0214 0.0170  33   LEU A N   
243  C CA  . LEU A 33  ? 0.4325 0.3778 0.3890 0.0318  -0.0240 0.0160  33   LEU A CA  
244  C C   . LEU A 33  ? 0.4072 0.3492 0.3649 0.0314  -0.0297 0.0154  33   LEU A C   
245  O O   . LEU A 33  ? 0.3780 0.3158 0.3286 0.0337  -0.0331 0.0140  33   LEU A O   
246  C CB  . LEU A 33  ? 0.4602 0.4050 0.4167 0.0336  -0.0249 0.0133  33   LEU A CB  
247  C CG  . LEU A 33  ? 0.4634 0.4127 0.4173 0.0358  -0.0198 0.0135  33   LEU A CG  
248  C CD1 . LEU A 33  ? 0.4286 0.3754 0.3804 0.0394  -0.0213 0.0104  33   LEU A CD1 
249  C CD2 . LEU A 33  ? 0.3712 0.3280 0.3328 0.0321  -0.0154 0.0163  33   LEU A CD2 
250  N N   . GLY A 34  ? 0.3650 0.3100 0.3315 0.0286  -0.0307 0.0164  34   GLY A N   
251  C CA  . GLY A 34  ? 0.4414 0.3863 0.4109 0.0280  -0.0360 0.0160  34   GLY A CA  
252  C C   . GLY A 34  ? 0.4060 0.3501 0.3721 0.0297  -0.0369 0.0178  34   GLY A C   
253  O O   . GLY A 34  ? 0.4422 0.3857 0.4067 0.0308  -0.0416 0.0172  34   GLY A O   
254  N N   . ILE A 35  ? 0.4496 0.3933 0.4141 0.0300  -0.0326 0.0201  35   ILE A N   
255  C CA  . ILE A 35  ? 0.4180 0.3591 0.3780 0.0321  -0.0334 0.0220  35   ILE A CA  
256  C C   . ILE A 35  ? 0.4309 0.3758 0.3988 0.0320  -0.0350 0.0230  35   ILE A C   
257  O O   . ILE A 35  ? 0.4728 0.4198 0.4463 0.0301  -0.0321 0.0237  35   ILE A O   
258  C CB  . ILE A 35  ? 0.4077 0.3450 0.3618 0.0319  -0.0284 0.0245  35   ILE A CB  
259  C CG1 . ILE A 35  ? 0.3609 0.2968 0.3075 0.0321  -0.0258 0.0240  35   ILE A CG1 
260  C CG2 . ILE A 35  ? 0.3286 0.2613 0.2771 0.0346  -0.0297 0.0267  35   ILE A CG2 
261  C CD1 . ILE A 35  ? 0.3978 0.3322 0.3403 0.0300  -0.0202 0.0268  35   ILE A CD1 
262  N N   . PRO A 36  ? 0.4749 0.4214 0.4430 0.0342  -0.0397 0.0231  36   PRO A N   
263  C CA  . PRO A 36  ? 0.4083 0.3606 0.3845 0.0349  -0.0409 0.0241  36   PRO A CA  
264  C C   . PRO A 36  ? 0.4678 0.4156 0.4401 0.0374  -0.0377 0.0264  36   PRO A C   
265  O O   . PRO A 36  ? 0.4629 0.4037 0.4255 0.0397  -0.0371 0.0276  36   PRO A O   
266  C CB  . PRO A 36  ? 0.3879 0.3439 0.3642 0.0370  -0.0470 0.0238  36   PRO A CB  
267  C CG  . PRO A 36  ? 0.4373 0.3861 0.4019 0.0389  -0.0481 0.0234  36   PRO A CG  
268  C CD  . PRO A 36  ? 0.4589 0.4030 0.4198 0.0366  -0.0440 0.0223  36   PRO A CD  
269  N N   . PHE A 37  ? 0.4445 0.3952 0.4231 0.0371  -0.0355 0.0270  37   PHE A N   
270  C CA  . PHE A 37  ? 0.4038 0.3482 0.3774 0.0398  -0.0329 0.0288  37   PHE A CA  
271  C C   . PHE A 37  ? 0.4129 0.3631 0.3922 0.0439  -0.0348 0.0294  37   PHE A C   
272  O O   . PHE A 37  ? 0.4881 0.4328 0.4630 0.0476  -0.0333 0.0306  37   PHE A O   
273  C CB  . PHE A 37  ? 0.3554 0.2955 0.3282 0.0360  -0.0278 0.0289  37   PHE A CB  
274  C CG  . PHE A 37  ? 0.3890 0.3363 0.3719 0.0334  -0.0267 0.0278  37   PHE A CG  
275  C CD1 . PHE A 37  ? 0.3449 0.2939 0.3312 0.0354  -0.0258 0.0281  37   PHE A CD1 
276  C CD2 . PHE A 37  ? 0.4073 0.3595 0.3954 0.0293  -0.0265 0.0264  37   PHE A CD2 
277  C CE1 . PHE A 37  ? 0.4012 0.3571 0.3961 0.0329  -0.0246 0.0273  37   PHE A CE1 
278  C CE2 . PHE A 37  ? 0.3541 0.3121 0.3504 0.0269  -0.0254 0.0257  37   PHE A CE2 
279  C CZ  . PHE A 37  ? 0.3795 0.3398 0.3794 0.0284  -0.0244 0.0262  37   PHE A CZ  
280  N N   . ALA A 38  ? 0.3902 0.3518 0.3790 0.0432  -0.0381 0.0285  38   ALA A N   
281  C CA  . ALA A 38  ? 0.3605 0.3315 0.3564 0.0471  -0.0400 0.0292  38   ALA A CA  
282  C C   . ALA A 38  ? 0.4103 0.3919 0.4119 0.0469  -0.0457 0.0290  38   ALA A C   
283  O O   . ALA A 38  ? 0.4029 0.3850 0.4051 0.0425  -0.0479 0.0277  38   ALA A O   
284  C CB  . ALA A 38  ? 0.3594 0.3365 0.3638 0.0448  -0.0371 0.0288  38   ALA A CB  
285  N N   . GLU A 39  ? 0.3902 0.3804 0.3957 0.0520  -0.0482 0.0302  39   GLU A N   
286  C CA  . GLU A 39  ? 0.3950 0.3991 0.4090 0.0506  -0.0535 0.0302  39   GLU A CA  
287  C C   . GLU A 39  ? 0.3740 0.3867 0.3986 0.0441  -0.0527 0.0296  39   GLU A C   
288  O O   . GLU A 39  ? 0.4012 0.4157 0.4297 0.0441  -0.0486 0.0299  39   GLU A O   
289  C CB  . GLU A 39  ? 0.4493 0.4637 0.4669 0.0579  -0.0557 0.0320  39   GLU A CB  
290  C CG  . GLU A 39  ? 0.5007 0.5077 0.5079 0.0644  -0.0580 0.0330  39   GLU A CG  
291  C CD  . GLU A 39  ? 0.5755 0.5824 0.5795 0.0615  -0.0633 0.0323  39   GLU A CD  
292  O OE1 . GLU A 39  ? 0.6428 0.6629 0.6552 0.0586  -0.0681 0.0321  39   GLU A OE1 
293  O OE2 . GLU A 39  ? 0.6183 0.6119 0.6109 0.0618  -0.0629 0.0319  39   GLU A OE2 
294  N N   . PRO A 40  ? 0.4517 0.4686 0.4799 0.0384  -0.0569 0.0287  40   PRO A N   
295  C CA  . PRO A 40  ? 0.4340 0.4581 0.4713 0.0317  -0.0567 0.0286  40   PRO A CA  
296  C C   . PRO A 40  ? 0.4178 0.4560 0.4654 0.0334  -0.0548 0.0304  40   PRO A C   
297  O O   . PRO A 40  ? 0.4353 0.4855 0.4877 0.0369  -0.0576 0.0319  40   PRO A O   
298  C CB  . PRO A 40  ? 0.4066 0.4355 0.4461 0.0269  -0.0634 0.0280  40   PRO A CB  
299  C CG  . PRO A 40  ? 0.4519 0.4702 0.4801 0.0300  -0.0657 0.0267  40   PRO A CG  
300  C CD  . PRO A 40  ? 0.4349 0.4514 0.4589 0.0381  -0.0628 0.0281  40   PRO A CD  
301  N N   . PRO A 41  ? 0.4005 0.4380 0.4510 0.0314  -0.0501 0.0305  41   PRO A N   
302  C CA  . PRO A 41  ? 0.3919 0.4429 0.4509 0.0341  -0.0480 0.0322  41   PRO A CA  
303  C C   . PRO A 41  ? 0.4210 0.4875 0.4915 0.0278  -0.0508 0.0337  41   PRO A C   
304  O O   . PRO A 41  ? 0.3387 0.4092 0.4143 0.0244  -0.0476 0.0344  41   PRO A O   
305  C CB  . PRO A 41  ? 0.4315 0.4744 0.4876 0.0344  -0.0419 0.0316  41   PRO A CB  
306  C CG  . PRO A 41  ? 0.4404 0.4722 0.4924 0.0281  -0.0419 0.0301  41   PRO A CG  
307  C CD  . PRO A 41  ? 0.4233 0.4491 0.4695 0.0279  -0.0463 0.0292  41   PRO A CD  
308  N N   . VAL A 42  ? 0.3768 0.4516 0.4506 0.0258  -0.0567 0.0343  42   VAL A N   
309  C CA  . VAL A 42  ? 0.4595 0.5478 0.5433 0.0180  -0.0603 0.0358  42   VAL A CA  
310  C C   . VAL A 42  ? 0.4592 0.5696 0.5531 0.0210  -0.0625 0.0384  42   VAL A C   
311  O O   . VAL A 42  ? 0.3695 0.4827 0.4614 0.0299  -0.0621 0.0386  42   VAL A O   
312  C CB  . VAL A 42  ? 0.5788 0.6594 0.6584 0.0112  -0.0663 0.0344  42   VAL A CB  
313  C CG1 . VAL A 42  ? 0.5270 0.5867 0.5957 0.0102  -0.0641 0.0317  42   VAL A CG1 
314  C CG2 . VAL A 42  ? 0.3754 0.4599 0.4527 0.0147  -0.0719 0.0342  42   VAL A CG2 
315  N N   . GLY A 43  ? 0.4013 0.5274 0.5060 0.0138  -0.0647 0.0406  43   GLY A N   
316  C CA  . GLY A 43  ? 0.3729 0.5225 0.4882 0.0158  -0.0672 0.0433  43   GLY A CA  
317  C C   . GLY A 43  ? 0.3909 0.5497 0.5091 0.0259  -0.0615 0.0444  43   GLY A C   
318  O O   . GLY A 43  ? 0.4872 0.6449 0.6065 0.0259  -0.0558 0.0447  43   GLY A O   
319  N N   . SER A 44  ? 0.4089 0.5758 0.5272 0.0351  -0.0629 0.0449  44   SER A N   
320  C CA  . SER A 44  ? 0.4304 0.6051 0.5502 0.0461  -0.0578 0.0457  44   SER A CA  
321  C C   . SER A 44  ? 0.4028 0.5549 0.5103 0.0517  -0.0521 0.0432  44   SER A C   
322  O O   . SER A 44  ? 0.3516 0.5059 0.4581 0.0599  -0.0473 0.0433  44   SER A O   
323  C CB  . SER A 44  ? 0.4194 0.6057 0.5404 0.0557  -0.0612 0.0467  44   SER A CB  
324  O OG  . SER A 44  ? 0.5490 0.7165 0.6580 0.0587  -0.0641 0.0447  44   SER A OG  
325  N N   . ARG A 45  ? 0.3802 0.5110 0.4780 0.0472  -0.0527 0.0409  45   ARG A N   
326  C CA  . ARG A 45  ? 0.3779 0.4881 0.4642 0.0516  -0.0477 0.0388  45   ARG A CA  
327  C C   . ARG A 45  ? 0.4034 0.5079 0.4902 0.0456  -0.0431 0.0382  45   ARG A C   
328  O O   . ARG A 45  ? 0.4481 0.5380 0.5267 0.0485  -0.0388 0.0366  45   ARG A O   
329  C CB  . ARG A 45  ? 0.4212 0.5126 0.4960 0.0515  -0.0501 0.0370  45   ARG A CB  
330  C CG  . ARG A 45  ? 0.3922 0.4852 0.4633 0.0585  -0.0542 0.0375  45   ARG A CG  
331  C CD  . ARG A 45  ? 0.6075 0.6805 0.6664 0.0568  -0.0558 0.0357  45   ARG A CD  
332  N NE  . ARG A 45  ? 0.8145 0.8881 0.8694 0.0606  -0.0610 0.0361  45   ARG A NE  
333  C CZ  . ARG A 45  ? 0.9350 1.0005 0.9807 0.0696  -0.0607 0.0365  45   ARG A CZ  
334  N NH1 . ARG A 45  ? 0.9318 0.9870 0.9713 0.0753  -0.0554 0.0364  45   ARG A NH1 
335  N NH2 . ARG A 45  ? 0.9806 1.0474 1.0227 0.0728  -0.0659 0.0371  45   ARG A NH2 
336  N N   . ARG A 46  ? 0.4029 0.5186 0.4990 0.0371  -0.0443 0.0396  46   ARG A N   
337  C CA  . ARG A 46  ? 0.3791 0.4909 0.4760 0.0321  -0.0400 0.0395  46   ARG A CA  
338  C C   . ARG A 46  ? 0.3471 0.4618 0.4433 0.0396  -0.0341 0.0395  46   ARG A C   
339  O O   . ARG A 46  ? 0.3027 0.4330 0.4044 0.0458  -0.0336 0.0410  46   ARG A O   
340  C CB  . ARG A 46  ? 0.4062 0.5318 0.5134 0.0227  -0.0420 0.0418  46   ARG A CB  
341  C CG  . ARG A 46  ? 0.3307 0.4498 0.4373 0.0167  -0.0383 0.0418  46   ARG A CG  
342  C CD  . ARG A 46  ? 0.2690 0.4034 0.3862 0.0075  -0.0403 0.0450  46   ARG A CD  
343  N NE  . ARG A 46  ? 0.3252 0.4532 0.4414 -0.0010 -0.0461 0.0448  46   ARG A NE  
344  C CZ  . ARG A 46  ? 0.3141 0.4512 0.4373 -0.0106 -0.0492 0.0474  46   ARG A CZ  
345  N NH1 . ARG A 46  ? 0.3021 0.4574 0.4347 -0.0128 -0.0468 0.0508  46   ARG A NH1 
346  N NH2 . ARG A 46  ? 0.3181 0.4461 0.4382 -0.0178 -0.0547 0.0466  46   ARG A NH2 
347  N N   . PHE A 47  ? 0.2634 0.3640 0.3528 0.0389  -0.0299 0.0379  47   PHE A N   
348  C CA  . PHE A 47  ? 0.2812 0.3806 0.3674 0.0453  -0.0245 0.0372  47   PHE A CA  
349  C C   . PHE A 47  ? 0.2981 0.3874 0.3749 0.0553  -0.0236 0.0357  47   PHE A C   
350  O O   . PHE A 47  ? 0.4199 0.5051 0.4917 0.0612  -0.0195 0.0346  47   PHE A O   
351  C CB  . PHE A 47  ? 0.3153 0.4361 0.4115 0.0470  -0.0223 0.0395  47   PHE A CB  
352  C CG  . PHE A 47  ? 0.3459 0.4781 0.4515 0.0369  -0.0234 0.0419  47   PHE A CG  
353  C CD1 . PHE A 47  ? 0.3028 0.4241 0.4056 0.0295  -0.0222 0.0413  47   PHE A CD1 
354  C CD2 . PHE A 47  ? 0.2619 0.4158 0.3791 0.0345  -0.0261 0.0449  47   PHE A CD2 
355  C CE1 . PHE A 47  ? 0.3043 0.4342 0.4146 0.0202  -0.0234 0.0438  47   PHE A CE1 
356  C CE2 . PHE A 47  ? 0.2927 0.4553 0.4175 0.0242  -0.0274 0.0474  47   PHE A CE2 
357  C CZ  . PHE A 47  ? 0.2434 0.3927 0.3642 0.0170  -0.0260 0.0468  47   PHE A CZ  
358  N N   . MET A 48  ? 0.3270 0.4115 0.4003 0.0575  -0.0275 0.0354  48   MET A N   
359  C CA  . MET A 48  ? 0.3613 0.4349 0.4244 0.0673  -0.0269 0.0344  48   MET A CA  
360  C C   . MET A 48  ? 0.3877 0.4380 0.4383 0.0657  -0.0261 0.0325  48   MET A C   
361  O O   . MET A 48  ? 0.3334 0.3778 0.3838 0.0576  -0.0272 0.0320  48   MET A O   
362  C CB  . MET A 48  ? 0.3265 0.4090 0.3921 0.0722  -0.0315 0.0357  48   MET A CB  
363  C CG  . MET A 48  ? 0.4580 0.5665 0.5373 0.0735  -0.0325 0.0380  48   MET A CG  
364  S SD  . MET A 48  ? 0.6017 0.7210 0.6815 0.0852  -0.0361 0.0394  48   MET A SD  
365  C CE  . MET A 48  ? 0.5456 0.6545 0.6154 0.0974  -0.0302 0.0380  48   MET A CE  
366  N N   . PRO A 49  ? 0.3856 0.4228 0.4253 0.0733  -0.0240 0.0315  49   PRO A N   
367  C CA  . PRO A 49  ? 0.3864 0.4019 0.4134 0.0719  -0.0234 0.0302  49   PRO A CA  
368  C C   . PRO A 49  ? 0.4453 0.4592 0.4719 0.0689  -0.0276 0.0309  49   PRO A C   
369  O O   . PRO A 49  ? 0.3749 0.4009 0.4072 0.0718  -0.0313 0.0322  49   PRO A O   
370  C CB  . PRO A 49  ? 0.3917 0.3965 0.4079 0.0822  -0.0221 0.0299  49   PRO A CB  
371  C CG  . PRO A 49  ? 0.3987 0.4184 0.4215 0.0886  -0.0201 0.0300  49   PRO A CG  
372  C CD  . PRO A 49  ? 0.3729 0.4156 0.4114 0.0838  -0.0222 0.0317  49   PRO A CD  
373  N N   . PRO A 50  ? 0.3483 0.3488 0.3685 0.0630  -0.0273 0.0301  50   PRO A N   
374  C CA  . PRO A 50  ? 0.3934 0.3916 0.4119 0.0602  -0.0310 0.0305  50   PRO A CA  
375  C C   . PRO A 50  ? 0.4196 0.4098 0.4288 0.0676  -0.0328 0.0314  50   PRO A C   
376  O O   . PRO A 50  ? 0.4764 0.4558 0.4770 0.0729  -0.0306 0.0314  50   PRO A O   
377  C CB  . PRO A 50  ? 0.3593 0.3450 0.3722 0.0534  -0.0289 0.0295  50   PRO A CB  
378  C CG  . PRO A 50  ? 0.3432 0.3186 0.3495 0.0553  -0.0245 0.0288  50   PRO A CG  
379  C CD  . PRO A 50  ? 0.3793 0.3674 0.3937 0.0587  -0.0234 0.0289  50   PRO A CD  
380  N N   . GLU A 51  ? 0.4249 0.4192 0.4349 0.0677  -0.0372 0.0321  51   GLU A N   
381  C CA  . GLU A 51  ? 0.5497 0.5366 0.5505 0.0742  -0.0396 0.0332  51   GLU A CA  
382  C C   . GLU A 51  ? 0.5256 0.5001 0.5181 0.0693  -0.0402 0.0329  51   GLU A C   
383  O O   . GLU A 51  ? 0.4892 0.4679 0.4861 0.0626  -0.0414 0.0320  51   GLU A O   
384  C CB  . GLU A 51  ? 0.6881 0.6914 0.6966 0.0782  -0.0446 0.0343  51   GLU A CB  
385  C CG  . GLU A 51  ? 1.0104 1.0076 1.0100 0.0839  -0.0483 0.0355  51   GLU A CG  
386  C CD  . GLU A 51  ? 1.1653 1.1805 1.1728 0.0890  -0.0535 0.0368  51   GLU A CD  
387  O OE1 . GLU A 51  ? 1.2695 1.3003 1.2873 0.0917  -0.0529 0.0372  51   GLU A OE1 
388  O OE2 . GLU A 51  ? 1.0933 1.1078 1.0965 0.0904  -0.0580 0.0376  51   GLU A OE2 
389  N N   . PRO A 52  ? 0.5359 0.4945 0.5153 0.0725  -0.0390 0.0338  52   PRO A N   
390  C CA  . PRO A 52  ? 0.4723 0.4198 0.4427 0.0686  -0.0391 0.0341  52   PRO A CA  
391  C C   . PRO A 52  ? 0.4770 0.4327 0.4502 0.0676  -0.0440 0.0340  52   PRO A C   
392  O O   . PRO A 52  ? 0.5045 0.4695 0.4813 0.0726  -0.0481 0.0347  52   PRO A O   
393  C CB  . PRO A 52  ? 0.5080 0.4401 0.4645 0.0745  -0.0385 0.0360  52   PRO A CB  
394  C CG  . PRO A 52  ? 0.5821 0.5123 0.5390 0.0792  -0.0360 0.0357  52   PRO A CG  
395  C CD  . PRO A 52  ? 0.5342 0.4844 0.5058 0.0808  -0.0378 0.0349  52   PRO A CD  
396  N N   . LYS A 53  ? 0.4239 0.3767 0.3955 0.0614  -0.0438 0.0330  53   LYS A N   
397  C CA  . LYS A 53  ? 0.4301 0.3884 0.4028 0.0598  -0.0484 0.0323  53   LYS A CA  
398  C C   . LYS A 53  ? 0.5339 0.4862 0.4962 0.0653  -0.0513 0.0339  53   LYS A C   
399  O O   . LYS A 53  ? 0.5981 0.5375 0.5494 0.0672  -0.0488 0.0354  53   LYS A O   
400  C CB  . LYS A 53  ? 0.4303 0.3839 0.4007 0.0533  -0.0465 0.0307  53   LYS A CB  
401  C CG  . LYS A 53  ? 0.4441 0.3988 0.4114 0.0519  -0.0507 0.0296  53   LYS A CG  
402  C CD  . LYS A 53  ? 0.4753 0.4429 0.4531 0.0499  -0.0557 0.0282  53   LYS A CD  
403  C CE  . LYS A 53  ? 0.4897 0.4563 0.4631 0.0479  -0.0603 0.0265  53   LYS A CE  
404  N NZ  . LYS A 53  ? 0.5269 0.5042 0.5102 0.0440  -0.0649 0.0252  53   LYS A NZ  
405  N N   . ARG A 54  ? 0.5285 0.4902 0.4941 0.0672  -0.0570 0.0338  54   ARG A N   
406  C CA  . ARG A 54  ? 0.5801 0.5378 0.5365 0.0730  -0.0605 0.0354  54   ARG A CA  
407  C C   . ARG A 54  ? 0.5809 0.5315 0.5286 0.0694  -0.0615 0.0345  54   ARG A C   
408  O O   . ARG A 54  ? 0.4909 0.4456 0.4433 0.0636  -0.0622 0.0322  54   ARG A O   
409  C CB  . ARG A 54  ? 0.6156 0.5887 0.5803 0.0767  -0.0665 0.0357  54   ARG A CB  
410  C CG  . ARG A 54  ? 0.7192 0.7012 0.6926 0.0812  -0.0651 0.0367  54   ARG A CG  
411  C CD  . ARG A 54  ? 0.8645 0.8616 0.8439 0.0869  -0.0709 0.0379  54   ARG A CD  
412  N NE  . ARG A 54  ? 0.9726 0.9849 0.9629 0.0806  -0.0755 0.0365  54   ARG A NE  
413  C CZ  . ARG A 54  ? 1.0786 1.1075 1.0830 0.0782  -0.0760 0.0364  54   ARG A CZ  
414  N NH1 . ARG A 54  ? 1.0181 1.0512 1.0276 0.0824  -0.0718 0.0373  54   ARG A NH1 
415  N NH2 . ARG A 54  ? 1.1106 1.1514 1.1234 0.0715  -0.0806 0.0354  54   ARG A NH2 
416  N N   . PRO A 55  ? 0.5114 0.4506 0.4455 0.0731  -0.0614 0.0365  55   PRO A N   
417  C CA  . PRO A 55  ? 0.4938 0.4258 0.4177 0.0704  -0.0616 0.0359  55   PRO A CA  
418  C C   . PRO A 55  ? 0.5656 0.5066 0.4934 0.0683  -0.0674 0.0333  55   PRO A C   
419  O O   . PRO A 55  ? 0.4846 0.4363 0.4194 0.0704  -0.0728 0.0331  55   PRO A O   
420  C CB  . PRO A 55  ? 0.5145 0.4364 0.4246 0.0764  -0.0625 0.0390  55   PRO A CB  
421  C CG  . PRO A 55  ? 0.5711 0.4889 0.4815 0.0809  -0.0602 0.0413  55   PRO A CG  
422  C CD  . PRO A 55  ? 0.4794 0.4113 0.4060 0.0803  -0.0610 0.0395  55   PRO A CD  
423  N N   . TRP A 56  ? 0.4842 0.4208 0.4072 0.0641  -0.0662 0.0313  56   TRP A N   
424  C CA  . TRP A 56  ? 0.5394 0.4806 0.4630 0.0616  -0.0715 0.0284  56   TRP A CA  
425  C C   . TRP A 56  ? 0.6325 0.5657 0.5411 0.0643  -0.0731 0.0287  56   TRP A C   
426  O O   . TRP A 56  ? 0.6364 0.5605 0.5350 0.0669  -0.0693 0.0314  56   TRP A O   
427  C CB  . TRP A 56  ? 0.5439 0.4855 0.4726 0.0556  -0.0691 0.0255  56   TRP A CB  
428  C CG  . TRP A 56  ? 0.5729 0.5056 0.4950 0.0544  -0.0621 0.0258  56   TRP A CG  
429  C CD1 . TRP A 56  ? 0.5679 0.4936 0.4787 0.0544  -0.0606 0.0250  56   TRP A CD1 
430  C CD2 . TRP A 56  ? 0.5520 0.4831 0.4785 0.0526  -0.0558 0.0272  56   TRP A CD2 
431  N NE1 . TRP A 56  ? 0.5938 0.5151 0.5025 0.0527  -0.0537 0.0261  56   TRP A NE1 
432  C CE2 . TRP A 56  ? 0.5791 0.5032 0.4973 0.0512  -0.0508 0.0274  56   TRP A CE2 
433  C CE3 . TRP A 56  ? 0.5378 0.4730 0.4739 0.0522  -0.0538 0.0283  56   TRP A CE3 
434  C CZ2 . TRP A 56  ? 0.5243 0.4459 0.4441 0.0488  -0.0445 0.0288  56   TRP A CZ2 
435  C CZ3 . TRP A 56  ? 0.5544 0.4854 0.4909 0.0501  -0.0476 0.0293  56   TRP A CZ3 
436  C CH2 . TRP A 56  ? 0.5119 0.4365 0.4407 0.0480  -0.0432 0.0296  56   TRP A CH2 
437  N N   . SER A 57  ? 0.6551 0.5907 0.5611 0.0633  -0.0789 0.0262  57   SER A N   
438  C CA  . SER A 57  ? 0.7284 0.6561 0.6191 0.0658  -0.0803 0.0261  57   SER A CA  
439  C C   . SER A 57  ? 0.6351 0.5586 0.5216 0.0621  -0.0789 0.0224  57   SER A C   
440  O O   . SER A 57  ? 0.6660 0.5933 0.5613 0.0578  -0.0794 0.0197  57   SER A O   
441  C CB  . SER A 57  ? 0.7877 0.7202 0.6754 0.0689  -0.0886 0.0260  57   SER A CB  
442  O OG  . SER A 57  ? 0.8618 0.8020 0.7572 0.0646  -0.0945 0.0226  57   SER A OG  
443  N N   . GLY A 58  ? 0.6334 0.5488 0.5057 0.0641  -0.0768 0.0225  58   GLY A N   
444  C CA  . GLY A 58  ? 0.6055 0.5167 0.4719 0.0622  -0.0752 0.0190  58   GLY A CA  
445  C C   . GLY A 58  ? 0.6451 0.5551 0.5156 0.0599  -0.0669 0.0197  58   GLY A C   
446  O O   . GLY A 58  ? 0.6219 0.5329 0.4981 0.0594  -0.0626 0.0229  58   GLY A O   
447  N N   . VAL A 59  ? 0.6072 0.5147 0.4742 0.0588  -0.0650 0.0165  59   VAL A N   
448  C CA  . VAL A 59  ? 0.6012 0.5091 0.4720 0.0569  -0.0576 0.0169  59   VAL A CA  
449  C C   . VAL A 59  ? 0.5716 0.4838 0.4556 0.0532  -0.0590 0.0144  59   VAL A C   
450  O O   . VAL A 59  ? 0.6698 0.5808 0.5532 0.0523  -0.0636 0.0106  59   VAL A O   
451  C CB  . VAL A 59  ? 0.6355 0.5393 0.4943 0.0590  -0.0541 0.0151  59   VAL A CB  
452  C CG1 . VAL A 59  ? 0.5240 0.4305 0.3875 0.0572  -0.0466 0.0157  59   VAL A CG1 
453  C CG2 . VAL A 59  ? 0.5365 0.4361 0.3809 0.0625  -0.0533 0.0176  59   VAL A CG2 
454  N N   . LEU A 60  ? 0.5263 0.4426 0.4211 0.0508  -0.0554 0.0166  60   LEU A N   
455  C CA  . LEU A 60  ? 0.4951 0.4157 0.4022 0.0472  -0.0559 0.0149  60   LEU A CA  
456  C C   . LEU A 60  ? 0.5646 0.4834 0.4701 0.0466  -0.0517 0.0127  60   LEU A C   
457  O O   . LEU A 60  ? 0.5927 0.5112 0.4947 0.0474  -0.0455 0.0144  60   LEU A O   
458  C CB  . LEU A 60  ? 0.5030 0.4284 0.4207 0.0455  -0.0531 0.0179  60   LEU A CB  
459  C CG  . LEU A 60  ? 0.5604 0.4913 0.4915 0.0418  -0.0532 0.0170  60   LEU A CG  
460  C CD1 . LEU A 60  ? 0.5015 0.4383 0.4414 0.0416  -0.0550 0.0191  60   LEU A CD1 
461  C CD2 . LEU A 60  ? 0.5840 0.5149 0.5179 0.0400  -0.0465 0.0175  60   LEU A CD2 
462  N N   . ASP A 61  ? 0.5163 0.4338 0.4236 0.0452  -0.0551 0.0091  61   ASP A N   
463  C CA  . ASP A 61  ? 0.5244 0.4399 0.4299 0.0457  -0.0514 0.0071  61   ASP A CA  
464  C C   . ASP A 61  ? 0.5226 0.4435 0.4400 0.0428  -0.0469 0.0088  61   ASP A C   
465  O O   . ASP A 61  ? 0.4977 0.4212 0.4248 0.0395  -0.0495 0.0086  61   ASP A O   
466  C CB  . ASP A 61  ? 0.6187 0.5283 0.5203 0.0457  -0.0569 0.0026  61   ASP A CB  
467  C CG  . ASP A 61  ? 0.7683 0.6752 0.6676 0.0475  -0.0532 0.0004  61   ASP A CG  
468  O OD1 . ASP A 61  ? 0.7657 0.6758 0.6747 0.0449  -0.0511 0.0010  61   ASP A OD1 
469  O OD2 . ASP A 61  ? 0.8577 0.7598 0.7451 0.0520  -0.0520 -0.0018 61   ASP A OD2 
470  N N   . ALA A 62  ? 0.4570 0.3802 0.3733 0.0437  -0.0402 0.0106  62   ALA A N   
471  C CA  . ALA A 62  ? 0.4594 0.3879 0.3857 0.0409  -0.0358 0.0122  62   ALA A CA  
472  C C   . ALA A 62  ? 0.5253 0.4548 0.4506 0.0423  -0.0323 0.0105  62   ALA A C   
473  O O   . ALA A 62  ? 0.5329 0.4674 0.4603 0.0418  -0.0267 0.0125  62   ALA A O   
474  C CB  . ALA A 62  ? 0.4684 0.3994 0.3954 0.0397  -0.0312 0.0162  62   ALA A CB  
475  N N   . THR A 63  ? 0.4712 0.3959 0.3930 0.0442  -0.0360 0.0069  63   THR A N   
476  C CA  . THR A 63  ? 0.4744 0.3989 0.3932 0.0474  -0.0331 0.0049  63   THR A CA  
477  C C   . THR A 63  ? 0.4956 0.4198 0.4224 0.0454  -0.0345 0.0037  63   THR A C   
478  O O   . THR A 63  ? 0.5320 0.4566 0.4575 0.0483  -0.0321 0.0025  63   THR A O   
479  C CB  . THR A 63  ? 0.4630 0.3797 0.3683 0.0525  -0.0358 0.0011  63   THR A CB  
480  O OG1 . THR A 63  ? 0.5004 0.4090 0.4043 0.0509  -0.0432 -0.0017 63   THR A OG1 
481  C CG2 . THR A 63  ? 0.5167 0.4334 0.4124 0.0548  -0.0345 0.0023  63   THR A CG2 
482  N N   . THR A 64  ? 0.5051 0.4291 0.4399 0.0408  -0.0383 0.0045  64   THR A N   
483  C CA  . THR A 64  ? 0.4414 0.3654 0.3841 0.0381  -0.0396 0.0041  64   THR A CA  
484  C C   . THR A 64  ? 0.4932 0.4239 0.4480 0.0331  -0.0390 0.0071  64   THR A C   
485  O O   . THR A 64  ? 0.4935 0.4269 0.4507 0.0315  -0.0399 0.0088  64   THR A O   
486  C CB  . THR A 64  ? 0.5236 0.4382 0.4620 0.0373  -0.0465 0.0010  64   THR A CB  
487  O OG1 . THR A 64  ? 0.5420 0.4570 0.4827 0.0338  -0.0513 0.0016  64   THR A OG1 
488  C CG2 . THR A 64  ? 0.5094 0.4152 0.4340 0.0429  -0.0476 -0.0026 64   THR A CG2 
489  N N   . PHE A 65  ? 0.4142 0.3474 0.3759 0.0313  -0.0374 0.0077  65   PHE A N   
490  C CA  . PHE A 65  ? 0.4253 0.3644 0.3976 0.0270  -0.0369 0.0101  65   PHE A CA  
491  C C   . PHE A 65  ? 0.4831 0.4212 0.4587 0.0237  -0.0425 0.0100  65   PHE A C   
492  O O   . PHE A 65  ? 0.4339 0.3657 0.4053 0.0232  -0.0473 0.0079  65   PHE A O   
493  C CB  . PHE A 65  ? 0.3537 0.2949 0.3316 0.0258  -0.0349 0.0105  65   PHE A CB  
494  C CG  . PHE A 65  ? 0.3883 0.3345 0.3661 0.0280  -0.0292 0.0114  65   PHE A CG  
495  C CD1 . PHE A 65  ? 0.3579 0.3100 0.3386 0.0265  -0.0254 0.0137  65   PHE A CD1 
496  C CD2 . PHE A 65  ? 0.4129 0.3576 0.3870 0.0316  -0.0279 0.0100  65   PHE A CD2 
497  C CE1 . PHE A 65  ? 0.4171 0.3748 0.3981 0.0273  -0.0204 0.0148  65   PHE A CE1 
498  C CE2 . PHE A 65  ? 0.3692 0.3212 0.3443 0.0333  -0.0227 0.0111  65   PHE A CE2 
499  C CZ  . PHE A 65  ? 0.3782 0.3370 0.3571 0.0305  -0.0190 0.0136  65   PHE A CZ  
500  N N   . GLN A 66  ? 0.3950 0.3393 0.3777 0.0215  -0.0419 0.0123  66   GLN A N   
501  C CA  . GLN A 66  ? 0.3714 0.3184 0.3590 0.0185  -0.0466 0.0129  66   GLN A CA  
502  C C   . GLN A 66  ? 0.3867 0.3374 0.3832 0.0143  -0.0472 0.0139  66   GLN A C   
503  O O   . GLN A 66  ? 0.4039 0.3539 0.4020 0.0140  -0.0442 0.0141  66   GLN A O   
504  C CB  . GLN A 66  ? 0.3637 0.3160 0.3536 0.0197  -0.0455 0.0149  66   GLN A CB  
505  C CG  . GLN A 66  ? 0.4303 0.3795 0.4128 0.0221  -0.0490 0.0140  66   GLN A CG  
506  C CD  . GLN A 66  ? 0.5314 0.4817 0.5160 0.0194  -0.0558 0.0131  66   GLN A CD  
507  O OE1 . GLN A 66  ? 0.5256 0.4782 0.5167 0.0152  -0.0577 0.0132  66   GLN A OE1 
508  N NE2 . GLN A 66  ? 0.5115 0.4608 0.4907 0.0212  -0.0596 0.0126  66   GLN A NE2 
509  N N   . ASN A 67  ? 0.4611 0.4165 0.4633 0.0110  -0.0512 0.0149  67   ASN A N   
510  C CA  . ASN A 67  ? 0.4094 0.3694 0.4201 0.0064  -0.0519 0.0164  67   ASN A CA  
511  C C   . ASN A 67  ? 0.3892 0.3547 0.4058 0.0067  -0.0462 0.0183  67   ASN A C   
512  O O   . ASN A 67  ? 0.3638 0.3321 0.3804 0.0097  -0.0426 0.0189  67   ASN A O   
513  C CB  . ASN A 67  ? 0.4946 0.4626 0.5115 0.0033  -0.0560 0.0178  67   ASN A CB  
514  C CG  . ASN A 67  ? 0.4543 0.4174 0.4659 0.0014  -0.0627 0.0160  67   ASN A CG  
515  O OD1 . ASN A 67  ? 0.4605 0.4132 0.4649 0.0005  -0.0651 0.0138  67   ASN A OD1 
516  N ND2 . ASN A 67  ? 0.4711 0.4416 0.4857 0.0012  -0.0659 0.0168  67   ASN A ND2 
517  N N   . VAL A 68  ? 0.2960 0.2620 0.3167 0.0034  -0.0459 0.0191  68   VAL A N   
518  C CA  . VAL A 68  ? 0.2896 0.2614 0.3162 0.0030  -0.0414 0.0209  68   VAL A CA  
519  C C   . VAL A 68  ? 0.4134 0.3953 0.4486 0.0004  -0.0421 0.0231  68   VAL A C   
520  O O   . VAL A 68  ? 0.3668 0.3511 0.4050 -0.0034 -0.0463 0.0238  68   VAL A O   
521  C CB  . VAL A 68  ? 0.4447 0.4123 0.4710 0.0011  -0.0408 0.0210  68   VAL A CB  
522  C CG1 . VAL A 68  ? 0.3587 0.3329 0.3911 0.0001  -0.0368 0.0230  68   VAL A CG1 
523  C CG2 . VAL A 68  ? 0.3466 0.3062 0.3649 0.0048  -0.0397 0.0189  68   VAL A CG2 
524  N N   . CYS A 69  ? 0.2668 0.2546 0.3055 0.0023  -0.0381 0.0242  69   CYS A N   
525  C CA  . CYS A 69  ? 0.3405 0.3390 0.3870 0.0012  -0.0379 0.0263  69   CYS A CA  
526  C C   . CYS A 69  ? 0.4572 0.4597 0.5093 -0.0041 -0.0389 0.0280  69   CYS A C   
527  O O   . CYS A 69  ? 0.3058 0.3038 0.3565 -0.0055 -0.0373 0.0280  69   CYS A O   
528  C CB  . CYS A 69  ? 0.2603 0.2618 0.3075 0.0048  -0.0331 0.0267  69   CYS A CB  
529  S SG  . CYS A 69  ? 0.4381 0.4348 0.4786 0.0103  -0.0322 0.0256  69   CYS A SG  
530  N N   . TYR A 70  ? 0.3513 0.3628 0.4097 -0.0070 -0.0418 0.0297  70   TYR A N   
531  C CA  . TYR A 70  ? 0.4029 0.4182 0.4661 -0.0133 -0.0433 0.0319  70   TYR A CA  
532  C C   . TYR A 70  ? 0.4143 0.4320 0.4799 -0.0135 -0.0386 0.0332  70   TYR A C   
533  O O   . TYR A 70  ? 0.3454 0.3693 0.4133 -0.0098 -0.0347 0.0336  70   TYR A O   
534  C CB  . TYR A 70  ? 0.3968 0.4256 0.4681 -0.0163 -0.0461 0.0341  70   TYR A CB  
535  C CG  . TYR A 70  ? 0.4684 0.4964 0.5412 -0.0243 -0.0512 0.0355  70   TYR A CG  
536  C CD1 . TYR A 70  ? 0.5036 0.5285 0.5738 -0.0266 -0.0571 0.0343  70   TYR A CD1 
537  C CD2 . TYR A 70  ? 0.4740 0.5033 0.5496 -0.0299 -0.0505 0.0380  70   TYR A CD2 
538  C CE1 . TYR A 70  ? 0.5216 0.5441 0.5920 -0.0347 -0.0623 0.0354  70   TYR A CE1 
539  C CE2 . TYR A 70  ? 0.5433 0.5701 0.6192 -0.0379 -0.0554 0.0396  70   TYR A CE2 
540  C CZ  . TYR A 70  ? 0.6478 0.6708 0.7210 -0.0405 -0.0614 0.0382  70   TYR A CZ  
541  O OH  . TYR A 70  ? 0.9372 0.9561 1.0095 -0.0494 -0.0668 0.0396  70   TYR A OH  
542  N N   . GLN A 71  ? 0.3274 0.3391 0.3913 -0.0174 -0.0393 0.0340  71   GLN A N   
543  C CA  . GLN A 71  ? 0.3396 0.3525 0.4045 -0.0173 -0.0351 0.0352  71   GLN A CA  
544  C C   . GLN A 71  ? 0.3547 0.3634 0.4191 -0.0228 -0.0369 0.0372  71   GLN A C   
545  O O   . GLN A 71  ? 0.4096 0.4098 0.4703 -0.0258 -0.0412 0.0368  71   GLN A O   
546  C CB  . GLN A 71  ? 0.3155 0.3205 0.3743 -0.0124 -0.0320 0.0328  71   GLN A CB  
547  C CG  . GLN A 71  ? 0.2652 0.2580 0.3170 -0.0118 -0.0345 0.0309  71   GLN A CG  
548  C CD  . GLN A 71  ? 0.3745 0.3628 0.4213 -0.0069 -0.0316 0.0287  71   GLN A CD  
549  O OE1 . GLN A 71  ? 0.3536 0.3386 0.3980 -0.0060 -0.0297 0.0285  71   GLN A OE1 
550  N NE2 . GLN A 71  ? 0.3920 0.3810 0.4372 -0.0037 -0.0312 0.0272  71   GLN A NE2 
551  N N   . TYR A 72  ? 0.4370 0.4504 0.5040 -0.0237 -0.0335 0.0393  72   TYR A N   
552  C CA  . TYR A 72  ? 0.4696 0.4775 0.5346 -0.0277 -0.0342 0.0413  72   TYR A CA  
553  C C   . TYR A 72  ? 0.5387 0.5323 0.5955 -0.0250 -0.0352 0.0391  72   TYR A C   
554  O O   . TYR A 72  ? 0.4295 0.4210 0.4834 -0.0196 -0.0328 0.0366  72   TYR A O   
555  C CB  . TYR A 72  ? 0.4273 0.4437 0.4958 -0.0276 -0.0297 0.0435  72   TYR A CB  
556  C CG  . TYR A 72  ? 0.5122 0.5238 0.5784 -0.0313 -0.0299 0.0462  72   TYR A CG  
557  C CD1 . TYR A 72  ? 0.4680 0.4717 0.5288 -0.0282 -0.0284 0.0452  72   TYR A CD1 
558  C CD2 . TYR A 72  ? 0.5395 0.5548 0.6088 -0.0382 -0.0318 0.0500  72   TYR A CD2 
559  C CE1 . TYR A 72  ? 0.5574 0.5562 0.6153 -0.0310 -0.0290 0.0478  72   TYR A CE1 
560  C CE2 . TYR A 72  ? 0.5958 0.6054 0.6619 -0.0418 -0.0321 0.0529  72   TYR A CE2 
561  C CZ  . TYR A 72  ? 0.7158 0.7166 0.7758 -0.0378 -0.0308 0.0517  72   TYR A CZ  
562  O OH  . TYR A 72  ? 0.8125 0.8071 0.8687 -0.0409 -0.0314 0.0549  72   TYR A OH  
563  N N   . VAL A 73  ? 0.4667 0.4505 0.5193 -0.0286 -0.0388 0.0401  73   VAL A N   
564  C CA  . VAL A 73  ? 0.4792 0.4494 0.5234 -0.0252 -0.0400 0.0381  73   VAL A CA  
565  C C   . VAL A 73  ? 0.5255 0.4921 0.5676 -0.0262 -0.0389 0.0406  73   VAL A C   
566  O O   . VAL A 73  ? 0.5205 0.4856 0.5631 -0.0318 -0.0408 0.0437  73   VAL A O   
567  C CB  . VAL A 73  ? 0.4665 0.4250 0.5048 -0.0271 -0.0455 0.0367  73   VAL A CB  
568  C CG1 . VAL A 73  ? 0.5284 0.4721 0.5570 -0.0230 -0.0467 0.0349  73   VAL A CG1 
569  C CG2 . VAL A 73  ? 0.4133 0.3749 0.4523 -0.0247 -0.0463 0.0339  73   VAL A CG2 
570  N N   A ASP A 74  ? 0.5916 0.5572 0.6312 -0.0208 -0.0360 0.0393  74   ASP A N   
571  N N   B ASP A 74  ? 0.6018 0.5679 0.6417 -0.0209 -0.0359 0.0394  74   ASP A N   
572  C CA  A ASP A 74  ? 0.6130 0.5762 0.6505 -0.0207 -0.0350 0.0415  74   ASP A CA  
573  C CA  B ASP A 74  ? 0.6191 0.5838 0.6575 -0.0212 -0.0347 0.0419  74   ASP A CA  
574  C C   A ASP A 74  ? 0.6541 0.6027 0.6842 -0.0223 -0.0393 0.0426  74   ASP A C   
575  C C   B ASP A 74  ? 0.6503 0.5997 0.6806 -0.0220 -0.0388 0.0427  74   ASP A C   
576  O O   A ASP A 74  ? 0.6596 0.5976 0.6835 -0.0196 -0.0421 0.0401  74   ASP A O   
577  O O   B ASP A 74  ? 0.6603 0.5999 0.6846 -0.0184 -0.0412 0.0399  74   ASP A O   
578  C CB  A ASP A 74  ? 0.5676 0.5325 0.6033 -0.0143 -0.0319 0.0395  74   ASP A CB  
579  C CB  B ASP A 74  ? 0.5948 0.5644 0.6333 -0.0157 -0.0307 0.0405  74   ASP A CB  
580  C CG  A ASP A 74  ? 0.5406 0.5046 0.5744 -0.0136 -0.0309 0.0418  74   ASP A CG  
581  C CG  B ASP A 74  ? 0.8790 0.8619 0.9240 -0.0162 -0.0265 0.0407  74   ASP A CG  
582  O OD1 A ASP A 74  ? 0.4893 0.4527 0.5236 -0.0182 -0.0316 0.0452  74   ASP A OD1 
583  O OD1 B ASP A 74  ? 0.8330 0.8220 0.8812 -0.0196 -0.0252 0.0435  74   ASP A OD1 
584  O OD2 A ASP A 74  ? 0.5274 0.4920 0.5592 -0.0086 -0.0294 0.0404  74   ASP A OD2 
585  O OD2 B ASP A 74  ? 0.7646 0.7511 0.8105 -0.0130 -0.0246 0.0381  74   ASP A OD2 
586  N N   . THR A 75  ? 0.6966 0.6435 0.7262 -0.0265 -0.0397 0.0465  75   THR A N   
587  C CA  . THR A 75  ? 0.8920 0.8226 0.9129 -0.0282 -0.0441 0.0479  75   THR A CA  
588  C C   . THR A 75  ? 0.9143 0.8408 0.9313 -0.0271 -0.0432 0.0509  75   THR A C   
589  O O   . THR A 75  ? 0.9103 0.8235 0.9203 -0.0299 -0.0467 0.0533  75   THR A O   
590  C CB  . THR A 75  ? 1.0532 0.9798 1.0744 -0.0372 -0.0481 0.0503  75   THR A CB  
591  O OG1 . THR A 75  ? 1.0233 0.9658 1.0540 -0.0427 -0.0453 0.0535  75   THR A OG1 
592  C CG2 . THR A 75  ? 1.0031 0.9249 1.0226 -0.0373 -0.0514 0.0468  75   THR A CG2 
593  N N   . LEU A 76  ? 0.9420 0.8790 0.9626 -0.0230 -0.0390 0.0508  76   LEU A N   
594  C CA  . LEU A 76  ? 0.9532 0.8882 0.9705 -0.0216 -0.0382 0.0537  76   LEU A CA  
595  C C   . LEU A 76  ? 0.9834 0.9025 0.9906 -0.0162 -0.0414 0.0532  76   LEU A C   
596  O O   . LEU A 76  ? 1.0410 0.9503 1.0421 -0.0179 -0.0435 0.0566  76   LEU A O   
597  C CB  . LEU A 76  ? 1.0240 0.9730 1.0464 -0.0179 -0.0336 0.0529  76   LEU A CB  
598  C CG  . LEU A 76  ? 1.0965 1.0459 1.1162 -0.0169 -0.0327 0.0561  76   LEU A CG  
599  C CD1 . LEU A 76  ? 1.1142 1.0655 1.1351 -0.0244 -0.0325 0.0608  76   LEU A CD1 
600  C CD2 . LEU A 76  ? 1.1040 1.0658 1.1274 -0.0128 -0.0290 0.0544  76   LEU A CD2 
601  N N   . TYR A 77  ? 0.9323 0.8486 0.9370 -0.0094 -0.0417 0.0490  77   TYR A N   
602  C CA  . TYR A 77  ? 0.8798 0.7822 0.8747 -0.0025 -0.0443 0.0480  77   TYR A CA  
603  C C   . TYR A 77  ? 0.8803 0.7716 0.8694 0.0004  -0.0472 0.0441  77   TYR A C   
604  O O   . TYR A 77  ? 0.8774 0.7719 0.8659 0.0076  -0.0458 0.0406  77   TYR A O   
605  C CB  . TYR A 77  ? 0.7491 0.6609 0.7455 0.0055  -0.0413 0.0469  77   TYR A CB  
606  C CG  . TYR A 77  ? 0.7934 0.7136 0.7928 0.0040  -0.0392 0.0504  77   TYR A CG  
607  C CD1 . TYR A 77  ? 0.7455 0.6558 0.7386 0.0029  -0.0415 0.0543  77   TYR A CD1 
608  C CD2 . TYR A 77  ? 0.8583 0.7956 0.8659 0.0038  -0.0352 0.0497  77   TYR A CD2 
609  C CE1 . TYR A 77  ? 0.7542 0.6723 0.7492 0.0019  -0.0397 0.0576  77   TYR A CE1 
610  C CE2 . TYR A 77  ? 0.8435 0.7882 0.8528 0.0027  -0.0335 0.0526  77   TYR A CE2 
611  C CZ  . TYR A 77  ? 0.8454 0.7811 0.8487 0.0019  -0.0357 0.0566  77   TYR A CZ  
612  O OH  . TYR A 77  ? 0.8561 0.7990 0.8603 0.0009  -0.0341 0.0595  77   TYR A OH  
613  N N   . PRO A 78  ? 1.0104 0.8890 0.9949 -0.0055 -0.0514 0.0449  78   PRO A N   
614  C CA  . PRO A 78  ? 1.0381 0.9043 1.0160 -0.0048 -0.0551 0.0414  78   PRO A CA  
615  C C   . PRO A 78  ? 1.0199 0.8763 0.9885 0.0059  -0.0559 0.0375  78   PRO A C   
616  O O   . PRO A 78  ? 1.0810 0.9248 1.0406 0.0106  -0.0578 0.0385  78   PRO A O   
617  C CB  . PRO A 78  ? 1.0686 0.9184 1.0394 -0.0127 -0.0602 0.0443  78   PRO A CB  
618  C CG  . PRO A 78  ? 1.0938 0.9554 1.0731 -0.0206 -0.0579 0.0493  78   PRO A CG  
619  C CD  . PRO A 78  ? 1.0613 0.9369 1.0461 -0.0145 -0.0529 0.0498  78   PRO A CD  
620  N N   . GLY A 79  ? 0.9804 0.8420 0.9504 0.0101  -0.0546 0.0334  79   GLY A N   
621  C CA  . GLY A 79  ? 0.9306 0.7837 0.8914 0.0203  -0.0552 0.0295  79   GLY A CA  
622  C C   . GLY A 79  ? 0.8878 0.7526 0.8514 0.0293  -0.0510 0.0293  79   GLY A C   
623  O O   . GLY A 79  ? 0.8323 0.6939 0.7897 0.0387  -0.0506 0.0264  79   GLY A O   
624  N N   . PHE A 80  ? 0.8441 0.7233 0.8170 0.0262  -0.0478 0.0324  80   PHE A N   
625  C CA  . PHE A 80  ? 0.7570 0.6498 0.7342 0.0327  -0.0440 0.0327  80   PHE A CA  
626  C C   . PHE A 80  ? 0.6968 0.6065 0.6824 0.0331  -0.0399 0.0304  80   PHE A C   
627  O O   . PHE A 80  ? 0.6267 0.5439 0.6195 0.0260  -0.0385 0.0308  80   PHE A O   
628  C CB  . PHE A 80  ? 0.6770 0.5756 0.6589 0.0282  -0.0431 0.0370  80   PHE A CB  
629  C CG  . PHE A 80  ? 0.6785 0.5950 0.6677 0.0313  -0.0391 0.0376  80   PHE A CG  
630  C CD1 . PHE A 80  ? 0.6057 0.5244 0.5915 0.0406  -0.0387 0.0372  80   PHE A CD1 
631  C CD2 . PHE A 80  ? 0.6340 0.5651 0.6330 0.0251  -0.0360 0.0386  80   PHE A CD2 
632  C CE1 . PHE A 80  ? 0.6542 0.5904 0.6470 0.0425  -0.0355 0.0379  80   PHE A CE1 
633  C CE2 . PHE A 80  ? 0.5886 0.5350 0.5934 0.0270  -0.0329 0.0390  80   PHE A CE2 
634  C CZ  . PHE A 80  ? 0.6575 0.6070 0.6596 0.0353  -0.0328 0.0387  80   PHE A CZ  
635  N N   . GLU A 81  ? 0.6768 0.5921 0.6608 0.0414  -0.0379 0.0281  81   GLU A N   
636  C CA  . GLU A 81  ? 0.7613 0.6902 0.7513 0.0416  -0.0343 0.0259  81   GLU A CA  
637  C C   . GLU A 81  ? 0.7411 0.6862 0.7419 0.0357  -0.0309 0.0278  81   GLU A C   
638  O O   . GLU A 81  ? 0.6585 0.6112 0.6642 0.0323  -0.0287 0.0267  81   GLU A O   
639  C CB  . GLU A 81  ? 0.7538 0.6883 0.7408 0.0515  -0.0323 0.0239  81   GLU A CB  
640  N N   . GLY A 82  ? 0.6926 0.6418 0.6959 0.0348  -0.0306 0.0306  82   GLY A N   
641  C CA  . GLY A 82  ? 0.6604 0.6233 0.6722 0.0297  -0.0278 0.0322  82   GLY A CA  
642  C C   . GLY A 82  ? 0.6073 0.5698 0.6231 0.0219  -0.0275 0.0323  82   GLY A C   
643  O O   . GLY A 82  ? 0.6253 0.5979 0.6468 0.0189  -0.0248 0.0319  82   GLY A O   
644  N N   . THR A 83  ? 0.6423 0.5933 0.6549 0.0185  -0.0305 0.0331  83   THR A N   
645  C CA  . THR A 83  ? 0.6643 0.6165 0.6812 0.0116  -0.0305 0.0334  83   THR A CA  
646  C C   . THR A 83  ? 0.6184 0.5658 0.6332 0.0118  -0.0317 0.0307  83   THR A C   
647  O O   . THR A 83  ? 0.6170 0.5704 0.6365 0.0086  -0.0304 0.0301  83   THR A O   
648  C CB  . THR A 83  ? 0.6992 0.6458 0.7159 0.0059  -0.0326 0.0366  83   THR A CB  
649  O OG1 . THR A 83  ? 0.7959 0.7272 0.8044 0.0073  -0.0367 0.0368  83   THR A OG1 
650  C CG2 . THR A 83  ? 0.6755 0.6290 0.6948 0.0052  -0.0308 0.0394  83   THR A CG2 
651  N N   . GLU A 84  ? 0.6115 0.5482 0.6187 0.0164  -0.0343 0.0289  84   GLU A N   
652  C CA  . GLU A 84  ? 0.6165 0.5468 0.6202 0.0164  -0.0362 0.0262  84   GLU A CA  
653  C C   . GLU A 84  ? 0.5838 0.5236 0.5903 0.0187  -0.0330 0.0241  84   GLU A C   
654  O O   . GLU A 84  ? 0.5645 0.5036 0.5714 0.0163  -0.0338 0.0228  84   GLU A O   
655  C CB  . GLU A 84  ? 0.6784 0.5935 0.6714 0.0216  -0.0397 0.0245  84   GLU A CB  
656  C CG  . GLU A 84  ? 0.8980 0.7998 0.8860 0.0185  -0.0437 0.0267  84   GLU A CG  
657  C CD  . GLU A 84  ? 1.0051 0.9029 0.9951 0.0094  -0.0468 0.0279  84   GLU A CD  
658  O OE1 . GLU A 84  ? 0.9612 0.8678 0.9572 0.0062  -0.0456 0.0271  84   GLU A OE1 
659  O OE2 . GLU A 84  ? 1.0210 0.9069 1.0062 0.0055  -0.0505 0.0299  84   GLU A OE2 
660  N N   . MET A 85  ? 0.4723 0.4210 0.4804 0.0231  -0.0296 0.0239  85   MET A N   
661  C CA  . MET A 85  ? 0.5222 0.4795 0.5322 0.0247  -0.0265 0.0223  85   MET A CA  
662  C C   . MET A 85  ? 0.4481 0.4112 0.4642 0.0186  -0.0252 0.0230  85   MET A C   
663  O O   . MET A 85  ? 0.5703 0.5355 0.5860 0.0189  -0.0241 0.0217  85   MET A O   
664  C CB  . MET A 85  ? 0.4953 0.4635 0.5075 0.0285  -0.0231 0.0228  85   MET A CB  
665  C CG  . MET A 85  ? 0.5324 0.5089 0.5509 0.0249  -0.0216 0.0253  85   MET A CG  
666  S SD  . MET A 85  ? 0.6832 0.6737 0.7042 0.0290  -0.0184 0.0258  85   MET A SD  
667  C CE  . MET A 85  ? 0.4222 0.4213 0.4464 0.0257  -0.0150 0.0248  85   MET A CE  
668  N N   . TRP A 86  ? 0.3179 0.2833 0.3388 0.0138  -0.0254 0.0251  86   TRP A N   
669  C CA  . TRP A 86  ? 0.4191 0.3901 0.4452 0.0093  -0.0240 0.0257  86   TRP A CA  
670  C C   . TRP A 86  ? 0.4384 0.4042 0.4645 0.0061  -0.0270 0.0256  86   TRP A C   
671  O O   . TRP A 86  ? 0.3907 0.3611 0.4204 0.0037  -0.0262 0.0258  86   TRP A O   
672  C CB  . TRP A 86  ? 0.3811 0.3587 0.4121 0.0062  -0.0222 0.0279  86   TRP A CB  
673  C CG  . TRP A 86  ? 0.3716 0.3549 0.4029 0.0085  -0.0200 0.0282  86   TRP A CG  
674  C CD1 . TRP A 86  ? 0.4236 0.4063 0.4538 0.0102  -0.0207 0.0295  86   TRP A CD1 
675  C CD2 . TRP A 86  ? 0.3749 0.3658 0.4073 0.0094  -0.0170 0.0273  86   TRP A CD2 
676  N NE1 . TRP A 86  ? 0.4009 0.3920 0.4324 0.0121  -0.0184 0.0295  86   TRP A NE1 
677  C CE2 . TRP A 86  ? 0.3582 0.3543 0.3910 0.0112  -0.0162 0.0282  86   TRP A CE2 
678  C CE3 . TRP A 86  ? 0.3790 0.3724 0.4118 0.0084  -0.0152 0.0263  86   TRP A CE3 
679  C CZ2 . TRP A 86  ? 0.4383 0.4434 0.4727 0.0114  -0.0136 0.0279  86   TRP A CZ2 
680  C CZ3 . TRP A 86  ? 0.3617 0.3622 0.3950 0.0084  -0.0125 0.0261  86   TRP A CZ3 
681  C CH2 . TRP A 86  ? 0.4270 0.4339 0.4615 0.0095  -0.0118 0.0269  86   TRP A CH2 
682  N N   . ASN A 87  ? 0.4020 0.3582 0.4236 0.0061  -0.0308 0.0253  87   ASN A N   
683  C CA  . ASN A 87  ? 0.3922 0.3444 0.4142 0.0019  -0.0342 0.0256  87   ASN A CA  
684  C C   . ASN A 87  ? 0.4306 0.3809 0.4499 0.0034  -0.0355 0.0232  87   ASN A C   
685  O O   . ASN A 87  ? 0.4369 0.3848 0.4513 0.0082  -0.0346 0.0211  87   ASN A O   
686  C CB  . ASN A 87  ? 0.4291 0.3698 0.4460 0.0003  -0.0385 0.0262  87   ASN A CB  
687  C CG  . ASN A 87  ? 0.5508 0.4935 0.5714 -0.0039 -0.0383 0.0296  87   ASN A CG  
688  O OD1 . ASN A 87  ? 0.6466 0.5999 0.6742 -0.0066 -0.0356 0.0314  87   ASN A OD1 
689  N ND2 . ASN A 87  ? 0.5827 0.5145 0.5975 -0.0041 -0.0411 0.0306  87   ASN A ND2 
690  N N   . PRO A 88  ? 0.4673 0.4195 0.4897 -0.0006 -0.0376 0.0236  88   PRO A N   
691  C CA  . PRO A 88  ? 0.4766 0.4266 0.4958 0.0007  -0.0396 0.0215  88   PRO A CA  
692  C C   . PRO A 88  ? 0.4797 0.4180 0.4893 0.0041  -0.0424 0.0188  88   PRO A C   
693  O O   . PRO A 88  ? 0.4083 0.3374 0.4137 0.0028  -0.0457 0.0188  88   PRO A O   
694  C CB  . PRO A 88  ? 0.4555 0.4079 0.4791 -0.0050 -0.0432 0.0229  88   PRO A CB  
695  C CG  . PRO A 88  ? 0.4996 0.4609 0.5311 -0.0082 -0.0406 0.0259  88   PRO A CG  
696  C CD  . PRO A 88  ? 0.4274 0.3842 0.4560 -0.0064 -0.0388 0.0264  88   PRO A CD  
697  N N   . ASN A 89  ? 0.4662 0.4041 0.4714 0.0085  -0.0413 0.0167  89   ASN A N   
698  C CA  . ASN A 89  ? 0.4241 0.3512 0.4192 0.0125  -0.0437 0.0138  89   ASN A CA  
699  C C   . ASN A 89  ? 0.4942 0.4181 0.4852 0.0122  -0.0470 0.0119  89   ASN A C   
700  O O   . ASN A 89  ? 0.4572 0.3735 0.4390 0.0166  -0.0481 0.0092  89   ASN A O   
701  C CB  . ASN A 89  ? 0.4113 0.3403 0.4030 0.0191  -0.0394 0.0128  89   ASN A CB  
702  C CG  . ASN A 89  ? 0.5087 0.4469 0.5026 0.0206  -0.0354 0.0129  89   ASN A CG  
703  O OD1 . ASN A 89  ? 0.3943 0.3383 0.3937 0.0172  -0.0349 0.0142  89   ASN A OD1 
704  N ND2 . ASN A 89  ? 0.4784 0.4180 0.4676 0.0261  -0.0323 0.0117  89   ASN A ND2 
705  N N   A ARG A 90  ? 0.4185 0.3486 0.4157 0.0076  -0.0484 0.0134  90   ARG A N   
706  N N   B ARG A 90  ? 0.4175 0.3477 0.4148 0.0076  -0.0484 0.0134  90   ARG A N   
707  C CA  A ARG A 90  ? 0.4000 0.3276 0.3940 0.0063  -0.0528 0.0120  90   ARG A CA  
708  C CA  B ARG A 90  ? 0.4047 0.3331 0.3992 0.0064  -0.0525 0.0121  90   ARG A CA  
709  C C   A ARG A 90  ? 0.4341 0.3669 0.4359 -0.0005 -0.0559 0.0143  90   ARG A C   
710  C C   B ARG A 90  ? 0.4337 0.3667 0.4356 -0.0005 -0.0559 0.0143  90   ARG A C   
711  O O   A ARG A 90  ? 0.4379 0.3767 0.4471 -0.0033 -0.0538 0.0169  90   ARG A O   
712  O O   B ARG A 90  ? 0.4388 0.3775 0.4480 -0.0034 -0.0539 0.0169  90   ARG A O   
713  C CB  A ARG A 90  ? 0.4184 0.3521 0.4122 0.0096  -0.0502 0.0117  90   ARG A CB  
714  C CB  B ARG A 90  ? 0.4135 0.3492 0.4090 0.0094  -0.0495 0.0122  90   ARG A CB  
715  C CG  A ARG A 90  ? 0.4722 0.4016 0.4573 0.0158  -0.0476 0.0095  90   ARG A CG  
716  C CG  B ARG A 90  ? 0.4239 0.3581 0.4134 0.0153  -0.0453 0.0108  90   ARG A CG  
717  C CD  A ARG A 90  ? 0.5118 0.4285 0.4862 0.0182  -0.0515 0.0064  90   ARG A CD  
718  C CD  B ARG A 90  ? 0.4966 0.4199 0.4749 0.0187  -0.0483 0.0076  90   ARG A CD  
719  N NE  A ARG A 90  ? 0.5708 0.4857 0.5375 0.0249  -0.0480 0.0046  90   ARG A NE  
720  N NE  B ARG A 90  ? 0.4419 0.3637 0.4143 0.0204  -0.0501 0.0062  90   ARG A NE  
721  C CZ  A ARG A 90  ? 0.5638 0.4759 0.5270 0.0292  -0.0455 0.0037  90   ARG A CZ  
722  C CZ  B ARG A 90  ? 0.5313 0.4431 0.4933 0.0226  -0.0540 0.0032  90   ARG A CZ  
723  N NH1 A ARG A 90  ? 0.4628 0.3713 0.4282 0.0276  -0.0466 0.0044  90   ARG A NH1 
724  N NH1 B ARG A 90  ? 0.5196 0.4210 0.4758 0.0232  -0.0567 0.0012  90   ARG A NH1 
725  N NH2 A ARG A 90  ? 0.5531 0.4663 0.5101 0.0353  -0.0420 0.0024  90   ARG A NH2 
726  N NH2 B ARG A 90  ? 0.3927 0.3038 0.3491 0.0243  -0.0555 0.0021  90   ARG A NH2 
727  N N   . GLU A 91  ? 0.4205 0.3522 0.4207 -0.0031 -0.0609 0.0135  91   GLU A N   
728  C CA  . GLU A 91  ? 0.4365 0.3748 0.4443 -0.0101 -0.0645 0.0158  91   GLU A CA  
729  C C   . GLU A 91  ? 0.4336 0.3874 0.4529 -0.0106 -0.0604 0.0189  91   GLU A C   
730  O O   . GLU A 91  ? 0.3916 0.3509 0.4118 -0.0060 -0.0571 0.0187  91   GLU A O   
731  C CB  . GLU A 91  ? 0.4328 0.3692 0.4369 -0.0119 -0.0705 0.0142  91   GLU A CB  
732  C CG  . GLU A 91  ? 0.5584 0.5044 0.5711 -0.0194 -0.0747 0.0168  91   GLU A CG  
733  C CD  . GLU A 91  ? 0.6801 0.6264 0.6897 -0.0210 -0.0808 0.0153  91   GLU A CD  
734  O OE1 . GLU A 91  ? 0.5289 0.4631 0.5271 -0.0178 -0.0831 0.0119  91   GLU A OE1 
735  O OE2 . GLU A 91  ? 0.8118 0.7711 0.8301 -0.0250 -0.0832 0.0176  91   GLU A OE2 
736  N N   . LEU A 92  ? 0.3870 0.3471 0.4140 -0.0159 -0.0606 0.0217  92   LEU A N   
737  C CA  . LEU A 92  ? 0.4297 0.4049 0.4670 -0.0163 -0.0572 0.0244  92   LEU A CA  
738  C C   . LEU A 92  ? 0.4513 0.4357 0.4927 -0.0173 -0.0605 0.0249  92   LEU A C   
739  O O   . LEU A 92  ? 0.4290 0.4123 0.4699 -0.0221 -0.0661 0.0249  92   LEU A O   
740  C CB  . LEU A 92  ? 0.3898 0.3701 0.4337 -0.0218 -0.0565 0.0276  92   LEU A CB  
741  C CG  . LEU A 92  ? 0.4973 0.4698 0.5380 -0.0215 -0.0538 0.0279  92   LEU A CG  
742  C CD1 . LEU A 92  ? 0.4434 0.4242 0.4918 -0.0268 -0.0526 0.0316  92   LEU A CD1 
743  C CD2 . LEU A 92  ? 0.4505 0.4228 0.4892 -0.0147 -0.0484 0.0265  92   LEU A CD2 
744  N N   . SER A 93  ? 0.4025 0.3958 0.4477 -0.0127 -0.0572 0.0255  93   SER A N   
745  C CA  . SER A 93  ? 0.3395 0.3426 0.3888 -0.0124 -0.0602 0.0262  93   SER A CA  
746  C C   . SER A 93  ? 0.4606 0.4736 0.5149 -0.0072 -0.0553 0.0275  93   SER A C   
747  O O   . SER A 93  ? 0.3920 0.4002 0.4430 -0.0031 -0.0505 0.0268  93   SER A O   
748  C CB  . SER A 93  ? 0.3958 0.3906 0.4363 -0.0096 -0.0638 0.0234  93   SER A CB  
749  O OG  . SER A 93  ? 0.3668 0.3713 0.4106 -0.0081 -0.0666 0.0241  93   SER A OG  
750  N N   . GLU A 94  ? 0.3787 0.4054 0.4404 -0.0072 -0.0568 0.0294  94   GLU A N   
751  C CA  . GLU A 94  ? 0.3533 0.3874 0.4177 -0.0008 -0.0527 0.0302  94   GLU A CA  
752  C C   . GLU A 94  ? 0.3701 0.3966 0.4264 0.0053  -0.0530 0.0284  94   GLU A C   
753  O O   . GLU A 94  ? 0.3851 0.4102 0.4389 0.0110  -0.0490 0.0283  94   GLU A O   
754  C CB  . GLU A 94  ? 0.4153 0.4671 0.4897 -0.0014 -0.0541 0.0328  94   GLU A CB  
755  C CG  . GLU A 94  ? 0.3818 0.4430 0.4646 -0.0071 -0.0527 0.0353  94   GLU A CG  
756  C CD  . GLU A 94  ? 0.4058 0.4876 0.4991 -0.0064 -0.0532 0.0381  94   GLU A CD  
757  O OE1 . GLU A 94  ? 0.3176 0.4059 0.4127 0.0006  -0.0490 0.0386  94   GLU A OE1 
758  O OE2 . GLU A 94  ? 0.3759 0.4670 0.4751 -0.0128 -0.0578 0.0398  94   GLU A OE2 
759  N N   . ASP A 95  ? 0.3625 0.3830 0.4135 0.0038  -0.0578 0.0268  95   ASP A N   
760  C CA  . ASP A 95  ? 0.4601 0.4719 0.5018 0.0091  -0.0580 0.0251  95   ASP A CA  
761  C C   . ASP A 95  ? 0.4065 0.4053 0.4405 0.0099  -0.0542 0.0234  95   ASP A C   
762  O O   . ASP A 95  ? 0.3910 0.3811 0.4191 0.0078  -0.0563 0.0216  95   ASP A O   
763  C CB  . ASP A 95  ? 0.3896 0.3999 0.4275 0.0074  -0.0647 0.0240  95   ASP A CB  
764  C CG  . ASP A 95  ? 0.3917 0.3933 0.4193 0.0129  -0.0649 0.0225  95   ASP A CG  
765  O OD1 . ASP A 95  ? 0.4560 0.4527 0.4795 0.0174  -0.0598 0.0226  95   ASP A OD1 
766  O OD2 . ASP A 95  ? 0.5057 0.5052 0.5287 0.0122  -0.0703 0.0213  95   ASP A OD2 
767  N N   . CYS A 96  ? 0.3609 0.3584 0.3944 0.0130  -0.0486 0.0240  96   CYS A N   
768  C CA  . CYS A 96  ? 0.4087 0.3974 0.4374 0.0128  -0.0447 0.0229  96   CYS A CA  
769  C C   . CYS A 96  ? 0.4458 0.4299 0.4692 0.0170  -0.0401 0.0231  96   CYS A C   
770  O O   . CYS A 96  ? 0.3178 0.2966 0.3380 0.0166  -0.0367 0.0225  96   CYS A O   
771  C CB  . CYS A 96  ? 0.4717 0.4638 0.5067 0.0090  -0.0427 0.0237  96   CYS A CB  
772  S SG  . CYS A 96  ? 0.4429 0.4449 0.4854 0.0104  -0.0387 0.0258  96   CYS A SG  
773  N N   . LEU A 97  ? 0.3112 0.2972 0.3334 0.0210  -0.0402 0.0240  97   LEU A N   
774  C CA  . LEU A 97  ? 0.4102 0.3902 0.4265 0.0243  -0.0362 0.0244  97   LEU A CA  
775  C C   . LEU A 97  ? 0.4260 0.3971 0.4324 0.0257  -0.0361 0.0237  97   LEU A C   
776  O O   . LEU A 97  ? 0.4027 0.3715 0.4039 0.0290  -0.0380 0.0242  97   LEU A O   
777  C CB  . LEU A 97  ? 0.3491 0.3329 0.3666 0.0288  -0.0361 0.0258  97   LEU A CB  
778  C CG  . LEU A 97  ? 0.3589 0.3524 0.3855 0.0283  -0.0350 0.0266  97   LEU A CG  
779  C CD1 . LEU A 97  ? 0.3254 0.3210 0.3514 0.0343  -0.0340 0.0277  97   LEU A CD1 
780  C CD2 . LEU A 97  ? 0.3152 0.3063 0.3431 0.0249  -0.0309 0.0262  97   LEU A CD2 
781  N N   . TYR A 98  ? 0.4048 0.3715 0.4084 0.0234  -0.0339 0.0228  98   TYR A N   
782  C CA  . TYR A 98  ? 0.3625 0.3224 0.3570 0.0246  -0.0332 0.0222  98   TYR A CA  
783  C C   . TYR A 98  ? 0.3916 0.3489 0.3841 0.0231  -0.0281 0.0226  98   TYR A C   
784  O O   . TYR A 98  ? 0.3938 0.3544 0.3921 0.0208  -0.0261 0.0226  98   TYR A O   
785  C CB  . TYR A 98  ? 0.3950 0.3539 0.3881 0.0235  -0.0366 0.0202  98   TYR A CB  
786  C CG  . TYR A 98  ? 0.3916 0.3532 0.3863 0.0238  -0.0423 0.0197  98   TYR A CG  
787  C CD1 . TYR A 98  ? 0.4392 0.3975 0.4265 0.0265  -0.0452 0.0194  98   TYR A CD1 
788  C CD2 . TYR A 98  ? 0.3823 0.3504 0.3858 0.0208  -0.0451 0.0198  98   TYR A CD2 
789  C CE1 . TYR A 98  ? 0.4742 0.4362 0.4633 0.0264  -0.0511 0.0190  98   TYR A CE1 
790  C CE2 . TYR A 98  ? 0.3740 0.3463 0.3797 0.0201  -0.0507 0.0197  98   TYR A CE2 
791  C CZ  . TYR A 98  ? 0.4692 0.4387 0.4679 0.0229  -0.0539 0.0192  98   TYR A CZ  
792  O OH  . TYR A 98  ? 0.4030 0.3777 0.4041 0.0218  -0.0599 0.0191  98   TYR A OH  
793  N N   . LEU A 99  ? 0.3803 0.3327 0.3648 0.0241  -0.0260 0.0230  99   LEU A N   
794  C CA  . LEU A 99  ? 0.4080 0.3597 0.3909 0.0219  -0.0214 0.0237  99   LEU A CA  
795  C C   . LEU A 99  ? 0.3758 0.3262 0.3524 0.0226  -0.0201 0.0232  99   LEU A C   
796  O O   . LEU A 99  ? 0.3957 0.3437 0.3673 0.0250  -0.0227 0.0223  99   LEU A O   
797  C CB  . LEU A 99  ? 0.3724 0.3200 0.3519 0.0215  -0.0187 0.0258  99   LEU A CB  
798  C CG  . LEU A 99  ? 0.3580 0.2990 0.3286 0.0241  -0.0193 0.0272  99   LEU A CG  
799  C CD1 . LEU A 99  ? 0.3295 0.2681 0.2923 0.0234  -0.0173 0.0280  99   LEU A CD1 
800  C CD2 . LEU A 99  ? 0.3957 0.3307 0.3632 0.0240  -0.0176 0.0291  99   LEU A CD2 
801  N N   . ASN A 100 ? 0.4196 0.3723 0.3963 0.0205  -0.0162 0.0237  100  ASN A N   
802  C CA  . ASN A 100 ? 0.3071 0.2615 0.2797 0.0215  -0.0145 0.0231  100  ASN A CA  
803  C C   . ASN A 100 ? 0.3940 0.3492 0.3624 0.0193  -0.0099 0.0255  100  ASN A C   
804  O O   . ASN A 100 ? 0.3702 0.3265 0.3418 0.0158  -0.0078 0.0268  100  ASN A O   
805  C CB  . ASN A 100 ? 0.2694 0.2287 0.2483 0.0211  -0.0143 0.0216  100  ASN A CB  
806  C CG  . ASN A 100 ? 0.3954 0.3533 0.3786 0.0218  -0.0189 0.0197  100  ASN A CG  
807  O OD1 . ASN A 100 ? 0.3954 0.3496 0.3748 0.0240  -0.0224 0.0183  100  ASN A OD1 
808  N ND2 . ASN A 100 ? 0.3135 0.2746 0.3044 0.0195  -0.0189 0.0198  100  ASN A ND2 
809  N N   . VAL A 101 ? 0.3951 0.3500 0.3560 0.0209  -0.0085 0.0260  101  VAL A N   
810  C CA  . VAL A 101 ? 0.4169 0.3740 0.3739 0.0179  -0.0040 0.0287  101  VAL A CA  
811  C C   . VAL A 101 ? 0.3975 0.3623 0.3530 0.0197  -0.0012 0.0282  101  VAL A C   
812  O O   . VAL A 101 ? 0.4640 0.4275 0.4145 0.0242  -0.0025 0.0265  101  VAL A O   
813  C CB  . VAL A 101 ? 0.4208 0.3703 0.3684 0.0181  -0.0040 0.0310  101  VAL A CB  
814  C CG1 . VAL A 101 ? 0.3813 0.3334 0.3238 0.0144  0.0007  0.0342  101  VAL A CG1 
815  C CG2 . VAL A 101 ? 0.3415 0.2833 0.2896 0.0174  -0.0064 0.0318  101  VAL A CG2 
816  N N   . TRP A 102 ? 0.3985 0.3716 0.3579 0.0165  0.0025  0.0296  102  TRP A N   
817  C CA  . TRP A 102 ? 0.3887 0.3711 0.3458 0.0183  0.0061  0.0300  102  TRP A CA  
818  C C   . TRP A 102 ? 0.4439 0.4300 0.3974 0.0131  0.0104  0.0340  102  TRP A C   
819  O O   . TRP A 102 ? 0.4093 0.3937 0.3651 0.0070  0.0111  0.0361  102  TRP A O   
820  C CB  . TRP A 102 ? 0.3961 0.3882 0.3612 0.0189  0.0072  0.0288  102  TRP A CB  
821  C CG  . TRP A 102 ? 0.4103 0.3995 0.3786 0.0238  0.0034  0.0251  102  TRP A CG  
822  C CD1 . TRP A 102 ? 0.4006 0.3914 0.3664 0.0300  0.0029  0.0226  102  TRP A CD1 
823  C CD2 . TRP A 102 ? 0.3463 0.3305 0.3206 0.0223  -0.0001 0.0239  102  TRP A CD2 
824  N NE1 . TRP A 102 ? 0.4151 0.4007 0.3844 0.0319  -0.0010 0.0200  102  TRP A NE1 
825  C CE2 . TRP A 102 ? 0.4553 0.4379 0.4304 0.0270  -0.0027 0.0210  102  TRP A CE2 
826  C CE3 . TRP A 102 ? 0.3972 0.3779 0.3755 0.0177  -0.0010 0.0250  102  TRP A CE3 
827  C CZ2 . TRP A 102 ? 0.4235 0.4017 0.4038 0.0263  -0.0063 0.0197  102  TRP A CZ2 
828  C CZ3 . TRP A 102 ? 0.5013 0.4792 0.4851 0.0179  -0.0042 0.0235  102  TRP A CZ3 
829  C CH2 . TRP A 102 ? 0.4130 0.3900 0.3981 0.0217  -0.0068 0.0210  102  TRP A CH2 
830  N N   . THR A 103 ? 0.4761 0.4671 0.4233 0.0152  0.0133  0.0351  103  THR A N   
831  C CA  . THR A 103 ? 0.4343 0.4302 0.3775 0.0098  0.0177  0.0394  103  THR A CA  
832  C C   . THR A 103 ? 0.4629 0.4720 0.4046 0.0136  0.0215  0.0396  103  THR A C   
833  O O   . THR A 103 ? 0.4974 0.5069 0.4377 0.0212  0.0202  0.0361  103  THR A O   
834  C CB  . THR A 103 ? 0.5291 0.5129 0.4615 0.0088  0.0170  0.0417  103  THR A CB  
835  O OG1 . THR A 103 ? 0.5292 0.5115 0.4542 0.0156  0.0163  0.0401  103  THR A OG1 
836  C CG2 . THR A 103 ? 0.5011 0.4715 0.4338 0.0082  0.0125  0.0408  103  THR A CG2 
837  N N   . PRO A 104 ? 0.5210 0.5411 0.4628 0.0082  0.0263  0.0436  104  PRO A N   
838  C CA  . PRO A 104 ? 0.5062 0.5405 0.4454 0.0115  0.0309  0.0447  104  PRO A CA  
839  C C   . PRO A 104 ? 0.5201 0.5476 0.4483 0.0182  0.0305  0.0435  104  PRO A C   
840  O O   . PRO A 104 ? 0.5976 0.6102 0.5194 0.0182  0.0273  0.0432  104  PRO A O   
841  C CB  . PRO A 104 ? 0.4894 0.5315 0.4281 0.0019  0.0352  0.0504  104  PRO A CB  
842  C CG  . PRO A 104 ? 0.4420 0.4786 0.3872 -0.0057 0.0329  0.0510  104  PRO A CG  
843  C CD  . PRO A 104 ? 0.4979 0.5171 0.4414 -0.0019 0.0276  0.0475  104  PRO A CD  
844  N N   . TYR A 105 ? 0.4968 0.5356 0.4223 0.0245  0.0338  0.0427  105  TYR A N   
845  C CA  . TYR A 105 ? 0.5474 0.5810 0.4611 0.0313  0.0339  0.0413  105  TYR A CA  
846  C C   . TYR A 105 ? 0.5976 0.6469 0.5075 0.0310  0.0405  0.0450  105  TYR A C   
847  O O   . TYR A 105 ? 0.6607 0.7267 0.5765 0.0336  0.0440  0.0449  105  TYR A O   
848  C CB  . TYR A 105 ? 0.4005 0.4312 0.3134 0.0414  0.0309  0.0354  105  TYR A CB  
849  C CG  . TYR A 105 ? 0.4821 0.5064 0.3820 0.0492  0.0302  0.0330  105  TYR A CG  
850  C CD1 . TYR A 105 ? 0.5151 0.5223 0.4090 0.0516  0.0242  0.0298  105  TYR A CD1 
851  C CD2 . TYR A 105 ? 0.4320 0.4682 0.3256 0.0544  0.0355  0.0337  105  TYR A CD2 
852  C CE1 . TYR A 105 ? 0.4952 0.4959 0.3764 0.0584  0.0230  0.0273  105  TYR A CE1 
853  C CE2 . TYR A 105 ? 0.4156 0.4450 0.2958 0.0619  0.0347  0.0311  105  TYR A CE2 
854  C CZ  . TYR A 105 ? 0.5498 0.5609 0.4238 0.0637  0.0282  0.0278  105  TYR A CZ  
855  O OH  . TYR A 105 ? 0.6064 0.6101 0.4667 0.0708  0.0268  0.0250  105  TYR A OH  
856  N N   . PRO A 106 ? 0.6085 0.6535 0.5084 0.0280  0.0424  0.0487  106  PRO A N   
857  C CA  . PRO A 106 ? 0.5630 0.5889 0.4552 0.0254  0.0383  0.0493  106  PRO A CA  
858  C C   . PRO A 106 ? 0.5772 0.5970 0.4757 0.0157  0.0367  0.0521  106  PRO A C   
859  O O   . PRO A 106 ? 0.5598 0.5910 0.4674 0.0102  0.0392  0.0540  106  PRO A O   
860  C CB  . PRO A 106 ? 0.6432 0.6710 0.5234 0.0243  0.0425  0.0537  106  PRO A CB  
861  C CG  . PRO A 106 ? 0.6808 0.7296 0.5625 0.0270  0.0488  0.0549  106  PRO A CG  
862  C CD  . PRO A 106 ? 0.6409 0.7017 0.5369 0.0259  0.0493  0.0534  106  PRO A CD  
863  N N   . ARG A 107 ? 0.5818 0.5843 0.4753 0.0141  0.0325  0.0523  107  ARG A N   
864  C CA  . ARG A 107 ? 0.5457 0.5402 0.4441 0.0064  0.0305  0.0541  107  ARG A CA  
865  C C   . ARG A 107 ? 0.5692 0.5697 0.4665 -0.0037 0.0352  0.0602  107  ARG A C   
866  O O   . ARG A 107 ? 0.5748 0.5808 0.4645 -0.0051 0.0393  0.0640  107  ARG A O   
867  C CB  . ARG A 107 ? 0.5720 0.5475 0.4642 0.0081  0.0252  0.0532  107  ARG A CB  
868  C CG  . ARG A 107 ? 0.6029 0.5740 0.4978 0.0165  0.0201  0.0473  107  ARG A CG  
869  C CD  . ARG A 107 ? 0.5067 0.4623 0.3982 0.0181  0.0145  0.0463  107  ARG A CD  
870  N NE  . ARG A 107 ? 0.3874 0.3342 0.2661 0.0185  0.0144  0.0495  107  ARG A NE  
871  C CZ  . ARG A 107 ? 0.3792 0.3236 0.2491 0.0246  0.0129  0.0481  107  ARG A CZ  
872  N NH1 . ARG A 107 ? 0.4046 0.3537 0.2767 0.0307  0.0112  0.0433  107  ARG A NH1 
873  N NH2 . ARG A 107 ? 0.3918 0.3280 0.2497 0.0245  0.0129  0.0515  107  ARG A NH2 
874  N N   . PRO A 108 ? 0.6323 0.6315 0.5366 -0.0110 0.0344  0.0613  108  PRO A N   
875  C CA  . PRO A 108 ? 0.7064 0.7096 0.6094 -0.0220 0.0381  0.0670  108  PRO A CA  
876  C C   . PRO A 108 ? 0.7483 0.7373 0.6372 -0.0253 0.0384  0.0715  108  PRO A C   
877  O O   . PRO A 108 ? 0.7960 0.7677 0.6787 -0.0214 0.0342  0.0700  108  PRO A O   
878  C CB  . PRO A 108 ? 0.6664 0.6630 0.5765 -0.0276 0.0351  0.0660  108  PRO A CB  
879  C CG  . PRO A 108 ? 0.6776 0.6740 0.5958 -0.0194 0.0313  0.0599  108  PRO A CG  
880  C CD  . PRO A 108 ? 0.6728 0.6639 0.5846 -0.0100 0.0297  0.0575  108  PRO A CD  
881  N N   . ALA A 109 ? 0.7208 0.7172 0.6045 -0.0323 0.0432  0.0771  109  ALA A N   
882  C CA  . ALA A 109 ? 0.8756 0.8578 0.7448 -0.0358 0.0436  0.0819  109  ALA A CA  
883  C C   . ALA A 109 ? 0.8831 0.8486 0.7484 -0.0455 0.0415  0.0851  109  ALA A C   
884  O O   . ALA A 109 ? 0.9195 0.8665 0.7722 -0.0466 0.0398  0.0879  109  ALA A O   
885  C CB  . ALA A 109 ? 0.9318 0.9281 0.7956 -0.0392 0.0497  0.0871  109  ALA A CB  
886  N N   . SER A 110 ? 0.7882 0.7591 0.6632 -0.0520 0.0413  0.0845  110  SER A N   
887  C CA  . SER A 110 ? 0.7893 0.7425 0.6600 -0.0602 0.0386  0.0863  110  SER A CA  
888  C C   . SER A 110 ? 0.7492 0.6980 0.6296 -0.0567 0.0343  0.0806  110  SER A C   
889  O O   . SER A 110 ? 0.6412 0.6049 0.5336 -0.0517 0.0343  0.0764  110  SER A O   
890  C CB  . SER A 110 ? 0.7244 0.6842 0.5941 -0.0743 0.0421  0.0921  110  SER A CB  
891  O OG  . SER A 110 ? 0.7719 0.7542 0.6557 -0.0772 0.0442  0.0908  110  SER A OG  
892  N N   . PRO A 111 ? 0.6630 0.5907 0.5371 -0.0591 0.0306  0.0805  111  PRO A N   
893  C CA  . PRO A 111 ? 0.6254 0.5464 0.5063 -0.0543 0.0264  0.0752  111  PRO A CA  
894  C C   . PRO A 111 ? 0.6540 0.5911 0.5489 -0.0577 0.0271  0.0727  111  PRO A C   
895  O O   . PRO A 111 ? 0.6483 0.5897 0.5441 -0.0681 0.0287  0.0755  111  PRO A O   
896  C CB  . PRO A 111 ? 0.5837 0.4800 0.4529 -0.0587 0.0236  0.0771  111  PRO A CB  
897  C CG  . PRO A 111 ? 0.6191 0.5060 0.4737 -0.0618 0.0255  0.0829  111  PRO A CG  
898  C CD  . PRO A 111 ? 0.6501 0.5592 0.5097 -0.0670 0.0306  0.0858  111  PRO A CD  
899  N N   . THR A 112 ? 0.5823 0.5280 0.4875 -0.0492 0.0255  0.0675  112  THR A N   
900  C CA  . THR A 112 ? 0.5207 0.4819 0.4390 -0.0506 0.0259  0.0650  112  THR A CA  
901  C C   . THR A 112 ? 0.4999 0.4514 0.4223 -0.0487 0.0219  0.0610  112  THR A C   
902  O O   . THR A 112 ? 0.5598 0.4996 0.4797 -0.0413 0.0189  0.0585  112  THR A O   
903  C CB  . THR A 112 ? 0.5667 0.5446 0.4931 -0.0418 0.0270  0.0621  112  THR A CB  
904  O OG1 . THR A 112 ? 0.6040 0.5887 0.5247 -0.0410 0.0305  0.0651  112  THR A OG1 
905  C CG2 . THR A 112 ? 0.5444 0.5404 0.4833 -0.0434 0.0281  0.0605  112  THR A CG2 
906  N N   . PRO A 113 ? 0.5159 0.4735 0.4448 -0.0552 0.0219  0.0606  113  PRO A N   
907  C CA  . PRO A 113 ? 0.4772 0.4283 0.4105 -0.0538 0.0186  0.0569  113  PRO A CA  
908  C C   . PRO A 113 ? 0.5156 0.4718 0.4569 -0.0432 0.0169  0.0525  113  PRO A C   
909  O O   . PRO A 113 ? 0.4602 0.4312 0.4077 -0.0392 0.0185  0.0518  113  PRO A O   
910  C CB  . PRO A 113 ? 0.4653 0.4302 0.4062 -0.0619 0.0198  0.0575  113  PRO A CB  
911  C CG  . PRO A 113 ? 0.5265 0.4946 0.4613 -0.0717 0.0228  0.0629  113  PRO A CG  
912  C CD  . PRO A 113 ? 0.5458 0.5173 0.4773 -0.0651 0.0250  0.0643  113  PRO A CD  
913  N N   . VAL A 114 ? 0.5224 0.4665 0.4630 -0.0389 0.0137  0.0497  114  VAL A N   
914  C CA  . VAL A 114 ? 0.4987 0.4451 0.4454 -0.0296 0.0116  0.0460  114  VAL A CA  
915  C C   . VAL A 114 ? 0.4549 0.4059 0.4103 -0.0300 0.0103  0.0432  114  VAL A C   
916  O O   . VAL A 114 ? 0.4463 0.3901 0.3994 -0.0349 0.0096  0.0433  114  VAL A O   
917  C CB  . VAL A 114 ? 0.4083 0.3385 0.3475 -0.0241 0.0089  0.0454  114  VAL A CB  
918  C CG1 . VAL A 114 ? 0.4774 0.4108 0.4235 -0.0156 0.0063  0.0418  114  VAL A CG1 
919  C CG2 . VAL A 114 ? 0.3244 0.2492 0.2538 -0.0239 0.0101  0.0485  114  VAL A CG2 
920  N N   . LEU A 115 ? 0.4278 0.3903 0.3922 -0.0250 0.0099  0.0408  115  LEU A N   
921  C CA  . LEU A 115 ? 0.4031 0.3692 0.3753 -0.0238 0.0083  0.0381  115  LEU A CA  
922  C C   . LEU A 115 ? 0.4297 0.3911 0.4038 -0.0162 0.0056  0.0356  115  LEU A C   
923  O O   . LEU A 115 ? 0.4544 0.4180 0.4285 -0.0113 0.0052  0.0351  115  LEU A O   
924  C CB  . LEU A 115 ? 0.3886 0.3714 0.3694 -0.0238 0.0096  0.0377  115  LEU A CB  
925  C CG  . LEU A 115 ? 0.5393 0.5307 0.5211 -0.0320 0.0118  0.0401  115  LEU A CG  
926  C CD1 . LEU A 115 ? 0.4360 0.4455 0.4265 -0.0309 0.0131  0.0399  115  LEU A CD1 
927  C CD2 . LEU A 115 ? 0.6576 0.6413 0.6383 -0.0370 0.0102  0.0395  115  LEU A CD2 
928  N N   . ILE A 116 ? 0.4358 0.3910 0.4112 -0.0155 0.0038  0.0340  116  ILE A N   
929  C CA  . ILE A 116 ? 0.3776 0.3306 0.3561 -0.0091 0.0013  0.0319  116  ILE A CA  
930  C C   . ILE A 116 ? 0.3874 0.3473 0.3744 -0.0086 0.0005  0.0300  116  ILE A C   
931  O O   . ILE A 116 ? 0.3672 0.3255 0.3546 -0.0119 0.0008  0.0298  116  ILE A O   
932  C CB  . ILE A 116 ? 0.4854 0.4255 0.4577 -0.0071 -0.0002 0.0319  116  ILE A CB  
933  C CG1 . ILE A 116 ? 0.4601 0.3915 0.4226 -0.0075 0.0004  0.0342  116  ILE A CG1 
934  C CG2 . ILE A 116 ? 0.3697 0.3104 0.3464 -0.0007 -0.0028 0.0301  116  ILE A CG2 
935  C CD1 . ILE A 116 ? 0.3887 0.3081 0.3453 -0.0038 -0.0014 0.0341  116  ILE A CD1 
936  N N   . TRP A 117 ? 0.3401 0.3068 0.3328 -0.0047 -0.0006 0.0288  117  TRP A N   
937  C CA  . TRP A 117 ? 0.3614 0.3345 0.3616 -0.0041 -0.0014 0.0275  117  TRP A CA  
938  C C   . TRP A 117 ? 0.4111 0.3808 0.4139 -0.0011 -0.0037 0.0263  117  TRP A C   
939  O O   . TRP A 117 ? 0.3930 0.3601 0.3952 0.0026  -0.0055 0.0259  117  TRP A O   
940  C CB  . TRP A 117 ? 0.3308 0.3116 0.3348 -0.0015 -0.0017 0.0269  117  TRP A CB  
941  C CG  . TRP A 117 ? 0.3290 0.3148 0.3396 -0.0006 -0.0028 0.0259  117  TRP A CG  
942  C CD1 . TRP A 117 ? 0.4028 0.3879 0.4163 0.0028  -0.0053 0.0248  117  TRP A CD1 
943  C CD2 . TRP A 117 ? 0.3503 0.3421 0.3647 -0.0035 -0.0019 0.0262  117  TRP A CD2 
944  N NE1 . TRP A 117 ? 0.3744 0.3640 0.3929 0.0022  -0.0057 0.0246  117  TRP A NE1 
945  C CE2 . TRP A 117 ? 0.3001 0.2942 0.3193 -0.0012 -0.0036 0.0254  117  TRP A CE2 
946  C CE3 . TRP A 117 ? 0.3642 0.3599 0.3781 -0.0083 0.0000  0.0272  117  TRP A CE3 
947  C CZ2 . TRP A 117 ? 0.3255 0.3254 0.3487 -0.0028 -0.0034 0.0256  117  TRP A CZ2 
948  C CZ3 . TRP A 117 ? 0.3451 0.3473 0.3635 -0.0100 -0.0001 0.0271  117  TRP A CZ3 
949  C CH2 . TRP A 117 ? 0.3278 0.3320 0.3506 -0.0069 -0.0017 0.0263  117  TRP A CH2 
950  N N   . ILE A 118 ? 0.3752 0.3460 0.3811 -0.0026 -0.0036 0.0258  118  ILE A N   
951  C CA  . ILE A 118 ? 0.2893 0.2602 0.2991 0.0002  -0.0053 0.0250  118  ILE A CA  
952  C C   . ILE A 118 ? 0.3255 0.3036 0.3419 -0.0003 -0.0057 0.0246  118  ILE A C   
953  O O   . ILE A 118 ? 0.3921 0.3728 0.4096 -0.0030 -0.0046 0.0246  118  ILE A O   
954  C CB  . ILE A 118 ? 0.2894 0.2543 0.2959 0.0001  -0.0047 0.0247  118  ILE A CB  
955  C CG1 . ILE A 118 ? 0.2935 0.2492 0.2919 0.0008  -0.0045 0.0254  118  ILE A CG1 
956  C CG2 . ILE A 118 ? 0.3392 0.3063 0.3501 0.0036  -0.0061 0.0242  118  ILE A CG2 
957  C CD1 . ILE A 118 ? 0.3335 0.2809 0.3261 0.0005  -0.0037 0.0250  118  ILE A CD1 
958  N N   . TYR A 119 ? 0.3893 0.3698 0.4093 0.0020  -0.0077 0.0243  119  TYR A N   
959  C CA  . TYR A 119 ? 0.3098 0.2954 0.3347 0.0016  -0.0084 0.0243  119  TYR A CA  
960  C C   . TYR A 119 ? 0.3232 0.3107 0.3515 0.0006  -0.0083 0.0246  119  TYR A C   
961  O O   . TYR A 119 ? 0.3137 0.2993 0.3415 0.0015  -0.0082 0.0245  119  TYR A O   
962  C CB  . TYR A 119 ? 0.3068 0.2920 0.3331 0.0039  -0.0109 0.0240  119  TYR A CB  
963  C CG  . TYR A 119 ? 0.2742 0.2573 0.3015 0.0051  -0.0132 0.0239  119  TYR A CG  
964  C CD1 . TYR A 119 ? 0.2949 0.2808 0.3267 0.0043  -0.0139 0.0245  119  TYR A CD1 
965  C CD2 . TYR A 119 ? 0.3039 0.2834 0.3276 0.0071  -0.0145 0.0234  119  TYR A CD2 
966  C CE1 . TYR A 119 ? 0.3432 0.3298 0.3769 0.0054  -0.0160 0.0247  119  TYR A CE1 
967  C CE2 . TYR A 119 ? 0.3447 0.3237 0.3696 0.0083  -0.0169 0.0235  119  TYR A CE2 
968  C CZ  . TYR A 119 ? 0.3967 0.3799 0.4271 0.0074  -0.0177 0.0242  119  TYR A CZ  
969  O OH  . TYR A 119 ? 0.3444 0.3294 0.3767 0.0085  -0.0201 0.0245  119  TYR A OH  
970  N N   . GLY A 120 ? 0.2230 0.2148 0.2542 -0.0007 -0.0081 0.0249  120  GLY A N   
971  C CA  . GLY A 120 ? 0.2564 0.2508 0.2907 -0.0016 -0.0081 0.0255  120  GLY A CA  
972  C C   . GLY A 120 ? 0.2989 0.2946 0.3370 -0.0008 -0.0103 0.0263  120  GLY A C   
973  O O   . GLY A 120 ? 0.2828 0.2761 0.3206 0.0004  -0.0122 0.0260  120  GLY A O   
974  N N   . GLY A 121 ? 0.3106 0.3097 0.3516 -0.0021 -0.0102 0.0273  121  GLY A N   
975  C CA  . GLY A 121 ? 0.2684 0.2688 0.3128 -0.0028 -0.0121 0.0287  121  GLY A CA  
976  C C   . GLY A 121 ? 0.3458 0.3506 0.3931 -0.0035 -0.0112 0.0297  121  GLY A C   
977  O O   . GLY A 121 ? 0.3404 0.3475 0.3910 -0.0042 -0.0127 0.0309  121  GLY A O   
978  N N   . GLY A 122 ? 0.2955 0.3020 0.3413 -0.0035 -0.0087 0.0293  122  GLY A N   
979  C CA  . GLY A 122 ? 0.2873 0.2987 0.3350 -0.0034 -0.0073 0.0302  122  GLY A CA  
980  C C   . GLY A 122 ? 0.4004 0.4141 0.4497 -0.0011 -0.0071 0.0300  122  GLY A C   
981  O O   . GLY A 122 ? 0.3828 0.4029 0.4351 -0.0008 -0.0061 0.0312  122  GLY A O   
982  N N   . PHE A 123 ? 0.3869 0.3962 0.4341 0.0007  -0.0080 0.0287  123  PHE A N   
983  C CA  . PHE A 123 ? 0.3196 0.3310 0.3682 0.0036  -0.0084 0.0287  123  PHE A CA  
984  C C   . PHE A 123 ? 0.3391 0.3573 0.3941 0.0020  -0.0108 0.0306  123  PHE A C   
985  O O   . PHE A 123 ? 0.3559 0.3792 0.4138 0.0041  -0.0114 0.0311  123  PHE A O   
986  C CB  . PHE A 123 ? 0.3250 0.3386 0.3718 0.0067  -0.0057 0.0281  123  PHE A CB  
987  C CG  . PHE A 123 ? 0.3124 0.3173 0.3515 0.0081  -0.0041 0.0261  123  PHE A CG  
988  C CD1 . PHE A 123 ? 0.3319 0.3297 0.3666 0.0101  -0.0048 0.0250  123  PHE A CD1 
989  C CD2 . PHE A 123 ? 0.3180 0.3213 0.3536 0.0068  -0.0021 0.0253  123  PHE A CD2 
990  C CE1 . PHE A 123 ? 0.3343 0.3229 0.3611 0.0103  -0.0035 0.0235  123  PHE A CE1 
991  C CE2 . PHE A 123 ? 0.3065 0.3010 0.3343 0.0069  -0.0011 0.0234  123  PHE A CE2 
992  C CZ  . PHE A 123 ? 0.3630 0.3498 0.3864 0.0084  -0.0018 0.0226  123  PHE A CZ  
993  N N   . TYR A 124 ? 0.2763 0.2943 0.3332 -0.0017 -0.0124 0.0318  124  TYR A N   
994  C CA  . TYR A 124 ? 0.3868 0.4090 0.4486 -0.0045 -0.0152 0.0337  124  TYR A CA  
995  C C   . TYR A 124 ? 0.3743 0.3889 0.4339 -0.0062 -0.0187 0.0331  124  TYR A C   
996  O O   . TYR A 124 ? 0.3603 0.3756 0.4222 -0.0092 -0.0217 0.0344  124  TYR A O   
997  C CB  . TYR A 124 ? 0.4205 0.4488 0.4859 -0.0079 -0.0144 0.0364  124  TYR A CB  
998  C CG  . TYR A 124 ? 0.4148 0.4370 0.4772 -0.0102 -0.0147 0.0368  124  TYR A CG  
999  C CD1 . TYR A 124 ? 0.4320 0.4485 0.4936 -0.0129 -0.0181 0.0375  124  TYR A CD1 
1000 C CD2 . TYR A 124 ? 0.3981 0.4198 0.4578 -0.0092 -0.0119 0.0364  124  TYR A CD2 
1001 C CE1 . TYR A 124 ? 0.3850 0.3955 0.4432 -0.0137 -0.0185 0.0379  124  TYR A CE1 
1002 C CE2 . TYR A 124 ? 0.4008 0.4179 0.4578 -0.0106 -0.0125 0.0369  124  TYR A CE2 
1003 C CZ  . TYR A 124 ? 0.4157 0.4275 0.4722 -0.0125 -0.0157 0.0378  124  TYR A CZ  
1004 O OH  . TYR A 124 ? 0.4589 0.4658 0.5122 -0.0127 -0.0164 0.0384  124  TYR A OH  
1005 N N   . SER A 125 ? 0.3411 0.3486 0.3956 -0.0043 -0.0181 0.0312  125  SER A N   
1006 C CA  . SER A 125 ? 0.2892 0.2897 0.3406 -0.0046 -0.0209 0.0303  125  SER A CA  
1007 C C   . SER A 125 ? 0.3321 0.3277 0.3785 -0.0016 -0.0196 0.0282  125  SER A C   
1008 O O   . SER A 125 ? 0.2990 0.2957 0.3441 -0.0002 -0.0168 0.0277  125  SER A O   
1009 C CB  . SER A 125 ? 0.3362 0.3337 0.3869 -0.0068 -0.0218 0.0314  125  SER A CB  
1010 O OG  . SER A 125 ? 0.3538 0.3522 0.4033 -0.0060 -0.0189 0.0314  125  SER A OG  
1011 N N   . GLY A 126 ? 0.3860 0.3758 0.4289 -0.0008 -0.0217 0.0272  126  GLY A N   
1012 C CA  . GLY A 126 ? 0.3256 0.3119 0.3636 0.0018  -0.0204 0.0256  126  GLY A CA  
1013 C C   . GLY A 126 ? 0.3686 0.3513 0.4033 0.0036  -0.0223 0.0243  126  GLY A C   
1014 O O   . GLY A 126 ? 0.3311 0.3150 0.3677 0.0031  -0.0246 0.0246  126  GLY A O   
1015 N N   . ALA A 127 ? 0.2762 0.2557 0.3061 0.0058  -0.0214 0.0231  127  ALA A N   
1016 C CA  . ALA A 127 ? 0.3250 0.3004 0.3502 0.0079  -0.0231 0.0219  127  ALA A CA  
1017 C C   . ALA A 127 ? 0.3736 0.3481 0.3941 0.0100  -0.0203 0.0213  127  ALA A C   
1018 O O   . ALA A 127 ? 0.2924 0.2689 0.3131 0.0101  -0.0183 0.0214  127  ALA A O   
1019 C CB  . ALA A 127 ? 0.3128 0.2832 0.3357 0.0081  -0.0270 0.0209  127  ALA A CB  
1020 N N   . ALA A 128 ? 0.3763 0.3486 0.3925 0.0115  -0.0201 0.0209  128  ALA A N   
1021 C CA  . ALA A 128 ? 0.3975 0.3697 0.4090 0.0128  -0.0172 0.0209  128  ALA A CA  
1022 C C   . ALA A 128 ? 0.4112 0.3812 0.4182 0.0157  -0.0181 0.0194  128  ALA A C   
1023 O O   . ALA A 128 ? 0.4098 0.3815 0.4131 0.0171  -0.0155 0.0195  128  ALA A O   
1024 C CB  . ALA A 128 ? 0.3437 0.3137 0.3514 0.0132  -0.0165 0.0215  128  ALA A CB  
1025 N N   . SER A 129 ? 0.4064 0.3725 0.4130 0.0165  -0.0218 0.0182  129  SER A N   
1026 C CA  . SER A 129 ? 0.4051 0.3669 0.4054 0.0201  -0.0230 0.0164  129  SER A CA  
1027 C C   . SER A 129 ? 0.3751 0.3376 0.3759 0.0217  -0.0223 0.0160  129  SER A C   
1028 O O   . SER A 129 ? 0.4358 0.3938 0.4308 0.0257  -0.0234 0.0142  129  SER A O   
1029 C CB  . SER A 129 ? 0.4341 0.3889 0.4312 0.0202  -0.0281 0.0148  129  SER A CB  
1030 O OG  . SER A 129 ? 0.4456 0.4000 0.4482 0.0167  -0.0309 0.0156  129  SER A OG  
1031 N N   . LEU A 130 ? 0.3091 0.2763 0.3161 0.0193  -0.0208 0.0175  130  LEU A N   
1032 C CA  . LEU A 130 ? 0.3547 0.3223 0.3619 0.0214  -0.0206 0.0174  130  LEU A CA  
1033 C C   . LEU A 130 ? 0.3577 0.3302 0.3617 0.0256  -0.0174 0.0170  130  LEU A C   
1034 O O   . LEU A 130 ? 0.3580 0.3364 0.3623 0.0247  -0.0142 0.0178  130  LEU A O   
1035 C CB  . LEU A 130 ? 0.3664 0.3390 0.3804 0.0180  -0.0195 0.0193  130  LEU A CB  
1036 C CG  . LEU A 130 ? 0.4398 0.4112 0.4583 0.0136  -0.0215 0.0204  130  LEU A CG  
1037 C CD1 . LEU A 130 ? 0.3326 0.3088 0.3560 0.0114  -0.0201 0.0221  130  LEU A CD1 
1038 C CD2 . LEU A 130 ? 0.4649 0.4278 0.4807 0.0133  -0.0262 0.0196  130  LEU A CD2 
1039 N N   . ASP A 131 ? 0.4558 0.4261 0.4566 0.0301  -0.0181 0.0159  131  ASP A N   
1040 C CA  . ASP A 131 ? 0.4218 0.3989 0.4201 0.0350  -0.0149 0.0157  131  ASP A CA  
1041 C C   . ASP A 131 ? 0.4118 0.4018 0.4166 0.0322  -0.0109 0.0179  131  ASP A C   
1042 O O   . ASP A 131 ? 0.5105 0.5079 0.5142 0.0333  -0.0077 0.0183  131  ASP A O   
1043 C CB  . ASP A 131 ? 0.4839 0.4566 0.4780 0.0412  -0.0165 0.0143  131  ASP A CB  
1044 C CG  . ASP A 131 ? 0.5545 0.5137 0.5395 0.0447  -0.0201 0.0116  131  ASP A CG  
1045 O OD1 . ASP A 131 ? 0.5638 0.5193 0.5461 0.0428  -0.0211 0.0107  131  ASP A OD1 
1046 O OD2 . ASP A 131 ? 0.6913 0.6429 0.6711 0.0495  -0.0224 0.0102  131  ASP A OD2 
1047 N N   . VAL A 132 ? 0.3650 0.3576 0.3758 0.0281  -0.0112 0.0194  132  VAL A N   
1048 C CA  . VAL A 132 ? 0.4225 0.4266 0.4385 0.0251  -0.0080 0.0213  132  VAL A CA  
1049 C C   . VAL A 132 ? 0.4368 0.4433 0.4531 0.0203  -0.0058 0.0222  132  VAL A C   
1050 O O   . VAL A 132 ? 0.4451 0.4604 0.4644 0.0171  -0.0032 0.0237  132  VAL A O   
1051 C CB  . VAL A 132 ? 0.4646 0.4706 0.4859 0.0217  -0.0088 0.0226  132  VAL A CB  
1052 C CG1 . VAL A 132 ? 0.5661 0.5765 0.5881 0.0260  -0.0091 0.0229  132  VAL A CG1 
1053 C CG2 . VAL A 132 ? 0.4261 0.4228 0.4478 0.0192  -0.0117 0.0223  132  VAL A CG2 
1054 N N   . TYR A 133 ? 0.3750 0.3735 0.3881 0.0196  -0.0071 0.0214  133  TYR A N   
1055 C CA  . TYR A 133 ? 0.4133 0.4120 0.4254 0.0157  -0.0053 0.0224  133  TYR A CA  
1056 C C   . TYR A 133 ? 0.4141 0.4119 0.4200 0.0184  -0.0041 0.0220  133  TYR A C   
1057 O O   . TYR A 133 ? 0.3410 0.3355 0.3440 0.0162  -0.0036 0.0227  133  TYR A O   
1058 C CB  . TYR A 133 ? 0.2602 0.2514 0.2730 0.0131  -0.0075 0.0223  133  TYR A CB  
1059 C CG  . TYR A 133 ? 0.3062 0.2977 0.3244 0.0109  -0.0088 0.0226  133  TYR A CG  
1060 C CD1 . TYR A 133 ? 0.3358 0.3339 0.3576 0.0089  -0.0072 0.0236  133  TYR A CD1 
1061 C CD2 . TYR A 133 ? 0.2920 0.2781 0.3116 0.0104  -0.0116 0.0222  133  TYR A CD2 
1062 C CE1 . TYR A 133 ? 0.3440 0.3424 0.3697 0.0071  -0.0082 0.0240  133  TYR A CE1 
1063 C CE2 . TYR A 133 ? 0.2650 0.2524 0.2892 0.0083  -0.0123 0.0229  133  TYR A CE2 
1064 C CZ  . TYR A 133 ? 0.3193 0.3123 0.3461 0.0068  -0.0105 0.0238  133  TYR A CZ  
1065 O OH  . TYR A 133 ? 0.3088 0.3033 0.3393 0.0049  -0.0109 0.0245  133  TYR A OH  
1066 N N   . ASP A 134 ? 0.3783 0.3784 0.3815 0.0236  -0.0039 0.0209  134  ASP A N   
1067 C CA  . ASP A 134 ? 0.3956 0.3961 0.3923 0.0271  -0.0023 0.0204  134  ASP A CA  
1068 C C   . ASP A 134 ? 0.4208 0.4305 0.4176 0.0237  0.0020  0.0229  134  ASP A C   
1069 O O   . ASP A 134 ? 0.4133 0.4344 0.4139 0.0230  0.0046  0.0242  134  ASP A O   
1070 C CB  . ASP A 134 ? 0.3875 0.3892 0.3813 0.0343  -0.0027 0.0185  134  ASP A CB  
1071 C CG  . ASP A 134 ? 0.5098 0.5103 0.4953 0.0393  -0.0016 0.0173  134  ASP A CG  
1072 O OD1 . ASP A 134 ? 0.5441 0.5450 0.5266 0.0369  0.0001  0.0185  134  ASP A OD1 
1073 O OD2 . ASP A 134 ? 0.5821 0.5804 0.5630 0.0461  -0.0024 0.0152  134  ASP A OD2 
1074 N N   . GLY A 135 ? 0.4050 0.4099 0.3971 0.0214  0.0025  0.0237  135  GLY A N   
1075 C CA  . GLY A 135 ? 0.3706 0.3815 0.3613 0.0171  0.0062  0.0265  135  GLY A CA  
1076 C C   . GLY A 135 ? 0.4001 0.4195 0.3867 0.0201  0.0097  0.0273  135  GLY A C   
1077 O O   . GLY A 135 ? 0.3800 0.4057 0.3656 0.0157  0.0130  0.0301  135  GLY A O   
1078 N N   . ARG A 136 ? 0.4057 0.4255 0.3894 0.0276  0.0090  0.0249  136  ARG A N   
1079 C CA  . ARG A 136 ? 0.5002 0.5283 0.4788 0.0316  0.0126  0.0255  136  ARG A CA  
1080 C C   . ARG A 136 ? 0.5272 0.5732 0.5111 0.0290  0.0172  0.0284  136  ARG A C   
1081 O O   . ARG A 136 ? 0.4811 0.5354 0.4617 0.0282  0.0211  0.0306  136  ARG A O   
1082 C CB  . ARG A 136 ? 0.4164 0.4405 0.3895 0.0411  0.0110  0.0219  136  ARG A CB  
1083 C CG  . ARG A 136 ? 0.3839 0.4145 0.3612 0.0461  0.0109  0.0206  136  ARG A CG  
1084 C CD  . ARG A 136 ? 0.4399 0.4626 0.4091 0.0559  0.0088  0.0167  136  ARG A CD  
1085 N NE  . ARG A 136 ? 0.5545 0.5600 0.5206 0.0552  0.0033  0.0143  136  ARG A NE  
1086 C CZ  . ARG A 136 ? 0.5580 0.5516 0.5152 0.0610  0.0001  0.0108  136  ARG A CZ  
1087 N NH1 . ARG A 136 ? 0.5353 0.5154 0.4914 0.0586  -0.0051 0.0092  136  ARG A NH1 
1088 N NH2 . ARG A 136 ? 0.4757 0.4712 0.4247 0.0690  0.0020  0.0090  136  ARG A NH2 
1089 N N   . PHE A 137 ? 0.4361 0.4887 0.4281 0.0271  0.0167  0.0287  137  PHE A N   
1090 C CA  . PHE A 137 ? 0.4142 0.4854 0.4121 0.0252  0.0204  0.0313  137  PHE A CA  
1091 C C   . PHE A 137 ? 0.4285 0.5041 0.4281 0.0146  0.0226  0.0350  137  PHE A C   
1092 O O   . PHE A 137 ? 0.4794 0.5688 0.4794 0.0120  0.0265  0.0379  137  PHE A O   
1093 C CB  . PHE A 137 ? 0.3849 0.4613 0.3901 0.0272  0.0186  0.0303  137  PHE A CB  
1094 C CG  . PHE A 137 ? 0.4165 0.4854 0.4187 0.0370  0.0159  0.0267  137  PHE A CG  
1095 C CD1 . PHE A 137 ? 0.4863 0.5621 0.4848 0.0460  0.0179  0.0256  137  PHE A CD1 
1096 C CD2 . PHE A 137 ? 0.4064 0.4608 0.4086 0.0371  0.0115  0.0247  137  PHE A CD2 
1097 C CE1 . PHE A 137 ? 0.5070 0.5731 0.5008 0.0551  0.0150  0.0221  137  PHE A CE1 
1098 C CE2 . PHE A 137 ? 0.4198 0.4654 0.4180 0.0450  0.0087  0.0216  137  PHE A CE2 
1099 C CZ  . PHE A 137 ? 0.4309 0.4812 0.4244 0.0540  0.0102  0.0203  137  PHE A CZ  
1100 N N   . LEU A 138 ? 0.3422 0.4062 0.3425 0.0086  0.0199  0.0350  138  LEU A N   
1101 C CA  . LEU A 138 ? 0.4273 0.4904 0.4269 -0.0012 0.0211  0.0381  138  LEU A CA  
1102 C C   . LEU A 138 ? 0.4685 0.5280 0.4598 -0.0025 0.0235  0.0401  138  LEU A C   
1103 O O   . LEU A 138 ? 0.4341 0.5012 0.4245 -0.0094 0.0265  0.0437  138  LEU A O   
1104 C CB  . LEU A 138 ? 0.3978 0.4462 0.3978 -0.0050 0.0175  0.0369  138  LEU A CB  
1105 C CG  . LEU A 138 ? 0.3939 0.4473 0.4017 -0.0068 0.0159  0.0362  138  LEU A CG  
1106 C CD1 . LEU A 138 ? 0.3516 0.3911 0.3595 -0.0074 0.0124  0.0342  138  LEU A CD1 
1107 C CD2 . LEU A 138 ? 0.3812 0.4453 0.3919 -0.0156 0.0179  0.0392  138  LEU A CD2 
1108 N N   . ALA A 139 ? 0.4008 0.4484 0.3857 0.0033  0.0218  0.0380  139  ALA A N   
1109 C CA  . ALA A 139 ? 0.4553 0.4990 0.4312 0.0036  0.0237  0.0396  139  ALA A CA  
1110 C C   . ALA A 139 ? 0.4797 0.5402 0.4548 0.0060  0.0284  0.0414  139  ALA A C   
1111 O O   . ALA A 139 ? 0.4635 0.5292 0.4352 0.0005  0.0318  0.0453  139  ALA A O   
1112 C CB  . ALA A 139 ? 0.4139 0.4438 0.3837 0.0104  0.0205  0.0365  139  ALA A CB  
1113 N N   . GLN A 140 ? 0.4515 0.5204 0.4294 0.0143  0.0287  0.0389  140  GLN A N   
1114 C CA  . GLN A 140 ? 0.4593 0.5450 0.4360 0.0185  0.0334  0.0402  140  GLN A CA  
1115 C C   . GLN A 140 ? 0.4852 0.5905 0.4695 0.0114  0.0371  0.0443  140  GLN A C   
1116 O O   . GLN A 140 ? 0.5005 0.6164 0.4823 0.0081  0.0413  0.0479  140  GLN A O   
1117 C CB  . GLN A 140 ? 0.3439 0.4322 0.3202 0.0304  0.0326  0.0362  140  GLN A CB  
1118 C CG  . GLN A 140 ? 0.3790 0.4771 0.3489 0.0374  0.0367  0.0364  140  GLN A CG  
1119 C CD  . GLN A 140 ? 0.4922 0.6154 0.4685 0.0356  0.0422  0.0401  140  GLN A CD  
1120 O OE1 . GLN A 140 ? 0.5080 0.6417 0.4940 0.0333  0.0418  0.0408  140  GLN A OE1 
1121 N NE2 . GLN A 140 ? 0.4720 0.6057 0.4430 0.0362  0.0471  0.0428  140  GLN A NE2 
1122 N N   . VAL A 141 ? 0.4895 0.6000 0.4828 0.0086  0.0353  0.0440  141  VAL A N   
1123 C CA  . VAL A 141 ? 0.4483 0.5800 0.4496 0.0026  0.0384  0.0475  141  VAL A CA  
1124 C C   . VAL A 141 ? 0.4707 0.5997 0.4718 -0.0110 0.0387  0.0514  141  VAL A C   
1125 O O   . VAL A 141 ? 0.4741 0.6183 0.4767 -0.0174 0.0424  0.0556  141  VAL A O   
1126 C CB  . VAL A 141 ? 0.4432 0.5826 0.4537 0.0056  0.0361  0.0456  141  VAL A CB  
1127 C CG1 . VAL A 141 ? 0.4158 0.5780 0.4351 -0.0013 0.0386  0.0494  141  VAL A CG1 
1128 C CG2 . VAL A 141 ? 0.3996 0.5408 0.4090 0.0193  0.0358  0.0420  141  VAL A CG2 
1129 N N   . GLU A 142 ? 0.4441 0.5536 0.4426 -0.0154 0.0349  0.0502  142  GLU A N   
1130 C CA  . GLU A 142 ? 0.3807 0.4843 0.3773 -0.0278 0.0347  0.0534  142  GLU A CA  
1131 C C   . GLU A 142 ? 0.4108 0.4988 0.3965 -0.0308 0.0352  0.0552  142  GLU A C   
1132 O O   . GLU A 142 ? 0.4956 0.5761 0.4773 -0.0408 0.0351  0.0582  142  GLU A O   
1133 C CB  . GLU A 142 ? 0.3255 0.4185 0.3256 -0.0314 0.0305  0.0514  142  GLU A CB  
1134 C CG  . GLU A 142 ? 0.4142 0.5231 0.4246 -0.0315 0.0299  0.0508  142  GLU A CG  
1135 C CD  . GLU A 142 ? 0.5533 0.6826 0.5681 -0.0399 0.0330  0.0551  142  GLU A CD  
1136 O OE1 . GLU A 142 ? 0.5958 0.7213 0.6054 -0.0496 0.0343  0.0586  142  GLU A OE1 
1137 O OE2 . GLU A 142 ? 0.6001 0.7494 0.6231 -0.0369 0.0341  0.0553  142  GLU A OE2 
1138 N N   . GLY A 143 ? 0.4466 0.5289 0.4264 -0.0221 0.0356  0.0535  143  GLY A N   
1139 C CA  . GLY A 143 ? 0.4592 0.5263 0.4281 -0.0237 0.0356  0.0550  143  GLY A CA  
1140 C C   . GLY A 143 ? 0.5216 0.5666 0.4865 -0.0256 0.0312  0.0534  143  GLY A C   
1141 O O   . GLY A 143 ? 0.5901 0.6220 0.5460 -0.0288 0.0310  0.0555  143  GLY A O   
1142 N N   . ALA A 144 ? 0.5144 0.5556 0.4857 -0.0233 0.0278  0.0500  144  ALA A N   
1143 C CA  . ALA A 144 ? 0.5139 0.5362 0.4824 -0.0246 0.0239  0.0484  144  ALA A CA  
1144 C C   . ALA A 144 ? 0.5112 0.5197 0.4732 -0.0173 0.0214  0.0463  144  ALA A C   
1145 O O   . ALA A 144 ? 0.4742 0.4865 0.4362 -0.0098 0.0214  0.0442  144  ALA A O   
1146 C CB  . ALA A 144 ? 0.4781 0.5019 0.4551 -0.0237 0.0212  0.0455  144  ALA A CB  
1147 N N   . VAL A 145 ? 0.4965 0.4888 0.4528 -0.0193 0.0191  0.0466  145  VAL A N   
1148 C CA  . VAL A 145 ? 0.4537 0.4349 0.4070 -0.0121 0.0157  0.0439  145  VAL A CA  
1149 C C   . VAL A 145 ? 0.4867 0.4656 0.4476 -0.0105 0.0126  0.0407  145  VAL A C   
1150 O O   . VAL A 145 ? 0.5058 0.4802 0.4679 -0.0154 0.0120  0.0413  145  VAL A O   
1151 C CB  . VAL A 145 ? 0.4516 0.4173 0.3944 -0.0133 0.0147  0.0460  145  VAL A CB  
1152 C CG1 . VAL A 145 ? 0.3510 0.3067 0.2924 -0.0059 0.0104  0.0431  145  VAL A CG1 
1153 C CG2 . VAL A 145 ? 0.3762 0.3447 0.3109 -0.0145 0.0179  0.0494  145  VAL A CG2 
1154 N N   . LEU A 146 ? 0.4780 0.4595 0.4434 -0.0039 0.0105  0.0375  146  LEU A N   
1155 C CA  . LEU A 146 ? 0.3977 0.3780 0.3702 -0.0029 0.0079  0.0351  146  LEU A CA  
1156 C C   . LEU A 146 ? 0.4542 0.4248 0.4255 0.0019  0.0040  0.0330  146  LEU A C   
1157 O O   . LEU A 146 ? 0.4027 0.3719 0.3711 0.0068  0.0025  0.0317  146  LEU A O   
1158 C CB  . LEU A 146 ? 0.3633 0.3557 0.3435 -0.0009 0.0084  0.0335  146  LEU A CB  
1159 C CG  . LEU A 146 ? 0.5057 0.4993 0.4933 -0.0028 0.0069  0.0323  146  LEU A CG  
1160 C CD1 . LEU A 146 ? 0.5804 0.5868 0.5735 -0.0054 0.0091  0.0331  146  LEU A CD1 
1161 C CD2 . LEU A 146 ? 0.5596 0.5499 0.5506 0.0026  0.0036  0.0294  146  LEU A CD2 
1162 N N   . VAL A 147 ? 0.4337 0.3982 0.4071 0.0005  0.0022  0.0325  147  VAL A N   
1163 C CA  . VAL A 147 ? 0.4538 0.4118 0.4275 0.0048  -0.0013 0.0308  147  VAL A CA  
1164 C C   . VAL A 147 ? 0.4209 0.3820 0.4030 0.0053  -0.0031 0.0289  147  VAL A C   
1165 O O   . VAL A 147 ? 0.3755 0.3384 0.3607 0.0018  -0.0018 0.0292  147  VAL A O   
1166 C CB  . VAL A 147 ? 0.5241 0.4712 0.4910 0.0043  -0.0020 0.0323  147  VAL A CB  
1167 C CG1 . VAL A 147 ? 0.3507 0.2937 0.3189 0.0095  -0.0059 0.0308  147  VAL A CG1 
1168 C CG2 . VAL A 147 ? 0.3273 0.2704 0.2847 0.0030  -0.0001 0.0350  147  VAL A CG2 
1169 N N   . SER A 148 ? 0.2986 0.2600 0.2837 0.0092  -0.0061 0.0270  148  SER A N   
1170 C CA  . SER A 148 ? 0.3516 0.3151 0.3440 0.0093  -0.0078 0.0258  148  SER A CA  
1171 C C   . SER A 148 ? 0.3752 0.3353 0.3683 0.0125  -0.0114 0.0250  148  SER A C   
1172 O O   . SER A 148 ? 0.3990 0.3570 0.3883 0.0151  -0.0134 0.0245  148  SER A O   
1173 C CB  . SER A 148 ? 0.3763 0.3464 0.3736 0.0097  -0.0079 0.0246  148  SER A CB  
1174 O OG  . SER A 148 ? 0.3887 0.3578 0.3834 0.0132  -0.0098 0.0234  148  SER A OG  
1175 N N   . MET A 149 ? 0.3436 0.3038 0.3408 0.0124  -0.0123 0.0249  149  MET A N   
1176 C CA  . MET A 149 ? 0.3032 0.2629 0.3021 0.0153  -0.0157 0.0245  149  MET A CA  
1177 C C   . MET A 149 ? 0.3173 0.2827 0.3244 0.0146  -0.0174 0.0238  149  MET A C   
1178 O O   . MET A 149 ? 0.3630 0.3312 0.3738 0.0124  -0.0154 0.0239  149  MET A O   
1179 C CB  . MET A 149 ? 0.3077 0.2628 0.3035 0.0170  -0.0155 0.0255  149  MET A CB  
1180 C CG  . MET A 149 ? 0.3074 0.2652 0.3084 0.0160  -0.0143 0.0254  149  MET A CG  
1181 S SD  . MET A 149 ? 0.4055 0.3619 0.4051 0.0114  -0.0104 0.0255  149  MET A SD  
1182 C CE  . MET A 149 ? 0.3517 0.2971 0.3408 0.0112  -0.0089 0.0268  149  MET A CE  
1183 N N   . ASN A 150 ? 0.3315 0.2988 0.3411 0.0160  -0.0210 0.0233  150  ASN A N   
1184 C CA  . ASN A 150 ? 0.3393 0.3125 0.3567 0.0147  -0.0226 0.0233  150  ASN A CA  
1185 C C   . ASN A 150 ? 0.3781 0.3534 0.3975 0.0164  -0.0219 0.0242  150  ASN A C   
1186 O O   . ASN A 150 ? 0.3349 0.3065 0.3495 0.0192  -0.0218 0.0246  150  ASN A O   
1187 C CB  . ASN A 150 ? 0.3316 0.3065 0.3510 0.0146  -0.0271 0.0227  150  ASN A CB  
1188 C CG  . ASN A 150 ? 0.4798 0.4515 0.4969 0.0134  -0.0283 0.0214  150  ASN A CG  
1189 O OD1 . ASN A 150 ? 0.3281 0.2985 0.3438 0.0129  -0.0255 0.0212  150  ASN A OD1 
1190 N ND2 . ASN A 150 ? 0.4910 0.4615 0.5075 0.0131  -0.0326 0.0206  150  ASN A ND2 
1191 N N   . TYR A 151 ? 0.3660 0.3470 0.3916 0.0151  -0.0211 0.0246  151  TYR A N   
1192 C CA  . TYR A 151 ? 0.3214 0.3063 0.3496 0.0176  -0.0205 0.0254  151  TYR A CA  
1193 C C   . TYR A 151 ? 0.3538 0.3481 0.3905 0.0157  -0.0218 0.0261  151  TYR A C   
1194 O O   . TYR A 151 ? 0.2770 0.2726 0.3166 0.0120  -0.0219 0.0261  151  TYR A O   
1195 C CB  . TYR A 151 ? 0.3670 0.3476 0.3915 0.0181  -0.0167 0.0252  151  TYR A CB  
1196 C CG  . TYR A 151 ? 0.3633 0.3451 0.3899 0.0143  -0.0145 0.0250  151  TYR A CG  
1197 C CD1 . TYR A 151 ? 0.3596 0.3375 0.3829 0.0116  -0.0134 0.0246  151  TYR A CD1 
1198 C CD2 . TYR A 151 ? 0.2906 0.2786 0.3223 0.0137  -0.0135 0.0253  151  TYR A CD2 
1199 C CE1 . TYR A 151 ? 0.3102 0.2903 0.3356 0.0085  -0.0117 0.0245  151  TYR A CE1 
1200 C CE2 . TYR A 151 ? 0.2563 0.2453 0.2892 0.0104  -0.0117 0.0252  151  TYR A CE2 
1201 C CZ  . TYR A 151 ? 0.3187 0.3039 0.3487 0.0079  -0.0111 0.0248  151  TYR A CZ  
1202 O OH  . TYR A 151 ? 0.2972 0.2846 0.3288 0.0052  -0.0097 0.0248  151  TYR A OH  
1203 N N   . ARG A 152 ? 0.3333 0.3346 0.3740 0.0183  -0.0227 0.0269  152  ARG A N   
1204 C CA  . ARG A 152 ? 0.3239 0.3362 0.3733 0.0159  -0.0238 0.0282  152  ARG A CA  
1205 C C   . ARG A 152 ? 0.3456 0.3600 0.3972 0.0137  -0.0205 0.0286  152  ARG A C   
1206 O O   . ARG A 152 ? 0.3473 0.3590 0.3956 0.0162  -0.0172 0.0280  152  ARG A O   
1207 C CB  . ARG A 152 ? 0.2762 0.2984 0.3301 0.0196  -0.0252 0.0293  152  ARG A CB  
1208 C CG  . ARG A 152 ? 0.1963 0.2196 0.2500 0.0204  -0.0298 0.0294  152  ARG A CG  
1209 C CD  . ARG A 152 ? 0.3056 0.3391 0.3631 0.0256  -0.0307 0.0305  152  ARG A CD  
1210 N NE  . ARG A 152 ? 0.3183 0.3432 0.3677 0.0321  -0.0283 0.0297  152  ARG A NE  
1211 C CZ  . ARG A 152 ? 0.3463 0.3760 0.3958 0.0388  -0.0282 0.0304  152  ARG A CZ  
1212 N NH1 . ARG A 152 ? 0.2474 0.2930 0.3059 0.0399  -0.0300 0.0319  152  ARG A NH1 
1213 N NH2 . ARG A 152 ? 0.2996 0.3181 0.3397 0.0445  -0.0263 0.0297  152  ARG A NH2 
1214 N N   . VAL A 153 ? 0.2777 0.2959 0.3341 0.0089  -0.0216 0.0295  153  VAL A N   
1215 C CA  . VAL A 153 ? 0.3136 0.3344 0.3720 0.0068  -0.0188 0.0303  153  VAL A CA  
1216 C C   . VAL A 153 ? 0.3564 0.3892 0.4225 0.0047  -0.0193 0.0325  153  VAL A C   
1217 O O   . VAL A 153 ? 0.3458 0.3856 0.4164 0.0044  -0.0221 0.0336  153  VAL A O   
1218 C CB  . VAL A 153 ? 0.3385 0.3529 0.3947 0.0031  -0.0192 0.0299  153  VAL A CB  
1219 C CG1 . VAL A 153 ? 0.3489 0.3543 0.3982 0.0048  -0.0177 0.0281  153  VAL A CG1 
1220 C CG2 . VAL A 153 ? 0.2555 0.2688 0.3133 -0.0003 -0.0235 0.0304  153  VAL A CG2 
1221 N N   . GLY A 154 ? 0.3205 0.3567 0.3884 0.0030  -0.0166 0.0336  154  GLY A N   
1222 C CA  . GLY A 154 ? 0.2855 0.3340 0.3605 0.0005  -0.0164 0.0362  154  GLY A CA  
1223 C C   . GLY A 154 ? 0.2490 0.3087 0.3280 0.0050  -0.0155 0.0369  154  GLY A C   
1224 O O   . GLY A 154 ? 0.3580 0.4147 0.4329 0.0111  -0.0136 0.0351  154  GLY A O   
1225 N N   . THR A 155 ? 0.2391 0.3118 0.3260 0.0020  -0.0171 0.0396  155  THR A N   
1226 C CA  . THR A 155 ? 0.2766 0.3629 0.3686 0.0066  -0.0164 0.0405  155  THR A CA  
1227 C C   . THR A 155 ? 0.3178 0.3994 0.4066 0.0118  -0.0187 0.0386  155  THR A C   
1228 O O   . THR A 155 ? 0.3692 0.4526 0.4559 0.0192  -0.0168 0.0376  155  THR A O   
1229 C CB  . THR A 155 ? 0.2698 0.3729 0.3719 0.0013  -0.0183 0.0442  155  THR A CB  
1230 O OG1 . THR A 155 ? 0.2401 0.3392 0.3433 -0.0047 -0.0237 0.0446  155  THR A OG1 
1231 C CG2 . THR A 155 ? 0.2265 0.3352 0.3312 -0.0033 -0.0155 0.0467  155  THR A CG2 
1232 N N   . PHE A 156 ? 0.2819 0.3562 0.3690 0.0084  -0.0229 0.0379  156  PHE A N   
1233 C CA  . PHE A 156 ? 0.3043 0.3744 0.3879 0.0129  -0.0254 0.0364  156  PHE A CA  
1234 C C   . PHE A 156 ? 0.3690 0.4284 0.4442 0.0197  -0.0224 0.0341  156  PHE A C   
1235 O O   . PHE A 156 ? 0.2593 0.3190 0.3323 0.0258  -0.0232 0.0336  156  PHE A O   
1236 C CB  . PHE A 156 ? 0.3140 0.3751 0.3949 0.0080  -0.0299 0.0356  156  PHE A CB  
1237 C CG  . PHE A 156 ? 0.3351 0.4027 0.4222 0.0003  -0.0332 0.0376  156  PHE A CG  
1238 C CD1 . PHE A 156 ? 0.3100 0.3903 0.4040 -0.0017 -0.0370 0.0394  156  PHE A CD1 
1239 C CD2 . PHE A 156 ? 0.3348 0.3966 0.4210 -0.0053 -0.0325 0.0381  156  PHE A CD2 
1240 C CE1 . PHE A 156 ? 0.3487 0.4347 0.4481 -0.0100 -0.0402 0.0416  156  PHE A CE1 
1241 C CE2 . PHE A 156 ? 0.2998 0.3658 0.3905 -0.0129 -0.0356 0.0403  156  PHE A CE2 
1242 C CZ  . PHE A 156 ? 0.3723 0.4502 0.4695 -0.0157 -0.0395 0.0421  156  PHE A CZ  
1243 N N   . GLY A 157 ? 0.3429 0.3924 0.4128 0.0185  -0.0194 0.0329  157  GLY A N   
1244 C CA  . GLY A 157 ? 0.3187 0.3567 0.3798 0.0233  -0.0168 0.0309  157  GLY A CA  
1245 C C   . GLY A 157 ? 0.3715 0.4117 0.4309 0.0278  -0.0127 0.0306  157  GLY A C   
1246 O O   . GLY A 157 ? 0.3420 0.3731 0.3936 0.0328  -0.0112 0.0290  157  GLY A O   
1247 N N   . PHE A 158 ? 0.3009 0.3524 0.3666 0.0261  -0.0110 0.0320  158  PHE A N   
1248 C CA  . PHE A 158 ? 0.2817 0.3331 0.3441 0.0294  -0.0068 0.0313  158  PHE A CA  
1249 C C   . PHE A 158 ? 0.2961 0.3638 0.3651 0.0319  -0.0048 0.0331  158  PHE A C   
1250 O O   . PHE A 158 ? 0.3407 0.4084 0.4060 0.0360  -0.0012 0.0322  158  PHE A O   
1251 C CB  . PHE A 158 ? 0.2682 0.3104 0.3263 0.0244  -0.0053 0.0303  158  PHE A CB  
1252 C CG  . PHE A 158 ? 0.3358 0.3625 0.3858 0.0237  -0.0061 0.0283  158  PHE A CG  
1253 C CD1 . PHE A 158 ? 0.2773 0.2937 0.3184 0.0283  -0.0046 0.0263  158  PHE A CD1 
1254 C CD2 . PHE A 158 ? 0.3387 0.3614 0.3896 0.0187  -0.0086 0.0285  158  PHE A CD2 
1255 C CE1 . PHE A 158 ? 0.3186 0.3218 0.3524 0.0268  -0.0053 0.0251  158  PHE A CE1 
1256 C CE2 . PHE A 158 ? 0.3569 0.3676 0.4009 0.0181  -0.0090 0.0270  158  PHE A CE2 
1257 C CZ  . PHE A 158 ? 0.3544 0.3559 0.3902 0.0216  -0.0073 0.0255  158  PHE A CZ  
1258 N N   . LEU A 159 ? 0.3688 0.4508 0.4474 0.0295  -0.0071 0.0357  159  LEU A N   
1259 C CA  . LEU A 159 ? 0.3628 0.4630 0.4485 0.0322  -0.0049 0.0378  159  LEU A CA  
1260 C C   . LEU A 159 ? 0.3779 0.4787 0.4594 0.0429  -0.0033 0.0363  159  LEU A C   
1261 O O   . LEU A 159 ? 0.4237 0.5193 0.5027 0.0466  -0.0059 0.0354  159  LEU A O   
1262 C CB  . LEU A 159 ? 0.3519 0.4679 0.4487 0.0271  -0.0082 0.0411  159  LEU A CB  
1263 C CG  . LEU A 159 ? 0.4334 0.5715 0.5391 0.0289  -0.0058 0.0440  159  LEU A CG  
1264 C CD1 . LEU A 159 ? 0.3348 0.4839 0.4495 0.0181  -0.0076 0.0478  159  LEU A CD1 
1265 C CD2 . LEU A 159 ? 0.3321 0.4825 0.4418 0.0369  -0.0070 0.0444  159  LEU A CD2 
1266 N N   . ALA A 160 ? 0.3791 0.4856 0.4591 0.0483  0.0010  0.0360  160  ALA A N   
1267 C CA  . ALA A 160 ? 0.3844 0.4899 0.4587 0.0597  0.0028  0.0342  160  ALA A CA  
1268 C C   . ALA A 160 ? 0.3912 0.5167 0.4712 0.0657  0.0064  0.0358  160  ALA A C   
1269 O O   . ALA A 160 ? 0.3361 0.4696 0.4189 0.0624  0.0094  0.0370  160  ALA A O   
1270 C CB  . ALA A 160 ? 0.3019 0.3856 0.3620 0.0627  0.0048  0.0306  160  ALA A CB  
1271 N N   . LEU A 161 ? 0.3740 0.5083 0.4556 0.0749  0.0060  0.0361  161  LEU A N   
1272 C CA  . LEU A 161 ? 0.3840 0.5341 0.4675 0.0842  0.0101  0.0366  161  LEU A CA  
1273 C C   . LEU A 161 ? 0.3333 0.4656 0.4024 0.0960  0.0113  0.0327  161  LEU A C   
1274 O O   . LEU A 161 ? 0.3757 0.5070 0.4432 0.1033  0.0090  0.0325  161  LEU A O   
1275 C CB  . LEU A 161 ? 0.4357 0.6122 0.5333 0.0855  0.0084  0.0403  161  LEU A CB  
1276 C CG  . LEU A 161 ? 0.4915 0.6798 0.6000 0.0719  0.0074  0.0438  161  LEU A CG  
1277 C CD1 . LEU A 161 ? 0.5545 0.7563 0.6746 0.0656  0.0023  0.0469  161  LEU A CD1 
1278 C CD2 . LEU A 161 ? 0.4801 0.6865 0.5937 0.0723  0.0126  0.0460  161  LEU A CD2 
1279 N N   . PRO A 162 ? 0.4133 0.5290 0.4707 0.0968  0.0142  0.0297  162  PRO A N   
1280 C CA  . PRO A 162 ? 0.4313 0.5239 0.4726 0.1052  0.0145  0.0258  162  PRO A CA  
1281 C C   . PRO A 162 ? 0.4765 0.5765 0.5156 0.1196  0.0156  0.0255  162  PRO A C   
1282 O O   . PRO A 162 ? 0.4730 0.5921 0.5174 0.1256  0.0191  0.0265  162  PRO A O   
1283 C CB  . PRO A 162 ? 0.3975 0.4785 0.4292 0.1036  0.0180  0.0232  162  PRO A CB  
1284 C CG  . PRO A 162 ? 0.3929 0.4821 0.4343 0.0904  0.0176  0.0256  162  PRO A CG  
1285 C CD  . PRO A 162 ? 0.3161 0.4306 0.3736 0.0883  0.0166  0.0298  162  PRO A CD  
1286 N N   . GLY A 163 ? 0.5710 0.6571 0.6024 0.1255  0.0128  0.0243  163  GLY A N   
1287 C CA  . GLY A 163 ? 0.5470 0.6384 0.5752 0.1404  0.0134  0.0240  163  GLY A CA  
1288 C C   . GLY A 163 ? 0.5763 0.6883 0.6177 0.1422  0.0100  0.0275  163  GLY A C   
1289 O O   . GLY A 163 ? 0.5896 0.7010 0.6266 0.1541  0.0088  0.0272  163  GLY A O   
1290 N N   . SER A 164 ? 0.4522 0.5816 0.5087 0.1308  0.0081  0.0306  164  SER A N   
1291 C CA  . SER A 164 ? 0.4634 0.6112 0.5322 0.1305  0.0039  0.0338  164  SER A CA  
1292 C C   . SER A 164 ? 0.5246 0.6528 0.5856 0.1300  -0.0008 0.0329  164  SER A C   
1293 O O   . SER A 164 ? 0.5745 0.6766 0.6229 0.1269  -0.0009 0.0304  164  SER A O   
1294 C CB  . SER A 164 ? 0.5122 0.6790 0.5969 0.1167  0.0025  0.0372  164  SER A CB  
1295 O OG  . SER A 164 ? 0.5048 0.6537 0.5862 0.1044  0.0004  0.0363  164  SER A OG  
1296 N N   . ARG A 165 ? 0.5474 0.6889 0.6161 0.1323  -0.0049 0.0352  165  ARG A N   
1297 C CA  . ARG A 165 ? 0.6400 0.7648 0.7016 0.1320  -0.0095 0.0348  165  ARG A CA  
1298 C C   . ARG A 165 ? 0.5589 0.6855 0.6285 0.1173  -0.0132 0.0361  165  ARG A C   
1299 O O   . ARG A 165 ? 0.5207 0.6283 0.5827 0.1126  -0.0159 0.0351  165  ARG A O   
1300 C CB  . ARG A 165 ? 0.7662 0.9041 0.8307 0.1434  -0.0124 0.0364  165  ARG A CB  
1301 C CG  . ARG A 165 ? 0.9992 1.1149 1.0504 0.1487  -0.0158 0.0354  165  ARG A CG  
1302 C CD  . ARG A 165 ? 1.1813 1.3137 1.2409 0.1517  -0.0211 0.0381  165  ARG A CD  
1303 N NE  . ARG A 165 ? 1.2966 1.4330 1.3644 0.1376  -0.0252 0.0394  165  ARG A NE  
1304 C CZ  . ARG A 165 ? 1.2881 1.4458 1.3683 0.1349  -0.0299 0.0419  165  ARG A CZ  
1305 N NH1 . ARG A 165 ? 1.3246 1.5041 1.4118 0.1453  -0.0309 0.0439  165  ARG A NH1 
1306 N NH2 . ARG A 165 ? 1.1538 1.3114 1.2390 0.1221  -0.0336 0.0425  165  ARG A NH2 
1307 N N   . GLU A 166 ? 0.4317 0.5814 0.5161 0.1101  -0.0133 0.0386  166  GLU A N   
1308 C CA  . GLU A 166 ? 0.4198 0.5739 0.5124 0.0974  -0.0176 0.0402  166  GLU A CA  
1309 C C   . GLU A 166 ? 0.4467 0.5872 0.5369 0.0856  -0.0162 0.0390  166  GLU A C   
1310 O O   . GLU A 166 ? 0.4796 0.6169 0.5726 0.0759  -0.0198 0.0396  166  GLU A O   
1311 C CB  . GLU A 166 ? 0.4242 0.6092 0.5335 0.0947  -0.0193 0.0437  166  GLU A CB  
1312 C CG  . GLU A 166 ? 0.5535 0.7559 0.6669 0.1067  -0.0212 0.0452  166  GLU A CG  
1313 C CD  . GLU A 166 ? 0.6894 0.9057 0.8040 0.1187  -0.0158 0.0455  166  GLU A CD  
1314 O OE1 . GLU A 166 ? 0.6025 0.8078 0.7098 0.1206  -0.0105 0.0435  166  GLU A OE1 
1315 O OE2 . GLU A 166 ? 0.7186 0.9580 0.8417 0.1264  -0.0170 0.0477  166  GLU A OE2 
1316 N N   . ALA A 167 ? 0.4193 0.5515 0.5035 0.0871  -0.0112 0.0374  167  ALA A N   
1317 C CA  . ALA A 167 ? 0.3976 0.5191 0.4798 0.0769  -0.0095 0.0365  167  ALA A CA  
1318 C C   . ALA A 167 ? 0.4456 0.5511 0.5159 0.0817  -0.0050 0.0337  167  ALA A C   
1319 O O   . ALA A 167 ? 0.3953 0.5068 0.4672 0.0809  -0.0012 0.0338  167  ALA A O   
1320 C CB  . ALA A 167 ? 0.3840 0.5251 0.4788 0.0690  -0.0087 0.0393  167  ALA A CB  
1321 N N   . PRO A 168 ? 0.3981 0.4824 0.4555 0.0863  -0.0057 0.0313  168  PRO A N   
1322 C CA  . PRO A 168 ? 0.4353 0.5025 0.4793 0.0924  -0.0022 0.0285  168  PRO A CA  
1323 C C   . PRO A 168 ? 0.5090 0.5627 0.5481 0.0835  -0.0005 0.0269  168  PRO A C   
1324 O O   . PRO A 168 ? 0.5023 0.5426 0.5306 0.0866  0.0023  0.0245  168  PRO A O   
1325 C CB  . PRO A 168 ? 0.3733 0.4228 0.4060 0.0985  -0.0045 0.0273  168  PRO A CB  
1326 C CG  . PRO A 168 ? 0.3863 0.4422 0.4263 0.0939  -0.0093 0.0294  168  PRO A CG  
1327 C CD  . PRO A 168 ? 0.3413 0.4166 0.3959 0.0853  -0.0101 0.0315  168  PRO A CD  
1328 N N   . GLY A 169 ? 0.3958 0.4520 0.4417 0.0729  -0.0026 0.0282  169  GLY A N   
1329 C CA  . GLY A 169 ? 0.3831 0.4279 0.4250 0.0649  -0.0013 0.0270  169  GLY A CA  
1330 C C   . GLY A 169 ? 0.4059 0.4309 0.4386 0.0617  -0.0032 0.0255  169  GLY A C   
1331 O O   . GLY A 169 ? 0.3961 0.4124 0.4225 0.0668  -0.0048 0.0251  169  GLY A O   
1332 N N   . ASN A 170 ? 0.3647 0.3836 0.3969 0.0533  -0.0030 0.0251  170  ASN A N   
1333 C CA  . ASN A 170 ? 0.3497 0.3515 0.3733 0.0498  -0.0040 0.0239  170  ASN A CA  
1334 C C   . ASN A 170 ? 0.3731 0.3723 0.3973 0.0489  -0.0074 0.0248  170  ASN A C   
1335 O O   . ASN A 170 ? 0.3910 0.3760 0.4069 0.0472  -0.0079 0.0241  170  ASN A O   
1336 C CB  . ASN A 170 ? 0.3170 0.3028 0.3273 0.0549  -0.0021 0.0217  170  ASN A CB  
1337 C CG  . ASN A 170 ? 0.4517 0.4368 0.4591 0.0546  0.0010  0.0202  170  ASN A CG  
1338 O OD1 . ASN A 170 ? 0.4683 0.4583 0.4805 0.0479  0.0017  0.0205  170  ASN A OD1 
1339 N ND2 . ASN A 170 ? 0.4786 0.4572 0.4773 0.0625  0.0028  0.0185  170  ASN A ND2 
1340 N N   . VAL A 171 ? 0.3526 0.3649 0.3856 0.0496  -0.0098 0.0265  171  VAL A N   
1341 C CA  . VAL A 171 ? 0.3256 0.3343 0.3574 0.0493  -0.0133 0.0271  171  VAL A CA  
1342 C C   . VAL A 171 ? 0.3823 0.3838 0.4129 0.0416  -0.0144 0.0268  171  VAL A C   
1343 O O   . VAL A 171 ? 0.4066 0.4001 0.4320 0.0415  -0.0162 0.0268  171  VAL A O   
1344 C CB  . VAL A 171 ? 0.3844 0.4084 0.4251 0.0518  -0.0163 0.0288  171  VAL A CB  
1345 C CG1 . VAL A 171 ? 0.3691 0.4018 0.4111 0.0605  -0.0148 0.0292  171  VAL A CG1 
1346 C CG2 . VAL A 171 ? 0.3476 0.3842 0.3992 0.0442  -0.0178 0.0301  171  VAL A CG2 
1347 N N   . GLY A 172 ? 0.3618 0.3661 0.3964 0.0356  -0.0131 0.0267  172  GLY A N   
1348 C CA  . GLY A 172 ? 0.3641 0.3612 0.3964 0.0296  -0.0136 0.0262  172  GLY A CA  
1349 C C   . GLY A 172 ? 0.3685 0.3511 0.3903 0.0299  -0.0118 0.0251  172  GLY A C   
1350 O O   . GLY A 172 ? 0.4156 0.3914 0.4334 0.0273  -0.0125 0.0250  172  GLY A O   
1351 N N   . LEU A 173 ? 0.3068 0.2846 0.3235 0.0326  -0.0093 0.0243  173  LEU A N   
1352 C CA  . LEU A 173 ? 0.3665 0.3293 0.3721 0.0324  -0.0080 0.0233  173  LEU A CA  
1353 C C   . LEU A 173 ? 0.3785 0.3325 0.3768 0.0367  -0.0095 0.0239  173  LEU A C   
1354 O O   . LEU A 173 ? 0.3782 0.3211 0.3687 0.0343  -0.0093 0.0240  173  LEU A O   
1355 C CB  . LEU A 173 ? 0.3377 0.2963 0.3385 0.0346  -0.0055 0.0220  173  LEU A CB  
1356 C CG  . LEU A 173 ? 0.3972 0.3607 0.4019 0.0296  -0.0039 0.0214  173  LEU A CG  
1357 C CD1 . LEU A 173 ? 0.4153 0.3758 0.4151 0.0330  -0.0017 0.0199  173  LEU A CD1 
1358 C CD2 . LEU A 173 ? 0.4218 0.3782 0.4227 0.0229  -0.0037 0.0212  173  LEU A CD2 
1359 N N   . LEU A 174 ? 0.4135 0.3738 0.4148 0.0429  -0.0111 0.0245  174  LEU A N   
1360 C CA  . LEU A 174 ? 0.3751 0.3285 0.3699 0.0477  -0.0130 0.0253  174  LEU A CA  
1361 C C   . LEU A 174 ? 0.3996 0.3549 0.3967 0.0439  -0.0154 0.0262  174  LEU A C   
1362 O O   . LEU A 174 ? 0.4074 0.3533 0.3967 0.0452  -0.0164 0.0269  174  LEU A O   
1363 C CB  . LEU A 174 ? 0.4024 0.3640 0.4004 0.0562  -0.0141 0.0258  174  LEU A CB  
1364 C CG  . LEU A 174 ? 0.4824 0.4413 0.4763 0.0622  -0.0116 0.0247  174  LEU A CG  
1365 C CD1 . LEU A 174 ? 0.4847 0.4573 0.4848 0.0705  -0.0126 0.0254  174  LEU A CD1 
1366 C CD2 . LEU A 174 ? 0.4984 0.4363 0.4766 0.0651  -0.0107 0.0239  174  LEU A CD2 
1367 N N   . ASP A 175 ? 0.3648 0.3316 0.3718 0.0395  -0.0164 0.0263  175  ASP A N   
1368 C CA  . ASP A 175 ? 0.3916 0.3581 0.3990 0.0358  -0.0185 0.0266  175  ASP A CA  
1369 C C   . ASP A 175 ? 0.3793 0.3346 0.3788 0.0318  -0.0164 0.0263  175  ASP A C   
1370 O O   . ASP A 175 ? 0.3972 0.3461 0.3905 0.0318  -0.0172 0.0270  175  ASP A O   
1371 C CB  . ASP A 175 ? 0.2887 0.2660 0.3058 0.0314  -0.0199 0.0264  175  ASP A CB  
1372 C CG  . ASP A 175 ? 0.3873 0.3773 0.4129 0.0336  -0.0224 0.0271  175  ASP A CG  
1373 O OD1 . ASP A 175 ? 0.3773 0.3691 0.4017 0.0394  -0.0236 0.0277  175  ASP A OD1 
1374 O OD2 . ASP A 175 ? 0.4576 0.4561 0.4911 0.0297  -0.0231 0.0273  175  ASP A OD2 
1375 N N   . GLN A 176 ? 0.3428 0.2966 0.3424 0.0284  -0.0137 0.0257  176  GLN A N   
1376 C CA  . GLN A 176 ? 0.3927 0.3382 0.3860 0.0238  -0.0117 0.0257  176  GLN A CA  
1377 C C   . GLN A 176 ? 0.3929 0.3252 0.3747 0.0259  -0.0112 0.0265  176  GLN A C   
1378 O O   . GLN A 176 ? 0.4319 0.3583 0.4079 0.0234  -0.0110 0.0275  176  GLN A O   
1379 C CB  . GLN A 176 ? 0.3367 0.2836 0.3320 0.0198  -0.0093 0.0249  176  GLN A CB  
1380 C CG  . GLN A 176 ? 0.3743 0.3326 0.3795 0.0174  -0.0098 0.0245  176  GLN A CG  
1381 C CD  . GLN A 176 ? 0.4151 0.3753 0.4221 0.0148  -0.0077 0.0238  176  GLN A CD  
1382 O OE1 . GLN A 176 ? 0.4504 0.4028 0.4507 0.0140  -0.0061 0.0233  176  GLN A OE1 
1383 N NE2 . GLN A 176 ? 0.3705 0.3399 0.3854 0.0133  -0.0080 0.0238  176  GLN A NE2 
1384 N N   . ARG A 177 ? 0.4218 0.3493 0.3999 0.0308  -0.0111 0.0262  177  ARG A N   
1385 C CA  . ARG A 177 ? 0.5017 0.4142 0.4674 0.0334  -0.0109 0.0270  177  ARG A CA  
1386 C C   . ARG A 177 ? 0.5044 0.4142 0.4662 0.0361  -0.0131 0.0286  177  ARG A C   
1387 O O   . ARG A 177 ? 0.4820 0.3801 0.4338 0.0343  -0.0126 0.0300  177  ARG A O   
1388 C CB  . ARG A 177 ? 0.4649 0.3729 0.4270 0.0400  -0.0107 0.0261  177  ARG A CB  
1389 C CG  . ARG A 177 ? 0.5679 0.4580 0.5155 0.0441  -0.0111 0.0270  177  ARG A CG  
1390 C CD  . ARG A 177 ? 0.4824 0.3675 0.4255 0.0519  -0.0107 0.0257  177  ARG A CD  
1391 N NE  . ARG A 177 ? 0.5568 0.4363 0.4967 0.0478  -0.0085 0.0239  177  ARG A NE  
1392 C CZ  . ARG A 177 ? 0.5512 0.4301 0.4898 0.0528  -0.0074 0.0220  177  ARG A CZ  
1393 N NH1 . ARG A 177 ? 0.5073 0.3924 0.4484 0.0625  -0.0081 0.0219  177  ARG A NH1 
1394 N NH2 . ARG A 177 ? 0.5155 0.3881 0.4500 0.0482  -0.0057 0.0203  177  ARG A NH2 
1395 N N   . LEU A 178 ? 0.4031 0.3239 0.3725 0.0399  -0.0156 0.0287  178  LEU A N   
1396 C CA  . LEU A 178 ? 0.3594 0.2789 0.3253 0.0426  -0.0182 0.0300  178  LEU A CA  
1397 C C   . LEU A 178 ? 0.4840 0.4018 0.4476 0.0367  -0.0176 0.0306  178  LEU A C   
1398 O O   . LEU A 178 ? 0.4445 0.3535 0.3988 0.0372  -0.0179 0.0322  178  LEU A O   
1399 C CB  . LEU A 178 ? 0.3472 0.2803 0.3226 0.0465  -0.0215 0.0297  178  LEU A CB  
1400 C CG  . LEU A 178 ? 0.4833 0.4165 0.4555 0.0503  -0.0250 0.0309  178  LEU A CG  
1401 C CD1 . LEU A 178 ? 0.4293 0.3485 0.3887 0.0557  -0.0251 0.0325  178  LEU A CD1 
1402 C CD2 . LEU A 178 ? 0.4714 0.4199 0.4543 0.0537  -0.0283 0.0305  178  LEU A CD2 
1403 N N   . ALA A 179 ? 0.4060 0.3321 0.3773 0.0316  -0.0166 0.0295  179  ALA A N   
1404 C CA  . ALA A 179 ? 0.5007 0.4260 0.4697 0.0267  -0.0153 0.0299  179  ALA A CA  
1405 C C   . ALA A 179 ? 0.3921 0.3064 0.3514 0.0232  -0.0125 0.0313  179  ALA A C   
1406 O O   . ALA A 179 ? 0.5074 0.4186 0.4611 0.0213  -0.0119 0.0327  179  ALA A O   
1407 C CB  . ALA A 179 ? 0.2760 0.2114 0.2542 0.0225  -0.0146 0.0284  179  ALA A CB  
1408 N N   . LEU A 180 ? 0.4264 0.3351 0.3835 0.0219  -0.0109 0.0311  180  LEU A N   
1409 C CA  . LEU A 180 ? 0.4836 0.3803 0.4306 0.0174  -0.0087 0.0326  180  LEU A CA  
1410 C C   . LEU A 180 ? 0.5443 0.4281 0.4795 0.0209  -0.0098 0.0346  180  LEU A C   
1411 O O   . LEU A 180 ? 0.5681 0.4439 0.4948 0.0167  -0.0084 0.0368  180  LEU A O   
1412 C CB  . LEU A 180 ? 0.2762 0.1677 0.2217 0.0150  -0.0073 0.0315  180  LEU A CB  
1413 C CG  . LEU A 180 ? 0.4228 0.3253 0.3785 0.0120  -0.0063 0.0295  180  LEU A CG  
1414 C CD1 . LEU A 180 ? 0.4185 0.3132 0.3693 0.0084  -0.0049 0.0287  180  LEU A CD1 
1415 C CD2 . LEU A 180 ? 0.3908 0.3047 0.3536 0.0073  -0.0054 0.0297  180  LEU A CD2 
1416 N N   . GLN A 181 ? 0.4999 0.3821 0.4345 0.0286  -0.0122 0.0343  181  GLN A N   
1417 C CA  . GLN A 181 ? 0.5355 0.4054 0.4585 0.0331  -0.0136 0.0364  181  GLN A CA  
1418 C C   . GLN A 181 ? 0.5672 0.4408 0.4891 0.0323  -0.0145 0.0380  181  GLN A C   
1419 O O   . GLN A 181 ? 0.5143 0.3772 0.4251 0.0313  -0.0141 0.0405  181  GLN A O   
1420 C CB  . GLN A 181 ? 0.4646 0.3346 0.3884 0.0423  -0.0162 0.0357  181  GLN A CB  
1421 C CG  . GLN A 181 ? 0.6292 0.4936 0.5516 0.0438  -0.0148 0.0342  181  GLN A CG  
1422 C CD  . GLN A 181 ? 0.6604 0.5282 0.5853 0.0535  -0.0167 0.0332  181  GLN A CD  
1423 O OE1 . GLN A 181 ? 0.6749 0.5564 0.6089 0.0575  -0.0189 0.0330  181  GLN A OE1 
1424 N NE2 . GLN A 181 ? 0.6178 0.4736 0.5345 0.0573  -0.0159 0.0325  181  GLN A NE2 
1425 N N   . TRP A 182 ? 0.4604 0.3484 0.3929 0.0326  -0.0157 0.0364  182  TRP A N   
1426 C CA  . TRP A 182 ? 0.4455 0.3374 0.3767 0.0317  -0.0164 0.0371  182  TRP A CA  
1427 C C   . TRP A 182 ? 0.5158 0.4043 0.4416 0.0248  -0.0129 0.0388  182  TRP A C   
1428 O O   . TRP A 182 ? 0.5272 0.4120 0.4453 0.0245  -0.0127 0.0408  182  TRP A O   
1429 C CB  . TRP A 182 ? 0.4846 0.3908 0.4275 0.0321  -0.0182 0.0347  182  TRP A CB  
1430 C CG  . TRP A 182 ? 0.5243 0.4335 0.4648 0.0327  -0.0197 0.0349  182  TRP A CG  
1431 C CD1 . TRP A 182 ? 0.4223 0.3333 0.3617 0.0377  -0.0238 0.0347  182  TRP A CD1 
1432 C CD2 . TRP A 182 ? 0.4399 0.3514 0.3785 0.0287  -0.0174 0.0350  182  TRP A CD2 
1433 N NE1 . TRP A 182 ? 0.5254 0.4382 0.4614 0.0368  -0.0242 0.0345  182  TRP A NE1 
1434 C CE2 . TRP A 182 ? 0.5237 0.4370 0.4592 0.0317  -0.0202 0.0346  182  TRP A CE2 
1435 C CE3 . TRP A 182 ? 0.3833 0.2966 0.3227 0.0231  -0.0135 0.0353  182  TRP A CE3 
1436 C CZ2 . TRP A 182 ? 0.5138 0.4296 0.4460 0.0300  -0.0187 0.0344  182  TRP A CZ2 
1437 C CZ3 . TRP A 182 ? 0.3555 0.2730 0.2929 0.0215  -0.0119 0.0354  182  TRP A CZ3 
1438 C CH2 . TRP A 182 ? 0.4395 0.3578 0.3728 0.0252  -0.0143 0.0349  182  TRP A CH2 
1439 N N   . VAL A 183 ? 0.4503 0.3410 0.3800 0.0192  -0.0102 0.0381  183  VAL A N   
1440 C CA  . VAL A 183 ? 0.4602 0.3510 0.3862 0.0125  -0.0070 0.0399  183  VAL A CA  
1441 C C   . VAL A 183 ? 0.5088 0.3843 0.4211 0.0105  -0.0061 0.0432  183  VAL A C   
1442 O O   . VAL A 183 ? 0.5757 0.4492 0.4812 0.0077  -0.0045 0.0458  183  VAL A O   
1443 C CB  . VAL A 183 ? 0.5201 0.4187 0.4541 0.0068  -0.0047 0.0386  183  VAL A CB  
1444 C CG1 . VAL A 183 ? 0.3908 0.2886 0.3201 -0.0006 -0.0014 0.0410  183  VAL A CG1 
1445 C CG2 . VAL A 183 ? 0.5455 0.4586 0.4910 0.0085  -0.0054 0.0360  183  VAL A CG2 
1446 N N   . GLN A 184 ? 0.5252 0.3891 0.4325 0.0125  -0.0071 0.0432  184  GLN A N   
1447 C CA  . GLN A 184 ? 0.5492 0.3956 0.4421 0.0106  -0.0066 0.0463  184  GLN A CA  
1448 C C   . GLN A 184 ? 0.5702 0.4116 0.4546 0.0147  -0.0080 0.0488  184  GLN A C   
1449 O O   . GLN A 184 ? 0.5244 0.3569 0.3981 0.0104  -0.0065 0.0524  184  GLN A O   
1450 C CB  . GLN A 184 ? 0.4884 0.3221 0.3763 0.0144  -0.0081 0.0453  184  GLN A CB  
1451 C CG  . GLN A 184 ? 0.4927 0.3272 0.3846 0.0090  -0.0065 0.0435  184  GLN A CG  
1452 C CD  . GLN A 184 ? 0.5887 0.4167 0.4735 -0.0013 -0.0041 0.0460  184  GLN A CD  
1453 O OE1 . GLN A 184 ? 0.6310 0.4415 0.5017 -0.0035 -0.0042 0.0488  184  GLN A OE1 
1454 N NE2 . GLN A 184 ? 0.5401 0.3819 0.4342 -0.0079 -0.0020 0.0453  184  GLN A NE2 
1455 N N   . GLU A 185 ? 0.4828 0.3299 0.3716 0.0227  -0.0110 0.0473  185  GLU A N   
1456 C CA  . GLU A 185 ? 0.5192 0.3615 0.3997 0.0274  -0.0130 0.0495  185  GLU A CA  
1457 C C   . GLU A 185 ? 0.6016 0.4523 0.4822 0.0245  -0.0117 0.0504  185  GLU A C   
1458 O O   . GLU A 185 ? 0.5692 0.4121 0.4384 0.0245  -0.0115 0.0537  185  GLU A O   
1459 C CB  . GLU A 185 ? 0.5284 0.3743 0.4127 0.0370  -0.0173 0.0478  185  GLU A CB  
1460 C CG  . GLU A 185 ? 0.6340 0.4745 0.5085 0.0416  -0.0196 0.0503  185  GLU A CG  
1461 C CD  . GLU A 185 ? 0.7880 0.6273 0.6619 0.0514  -0.0241 0.0499  185  GLU A CD  
1462 O OE1 . GLU A 185 ? 0.7955 0.6259 0.6581 0.0557  -0.0261 0.0526  185  GLU A OE1 
1463 O OE2 . GLU A 185 ? 0.8170 0.6651 0.7016 0.0549  -0.0255 0.0471  185  GLU A OE2 
1464 N N   . ASN A 186 ? 0.4890 0.3549 0.3812 0.0222  -0.0107 0.0478  186  ASN A N   
1465 C CA  . ASN A 186 ? 0.4234 0.2982 0.3164 0.0225  -0.0104 0.0476  186  ASN A CA  
1466 C C   . ASN A 186 ? 0.4963 0.3790 0.3914 0.0159  -0.0061 0.0481  186  ASN A C   
1467 O O   . ASN A 186 ? 0.5363 0.4239 0.4284 0.0162  -0.0052 0.0487  186  ASN A O   
1468 C CB  . ASN A 186 ? 0.4150 0.3008 0.3184 0.0275  -0.0139 0.0437  186  ASN A CB  
1469 C CG  . ASN A 186 ? 0.5063 0.3883 0.4082 0.0345  -0.0185 0.0434  186  ASN A CG  
1470 O OD1 . ASN A 186 ? 0.5670 0.4438 0.4601 0.0382  -0.0204 0.0452  186  ASN A OD1 
1471 N ND2 . ASN A 186 ? 0.5434 0.4290 0.4540 0.0368  -0.0202 0.0414  186  ASN A ND2 
1472 N N   . ILE A 187 ? 0.4735 0.3585 0.3738 0.0102  -0.0037 0.0479  187  ILE A N   
1473 C CA  . ILE A 187 ? 0.4890 0.3852 0.3941 0.0047  0.0000  0.0480  187  ILE A CA  
1474 C C   . ILE A 187 ? 0.5525 0.4464 0.4475 -0.0001 0.0035  0.0522  187  ILE A C   
1475 O O   . ILE A 187 ? 0.4850 0.3904 0.3825 -0.0020 0.0063  0.0525  187  ILE A O   
1476 C CB  . ILE A 187 ? 0.4355 0.3353 0.3486 -0.0005 0.0015  0.0468  187  ILE A CB  
1477 C CG1 . ILE A 187 ? 0.4734 0.3894 0.3962 -0.0025 0.0037  0.0452  187  ILE A CG1 
1478 C CG2 . ILE A 187 ? 0.4397 0.3291 0.3448 -0.0075 0.0034  0.0501  187  ILE A CG2 
1479 C CD1 . ILE A 187 ? 0.4261 0.3497 0.3560 0.0042  0.0011  0.0416  187  ILE A CD1 
1480 N N   . ALA A 188 ? 0.4752 0.3546 0.3585 -0.0017 0.0033  0.0557  188  ALA A N   
1481 C CA  . ALA A 188 ? 0.4321 0.3089 0.3050 -0.0064 0.0064  0.0603  188  ALA A CA  
1482 C C   . ALA A 188 ? 0.5425 0.4271 0.4134 -0.0012 0.0066  0.0600  188  ALA A C   
1483 O O   . ALA A 188 ? 0.5483 0.4385 0.4145 -0.0046 0.0102  0.0628  188  ALA A O   
1484 C CB  . ALA A 188 ? 0.4753 0.3323 0.3339 -0.0080 0.0055  0.0643  188  ALA A CB  
1485 N N   . ALA A 189 ? 0.5234 0.4092 0.3977 0.0069  0.0026  0.0564  189  ALA A N   
1486 C CA  . ALA A 189 ? 0.4850 0.3765 0.3560 0.0119  0.0020  0.0556  189  ALA A CA  
1487 C C   . ALA A 189 ? 0.5118 0.4189 0.3902 0.0108  0.0051  0.0536  189  ALA A C   
1488 O O   . ALA A 189 ? 0.6168 0.5289 0.4907 0.0137  0.0060  0.0534  189  ALA A O   
1489 C CB  . ALA A 189 ? 0.4644 0.3539 0.3376 0.0198  -0.0035 0.0522  189  ALA A CB  
1490 N N   . PHE A 190 ? 0.4949 0.4095 0.3842 0.0074  0.0064  0.0518  190  PHE A N   
1491 C CA  . PHE A 190 ? 0.4971 0.4266 0.3941 0.0077  0.0088  0.0496  190  PHE A CA  
1492 C C   . PHE A 190 ? 0.4828 0.4200 0.3805 0.0001  0.0141  0.0530  190  PHE A C   
1493 O O   . PHE A 190 ? 0.5679 0.5187 0.4723 -0.0001 0.0166  0.0518  190  PHE A O   
1494 C CB  . PHE A 190 ? 0.4774 0.4120 0.3869 0.0097  0.0063  0.0452  190  PHE A CB  
1495 C CG  . PHE A 190 ? 0.4507 0.3802 0.3616 0.0159  0.0010  0.0419  190  PHE A CG  
1496 C CD1 . PHE A 190 ? 0.4908 0.4104 0.4005 0.0168  -0.0022 0.0423  190  PHE A CD1 
1497 C CD2 . PHE A 190 ? 0.4718 0.4066 0.3848 0.0210  -0.0010 0.0384  190  PHE A CD2 
1498 C CE1 . PHE A 190 ? 0.4007 0.3183 0.3129 0.0222  -0.0072 0.0395  190  PHE A CE1 
1499 C CE2 . PHE A 190 ? 0.3824 0.3133 0.2969 0.0255  -0.0062 0.0356  190  PHE A CE2 
1500 C CZ  . PHE A 190 ? 0.3838 0.3074 0.2987 0.0259  -0.0093 0.0363  190  PHE A CZ  
1501 N N   . GLY A 191 ? 0.4882 0.4168 0.3788 -0.0062 0.0155  0.0573  191  GLY A N   
1502 C CA  . GLY A 191 ? 0.3997 0.3352 0.2909 -0.0150 0.0201  0.0610  191  GLY A CA  
1503 C C   . GLY A 191 ? 0.5132 0.4473 0.4116 -0.0209 0.0194  0.0604  191  GLY A C   
1504 O O   . GLY A 191 ? 0.5202 0.4608 0.4203 -0.0292 0.0225  0.0632  191  GLY A O   
1505 N N   . GLY A 192 ? 0.4622 0.3885 0.3647 -0.0168 0.0153  0.0569  192  GLY A N   
1506 C CA  . GLY A 192 ? 0.5016 0.4251 0.4094 -0.0216 0.0145  0.0561  192  GLY A CA  
1507 C C   . GLY A 192 ? 0.5572 0.4631 0.4549 -0.0270 0.0138  0.0592  192  GLY A C   
1508 O O   . GLY A 192 ? 0.5949 0.4876 0.4821 -0.0242 0.0124  0.0609  192  GLY A O   
1509 N N   . ASP A 193 ? 0.5277 0.4324 0.4276 -0.0344 0.0144  0.0596  193  ASP A N   
1510 C CA  . ASP A 193 ? 0.4949 0.3815 0.3843 -0.0405 0.0136  0.0622  193  ASP A CA  
1511 C C   . ASP A 193 ? 0.5113 0.3864 0.4016 -0.0364 0.0101  0.0587  193  ASP A C   
1512 O O   . ASP A 193 ? 0.4834 0.3638 0.3815 -0.0389 0.0098  0.0563  193  ASP A O   
1513 C CB  . ASP A 193 ? 0.5751 0.4684 0.4660 -0.0523 0.0163  0.0648  193  ASP A CB  
1514 C CG  . ASP A 193 ? 0.6487 0.5223 0.5268 -0.0605 0.0156  0.0680  193  ASP A CG  
1515 O OD1 . ASP A 193 ? 0.6370 0.4906 0.5051 -0.0562 0.0129  0.0678  193  ASP A OD1 
1516 O OD2 . ASP A 193 ? 0.6824 0.5608 0.5601 -0.0716 0.0176  0.0710  193  ASP A OD2 
1517 N N   . PRO A 194 ? 0.5510 0.4112 0.4334 -0.0295 0.0074  0.0585  194  PRO A N   
1518 C CA  . PRO A 194 ? 0.5496 0.4015 0.4338 -0.0243 0.0044  0.0550  194  PRO A CA  
1519 C C   . PRO A 194 ? 0.6484 0.4882 0.5270 -0.0316 0.0044  0.0554  194  PRO A C   
1520 O O   . PRO A 194 ? 0.5488 0.3833 0.4293 -0.0281 0.0025  0.0522  194  PRO A O   
1521 C CB  . PRO A 194 ? 0.5625 0.4006 0.4371 -0.0163 0.0019  0.0558  194  PRO A CB  
1522 C CG  . PRO A 194 ? 0.5194 0.3500 0.3816 -0.0212 0.0037  0.0609  194  PRO A CG  
1523 C CD  . PRO A 194 ? 0.5291 0.3796 0.4001 -0.0260 0.0070  0.0615  194  PRO A CD  
1524 N N   . MET A 195 ? 0.5973 0.4321 0.4681 -0.0416 0.0063  0.0593  195  MET A N   
1525 C CA  . MET A 195 ? 0.6383 0.4606 0.5025 -0.0499 0.0059  0.0598  195  MET A CA  
1526 C C   . MET A 195 ? 0.6388 0.4777 0.5144 -0.0575 0.0073  0.0584  195  MET A C   
1527 O O   . MET A 195 ? 0.6627 0.4937 0.5342 -0.0651 0.0066  0.0583  195  MET A O   
1528 C CB  . MET A 195 ? 0.6481 0.4522 0.4955 -0.0577 0.0064  0.0650  195  MET A CB  
1529 C CG  . MET A 195 ? 0.6259 0.4091 0.4596 -0.0495 0.0042  0.0662  195  MET A CG  
1530 S SD  . MET A 195 ? 0.9677 0.7228 0.7788 -0.0585 0.0038  0.0718  195  MET A SD  
1531 C CE  . MET A 195 ? 0.7675 0.5408 0.5837 -0.0731 0.0079  0.0764  195  MET A CE  
1532 N N   . SER A 196 ? 0.5500 0.4112 0.4393 -0.0549 0.0089  0.0572  196  SER A N   
1533 C CA  . SER A 196 ? 0.4969 0.3748 0.3982 -0.0593 0.0097  0.0553  196  SER A CA  
1534 C C   . SER A 196 ? 0.5093 0.4014 0.4238 -0.0500 0.0091  0.0512  196  SER A C   
1535 O O   . SER A 196 ? 0.5357 0.4437 0.4580 -0.0472 0.0107  0.0512  196  SER A O   
1536 C CB  . SER A 196 ? 0.4978 0.3906 0.4020 -0.0688 0.0129  0.0590  196  SER A CB  
1537 O OG  . SER A 196 ? 0.5184 0.4288 0.4347 -0.0721 0.0134  0.0572  196  SER A OG  
1538 N N   . VAL A 197 ? 0.5573 0.4429 0.4735 -0.0452 0.0067  0.0476  197  VAL A N   
1539 C CA  . VAL A 197 ? 0.5174 0.4139 0.4449 -0.0370 0.0058  0.0441  197  VAL A CA  
1540 C C   . VAL A 197 ? 0.5325 0.4344 0.4668 -0.0395 0.0052  0.0415  197  VAL A C   
1541 O O   . VAL A 197 ? 0.5025 0.3919 0.4309 -0.0411 0.0039  0.0404  197  VAL A O   
1542 C CB  . VAL A 197 ? 0.6266 0.5125 0.5507 -0.0275 0.0035  0.0425  197  VAL A CB  
1543 C CG1 . VAL A 197 ? 0.5468 0.4440 0.4829 -0.0207 0.0022  0.0389  197  VAL A CG1 
1544 C CG2 . VAL A 197 ? 0.4789 0.3604 0.3964 -0.0240 0.0036  0.0449  197  VAL A CG2 
1545 N N   . THR A 198 ? 0.4632 0.3831 0.4091 -0.0394 0.0061  0.0405  198  THR A N   
1546 C CA  . THR A 198 ? 0.4304 0.3573 0.3832 -0.0414 0.0055  0.0383  198  THR A CA  
1547 C C   . THR A 198 ? 0.4216 0.3553 0.3832 -0.0329 0.0044  0.0355  198  THR A C   
1548 O O   . THR A 198 ? 0.4066 0.3501 0.3739 -0.0288 0.0048  0.0356  198  THR A O   
1549 C CB  . THR A 198 ? 0.4776 0.4209 0.4369 -0.0481 0.0072  0.0399  198  THR A CB  
1550 O OG1 . THR A 198 ? 0.5697 0.5077 0.5212 -0.0575 0.0082  0.0429  198  THR A OG1 
1551 C CG2 . THR A 198 ? 0.4247 0.3767 0.3918 -0.0493 0.0063  0.0376  198  THR A CG2 
1552 N N   . LEU A 199 ? 0.4130 0.3413 0.3751 -0.0303 0.0028  0.0331  199  LEU A N   
1553 C CA  . LEU A 199 ? 0.4548 0.3909 0.4258 -0.0239 0.0019  0.0309  199  LEU A CA  
1554 C C   . LEU A 199 ? 0.5185 0.4685 0.4983 -0.0266 0.0023  0.0302  199  LEU A C   
1555 O O   . LEU A 199 ? 0.4630 0.4140 0.4417 -0.0328 0.0026  0.0305  199  LEU A O   
1556 C CB  . LEU A 199 ? 0.4276 0.3540 0.3957 -0.0199 0.0005  0.0289  199  LEU A CB  
1557 C CG  . LEU A 199 ? 0.4653 0.3769 0.4238 -0.0160 -0.0002 0.0294  199  LEU A CG  
1558 C CD1 . LEU A 199 ? 0.3988 0.3052 0.3566 -0.0107 -0.0013 0.0271  199  LEU A CD1 
1559 C CD2 . LEU A 199 ? 0.4291 0.3434 0.3891 -0.0111 -0.0007 0.0304  199  LEU A CD2 
1560 N N   . PHE A 200 ? 0.4203 0.3806 0.4084 -0.0221 0.0019  0.0295  200  PHE A N   
1561 C CA  . PHE A 200 ? 0.3955 0.3668 0.3911 -0.0232 0.0019  0.0287  200  PHE A CA  
1562 C C   . PHE A 200 ? 0.3724 0.3476 0.3744 -0.0173 0.0006  0.0273  200  PHE A C   
1563 O O   . PHE A 200 ? 0.3809 0.3544 0.3830 -0.0128 -0.0001 0.0272  200  PHE A O   
1564 C CB  . PHE A 200 ? 0.2797 0.2629 0.2785 -0.0271 0.0033  0.0302  200  PHE A CB  
1565 C CG  . PHE A 200 ? 0.3948 0.3853 0.3966 -0.0228 0.0040  0.0309  200  PHE A CG  
1566 C CD1 . PHE A 200 ? 0.4044 0.3885 0.4015 -0.0199 0.0042  0.0313  200  PHE A CD1 
1567 C CD2 . PHE A 200 ? 0.3248 0.3289 0.3331 -0.0218 0.0046  0.0311  200  PHE A CD2 
1568 C CE1 . PHE A 200 ? 0.3729 0.3633 0.3713 -0.0160 0.0049  0.0316  200  PHE A CE1 
1569 C CE2 . PHE A 200 ? 0.3149 0.3249 0.3243 -0.0174 0.0055  0.0313  200  PHE A CE2 
1570 C CZ  . PHE A 200 ? 0.2706 0.2734 0.2749 -0.0146 0.0056  0.0315  200  PHE A CZ  
1571 N N   . GLY A 201 ? 0.3516 0.3311 0.3579 -0.0176 0.0000  0.0264  201  GLY A N   
1572 C CA  . GLY A 201 ? 0.3649 0.3478 0.3769 -0.0129 -0.0012 0.0255  201  GLY A CA  
1573 C C   . GLY A 201 ? 0.4009 0.3907 0.4173 -0.0144 -0.0015 0.0252  201  GLY A C   
1574 O O   . GLY A 201 ? 0.3637 0.3547 0.3783 -0.0188 -0.0009 0.0253  201  GLY A O   
1575 N N   . GLU A 202 ? 0.3288 0.3224 0.3502 -0.0111 -0.0025 0.0251  202  GLU A N   
1576 C CA  . GLU A 202 ? 0.3794 0.3793 0.4044 -0.0120 -0.0029 0.0252  202  GLU A CA  
1577 C C   . GLU A 202 ? 0.3302 0.3285 0.3573 -0.0100 -0.0037 0.0249  202  GLU A C   
1578 O O   . GLU A 202 ? 0.3960 0.3916 0.4242 -0.0071 -0.0045 0.0248  202  GLU A O   
1579 C CB  . GLU A 202 ? 0.3455 0.3532 0.3744 -0.0104 -0.0033 0.0259  202  GLU A CB  
1580 C CG  . GLU A 202 ? 0.3747 0.3892 0.4069 -0.0110 -0.0038 0.0264  202  GLU A CG  
1581 C CD  . GLU A 202 ? 0.4167 0.4300 0.4516 -0.0078 -0.0053 0.0266  202  GLU A CD  
1582 O OE1 . GLU A 202 ? 0.3744 0.3826 0.4091 -0.0055 -0.0060 0.0264  202  GLU A OE1 
1583 O OE2 . GLU A 202 ? 0.3835 0.4010 0.4202 -0.0079 -0.0059 0.0273  202  GLU A OE2 
1584 N N   . SGB A 203 ? 0.3359 0.3366 0.3633 -0.0118 -0.0035 0.0248  203  SGB A N   
1585 C CA  . SGB A 203 ? 0.3071 0.3079 0.3361 -0.0104 -0.0038 0.0248  203  SGB A CA  
1586 C C   . SGB A 203 ? 0.3796 0.3743 0.4060 -0.0085 -0.0033 0.0240  203  SGB A C   
1587 O O   . SGB A 203 ? 0.4068 0.3958 0.4278 -0.0095 -0.0024 0.0229  203  SGB A O   
1588 C CB  . SGB A 203 ? 0.3180 0.3226 0.3519 -0.0081 -0.0051 0.0260  203  SGB A CB  
1589 O OG  . SGB A 203 ? 0.4025 0.4088 0.4378 -0.0081 -0.0051 0.0266  203  SGB A OG  
1590 O O1  . SGB A 203 ? 0.4971 0.5008 0.5364 -0.0047 -0.0065 0.0274  203  SGB A O1  
1591 P P1  . SGB A 203 ? 0.6220 0.6288 0.6609 -0.0064 -0.0060 0.0279  203  SGB A P1  
1592 C C1  . SGB A 203 ? 0.5786 0.5877 0.6175 -0.0068 -0.0048 0.0283  203  SGB A C1  
1593 O O2  . SGB A 203 ? 0.7299 0.7381 0.7712 -0.0060 -0.0080 0.0293  203  SGB A O2  
1594 C C2  . SGB A 203 ? 0.6634 0.6706 0.7072 -0.0055 -0.0098 0.0308  203  SGB A C2  
1595 C C4  . SGB A 203 ? 0.6308 0.6375 0.6740 -0.0047 -0.0113 0.0317  203  SGB A C4  
1596 C C3  . SGB A 203 ? 0.6581 0.6680 0.7038 -0.0070 -0.0093 0.0324  203  SGB A C3  
1597 N N   . ALA A 204 ? 0.2233 0.2190 0.2532 -0.0057 -0.0039 0.0246  204  ALA A N   
1598 C CA  . ALA A 204 ? 0.3706 0.3622 0.3986 -0.0030 -0.0036 0.0240  204  ALA A CA  
1599 C C   . ALA A 204 ? 0.3767 0.3618 0.4003 -0.0023 -0.0036 0.0234  204  ALA A C   
1600 O O   . ALA A 204 ? 0.3831 0.3626 0.4023 -0.0003 -0.0031 0.0227  204  ALA A O   
1601 C CB  . ALA A 204 ? 0.2825 0.2784 0.3159 -0.0009 -0.0047 0.0251  204  ALA A CB  
1602 N N   . GLY A 205 ? 0.3071 0.2927 0.3311 -0.0035 -0.0042 0.0238  205  GLY A N   
1603 C CA  . GLY A 205 ? 0.2873 0.2671 0.3063 -0.0035 -0.0040 0.0237  205  GLY A CA  
1604 C C   . GLY A 205 ? 0.3938 0.3682 0.4064 -0.0067 -0.0026 0.0231  205  GLY A C   
1605 O O   . GLY A 205 ? 0.4379 0.4038 0.4442 -0.0061 -0.0023 0.0228  205  GLY A O   
1606 N N   . ALA A 206 ? 0.2860 0.2646 0.2996 -0.0103 -0.0021 0.0231  206  ALA A N   
1607 C CA  . ALA A 206 ? 0.3072 0.2807 0.3147 -0.0142 -0.0014 0.0223  206  ALA A CA  
1608 C C   . ALA A 206 ? 0.3906 0.3562 0.3929 -0.0118 -0.0011 0.0209  206  ALA A C   
1609 O O   . ALA A 206 ? 0.4212 0.3766 0.4153 -0.0130 -0.0008 0.0202  206  ALA A O   
1610 C CB  . ALA A 206 ? 0.2826 0.2636 0.2928 -0.0180 -0.0015 0.0225  206  ALA A CB  
1611 N N   . ALA A 207 ? 0.2711 0.2412 0.2774 -0.0087 -0.0011 0.0206  207  ALA A N   
1612 C CA  . ALA A 207 ? 0.3672 0.3314 0.3687 -0.0051 -0.0004 0.0192  207  ALA A CA  
1613 C C   . ALA A 207 ? 0.4549 0.4110 0.4522 -0.0014 -0.0005 0.0192  207  ALA A C   
1614 O O   . ALA A 207 ? 0.4467 0.3924 0.4354 0.0003  -0.0001 0.0179  207  ALA A O   
1615 C CB  . ALA A 207 ? 0.2932 0.2657 0.3010 -0.0017 0.0000  0.0196  207  ALA A CB  
1616 N N   . SER A 208 ? 0.3417 0.3019 0.3440 0.0001  -0.0014 0.0205  208  SER A N   
1617 C CA  . SER A 208 ? 0.4004 0.3541 0.3991 0.0038  -0.0019 0.0208  208  SER A CA  
1618 C C   . SER A 208 ? 0.4062 0.3478 0.3950 0.0011  -0.0016 0.0206  208  SER A C   
1619 O O   . SER A 208 ? 0.4183 0.3497 0.3994 0.0043  -0.0016 0.0202  208  SER A O   
1620 C CB  . SER A 208 ? 0.2818 0.2418 0.2868 0.0050  -0.0033 0.0221  208  SER A CB  
1621 O OG  . SER A 208 ? 0.3478 0.3171 0.3607 0.0073  -0.0040 0.0224  208  SER A OG  
1622 N N   . VAL A 209 ? 0.3916 0.3347 0.3803 -0.0048 -0.0014 0.0213  209  VAL A N   
1623 C CA  . VAL A 209 ? 0.3747 0.3079 0.3547 -0.0090 -0.0011 0.0218  209  VAL A CA  
1624 C C   . VAL A 209 ? 0.4484 0.3707 0.4196 -0.0096 -0.0010 0.0202  209  VAL A C   
1625 O O   . VAL A 209 ? 0.4574 0.3658 0.4184 -0.0090 -0.0012 0.0201  209  VAL A O   
1626 C CB  . VAL A 209 ? 0.3907 0.3310 0.3736 -0.0157 -0.0007 0.0229  209  VAL A CB  
1627 C CG1 . VAL A 209 ? 0.3330 0.2636 0.3066 -0.0220 -0.0004 0.0234  209  VAL A CG1 
1628 C CG2 . VAL A 209 ? 0.3411 0.2893 0.3298 -0.0145 -0.0007 0.0243  209  VAL A CG2 
1629 N N   . GLY A 210 ? 0.3912 0.3187 0.3653 -0.0102 -0.0007 0.0188  210  GLY A N   
1630 C CA  . GLY A 210 ? 0.3803 0.2980 0.3457 -0.0102 -0.0006 0.0167  210  GLY A CA  
1631 C C   . GLY A 210 ? 0.4514 0.3591 0.4103 -0.0027 -0.0004 0.0156  210  GLY A C   
1632 O O   . GLY A 210 ? 0.4792 0.3717 0.4260 -0.0025 -0.0006 0.0142  210  GLY A O   
1633 N N   . MET A 211 ? 0.3893 0.3051 0.3556 0.0037  -0.0002 0.0163  211  MET A N   
1634 C CA  . MET A 211 ? 0.4038 0.3132 0.3652 0.0118  -0.0001 0.0154  211  MET A CA  
1635 C C   . MET A 211 ? 0.3988 0.2953 0.3517 0.0137  -0.0009 0.0163  211  MET A C   
1636 O O   . MET A 211 ? 0.4022 0.2875 0.3461 0.0196  -0.0009 0.0152  211  MET A O   
1637 C CB  . MET A 211 ? 0.3996 0.3238 0.3722 0.0174  0.0002  0.0161  211  MET A CB  
1638 C CG  . MET A 211 ? 0.4853 0.4161 0.4602 0.0184  0.0016  0.0148  211  MET A CG  
1639 S SD  . MET A 211 ? 0.5959 0.5461 0.5857 0.0199  0.0017  0.0166  211  MET A SD  
1640 C CE  . MET A 211 ? 0.5360 0.4918 0.5273 0.0156  0.0030  0.0158  211  MET A CE  
1641 N N   . HIS A 212 ? 0.3877 0.2857 0.3428 0.0093  -0.0015 0.0183  212  HIS A N   
1642 C CA  . HIS A 212 ? 0.4157 0.3009 0.3618 0.0096  -0.0023 0.0196  212  HIS A CA  
1643 C C   . HIS A 212 ? 0.4893 0.3571 0.4217 0.0048  -0.0023 0.0189  212  HIS A C   
1644 O O   . HIS A 212 ? 0.4785 0.3302 0.3992 0.0081  -0.0029 0.0190  212  HIS A O   
1645 C CB  . HIS A 212 ? 0.4036 0.2957 0.3551 0.0060  -0.0026 0.0219  212  HIS A CB  
1646 C CG  . HIS A 212 ? 0.4135 0.3184 0.3754 0.0113  -0.0034 0.0224  212  HIS A CG  
1647 N ND1 . HIS A 212 ? 0.4008 0.3035 0.3612 0.0190  -0.0044 0.0226  212  HIS A ND1 
1648 C CD2 . HIS A 212 ? 0.3801 0.2995 0.3532 0.0098  -0.0035 0.0228  212  HIS A CD2 
1649 C CE1 . HIS A 212 ? 0.4594 0.3755 0.4303 0.0212  -0.0053 0.0231  212  HIS A CE1 
1650 N NE2 . HIS A 212 ? 0.4201 0.3454 0.3982 0.0157  -0.0048 0.0232  212  HIS A NE2 
1651 N N   . ILE A 213 ? 0.4769 0.3473 0.4102 -0.0030 -0.0020 0.0183  213  ILE A N   
1652 C CA  . ILE A 213 ? 0.4899 0.3441 0.4101 -0.0086 -0.0025 0.0173  213  ILE A CA  
1653 C C   . ILE A 213 ? 0.6070 0.4473 0.5167 -0.0015 -0.0027 0.0145  213  ILE A C   
1654 O O   . ILE A 213 ? 0.6225 0.4432 0.5176 -0.0023 -0.0036 0.0139  213  ILE A O   
1655 C CB  . ILE A 213 ? 0.4309 0.2932 0.3552 -0.0173 -0.0025 0.0166  213  ILE A CB  
1656 C CG1 . ILE A 213 ? 0.4286 0.3043 0.3621 -0.0238 -0.0021 0.0194  213  ILE A CG1 
1657 C CG2 . ILE A 213 ? 0.4739 0.3183 0.3835 -0.0234 -0.0036 0.0150  213  ILE A CG2 
1658 C CD1 . ILE A 213 ? 0.3732 0.2588 0.3115 -0.0319 -0.0023 0.0192  213  ILE A CD1 
1659 N N   . LEU A 214 ? 0.5663 0.4167 0.4828 0.0059  -0.0018 0.0129  214  LEU A N   
1660 C CA  . LEU A 214 ? 0.5344 0.3744 0.4416 0.0129  -0.0015 0.0100  214  LEU A CA  
1661 C C   . LEU A 214 ? 0.5994 0.4350 0.5036 0.0242  -0.0014 0.0101  214  LEU A C   
1662 O O   . LEU A 214 ? 0.5755 0.4037 0.4722 0.0321  -0.0009 0.0078  214  LEU A O   
1663 C CB  . LEU A 214 ? 0.4457 0.3004 0.3615 0.0145  -0.0002 0.0083  214  LEU A CB  
1664 C CG  . LEU A 214 ? 0.5727 0.4326 0.4912 0.0046  -0.0006 0.0079  214  LEU A CG  
1665 C CD1 . LEU A 214 ? 0.4950 0.3705 0.4227 0.0067  0.0007  0.0069  214  LEU A CD1 
1666 C CD2 . LEU A 214 ? 0.4871 0.3265 0.3891 -0.0010 -0.0020 0.0059  214  LEU A CD2 
1667 N N   . SER A 215 ? 0.5961 0.4379 0.5067 0.0254  -0.0019 0.0128  215  SER A N   
1668 C CA  . SER A 215 ? 0.5165 0.3563 0.4254 0.0359  -0.0023 0.0134  215  SER A CA  
1669 C C   . SER A 215 ? 0.5619 0.3846 0.4593 0.0353  -0.0038 0.0153  215  SER A C   
1670 O O   . SER A 215 ? 0.5249 0.3516 0.4266 0.0298  -0.0043 0.0178  215  SER A O   
1671 C CB  . SER A 215 ? 0.5054 0.3674 0.4310 0.0390  -0.0021 0.0150  215  SER A CB  
1672 O OG  . SER A 215 ? 0.5794 0.4417 0.5038 0.0498  -0.0026 0.0153  215  SER A OG  
1673 N N   . LEU A 216 ? 0.6054 0.4085 0.4875 0.0416  -0.0043 0.0140  216  LEU A N   
1674 C CA  . LEU A 216 ? 0.6028 0.3844 0.4701 0.0402  -0.0058 0.0157  216  LEU A CA  
1675 C C   . LEU A 216 ? 0.5828 0.3700 0.4550 0.0410  -0.0067 0.0192  216  LEU A C   
1676 O O   . LEU A 216 ? 0.6242 0.4035 0.4914 0.0333  -0.0073 0.0216  216  LEU A O   
1677 C CB  . LEU A 216 ? 0.8052 0.5658 0.6557 0.0505  -0.0065 0.0138  216  LEU A CB  
1678 C CG  . LEU A 216 ? 1.0013 0.7498 0.8418 0.0481  -0.0061 0.0101  216  LEU A CG  
1679 C CD1 . LEU A 216 ? 0.9893 0.7142 0.8108 0.0587  -0.0068 0.0077  216  LEU A CD1 
1680 C CD2 . LEU A 216 ? 1.0955 0.8347 0.9308 0.0331  -0.0068 0.0109  216  LEU A CD2 
1681 N N   . PRO A 217 ? 0.5923 0.3935 0.4738 0.0503  -0.0070 0.0196  217  PRO A N   
1682 C CA  . PRO A 217 ? 0.5132 0.3178 0.3974 0.0511  -0.0083 0.0228  217  PRO A CA  
1683 C C   . PRO A 217 ? 0.5354 0.3529 0.4300 0.0409  -0.0079 0.0245  217  PRO A C   
1684 O O   . PRO A 217 ? 0.6131 0.4304 0.5071 0.0401  -0.0088 0.0271  217  PRO A O   
1685 C CB  . PRO A 217 ? 0.5099 0.3307 0.4043 0.0620  -0.0089 0.0225  217  PRO A CB  
1686 C CG  . PRO A 217 ? 0.5169 0.3338 0.4069 0.0696  -0.0078 0.0196  217  PRO A CG  
1687 C CD  . PRO A 217 ? 0.4427 0.2558 0.3311 0.0605  -0.0063 0.0176  217  PRO A CD  
1688 N N   . SER A 218 ? 0.5372 0.3660 0.4409 0.0340  -0.0065 0.0232  218  SER A N   
1689 C CA  . SER A 218 ? 0.5573 0.3973 0.4696 0.0251  -0.0060 0.0248  218  SER A CA  
1690 C C   . SER A 218 ? 0.6176 0.4443 0.5198 0.0155  -0.0056 0.0261  218  SER A C   
1691 O O   . SER A 218 ? 0.5837 0.4157 0.4889 0.0091  -0.0052 0.0283  218  SER A O   
1692 C CB  . SER A 218 ? 0.4643 0.3225 0.3906 0.0221  -0.0050 0.0233  218  SER A CB  
1693 O OG  . SER A 218 ? 0.5212 0.3934 0.4578 0.0293  -0.0055 0.0229  218  SER A OG  
1694 N N   . ARG A 219 ? 0.6859 0.4949 0.5752 0.0146  -0.0057 0.0248  219  ARG A N   
1695 C CA  . ARG A 219 ? 0.7490 0.5465 0.6294 0.0037  -0.0055 0.0258  219  ARG A CA  
1696 C C   . ARG A 219 ? 0.6872 0.4760 0.5602 -0.0009 -0.0058 0.0296  219  ARG A C   
1697 O O   . ARG A 219 ? 0.7083 0.4992 0.5815 -0.0113 -0.0050 0.0314  219  ARG A O   
1698 C CB  . ARG A 219 ? 0.8169 0.5952 0.6836 0.0038  -0.0062 0.0234  219  ARG A CB  
1699 C CG  . ARG A 219 ? 0.8291 0.6181 0.7034 0.0050  -0.0055 0.0199  219  ARG A CG  
1700 C CD  . ARG A 219 ? 0.8657 0.6717 0.7518 -0.0050 -0.0046 0.0204  219  ARG A CD  
1701 N NE  . ARG A 219 ? 0.8347 0.6309 0.7127 -0.0167 -0.0051 0.0222  219  ARG A NE  
1702 C CZ  . ARG A 219 ? 0.9167 0.7027 0.7864 -0.0236 -0.0059 0.0206  219  ARG A CZ  
1703 N NH1 . ARG A 219 ? 0.9218 0.7052 0.7893 -0.0195 -0.0061 0.0169  219  ARG A NH1 
1704 N NH2 . ARG A 219 ? 1.0545 0.8332 0.9176 -0.0350 -0.0065 0.0227  219  ARG A NH2 
1705 N N   . SER A 220 ? 0.6098 0.3905 0.4767 0.0071  -0.0068 0.0310  220  SER A N   
1706 C CA  . SER A 220 ? 0.6641 0.4362 0.5231 0.0037  -0.0071 0.0349  220  SER A CA  
1707 C C   . SER A 220 ? 0.6697 0.4613 0.5410 0.0016  -0.0061 0.0368  220  SER A C   
1708 O O   . SER A 220 ? 0.7459 0.5328 0.6114 -0.0004 -0.0061 0.0401  220  SER A O   
1709 C CB  . SER A 220 ? 0.8271 0.5827 0.6739 0.0138  -0.0089 0.0358  220  SER A CB  
1710 O OG  . SER A 220 ? 0.8694 0.6387 0.7262 0.0247  -0.0096 0.0347  220  SER A OG  
1711 N N   . LEU A 221 ? 0.5900 0.4024 0.4772 0.0019  -0.0054 0.0349  221  LEU A N   
1712 C CA  . LEU A 221 ? 0.4979 0.3275 0.3960 0.0020  -0.0049 0.0361  221  LEU A CA  
1713 C C   . LEU A 221 ? 0.4972 0.3398 0.4032 -0.0072 -0.0031 0.0365  221  LEU A C   
1714 O O   . LEU A 221 ? 0.4815 0.3387 0.3964 -0.0073 -0.0025 0.0371  221  LEU A O   
1715 C CB  . LEU A 221 ? 0.5035 0.3472 0.4135 0.0107  -0.0060 0.0339  221  LEU A CB  
1716 C CG  . LEU A 221 ? 0.6211 0.4578 0.5268 0.0213  -0.0080 0.0332  221  LEU A CG  
1717 C CD1 . LEU A 221 ? 0.5643 0.4183 0.4838 0.0275  -0.0088 0.0311  221  LEU A CD1 
1718 C CD2 . LEU A 221 ? 0.5938 0.4203 0.4897 0.0251  -0.0094 0.0360  221  LEU A CD2 
1719 N N   . PHE A 222 ? 0.4749 0.3127 0.3777 -0.0145 -0.0023 0.0360  222  PHE A N   
1720 C CA  . PHE A 222 ? 0.5816 0.4327 0.4917 -0.0235 -0.0007 0.0367  222  PHE A CA  
1721 C C   . PHE A 222 ? 0.5566 0.3968 0.4580 -0.0329 -0.0005 0.0373  222  PHE A C   
1722 O O   . PHE A 222 ? 0.6024 0.4255 0.4934 -0.0317 -0.0018 0.0361  222  PHE A O   
1723 C CB  . PHE A 222 ? 0.4198 0.2893 0.3448 -0.0212 -0.0005 0.0341  222  PHE A CB  
1724 C CG  . PHE A 222 ? 0.4536 0.3197 0.3789 -0.0196 -0.0012 0.0311  222  PHE A CG  
1725 C CD1 . PHE A 222 ? 0.4895 0.3501 0.4133 -0.0107 -0.0023 0.0292  222  PHE A CD1 
1726 C CD2 . PHE A 222 ? 0.4739 0.3433 0.4007 -0.0269 -0.0008 0.0302  222  PHE A CD2 
1727 C CE1 . PHE A 222 ? 0.5280 0.3860 0.4515 -0.0087 -0.0026 0.0264  222  PHE A CE1 
1728 C CE2 . PHE A 222 ? 0.5247 0.3902 0.4504 -0.0252 -0.0015 0.0273  222  PHE A CE2 
1729 C CZ  . PHE A 222 ? 0.4966 0.3563 0.4204 -0.0161 -0.0022 0.0253  222  PHE A CZ  
1730 N N   . HIS A 223 ? 0.5549 0.4054 0.4604 -0.0421 0.0009  0.0390  223  HIS A N   
1731 C CA  . HIS A 223 ? 0.6103 0.4516 0.5075 -0.0529 0.0007  0.0401  223  HIS A CA  
1732 C C   . HIS A 223 ? 0.6341 0.4887 0.5402 -0.0586 0.0007  0.0383  223  HIS A C   
1733 O O   . HIS A 223 ? 0.7389 0.5844 0.6381 -0.0658 -0.0004 0.0377  223  HIS A O   
1734 C CB  . HIS A 223 ? 0.5615 0.4017 0.4532 -0.0606 0.0021  0.0447  223  HIS A CB  
1735 C CG  . HIS A 223 ? 0.6606 0.4926 0.5462 -0.0538 0.0022  0.0466  223  HIS A CG  
1736 N ND1 . HIS A 223 ? 0.6754 0.4836 0.5454 -0.0519 0.0007  0.0477  223  HIS A ND1 
1737 C CD2 . HIS A 223 ? 0.5346 0.3783 0.4272 -0.0472 0.0032  0.0472  223  HIS A CD2 
1738 C CE1 . HIS A 223 ? 0.6282 0.4351 0.4964 -0.0448 0.0009  0.0492  223  HIS A CE1 
1739 N NE2 . HIS A 223 ? 0.6478 0.4760 0.5294 -0.0422 0.0023  0.0489  223  HIS A NE2 
1740 N N   . ARG A 224 ? 0.5930 0.4681 0.5135 -0.0550 0.0017  0.0372  224  ARG A N   
1741 C CA  . ARG A 224 ? 0.5964 0.4860 0.5258 -0.0599 0.0017  0.0360  224  ARG A CA  
1742 C C   . ARG A 224 ? 0.5603 0.4635 0.5020 -0.0513 0.0017  0.0335  224  ARG A C   
1743 O O   . ARG A 224 ? 0.5362 0.4409 0.4807 -0.0436 0.0020  0.0334  224  ARG A O   
1744 C CB  . ARG A 224 ? 0.5487 0.4534 0.4833 -0.0681 0.0034  0.0393  224  ARG A CB  
1745 C CG  . ARG A 224 ? 0.6803 0.5768 0.6058 -0.0801 0.0030  0.0415  224  ARG A CG  
1746 C CD  . ARG A 224 ? 0.6550 0.5669 0.5848 -0.0878 0.0052  0.0456  224  ARG A CD  
1747 N NE  . ARG A 224 ? 0.7917 0.7026 0.7195 -0.0831 0.0071  0.0480  224  ARG A NE  
1748 C CZ  . ARG A 224 ? 0.8568 0.7506 0.7719 -0.0857 0.0072  0.0506  224  ARG A CZ  
1749 N NH1 . ARG A 224 ? 0.8377 0.7129 0.7406 -0.0932 0.0054  0.0512  224  ARG A NH1 
1750 N NH2 . ARG A 224 ? 0.8870 0.7814 0.8008 -0.0805 0.0088  0.0526  224  ARG A NH2 
1751 N N   . ALA A 225 ? 0.5154 0.4284 0.4639 -0.0531 0.0013  0.0317  225  ALA A N   
1752 C CA  . ALA A 225 ? 0.4527 0.3765 0.4114 -0.0457 0.0011  0.0295  225  ALA A CA  
1753 C C   . ALA A 225 ? 0.4432 0.3839 0.4115 -0.0490 0.0012  0.0292  225  ALA A C   
1754 O O   . ALA A 225 ? 0.4434 0.3847 0.4095 -0.0563 0.0005  0.0292  225  ALA A O   
1755 C CB  . ALA A 225 ? 0.4049 0.3170 0.3588 -0.0404 -0.0001 0.0267  225  ALA A CB  
1756 N N   . VAL A 226 ? 0.3772 0.3310 0.3556 -0.0434 0.0016  0.0290  226  VAL A N   
1757 C CA  . VAL A 226 ? 0.3987 0.3678 0.3860 -0.0445 0.0015  0.0287  226  VAL A CA  
1758 C C   . VAL A 226 ? 0.4520 0.4230 0.4443 -0.0379 0.0006  0.0266  226  VAL A C   
1759 O O   . VAL A 226 ? 0.4757 0.4461 0.4707 -0.0313 0.0006  0.0263  226  VAL A O   
1760 C CB  . VAL A 226 ? 0.3955 0.3789 0.3898 -0.0437 0.0028  0.0306  226  VAL A CB  
1761 C CG1 . VAL A 226 ? 0.4482 0.4474 0.4511 -0.0442 0.0024  0.0305  226  VAL A CG1 
1762 C CG2 . VAL A 226 ? 0.3570 0.3398 0.3464 -0.0501 0.0042  0.0333  226  VAL A CG2 
1763 N N   . LEU A 227 ? 0.4160 0.3893 0.4092 -0.0400 -0.0003 0.0254  227  LEU A N   
1764 C CA  . LEU A 227 ? 0.4408 0.4163 0.4383 -0.0344 -0.0009 0.0238  227  LEU A CA  
1765 C C   . LEU A 227 ? 0.4213 0.4114 0.4270 -0.0348 -0.0013 0.0244  227  LEU A C   
1766 O O   . LEU A 227 ? 0.3609 0.3554 0.3662 -0.0397 -0.0020 0.0243  227  LEU A O   
1767 C CB  . LEU A 227 ? 0.3907 0.3559 0.3814 -0.0347 -0.0015 0.0217  227  LEU A CB  
1768 C CG  . LEU A 227 ? 0.4568 0.4066 0.4392 -0.0315 -0.0013 0.0208  227  LEU A CG  
1769 C CD1 . LEU A 227 ? 0.3508 0.2900 0.3239 -0.0374 -0.0014 0.0216  227  LEU A CD1 
1770 C CD2 . LEU A 227 ? 0.3799 0.3226 0.3578 -0.0281 -0.0015 0.0185  227  LEU A CD2 
1771 N N   . GLN A 228 ? 0.3628 0.3596 0.3750 -0.0296 -0.0012 0.0250  228  GLN A N   
1772 C CA  . GLN A 228 ? 0.3302 0.3396 0.3494 -0.0285 -0.0017 0.0257  228  GLN A CA  
1773 C C   . GLN A 228 ? 0.3858 0.3953 0.4075 -0.0249 -0.0026 0.0250  228  GLN A C   
1774 O O   . GLN A 228 ? 0.3826 0.3882 0.4056 -0.0204 -0.0026 0.0247  228  GLN A O   
1775 C CB  . GLN A 228 ? 0.2569 0.2730 0.2804 -0.0251 -0.0011 0.0269  228  GLN A CB  
1776 C CG  . GLN A 228 ? 0.2670 0.2845 0.2880 -0.0286 0.0002  0.0280  228  GLN A CG  
1777 C CD  . GLN A 228 ? 0.3534 0.3760 0.3770 -0.0241 0.0011  0.0288  228  GLN A CD  
1778 O OE1 . GLN A 228 ? 0.3526 0.3730 0.3729 -0.0252 0.0024  0.0297  228  GLN A OE1 
1779 N NE2 . GLN A 228 ? 0.3412 0.3692 0.3695 -0.0187 0.0003  0.0286  228  GLN A NE2 
1780 N N   . SER A 229 ? 0.3238 0.3377 0.3458 -0.0274 -0.0034 0.0248  229  SER A N   
1781 C CA  . SER A 229 ? 0.2600 0.2747 0.2838 -0.0246 -0.0040 0.0245  229  SER A CA  
1782 C C   . SER A 229 ? 0.2864 0.2920 0.3076 -0.0214 -0.0034 0.0235  229  SER A C   
1783 O O   . SER A 229 ? 0.2692 0.2763 0.2940 -0.0177 -0.0035 0.0242  229  SER A O   
1784 C CB  . SER A 229 ? 0.2700 0.2919 0.3000 -0.0204 -0.0046 0.0259  229  SER A CB  
1785 O OG  . SER A 229 ? 0.3627 0.3943 0.3956 -0.0214 -0.0051 0.0270  229  SER A OG  
1786 N N   . GLY A 230 ? 0.3095 0.3062 0.3243 -0.0229 -0.0028 0.0221  230  GLY A N   
1787 C CA  . GLY A 230 ? 0.3404 0.3301 0.3528 -0.0191 -0.0020 0.0211  230  GLY A CA  
1788 C C   . GLY A 230 ? 0.3696 0.3481 0.3729 -0.0207 -0.0016 0.0194  230  GLY A C   
1789 O O   . GLY A 230 ? 0.4233 0.3980 0.4227 -0.0249 -0.0019 0.0194  230  GLY A O   
1790 N N   . THR A 231 ? 0.3212 0.2942 0.3207 -0.0173 -0.0009 0.0181  231  THR A N   
1791 C CA  . THR A 231 ? 0.4592 0.4194 0.4481 -0.0177 -0.0006 0.0160  231  THR A CA  
1792 C C   . THR A 231 ? 0.4083 0.3648 0.3958 -0.0108 0.0005  0.0152  231  THR A C   
1793 O O   . THR A 231 ? 0.3780 0.3430 0.3722 -0.0074 0.0011  0.0161  231  THR A O   
1794 C CB  . THR A 231 ? 0.4098 0.3680 0.3927 -0.0214 -0.0012 0.0143  231  THR A CB  
1795 O OG1 . THR A 231 ? 0.4367 0.4028 0.4237 -0.0185 -0.0006 0.0144  231  THR A OG1 
1796 C CG2 . THR A 231 ? 0.3572 0.3204 0.3415 -0.0287 -0.0026 0.0151  231  THR A CG2 
1797 N N   . PRO A 232 ? 0.4460 0.3897 0.4245 -0.0086 0.0007  0.0138  232  PRO A N   
1798 C CA  . PRO A 232 ? 0.3930 0.3354 0.3706 -0.0009 0.0019  0.0131  232  PRO A CA  
1799 C C   . PRO A 232 ? 0.4285 0.3713 0.4021 0.0011  0.0030  0.0112  232  PRO A C   
1800 O O   . PRO A 232 ? 0.4444 0.3929 0.4210 0.0070  0.0044  0.0113  232  PRO A O   
1801 C CB  . PRO A 232 ? 0.3577 0.2854 0.3256 0.0014  0.0017  0.0122  232  PRO A CB  
1802 C CG  . PRO A 232 ? 0.3630 0.2811 0.3233 -0.0063 0.0005  0.0117  232  PRO A CG  
1803 C CD  . PRO A 232 ? 0.4366 0.3668 0.4049 -0.0127 -0.0001 0.0129  232  PRO A CD  
1804 N N   . ASN A 233 ? 0.4327 0.3701 0.3993 -0.0037 0.0023  0.0096  233  ASN A N   
1805 C CA  . ASN A 233 ? 0.4116 0.3499 0.3740 -0.0021 0.0032  0.0077  233  ASN A CA  
1806 C C   . ASN A 233 ? 0.4121 0.3662 0.3850 -0.0040 0.0034  0.0099  233  ASN A C   
1807 O O   . ASN A 233 ? 0.4193 0.3813 0.4012 -0.0066 0.0026  0.0122  233  ASN A O   
1808 C CB  . ASN A 233 ? 0.4092 0.3354 0.3595 -0.0073 0.0017  0.0051  233  ASN A CB  
1809 C CG  . ASN A 233 ? 0.4829 0.4122 0.4366 -0.0161 -0.0003 0.0065  233  ASN A CG  
1810 O OD1 . ASN A 233 ? 0.5112 0.4391 0.4675 -0.0181 -0.0008 0.0081  233  ASN A OD1 
1811 N ND2 . ASN A 233 ? 0.4597 0.3946 0.4136 -0.0211 -0.0015 0.0062  233  ASN A ND2 
1812 N N   . GLY A 234 ? 0.3804 0.3382 0.3512 -0.0026 0.0044  0.0090  234  GLY A N   
1813 C CA  . GLY A 234 ? 0.3639 0.3354 0.3434 -0.0041 0.0045  0.0113  234  GLY A CA  
1814 C C   . GLY A 234 ? 0.4229 0.4037 0.4089 0.0014  0.0067  0.0132  234  GLY A C   
1815 O O   . GLY A 234 ? 0.4766 0.4551 0.4613 0.0069  0.0082  0.0125  234  GLY A O   
1816 N N   . PRO A 235 ? 0.4369 0.4287 0.4299 -0.0001 0.0069  0.0157  235  PRO A N   
1817 C CA  . PRO A 235 ? 0.4296 0.4307 0.4269 0.0039  0.0