data_2WHQ
# 
_entry.id   2WHQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WHQ         
PDBE  EBI-39644    
WWPDB D_1290039644 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WHQ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ekstrom, F.'       1 
'Hornberg, A.'      2 
'Artursson, E.'     3 
'Hammarstrom, L.G.' 4 
'Schneider, G.'     5 
'Pang, Y.P.'        6 
# 
_citation.id                        primary 
_citation.title                     
;Structure of Hi-6Sarin-Acetylcholinesterase Determined by X-Ray Crystallography and Molecular Dynamics Simulation: Reactivator Mechanism and Design.
;
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            4 
_citation.page_first                E5957 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19536291 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PONE.0005957 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ekstrom, F.'       1 ? 
primary 'Hornberg, A.'      2 ? 
primary 'Artursson, E.'     3 ? 
primary 'Hammarstrom, L.G.' 4 ? 
primary 'Schneider, G.'     5 ? 
primary 'Pang, Y.P.'        6 ? 
# 
_cell.entry_id           2WHQ 
_cell.length_a           79.550 
_cell.length_b           112.320 
_cell.length_c           227.060 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WHQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                                                           60311.992 2   
3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' 'CATALYTIC SER203 PHOSPHONYLATED BY SARIN. THE COMPLEX WAS SUBSEQUENTLY AGED' 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       221.208   3   ? ? 
?                                   ?                                                                             
3 non-polymer syn '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 288.302   2   ? ? 
?                                   ?                                                                             
4 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                                          282.331   1   ? ? 
?                                   ?                                                                             
5 non-polymer syn 'TRIETHYLENE GLYCOL'                                                                           150.173   4   ? ? 
?                                   ?                                                                             
6 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                        106.120   1   ? ? 
?                                   ?                                                                             
7 water       nat water                                                                                          18.015    650 ? ? 
?                                   ?                                                                             
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SBG)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGEXAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SBG n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               MOUSE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HUMAN EMBRYONIC KIDNEY (HEK) 293 CELLS' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCDNA3.1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACES_MOUSE 1 ? ? P21836 ? 
2 PDB 2WHQ       1 ? ? 2WHQ   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2WHQ A 1   ? 543 ? P21836 32  ? 574 ? 1   543 
2 2 2WHQ A 544 ? 548 ? 2WHQ   544 ? 548 ? 544 548 
3 1 2WHQ B 1   ? 543 ? P21836 32  ? 574 ? 1   543 
4 2 2WHQ B 544 ? 548 ? 2WHQ   544 ? 548 ? 544 548 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                        
? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                       
? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                     
? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                                
? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                                                       
? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                      
? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                                
? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                                                        
? 'C2 H5 N O2'      75.067  
HI6 non-polymer                  . '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 
'1-(2-HYDROXY-IMINOMETHYLPYRIDINIUM)-1-(4-CARBOXYAMINO)-PYRIDINIUM DIMETHYLETHER' 'C14 H16 N4 O3 2' 288.302 
HIS 'L-peptide linking'          y HISTIDINE                                                                                      
? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                                                                                          
? 'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                     
? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                        
? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                         
? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                     
? 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'     221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                                                                          
'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'      282.331 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                                                                        
? 'C4 H10 O3'       106.120 
PGE non-polymer                  . 'TRIETHYLENE GLYCOL'                                                                           
? 'C6 H14 O4'       150.173 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                  
? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                        
? 'C5 H9 N O2'      115.130 
SBG non-polymer                  n 'O-[(S)-HYDROXY(METHYL)PHOSPHORYL]-L-SERINE'                                                   
? 'C4 H10 N O5 P'   183.100 
SER 'L-peptide linking'          y SERINE                                                                                         
? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking'          y THREONINE                                                                                      
? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                     
? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                       
? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                                                         
? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2WHQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.1 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '26-30 % (V/V) PEG750MME 0.1 M HEPES PH 7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-02-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.041 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             1.041 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WHQ 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.20 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   110895 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.30 
_reflns.B_iso_Wilson_estimate        45.78 
_reflns.pdbx_redundancy              5.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.30 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.44 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.50 
_reflns_shell.pdbx_redundancy        5.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WHQ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     110749 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.089 
_refine.ls_d_res_high                            2.150 
_refine.ls_percent_reflns_obs                    99.59 
_refine.ls_R_factor_obs                          0.1860 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1855 
_refine.ls_R_factor_R_free                       0.2119 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2191 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.8764 
_refine.aniso_B[2][2]                            0.7953 
_refine.aniso_B[3][3]                            0.0811 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.361 
_refine.solvent_model_param_bsol                 70.001 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'RESIDUES 258-264 ARE DISORDERED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.35 
_refine.pdbx_overall_phase_error                 20.38 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8313 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         132 
_refine_hist.number_atoms_solvent             650 
_refine_hist.number_atoms_total               9095 
_refine_hist.d_res_high                       2.150 
_refine_hist.d_res_low                        29.089 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 8737  'X-RAY DIFFRACTION' ? 
f_angle_d          1.235  ? ? 11909 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.237 ? ? 3130  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.085  ? ? 1280  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1562  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.1500 2.1967  6658 0.3523 99.00  0.3714 . . 123 . . 
'X-RAY DIFFRACTION' . 2.1967 2.2478  6743 0.2686 100.00 0.2762 . . 141 . . 
'X-RAY DIFFRACTION' . 2.2478 2.3040  6691 0.2268 100.00 0.2711 . . 139 . . 
'X-RAY DIFFRACTION' . 2.3040 2.3663  6720 0.2123 100.00 0.2668 . . 147 . . 
'X-RAY DIFFRACTION' . 2.3663 2.4359  6776 0.2075 100.00 0.2350 . . 131 . . 
'X-RAY DIFFRACTION' . 2.4359 2.5145  6754 0.1830 100.00 0.2132 . . 115 . . 
'X-RAY DIFFRACTION' . 2.5145 2.6043  6766 0.1778 100.00 0.2102 . . 147 . . 
'X-RAY DIFFRACTION' . 2.6043 2.7085  6741 0.1698 100.00 0.2257 . . 151 . . 
'X-RAY DIFFRACTION' . 2.7085 2.8316  6784 0.1742 100.00 0.2079 . . 133 . . 
'X-RAY DIFFRACTION' . 2.8316 2.9808  6796 0.1710 100.00 0.2064 . . 137 . . 
'X-RAY DIFFRACTION' . 2.9808 3.1673  6785 0.1769 100.00 0.1891 . . 148 . . 
'X-RAY DIFFRACTION' . 3.1673 3.4115  6831 0.1736 100.00 0.2072 . . 125 . . 
'X-RAY DIFFRACTION' . 3.4115 3.7542  6839 0.1580 100.00 0.1663 . . 146 . . 
'X-RAY DIFFRACTION' . 3.7542 4.2960  6880 0.1402 100.00 0.1739 . . 134 . . 
'X-RAY DIFFRACTION' . 4.2960 5.4068  6938 0.1349 100.00 0.1531 . . 137 . . 
'X-RAY DIFFRACTION' . 5.4068 29.0921 6856 0.1812 95.00  0.1964 . . 137 . . 
# 
_struct.entry_id                  2WHQ 
_struct.title                     'Crystal structure of acetylcholinesterase, phosphonylated by sarin (aged) in complex with HI-6' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WHQ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HI-6, SYNAPSE, MEMBRANE, SECRETED, HYDROLASE, NEUROTRANSMITTER DEGRADATION, CHOLINESTERASE, SERINE ESTERASE, ALTERNATIVE SPLICING, CELL JUNCTION, CELL MEMBRANE, DISULFIDE BOND, AGED SARIN, GPI-ANCHOR, LIPOPROTEIN, GLYCOPROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 2 ? 
I N N 3 ? 
J N N 6 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 7 ? 
O N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  ALA A 204 ? SER A 215 ? ALA A 204 SER A 215 1 ? 12 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 276 ? ASN A 265 ARG A 276 1 ? 12 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? GLY A 342 ? GLY A 335 GLY A 342 5 ? 8  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? ALA A 542 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 ALA B 204 ? LEU B 214 ? ALA B 204 LEU B 214 1 ? 11 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P39 39 ASN B 265 ? ARG B 276 ? ASN B 265 ARG B 276 1 ? 12 
HELX_P HELX_P40 40 PRO B 277 ? TRP B 286 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P41 41 HIS B 287 ? LEU B 289 ? HIS B 287 LEU B 289 5 ? 3  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P50 50 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P51 51 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P52 52 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P53 53 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P54 54 ARG B 534 ? ALA B 542 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.019 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.097 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.071 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.052 ? ?               
covale1 covale both ? A GLU 202 C   ? ? ? 1_555 A SBG 203 N  ? ? A GLU 202 A SBG 203 1_555 ? ? ? ? ? ? ? 1.329 ? ?               
covale2 covale both ? A SBG 203 C   ? ? ? 1_555 A ALA 204 N  ? ? A SBG 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.333 ? ?               
covale3 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 601 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale4 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale5 covale both ? B GLU 202 C   ? ? ? 1_555 B SBG 203 N  ? ? B GLU 202 B SBG 203 1_555 ? ? ? ? ? ? ? 1.334 ? ?               
covale6 covale both ? B SBG 203 C   ? ? ? 1_555 B ALA 204 N  ? ? B SBG 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.340 ? ?               
covale7 covale one  ? B ASN 350 ND2 ? ? ? 1_555 H NAG .   C1 ? ? B ASN 350 B NAG 601 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -0.74 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 3.13  
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -7.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
BD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
BD 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLY A 201 ? GLY A 192 GLY A 201 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLY B 201 ? GLY B 192 GLY B 201 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
BD 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
BD 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
BD 1  2  O VAL B 239 ? O VAL B 239 N VAL B 303 ? N VAL B 303 
# 
_database_PDB_matrix.entry_id          2WHQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WHQ 
_atom_sites.fract_transf_matrix[1][1]   0.012571 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008903 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004404 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 32.158  14.552  55.475  1.00 94.25  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.706  14.576  55.370  1.00 91.98  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 30.108  14.728  56.760  1.00 90.55  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.793  14.521  57.763  1.00 93.78  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.186  13.303  54.677  1.00 86.89  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.259  12.037  55.520  1.00 77.49  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 30.055  10.768  54.706  1.00 75.03  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.977  10.124  54.841  1.00 66.70  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.981  10.415  53.934  1.00 76.01  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.832  15.093  56.818  1.00 83.32  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.168  15.329  58.087  1.00 72.01  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.832  15.996  57.861  1.00 67.97  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.794  15.444  58.224  1.00 60.55  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.863  17.184  57.250  1.00 74.45  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.645  17.942  56.934  1.00 73.50  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.286  17.894  55.450  1.00 75.76  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.254  18.413  55.047  1.00 84.46  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 25.750  19.400  57.401  1.00 68.93  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 25.112  19.706  58.782  1.00 82.35  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 25.773  18.907  59.891  1.00 80.32  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.713  19.528  61.217  1.00 79.54  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.727  19.351  62.097  1.00 79.87  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.678  18.597  61.800  1.00 77.03  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 24.785  19.936  63.284  1.00 82.46  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 26.131  17.268  54.643  1.00 69.75  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.852  17.125  53.220  1.00 66.72  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.590  16.308  53.000  1.00 61.63  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.182  15.553  53.874  1.00 62.48  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 27.001  16.410  52.519  1.00 76.35  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 28.346  17.091  52.608  1.00 86.36  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.356  16.423  51.708  1.00 95.35  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 30.465  16.094  52.182  1.00 98.27  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.019  16.200  50.526  1.00 99.97  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.995  16.457  51.816  1.00 56.38  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.854  15.651  51.381  1.00 51.76  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.310  14.201  51.172  1.00 54.83  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.176  13.931  50.337  1.00 50.31  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.268  16.228  50.074  1.00 45.33  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.052  15.452  49.565  1.00 50.23  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.843  14.302  49.990  1.00 52.82  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.291  15.993  48.730  1.00 51.37  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.727  13.264  51.939  1.00 59.74  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.062  11.833  51.892  1.00 58.46  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.771  11.160  50.548  1.00 51.54  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.325  10.102  50.277  1.00 49.20  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.167  11.239  52.993  1.00 63.12  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.069  12.293  53.176  1.00 58.52  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.817  13.556  53.063  1.00 55.38  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.925  11.755  49.714  1.00 50.88  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.646  11.185  48.399  1.00 50.31  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.719  11.494  47.366  1.00 50.73  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.710  10.921  46.281  1.00 56.02  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.296  11.668  47.868  1.00 66.05  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.118  10.754  48.189  1.00 70.32  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.198  9.397   47.492  1.00 68.62  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.650  9.288   46.343  1.00 59.43  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 18.749  8.354   48.191  1.00 69.40  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.643  12.397  47.693  1.00 45.90  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.629  12.844  46.703  1.00 41.35  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 26.037  12.271  46.904  1.00 40.52  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.983  12.690  46.242  1.00 44.17  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.679  14.376  46.665  1.00 38.66  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.337  15.022  46.280  1.00 40.63  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.413  16.533  46.419  1.00 35.30  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.908  14.624  44.859  1.00 38.65  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.180  11.324  47.823  1.00 42.54  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.491  10.754  48.089  1.00 39.50  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.526  9.331   47.565  1.00 46.51  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.702  8.494   47.964  1.00 42.00  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.817  10.789  49.584  1.00 42.54  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.679  12.164  50.258  1.00 54.11  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.820  12.072  51.790  1.00 54.62  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.673  13.164  49.681  1.00 55.56  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.477  9.064   46.668  1.00 38.00  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.575  7.775   45.998  1.00 38.45  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 30.049  7.330   45.869  1.00 43.59  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.948  8.150   45.664  1.00 48.29  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.891  7.844   44.592  1.00 46.31  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 28.175  6.593   43.777  1.00 46.13  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.380  8.067   44.736  1.00 46.63  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.302  6.037   45.995  1.00 36.59  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.652  5.526   45.785  1.00 37.37  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.719  4.774   44.462  1.00 40.74  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.819  3.999   44.147  1.00 39.45  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 32.095  4.621   46.946  1.00 35.45  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.418  3.869   46.685  1.00 38.20  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.919  3.097   47.925  1.00 36.91  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.284  3.980   49.041  1.00 36.56  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.494  4.495   49.226  1.00 43.17  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.727  5.274   50.275  1.00 44.61  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.478  4.233   48.360  1.00 43.44  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.770  5.030   43.686  1.00 36.46  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 33.086  4.256   42.491  1.00 29.99  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.474  3.620   42.660  1.00 39.95  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.148  3.857   43.681  1.00 41.49  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.973  5.108   41.194  1.00 30.59  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.519  5.533   40.985  1.00 31.17  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.898  6.339   41.251  1.00 30.28  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.876  2.790   41.695  1.00 40.02  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.143  2.029   41.757  1.00 42.07  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.333  2.932   42.115  1.00 41.68  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.215  2.534   42.862  1.00 43.68  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.371  1.300   40.417  1.00 34.54  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.688  0.510   40.232  1.00 39.97  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.940  -0.655  41.235  1.00 47.81  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.979  -0.174  42.127  1.00 57.74  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.198  -0.672  42.239  1.00 50.67  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.551  -1.761  41.596  1.00 41.73  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 41.046  -0.095  43.061  1.00 61.56  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.328  4.165   41.617  1.00 36.55  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.404  5.090   41.894  1.00 37.85  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.287  5.918   43.169  1.00 44.67  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.242  6.597   43.559  1.00 43.10  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.129  5.889   43.822  1.00 41.45  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.970  6.643   45.047  1.00 43.65  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.591  7.224   45.267  1.00 45.72  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.621  6.808   44.640  1.00 44.10  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.516  8.196   46.164  1.00 41.25  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.247  8.778   46.567  1.00 45.50  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.955  10.004  45.746  1.00 41.54  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.872  10.754  45.398  1.00 41.29  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.282  9.184   48.042  1.00 43.56  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 34.105  8.046   49.009  1.00 50.41  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 34.298  8.498   50.439  1.00 57.83  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 35.422  8.817   50.858  1.00 61.07  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 33.205  8.532   51.201  1.00 49.99  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.673  10.221  45.477  1.00 37.09  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.224  11.355  44.683  1.00 37.00  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.140  12.090  45.444  1.00 40.02  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.369  11.476  46.183  1.00 39.42  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.617  10.874  43.365  1.00 39.08  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.463  10.071  42.390  1.00 44.26  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.575  9.497   41.322  1.00 42.07  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.553  10.940  41.773  1.00 47.27  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 31.079  13.404  45.253  1.00 35.97  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.964  14.186  45.733  1.00 35.00  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.307  14.832  44.517  1.00 37.16  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.941  15.609  43.790  1.00 38.42  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.414  15.269  46.707  1.00 36.70  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.281  16.233  47.088  1.00 43.84  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.711  17.226  48.169  1.00 53.69  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 31.021  17.776  47.864  1.00 63.47  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 32.130  17.518  48.550  1.00 65.04  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.097  16.743  49.631  1.00 57.28  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.279  18.056  48.154  1.00 68.56  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 28.034  14.515  44.312  1.00 33.00  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.286  15.040  43.191  1.00 30.52  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.482  16.255  43.618  1.00 38.16  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.681  16.789  44.716  1.00 39.21  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.560  16.680  42.756  1.00 35.19  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.752  17.865  43.030  1.00 36.49  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.278  17.619  42.682  1.00 37.96  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.957  16.851  41.765  1.00 40.87  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.277  19.084  42.243  1.00 37.11  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.470  20.349  42.587  1.00 41.44  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.205  18.819  40.743  1.00 35.03  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 24.846  21.552  41.747  1.00 39.38  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.387  18.258  43.431  1.00 37.24  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.957  18.111  43.212  1.00 37.89  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.530  19.187  42.235  1.00 40.81  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 20.695  20.371  42.512  1.00 43.50  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.221  18.289  44.543  1.00 41.20  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.711  18.056  44.505  1.00 39.83  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 18.047  18.496  45.838  1.00 38.99  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.934  19.396  45.540  1.00 65.18  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.676  19.233  45.944  1.00 75.02  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.340  18.218  46.734  1.00 79.00  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.752  20.112  45.569  1.00 75.53  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.007  18.788  41.084  1.00 39.26  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.586  19.751  40.071  1.00 39.73  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.077  19.868  40.005  1.00 44.50  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.361  18.939  40.346  1.00 46.26  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.114  19.350  38.687  1.00 41.06  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.636  19.372  38.566  1.00 38.52  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.030  18.991  37.167  1.00 40.22  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.193  20.731  38.951  1.00 39.47  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.600  21.009  39.529  1.00 46.33  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.179  21.235  39.368  1.00 47.07  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.766  20.901  37.936  1.00 47.57  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.318  21.446  36.990  1.00 44.35  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.870  22.702  39.685  1.00 63.12  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 14.556  22.946  40.409  1.00 80.89  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 13.389  23.004  39.436  1.00 91.63  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 12.123  23.513  40.107  1.00 96.63  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 11.059  23.781  39.098  1.00 97.63  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.822  19.979  37.772  1.00 44.75  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.184  19.786  36.478  1.00 41.48  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.736  20.230  36.636  1.00 47.86  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.248  20.319  37.759  1.00 46.76  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.274  18.339  36.029  1.00 38.67  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.048  20.525  35.519  1.00 50.80  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.706  21.126  35.610  1.00 48.21  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.790   20.351  36.542  1.00 48.18  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.126   20.960  37.368  1.00 48.71  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.191  21.050  34.171  1.00 50.16  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.437  21.089  33.337  1.00 48.93  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.459  20.296  34.124  1.00 44.26  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.774   19.027  36.426  1.00 48.23  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.899   18.196  37.234  1.00 46.06  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.449   17.731  38.578  1.00 53.33  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.763   16.993  39.279  1.00 48.63  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.666  18.147  38.944  1.00 50.28  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.275  17.728  40.204  1.00 46.36  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.792  17.580  40.149  1.00 49.36  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.408  17.773  39.103  1.00 49.60  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.416  17.224  41.283  1.00 46.90  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.886  17.237  41.340  1.00 38.70  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.526  16.028  40.637  1.00 41.47  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.857  15.011  40.456  1.00 37.32  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.160  17.178  42.838  1.00 40.30  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.943  16.395  43.389  1.00 41.58  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.809  16.967  42.602  1.00 45.69  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.797  16.145  40.231  1.00 35.79  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.552  14.991  39.730  1.00 33.00  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.944  15.024  40.357  1.00 39.56  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.372  16.054  40.864  1.00 42.34  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.691  14.964  38.159  1.00 41.28  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.328  14.834  37.466  1.00 37.64  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.419  16.188  37.652  1.00 40.84  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.650  13.903  40.311  1.00 35.46  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.014  13.845  40.794  1.00 36.87  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.963  13.952  39.608  1.00 37.77  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.776  13.286  38.606  1.00 37.13  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.269  12.521  41.524  1.00 36.20  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.383  12.356  42.621  1.00 49.59  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.983  14.789  39.728  1.00 38.25  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.999  14.864  38.697  1.00 39.48  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.394  14.684  39.290  1.00 40.69  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.703  15.234  40.350  1.00 42.56  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.895  16.177  37.959  1.00 30.56  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.218  13.901  38.601  1.00 36.20  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.626  13.715  38.963  1.00 34.13  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.422  14.070  37.727  1.00 32.44  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.490  13.304  36.765  1.00 34.39  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.906  12.271  39.426  1.00 32.35  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.078  11.849  40.630  1.00 36.14  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.775  11.381  40.472  1.00 27.92  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.600  11.947  41.918  1.00 34.31  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 25.015  11.003  41.590  1.00 32.23  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.849  11.591  43.032  1.00 37.72  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.555  11.116  42.870  1.00 34.82  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.982  15.268  37.738  1.00 33.63  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.581  15.848  36.545  1.00 33.80  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.102  15.946  36.712  1.00 32.68  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.586  16.207  37.814  1.00 33.63  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 28.992  17.240  36.327  1.00 34.79  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.460  17.334  36.364  1.00 42.04  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.027  18.801  36.358  1.00 35.69  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.787  16.572  35.206  1.00 33.50  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.849  15.740  35.629  1.00 28.31  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.298  15.838  35.694  1.00 30.60  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 34.002  14.675  36.406  1.00 35.72  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 35.026  14.860  37.060  1.00 35.69  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.468  13.467  36.273  1.00 35.20  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.127  12.288  36.837  1.00 35.43  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.278  11.812  35.944  1.00 35.98  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.061  11.435  34.790  1.00 33.57  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.170  11.103  36.961  1.00 32.83  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.942  11.457  37.794  1.00 30.05  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.903  9.892   37.559  1.00 30.64  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.899  10.300  37.799  1.00 33.10  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.505  11.796  36.479  1.00 36.41  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.605  11.375  35.587  1.00 32.56  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.476  9.897   35.283  1.00 41.15  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.199  9.144   36.221  1.00 40.83  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.863  11.609  36.443  1.00 29.73  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.340  11.531  37.911  1.00 34.63  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.973  12.192  37.826  1.00 27.13  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.669  9.469   34.036  1.00 37.12  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.664  8.021   33.765  1.00 36.61  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.990  7.522   33.182  1.00 35.05  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.157  6.334   32.959  1.00 39.74  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.471  7.599   32.885  1.00 37.76  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.492  8.186   31.503  1.00 35.75  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.165  7.548   30.472  1.00 27.29  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.851  9.390   31.235  1.00 35.25  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.198  8.111   29.187  1.00 32.31  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 35.867  9.948   29.961  1.00 32.53  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.552  9.301   28.933  1.00 35.49  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.928  8.442   32.958  1.00 35.82  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.241  8.120   32.397  1.00 34.19  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.292  9.020   33.016  1.00 36.30  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.969  10.107  33.496  1.00 35.35  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.247  8.314   30.877  1.00 31.83  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.548  8.575   32.993  1.00 32.05  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.660  9.477   33.265  1.00 37.22  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.680  10.583  32.204  1.00 36.87  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.480  10.320  31.021  1.00 38.34  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.993  8.713   33.266  1.00 36.23  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.195  7.832   34.492  1.00 43.41  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.273  8.634   35.784  1.00 50.05  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.163  9.501   35.911  1.00 58.24  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.456  8.389   36.686  1.00 44.54  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.933  11.825  32.625  1.00 39.79  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.983  12.918  31.651  1.00 37.29  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.925  12.583  30.483  1.00 39.54  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.097  12.288  30.692  1.00 37.66  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.527  14.093  32.477  1.00 37.45  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.122  13.758  33.897  1.00 38.86  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.321  12.265  33.978  1.00 39.62  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.402  12.596  29.253  1.00 37.03  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.224  12.165  28.116  1.00 34.75  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.164  13.282  27.610  1.00 38.46  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.110  13.643  26.444  1.00 36.21  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.171  11.812  27.072  1.00 37.63  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.110  12.907  27.324  1.00 36.11  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.007  12.882  28.849  1.00 31.62  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.033  13.785  28.485  1.00 41.78  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.844  14.967  28.202  1.00 41.97  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.341  14.617  28.111  1.00 43.40  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.741  13.530  28.506  1.00 36.17  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.641  16.052  29.295  1.00 43.15  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.156  16.384  29.463  1.00 39.08  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.254  15.606  30.636  1.00 41.05  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.158  15.535  27.593  1.00 39.87  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.594  15.316  27.512  1.00 36.59  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.918  14.082  26.699  1.00 40.57  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.498  13.951  25.546  1.00 42.28  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.641  13.151  27.305  1.00 39.01  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.099  11.971  26.581  1.00 45.22  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.933  11.043  26.240  1.00 45.51  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.097  10.095  25.476  1.00 41.39  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.141  11.216  27.408  1.00 47.94  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.518  10.648  28.544  1.00 50.77  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.752  11.311  26.802  1.00 40.71  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.592  10.470  26.518  1.00 38.90  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.734  10.982  25.340  1.00 39.04  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.782  10.314  24.924  1.00 39.00  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.719  10.306  27.763  1.00 45.22  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.360  9.598   28.946  1.00 42.88  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.405  9.754   30.138  1.00 57.60  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 50.002  9.447   31.435  1.00 77.56  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.753  8.338   32.121  1.00 82.85  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 48.918  7.439   31.624  1.00 84.80  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 50.326  8.129   33.300  1.00 78.83  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.060  12.154  24.799  1.00 35.92  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.355  12.629  23.598  1.00 37.55  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.442  11.594  22.476  1.00 36.88  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.514  11.024  22.246  1.00 37.74  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 49.920  13.971  23.105  1.00 38.92  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.106  14.627  21.962  1.00 32.65  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 49.874  15.847  21.394  1.00 34.38  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.742  17.023  22.250  1.00 30.93  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.365  18.176  22.034  1.00 36.25  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.211  18.313  21.010  1.00 31.66  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.148  19.196  22.849  1.00 32.28  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.317  11.376  21.783  1.00 31.05  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.188  10.417  20.668  1.00 28.87  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.112  8.957   21.135  1.00 31.50  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.883  8.067   20.317  1.00 37.98  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.317  10.552  19.620  1.00 31.59  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.568  11.972  19.149  1.00 36.79  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.555  12.722  18.574  1.00 34.67  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 50.829  12.542  19.271  1.00 36.56  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.788  14.023  18.119  1.00 30.86  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.068  13.836  18.841  1.00 33.41  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.031  14.585  18.261  1.00 34.09  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.300  8.705   22.437  1.00 32.61  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.314  7.314   22.946  1.00 36.55  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 46.947  6.854   23.449  1.00 34.16  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.137  7.681   23.844  1.00 35.91  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.333  7.163   24.075  1.00 33.13  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.744  7.572   23.663  1.00 48.56  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.982  6.627   24.581  1.00 51.53  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.857  5.115   23.637  1.00 52.96  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.691  5.529   23.414  1.00 33.88  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.489  4.944   24.022  1.00 36.13  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.352  5.488   25.429  1.00 39.72  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.373  5.728   26.085  1.00 35.15  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.813  3.448   24.080  1.00 37.67  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.751  3.237   22.909  1.00 38.57  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.593  4.496   22.863  1.00 31.79  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.110  5.699   25.889  1.00 33.48  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.901  6.206   27.251  1.00 34.21  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.282  5.137   28.284  1.00 39.04  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.104  3.949   28.040  1.00 41.21  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.388  6.448   27.307  1.00 28.00  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.819  5.397   26.348  1.00 34.16  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.861  5.253   25.244  1.00 33.77  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.819  5.569   29.414  1.00 44.98  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.040  4.686   30.554  1.00 47.02  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.959  4.962   31.587  1.00 44.21  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.618  6.121   31.844  1.00 40.02  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.412  4.938   31.168  1.00 55.89  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.575  4.568   30.246  1.00 79.28  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.941  4.888   30.853  1.00 98.74  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.084  4.793   32.098  1.00 103.31 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.869  5.240   30.085  1.00 104.12 ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.416  3.898   32.184  1.00 44.66  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.383  3.985   33.222  1.00 42.13  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.821  4.927   34.347  1.00 39.42  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.987  4.905   34.725  1.00 38.99  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.304  2.548   33.747  1.00 46.84  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.805  1.696   32.591  1.00 50.14  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.886  2.516   31.966  1.00 44.51  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.909  5.769   34.827  1.00 34.04  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.195  6.718   35.895  1.00 35.82  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.614  5.966   37.156  1.00 42.63  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 42.028  4.931   37.499  1.00 43.35  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.942  7.579   36.184  1.00 35.98  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 41.001  8.417   37.482  1.00 33.22  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.063  9.530   37.335  1.00 43.89  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.950  10.572  38.437  1.00 43.49  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.849  11.720  38.165  1.00 45.69  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.631  6.472   37.841  1.00 41.43  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.089  5.827   39.064  1.00 46.40  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.303  6.404   40.228  1.00 43.53  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.951  7.587   40.197  1.00 37.54  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.592  6.010   39.253  1.00 53.86  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.418  5.342   38.162  1.00 61.56  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.895  5.398   38.500  1.00 72.94  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.309  6.764   38.795  1.00 79.87  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.064  7.511   37.995  1.00 84.94  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 49.517  7.020   36.839  1.00 80.60  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.373  8.751   38.359  1.00 86.22  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.998  5.567   41.240  1.00 39.64  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.173  5.987   42.388  1.00 41.22  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.668  7.290   43.006  1.00 42.25  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.870  7.551   43.037  1.00 41.89  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.353  4.841   43.399  1.00 42.67  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.651  3.655   42.568  1.00 46.87  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.399  4.152   41.330  1.00 41.32  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.736  8.102   43.483  1.00 41.07  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 42.068  9.343   44.165  1.00 45.44  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.699  9.202   45.633  1.00 49.47  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.977  8.279   46.018  1.00 50.23  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.275  10.503  43.568  1.00 44.46  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.799  10.261  43.587  1.00 45.57  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.928  10.525  44.617  1.00 46.34  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 39.015  9.689   42.534  1.00 43.31  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.651  10.148  44.261  1.00 46.42  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.676  9.637   42.987  1.00 43.34  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.313  9.211   41.255  1.00 41.82  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.641  9.132   42.199  1.00 39.01  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.281  8.705   40.471  1.00 46.29  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.962  8.675   40.945  1.00 42.67  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.169  10.129  46.455  1.00 53.06  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.825  10.079  47.869  1.00 57.19  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.866  11.211  48.190  1.00 50.94  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.857  12.234  47.516  1.00 54.24  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 43.076  10.176  48.744  1.00 62.95  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.611  11.484  48.698  1.00 66.66  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 40.060  11.016  49.222  1.00 50.33  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 39.101  12.018  49.625  1.00 50.89  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.880  12.001  48.730  1.00 52.24  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.682  11.085  47.922  1.00 50.07  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 37.050  13.021  48.886  1.00 46.69  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.810  13.088  48.149  1.00 46.30  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 36.031  13.986  46.951  1.00 45.30  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.321  15.175  47.098  1.00 50.71  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.651  13.628  49.022  1.00 46.87  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.356  13.694  48.213  1.00 41.05  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.476  12.765  50.286  1.00 40.37  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.919  13.405  45.762  1.00 40.20  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 36.052  14.169  44.532  1.00 42.02  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.776  14.972  44.311  1.00 44.43  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.668  14.429  44.357  1.00 45.72  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.340  13.246  43.342  1.00 39.36  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.551  13.938  41.980  1.00 46.21  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.702  13.297  41.204  1.00 46.34  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.286  13.913  41.143  1.00 39.57  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.930  16.272  44.107  1.00 38.87  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.791  17.112  43.782  1.00 42.17  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.323  16.870  42.339  1.00 45.10  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.074  17.089  41.395  1.00 42.04  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 34.121  18.588  43.988  1.00 48.48  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.885  19.462  43.918  1.00 61.30  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.461  19.789  42.793  1.00 60.86  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.319  19.795  44.983  1.00 70.78  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.084  16.406  42.192  1.00 37.34  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.501  16.102  40.893  1.00 35.91  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.279  16.968  40.655  1.00 35.56  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.232  16.460  40.280  1.00 37.89  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.103  14.637  40.839  1.00 36.87  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.401  18.271  40.896  1.00 35.16  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.251  19.174  40.839  1.00 38.44  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.272  20.104  39.620  1.00 42.59  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.325  20.839  39.394  1.00 39.83  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.128  20.040  42.121  1.00 40.31  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.238  20.935  42.203  1.00 39.77  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 29.076  19.171  43.393  1.00 41.90  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.354  20.073  38.843  1.00 39.66  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.472  20.926  37.663  1.00 37.85  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.115  20.211  36.476  1.00 35.35  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.875  19.268  36.635  1.00 37.08  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.304  22.183  37.962  1.00 41.67  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.662  21.791  38.198  1.00 42.14  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.772  22.912  39.198  1.00 37.88  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.789  20.654  35.272  1.00 34.40  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.365  20.055  34.084  1.00 36.78  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.870  20.253  34.058  1.00 34.97  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.372  21.256  34.523  1.00 32.85  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.734  20.656  32.832  1.00 34.07  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.330  20.185  32.582  1.00 33.24  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.079  18.845  32.348  1.00 31.46  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.259  21.087  32.578  1.00 35.16  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.769  18.386  32.099  1.00 37.57  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.957  20.642  32.346  1.00 36.48  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.713  19.284  32.101  1.00 32.29  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.590  19.291  33.514  1.00 33.88  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.028  19.438  33.351  1.00 33.90  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.431  20.077  32.017  1.00 33.10  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.567  20.433  31.202  1.00 31.79  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.701  18.079  33.532  1.00 32.38  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.180  17.876  34.969  1.00 34.52  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.449  18.685  35.299  1.00 44.89  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.952  19.475  34.477  1.00 40.79  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.977  18.473  36.500  1.00 43.68  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.742  20.231  31.811  1.00 36.23  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.286  20.785  30.572  1.00 31.24  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.756  20.083  29.316  1.00 32.04  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.510  18.886  29.314  1.00 31.01  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.817  20.695  30.566  1.00 37.36  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.469  21.455  31.726  1.00 36.89  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 38.985  22.493  32.154  1.00 34.64  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.572  20.922  32.232  1.00 35.83  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.625  20.847  28.245  1.00 26.51  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.368  20.331  26.905  1.00 26.84  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.687  19.953  26.195  1.00 31.52  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.723  20.629  26.344  1.00 29.90  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.637  21.421  26.082  1.00 36.93  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.570  21.077  24.608  1.00 34.41  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.250  21.707  26.681  1.00 31.47  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.658  18.867  25.433  1.00 28.69  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.865  18.439  24.742  1.00 32.94  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.257  19.487  23.722  1.00 36.25  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.402  20.045  23.009  1.00 27.32  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.686  17.082  24.069  1.00 28.14  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.402  15.723  25.271  1.00 33.36  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.561  19.721  23.640  1.00 29.79  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.100  20.747  22.769  1.00 36.19  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.584  20.634  21.338  1.00 36.16  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.599  19.556  20.752  1.00 29.17  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.636  20.730  22.820  1.00 37.23  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.175  22.119  22.870  1.00 37.87  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.616  22.690  24.067  1.00 43.87  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.183  22.893  21.734  1.00 42.01  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.083  24.004  24.097  1.00 42.28  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.636  24.179  21.755  1.00 43.66  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.086  24.732  22.922  1.00 49.49  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.533  26.032  22.864  1.00 65.97  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.114  21.750  20.776  1.00 30.25  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.442  21.699  19.478  1.00 32.14  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.325  23.045  18.786  1.00 31.57  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.357  24.093  19.422  1.00 35.77  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.028  21.100  19.618  1.00 28.40  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.051  21.955  20.432  1.00 24.89  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 35.789  21.179  20.834  1.00 35.29  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.717  21.455  20.329  1.00 29.69  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 35.935  20.173  21.716  1.00 31.77  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.159  22.989  17.470  1.00 35.68  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 38.836  24.165  16.667  1.00 38.07  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.478  24.749  17.061  1.00 43.44  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.510  24.016  17.308  1.00 35.12  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.835  23.776  15.188  1.00 43.15  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.489  24.898  14.248  1.00 50.67  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.190  25.054  13.764  1.00 53.40  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.460  25.806  13.841  1.00 54.73  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.867  26.087  12.900  1.00 54.33  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.156  26.834  12.976  1.00 56.54  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.859  26.974  12.504  1.00 62.76  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.563  28.014  11.645  1.00 65.95  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.420  26.071  17.129  1.00 43.04  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.220  26.783  17.532  1.00 41.86  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 35.617  27.548  16.344  1.00 48.91  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.320  28.278  15.647  1.00 45.54  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.521  27.733  18.703  1.00 41.48  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.290  28.579  19.044  1.00 44.62  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 36.974  26.916  19.925  1.00 39.44  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.317  27.360  16.128  1.00 50.54  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 33.599  27.877  14.960  1.00 54.12  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.391  29.382  15.072  1.00 46.98  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 32.766  29.849  16.016  1.00 53.74  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.242  27.162  14.851  1.00 61.93  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 31.416  27.592  13.625  1.00 68.93  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 31.714  28.633  12.979  1.00 59.92  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 30.439  26.862  13.322  1.00 67.33  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 33.914  30.135  14.108  1.00 47.84  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 33.804  31.598  14.134  1.00 63.29  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.138  32.210  12.889  1.00 62.83  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.271  33.410  12.650  1.00 64.04  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.192  32.265  14.289  1.00 67.33  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.060  31.776  13.259  1.00 69.01  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 35.793  31.961  15.659  1.00 64.52  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.421  31.399  12.114  1.00 60.45  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 31.785  31.879  10.885  1.00 61.55  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 30.783  33.006  11.148  1.00 65.33  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 30.793  34.024  10.455  1.00 66.22  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.097  30.738  10.129  1.00 64.15  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.545  31.119  8.747   1.00 68.85  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 31.680  31.535  7.822   1.00 71.18  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 29.733  29.988  8.129   1.00 68.96  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 29.916  32.815  12.140  1.00 62.73  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 28.929  33.835  12.511  1.00 59.41  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 28.987  34.165  14.001  1.00 62.36  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.261  33.574  14.804  1.00 63.39  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 27.518  33.367  12.168  1.00 51.23  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.280  33.049  10.713  1.00 56.06  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.359  34.041  9.745   1.00 50.85  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 26.920  31.759  10.308  1.00 54.05  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.115  33.761  8.410   1.00 49.37  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 26.667  31.467  8.972   1.00 50.05  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 26.767  32.472  8.028   1.00 53.35  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 26.518  32.198  6.695   1.00 57.34  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 29.853  35.112  14.376  1.00 72.98  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.084  35.574  15.758  1.00 72.56  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 28.833  35.997  16.543  1.00 69.43  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.136  36.920  16.132  1.00 69.77  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.001  36.782  15.562  1.00 74.47  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 31.774  36.454  14.317  1.00 78.18  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 30.833  35.676  13.428  1.00 76.62  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.565  35.340  17.671  1.00 69.97  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.468  35.739  18.549  1.00 66.31  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.112  35.172  18.159  1.00 64.59  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.115  35.349  18.863  1.00 65.26  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.082  34.489  17.021  1.00 58.80  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 24.865  33.900  16.488  1.00 52.82  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 24.590  32.556  17.191  1.00 49.92  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.451  31.674  17.221  1.00 49.93  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.050  33.743  14.975  1.00 50.22  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.014  32.897  14.307  1.00 48.20  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 22.688  33.313  14.241  1.00 47.40  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.370  31.703  13.704  1.00 46.78  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 21.736  32.537  13.605  1.00 44.48  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.423  30.918  13.062  1.00 47.79  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.106  31.335  13.012  1.00 45.03  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.407  32.414  17.785  1.00 45.15  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.071  31.213  18.563  1.00 53.30  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.226  29.904  17.764  1.00 48.45  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 23.565  28.851  18.318  1.00 42.77  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 21.643  31.315  19.116  1.00 62.94  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.175  30.092  19.894  1.00 74.20  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.688  30.069  21.330  1.00 86.95  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 21.673  31.145  21.973  1.00 94.74  ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 22.096  28.983  21.818  1.00 85.04  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 22.985  29.983  16.459  1.00 42.86  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 22.910  28.787  15.631  1.00 46.12  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.241  28.074  15.548  1.00 47.72  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.288  26.852  15.426  1.00 49.20  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.321  28.850  15.603  1.00 42.29  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.671  28.312  15.684  1.00 43.26  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.203  28.213  17.134  1.00 48.58  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 27.912  27.266  17.466  1.00 47.79  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.650  29.137  14.828  1.00 42.35  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.540  30.518  15.189  1.00 44.98  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.334  28.990  13.320  1.00 38.68  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 26.856  29.172  17.994  1.00 47.74  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.429  29.211  19.341  1.00 49.69  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.012  28.034  20.222  1.00 48.46  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.811  27.523  21.009  1.00 50.66  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.099  30.523  20.057  1.00 58.30  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 27.701  31.776  19.416  1.00 68.96  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.218  31.775  19.392  1.00 80.48  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 29.837  30.908  20.056  1.00 83.92  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 29.792  32.653  18.706  1.00 85.17  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 25.764  27.604  20.092  1.00 42.17  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.270  26.503  20.907  1.00 43.94  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.090  25.216  20.736  1.00 39.71  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.018  24.331  21.580  1.00 40.94  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 23.793  26.223  20.623  1.00 42.57  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.506  25.656  19.233  1.00 46.21  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 21.790  25.076  19.085  1.00 58.73  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 22.003  23.382  19.569  1.00 63.09  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 26.849  25.107  19.648  1.00 31.80  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.688  23.934  19.440  1.00 33.49  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.122  24.154  19.936  1.00 38.15  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 29.901  23.197  20.032  1.00 31.12  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.689  23.501  17.967  1.00 32.80  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.319  23.352  17.417  1.00 37.69  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 25.650  24.256  16.647  1.00 32.22  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.432  22.235  17.595  1.00 32.75  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.410  23.775  16.338  1.00 35.08  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.245  22.540  16.910  1.00 33.86  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.527  21.010  18.274  1.00 33.58  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.144  21.662  16.879  1.00 35.89  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.432  20.142  18.245  1.00 37.18  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.260  20.477  17.561  1.00 35.01  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.474  25.404  20.246  1.00 29.79  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 30.855  25.725  20.638  1.00 39.19  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.205  25.282  22.071  1.00 41.34  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.335  25.185  22.912  1.00 41.71  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.138  27.230  20.460  1.00 37.08  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.533  27.589  19.029  1.00 43.01  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 31.936  26.731  18.248  1.00 48.79  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.411  28.858  18.686  1.00 45.27  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.493  25.023  22.355  1.00 45.30  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 32.878  24.657  23.733  1.00 44.48  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.329  25.624  24.771  1.00 40.16  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.392  26.827  24.563  1.00 35.72  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.413  24.749  23.703  1.00 39.67  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.756  24.372  22.283  1.00 38.13  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.648  25.022  21.438  1.00 38.26  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 31.805  25.109  25.879  1.00 37.50  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.277  25.976  26.917  1.00 35.43  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.033  25.799  28.236  1.00 39.21  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.576  26.230  29.292  1.00 39.24  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.771  25.731  27.106  1.00 33.65  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.470  24.344  27.666  1.00 38.28  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.253  23.409  27.482  1.00 30.17  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.334  24.207  28.350  1.00 35.51  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.184  25.139  28.172  1.00 35.88  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.121  25.060  29.309  1.00 34.39  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.491  25.204  28.703  1.00 35.63  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.628  25.192  27.472  1.00 37.32  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 34.021  23.721  30.046  1.00 32.87  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.761  23.590  30.906  1.00 42.28  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.832  24.514  32.125  1.00 50.15  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 31.589  24.509  32.884  1.00 70.89  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.498  25.210  32.562  1.00 79.10  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.490  25.996  31.490  1.00 79.23  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.401  25.128  33.312  1.00 73.79  ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.497  25.344  29.551  1.00 36.04  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 37.855  25.607  29.102  1.00 35.60  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.375  24.479  28.209  1.00 36.56  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 38.118  23.286  28.470  1.00 32.23  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 38.768  25.778  30.320  1.00 37.02  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.245  25.928  29.984  1.00 44.31  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.121  25.910  31.231  1.00 53.05  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.659  26.399  32.281  1.00 42.65  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.261  25.398  31.164  1.00 62.42  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.086  24.853  27.148  1.00 28.08  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.724  23.856  26.285  1.00 33.94  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 40.972  23.342  26.975  1.00 39.05  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 41.752  24.114  27.490  1.00 40.69  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.118  24.438  24.923  1.00 28.14  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 39.018  25.010  24.030  1.00 41.64  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.592  25.375  22.656  1.00 38.80  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 37.898  24.002  23.901  1.00 33.94  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.160  22.030  26.972  1.00 37.04  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.353  21.447  27.551  1.00 31.61  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.537  20.021  27.025  1.00 35.50  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.557  19.350  26.726  1.00 33.42  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.224  21.424  29.084  1.00 33.61  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.236  20.630  29.691  1.00 32.57  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.781  19.547  26.949  1.00 34.75  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.030  18.129  26.677  1.00 34.88  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.638  17.270  27.884  1.00 35.99  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.340  16.071  27.763  1.00 34.52  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.489  17.894  26.308  1.00 36.54  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 45.874  18.519  24.982  1.00 40.37  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.296  18.170  24.575  1.00 42.50  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.521  17.042  24.076  1.00 34.38  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.184  19.034  24.755  1.00 40.63  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.623  17.884  29.056  1.00 31.69  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.139  17.178  30.242  1.00 37.72  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.608  17.293  30.238  1.00 36.28  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 41.048  18.256  30.787  1.00 33.68  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.739  17.808  31.492  1.00 40.19  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.206  17.205  32.777  1.00 38.28  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.437  16.228  32.740  1.00 36.43  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.581  17.718  33.838  1.00 48.96  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 40.948  16.328  29.588  1.00 28.87  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.515  16.449  29.264  1.00 33.04  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.742  15.128  29.374  1.00 31.83  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.566  15.075  29.044  1.00 29.67  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.342  17.010  27.826  1.00 29.37  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 39.986  15.907  26.509  1.00 33.94  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.399  14.061  29.824  1.00 26.01  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.765  12.745  29.807  1.00 32.89  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 37.887  12.524  31.057  1.00 32.23  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.283  11.887  32.041  1.00 31.90  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.814  11.645  29.589  1.00 31.00  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.405  11.636  28.169  1.00 31.87  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.328  10.458  27.932  1.00 29.99  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.285  11.639  27.092  1.00 33.25  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.692  13.101  31.003  1.00 30.53  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.749  13.086  32.119  1.00 29.70  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.395  12.671  31.582  1.00 34.49  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.120  12.827  30.388  1.00 31.24  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.655  14.480  32.754  1.00 32.79  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 36.964  14.939  33.334  1.00 35.28  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.335  14.585  34.641  1.00 36.57  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 37.854  15.691  32.571  1.00 35.45  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.558  14.991  35.180  1.00 38.01  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 39.085  16.113  33.097  1.00 38.71  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.424  15.751  34.394  1.00 41.26  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.622  16.141  34.894  1.00 35.78  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.556  12.133  32.454  1.00 31.04  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.217  11.743  32.059  1.00 31.64  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.196  12.222  33.094  1.00 34.50  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.554  12.623  34.202  1.00 34.10  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.137  10.235  31.815  1.00 29.07  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.415  9.267   32.971  1.00 30.99  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.239  9.230   33.967  1.00 28.45  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.651  7.866   32.416  1.00 31.54  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 29.929  12.174  32.711  1.00 32.00  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.846  12.778  33.461  1.00 32.26  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.726  11.767  33.647  1.00 34.06  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.438  10.988  32.738  1.00 31.72  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.295  13.989  32.699  1.00 27.21  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.390  14.959  32.256  1.00 32.97  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 30.103  15.528  33.082  1.00 31.51  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.484  15.189  30.943  1.00 31.22  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 27.085  11.800  34.815  1.00 36.40  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 25.980  10.904  35.118  1.00 32.86  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.788  11.669  35.682  1.00 35.01  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 24.936  12.402  36.649  1.00 40.02  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.383  9.865   36.185  1.00 33.20  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.185  8.956   36.524  1.00 30.31  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.608  9.057   35.726  1.00 29.35  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.609  11.483  35.090  1.00 33.78  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.366  11.995  35.679  1.00 34.54  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.505  10.810  36.077  1.00 35.99  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.414  9.838   35.338  1.00 34.59  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.558  12.822  34.682  1.00 33.03  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.143  14.142  34.265  1.00 33.34  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.850  15.381  34.785  1.00 32.29  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 23.089  14.363  33.211  1.00 29.51  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.565  16.352  34.120  1.00 30.63  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.322  15.755  33.141  1.00 35.34  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.747  13.519  32.307  1.00 33.11  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.199  16.327  32.201  1.00 35.77  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.602  14.082  31.372  1.00 38.26  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.829  15.480  31.335  1.00 36.76  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 20.868  10.897  37.239  1.00 35.16  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 19.989  9.842   37.710  1.00 36.80  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 18.811  10.510  38.390  1.00 41.73  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 18.896  11.686  38.760  1.00 39.91  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.670  8.893   38.753  1.00 40.82  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 20.850  9.583   39.996  1.00 42.56  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 22.006  8.399   38.271  1.00 39.46  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.707  9.765   38.555  1.00 40.63  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.581  10.223  39.367  1.00 41.84  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 17.040  10.587  40.777  1.00 42.19  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 18.099  10.163  41.219  1.00 47.29  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.670  8.991   39.412  1.00 40.81  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.945  8.297   38.111  1.00 40.80  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.430  8.463   37.924  1.00 41.58  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.240  11.383  41.465  1.00 41.72  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.529  11.780  42.828  1.00 43.53  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 15.277  11.563  43.626  1.00 49.37  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 14.253  12.156  43.317  1.00 49.91  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.877  13.260  42.877  1.00 35.64  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 17.179  13.791  44.258  1.00 38.98  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.487  14.033  44.655  1.00 38.41  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 16.152  14.076  45.165  1.00 37.37  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 18.773  14.542  45.928  1.00 36.76  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.428  14.578  46.435  1.00 34.44  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.742  14.811  46.800  1.00 42.94  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 18.030  15.314  48.043  1.00 47.87  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.348  10.712  44.654  1.00 51.53  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.537  9.955   45.068  1.00 45.01  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.843  8.879   44.044  1.00 44.38  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 16.013  8.627   43.172  1.00 45.85  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 16.071  9.290   46.370  1.00 50.08  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.587  9.129   46.154  1.00 54.52  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 14.203  10.445  45.545  1.00 50.43  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 18.002  8.240   44.146  1.00 47.08  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.406  7.283   43.119  1.00 49.06  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.453  6.097   43.070  1.00 47.60  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 16.820  5.770   44.064  1.00 52.48  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 19.870  6.847   43.300  1.00 48.42  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 20.871  8.006   43.092  1.00 55.48  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.308  7.525   43.097  1.00 62.17  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.613  6.666   44.244  1.00 57.43  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 23.009  7.136   45.418  1.00 55.76  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 23.137  8.440   45.570  1.00 46.56  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 23.281  6.314   46.433  1.00 60.74  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.332  5.465   41.896  1.00 50.36  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.438  4.321   41.702  1.00 56.05  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.779  3.189   42.672  1.00 59.95  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.959  2.881   42.866  1.00 58.80  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.758  3.865   40.272  1.00 49.65  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.410  5.018   39.623  1.00 53.44  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 18.135  5.749   40.695  1.00 53.53  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.767  2.558   43.251  1.00 61.42  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 16.028  1.473   44.189  1.00 69.16  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 16.319  0.148   43.468  1.00 70.22  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 17.047  -0.697  43.987  1.00 70.60  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 14.886  1.329   45.168  1.00 69.45  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.763  -0.021  42.271  1.00 67.38  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 16.085  -1.179  41.436  1.00 64.77  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.841  -0.764  40.163  1.00 57.14  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.714  0.365   39.698  1.00 52.38  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.821  -1.955  41.076  1.00 64.90  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 13.849  -1.094  40.523  1.00 71.32  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.625  -1.691  39.597  1.00 50.98  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.481  -1.408  38.437  1.00 48.09  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.703  -0.816  37.248  1.00 51.15  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.746  -1.419  36.767  1.00 50.37  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 19.082  -2.782  38.089  1.00 38.87  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.984  -3.574  39.382  1.00 47.68  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.721  -3.096  40.037  1.00 53.69  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 18.137  0.358   36.796  1.00 45.81  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.479  1.104   35.737  1.00 44.70  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.272  1.064   34.419  1.00 41.55  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.493  1.200   34.426  1.00 38.72  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.375  2.571   36.164  1.00 47.51  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.901  2.626   37.507  1.00 52.00  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.447  3.351   35.257  1.00 46.00  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.575  0.902   33.285  1.00 41.84  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.255  0.948   31.981  1.00 41.31  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.121  2.197   31.819  1.00 38.91  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.770  3.281   32.277  1.00 38.05  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.091  0.948   30.986  1.00 39.00  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.031  0.084   31.703  1.00 44.36  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.172  0.456   33.168  1.00 47.35  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.262  2.027   31.174  1.00 39.22  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.239  3.092   31.055  1.00 37.55  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.292  3.588   29.607  1.00 38.23  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.290  2.785   28.678  1.00 32.64  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.627  2.573   31.506  1.00 36.72  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 23.691  3.664   31.366  1.00 34.16  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.551  2.044   32.961  1.00 27.10  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.314  4.905   29.423  1.00 30.58  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.534  5.494   28.102  1.00 30.93  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 22.901  6.179   28.112  1.00 30.71  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.234  6.899   29.053  1.00 36.83  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.455  6.528   27.777  1.00 36.88  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.040  6.040   27.427  1.00 44.55  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.089  7.203   27.319  1.00 46.72  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.074  5.329   26.125  1.00 55.50  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.704  5.939   27.084  1.00 32.16  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.020  6.566   27.017  1.00 32.09  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.088  7.416   25.760  1.00 29.67  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 24.933  6.905   24.661  1.00 33.09  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.174  5.531   26.980  1.00 32.30  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.127  4.584   28.174  1.00 31.78  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.531  6.244   26.968  1.00 26.41  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.337  3.677   28.190  1.00 29.72  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.330  8.709   25.932  1.00 27.64  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.346  9.629   24.816  1.00 30.34  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.756  9.843   24.313  1.00 36.31  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.652  10.104  25.092  1.00 33.47  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 24.764  10.977  25.220  1.00 29.72  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 24.849  12.022  24.116  1.00 31.70  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.687  13.098  24.064  1.00 33.66  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.043  12.084  22.927  1.00 33.12  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.446  13.836  22.927  1.00 34.23  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.447  13.227  22.208  1.00 32.09  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.017  11.283  22.404  1.00 27.32  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 23.869  13.583  20.979  1.00 30.20  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.449  11.633  21.183  1.00 32.10  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 22.870  12.783  20.490  1.00 31.55  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 26.940  9.732   23.004  1.00 31.18  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.204  10.112  22.371  1.00 27.83  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 27.967  11.266  21.377  1.00 29.02  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.335  11.072  20.328  1.00 34.63  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.805  8.917   21.622  1.00 29.73  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 28.899  7.700   22.569  1.00 27.35  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.169  9.287   21.027  1.00 29.89  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.468  6.464   21.890  1.00 26.99  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.466  12.457  21.698  1.00 28.04  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.240  13.628  20.833  1.00 27.92  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 28.914  13.533  19.463  1.00 32.57  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 29.877  12.772  19.278  1.00 28.93  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.699  14.910  21.519  1.00 27.54  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.180  14.907  21.925  1.00 30.98  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.195  15.128  20.980  1.00 26.06  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.547  14.721  23.270  1.00 27.29  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.567  15.144  21.375  1.00 29.77  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 31.858  14.745  23.673  1.00 23.72  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 32.875  14.949  22.730  1.00 32.25  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.174  14.941  23.166  1.00 27.43  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.397  14.316  18.512  1.00 23.10  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.015  14.480  17.203  1.00 25.53  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 29.802  15.787  17.124  1.00 29.59  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.098  16.442  18.141  1.00 25.80  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.113  16.200  15.902  1.00 28.89  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 30.980  17.346  15.687  1.00 27.30  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.155  16.978  14.791  1.00 31.03  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.249  17.532  14.922  1.00 29.63  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 31.920  16.034  13.888  1.00 29.75  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 32.839  15.762  12.799  1.00 28.31  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.128  15.088  13.240  1.00 34.25  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.095  15.041  12.469  1.00 36.45  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.147  14.585  14.481  1.00 28.97  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.369  14.001  15.082  1.00 26.76  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.454  15.057  15.311  1.00 27.32  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.572  14.717  15.669  1.00 28.97  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 35.949  12.867  14.217  1.00 25.47  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.111  11.596  14.204  1.00 29.01  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 34.955  10.846  15.363  1.00 29.23  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.484  11.164  13.026  1.00 22.47  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.200  9.679   15.364  1.00 28.81  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 33.719  9.996   13.012  1.00 28.48  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.586  9.243   14.192  1.00 28.45  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.124  16.337  15.123  1.00 27.70  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.092  17.412  15.378  1.00 30.98  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.598  18.410  16.447  1.00 32.43  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.301  19.346  16.799  1.00 32.62  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.429  18.159  14.072  1.00 32.97  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.314  19.092  13.606  1.00 32.64  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.165  20.374  14.150  1.00 31.87  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.394  18.676  12.653  1.00 31.33  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.127  21.225  13.724  1.00 28.54  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.351  19.517  12.220  1.00 29.19  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.234  20.781  12.748  1.00 36.39  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.207  21.590  12.301  1.00 35.18  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.383  18.214  16.948  1.00 30.50  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.812  19.118  17.939  1.00 28.00  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.705  18.428  18.729  1.00 28.55  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.351  17.276  18.449  1.00 27.39  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.200  20.335  17.243  1.00 33.15  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.183  19.923  16.330  1.00 29.53  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.121  19.165  19.673  1.00 28.46  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.030  18.653  20.486  1.00 29.31  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.404  18.505  21.961  1.00 35.97  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.581  18.592  22.354  1.00 30.33  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.388  18.284  22.784  1.00 32.92  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.547  18.208  24.233  1.00 31.87  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.269  17.669  24.855  1.00 35.55  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.176  17.975  24.382  1.00 26.89  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 31.844  19.600  24.801  1.00 24.90  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.412  16.918  25.939  1.00 31.45  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.282  16.318  26.604  1.00 31.50  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.574  17.356  27.478  1.00 35.48  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.495  17.101  28.009  1.00 33.76  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.725  15.069  27.436  1.00 23.30  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.169  18.534  27.618  1.00 31.96  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.616  19.529  28.550  1.00 32.54  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.670  20.555  27.898  1.00 32.71  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.180  21.459  28.581  1.00 36.70  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 29.752  20.265  29.285  1.00 34.23  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.661  20.868  28.364  1.00 34.54  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.415  20.441  26.593  1.00 24.40  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.546  21.436  25.935  1.00 31.53  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.120  21.315  26.466  1.00 30.57  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.671  20.217  26.836  1.00 30.18  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.553  21.268  24.414  1.00 33.78  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 27.909  21.217  23.706  1.00 40.29  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 27.661  21.048  22.237  1.00 34.88  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 28.753  22.490  23.984  1.00 39.93  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.412  22.436  26.494  1.00 35.27  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.033  22.471  26.950  1.00 33.78  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.156  21.448  26.230  1.00 36.95  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.288  20.863  26.865  1.00 41.56  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.428  23.874  26.779  1.00 39.67  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.011  24.889  27.751  1.00 46.32  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.754  24.495  28.667  1.00 47.74  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 22.716  26.091  27.606  1.00 63.11  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.353  21.241  24.922  1.00 30.52  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.468  20.332  24.191  1.00 37.15  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.638  18.871  24.597  1.00 35.10  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 20.853  18.021  24.175  1.00 35.55  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.582  20.424  22.637  1.00 42.30  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 20.778  21.584  22.114  1.00 48.66  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 23.031  20.481  22.199  1.00 35.80  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.662  18.576  25.391  1.00 32.01  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 22.905  17.188  25.824  1.00 32.75  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.597  16.999  27.307  1.00 30.95  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 22.997  16.014  27.898  1.00 31.55  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.354  16.742  25.537  1.00 25.76  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 24.853  16.976  24.116  1.00 30.00  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 23.998  16.862  23.027  1.00 29.54  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.193  17.306  23.869  1.00 28.56  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.446  17.066  21.737  1.00 28.23  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.651  17.523  22.573  1.00 25.34  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 25.771  17.391  21.516  1.00 28.48  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.183  17.595  20.231  1.00 29.52  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 21.897  17.965  27.892  1.00 34.47  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.501  17.947  29.300  1.00 37.13  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.595  16.743  29.629  1.00 38.14  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.450  16.682  29.184  1.00 30.41  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.776  19.261  29.612  1.00 33.92  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.483  19.460  31.110  1.00 41.49  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.618  18.516  31.922  1.00 39.44  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.109  20.595  31.470  1.00 39.53  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.108  15.805  30.424  1.00 36.77  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.368  14.599  30.764  1.00 35.45  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.285  14.691  31.839  1.00 34.20  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.641  13.681  32.158  1.00 33.60  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.066  15.879  32.397  1.00 33.64  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.141  16.008  33.535  1.00 41.15  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 16.685  15.659  33.201  1.00 45.60  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 15.964  15.152  34.061  1.00 41.90  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.226  17.395  34.210  1.00 35.06  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.526  18.527  33.475  1.00 32.04  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 17.711  19.894  34.183  1.00 37.84  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.100  20.363  34.123  1.00 44.00  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.613  21.347  34.864  1.00 45.77  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 20.876  21.692  34.706  1.00 45.23  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 18.875  21.992  35.764  1.00 41.75  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.259  15.933  31.965  1.00 40.33  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 14.863  15.729  31.573  1.00 37.98  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.560  14.243  31.402  1.00 35.04  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.561  13.753  31.924  1.00 38.43  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.512  16.526  30.302  1.00 37.49  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 14.910  17.965  30.382  1.00 37.25  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.162  18.858  31.120  1.00 37.71  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.065  18.416  29.759  1.00 38.33  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.534  20.183  31.220  1.00 41.32  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.451  19.746  29.864  1.00 35.52  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.686  20.626  30.591  1.00 39.98  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.421  13.537  30.674  1.00 32.36  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.313  12.080  30.554  1.00 35.96  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.347  11.366  31.925  1.00 40.88  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 14.552  10.448  32.189  1.00 38.75  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.406  11.542  29.634  1.00 32.46  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.152  11.835  28.146  1.00 38.30  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.383  11.561  27.302  1.00 36.25  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 14.960  11.002  27.658  1.00 40.54  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.277  11.777  32.783  1.00 34.42  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.366  11.235  34.134  1.00 36.97  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.082  11.503  34.923  1.00 44.39  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.507  10.583  35.491  1.00 41.33  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.549  11.806  34.865  1.00 37.52  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 14.626  12.754  34.939  1.00 43.56  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.458  13.127  35.738  1.00 44.38  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.158  12.540  35.188  1.00 49.23  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.395  11.931  35.925  1.00 46.99  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.319  14.650  35.864  1.00 35.25  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.593  15.080  37.138  1.00 40.05  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 11.066  14.861  37.043  1.00 48.74  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.473  15.039  35.975  1.00 49.12  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.438  14.469  38.158  1.00 44.45  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 11.899  12.728  33.901  1.00 45.42  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 10.606  12.337  33.355  1.00 38.14  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.527  10.834  33.106  1.00 41.22  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.533   10.205  33.449  1.00 39.04  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.274  13.106  32.063  1.00 42.25  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 8.994   12.566  31.438  1.00 46.04  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.154  14.588  32.355  1.00 36.68  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 11.579  10.253  32.535  1.00 43.47  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.572  8.824   32.201  1.00 36.62  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.255  7.925   33.233  1.00 37.21  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.247  6.705   33.106  1.00 43.38  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.168  8.597   30.820  1.00 34.31  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.347  9.251   29.719  1.00 43.96  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 9.924   8.694   29.654  1.00 58.25  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 9.711   7.510   30.017  1.00 52.60  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.020   9.446   29.234  1.00 64.10  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 12.826  8.515   34.273  1.00 36.93  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.514  7.717   35.277  1.00 40.32  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 14.816  7.094   34.783  1.00 41.93  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.352  6.185   35.412  1.00 44.92  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.334  7.580   33.661  1.00 40.10  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.566  7.017   33.080  1.00 44.84  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 17.843  7.329   33.868  1.00 40.52  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 17.934  8.345   34.559  1.00 40.93  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 16.736  7.502   31.647  1.00 39.63  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 18.830  6.450   33.750  1.00 38.45  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.196  6.782   34.129  1.00 36.43  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 20.937  7.184   32.836  1.00 38.25  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 21.002  6.408   31.881  1.00 37.01  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 20.903  5.600   34.859  1.00 37.33  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.447  5.826   34.958  1.00 31.78  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.302  5.403   36.269  1.00 33.64  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.470  8.402   32.790  1.00 36.96  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.097  8.876   31.560  1.00 33.77  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.579  9.212   31.752  1.00 38.07  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 23.957  9.946   32.683  1.00 33.68  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.326  10.069  30.961  1.00 34.82  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.696  10.332  29.495  1.00 46.08  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.485  10.560  28.640  1.00 41.58  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.709  11.495  29.351  1.00 50.20  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.408  8.669   30.868  1.00 32.93  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 25.841  8.933   30.913  1.00 36.80  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.295  9.614   29.626  1.00 32.92  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 25.846  9.245   28.535  1.00 31.47  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.656  7.621   31.075  1.00 38.42  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.176  7.928   31.161  1.00 26.75  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.167  6.816   32.294  1.00 34.72  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.186  10.595  29.745  1.00 28.59  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 27.886  11.109  28.557  1.00 32.46  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.375  11.299  28.855  1.00 33.76  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.746  11.702  29.957  1.00 35.61  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.282  12.438  28.109  1.00 31.18  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.360  13.396  29.154  1.00 31.48  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.237  11.021  27.882  1.00 29.54  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.677  11.200  28.113  1.00 30.52  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.312  12.150  27.123  1.00 28.64  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.887  12.238  25.968  1.00 31.73  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.408  9.859   28.011  1.00 26.48  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.754  9.493   26.543  1.00 33.05  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.356  9.005   25.478  1.00 32.43  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 30.937  7.374   26.059  1.00 24.17  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.365  12.830  27.558  1.00 31.52  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.231  13.530  26.611  1.00 33.17  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.176  12.506  26.001  1.00 30.04  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.579  11.560  26.674  1.00 28.26  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.024  14.660  27.296  1.00 27.67  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.170  15.888  27.589  1.00 40.49  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 32.988  15.959  27.217  1.00 32.99  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 34.770  16.869  28.254  1.00 36.11  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.514  12.673  24.727  1.00 29.16  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.556  11.847  24.107  1.00 24.40  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.399  12.780  23.272  1.00 29.00  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 36.901  13.808  22.781  1.00 30.17  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 35.980  10.713  23.213  1.00 26.57  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.078  11.179  22.071  1.00 28.88  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.717  11.416  22.287  1.00 32.81  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.585  11.401  20.792  1.00 27.52  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 32.874  11.859  21.249  1.00 32.63  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.736  11.839  19.729  1.00 24.77  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.393  12.068  19.977  1.00 30.96  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.578  12.512  18.955  1.00 26.41  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.664  12.419  23.082  1.00 30.11  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.565  13.267  22.301  1.00 31.25  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.130  13.431  20.835  1.00 27.49  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.712  12.462  20.183  1.00 30.77  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.004  12.765  22.406  1.00 27.10  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.651  13.049  23.798  1.00 24.36  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 43.033  12.363  23.849  1.00 31.82  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.821  10.937  24.050  1.00 27.81  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.765  10.011  24.079  1.00 34.99  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 45.042  10.334  23.868  1.00 28.34  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.413  8.749   24.307  1.00 30.83  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.189  14.671  20.343  1.00 26.49  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 38.811  14.946  18.960  1.00 27.26  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.019  15.491  18.185  1.00 35.68  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.084  15.731  18.785  1.00 30.48  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.605  15.914  18.859  1.00 31.63  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.354  15.265  19.412  1.00 29.42  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 37.887  17.271  19.572  1.00 22.91  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 39.866  15.648  16.864  1.00 30.26  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 40.916  16.229  16.034  1.00 33.62  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.190  15.400  16.018  1.00 30.84  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.153  14.167  16.180  1.00 31.54  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.325  16.070  15.836  1.00 30.25  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.614  15.395  15.911  1.00 27.68  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 44.742  14.595  17.224  1.00 35.67  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.146  13.438  17.211  1.00 32.49  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 45.836  16.359  15.750  1.00 30.02  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.825  17.346  16.784  1.00 30.40  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 45.830  17.056  14.385  1.00 27.26  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.387  15.206  18.351  1.00 29.89  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.552  14.550  19.663  1.00 34.15  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 43.865  13.193  19.757  1.00 36.15  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.356  12.287  20.450  1.00 28.35  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.058  15.489  20.780  1.00 28.95  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.587  16.886  20.625  1.00 33.05  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 45.847  17.216  21.095  1.00 31.24  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 43.870  17.834  19.920  1.00 30.48  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.367  18.472  20.893  1.00 36.54  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.385  19.108  19.729  1.00 31.00  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.632  19.421  20.216  1.00 34.39  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 42.719  13.058  19.078  1.00 29.53  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 41.982  11.812  19.115  1.00 26.48  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.188  10.892  17.927  1.00 27.79  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 41.911  9.692   18.030  1.00 29.56  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.668  11.428  16.803  1.00 24.64  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.599  10.686  15.543  1.00 26.89  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 43.820  10.697  14.626  1.00 30.30  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 43.871  9.945   13.643  1.00 34.31  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.274  10.995  14.813  1.00 26.26  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.065  10.547  15.618  1.00 30.77  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 39.732  9.208   15.691  1.00 28.71  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.337  11.448  16.372  1.00 31.10  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.649  8.787   16.467  1.00 27.81  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.251  11.039  17.164  1.00 30.93  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 37.912  9.712   17.220  1.00 23.86  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 44.796  11.535  14.938  1.00 30.32  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.042  11.518  14.175  1.00 34.66  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 46.684  10.148  14.341  1.00 33.50  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 46.817  9.654   15.450  1.00 38.03  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.002  12.628  14.611  1.00 28.72  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.325  12.682  13.822  1.00 40.25  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 48.805  14.140  13.579  1.00 30.80  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.409  11.838  14.530  1.00 34.01  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.061  9.547   13.224  1.00 34.34  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.547  8.176   13.189  1.00 35.44  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 48.717  8.025   12.213  1.00 38.93  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 48.726  8.595   11.121  1.00 35.32  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.433  7.235   12.786  1.00 35.29  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 49.712  7.269   12.651  1.00 34.06  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 50.746  6.746   11.784  1.00 40.74  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.543  5.250   11.925  1.00 37.50  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.089  4.626   12.831  1.00 41.16  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.113  7.224   12.267  1.00 40.82  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.184  8.728   11.964  1.00 47.29  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 52.955  9.499   12.988  1.00 53.74  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 52.718  9.000   10.547  1.00 42.57  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 49.652  4.697   11.089  1.00 42.28  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.180  3.316   11.239  1.00 43.52  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.355  2.369   11.344  1.00 45.30  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.272  2.447   10.522  1.00 41.13  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.397  3.081   9.949   1.00 43.02  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 47.863  4.447   9.605   1.00 40.84  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 48.963  5.403   9.990   1.00 34.92  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.349  1.521   12.368  1.00 48.64  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.440  0.592   12.590  1.00 47.75  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.432  1.017   13.662  1.00 54.54  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.146  0.173   14.200  1.00 54.75  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.499  2.312   13.967  1.00 49.09  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.390  2.793   15.026  1.00 49.42  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 52.826  2.391   16.391  1.00 49.10  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.652  2.035   16.504  1.00 54.31  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.536  4.319   14.966  1.00 49.16  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.314  4.974   15.322  1.00 46.61  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 53.653  2.449   17.426  1.00 48.97  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.169  2.184   18.782  1.00 49.42  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 52.692  3.485   19.433  1.00 46.27  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 51.811  3.491   20.304  1.00 48.16  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.279  1.547   19.637  1.00 49.51  ? 165  ARG A CB  1 
ATOM   1286 N N   . GLU A 1 166 ? 53.289  4.590   19.002  1.00 44.59  ? 166  GLU A N   1 
ATOM   1287 C CA  . GLU A 1 166 ? 53.124  5.852   19.696  1.00 43.89  ? 166  GLU A CA  1 
ATOM   1288 C C   . GLU A 1 166 ? 51.891  6.638   19.221  1.00 42.95  ? 166  GLU A C   1 
ATOM   1289 O O   . GLU A 1 166 ? 51.404  7.518   19.930  1.00 50.33  ? 166  GLU A O   1 
ATOM   1290 C CB  . GLU A 1 166 ? 54.404  6.684   19.563  1.00 48.34  ? 166  GLU A CB  1 
ATOM   1291 C CG  . GLU A 1 166 ? 55.679  5.983   20.081  1.00 53.47  ? 166  GLU A CG  1 
ATOM   1292 C CD  . GLU A 1 166 ? 56.457  5.261   18.970  1.00 66.01  ? 166  GLU A CD  1 
ATOM   1293 O OE1 . GLU A 1 166 ? 55.875  4.949   17.896  1.00 66.52  ? 166  GLU A OE1 1 
ATOM   1294 O OE2 . GLU A 1 166 ? 57.661  5.005   19.171  1.00 68.24  ? 166  GLU A OE2 1 
ATOM   1295 N N   . ALA A 1 167 ? 51.396  6.316   18.027  1.00 36.16  ? 167  ALA A N   1 
ATOM   1296 C CA  . ALA A 1 167 ? 50.216  6.969   17.453  1.00 38.79  ? 167  ALA A CA  1 
ATOM   1297 C C   . ALA A 1 167 ? 49.464  5.987   16.565  1.00 38.33  ? 167  ALA A C   1 
ATOM   1298 O O   . ALA A 1 167 ? 49.440  6.144   15.326  1.00 33.43  ? 167  ALA A O   1 
ATOM   1299 C CB  . ALA A 1 167 ? 50.613  8.232   16.644  1.00 37.27  ? 167  ALA A CB  1 
ATOM   1300 N N   . PRO A 1 168 ? 48.854  4.965   17.192  1.00 37.48  ? 168  PRO A N   1 
ATOM   1301 C CA  . PRO A 1 168 ? 48.199  3.855   16.471  1.00 38.62  ? 168  PRO A CA  1 
ATOM   1302 C C   . PRO A 1 168 ? 46.890  4.246   15.772  1.00 42.91  ? 168  PRO A C   1 
ATOM   1303 O O   . PRO A 1 168 ? 46.405  3.476   14.936  1.00 43.60  ? 168  PRO A O   1 
ATOM   1304 C CB  . PRO A 1 168 ? 47.923  2.823   17.578  1.00 35.25  ? 168  PRO A CB  1 
ATOM   1305 C CG  . PRO A 1 168 ? 47.850  3.646   18.864  1.00 36.99  ? 168  PRO A CG  1 
ATOM   1306 C CD  . PRO A 1 168 ? 48.749  4.842   18.662  1.00 32.84  ? 168  PRO A CD  1 
ATOM   1307 N N   . GLY A 1 169 ? 46.326  5.411   16.097  1.00 39.16  ? 169  GLY A N   1 
ATOM   1308 C CA  . GLY A 1 169 ? 45.034  5.794   15.532  1.00 34.05  ? 169  GLY A CA  1 
ATOM   1309 C C   . GLY A 1 169 ? 43.842  5.441   16.422  1.00 38.32  ? 169  GLY A C   1 
ATOM   1310 O O   . GLY A 1 169 ? 43.973  4.657   17.374  1.00 30.90  ? 169  GLY A O   1 
ATOM   1311 N N   . ASN A 1 170 ? 42.685  6.057   16.147  1.00 32.12  ? 170  ASN A N   1 
ATOM   1312 C CA  . ASN A 1 170 ? 41.447  5.694   16.819  1.00 30.83  ? 170  ASN A CA  1 
ATOM   1313 C C   . ASN A 1 170 ? 41.396  5.858   18.345  1.00 35.70  ? 170  ASN A C   1 
ATOM   1314 O O   . ASN A 1 170 ? 40.526  5.265   18.999  1.00 36.67  ? 170  ASN A O   1 
ATOM   1315 C CB  . ASN A 1 170 ? 41.087  4.243   16.477  1.00 28.67  ? 170  ASN A CB  1 
ATOM   1316 C CG  . ASN A 1 170 ? 40.840  4.038   14.976  1.00 37.80  ? 170  ASN A CG  1 
ATOM   1317 O OD1 . ASN A 1 170 ? 40.255  4.900   14.327  1.00 40.21  ? 170  ASN A OD1 1 
ATOM   1318 N ND2 . ASN A 1 170 ? 41.292  2.884   14.422  1.00 36.50  ? 170  ASN A ND2 1 
ATOM   1319 N N   . VAL A 1 171 ? 42.288  6.645   18.929  1.00 33.24  ? 171  VAL A N   1 
ATOM   1320 C CA  . VAL A 1 171 ? 42.341  6.681   20.387  1.00 30.25  ? 171  VAL A CA  1 
ATOM   1321 C C   . VAL A 1 171 ? 41.140  7.415   20.985  1.00 36.04  ? 171  VAL A C   1 
ATOM   1322 O O   . VAL A 1 171 ? 40.763  7.160   22.120  1.00 35.84  ? 171  VAL A O   1 
ATOM   1323 C CB  . VAL A 1 171 ? 43.674  7.184   20.940  1.00 34.58  ? 171  VAL A CB  1 
ATOM   1324 C CG1 . VAL A 1 171 ? 44.830  6.400   20.318  1.00 36.35  ? 171  VAL A CG1 1 
ATOM   1325 C CG2 . VAL A 1 171 ? 43.822  8.668   20.710  1.00 30.80  ? 171  VAL A CG2 1 
ATOM   1326 N N   . GLY A 1 172 ? 40.499  8.265   20.190  1.00 31.17  ? 172  GLY A N   1 
ATOM   1327 C CA  . GLY A 1 172 ? 39.233  8.852   20.601  1.00 30.62  ? 172  GLY A CA  1 
ATOM   1328 C C   . GLY A 1 172 ? 38.127  7.820   20.789  1.00 32.77  ? 172  GLY A C   1 
ATOM   1329 O O   . GLY A 1 172 ? 37.300  7.946   21.687  1.00 35.85  ? 172  GLY A O   1 
ATOM   1330 N N   . LEU A 1 173 ? 38.102  6.813   19.920  1.00 30.01  ? 173  LEU A N   1 
ATOM   1331 C CA  . LEU A 1 173 ? 37.196  5.675   20.069  1.00 30.80  ? 173  LEU A CA  1 
ATOM   1332 C C   . LEU A 1 173 ? 37.538  4.801   21.276  1.00 30.45  ? 173  LEU A C   1 
ATOM   1333 O O   . LEU A 1 173 ? 36.647  4.251   21.916  1.00 33.02  ? 173  LEU A O   1 
ATOM   1334 C CB  . LEU A 1 173 ? 37.182  4.825   18.794  1.00 27.13  ? 173  LEU A CB  1 
ATOM   1335 C CG  . LEU A 1 173 ? 36.654  5.500   17.520  1.00 35.87  ? 173  LEU A CG  1 
ATOM   1336 C CD1 . LEU A 1 173 ? 36.964  4.641   16.305  1.00 31.61  ? 173  LEU A CD1 1 
ATOM   1337 C CD2 . LEU A 1 173 ? 35.154  5.758   17.625  1.00 35.84  ? 173  LEU A CD2 1 
ATOM   1338 N N   . LEU A 1 174 ? 38.829  4.686   21.582  1.00 31.73  ? 174  LEU A N   1 
ATOM   1339 C CA  . LEU A 1 174 ? 39.271  3.985   22.774  1.00 33.26  ? 174  LEU A CA  1 
ATOM   1340 C C   . LEU A 1 174 ? 38.903  4.776   24.034  1.00 34.40  ? 174  LEU A C   1 
ATOM   1341 O O   . LEU A 1 174 ? 38.598  4.166   25.057  1.00 31.03  ? 174  LEU A O   1 
ATOM   1342 C CB  . LEU A 1 174 ? 40.778  3.663   22.729  1.00 34.88  ? 174  LEU A CB  1 
ATOM   1343 C CG  . LEU A 1 174 ? 41.224  2.670   21.632  1.00 44.48  ? 174  LEU A CG  1 
ATOM   1344 C CD1 . LEU A 1 174 ? 42.746  2.585   21.537  1.00 43.45  ? 174  LEU A CD1 1 
ATOM   1345 C CD2 . LEU A 1 174 ? 40.654  1.274   21.821  1.00 41.09  ? 174  LEU A CD2 1 
ATOM   1346 N N   . ASP A 1 175 ? 38.906  6.120   23.956  1.00 29.68  ? 175  ASP A N   1 
ATOM   1347 C CA  . ASP A 1 175 ? 38.399  6.944   25.057  1.00 35.33  ? 175  ASP A CA  1 
ATOM   1348 C C   . ASP A 1 175 ? 36.937  6.596   25.325  1.00 32.26  ? 175  ASP A C   1 
ATOM   1349 O O   . ASP A 1 175 ? 36.520  6.421   26.472  1.00 32.80  ? 175  ASP A O   1 
ATOM   1350 C CB  . ASP A 1 175 ? 38.494  8.450   24.758  1.00 23.92  ? 175  ASP A CB  1 
ATOM   1351 C CG  . ASP A 1 175 ? 39.948  8.939   24.623  1.00 35.22  ? 175  ASP A CG  1 
ATOM   1352 O OD1 . ASP A 1 175 ? 40.880  8.217   25.057  1.00 35.88  ? 175  ASP A OD1 1 
ATOM   1353 O OD2 . ASP A 1 175 ? 40.145  10.065  24.109  1.00 39.10  ? 175  ASP A OD2 1 
ATOM   1354 N N   . GLN A 1 176 ? 36.163  6.490   24.254  1.00 27.24  ? 176  GLN A N   1 
ATOM   1355 C CA  . GLN A 1 176 ? 34.763  6.129   24.401  1.00 29.40  ? 176  GLN A CA  1 
ATOM   1356 C C   . GLN A 1 176 ? 34.646  4.731   25.009  1.00 28.56  ? 176  GLN A C   1 
ATOM   1357 O O   . GLN A 1 176 ? 33.826  4.491   25.896  1.00 32.38  ? 176  GLN A O   1 
ATOM   1358 C CB  . GLN A 1 176 ? 34.022  6.195   23.057  1.00 29.71  ? 176  GLN A CB  1 
ATOM   1359 C CG  . GLN A 1 176 ? 33.962  7.587   22.429  1.00 30.11  ? 176  GLN A CG  1 
ATOM   1360 C CD  . GLN A 1 176 ? 33.515  7.516   20.965  1.00 37.94  ? 176  GLN A CD  1 
ATOM   1361 O OE1 . GLN A 1 176 ? 33.032  6.469   20.489  1.00 33.74  ? 176  GLN A OE1 1 
ATOM   1362 N NE2 . GLN A 1 176 ? 33.663  8.628   20.251  1.00 28.53  ? 176  GLN A NE2 1 
ATOM   1363 N N   . ARG A 1 177 ? 35.446  3.807   24.501  1.00 30.32  ? 177  ARG A N   1 
ATOM   1364 C CA  . ARG A 1 177 ? 35.392  2.425   24.982  1.00 34.26  ? 177  ARG A CA  1 
ATOM   1365 C C   . ARG A 1 177 ? 35.670  2.346   26.492  1.00 37.79  ? 177  ARG A C   1 
ATOM   1366 O O   . ARG A 1 177 ? 34.945  1.666   27.226  1.00 37.92  ? 177  ARG A O   1 
ATOM   1367 C CB  . ARG A 1 177 ? 36.387  1.557   24.220  1.00 33.86  ? 177  ARG A CB  1 
ATOM   1368 C CG  . ARG A 1 177 ? 36.352  0.078   24.643  1.00 36.34  ? 177  ARG A CG  1 
ATOM   1369 C CD  . ARG A 1 177 ? 37.308  -0.738  23.782  1.00 36.53  ? 177  ARG A CD  1 
ATOM   1370 N NE  . ARG A 1 177 ? 36.678  -1.071  22.512  1.00 40.88  ? 177  ARG A NE  1 
ATOM   1371 C CZ  . ARG A 1 177 ? 37.317  -1.594  21.467  1.00 39.39  ? 177  ARG A CZ  1 
ATOM   1372 N NH1 . ARG A 1 177 ? 38.632  -1.831  21.515  1.00 33.80  ? 177  ARG A NH1 1 
ATOM   1373 N NH2 . ARG A 1 177 ? 36.634  -1.880  20.374  1.00 32.79  ? 177  ARG A NH2 1 
ATOM   1374 N N   . LEU A 1 178 ? 36.707  3.061   26.940  1.00 37.46  ? 178  LEU A N   1 
ATOM   1375 C CA  . LEU A 1 178 ? 37.054  3.139   28.351  1.00 34.01  ? 178  LEU A CA  1 
ATOM   1376 C C   . LEU A 1 178 ? 35.894  3.662   29.195  1.00 36.79  ? 178  LEU A C   1 
ATOM   1377 O O   . LEU A 1 178 ? 35.612  3.106   30.263  1.00 31.08  ? 178  LEU A O   1 
ATOM   1378 C CB  . LEU A 1 178 ? 38.292  3.999   28.574  1.00 28.26  ? 178  LEU A CB  1 
ATOM   1379 C CG  . LEU A 1 178 ? 38.842  4.058   29.993  1.00 36.04  ? 178  LEU A CG  1 
ATOM   1380 C CD1 . LEU A 1 178 ? 39.080  2.639   30.591  1.00 32.65  ? 178  LEU A CD1 1 
ATOM   1381 C CD2 . LEU A 1 178 ? 40.141  4.853   29.940  1.00 37.56  ? 178  LEU A CD2 1 
ATOM   1382 N N   . ALA A 1 179 ? 35.216  4.710   28.719  1.00 33.46  ? 179  ALA A N   1 
ATOM   1383 C CA  . ALA A 1 179 ? 33.998  5.166   29.397  1.00 36.36  ? 179  ALA A CA  1 
ATOM   1384 C C   . ALA A 1 179 ? 32.942  4.062   29.482  1.00 30.13  ? 179  ALA A C   1 
ATOM   1385 O O   . ALA A 1 179 ? 32.298  3.922   30.519  1.00 34.60  ? 179  ALA A O   1 
ATOM   1386 C CB  . ALA A 1 179 ? 33.406  6.455   28.763  1.00 27.22  ? 179  ALA A CB  1 
ATOM   1387 N N   . LEU A 1 180 ? 32.772  3.275   28.416  1.00 27.63  ? 180  LEU A N   1 
ATOM   1388 C CA  . LEU A 1 180 ? 31.791  2.178   28.439  1.00 35.99  ? 180  LEU A CA  1 
ATOM   1389 C C   . LEU A 1 180 ? 32.184  1.108   29.465  1.00 35.33  ? 180  LEU A C   1 
ATOM   1390 O O   . LEU A 1 180 ? 31.311  0.520   30.094  1.00 37.61  ? 180  LEU A O   1 
ATOM   1391 C CB  . LEU A 1 180 ? 31.588  1.515   27.062  1.00 25.21  ? 180  LEU A CB  1 
ATOM   1392 C CG  . LEU A 1 180 ? 31.250  2.379   25.828  1.00 32.94  ? 180  LEU A CG  1 
ATOM   1393 C CD1 . LEU A 1 180 ? 30.843  1.511   24.642  1.00 31.60  ? 180  LEU A CD1 1 
ATOM   1394 C CD2 . LEU A 1 180 ? 30.182  3.429   26.087  1.00 31.71  ? 180  LEU A CD2 1 
ATOM   1395 N N   . GLN A 1 181 ? 33.487  0.847   29.613  1.00 33.22  ? 181  GLN A N   1 
ATOM   1396 C CA  . GLN A 1 181 ? 33.964  -0.151  30.585  1.00 35.11  ? 181  GLN A CA  1 
ATOM   1397 C C   . GLN A 1 181 ? 33.717  0.395   31.979  1.00 38.97  ? 181  GLN A C   1 
ATOM   1398 O O   . GLN A 1 181 ? 33.332  -0.339  32.884  1.00 35.37  ? 181  GLN A O   1 
ATOM   1399 C CB  . GLN A 1 181 ? 35.457  -0.481  30.378  1.00 34.39  ? 181  GLN A CB  1 
ATOM   1400 C CG  . GLN A 1 181 ? 35.705  -1.192  29.041  1.00 47.49  ? 181  GLN A CG  1 
ATOM   1401 C CD  . GLN A 1 181 ? 37.182  -1.333  28.646  1.00 51.14  ? 181  GLN A CD  1 
ATOM   1402 O OE1 . GLN A 1 181 ? 38.046  -0.596  29.117  1.00 53.39  ? 181  GLN A OE1 1 
ATOM   1403 N NE2 . GLN A 1 181 ? 37.457  -2.271  27.746  1.00 47.01  ? 181  GLN A NE2 1 
ATOM   1404 N N   . TRP A 1 182 ? 33.918  1.704   32.136  1.00 33.85  ? 182  TRP A N   1 
ATOM   1405 C CA  . TRP A 1 182 ? 33.657  2.363   33.403  1.00 35.31  ? 182  TRP A CA  1 
ATOM   1406 C C   . TRP A 1 182 ? 32.176  2.198   33.781  1.00 39.81  ? 182  TRP A C   1 
ATOM   1407 O O   . TRP A 1 182 ? 31.847  1.980   34.942  1.00 36.33  ? 182  TRP A O   1 
ATOM   1408 C CB  . TRP A 1 182 ? 34.003  3.851   33.318  1.00 32.31  ? 182  TRP A CB  1 
ATOM   1409 C CG  . TRP A 1 182 ? 33.826  4.589   34.622  1.00 38.67  ? 182  TRP A CG  1 
ATOM   1410 C CD1 . TRP A 1 182 ? 34.810  4.892   35.539  1.00 35.11  ? 182  TRP A CD1 1 
ATOM   1411 C CD2 . TRP A 1 182 ? 32.605  5.142   35.148  1.00 31.50  ? 182  TRP A CD2 1 
ATOM   1412 N NE1 . TRP A 1 182 ? 34.263  5.593   36.597  1.00 34.78  ? 182  TRP A NE1 1 
ATOM   1413 C CE2 . TRP A 1 182 ? 32.920  5.764   36.380  1.00 37.51  ? 182  TRP A CE2 1 
ATOM   1414 C CE3 . TRP A 1 182 ? 31.285  5.178   34.699  1.00 35.26  ? 182  TRP A CE3 1 
ATOM   1415 C CZ2 . TRP A 1 182 ? 31.950  6.418   37.167  1.00 34.81  ? 182  TRP A CZ2 1 
ATOM   1416 C CZ3 . TRP A 1 182 ? 30.325  5.821   35.479  1.00 30.09  ? 182  TRP A CZ3 1 
ATOM   1417 C CH2 . TRP A 1 182 ? 30.664  6.427   36.698  1.00 35.44  ? 182  TRP A CH2 1 
ATOM   1418 N N   . VAL A 1 183 ? 31.285  2.290   32.800  1.00 35.80  ? 183  VAL A N   1 
ATOM   1419 C CA  . VAL A 1 183 ? 29.871  2.129   33.106  1.00 36.18  ? 183  VAL A CA  1 
ATOM   1420 C C   . VAL A 1 183 ? 29.596  0.706   33.587  1.00 37.68  ? 183  VAL A C   1 
ATOM   1421 O O   . VAL A 1 183 ? 28.879  0.491   34.581  1.00 36.33  ? 183  VAL A O   1 
ATOM   1422 C CB  . VAL A 1 183 ? 28.993  2.510   31.904  1.00 37.24  ? 183  VAL A CB  1 
ATOM   1423 C CG1 . VAL A 1 183 ? 27.599  1.940   32.048  1.00 34.09  ? 183  VAL A CG1 1 
ATOM   1424 C CG2 . VAL A 1 183 ? 28.948  4.048   31.764  1.00 31.19  ? 183  VAL A CG2 1 
ATOM   1425 N N   . GLN A 1 184 ? 30.196  -0.268  32.904  1.00 35.61  ? 184  GLN A N   1 
ATOM   1426 C CA  . GLN A 1 184 ? 30.022  -1.656  33.295  1.00 42.38  ? 184  GLN A CA  1 
ATOM   1427 C C   . GLN A 1 184 ? 30.430  -1.844  34.753  1.00 40.90  ? 184  GLN A C   1 
ATOM   1428 O O   . GLN A 1 184 ? 29.719  -2.482  35.505  1.00 38.58  ? 184  GLN A O   1 
ATOM   1429 C CB  . GLN A 1 184 ? 30.815  -2.599  32.384  1.00 37.18  ? 184  GLN A CB  1 
ATOM   1430 C CG  . GLN A 1 184 ? 30.168  -2.756  31.047  1.00 37.90  ? 184  GLN A CG  1 
ATOM   1431 C CD  . GLN A 1 184 ? 28.807  -3.384  31.155  1.00 42.47  ? 184  GLN A CD  1 
ATOM   1432 O OE1 . GLN A 1 184 ? 27.796  -2.758  30.815  1.00 46.79  ? 184  GLN A OE1 1 
ATOM   1433 N NE2 . GLN A 1 184 ? 28.760  -4.628  31.636  1.00 34.91  ? 184  GLN A NE2 1 
ATOM   1434 N N   . GLU A 1 185 ? 31.558  -1.267  35.154  1.00 37.02  ? 185  GLU A N   1 
ATOM   1435 C CA  . GLU A 1 185 ? 32.047  -1.504  36.503  1.00 37.75  ? 185  GLU A CA  1 
ATOM   1436 C C   . GLU A 1 185 ? 31.321  -0.693  37.581  1.00 42.16  ? 185  GLU A C   1 
ATOM   1437 O O   . GLU A 1 185 ? 31.157  -1.179  38.704  1.00 39.41  ? 185  GLU A O   1 
ATOM   1438 C CB  . GLU A 1 185 ? 33.563  -1.285  36.625  1.00 38.41  ? 185  GLU A CB  1 
ATOM   1439 C CG  . GLU A 1 185 ? 34.027  -1.348  38.087  1.00 44.69  ? 185  GLU A CG  1 
ATOM   1440 C CD  . GLU A 1 185 ? 35.471  -1.783  38.270  1.00 59.83  ? 185  GLU A CD  1 
ATOM   1441 O OE1 . GLU A 1 185 ? 35.784  -2.417  39.320  1.00 59.73  ? 185  GLU A OE1 1 
ATOM   1442 O OE2 . GLU A 1 185 ? 36.294  -1.479  37.377  1.00 61.35  ? 185  GLU A OE2 1 
ATOM   1443 N N   . ASN A 1 186 ? 30.881  0.522   37.248  1.00 34.36  ? 186  ASN A N   1 
ATOM   1444 C CA  . ASN A 1 186 ? 30.480  1.474   38.274  1.00 29.75  ? 186  ASN A CA  1 
ATOM   1445 C C   . ASN A 1 186 ? 29.021  1.895   38.293  1.00 34.14  ? 186  ASN A C   1 
ATOM   1446 O O   . ASN A 1 186 ? 28.561  2.421   39.297  1.00 38.56  ? 186  ASN A O   1 
ATOM   1447 C CB  . ASN A 1 186 ? 31.348  2.745   38.193  1.00 31.23  ? 186  ASN A CB  1 
ATOM   1448 C CG  . ASN A 1 186 ? 32.826  2.455   38.427  1.00 40.44  ? 186  ASN A CG  1 
ATOM   1449 O OD1 . ASN A 1 186 ? 33.208  2.016   39.507  1.00 40.11  ? 186  ASN A OD1 1 
ATOM   1450 N ND2 . ASN A 1 186 ? 33.663  2.702   37.410  1.00 39.90  ? 186  ASN A ND2 1 
ATOM   1451 N N   . ILE A 1 187 ? 28.307  1.720   37.186  1.00 34.88  ? 187  ILE A N   1 
ATOM   1452 C CA  . ILE A 1 187 ? 26.980  2.335   37.062  1.00 33.42  ? 187  ILE A CA  1 
ATOM   1453 C C   . ILE A 1 187 ? 25.983  1.794   38.102  1.00 37.56  ? 187  ILE A C   1 
ATOM   1454 O O   . ILE A 1 187 ? 25.069  2.508   38.526  1.00 35.71  ? 187  ILE A O   1 
ATOM   1455 C CB  . ILE A 1 187 ? 26.397  2.259   35.611  1.00 30.61  ? 187  ILE A CB  1 
ATOM   1456 C CG1 . ILE A 1 187 ? 25.381  3.388   35.393  1.00 31.82  ? 187  ILE A CG1 1 
ATOM   1457 C CG2 . ILE A 1 187 ? 25.736  0.917   35.341  1.00 31.90  ? 187  ILE A CG2 1 
ATOM   1458 C CD1 . ILE A 1 187 ? 26.026  4.789   35.474  1.00 26.97  ? 187  ILE A CD1 1 
ATOM   1459 N N   . ALA A 1 188 ? 26.170  0.550   38.540  1.00 32.69  ? 188  ALA A N   1 
ATOM   1460 C CA  . ALA A 1 188 ? 25.299  0.003   39.590  1.00 32.18  ? 188  ALA A CA  1 
ATOM   1461 C C   . ALA A 1 188 ? 25.346  0.835   40.874  1.00 40.95  ? 188  ALA A C   1 
ATOM   1462 O O   . ALA A 1 188 ? 24.406  0.817   41.667  1.00 42.30  ? 188  ALA A O   1 
ATOM   1463 C CB  . ALA A 1 188 ? 25.605  -1.493  39.876  1.00 33.23  ? 188  ALA A CB  1 
ATOM   1464 N N   . ALA A 1 189 ? 26.422  1.585   41.086  1.00 37.50  ? 189  ALA A N   1 
ATOM   1465 C CA  . ALA A 1 189 ? 26.501  2.385   42.305  1.00 36.22  ? 189  ALA A CA  1 
ATOM   1466 C C   . ALA A 1 189 ? 25.483  3.509   42.254  1.00 40.14  ? 189  ALA A C   1 
ATOM   1467 O O   . ALA A 1 189 ? 25.184  4.124   43.271  1.00 45.38  ? 189  ALA A O   1 
ATOM   1468 C CB  . ALA A 1 189 ? 27.890  2.951   42.493  1.00 38.16  ? 189  ALA A CB  1 
ATOM   1469 N N   . PHE A 1 190 ? 24.973  3.792   41.058  1.00 39.04  ? 190  PHE A N   1 
ATOM   1470 C CA  . PHE A 1 190 ? 24.082  4.925   40.848  1.00 36.47  ? 190  PHE A CA  1 
ATOM   1471 C C   . PHE A 1 190 ? 22.650  4.439   40.635  1.00 39.26  ? 190  PHE A C   1 
ATOM   1472 O O   . PHE A 1 190 ? 21.768  5.236   40.386  1.00 45.15  ? 190  PHE A O   1 
ATOM   1473 C CB  . PHE A 1 190 ? 24.523  5.761   39.619  1.00 36.03  ? 190  PHE A CB  1 
ATOM   1474 C CG  . PHE A 1 190 ? 25.891  6.390   39.748  1.00 32.51  ? 190  PHE A CG  1 
ATOM   1475 C CD1 . PHE A 1 190 ? 27.030  5.687   39.387  1.00 35.18  ? 190  PHE A CD1 1 
ATOM   1476 C CD2 . PHE A 1 190 ? 26.035  7.690   40.204  1.00 35.23  ? 190  PHE A CD2 1 
ATOM   1477 C CE1 . PHE A 1 190 ? 28.305  6.275   39.497  1.00 34.51  ? 190  PHE A CE1 1 
ATOM   1478 C CE2 . PHE A 1 190 ? 27.306  8.287   40.322  1.00 34.69  ? 190  PHE A CE2 1 
ATOM   1479 C CZ  . PHE A 1 190 ? 28.441  7.575   39.965  1.00 27.19  ? 190  PHE A CZ  1 
ATOM   1480 N N   . GLY A 1 191 ? 22.424  3.132   40.707  1.00 39.76  ? 191  GLY A N   1 
ATOM   1481 C CA  . GLY A 1 191 ? 21.110  2.581   40.409  1.00 38.97  ? 191  GLY A CA  1 
ATOM   1482 C C   . GLY A 1 191 ? 20.953  2.148   38.963  1.00 42.29  ? 191  GLY A C   1 
ATOM   1483 O O   . GLY A 1 191 ? 19.876  1.702   38.552  1.00 41.95  ? 191  GLY A O   1 
ATOM   1484 N N   . GLY A 1 192 ? 22.029  2.265   38.182  1.00 41.66  ? 192  GLY A N   1 
ATOM   1485 C CA  . GLY A 1 192 ? 21.994  1.867   36.784  1.00 39.37  ? 192  GLY A CA  1 
ATOM   1486 C C   . GLY A 1 192 ? 22.215  0.372   36.587  1.00 43.11  ? 192  GLY A C   1 
ATOM   1487 O O   . GLY A 1 192 ? 22.912  -0.275  37.367  1.00 40.38  ? 192  GLY A O   1 
ATOM   1488 N N   . ASP A 1 193 ? 21.634  -0.173  35.526  1.00 42.41  ? 193  ASP A N   1 
ATOM   1489 C CA  . ASP A 1 193 ? 21.717  -1.599  35.223  1.00 40.86  ? 193  ASP A CA  1 
ATOM   1490 C C   . ASP A 1 193 ? 22.759  -1.864  34.126  1.00 37.22  ? 193  ASP A C   1 
ATOM   1491 O O   . ASP A 1 193 ? 22.487  -1.610  32.954  1.00 37.90  ? 193  ASP A O   1 
ATOM   1492 C CB  . ASP A 1 193 ? 20.329  -2.085  34.766  1.00 38.04  ? 193  ASP A CB  1 
ATOM   1493 C CG  . ASP A 1 193 ? 20.278  -3.585  34.505  1.00 46.32  ? 193  ASP A CG  1 
ATOM   1494 O OD1 . ASP A 1 193 ? 21.330  -4.246  34.587  1.00 46.74  ? 193  ASP A OD1 1 
ATOM   1495 O OD2 . ASP A 1 193 ? 19.171  -4.109  34.231  1.00 46.94  ? 193  ASP A OD2 1 
ATOM   1496 N N   . PRO A 1 194 ? 23.949  -2.391  34.498  1.00 37.22  ? 194  PRO A N   1 
ATOM   1497 C CA  . PRO A 1 194 ? 24.984  -2.627  33.478  1.00 36.96  ? 194  PRO A CA  1 
ATOM   1498 C C   . PRO A 1 194 ? 24.563  -3.665  32.435  1.00 42.42  ? 194  PRO A C   1 
ATOM   1499 O O   . PRO A 1 194 ? 25.214  -3.777  31.373  1.00 38.27  ? 194  PRO A O   1 
ATOM   1500 C CB  . PRO A 1 194 ? 26.187  -3.147  34.283  1.00 38.18  ? 194  PRO A CB  1 
ATOM   1501 C CG  . PRO A 1 194 ? 25.614  -3.676  35.584  1.00 39.82  ? 194  PRO A CG  1 
ATOM   1502 C CD  . PRO A 1 194 ? 24.366  -2.834  35.850  1.00 39.99  ? 194  PRO A CD  1 
ATOM   1503 N N   . MET A 1 195 ? 23.510  -4.430  32.735  1.00 37.31  ? 195  MET A N   1 
ATOM   1504 C CA  . MET A 1 195 ? 23.018  -5.437  31.790  1.00 43.94  ? 195  MET A CA  1 
ATOM   1505 C C   . MET A 1 195 ? 21.970  -4.867  30.837  1.00 45.51  ? 195  MET A C   1 
ATOM   1506 O O   . MET A 1 195 ? 21.465  -5.573  29.972  1.00 51.81  ? 195  MET A O   1 
ATOM   1507 C CB  . MET A 1 195 ? 22.503  -6.695  32.512  1.00 42.53  ? 195  MET A CB  1 
ATOM   1508 C CG  . MET A 1 195 ? 23.599  -7.436  33.274  1.00 43.91  ? 195  MET A CG  1 
ATOM   1509 S SD  . MET A 1 195 ? 23.120  -9.055  33.921  1.00 70.06  ? 195  MET A SD  1 
ATOM   1510 C CE  . MET A 1 195 ? 21.468  -8.735  34.526  1.00 53.97  ? 195  MET A CE  1 
ATOM   1511 N N   . SER A 1 196 ? 21.650  -3.587  30.989  1.00 41.58  ? 196  SER A N   1 
ATOM   1512 C CA  . SER A 1 196 ? 20.829  -2.907  29.984  1.00 37.87  ? 196  SER A CA  1 
ATOM   1513 C C   . SER A 1 196 ? 21.419  -1.538  29.604  1.00 39.81  ? 196  SER A C   1 
ATOM   1514 O O   . SER A 1 196 ? 21.034  -0.506  30.167  1.00 38.13  ? 196  SER A O   1 
ATOM   1515 C CB  . SER A 1 196 ? 19.371  -2.767  30.445  1.00 31.25  ? 196  SER A CB  1 
ATOM   1516 O OG  . SER A 1 196 ? 18.606  -2.103  29.446  1.00 37.71  ? 196  SER A OG  1 
ATOM   1517 N N   . VAL A 1 197 ? 22.348  -1.541  28.649  1.00 37.62  ? 197  VAL A N   1 
ATOM   1518 C CA  . VAL A 1 197 ? 23.021  -0.315  28.219  1.00 39.78  ? 197  VAL A CA  1 
ATOM   1519 C C   . VAL A 1 197 ? 22.720  -0.042  26.745  1.00 38.54  ? 197  VAL A C   1 
ATOM   1520 O O   . VAL A 1 197 ? 22.967  -0.889  25.885  1.00 40.99  ? 197  VAL A O   1 
ATOM   1521 C CB  . VAL A 1 197 ? 24.565  -0.382  28.428  1.00 43.02  ? 197  VAL A CB  1 
ATOM   1522 C CG1 . VAL A 1 197 ? 25.255  0.877   27.825  1.00 44.00  ? 197  VAL A CG1 1 
ATOM   1523 C CG2 . VAL A 1 197 ? 24.914  -0.552  29.932  1.00 37.40  ? 197  VAL A CG2 1 
ATOM   1524 N N   . THR A 1 198 ? 22.173  1.136   26.461  1.00 34.18  ? 198  THR A N   1 
ATOM   1525 C CA  . THR A 1 198 ? 21.867  1.525   25.089  1.00 36.57  ? 198  THR A CA  1 
ATOM   1526 C C   . THR A 1 198 ? 22.779  2.699   24.738  1.00 34.16  ? 198  THR A C   1 
ATOM   1527 O O   . THR A 1 198 ? 22.782  3.697   25.458  1.00 33.56  ? 198  THR A O   1 
ATOM   1528 C CB  . THR A 1 198 ? 20.370  1.936   24.955  1.00 35.17  ? 198  THR A CB  1 
ATOM   1529 O OG1 . THR A 1 198 ? 19.545  0.805   25.241  1.00 38.14  ? 198  THR A OG1 1 
ATOM   1530 C CG2 . THR A 1 198 ? 20.041  2.447   23.547  1.00 29.17  ? 198  THR A CG2 1 
ATOM   1531 N N   . LEU A 1 199 ? 23.573  2.571   23.671  1.00 32.49  ? 199  LEU A N   1 
ATOM   1532 C CA  . LEU A 1 199 ? 24.334  3.722   23.151  1.00 33.81  ? 199  LEU A CA  1 
ATOM   1533 C C   . LEU A 1 199 ? 23.464  4.550   22.203  1.00 38.10  ? 199  LEU A C   1 
ATOM   1534 O O   . LEU A 1 199 ? 22.703  3.997   21.416  1.00 41.19  ? 199  LEU A O   1 
ATOM   1535 C CB  . LEU A 1 199 ? 25.585  3.282   22.409  1.00 30.27  ? 199  LEU A CB  1 
ATOM   1536 C CG  . LEU A 1 199 ? 26.452  2.179   23.030  1.00 28.79  ? 199  LEU A CG  1 
ATOM   1537 C CD1 . LEU A 1 199 ? 27.618  1.902   22.107  1.00 27.44  ? 199  LEU A CD1 1 
ATOM   1538 C CD2 . LEU A 1 199 ? 26.960  2.594   24.393  1.00 29.54  ? 199  LEU A CD2 1 
ATOM   1539 N N   . PHE A 1 200 ? 23.554  5.870   22.303  1.00 32.85  ? 200  PHE A N   1 
ATOM   1540 C CA  . PHE A 1 200 ? 22.985  6.736   21.283  1.00 32.07  ? 200  PHE A CA  1 
ATOM   1541 C C   . PHE A 1 200 ? 23.909  7.915   21.005  1.00 32.56  ? 200  PHE A C   1 
ATOM   1542 O O   . PHE A 1 200 ? 24.661  8.344   21.883  1.00 29.62  ? 200  PHE A O   1 
ATOM   1543 C CB  . PHE A 1 200 ? 21.517  7.130   21.572  1.00 30.06  ? 200  PHE A CB  1 
ATOM   1544 C CG  . PHE A 1 200 ? 21.294  8.122   22.704  1.00 33.07  ? 200  PHE A CG  1 
ATOM   1545 C CD1 . PHE A 1 200 ? 21.877  7.955   23.955  1.00 31.52  ? 200  PHE A CD1 1 
ATOM   1546 C CD2 . PHE A 1 200 ? 20.357  9.164   22.534  1.00 30.86  ? 200  PHE A CD2 1 
ATOM   1547 C CE1 . PHE A 1 200 ? 21.603  8.838   25.002  1.00 26.21  ? 200  PHE A CE1 1 
ATOM   1548 C CE2 . PHE A 1 200 ? 20.063  10.052  23.562  1.00 27.93  ? 200  PHE A CE2 1 
ATOM   1549 C CZ  . PHE A 1 200 ? 20.692  9.912   24.811  1.00 26.48  ? 200  PHE A CZ  1 
ATOM   1550 N N   . GLY A 1 201 ? 23.904  8.379   19.759  1.00 28.66  ? 201  GLY A N   1 
ATOM   1551 C CA  . GLY A 1 201 ? 24.751  9.480   19.346  1.00 29.71  ? 201  GLY A CA  1 
ATOM   1552 C C   . GLY A 1 201 ? 24.247  10.044  18.030  1.00 34.57  ? 201  GLY A C   1 
ATOM   1553 O O   . GLY A 1 201 ? 23.503  9.388   17.301  1.00 32.83  ? 201  GLY A O   1 
ATOM   1554 N N   . GLU A 1 202 ? 24.658  11.268  17.731  1.00 26.80  ? 202  GLU A N   1 
ATOM   1555 C CA  . GLU A 1 202 ? 24.270  11.923  16.510  1.00 29.15  ? 202  GLU A CA  1 
ATOM   1556 C C   . GLU A 1 202 ? 25.500  12.273  15.657  1.00 31.14  ? 202  GLU A C   1 
ATOM   1557 O O   . GLU A 1 202 ? 26.543  12.649  16.182  1.00 29.63  ? 202  GLU A O   1 
ATOM   1558 C CB  . GLU A 1 202 ? 23.434  13.167  16.848  1.00 29.16  ? 202  GLU A CB  1 
ATOM   1559 C CG  . GLU A 1 202 ? 22.827  13.840  15.641  1.00 32.65  ? 202  GLU A CG  1 
ATOM   1560 C CD  . GLU A 1 202 ? 23.716  14.955  15.121  1.00 37.03  ? 202  GLU A CD  1 
ATOM   1561 O OE1 . GLU A 1 202 ? 24.729  15.243  15.773  1.00 36.98  ? 202  GLU A OE1 1 
ATOM   1562 O OE2 . GLU A 1 202 ? 23.377  15.566  14.092  1.00 39.49  ? 202  GLU A OE2 1 
HETATM 1563 N N   . SBG A 1 203 ? 25.349  12.141  14.343  1.00 32.54  ? 203  SBG A N   1 
HETATM 1564 C CA  . SBG A 1 203 ? 26.396  12.427  13.373  1.00 26.57  ? 203  SBG A CA  1 
HETATM 1565 C CB  . SBG A 1 203 ? 26.572  13.947  13.322  1.00 25.70  ? 203  SBG A CB  1 
HETATM 1566 O OG  . SBG A 1 203 ? 27.405  14.305  12.221  1.00 34.36  ? 203  SBG A OG  1 
HETATM 1567 C C   . SBG A 1 203 ? 27.669  11.615  13.672  1.00 28.83  ? 203  SBG A C   1 
HETATM 1568 O O   . SBG A 1 203 ? 27.613  10.403  13.682  1.00 32.72  ? 203  SBG A O   1 
HETATM 1569 O O2  . SBG A 1 203 ? 27.748  16.760  12.428  1.00 30.38  ? 203  SBG A O2  1 
HETATM 1570 P P1  . SBG A 1 203 ? 28.516  15.466  12.400  1.00 30.71  ? 203  SBG A P1  1 
HETATM 1571 O O1  . SBG A 1 203 ? 29.462  15.088  13.504  1.00 34.39  ? 203  SBG A O1  1 
HETATM 1572 C C1  . SBG A 1 203 ? 29.389  15.386  10.807  1.00 22.81  ? 203  SBG A C1  1 
ATOM   1573 N N   . ALA A 1 204 ? 28.801  12.270  13.932  1.00 23.77  ? 204  ALA A N   1 
ATOM   1574 C CA  . ALA A 1 204 ? 30.023  11.548  14.316  1.00 29.72  ? 204  ALA A CA  1 
ATOM   1575 C C   . ALA A 1 204 ? 29.826  10.663  15.572  1.00 33.25  ? 204  ALA A C   1 
ATOM   1576 O O   . ALA A 1 204 ? 30.468  9.607   15.710  1.00 32.20  ? 204  ALA A O   1 
ATOM   1577 C CB  . ALA A 1 204 ? 31.183  12.533  14.525  1.00 25.49  ? 204  ALA A CB  1 
ATOM   1578 N N   . GLY A 1 205 ? 28.940  11.084  16.479  1.00 28.90  ? 205  GLY A N   1 
ATOM   1579 C CA  . GLY A 1 205 ? 28.587  10.264  17.643  1.00 24.13  ? 205  GLY A CA  1 
ATOM   1580 C C   . GLY A 1 205 ? 27.872  8.988   17.188  1.00 33.35  ? 205  GLY A C   1 
ATOM   1581 O O   . GLY A 1 205 ? 28.148  7.892   17.698  1.00 33.72  ? 205  GLY A O   1 
ATOM   1582 N N   . ALA A 1 206 ? 26.959  9.130   16.221  1.00 26.81  ? 206  ALA A N   1 
ATOM   1583 C CA  . ALA A 1 206 ? 26.308  7.966   15.579  1.00 31.50  ? 206  ALA A CA  1 
ATOM   1584 C C   . ALA A 1 206 ? 27.306  7.081   14.842  1.00 31.90  ? 206  ALA A C   1 
ATOM   1585 O O   . ALA A 1 206 ? 27.249  5.866   14.963  1.00 32.96  ? 206  ALA A O   1 
ATOM   1586 C CB  . ALA A 1 206 ? 25.190  8.397   14.604  1.00 24.33  ? 206  ALA A CB  1 
ATOM   1587 N N   . ALA A 1 207 ? 28.185  7.679   14.039  1.00 28.95  ? 207  ALA A N   1 
ATOM   1588 C CA  . ALA A 1 207 ? 29.257  6.904   13.407  1.00 30.62  ? 207  ALA A CA  1 
ATOM   1589 C C   . ALA A 1 207 ? 30.048  6.133   14.482  1.00 34.46  ? 207  ALA A C   1 
ATOM   1590 O O   . ALA A 1 207 ? 30.376  4.958   14.304  1.00 37.88  ? 207  ALA A O   1 
ATOM   1591 C CB  . ALA A 1 207 ? 30.187  7.823   12.630  1.00 29.23  ? 207  ALA A CB  1 
ATOM   1592 N N   . SER A 1 208 ? 30.342  6.798   15.604  1.00 30.59  ? 208  SER A N   1 
ATOM   1593 C CA  . SER A 1 208 ? 31.049  6.158   16.735  1.00 29.37  ? 208  SER A CA  1 
ATOM   1594 C C   . SER A 1 208 ? 30.281  4.941   17.255  1.00 31.99  ? 208  SER A C   1 
ATOM   1595 O O   . SER A 1 208 ? 30.861  3.874   17.455  1.00 30.37  ? 208  SER A O   1 
ATOM   1596 C CB  . SER A 1 208 ? 31.266  7.151   17.886  1.00 28.90  ? 208  SER A CB  1 
ATOM   1597 O OG  . SER A 1 208 ? 32.204  8.159   17.543  1.00 26.43  ? 208  SER A OG  1 
ATOM   1598 N N   . VAL A 1 209 ? 28.979  5.113   17.475  1.00 29.61  ? 209  VAL A N   1 
ATOM   1599 C CA  . VAL A 1 209 ? 28.130  4.035   17.942  1.00 30.74  ? 209  VAL A CA  1 
ATOM   1600 C C   . VAL A 1 209 ? 28.227  2.869   16.965  1.00 35.42  ? 209  VAL A C   1 
ATOM   1601 O O   . VAL A 1 209 ? 28.313  1.714   17.371  1.00 36.65  ? 209  VAL A O   1 
ATOM   1602 C CB  . VAL A 1 209 ? 26.656  4.485   18.051  1.00 31.51  ? 209  VAL A CB  1 
ATOM   1603 C CG1 . VAL A 1 209 ? 25.728  3.279   18.150  1.00 27.63  ? 209  VAL A CG1 1 
ATOM   1604 C CG2 . VAL A 1 209 ? 26.465  5.414   19.257  1.00 26.38  ? 209  VAL A CG2 1 
ATOM   1605 N N   . GLY A 1 210 ? 28.225  3.186   15.671  1.00 33.90  ? 210  GLY A N   1 
ATOM   1606 C CA  . GLY A 1 210 ? 28.359  2.184   14.626  1.00 27.44  ? 210  GLY A CA  1 
ATOM   1607 C C   . GLY A 1 210 ? 29.671  1.432   14.711  1.00 32.21  ? 210  GLY A C   1 
ATOM   1608 O O   . GLY A 1 210 ? 29.736  0.227   14.507  1.00 34.87  ? 210  GLY A O   1 
ATOM   1609 N N   . MET A 1 211 ? 30.734  2.137   15.048  1.00 33.00  ? 211  MET A N   1 
ATOM   1610 C CA  . MET A 1 211 ? 32.025  1.484   15.146  1.00 32.21  ? 211  MET A CA  1 
ATOM   1611 C C   . MET A 1 211 ? 32.166  0.557   16.339  1.00 32.07  ? 211  MET A C   1 
ATOM   1612 O O   . MET A 1 211 ? 32.880  -0.442  16.262  1.00 33.56  ? 211  MET A O   1 
ATOM   1613 C CB  . MET A 1 211 ? 33.133  2.519   15.101  1.00 33.39  ? 211  MET A CB  1 
ATOM   1614 C CG  . MET A 1 211 ? 33.276  3.015   13.657  1.00 42.74  ? 211  MET A CG  1 
ATOM   1615 S SD  . MET A 1 211 ? 34.269  4.474   13.574  1.00 45.27  ? 211  MET A SD  1 
ATOM   1616 C CE  . MET A 1 211 ? 33.762  5.148   11.979  1.00 34.13  ? 211  MET A CE  1 
ATOM   1617 N N   . HIS A 1 212 ? 31.477  0.885   17.432  1.00 27.87  ? 212  HIS A N   1 
ATOM   1618 C CA  . HIS A 1 212 ? 31.422  -0.011  18.578  1.00 28.82  ? 212  HIS A CA  1 
ATOM   1619 C C   . HIS A 1 212 ? 30.645  -1.266  18.241  1.00 33.17  ? 212  HIS A C   1 
ATOM   1620 O O   . HIS A 1 212 ? 31.011  -2.337  18.699  1.00 37.83  ? 212  HIS A O   1 
ATOM   1621 C CB  . HIS A 1 212 ? 30.848  0.674   19.822  1.00 30.31  ? 212  HIS A CB  1 
ATOM   1622 C CG  . HIS A 1 212 ? 31.741  1.735   20.362  1.00 33.35  ? 212  HIS A CG  1 
ATOM   1623 N ND1 . HIS A 1 212 ? 32.976  1.454   20.910  1.00 33.82  ? 212  HIS A ND1 1 
ATOM   1624 C CD2 . HIS A 1 212 ? 31.609  3.083   20.386  1.00 29.44  ? 212  HIS A CD2 1 
ATOM   1625 C CE1 . HIS A 1 212 ? 33.560  2.586   21.263  1.00 34.19  ? 212  HIS A CE1 1 
ATOM   1626 N NE2 . HIS A 1 212 ? 32.750  3.588   20.956  1.00 33.12  ? 212  HIS A NE2 1 
ATOM   1627 N N   . ILE A 1 213 ? 29.597  -1.135  17.427  1.00 34.89  ? 213  ILE A N   1 
ATOM   1628 C CA  . ILE A 1 213 ? 28.868  -2.306  16.915  1.00 33.56  ? 213  ILE A CA  1 
ATOM   1629 C C   . ILE A 1 213 ? 29.809  -3.204  16.096  1.00 41.92  ? 213  ILE A C   1 
ATOM   1630 O O   . ILE A 1 213 ? 29.696  -4.421  16.135  1.00 40.15  ? 213  ILE A O   1 
ATOM   1631 C CB  . ILE A 1 213 ? 27.649  -1.901  16.033  1.00 35.56  ? 213  ILE A CB  1 
ATOM   1632 C CG1 . ILE A 1 213 ? 26.590  -1.171  16.879  1.00 32.25  ? 213  ILE A CG1 1 
ATOM   1633 C CG2 . ILE A 1 213 ? 27.039  -3.136  15.277  1.00 37.09  ? 213  ILE A CG2 1 
ATOM   1634 C CD1 . ILE A 1 213 ? 25.412  -0.652  16.076  1.00 35.60  ? 213  ILE A CD1 1 
ATOM   1635 N N   . LEU A 1 214 ? 30.747  -2.599  15.372  1.00 38.51  ? 214  LEU A N   1 
ATOM   1636 C CA  . LEU A 1 214 ? 31.584  -3.343  14.443  1.00 38.36  ? 214  LEU A CA  1 
ATOM   1637 C C   . LEU A 1 214 ? 32.915  -3.790  15.053  1.00 39.67  ? 214  LEU A C   1 
ATOM   1638 O O   . LEU A 1 214 ? 33.708  -4.452  14.396  1.00 37.60  ? 214  LEU A O   1 
ATOM   1639 C CB  . LEU A 1 214 ? 31.851  -2.502  13.187  1.00 32.96  ? 214  LEU A CB  1 
ATOM   1640 C CG  . LEU A 1 214 ? 30.574  -2.110  12.454  1.00 36.89  ? 214  LEU A CG  1 
ATOM   1641 C CD1 . LEU A 1 214 ? 30.873  -1.151  11.286  1.00 32.65  ? 214  LEU A CD1 1 
ATOM   1642 C CD2 . LEU A 1 214 ? 29.839  -3.358  11.985  1.00 34.11  ? 214  LEU A CD2 1 
ATOM   1643 N N   . SER A 1 215 ? 33.172  -3.397  16.293  1.00 37.07  ? 215  SER A N   1 
ATOM   1644 C CA  . SER A 1 215 ? 34.451  -3.680  16.909  1.00 34.72  ? 215  SER A CA  1 
ATOM   1645 C C   . SER A 1 215 ? 34.230  -4.596  18.104  1.00 43.05  ? 215  SER A C   1 
ATOM   1646 O O   . SER A 1 215 ? 33.615  -4.210  19.104  1.00 40.63  ? 215  SER A O   1 
ATOM   1647 C CB  . SER A 1 215 ? 35.130  -2.385  17.333  1.00 38.82  ? 215  SER A CB  1 
ATOM   1648 O OG  . SER A 1 215 ? 36.428  -2.659  17.829  1.00 41.79  ? 215  SER A OG  1 
ATOM   1649 N N   . LEU A 1 216 ? 34.741  -5.815  17.980  1.00 45.69  ? 216  LEU A N   1 
ATOM   1650 C CA  . LEU A 1 216 ? 34.407  -6.918  18.871  1.00 47.89  ? 216  LEU A CA  1 
ATOM   1651 C C   . LEU A 1 216 ? 34.546  -6.609  20.348  1.00 44.43  ? 216  LEU A C   1 
ATOM   1652 O O   . LEU A 1 216 ? 33.629  -6.871  21.109  1.00 42.92  ? 216  LEU A O   1 
ATOM   1653 C CB  . LEU A 1 216 ? 35.248  -8.151  18.525  1.00 60.54  ? 216  LEU A CB  1 
ATOM   1654 C CG  . LEU A 1 216 ? 34.672  -9.469  19.039  1.00 77.46  ? 216  LEU A CG  1 
ATOM   1655 C CD1 . LEU A 1 216 ? 33.350  -9.775  18.329  1.00 79.46  ? 216  LEU A CD1 1 
ATOM   1656 C CD2 . LEU A 1 216 ? 35.674  -10.604 18.851  1.00 80.57  ? 216  LEU A CD2 1 
ATOM   1657 N N   . PRO A 1 217 ? 35.702  -6.061  20.767  1.00 45.52  ? 217  PRO A N   1 
ATOM   1658 C CA  . PRO A 1 217 ? 35.879  -5.758  22.197  1.00 38.95  ? 217  PRO A CA  1 
ATOM   1659 C C   . PRO A 1 217 ? 34.861  -4.745  22.771  1.00 40.42  ? 217  PRO A C   1 
ATOM   1660 O O   . PRO A 1 217 ? 34.735  -4.664  23.988  1.00 44.15  ? 217  PRO A O   1 
ATOM   1661 C CB  . PRO A 1 217 ? 37.303  -5.182  22.265  1.00 40.79  ? 217  PRO A CB  1 
ATOM   1662 C CG  . PRO A 1 217 ? 37.995  -5.726  21.018  1.00 43.49  ? 217  PRO A CG  1 
ATOM   1663 C CD  . PRO A 1 217 ? 36.910  -5.752  19.976  1.00 39.98  ? 217  PRO A CD  1 
ATOM   1664 N N   . SER A 1 218 ? 34.145  -3.997  21.937  1.00 39.71  ? 218  SER A N   1 
ATOM   1665 C CA  . SER A 1 218 ? 33.144  -3.070  22.479  1.00 38.39  ? 218  SER A CA  1 
ATOM   1666 C C   . SER A 1 218 ? 31.828  -3.775  22.685  1.00 44.01  ? 218  SER A C   1 
ATOM   1667 O O   . SER A 1 218 ? 30.975  -3.292  23.421  1.00 41.23  ? 218  SER A O   1 
ATOM   1668 C CB  . SER A 1 218 ? 32.905  -1.889  21.554  1.00 33.96  ? 218  SER A CB  1 
ATOM   1669 O OG  . SER A 1 218 ? 34.008  -1.002  21.558  1.00 40.09  ? 218  SER A OG  1 
ATOM   1670 N N   . ARG A 1 219 ? 31.668  -4.917  22.028  1.00 46.99  ? 219  ARG A N   1 
ATOM   1671 C CA  . ARG A 1 219 ? 30.358  -5.561  21.920  1.00 53.33  ? 219  ARG A CA  1 
ATOM   1672 C C   . ARG A 1 219 ? 29.791  -6.042  23.245  1.00 52.59  ? 219  ARG A C   1 
ATOM   1673 O O   . ARG A 1 219 ? 28.577  -6.064  23.433  1.00 53.05  ? 219  ARG A O   1 
ATOM   1674 C CB  . ARG A 1 219 ? 30.402  -6.709  20.914  1.00 58.05  ? 219  ARG A CB  1 
ATOM   1675 C CG  . ARG A 1 219 ? 30.546  -6.243  19.467  1.00 60.04  ? 219  ARG A CG  1 
ATOM   1676 C CD  . ARG A 1 219 ? 29.468  -5.233  19.101  1.00 62.45  ? 219  ARG A CD  1 
ATOM   1677 N NE  . ARG A 1 219 ? 28.121  -5.685  19.458  1.00 64.34  ? 219  ARG A NE  1 
ATOM   1678 C CZ  . ARG A 1 219 ? 27.330  -6.410  18.672  1.00 69.19  ? 219  ARG A CZ  1 
ATOM   1679 N NH1 . ARG A 1 219 ? 27.739  -6.780  17.461  1.00 69.38  ? 219  ARG A NH1 1 
ATOM   1680 N NH2 . ARG A 1 219 ? 26.123  -6.765  19.098  1.00 71.43  ? 219  ARG A NH2 1 
ATOM   1681 N N   . SER A 1 220 ? 30.674  -6.421  24.160  1.00 48.28  ? 220  SER A N   1 
ATOM   1682 C CA  . SER A 1 220 ? 30.260  -6.827  25.492  1.00 50.33  ? 220  SER A CA  1 
ATOM   1683 C C   . SER A 1 220 ? 29.895  -5.661  26.404  1.00 46.55  ? 220  SER A C   1 
ATOM   1684 O O   . SER A 1 220 ? 29.580  -5.890  27.567  1.00 48.82  ? 220  SER A O   1 
ATOM   1685 C CB  . SER A 1 220 ? 31.361  -7.659  26.167  1.00 63.09  ? 220  SER A CB  1 
ATOM   1686 O OG  . SER A 1 220 ? 32.615  -6.996  26.136  1.00 65.45  ? 220  SER A OG  1 
ATOM   1687 N N   . LEU A 1 221 ? 29.928  -4.421  25.900  1.00 35.94  ? 221  LEU A N   1 
ATOM   1688 C CA  . LEU A 1 221 ? 29.774  -3.271  26.796  1.00 33.48  ? 221  LEU A CA  1 
ATOM   1689 C C   . LEU A 1 221 ? 28.454  -2.547  26.602  1.00 39.10  ? 221  LEU A C   1 
ATOM   1690 O O   . LEU A 1 221 ? 28.194  -1.521  27.248  1.00 36.25  ? 221  LEU A O   1 
ATOM   1691 C CB  . LEU A 1 221 ? 30.942  -2.283  26.641  1.00 36.35  ? 221  LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 221 ? 32.327  -2.933  26.585  1.00 42.76  ? 221  LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 221 ? 33.391  -1.880  26.203  1.00 36.28  ? 221  LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 221 ? 32.688  -3.675  27.916  1.00 33.35  ? 221  LEU A CD2 1 
ATOM   1695 N N   . PHE A 1 222 ? 27.627  -3.071  25.706  1.00 35.56  ? 222  PHE A N   1 
ATOM   1696 C CA  . PHE A 1 222 ? 26.319  -2.475  25.474  1.00 40.30  ? 222  PHE A CA  1 
ATOM   1697 C C   . PHE A 1 222 ? 25.384  -3.483  24.820  1.00 41.58  ? 222  PHE A C   1 
ATOM   1698 O O   . PHE A 1 222 ? 25.830  -4.514  24.327  1.00 34.93  ? 222  PHE A O   1 
ATOM   1699 C CB  . PHE A 1 222 ? 26.449  -1.215  24.616  1.00 36.19  ? 222  PHE A CB  1 
ATOM   1700 C CG  . PHE A 1 222 ? 26.900  -1.478  23.206  1.00 36.16  ? 222  PHE A CG  1 
ATOM   1701 C CD1 . PHE A 1 222 ? 28.237  -1.746  22.927  1.00 33.37  ? 222  PHE A CD1 1 
ATOM   1702 C CD2 . PHE A 1 222 ? 25.992  -1.431  22.150  1.00 35.78  ? 222  PHE A CD2 1 
ATOM   1703 C CE1 . PHE A 1 222 ? 28.663  -1.973  21.612  1.00 35.45  ? 222  PHE A CE1 1 
ATOM   1704 C CE2 . PHE A 1 222 ? 26.411  -1.658  20.830  1.00 37.69  ? 222  PHE A CE2 1 
ATOM   1705 C CZ  . PHE A 1 222 ? 27.749  -1.927  20.566  1.00 37.86  ? 222  PHE A CZ  1 
ATOM   1706 N N   . HIS A 1 223 ? 24.091  -3.186  24.797  1.00 42.95  ? 223  HIS A N   1 
ATOM   1707 C CA  . HIS A 1 223 ? 23.124  -4.180  24.336  1.00 41.64  ? 223  HIS A CA  1 
ATOM   1708 C C   . HIS A 1 223 ? 22.297  -3.730  23.139  1.00 45.80  ? 223  HIS A C   1 
ATOM   1709 O O   . HIS A 1 223 ? 21.820  -4.556  22.362  1.00 49.31  ? 223  HIS A O   1 
ATOM   1710 C CB  . HIS A 1 223 ? 22.238  -4.586  25.515  1.00 36.48  ? 223  HIS A CB  1 
ATOM   1711 C CG  . HIS A 1 223 ? 23.031  -4.853  26.754  1.00 42.65  ? 223  HIS A CG  1 
ATOM   1712 N ND1 . HIS A 1 223 ? 23.575  -6.088  27.035  1.00 42.28  ? 223  HIS A ND1 1 
ATOM   1713 C CD2 . HIS A 1 223 ? 23.441  -4.023  27.743  1.00 28.96  ? 223  HIS A CD2 1 
ATOM   1714 C CE1 . HIS A 1 223 ? 24.258  -6.015  28.163  1.00 40.65  ? 223  HIS A CE1 1 
ATOM   1715 N NE2 . HIS A 1 223 ? 24.198  -4.772  28.607  1.00 47.06  ? 223  HIS A NE2 1 
ATOM   1716 N N   . ARG A 1 224 ? 22.141  -2.420  22.995  1.00 38.88  ? 224  ARG A N   1 
ATOM   1717 C CA  . ARG A 1 224 ? 21.311  -1.843  21.943  1.00 41.56  ? 224  ARG A CA  1 
ATOM   1718 C C   . ARG A 1 224 ? 21.938  -0.508  21.511  1.00 39.19  ? 224  ARG A C   1 
ATOM   1719 O O   . ARG A 1 224 ? 22.722  0.072   22.262  1.00 39.05  ? 224  ARG A O   1 
ATOM   1720 C CB  . ARG A 1 224 ? 19.905  -1.589  22.487  1.00 44.63  ? 224  ARG A CB  1 
ATOM   1721 C CG  . ARG A 1 224 ? 19.041  -2.815  22.494  1.00 54.46  ? 224  ARG A CG  1 
ATOM   1722 C CD  . ARG A 1 224 ? 17.733  -2.601  23.252  1.00 52.45  ? 224  ARG A CD  1 
ATOM   1723 N NE  . ARG A 1 224 ? 17.963  -2.487  24.680  1.00 57.59  ? 224  ARG A NE  1 
ATOM   1724 C CZ  . ARG A 1 224 ? 18.254  -3.509  25.480  1.00 62.42  ? 224  ARG A CZ  1 
ATOM   1725 N NH1 . ARG A 1 224 ? 18.359  -4.739  24.999  1.00 62.59  ? 224  ARG A NH1 1 
ATOM   1726 N NH2 . ARG A 1 224 ? 18.451  -3.294  26.771  1.00 66.62  ? 224  ARG A NH2 1 
ATOM   1727 N N   . ALA A 1 225 ? 21.563  -0.012  20.335  1.00 34.94  ? 225  ALA A N   1 
ATOM   1728 C CA  . ALA A 1 225 ? 22.205  1.168   19.763  1.00 35.18  ? 225  ALA A CA  1 
ATOM   1729 C C   . ALA A 1 225 ? 21.243  2.053   18.979  1.00 36.97  ? 225  ALA A C   1 
ATOM   1730 O O   . ALA A 1 225 ? 20.356  1.570   18.268  1.00 35.77  ? 225  ALA A O   1 
ATOM   1731 C CB  . ALA A 1 225 ? 23.334  0.740   18.865  1.00 36.71  ? 225  ALA A CB  1 
ATOM   1732 N N   . VAL A 1 226 ? 21.452  3.355   19.101  1.00 29.55  ? 226  VAL A N   1 
ATOM   1733 C CA  . VAL A 1 226 ? 20.690  4.330   18.364  1.00 30.96  ? 226  VAL A CA  1 
ATOM   1734 C C   . VAL A 1 226 ? 21.618  5.219   17.535  1.00 35.31  ? 226  VAL A C   1 
ATOM   1735 O O   . VAL A 1 226 ? 22.508  5.891   18.098  1.00 37.03  ? 226  VAL A O   1 
ATOM   1736 C CB  . VAL A 1 226 ? 19.874  5.218   19.322  1.00 31.76  ? 226  VAL A CB  1 
ATOM   1737 C CG1 . VAL A 1 226 ? 19.100  6.255   18.496  1.00 33.71  ? 226  VAL A CG1 1 
ATOM   1738 C CG2 . VAL A 1 226 ? 18.919  4.349   20.170  1.00 32.31  ? 226  VAL A CG2 1 
ATOM   1739 N N   . LEU A 1 227 ? 21.413  5.246   16.217  1.00 33.41  ? 227  LEU A N   1 
ATOM   1740 C CA  . LEU A 1 227 ? 22.267  6.067   15.333  1.00 36.93  ? 227  LEU A CA  1 
ATOM   1741 C C   . LEU A 1 227 ? 21.466  7.183   14.676  1.00 35.90  ? 227  LEU A C   1 
ATOM   1742 O O   . LEU A 1 227 ? 20.677  6.939   13.766  1.00 32.45  ? 227  LEU A O   1 
ATOM   1743 C CB  . LEU A 1 227 ? 22.992  5.229   14.266  1.00 34.59  ? 227  LEU A CB  1 
ATOM   1744 C CG  . LEU A 1 227 ? 24.055  4.206   14.716  1.00 35.41  ? 227  LEU A CG  1 
ATOM   1745 C CD1 . LEU A 1 227 ? 23.384  2.960   15.303  1.00 29.54  ? 227  LEU A CD1 1 
ATOM   1746 C CD2 . LEU A 1 227 ? 24.987  3.794   13.587  1.00 31.77  ? 227  LEU A CD2 1 
ATOM   1747 N N   . GLN A 1 228 ? 21.672  8.403   15.154  1.00 31.84  ? 228  GLN A N   1 
ATOM   1748 C CA  . GLN A 1 228 ? 20.970  9.573   14.646  1.00 30.24  ? 228  GLN A CA  1 
ATOM   1749 C C   . GLN A 1 228 ? 21.836  10.337  13.634  1.00 32.64  ? 228  GLN A C   1 
ATOM   1750 O O   . GLN A 1 228 ? 22.892  10.861  13.999  1.00 35.32  ? 228  GLN A O   1 
ATOM   1751 C CB  . GLN A 1 228 ? 20.596  10.498  15.814  1.00 25.65  ? 228  GLN A CB  1 
ATOM   1752 C CG  . GLN A 1 228 ? 19.815  9.799   16.948  1.00 29.29  ? 228  GLN A CG  1 
ATOM   1753 C CD  . GLN A 1 228 ? 19.580  10.689  18.170  1.00 31.10  ? 228  GLN A CD  1 
ATOM   1754 O OE1 . GLN A 1 228 ? 19.360  10.193  19.271  1.00 33.01  ? 228  GLN A OE1 1 
ATOM   1755 N NE2 . GLN A 1 228 ? 19.641  12.004  17.978  1.00 27.40  ? 228  GLN A NE2 1 
ATOM   1756 N N   . SER A 1 229 ? 21.398  10.392  12.371  1.00 32.86  ? 229  SER A N   1 
ATOM   1757 C CA  . SER A 1 229 ? 22.075  11.191  11.321  1.00 22.95  ? 229  SER A CA  1 
ATOM   1758 C C   . SER A 1 229 ? 23.576  10.925  11.179  1.00 29.40  ? 229  SER A C   1 
ATOM   1759 O O   . SER A 1 229 ? 24.378  11.860  11.078  1.00 26.90  ? 229  SER A O   1 
ATOM   1760 C CB  . SER A 1 229 ? 21.880  12.689  11.552  1.00 26.86  ? 229  SER A CB  1 
ATOM   1761 O OG  . SER A 1 229 ? 20.508  13.033  11.673  1.00 31.10  ? 229  SER A OG  1 
ATOM   1762 N N   . GLY A 1 230 ? 23.955  9.659   11.135  1.00 24.84  ? 230  GLY A N   1 
ATOM   1763 C CA  . GLY A 1 230 ? 25.354  9.312   10.964  1.00 33.53  ? 230  GLY A CA  1 
ATOM   1764 C C   . GLY A 1 230 ? 25.525  7.805   10.992  1.00 33.92  ? 230  GLY A C   1 
ATOM   1765 O O   . GLY A 1 230 ? 24.688  7.078   11.540  1.00 34.43  ? 230  GLY A O   1 
ATOM   1766 N N   . THR A 1 231 ? 26.626  7.342   10.418  1.00 30.97  ? 231  THR A N   1 
ATOM   1767 C CA  . THR A 1 231 ? 26.850  5.921   10.222  1.00 37.69  ? 231  THR A CA  1 
ATOM   1768 C C   . THR A 1 231 ? 28.336  5.683   10.141  1.00 30.84  ? 231  THR A C   1 
ATOM   1769 O O   . THR A 1 231 ? 29.087  6.579   9.751   1.00 32.88  ? 231  THR A O   1 
ATOM   1770 C CB  . THR A 1 231 ? 26.242  5.417   8.866   1.00 39.01  ? 231  THR A CB  1 
ATOM   1771 O OG1 . THR A 1 231 ? 26.814  6.168   7.804   1.00 34.83  ? 231  THR A OG1 1 
ATOM   1772 C CG2 . THR A 1 231 ? 24.744  5.605   8.811   1.00 32.53  ? 231  THR A CG2 1 
ATOM   1773 N N   . PRO A 1 232 ? 28.772  4.458   10.463  1.00 32.79  ? 232  PRO A N   1 
ATOM   1774 C CA  . PRO A 1 232 ? 30.212  4.197   10.328  1.00 28.45  ? 232  PRO A CA  1 
ATOM   1775 C C   . PRO A 1 232 ? 30.615  4.031   8.854   1.00 36.17  ? 232  PRO A C   1 
ATOM   1776 O O   . PRO A 1 232 ? 31.733  4.396   8.475   1.00 35.28  ? 232  PRO A O   1 
ATOM   1777 C CB  . PRO A 1 232 ? 30.412  2.906   11.137  1.00 25.33  ? 232  PRO A CB  1 
ATOM   1778 C CG  . PRO A 1 232 ? 29.085  2.183   11.035  1.00 31.02  ? 232  PRO A CG  1 
ATOM   1779 C CD  . PRO A 1 232 ? 28.016  3.280   10.948  1.00 31.91  ? 232  PRO A CD  1 
ATOM   1780 N N   . ASN A 1 233 ? 29.719  3.493   8.027   1.00 32.88  ? 233  ASN A N   1 
ATOM   1781 C CA  . ASN A 1 233 ? 29.961  3.417   6.584   1.00 33.82  ? 233  ASN A CA  1 
ATOM   1782 C C   . ASN A 1 233 ? 29.795  4.823   5.976   1.00 37.32  ? 233  ASN A C   1 
ATOM   1783 O O   . ASN A 1 233 ? 29.388  5.756   6.670   1.00 36.82  ? 233  ASN A O   1 
ATOM   1784 C CB  . ASN A 1 233 ? 28.988  2.422   5.924   1.00 31.57  ? 233  ASN A CB  1 
ATOM   1785 C CG  . ASN A 1 233 ? 27.546  2.677   6.325   1.00 39.22  ? 233  ASN A CG  1 
ATOM   1786 O OD1 . ASN A 1 233 ? 27.206  2.636   7.502   1.00 38.41  ? 233  ASN A OD1 1 
ATOM   1787 N ND2 . ASN A 1 233 ? 26.694  2.948   5.351   1.00 33.68  ? 233  ASN A ND2 1 
ATOM   1788 N N   . GLY A 1 234 ? 30.094  4.985   4.691   1.00 34.70  ? 234  GLY A N   1 
ATOM   1789 C CA  . GLY A 1 234 ? 29.928  6.288   4.055   1.00 32.32  ? 234  GLY A CA  1 
ATOM   1790 C C   . GLY A 1 234 ? 31.220  7.070   3.831   1.00 35.00  ? 234  GLY A C   1 
ATOM   1791 O O   . GLY A 1 234 ? 32.293  6.606   4.176   1.00 36.99  ? 234  GLY A O   1 
ATOM   1792 N N   . PRO A 1 235 ? 31.123  8.270   3.245   1.00 36.90  ? 235  PRO A N   1 
ATOM   1793 C CA  . PRO A 1 235 ? 32.363  8.841   2.703   1.00 32.94  ? 235  PRO A CA  1 
ATOM   1794 C C   . PRO A 1 235 ? 33.194  9.684   3.683   1.00 33.87  ? 235  PRO A C   1 
ATOM   1795 O O   . PRO A 1 235 ? 34.299  10.106  3.300   1.00 38.03  ? 235  PRO A O   1 
ATOM   1796 C CB  . PRO A 1 235 ? 31.860  9.711   1.537   1.00 36.66  ? 235  PRO A CB  1 
ATOM   1797 C CG  . PRO A 1 235 ? 30.478  10.144  1.958   1.00 34.15  ? 235  PRO A CG  1 
ATOM   1798 C CD  . PRO A 1 235 ? 29.924  9.049   2.872   1.00 30.68  ? 235  PRO A CD  1 
ATOM   1799 N N   . TRP A 1 236 ? 32.719  9.916   4.911   1.00 32.11  ? 236  TRP A N   1 
ATOM   1800 C CA  . TRP A 1 236 ? 33.434  10.867  5.797   1.00 35.65  ? 236  TRP A CA  1 
ATOM   1801 C C   . TRP A 1 236 ? 33.939  10.286  7.116   1.00 33.85  ? 236  TRP A C   1 
ATOM   1802 O O   . TRP A 1 236 ? 34.860  10.832  7.713   1.00 33.48  ? 236  TRP A O   1 
ATOM   1803 C CB  . TRP A 1 236 ? 32.583  12.119  6.091   1.00 33.15  ? 236  TRP A CB  1 
ATOM   1804 C CG  . TRP A 1 236 ? 31.238  11.790  6.685   1.00 34.71  ? 236  TRP A CG  1 
ATOM   1805 C CD1 . TRP A 1 236 ? 30.061  11.599  5.991   1.00 32.62  ? 236  TRP A CD1 1 
ATOM   1806 C CD2 . TRP A 1 236 ? 30.915  11.591  8.078   1.00 28.06  ? 236  TRP A CD2 1 
ATOM   1807 N NE1 . TRP A 1 236 ? 29.047  11.289  6.852   1.00 28.17  ? 236  TRP A NE1 1 
ATOM   1808 C CE2 . TRP A 1 236 ? 29.530  11.273  8.140   1.00 27.99  ? 236  TRP A CE2 1 
ATOM   1809 C CE3 . TRP A 1 236 ? 31.647  11.656  9.270   1.00 28.38  ? 236  TRP A CE3 1 
ATOM   1810 C CZ2 . TRP A 1 236 ? 28.864  11.032  9.349   1.00 27.57  ? 236  TRP A CZ2 1 
ATOM   1811 C CZ3 . TRP A 1 236 ? 30.979  11.395  10.492  1.00 26.81  ? 236  TRP A CZ3 1 
ATOM   1812 C CH2 . TRP A 1 236 ? 29.605  11.091  10.518  1.00 24.17  ? 236  TRP A CH2 1 
ATOM   1813 N N   . ALA A 1 237 ? 33.310  9.214   7.588   1.00 29.14  ? 237  ALA A N   1 
ATOM   1814 C CA  . ALA A 1 237 ? 33.554  8.718   8.953   1.00 32.85  ? 237  ALA A CA  1 
ATOM   1815 C C   . ALA A 1 237 ? 34.846  7.916   9.131   1.00 28.50  ? 237  ALA A C   1 
ATOM   1816 O O   . ALA A 1 237 ? 35.227  7.679   10.266  1.00 29.72  ? 237  ALA A O   1 
ATOM   1817 C CB  . ALA A 1 237 ? 32.358  7.864   9.477   1.00 23.33  ? 237  ALA A CB  1 
ATOM   1818 N N   . THR A 1 238 ? 35.468  7.449   8.048   1.00 28.69  ? 238  THR A N   1 
ATOM   1819 C CA  . THR A 1 238 ? 36.753  6.728   8.163   1.00 27.05  ? 238  THR A CA  1 
ATOM   1820 C C   . THR A 1 238 ? 37.697  7.116   7.027   1.00 32.68  ? 238  THR A C   1 
ATOM   1821 O O   . THR A 1 238 ? 37.269  7.635   5.987   1.00 30.28  ? 238  THR A O   1 
ATOM   1822 C CB  . THR A 1 238 ? 36.600  5.190   8.111   1.00 30.80  ? 238  THR A CB  1 
ATOM   1823 O OG1 . THR A 1 238 ? 36.013  4.813   6.860   1.00 33.59  ? 238  THR A OG1 1 
ATOM   1824 C CG2 . THR A 1 238 ? 35.752  4.668   9.260   1.00 34.13  ? 238  THR A CG2 1 
ATOM   1825 N N   . VAL A 1 239 ? 38.992  6.883   7.227   1.00 30.13  ? 239  VAL A N   1 
ATOM   1826 C CA  . VAL A 1 239 ? 39.959  7.043   6.144   1.00 30.84  ? 239  VAL A CA  1 
ATOM   1827 C C   . VAL A 1 239 ? 40.782  5.762   6.130   1.00 35.96  ? 239  VAL A C   1 
ATOM   1828 O O   . VAL A 1 239 ? 40.861  5.087   7.149   1.00 38.53  ? 239  VAL A O   1 
ATOM   1829 C CB  . VAL A 1 239 ? 40.922  8.245   6.362   1.00 35.24  ? 239  VAL A CB  1 
ATOM   1830 C CG1 . VAL A 1 239 ? 40.229  9.556   6.045   1.00 28.70  ? 239  VAL A CG1 1 
ATOM   1831 C CG2 . VAL A 1 239 ? 41.503  8.240   7.794   1.00 30.03  ? 239  VAL A CG2 1 
ATOM   1832 N N   . SER A 1 240 ? 41.378  5.431   4.987   1.00 32.23  ? 240  SER A N   1 
ATOM   1833 C CA  . SER A 1 240 ? 42.303  4.295   4.898   1.00 38.71  ? 240  SER A CA  1 
ATOM   1834 C C   . SER A 1 240 ? 43.555  4.566   5.716   1.00 36.46  ? 240  SER A C   1 
ATOM   1835 O O   . SER A 1 240 ? 43.830  5.707   6.102   1.00 37.10  ? 240  SER A O   1 
ATOM   1836 C CB  . SER A 1 240 ? 42.714  4.063   3.441   1.00 32.50  ? 240  SER A CB  1 
ATOM   1837 O OG  . SER A 1 240 ? 43.473  5.169   2.981   1.00 38.80  ? 240  SER A OG  1 
ATOM   1838 N N   . ALA A 1 241 ? 44.339  3.525   5.956   1.00 40.34  ? 241  ALA A N   1 
ATOM   1839 C CA  . ALA A 1 241 ? 45.596  3.691   6.654   1.00 36.65  ? 241  ALA A CA  1 
ATOM   1840 C C   . ALA A 1 241 ? 46.516  4.611   5.856   1.00 39.16  ? 241  ALA A C   1 
ATOM   1841 O O   . ALA A 1 241 ? 47.228  5.436   6.434   1.00 40.16  ? 241  ALA A O   1 
ATOM   1842 C CB  . ALA A 1 241 ? 46.275  2.320   6.913   1.00 37.92  ? 241  ALA A CB  1 
ATOM   1843 N N   . GLY A 1 242 ? 46.491  4.468   4.529   1.00 38.84  ? 242  GLY A N   1 
ATOM   1844 C CA  . GLY A 1 242 ? 47.348  5.249   3.648   1.00 37.06  ? 242  GLY A CA  1 
ATOM   1845 C C   . GLY A 1 242 ? 47.044  6.743   3.745   1.00 41.44  ? 242  GLY A C   1 
ATOM   1846 O O   . GLY A 1 242 ? 47.944  7.569   3.869   1.00 40.51  ? 242  GLY A O   1 
ATOM   1847 N N   . GLU A 1 243 ? 45.763  7.083   3.691   1.00 35.56  ? 243  GLU A N   1 
ATOM   1848 C CA  . GLU A 1 243 ? 45.335  8.470   3.762   1.00 36.76  ? 243  GLU A CA  1 
ATOM   1849 C C   . GLU A 1 243 ? 45.628  9.081   5.152   1.00 31.62  ? 243  GLU A C   1 
ATOM   1850 O O   . GLU A 1 243 ? 46.130  10.204  5.250   1.00 37.58  ? 243  GLU A O   1 
ATOM   1851 C CB  . GLU A 1 243 ? 43.857  8.578   3.354   1.00 39.14  ? 243  GLU A CB  1 
ATOM   1852 C CG  . GLU A 1 243 ? 43.262  9.974   3.424   1.00 38.57  ? 243  GLU A CG  1 
ATOM   1853 C CD  . GLU A 1 243 ? 43.945  10.955  2.472   1.00 43.38  ? 243  GLU A CD  1 
ATOM   1854 O OE1 . GLU A 1 243 ? 43.603  12.156  2.513   1.00 39.99  ? 243  GLU A OE1 1 
ATOM   1855 O OE2 . GLU A 1 243 ? 44.826  10.530  1.691   1.00 43.20  ? 243  GLU A OE2 1 
ATOM   1856 N N   . ALA A 1 244 ? 45.379  8.329   6.217   1.00 31.47  ? 244  ALA A N   1 
ATOM   1857 C CA  . ALA A 1 244 ? 45.720  8.792   7.565   1.00 29.10  ? 244  ALA A CA  1 
ATOM   1858 C C   . ALA A 1 244 ? 47.231  9.075   7.691   1.00 37.55  ? 244  ALA A C   1 
ATOM   1859 O O   . ALA A 1 244 ? 47.640  10.096  8.260   1.00 38.32  ? 244  ALA A O   1 
ATOM   1860 C CB  . ALA A 1 244 ? 45.263  7.795   8.635   1.00 29.58  ? 244  ALA A CB  1 
ATOM   1861 N N   . ARG A 1 245 ? 48.052  8.189   7.141   1.00 31.04  ? 245  ARG A N   1 
ATOM   1862 C CA  . ARG A 1 245 ? 49.508  8.369   7.217   1.00 38.91  ? 245  ARG A CA  1 
ATOM   1863 C C   . ARG A 1 245 ? 49.886  9.667   6.500   1.00 37.84  ? 245  ARG A C   1 
ATOM   1864 O O   . ARG A 1 245 ? 50.584  10.518  7.046   1.00 35.66  ? 245  ARG A O   1 
ATOM   1865 C CB  . ARG A 1 245 ? 50.269  7.179   6.598   1.00 37.61  ? 245  ARG A CB  1 
ATOM   1866 C CG  . ARG A 1 245 ? 51.805  7.374   6.524   1.00 42.06  ? 245  ARG A CG  1 
ATOM   1867 C CD  . ARG A 1 245 ? 52.564  6.044   6.331   1.00 39.10  ? 245  ARG A CD  1 
ATOM   1868 N NE  . ARG A 1 245 ? 52.476  5.210   7.527   1.00 41.41  ? 245  ARG A NE  1 
ATOM   1869 C CZ  . ARG A 1 245 ? 53.282  5.324   8.574   1.00 44.30  ? 245  ARG A CZ  1 
ATOM   1870 N NH1 . ARG A 1 245 ? 54.253  6.235   8.567   1.00 43.64  ? 245  ARG A NH1 1 
ATOM   1871 N NH2 . ARG A 1 245 ? 53.117  4.535   9.628   1.00 39.82  ? 245  ARG A NH2 1 
ATOM   1872 N N   . ARG A 1 246 ? 49.381  9.814   5.285   1.00 31.37  ? 246  ARG A N   1 
ATOM   1873 C CA  . ARG A 1 246 ? 49.613  11.007  4.478   1.00 40.75  ? 246  ARG A CA  1 
ATOM   1874 C C   . ARG A 1 246 ? 49.216  12.328  5.188   1.00 42.75  ? 246  ARG A C   1 
ATOM   1875 O O   . ARG A 1 246 ? 49.989  13.284  5.199   1.00 38.03  ? 246  ARG A O   1 
ATOM   1876 C CB  . ARG A 1 246 ? 48.839  10.850  3.182   1.00 36.14  ? 246  ARG A CB  1 
ATOM   1877 C CG  . ARG A 1 246 ? 49.095  11.905  2.160   1.00 38.55  ? 246  ARG A CG  1 
ATOM   1878 C CD  . ARG A 1 246 ? 47.804  12.234  1.416   1.00 50.23  ? 246  ARG A CD  1 
ATOM   1879 N NE  . ARG A 1 246 ? 47.819  13.668  1.317   1.00 58.23  ? 246  ARG A NE  1 
ATOM   1880 C CZ  . ARG A 1 246 ? 46.847  14.483  1.655   1.00 46.17  ? 246  ARG A CZ  1 
ATOM   1881 N NH1 . ARG A 1 246 ? 45.664  14.031  2.032   1.00 41.34  ? 246  ARG A NH1 1 
ATOM   1882 N NH2 . ARG A 1 246 ? 47.065  15.777  1.534   1.00 59.70  ? 246  ARG A NH2 1 
ATOM   1883 N N   . ARG A 1 247 ? 48.012  12.373  5.766   1.00 33.98  ? 247  ARG A N   1 
ATOM   1884 C CA  . ARG A 1 247 ? 47.540  13.533  6.541   1.00 33.50  ? 247  ARG A CA  1 
ATOM   1885 C C   . ARG A 1 247 ? 48.362  13.824  7.793   1.00 32.88  ? 247  ARG A C   1 
ATOM   1886 O O   . ARG A 1 247 ? 48.642  14.973  8.079   1.00 37.97  ? 247  ARG A O   1 
ATOM   1887 C CB  . ARG A 1 247 ? 46.068  13.359  6.951   1.00 29.28  ? 247  ARG A CB  1 
ATOM   1888 C CG  . ARG A 1 247 ? 45.141  13.411  5.758   1.00 33.32  ? 247  ARG A CG  1 
ATOM   1889 C CD  . ARG A 1 247 ? 43.721  13.139  6.176   1.00 30.92  ? 247  ARG A CD  1 
ATOM   1890 N NE  . ARG A 1 247 ? 42.875  12.930  5.016   1.00 28.60  ? 247  ARG A NE  1 
ATOM   1891 C CZ  . ARG A 1 247 ? 41.543  12.944  5.067   1.00 38.42  ? 247  ARG A CZ  1 
ATOM   1892 N NH1 . ARG A 1 247 ? 40.915  13.170  6.223   1.00 34.95  ? 247  ARG A NH1 1 
ATOM   1893 N NH2 . ARG A 1 247 ? 40.840  12.736  3.966   1.00 34.67  ? 247  ARG A NH2 1 
ATOM   1894 N N   . ALA A 1 248 ? 48.738  12.793  8.541   1.00 31.84  ? 248  ALA A N   1 
ATOM   1895 C CA  . ALA A 1 248 ? 49.530  13.004  9.746   1.00 36.31  ? 248  ALA A CA  1 
ATOM   1896 C C   . ALA A 1 248 ? 50.891  13.559  9.377   1.00 37.32  ? 248  ALA A C   1 
ATOM   1897 O O   . ALA A 1 248 ? 51.424  14.426  10.067  1.00 36.51  ? 248  ALA A O   1 
ATOM   1898 C CB  . ALA A 1 248 ? 49.689  11.711  10.539  1.00 34.23  ? 248  ALA A CB  1 
ATOM   1899 N N   . THR A 1 249 ? 51.460  13.077  8.280   1.00 35.06  ? 249  THR A N   1 
ATOM   1900 C CA  . THR A 1 249 ? 52.815  13.527  7.950   1.00 32.53  ? 249  THR A CA  1 
ATOM   1901 C C   . THR A 1 249 ? 52.840  14.899  7.294   1.00 32.83  ? 249  THR A C   1 
ATOM   1902 O O   . THR A 1 249 ? 53.745  15.681  7.563   1.00 37.98  ? 249  THR A O   1 
ATOM   1903 C CB  . THR A 1 249 ? 53.756  12.411  7.302   1.00 52.43  ? 249  THR A CB  1 
ATOM   1904 O OG1 . THR A 1 249 ? 54.543  12.943  6.226   1.00 50.00  ? 249  THR A OG1 1 
ATOM   1905 C CG2 . THR A 1 249 ? 52.985  11.197  6.849   1.00 35.36  ? 249  THR A CG2 1 
ATOM   1906 N N   . LEU A 1 250 ? 51.801  15.229  6.518   1.00 37.14  ? 250  LEU A N   1 
ATOM   1907 C CA  . LEU A 1 250 ? 51.645  16.595  6.039   1.00 35.10  ? 250  LEU A CA  1 
ATOM   1908 C C   . LEU A 1 250 ? 51.500  17.519  7.255   1.00 36.77  ? 250  LEU A C   1 
ATOM   1909 O O   . LEU A 1 250 ? 52.172  18.542  7.340   1.00 40.26  ? 250  LEU A O   1 
ATOM   1910 C CB  . LEU A 1 250 ? 50.423  16.740  5.105   1.00 37.05  ? 250  LEU A CB  1 
ATOM   1911 C CG  . LEU A 1 250 ? 50.135  18.135  4.540   1.00 35.45  ? 250  LEU A CG  1 
ATOM   1912 C CD1 . LEU A 1 250 ? 51.418  18.755  3.955   1.00 37.32  ? 250  LEU A CD1 1 
ATOM   1913 C CD2 . LEU A 1 250 ? 49.032  18.085  3.464   1.00 35.83  ? 250  LEU A CD2 1 
ATOM   1914 N N   . LEU A 1 251 ? 50.629  17.163  8.200   1.00 36.95  ? 251  LEU A N   1 
ATOM   1915 C CA  . LEU A 1 251 ? 50.428  18.019  9.369   1.00 37.75  ? 251  LEU A CA  1 
ATOM   1916 C C   . LEU A 1 251 ? 51.743  18.220  10.122  1.00 38.44  ? 251  LEU A C   1 
ATOM   1917 O O   . LEU A 1 251 ? 52.090  19.346  10.482  1.00 34.27  ? 251  LEU A O   1 
ATOM   1918 C CB  . LEU A 1 251 ? 49.389  17.462  10.323  1.00 43.32  ? 251  LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 251 ? 49.352  18.381  11.547  1.00 47.97  ? 251  LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 251 ? 48.237  19.372  11.395  1.00 41.04  ? 251  LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 251 ? 49.204  17.614  12.829  1.00 52.63  ? 251  LEU A CD2 1 
ATOM   1922 N N   . ALA A 1 252 ? 52.474  17.132  10.364  1.00 34.06  ? 252  ALA A N   1 
ATOM   1923 C CA  . ALA A 1 252 ? 53.783  17.263  10.996  1.00 38.45  ? 252  ALA A CA  1 
ATOM   1924 C C   . ALA A 1 252 ? 54.634  18.300  10.251  1.00 41.50  ? 252  ALA A C   1 
ATOM   1925 O O   . ALA A 1 252 ? 55.189  19.187  10.898  1.00 42.72  ? 252  ALA A O   1 
ATOM   1926 C CB  . ALA A 1 252 ? 54.493  15.931  11.093  1.00 36.90  ? 252  ALA A CB  1 
ATOM   1927 N N   . ARG A 1 253 ? 54.708  18.220  8.912   1.00 39.21  ? 253  ARG A N   1 
ATOM   1928 C CA  A ARG A 1 253 ? 55.470  19.192  8.107   0.50 44.40  ? 253  ARG A CA  1 
ATOM   1929 C CA  B ARG A 1 253 ? 55.507  19.191  8.156   0.50 43.94  ? 253  ARG A CA  1 
ATOM   1930 C C   . ARG A 1 253 ? 55.008  20.621  8.383   1.00 43.43  ? 253  ARG A C   1 
ATOM   1931 O O   . ARG A 1 253 ? 55.804  21.517  8.608   1.00 42.29  ? 253  ARG A O   1 
ATOM   1932 C CB  A ARG A 1 253 ? 55.310  18.924  6.601   0.50 46.25  ? 253  ARG A CB  1 
ATOM   1933 C CB  B ARG A 1 253 ? 55.525  18.879  6.656   0.50 45.23  ? 253  ARG A CB  1 
ATOM   1934 C CG  A ARG A 1 253 ? 56.368  18.047  5.960   0.50 46.41  ? 253  ARG A CG  1 
ATOM   1935 C CG  B ARG A 1 253 ? 56.267  17.614  6.255   0.50 45.39  ? 253  ARG A CG  1 
ATOM   1936 C CD  A ARG A 1 253 ? 56.607  18.428  4.474   0.50 56.67  ? 253  ARG A CD  1 
ATOM   1937 C CD  B ARG A 1 253 ? 56.329  17.512  4.726   0.50 53.35  ? 253  ARG A CD  1 
ATOM   1938 N NE  A ARG A 1 253 ? 55.633  17.870  3.527   0.50 53.61  ? 253  ARG A NE  1 
ATOM   1939 N NE  B ARG A 1 253 ? 56.715  16.188  4.240   0.50 57.37  ? 253  ARG A NE  1 
ATOM   1940 C CZ  A ARG A 1 253 ? 54.867  18.590  2.702   0.50 51.99  ? 253  ARG A CZ  1 
ATOM   1941 C CZ  B ARG A 1 253 ? 55.864  15.303  3.724   0.50 57.35  ? 253  ARG A CZ  1 
ATOM   1942 N NH1 A ARG A 1 253 ? 54.026  17.974  1.878   0.50 46.43  ? 253  ARG A NH1 1 
ATOM   1943 N NH1 B ARG A 1 253 ? 56.320  14.124  3.307   0.50 58.14  ? 253  ARG A NH1 1 
ATOM   1944 N NH2 A ARG A 1 253 ? 54.939  19.924  2.684   0.50 43.41  ? 253  ARG A NH2 1 
ATOM   1945 N NH2 B ARG A 1 253 ? 54.561  15.592  3.622   0.50 44.54  ? 253  ARG A NH2 1 
ATOM   1946 N N   . LEU A 1 254 ? 53.691  20.832  8.351   1.00 35.15  ? 254  LEU A N   1 
ATOM   1947 C CA  . LEU A 1 254 ? 53.141  22.176  8.535   1.00 37.97  ? 254  LEU A CA  1 
ATOM   1948 C C   . LEU A 1 254 ? 53.520  22.840  9.868   1.00 41.51  ? 254  LEU A C   1 
ATOM   1949 O O   . LEU A 1 254 ? 53.563  24.062  9.964   1.00 41.12  ? 254  LEU A O   1 
ATOM   1950 C CB  . LEU A 1 254 ? 51.615  22.185  8.321   1.00 31.96  ? 254  LEU A CB  1 
ATOM   1951 C CG  . LEU A 1 254 ? 51.242  21.824  6.873   1.00 34.71  ? 254  LEU A CG  1 
ATOM   1952 C CD1 . LEU A 1 254 ? 49.731  21.673  6.661   1.00 30.53  ? 254  LEU A CD1 1 
ATOM   1953 C CD2 . LEU A 1 254 ? 51.822  22.836  5.882   1.00 36.88  ? 254  LEU A CD2 1 
ATOM   1954 N N   . VAL A 1 255 ? 53.794  22.039  10.891  1.00 44.51  ? 255  VAL A N   1 
ATOM   1955 C CA  . VAL A 1 255 ? 54.142  22.579  12.194  1.00 42.84  ? 255  VAL A CA  1 
ATOM   1956 C C   . VAL A 1 255 ? 55.621  22.361  12.515  1.00 51.78  ? 255  VAL A C   1 
ATOM   1957 O O   . VAL A 1 255 ? 56.046  22.492  13.658  1.00 59.92  ? 255  VAL A O   1 
ATOM   1958 C CB  . VAL A 1 255 ? 53.250  22.001  13.325  1.00 47.32  ? 255  VAL A CB  1 
ATOM   1959 C CG1 . VAL A 1 255 ? 51.773  22.327  13.056  1.00 37.15  ? 255  VAL A CG1 1 
ATOM   1960 C CG2 . VAL A 1 255 ? 53.464  20.472  13.500  1.00 36.61  ? 255  VAL A CG2 1 
ATOM   1961 N N   . GLY A 1 256 ? 56.409  22.028  11.505  1.00 51.20  ? 256  GLY A N   1 
ATOM   1962 C CA  . GLY A 1 256 ? 57.851  21.990  11.683  1.00 54.25  ? 256  GLY A CA  1 
ATOM   1963 C C   . GLY A 1 256 ? 58.414  20.711  12.266  1.00 61.55  ? 256  GLY A C   1 
ATOM   1964 O O   . GLY A 1 256 ? 59.364  20.739  13.043  1.00 65.87  ? 256  GLY A O   1 
ATOM   1965 N N   . CYS A 1 257 ? 57.836  19.582  11.882  1.00 60.19  ? 257  CYS A N   1 
ATOM   1966 C CA  . CYS A 1 257 ? 58.290  18.291  12.362  1.00 50.28  ? 257  CYS A CA  1 
ATOM   1967 C C   . CYS A 1 257 ? 58.644  17.419  11.177  1.00 54.24  ? 257  CYS A C   1 
ATOM   1968 O O   . CYS A 1 257 ? 57.763  17.000  10.430  1.00 58.99  ? 257  CYS A O   1 
ATOM   1969 C CB  . CYS A 1 257 ? 57.195  17.634  13.207  1.00 45.62  ? 257  CYS A CB  1 
ATOM   1970 S SG  . CYS A 1 257 ? 57.026  18.375  14.859  1.00 47.47  ? 257  CYS A SG  1 
ATOM   1971 N N   . ASN A 1 265 ? 61.105  7.740   9.979   1.00 75.66  ? 265  ASN A N   1 
ATOM   1972 C CA  . ASN A 1 265 ? 60.991  7.184   11.330  1.00 74.31  ? 265  ASN A CA  1 
ATOM   1973 C C   . ASN A 1 265 ? 59.793  7.757   12.109  1.00 62.66  ? 265  ASN A C   1 
ATOM   1974 O O   . ASN A 1 265 ? 59.770  8.942   12.454  1.00 56.40  ? 265  ASN A O   1 
ATOM   1975 C CB  . ASN A 1 265 ? 62.297  7.418   12.096  1.00 76.68  ? 265  ASN A CB  1 
ATOM   1976 C CG  . ASN A 1 265 ? 62.269  6.842   13.503  1.00 79.11  ? 265  ASN A CG  1 
ATOM   1977 O OD1 . ASN A 1 265 ? 62.196  7.584   14.484  1.00 75.69  ? 265  ASN A OD1 1 
ATOM   1978 N ND2 . ASN A 1 265 ? 62.347  5.517   13.608  1.00 84.00  ? 265  ASN A ND2 1 
ATOM   1979 N N   . ASP A 1 266 ? 58.799  6.921   12.390  1.00 55.39  ? 266  ASP A N   1 
ATOM   1980 C CA  . ASP A 1 266 ? 57.575  7.410   13.031  1.00 50.10  ? 266  ASP A CA  1 
ATOM   1981 C C   . ASP A 1 266 ? 57.816  7.920   14.450  1.00 51.44  ? 266  ASP A C   1 
ATOM   1982 O O   . ASP A 1 266 ? 57.194  8.892   14.878  1.00 45.69  ? 266  ASP A O   1 
ATOM   1983 C CB  . ASP A 1 266 ? 56.501  6.318   13.078  1.00 50.37  ? 266  ASP A CB  1 
ATOM   1984 C CG  . ASP A 1 266 ? 55.893  6.033   11.724  1.00 47.94  ? 266  ASP A CG  1 
ATOM   1985 O OD1 . ASP A 1 266 ? 56.082  6.850   10.804  1.00 51.62  ? 266  ASP A OD1 1 
ATOM   1986 O OD2 . ASP A 1 266 ? 55.216  4.990   11.579  1.00 52.52  ? 266  ASP A OD2 1 
ATOM   1987 N N   . THR A 1 267 ? 58.710  7.253   15.177  1.00 47.12  ? 267  THR A N   1 
ATOM   1988 C CA  . THR A 1 267 ? 58.991  7.590   16.573  1.00 47.73  ? 267  THR A CA  1 
ATOM   1989 C C   . THR A 1 267 ? 59.453  9.044   16.717  1.00 45.10  ? 267  THR A C   1 
ATOM   1990 O O   . THR A 1 267 ? 59.015  9.757   17.613  1.00 51.16  ? 267  THR A O   1 
ATOM   1991 C CB  . THR A 1 267 ? 60.066  6.633   17.186  1.00 52.58  ? 267  THR A CB  1 
ATOM   1992 O OG1 . THR A 1 267 ? 59.568  5.290   17.208  1.00 53.37  ? 267  THR A OG1 1 
ATOM   1993 C CG2 . THR A 1 267 ? 60.430  7.052   18.608  1.00 47.82  ? 267  THR A CG2 1 
ATOM   1994 N N   . GLU A 1 268 ? 60.358  9.456   15.839  1.00 41.56  ? 268  GLU A N   1 
ATOM   1995 C CA  . GLU A 1 268 ? 60.904  10.818  15.824  1.00 52.24  ? 268  GLU A CA  1 
ATOM   1996 C C   . GLU A 1 268 ? 59.846  11.868  15.408  1.00 48.04  ? 268  GLU A C   1 
ATOM   1997 O O   . GLU A 1 268 ? 59.698  12.900  16.042  1.00 49.46  ? 268  GLU A O   1 
ATOM   1998 C CB  . GLU A 1 268 ? 62.121  10.861  14.887  1.00 58.71  ? 268  GLU A CB  1 
ATOM   1999 C CG  . GLU A 1 268 ? 62.876  12.187  14.840  1.00 79.96  ? 268  GLU A CG  1 
ATOM   2000 C CD  . GLU A 1 268 ? 64.098  12.159  13.893  1.00 96.30  ? 268  GLU A CD  1 
ATOM   2001 O OE1 . GLU A 1 268 ? 64.429  11.076  13.352  1.00 99.67  ? 268  GLU A OE1 1 
ATOM   2002 O OE2 . GLU A 1 268 ? 64.728  13.227  13.691  1.00 97.00  ? 268  GLU A OE2 1 
ATOM   2003 N N   . LEU A 1 269 ? 59.124  11.596  14.330  1.00 43.90  ? 269  LEU A N   1 
ATOM   2004 C CA  . LEU A 1 269 ? 58.035  12.463  13.902  1.00 51.46  ? 269  LEU A CA  1 
ATOM   2005 C C   . LEU A 1 269 ? 57.026  12.675  15.047  1.00 50.31  ? 269  LEU A C   1 
ATOM   2006 O O   . LEU A 1 269 ? 56.695  13.803  15.403  1.00 46.57  ? 269  LEU A O   1 
ATOM   2007 C CB  . LEU A 1 269 ? 57.363  11.869  12.665  1.00 41.64  ? 269  LEU A CB  1 
ATOM   2008 C CG  . LEU A 1 269 ? 56.246  12.633  11.982  1.00 47.69  ? 269  LEU A CG  1 
ATOM   2009 C CD1 . LEU A 1 269 ? 56.070  12.101  10.571  1.00 50.79  ? 269  LEU A CD1 1 
ATOM   2010 C CD2 . LEU A 1 269 ? 54.962  12.457  12.767  1.00 42.02  ? 269  LEU A CD2 1 
ATOM   2011 N N   . ILE A 1 270 ? 56.575  11.580  15.643  1.00 45.51  ? 270  ILE A N   1 
ATOM   2012 C CA  . ILE A 1 270 ? 55.587  11.642  16.703  1.00 42.96  ? 270  ILE A CA  1 
ATOM   2013 C C   . ILE A 1 270 ? 56.123  12.352  17.935  1.00 42.47  ? 270  ILE A C   1 
ATOM   2014 O O   . ILE A 1 270 ? 55.426  13.180  18.528  1.00 42.17  ? 270  ILE A O   1 
ATOM   2015 C CB  . ILE A 1 270 ? 55.037  10.250  17.055  1.00 41.84  ? 270  ILE A CB  1 
ATOM   2016 C CG1 . ILE A 1 270 ? 54.351  9.634   15.832  1.00 41.42  ? 270  ILE A CG1 1 
ATOM   2017 C CG2 . ILE A 1 270 ? 54.038  10.347  18.188  1.00 35.02  ? 270  ILE A CG2 1 
ATOM   2018 C CD1 . ILE A 1 270 ? 54.139  8.127   15.964  1.00 48.99  ? 270  ILE A CD1 1 
ATOM   2019 N N   . ALA A 1 271 ? 57.356  12.036  18.318  1.00 38.78  ? 271  ALA A N   1 
ATOM   2020 C CA  . ALA A 1 271 ? 57.976  12.713  19.447  1.00 40.56  ? 271  ALA A CA  1 
ATOM   2021 C C   . ALA A 1 271 ? 58.018  14.221  19.199  1.00 43.28  ? 271  ALA A C   1 
ATOM   2022 O O   . ALA A 1 271 ? 57.790  15.007  20.105  1.00 45.07  ? 271  ALA A O   1 
ATOM   2023 C CB  . ALA A 1 271 ? 59.406  12.150  19.732  1.00 37.98  ? 271  ALA A CB  1 
ATOM   2024 N N   . CYS A 1 272 ? 58.306  14.628  17.966  1.00 45.95  ? 272  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 272 ? 58.335  16.055  17.651  1.00 45.08  ? 272  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 272 ? 56.920  16.661  17.734  1.00 43.48  ? 272  CYS A C   1 
ATOM   2027 O O   . CYS A 1 272 ? 56.736  17.708  18.340  1.00 42.68  ? 272  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 272 ? 58.973  16.321  16.281  1.00 41.86  ? 272  CYS A CB  1 
ATOM   2029 S SG  . CYS A 1 272 ? 58.886  18.069  15.777  1.00 51.76  ? 272  CYS A SG  1 
ATOM   2030 N N   . LEU A 1 273 ? 55.924  15.985  17.168  1.00 37.76  ? 273  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 273 ? 54.525  16.432  17.330  1.00 42.30  ? 273  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 273 ? 54.131  16.598  18.809  1.00 42.82  ? 273  LEU A C   1 
ATOM   2033 O O   . LEU A 1 273 ? 53.344  17.473  19.147  1.00 42.17  ? 273  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 273 ? 53.534  15.488  16.635  1.00 36.14  ? 273  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 273 ? 53.415  15.477  15.101  1.00 39.17  ? 273  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 273 ? 52.424  14.399  14.654  1.00 38.03  ? 273  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 273 ? 52.991  16.815  14.552  1.00 36.01  ? 273  LEU A CD2 1 
ATOM   2038 N N   . ARG A 1 274 ? 54.688  15.768  19.689  1.00 37.19  ? 274  ARG A N   1 
ATOM   2039 C CA  . ARG A 1 274 ? 54.362  15.873  21.107  1.00 40.02  ? 274  ARG A CA  1 
ATOM   2040 C C   . ARG A 1 274 ? 54.931  17.131  21.761  1.00 46.08  ? 274  ARG A C   1 
ATOM   2041 O O   . ARG A 1 274 ? 54.441  17.554  22.807  1.00 42.29  ? 274  ARG A O   1 
ATOM   2042 C CB  . ARG A 1 274 ? 54.760  14.609  21.890  1.00 34.65  ? 274  ARG A CB  1 
ATOM   2043 C CG  . ARG A 1 274 ? 53.795  13.438  21.661  1.00 38.81  ? 274  ARG A CG  1 
ATOM   2044 C CD  . ARG A 1 274 ? 53.991  12.328  22.706  1.00 46.28  ? 274  ARG A CD  1 
ATOM   2045 N NE  . ARG A 1 274 ? 55.413  12.091  22.925  1.00 48.79  ? 274  ARG A NE  1 
ATOM   2046 C CZ  . ARG A 1 274 ? 56.106  11.083  22.395  1.00 48.27  ? 274  ARG A CZ  1 
ATOM   2047 N NH1 . ARG A 1 274 ? 55.490  10.185  21.631  1.00 39.02  ? 274  ARG A NH1 1 
ATOM   2048 N NH2 . ARG A 1 274 ? 57.418  10.969  22.637  1.00 44.20  ? 274  ARG A NH2 1 
ATOM   2049 N N   . THR A 1 275 ? 55.947  17.744  21.151  1.00 40.74  ? 275  THR A N   1 
ATOM   2050 C CA  . THR A 1 275 ? 56.482  18.976  21.718  1.00 42.62  ? 275  THR A CA  1 
ATOM   2051 C C   . THR A 1 275 ? 55.664  20.196  21.287  1.00 44.64  ? 275  THR A C   1 
ATOM   2052 O O   . THR A 1 275 ? 55.848  21.282  21.826  1.00 47.19  ? 275  THR A O   1 
ATOM   2053 C CB  . THR A 1 275 ? 57.953  19.208  21.345  1.00 45.56  ? 275  THR A CB  1 
ATOM   2054 O OG1 . THR A 1 275 ? 58.044  19.531  19.948  1.00 43.86  ? 275  THR A OG1 1 
ATOM   2055 C CG2 . THR A 1 275 ? 58.778  17.973  21.657  1.00 39.86  ? 275  THR A CG2 1 
ATOM   2056 N N   . ARG A 1 276 ? 54.752  20.022  20.334  1.00 37.28  ? 276  ARG A N   1 
ATOM   2057 C CA  . ARG A 1 276 ? 54.006  21.165  19.790  1.00 39.75  ? 276  ARG A CA  1 
ATOM   2058 C C   . ARG A 1 276 ? 52.848  21.620  20.700  1.00 39.62  ? 276  ARG A C   1 
ATOM   2059 O O   . ARG A 1 276 ? 52.170  20.802  21.316  1.00 38.92  ? 276  ARG A O   1 
ATOM   2060 C CB  . ARG A 1 276 ? 53.498  20.870  18.369  1.00 38.44  ? 276  ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 276 ? 54.612  20.749  17.342  1.00 46.03  ? 276  ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 276 ? 55.485  22.002  17.334  1.00 52.89  ? 276  ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 276 ? 56.590  21.888  16.387  1.00 65.19  ? 276  ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 276 ? 57.876  21.769  16.727  1.00 71.01  ? 276  ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 276 ? 58.240  21.762  18.007  1.00 66.87  ? 276  ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 276 ? 58.807  21.669  15.781  1.00 70.13  ? 276  ARG A NH2 1 
ATOM   2067 N N   . PRO A 1 277 ? 52.657  22.938  20.814  1.00 43.45  ? 277  PRO A N   1 
ATOM   2068 C CA  . PRO A 1 277 ? 51.513  23.492  21.542  1.00 37.65  ? 277  PRO A CA  1 
ATOM   2069 C C   . PRO A 1 277 ? 50.213  22.933  20.950  1.00 38.59  ? 277  PRO A C   1 
ATOM   2070 O O   . PRO A 1 277 ? 50.084  22.860  19.728  1.00 39.90  ? 277  PRO A O   1 
ATOM   2071 C CB  . PRO A 1 277 ? 51.619  24.993  21.253  1.00 38.88  ? 277  PRO A CB  1 
ATOM   2072 C CG  . PRO A 1 277 ? 53.088  25.227  20.988  1.00 41.94  ? 277  PRO A CG  1 
ATOM   2073 C CD  . PRO A 1 277 ? 53.578  23.984  20.318  1.00 45.36  ? 277  PRO A CD  1 
ATOM   2074 N N   . ALA A 1 278 ? 49.271  22.531  21.794  1.00 38.44  ? 278  ALA A N   1 
ATOM   2075 C CA  . ALA A 1 278 ? 47.979  22.037  21.306  1.00 38.04  ? 278  ALA A CA  1 
ATOM   2076 C C   . ALA A 1 278 ? 47.396  22.943  20.216  1.00 34.93  ? 278  ALA A C   1 
ATOM   2077 O O   . ALA A 1 278 ? 46.858  22.477  19.207  1.00 37.14  ? 278  ALA A O   1 
ATOM   2078 C CB  . ALA A 1 278 ? 46.997  21.895  22.466  1.00 30.64  ? 278  ALA A CB  1 
ATOM   2079 N N   . GLN A 1 279 ? 47.512  24.246  20.417  1.00 39.17  ? 279  GLN A N   1 
ATOM   2080 C CA  . GLN A 1 279 ? 46.854  25.196  19.519  1.00 39.42  ? 279  GLN A CA  1 
ATOM   2081 C C   . GLN A 1 279 ? 47.509  25.230  18.138  1.00 41.86  ? 279  GLN A C   1 
ATOM   2082 O O   . GLN A 1 279 ? 46.850  25.555  17.147  1.00 37.64  ? 279  GLN A O   1 
ATOM   2083 C CB  . GLN A 1 279 ? 46.806  26.598  20.130  1.00 31.71  ? 279  GLN A CB  1 
ATOM   2084 C CG  . GLN A 1 279 ? 46.019  27.594  19.307  1.00 34.88  ? 279  GLN A CG  1 
ATOM   2085 C CD  . GLN A 1 279 ? 44.528  27.281  19.339  1.00 44.24  ? 279  GLN A CD  1 
ATOM   2086 O OE1 . GLN A 1 279 ? 43.962  27.039  20.404  1.00 48.87  ? 279  GLN A OE1 1 
ATOM   2087 N NE2 . GLN A 1 279 ? 43.893  27.283  18.175  1.00 43.71  ? 279  GLN A NE2 1 
ATOM   2088 N N   . ASP A 1 280 ? 48.797  24.888  18.064  1.00 38.44  ? 280  ASP A N   1 
ATOM   2089 C CA  . ASP A 1 280 ? 49.466  24.799  16.762  1.00 35.26  ? 280  ASP A CA  1 
ATOM   2090 C C   . ASP A 1 280 ? 48.882  23.644  15.932  1.00 31.14  ? 280  ASP A C   1 
ATOM   2091 O O   . ASP A 1 280 ? 48.635  23.778  14.733  1.00 39.08  ? 280  ASP A O   1 
ATOM   2092 C CB  . ASP A 1 280 ? 50.980  24.618  16.931  1.00 48.63  ? 280  ASP A CB  1 
ATOM   2093 C CG  . ASP A 1 280 ? 51.687  25.897  17.391  1.00 66.96  ? 280  ASP A CG  1 
ATOM   2094 O OD1 . ASP A 1 280 ? 50.997  26.876  17.762  1.00 73.39  ? 280  ASP A OD1 1 
ATOM   2095 O OD2 . ASP A 1 280 ? 52.942  25.920  17.383  1.00 73.03  ? 280  ASP A OD2 1 
ATOM   2096 N N   . LEU A 1 281 ? 48.655  22.503  16.574  1.00 32.76  ? 281  LEU A N   1 
ATOM   2097 C CA  . LEU A 1 281 ? 47.999  21.401  15.884  1.00 29.07  ? 281  LEU A CA  1 
ATOM   2098 C C   . LEU A 1 281 ? 46.636  21.852  15.364  1.00 33.05  ? 281  LEU A C   1 
ATOM   2099 O O   . LEU A 1 281 ? 46.317  21.647  14.189  1.00 36.79  ? 281  LEU A O   1 
ATOM   2100 C CB  . LEU A 1 281 ? 47.874  20.182  16.798  1.00 27.81  ? 281  LEU A CB  1 
ATOM   2101 C CG  . LEU A 1 281 ? 49.230  19.707  17.376  1.00 37.11  ? 281  LEU A CG  1 
ATOM   2102 C CD1 . LEU A 1 281 ? 49.096  18.380  18.107  1.00 33.98  ? 281  LEU A CD1 1 
ATOM   2103 C CD2 . LEU A 1 281 ? 50.276  19.581  16.272  1.00 32.26  ? 281  LEU A CD2 1 
ATOM   2104 N N   . VAL A 1 282 ? 45.845  22.487  16.229  1.00 40.50  ? 282  VAL A N   1 
ATOM   2105 C CA  . VAL A 1 282 ? 44.487  22.897  15.861  1.00 38.06  ? 282  VAL A CA  1 
ATOM   2106 C C   . VAL A 1 282 ? 44.530  23.893  14.690  1.00 39.29  ? 282  VAL A C   1 
ATOM   2107 O O   . VAL A 1 282 ? 43.744  23.803  13.755  1.00 36.00  ? 282  VAL A O   1 
ATOM   2108 C CB  . VAL A 1 282 ? 43.709  23.504  17.064  1.00 33.40  ? 282  VAL A CB  1 
ATOM   2109 C CG1 . VAL A 1 282 ? 42.394  24.161  16.580  1.00 28.79  ? 282  VAL A CG1 1 
ATOM   2110 C CG2 . VAL A 1 282 ? 43.424  22.425  18.106  1.00 35.07  ? 282  VAL A CG2 1 
ATOM   2111 N N   . ASP A 1 283 ? 45.474  24.826  14.740  1.00 35.29  ? 283  ASP A N   1 
ATOM   2112 C CA  . ASP A 1 283 ? 45.585  25.850  13.700  1.00 40.41  ? 283  ASP A CA  1 
ATOM   2113 C C   . ASP A 1 283 ? 45.851  25.281  12.289  1.00 40.80  ? 283  ASP A C   1 
ATOM   2114 O O   . ASP A 1 283 ? 45.608  25.968  11.313  1.00 38.27  ? 283  ASP A O   1 
ATOM   2115 C CB  . ASP A 1 283 ? 46.681  26.891  14.064  1.00 36.65  ? 283  ASP A CB  1 
ATOM   2116 C CG  . ASP A 1 283 ? 46.253  27.848  15.208  1.00 50.06  ? 283  ASP A CG  1 
ATOM   2117 O OD1 . ASP A 1 283 ? 45.059  27.870  15.598  1.00 45.81  ? 283  ASP A OD1 1 
ATOM   2118 O OD2 . ASP A 1 283 ? 47.123  28.586  15.718  1.00 57.26  ? 283  ASP A OD2 1 
ATOM   2119 N N   . HIS A 1 284 ? 46.357  24.052  12.178  1.00 40.17  ? 284  HIS A N   1 
ATOM   2120 C CA  . HIS A 1 284 ? 46.714  23.500  10.860  1.00 36.26  ? 284  HIS A CA  1 
ATOM   2121 C C   . HIS A 1 284 ? 45.903  22.297  10.426  1.00 38.45  ? 284  HIS A C   1 
ATOM   2122 O O   . HIS A 1 284 ? 46.069  21.808  9.306   1.00 41.05  ? 284  HIS A O   1 
ATOM   2123 C CB  . HIS A 1 284 ? 48.201  23.131  10.803  1.00 38.82  ? 284  HIS A CB  1 
ATOM   2124 C CG  . HIS A 1 284 ? 49.100  24.322  10.760  1.00 40.69  ? 284  HIS A CG  1 
ATOM   2125 N ND1 . HIS A 1 284 ? 49.736  24.813  11.881  1.00 46.82  ? 284  HIS A ND1 1 
ATOM   2126 C CD2 . HIS A 1 284 ? 49.431  25.150  9.743   1.00 40.68  ? 284  HIS A CD2 1 
ATOM   2127 C CE1 . HIS A 1 284 ? 50.442  25.879  11.550  1.00 44.80  ? 284  HIS A CE1 1 
ATOM   2128 N NE2 . HIS A 1 284 ? 50.269  26.110  10.261  1.00 44.44  ? 284  HIS A NE2 1 
ATOM   2129 N N   . GLU A 1 285 ? 45.012  21.826  11.285  1.00 34.34  ? 285  GLU A N   1 
ATOM   2130 C CA  . GLU A 1 285 ? 44.405  20.529  11.026  1.00 43.83  ? 285  GLU A CA  1 
ATOM   2131 C C   . GLU A 1 285 ? 43.581  20.537  9.736   1.00 41.45  ? 285  GLU A C   1 
ATOM   2132 O O   . GLU A 1 285 ? 43.629  19.574  8.982   1.00 39.14  ? 285  GLU A O   1 
ATOM   2133 C CB  . GLU A 1 285 ? 43.596  20.015  12.228  1.00 41.10  ? 285  GLU A CB  1 
ATOM   2134 C CG  . GLU A 1 285 ? 42.243  20.703  12.415  1.00 52.77  ? 285  GLU A CG  1 
ATOM   2135 C CD  . GLU A 1 285 ? 41.487  20.205  13.644  1.00 50.20  ? 285  GLU A CD  1 
ATOM   2136 O OE1 . GLU A 1 285 ? 40.639  20.937  14.168  1.00 58.35  ? 285  GLU A OE1 1 
ATOM   2137 O OE2 . GLU A 1 285 ? 41.747  19.090  14.094  1.00 51.00  ? 285  GLU A OE2 1 
ATOM   2138 N N   . TRP A 1 286 ? 42.877  21.636  9.463   1.00 35.07  ? 286  TRP A N   1 
ATOM   2139 C CA  . TRP A 1 286 ? 42.059  21.748  8.263   1.00 34.46  ? 286  TRP A CA  1 
ATOM   2140 C C   . TRP A 1 286 ? 42.873  21.820  6.974   1.00 41.71  ? 286  TRP A C   1 
ATOM   2141 O O   . TRP A 1 286 ? 42.329  21.597  5.904   1.00 46.04  ? 286  TRP A O   1 
ATOM   2142 C CB  . TRP A 1 286 ? 41.091  22.942  8.349   1.00 31.10  ? 286  TRP A CB  1 
ATOM   2143 N N   . HIS A 1 287 ? 44.174  22.101  7.071   1.00 36.98  ? 287  HIS A N   1 
ATOM   2144 C CA  . HIS A 1 287 ? 45.008  22.266  5.873   1.00 38.40  ? 287  HIS A CA  1 
ATOM   2145 C C   . HIS A 1 287 ? 45.413  20.958  5.172   1.00 42.35  ? 287  HIS A C   1 
ATOM   2146 O O   . HIS A 1 287 ? 46.057  21.002  4.134   1.00 41.18  ? 287  HIS A O   1 
ATOM   2147 C CB  . HIS A 1 287 ? 46.289  23.057  6.191   1.00 40.10  ? 287  HIS A CB  1 
ATOM   2148 C CG  . HIS A 1 287 ? 46.037  24.437  6.705   1.00 50.60  ? 287  HIS A CG  1 
ATOM   2149 N ND1 . HIS A 1 287 ? 46.859  25.048  7.626   1.00 58.79  ? 287  HIS A ND1 1 
ATOM   2150 C CD2 . HIS A 1 287 ? 45.045  25.319  6.441   1.00 54.97  ? 287  HIS A CD2 1 
ATOM   2151 C CE1 . HIS A 1 287 ? 46.393  26.254  7.897   1.00 63.50  ? 287  HIS A CE1 1 
ATOM   2152 N NE2 . HIS A 1 287 ? 45.289  26.441  7.194   1.00 63.06  ? 287  HIS A NE2 1 
ATOM   2153 N N   . VAL A 1 288 ? 45.042  19.806  5.729   1.00 36.78  ? 288  VAL A N   1 
ATOM   2154 C CA  . VAL A 1 288 ? 45.523  18.533  5.185   1.00 36.52  ? 288  VAL A CA  1 
ATOM   2155 C C   . VAL A 1 288 ? 44.544  17.744  4.331   1.00 37.87  ? 288  VAL A C   1 
ATOM   2156 O O   . VAL A 1 288 ? 44.908  16.678  3.822   1.00 39.08  ? 288  VAL A O   1 
ATOM   2157 C CB  . VAL A 1 288 ? 46.096  17.597  6.287   1.00 35.49  ? 288  VAL A CB  1 
ATOM   2158 C CG1 . VAL A 1 288 ? 47.167  18.327  7.086   1.00 34.68  ? 288  VAL A CG1 1 
ATOM   2159 C CG2 . VAL A 1 288 ? 44.999  17.072  7.209   1.00 31.97  ? 288  VAL A CG2 1 
ATOM   2160 N N   . LEU A 1 289 ? 43.314  18.250  4.181   1.00 31.98  ? 289  LEU A N   1 
ATOM   2161 C CA  . LEU A 1 289 ? 42.330  17.637  3.289   1.00 35.38  ? 289  LEU A CA  1 
ATOM   2162 C C   . LEU A 1 289 ? 42.833  17.666  1.849   1.00 35.32  ? 289  LEU A C   1 
ATOM   2163 O O   . LEU A 1 289 ? 43.467  18.630  1.415   1.00 41.49  ? 289  LEU A O   1 
ATOM   2164 C CB  . LEU A 1 289 ? 40.943  18.323  3.398   1.00 26.89  ? 289  LEU A CB  1 
ATOM   2165 C CG  . LEU A 1 289 ? 40.188  18.073  4.711   1.00 35.52  ? 289  LEU A CG  1 
ATOM   2166 C CD1 . LEU A 1 289 ? 38.808  18.774  4.786   1.00 35.15  ? 289  LEU A CD1 1 
ATOM   2167 C CD2 . LEU A 1 289 ? 40.020  16.599  4.934   1.00 29.56  ? 289  LEU A CD2 1 
ATOM   2168 N N   . PRO A 1 290 ? 42.553  16.601  1.095   1.00 41.12  ? 290  PRO A N   1 
ATOM   2169 C CA  . PRO A 1 290 ? 43.118  16.486  -0.262  1.00 39.58  ? 290  PRO A CA  1 
ATOM   2170 C C   . PRO A 1 290 ? 42.382  17.349  -1.280  1.00 42.77  ? 290  PRO A C   1 
ATOM   2171 O O   . PRO A 1 290 ? 42.967  17.683  -2.300  1.00 39.32  ? 290  PRO A O   1 
ATOM   2172 C CB  . PRO A 1 290 ? 42.950  15.005  -0.597  1.00 40.54  ? 290  PRO A CB  1 
ATOM   2173 C CG  . PRO A 1 290 ? 41.835  14.520  0.314   1.00 38.41  ? 290  PRO A CG  1 
ATOM   2174 C CD  . PRO A 1 290 ? 41.824  15.398  1.531   1.00 34.93  ? 290  PRO A CD  1 
ATOM   2175 N N   . GLN A 1 291 ? 41.128  17.709  -1.012  1.00 36.13  ? 291  GLN A N   1 
ATOM   2176 C CA  . GLN A 1 291 ? 40.416  18.622  -1.905  1.00 40.41  ? 291  GLN A CA  1 
ATOM   2177 C C   . GLN A 1 291 ? 39.591  19.655  -1.125  1.00 38.73  ? 291  GLN A C   1 
ATOM   2178 O O   . GLN A 1 291 ? 39.241  19.441  0.029   1.00 42.18  ? 291  GLN A O   1 
ATOM   2179 C CB  . GLN A 1 291 ? 39.484  17.854  -2.861  1.00 44.10  ? 291  GLN A CB  1 
ATOM   2180 C CG  . GLN A 1 291 ? 40.121  16.708  -3.644  1.00 47.01  ? 291  GLN A CG  1 
ATOM   2181 C CD  . GLN A 1 291 ? 39.920  15.342  -2.970  1.00 56.98  ? 291  GLN A CD  1 
ATOM   2182 O OE1 . GLN A 1 291 ? 40.533  14.333  -3.366  1.00 60.83  ? 291  GLN A OE1 1 
ATOM   2183 N NE2 . GLN A 1 291 ? 39.049  15.303  -1.956  1.00 52.77  ? 291  GLN A NE2 1 
ATOM   2184 N N   . GLU A 1 292 ? 39.288  20.773  -1.769  1.00 38.93  ? 292  GLU A N   1 
ATOM   2185 C CA  . GLU A 1 292 ? 38.311  21.718  -1.260  1.00 41.74  ? 292  GLU A CA  1 
ATOM   2186 C C   . GLU A 1 292 ? 37.023  20.932  -1.055  1.00 34.82  ? 292  GLU A C   1 
ATOM   2187 O O   . GLU A 1 292 ? 36.556  20.286  -1.987  1.00 39.30  ? 292  GLU A O   1 
ATOM   2188 C CB  . GLU A 1 292 ? 38.075  22.819  -2.306  1.00 42.82  ? 292  GLU A CB  1 
ATOM   2189 C CG  . GLU A 1 292 ? 37.284  24.007  -1.786  1.00 58.47  ? 292  GLU A CG  1 
ATOM   2190 C CD  . GLU A 1 292 ? 36.989  25.057  -2.862  1.00 73.90  ? 292  GLU A CD  1 
ATOM   2191 O OE1 . GLU A 1 292 ? 37.565  24.976  -3.972  1.00 78.20  ? 292  GLU A OE1 1 
ATOM   2192 O OE2 . GLU A 1 292 ? 36.174  25.969  -2.590  1.00 78.10  ? 292  GLU A OE2 1 
ATOM   2193 N N   . SER A 1 293 ? 36.460  20.953  0.149   1.00 37.35  ? 293  SER A N   1 
ATOM   2194 C CA  . SER A 1 293 ? 35.220  20.194  0.399   1.00 38.23  ? 293  SER A CA  1 
ATOM   2195 C C   . SER A 1 293 ? 34.341  20.705  1.508   1.00 36.93  ? 293  SER A C   1 
ATOM   2196 O O   . SER A 1 293 ? 34.696  21.642  2.212   1.00 30.60  ? 293  SER A O   1 
ATOM   2197 C CB  . SER A 1 293 ? 35.507  18.710  0.656   1.00 45.22  ? 293  SER A CB  1 
ATOM   2198 O OG  . SER A 1 293 ? 36.747  18.523  1.277   1.00 41.35  ? 293  SER A OG  1 
ATOM   2199 N N   . ILE A 1 294 ? 33.160  20.091  1.627   1.00 34.58  ? 294  ILE A N   1 
ATOM   2200 C CA  . ILE A 1 294 ? 32.358  20.189  2.836   1.00 36.32  ? 294  ILE A CA  1 
ATOM   2201 C C   . ILE A 1 294 ? 31.972  18.771  3.266   1.00 34.94  ? 294  ILE A C   1 
ATOM   2202 O O   . ILE A 1 294 ? 32.038  17.828  2.479   1.00 31.02  ? 294  ILE A O   1 
ATOM   2203 C CB  . ILE A 1 294 ? 31.097  21.046  2.652   1.00 39.74  ? 294  ILE A CB  1 
ATOM   2204 C CG1 . ILE A 1 294 ? 30.252  20.484  1.518   1.00 34.09  ? 294  ILE A CG1 1 
ATOM   2205 C CG2 . ILE A 1 294 ? 31.463  22.528  2.411   1.00 35.91  ? 294  ILE A CG2 1 
ATOM   2206 C CD1 . ILE A 1 294 ? 28.885  21.137  1.431   1.00 42.98  ? 294  ILE A CD1 1 
ATOM   2207 N N   . PHE A 1 295 ? 31.590  18.633  4.522   1.00 31.57  ? 295  PHE A N   1 
ATOM   2208 C CA  . PHE A 1 295 ? 31.292  17.338  5.098   1.00 29.88  ? 295  PHE A CA  1 
ATOM   2209 C C   . PHE A 1 295 ? 32.492  16.381  4.962   1.00 32.07  ? 295  PHE A C   1 
ATOM   2210 O O   . PHE A 1 295 ? 32.319  15.189  4.724   1.00 28.70  ? 295  PHE A O   1 
ATOM   2211 C CB  . PHE A 1 295 ? 30.019  16.741  4.457   1.00 28.85  ? 295  PHE A CB  1 
ATOM   2212 C CG  . PHE A 1 295 ? 29.067  16.117  5.462   1.00 32.39  ? 295  PHE A CG  1 
ATOM   2213 C CD1 . PHE A 1 295 ? 29.527  15.176  6.391   1.00 29.57  ? 295  PHE A CD1 1 
ATOM   2214 C CD2 . PHE A 1 295 ? 27.713  16.486  5.491   1.00 30.77  ? 295  PHE A CD2 1 
ATOM   2215 C CE1 . PHE A 1 295 ? 28.654  14.576  7.307   1.00 30.59  ? 295  PHE A CE1 1 
ATOM   2216 C CE2 . PHE A 1 295 ? 26.838  15.914  6.405   1.00 27.43  ? 295  PHE A CE2 1 
ATOM   2217 C CZ  . PHE A 1 295 ? 27.294  14.947  7.306   1.00 31.18  ? 295  PHE A CZ  1 
ATOM   2218 N N   . ARG A 1 296 ? 33.703  16.924  5.087   1.00 29.36  ? 296  ARG A N   1 
ATOM   2219 C CA  . ARG A 1 296 ? 34.924  16.104  5.184   1.00 30.74  ? 296  ARG A CA  1 
ATOM   2220 C C   . ARG A 1 296 ? 35.775  16.611  6.339   1.00 32.96  ? 296  ARG A C   1 
ATOM   2221 O O   . ARG A 1 296 ? 35.887  17.817  6.551   1.00 31.87  ? 296  ARG A O   1 
ATOM   2222 C CB  . ARG A 1 296 ? 35.761  16.143  3.892   1.00 29.16  ? 296  ARG A CB  1 
ATOM   2223 C CG  . ARG A 1 296 ? 35.133  15.494  2.662   1.00 31.79  ? 296  ARG A CG  1 
ATOM   2224 C CD  . ARG A 1 296 ? 34.821  14.006  2.834   1.00 31.28  ? 296  ARG A CD  1 
ATOM   2225 N NE  . ARG A 1 296 ? 34.268  13.455  1.591   1.00 33.51  ? 296  ARG A NE  1 
ATOM   2226 C CZ  . ARG A 1 296 ? 32.965  13.320  1.349   1.00 39.60  ? 296  ARG A CZ  1 
ATOM   2227 N NH1 . ARG A 1 296 ? 32.074  13.683  2.272   1.00 33.77  ? 296  ARG A NH1 1 
ATOM   2228 N NH2 . ARG A 1 296 ? 32.551  12.819  0.193   1.00 33.45  ? 296  ARG A NH2 1 
ATOM   2229 N N   . PHE A 1 297 ? 36.396  15.701  7.077   1.00 25.52  ? 297  PHE A N   1 
ATOM   2230 C CA  . PHE A 1 297 ? 37.148  16.095  8.272   1.00 24.16  ? 297  PHE A CA  1 
ATOM   2231 C C   . PHE A 1 297 ? 38.527  15.425  8.289   1.00 32.24  ? 297  PHE A C   1 
ATOM   2232 O O   . PHE A 1 297 ? 38.667  14.259  7.904   1.00 32.72  ? 297  PHE A O   1 
ATOM   2233 C CB  . PHE A 1 297 ? 36.318  15.768  9.518   1.00 22.90  ? 297  PHE A CB  1 
ATOM   2234 C CG  . PHE A 1 297 ? 34.836  16.063  9.322   1.00 26.47  ? 297  PHE A CG  1 
ATOM   2235 C CD1 . PHE A 1 297 ? 34.374  17.376  9.334   1.00 25.28  ? 297  PHE A CD1 1 
ATOM   2236 C CD2 . PHE A 1 297 ? 33.939  15.043  9.042   1.00 28.59  ? 297  PHE A CD2 1 
ATOM   2237 C CE1 . PHE A 1 297 ? 33.011  17.673  9.080   1.00 31.33  ? 297  PHE A CE1 1 
ATOM   2238 C CE2 . PHE A 1 297 ? 32.576  15.330  8.805   1.00 27.45  ? 297  PHE A CE2 1 
ATOM   2239 C CZ  . PHE A 1 297 ? 32.124  16.650  8.821   1.00 26.27  ? 297  PHE A CZ  1 
ATOM   2240 N N   . SER A 1 298 ? 39.528  16.187  8.725   1.00 28.22  ? 298  SER A N   1 
ATOM   2241 C CA  . SER A 1 298 ? 40.946  15.824  8.599   1.00 29.08  ? 298  SER A CA  1 
ATOM   2242 C C   . SER A 1 298 ? 41.337  14.567  9.359   1.00 33.11  ? 298  SER A C   1 
ATOM   2243 O O   . SER A 1 298 ? 41.961  13.656  8.799   1.00 33.59  ? 298  SER A O   1 
ATOM   2244 C CB  . SER A 1 298 ? 41.813  16.992  9.059   1.00 34.05  ? 298  SER A CB  1 
ATOM   2245 O OG  . SER A 1 298 ? 41.594  18.074  8.169   1.00 36.36  ? 298  SER A OG  1 
ATOM   2246 N N   . PHE A 1 299 ? 40.919  14.501  10.617  1.00 30.23  ? 299  PHE A N   1 
ATOM   2247 C CA  . PHE A 1 299 ? 41.335  13.423  11.493  1.00 34.15  ? 299  PHE A CA  1 
ATOM   2248 C C   . PHE A 1 299 ? 40.147  12.673  12.090  1.00 32.41  ? 299  PHE A C   1 
ATOM   2249 O O   . PHE A 1 299 ? 39.470  13.161  13.015  1.00 31.69  ? 299  PHE A O   1 
ATOM   2250 C CB  . PHE A 1 299 ? 42.297  13.969  12.549  1.00 27.83  ? 299  PHE A CB  1 
ATOM   2251 C CG  . PHE A 1 299 ? 43.553  14.531  11.950  1.00 30.09  ? 299  PHE A CG  1 
ATOM   2252 C CD1 . PHE A 1 299 ? 44.614  13.691  11.632  1.00 26.29  ? 299  PHE A CD1 1 
ATOM   2253 C CD2 . PHE A 1 299 ? 43.652  15.885  11.650  1.00 27.54  ? 299  PHE A CD2 1 
ATOM   2254 C CE1 . PHE A 1 299 ? 45.780  14.185  11.053  1.00 33.02  ? 299  PHE A CE1 1 
ATOM   2255 C CE2 . PHE A 1 299 ? 44.816  16.401  11.048  1.00 33.48  ? 299  PHE A CE2 1 
ATOM   2256 C CZ  . PHE A 1 299 ? 45.898  15.543  10.765  1.00 30.42  ? 299  PHE A CZ  1 
ATOM   2257 N N   . VAL A 1 300 ? 39.925  11.476  11.544  1.00 29.31  ? 300  VAL A N   1 
ATOM   2258 C CA  . VAL A 1 300 ? 38.756  10.648  11.854  1.00 23.69  ? 300  VAL A CA  1 
ATOM   2259 C C   . VAL A 1 300 ? 39.232  9.199   12.058  1.00 28.60  ? 300  VAL A C   1 
ATOM   2260 O O   . VAL A 1 300 ? 40.412  8.888   11.855  1.00 29.62  ? 300  VAL A O   1 
ATOM   2261 C CB  . VAL A 1 300 ? 37.746  10.651  10.663  1.00 31.35  ? 300  VAL A CB  1 
ATOM   2262 C CG1 . VAL A 1 300 ? 37.261  12.047  10.366  1.00 26.21  ? 300  VAL A CG1 1 
ATOM   2263 C CG2 . VAL A 1 300 ? 38.404  10.036  9.393   1.00 30.61  ? 300  VAL A CG2 1 
ATOM   2264 N N   . PRO A 1 301 ? 38.316  8.306   12.454  1.00 31.55  ? 301  PRO A N   1 
ATOM   2265 C CA  . PRO A 1 301 ? 38.705  6.894   12.582  1.00 29.22  ? 301  PRO A CA  1 
ATOM   2266 C C   . PRO A 1 301 ? 39.375  6.330   11.333  1.00 33.35  ? 301  PRO A C   1 
ATOM   2267 O O   . PRO A 1 301 ? 39.010  6.643   10.180  1.00 30.66  ? 301  PRO A O   1 
ATOM   2268 C CB  . PRO A 1 301 ? 37.363  6.187   12.836  1.00 32.86  ? 301  PRO A CB  1 
ATOM   2269 C CG  . PRO A 1 301 ? 36.601  7.188   13.651  1.00 30.92  ? 301  PRO A CG  1 
ATOM   2270 C CD  . PRO A 1 301 ? 36.949  8.546   12.960  1.00 32.63  ? 301  PRO A CD  1 
ATOM   2271 N N   . VAL A 1 302 ? 40.369  5.487   11.581  1.00 31.68  ? 302  VAL A N   1 
ATOM   2272 C CA  . VAL A 1 302 ? 41.165  4.944   10.517  1.00 27.24  ? 302  VAL A CA  1 
ATOM   2273 C C   . VAL A 1 302 ? 40.906  3.426   10.465  1.00 34.17  ? 302  VAL A C   1 
ATOM   2274 O O   . VAL A 1 302 ? 40.735  2.779   11.509  1.00 34.37  ? 302  VAL A O   1 
ATOM   2275 C CB  . VAL A 1 302 ? 42.671  5.280   10.740  1.00 39.16  ? 302  VAL A CB  1 
ATOM   2276 C CG1 . VAL A 1 302 ? 43.161  4.792   12.104  1.00 31.68  ? 302  VAL A CG1 1 
ATOM   2277 C CG2 . VAL A 1 302 ? 43.529  4.713   9.631   1.00 33.13  ? 302  VAL A CG2 1 
ATOM   2278 N N   . VAL A 1 303 ? 40.835  2.877   9.253   1.00 31.75  ? 303  VAL A N   1 
ATOM   2279 C CA  . VAL A 1 303 ? 40.789  1.428   9.065   1.00 41.21  ? 303  VAL A CA  1 
ATOM   2280 C C   . VAL A 1 303 ? 42.182  0.857   9.373   1.00 40.88  ? 303  VAL A C   1 
ATOM   2281 O O   . VAL A 1 303 ? 43.050  0.789   8.506   1.00 42.80  ? 303  VAL A O   1 
ATOM   2282 C CB  . VAL A 1 303 ? 40.342  1.070   7.649   1.00 41.98  ? 303  VAL A CB  1 
ATOM   2283 C CG1 . VAL A 1 303 ? 40.206  -0.435  7.488   1.00 35.35  ? 303  VAL A CG1 1 
ATOM   2284 C CG2 . VAL A 1 303 ? 39.025  1.755   7.361   1.00 37.05  ? 303  VAL A CG2 1 
ATOM   2285 N N   . ASP A 1 304 ? 42.384  0.482   10.632  1.00 40.36  ? 304  ASP A N   1 
ATOM   2286 C CA  . ASP A 1 304 ? 43.702  0.131   11.148  1.00 38.81  ? 304  ASP A CA  1 
ATOM   2287 C C   . ASP A 1 304 ? 43.958  -1.378  11.163  1.00 44.24  ? 304  ASP A C   1 
ATOM   2288 O O   . ASP A 1 304 ? 45.057  -1.810  11.488  1.00 43.52  ? 304  ASP A O   1 
ATOM   2289 C CB  . ASP A 1 304 ? 43.866  0.672   12.580  1.00 35.26  ? 304  ASP A CB  1 
ATOM   2290 C CG  . ASP A 1 304 ? 42.763  0.164   13.545  1.00 46.88  ? 304  ASP A CG  1 
ATOM   2291 O OD1 . ASP A 1 304 ? 41.782  -0.451  13.073  1.00 39.24  ? 304  ASP A OD1 1 
ATOM   2292 O OD2 . ASP A 1 304 ? 42.867  0.386   14.776  1.00 45.21  ? 304  ASP A OD2 1 
ATOM   2293 N N   . GLY A 1 305 ? 42.943  -2.167  10.826  1.00 43.57  ? 305  GLY A N   1 
ATOM   2294 C CA  . GLY A 1 305 ? 43.031  -3.613  10.956  1.00 40.56  ? 305  GLY A CA  1 
ATOM   2295 C C   . GLY A 1 305 ? 43.077  -4.041  12.418  1.00 45.43  ? 305  GLY A C   1 
ATOM   2296 O O   . GLY A 1 305 ? 43.445  -5.170  12.717  1.00 45.11  ? 305  GLY A O   1 
ATOM   2297 N N   . ASP A 1 306 ? 42.722  -3.135  13.330  1.00 44.97  ? 306  ASP A N   1 
ATOM   2298 C CA  . ASP A 1 306 ? 42.747  -3.415  14.771  1.00 45.84  ? 306  ASP A CA  1 
ATOM   2299 C C   . ASP A 1 306 ? 41.372  -3.100  15.398  1.00 45.85  ? 306  ASP A C   1 
ATOM   2300 O O   . ASP A 1 306 ? 40.501  -3.973  15.477  1.00 47.01  ? 306  ASP A O   1 
ATOM   2301 C CB  . ASP A 1 306 ? 43.867  -2.618  15.458  1.00 48.55  ? 306  ASP A CB  1 
ATOM   2302 C CG  . ASP A 1 306 ? 44.015  -2.955  16.950  1.00 57.14  ? 306  ASP A CG  1 
ATOM   2303 O OD1 . ASP A 1 306 ? 43.440  -3.972  17.402  1.00 54.20  ? 306  ASP A OD1 1 
ATOM   2304 O OD2 . ASP A 1 306 ? 44.711  -2.199  17.669  1.00 59.77  ? 306  ASP A OD2 1 
ATOM   2305 N N   . PHE A 1 307 ? 41.169  -1.860  15.839  1.00 42.35  ? 307  PHE A N   1 
ATOM   2306 C CA  . PHE A 1 307 ? 39.821  -1.432  16.208  1.00 41.51  ? 307  PHE A CA  1 
ATOM   2307 C C   . PHE A 1 307 ? 38.832  -1.775  15.088  1.00 40.61  ? 307  PHE A C   1 
ATOM   2308 O O   . PHE A 1 307 ? 37.784  -2.354  15.329  1.00 39.52  ? 307  PHE A O   1 
ATOM   2309 C CB  . PHE A 1 307 ? 39.751  0.071   16.534  1.00 39.60  ? 307  PHE A CB  1 
ATOM   2310 C CG  . PHE A 1 307 ? 38.490  0.459   17.270  1.00 36.59  ? 307  PHE A CG  1 
ATOM   2311 C CD1 . PHE A 1 307 ? 37.275  0.507   16.604  1.00 31.78  ? 307  PHE A CD1 1 
ATOM   2312 C CD2 . PHE A 1 307 ? 38.515  0.722   18.639  1.00 36.66  ? 307  PHE A CD2 1 
ATOM   2313 C CE1 . PHE A 1 307 ? 36.109  0.824   17.282  1.00 35.67  ? 307  PHE A CE1 1 
ATOM   2314 C CE2 . PHE A 1 307 ? 37.344  1.058   19.326  1.00 44.05  ? 307  PHE A CE2 1 
ATOM   2315 C CZ  . PHE A 1 307 ? 36.140  1.106   18.647  1.00 38.65  ? 307  PHE A CZ  1 
ATOM   2316 N N   . LEU A 1 308 ? 39.162  -1.397  13.860  1.00 42.31  ? 308  LEU A N   1 
ATOM   2317 C CA  . LEU A 1 308 ? 38.351  -1.790  12.715  1.00 43.52  ? 308  LEU A CA  1 
ATOM   2318 C C   . LEU A 1 308 ? 39.157  -2.810  11.918  1.00 47.70  ? 308  LEU A C   1 
ATOM   2319 O O   . LEU A 1 308 ? 40.194  -2.470  11.343  1.00 43.22  ? 308  LEU A O   1 
ATOM   2320 C CB  . LEU A 1 308 ? 38.034  -0.575  11.847  1.00 43.58  ? 308  LEU A CB  1 
ATOM   2321 C CG  . LEU A 1 308 ? 37.149  0.494   12.485  1.00 43.61  ? 308  LEU A CG  1 
ATOM   2322 C CD1 . LEU A 1 308 ? 37.074  1.707   11.558  1.00 39.80  ? 308  LEU A CD1 1 
ATOM   2323 C CD2 . LEU A 1 308 ? 35.779  -0.088  12.768  1.00 37.27  ? 308  LEU A CD2 1 
ATOM   2324 N N   . SER A 1 309 ? 38.689  -4.055  11.890  1.00 47.65  ? 309  SER A N   1 
ATOM   2325 C CA  . SER A 1 309 ? 39.449  -5.132  11.261  1.00 49.93  ? 309  SER A CA  1 
ATOM   2326 C C   . SER A 1 309 ? 39.380  -5.033  9.748   1.00 48.47  ? 309  SER A C   1 
ATOM   2327 O O   . SER A 1 309 ? 40.156  -5.673  9.049   1.00 51.88  ? 309  SER A O   1 
ATOM   2328 C CB  . SER A 1 309 ? 38.932  -6.498  11.720  1.00 50.49  ? 309  SER A CB  1 
ATOM   2329 O OG  . SER A 1 309 ? 37.591  -6.684  11.298  1.00 54.69  ? 309  SER A OG  1 
ATOM   2330 N N   . ASP A 1 310 ? 38.443  -4.232  9.251   1.00 43.21  ? 310  ASP A N   1 
ATOM   2331 C CA  . ASP A 1 310 ? 38.257  -4.018  7.811   1.00 44.53  ? 310  ASP A CA  1 
ATOM   2332 C C   . ASP A 1 310 ? 37.406  -2.760  7.648   1.00 40.51  ? 310  ASP A C   1 
ATOM   2333 O O   . ASP A 1 310 ? 36.993  -2.178  8.652   1.00 39.32  ? 310  ASP A O   1 
ATOM   2334 C CB  . ASP A 1 310 ? 37.557  -5.222  7.171   1.00 49.55  ? 310  ASP A CB  1 
ATOM   2335 C CG  . ASP A 1 310 ? 37.823  -5.332  5.656   1.00 58.35  ? 310  ASP A CG  1 
ATOM   2336 O OD1 . ASP A 1 310 ? 38.264  -4.338  5.035   1.00 57.88  ? 310  ASP A OD1 1 
ATOM   2337 O OD2 . ASP A 1 310 ? 37.586  -6.421  5.085   1.00 60.98  ? 310  ASP A OD2 1 
ATOM   2338 N N   . THR A 1 311 ? 37.155  -2.321  6.415   1.00 41.15  ? 311  THR A N   1 
ATOM   2339 C CA  . THR A 1 311 ? 36.294  -1.154  6.206   1.00 37.99  ? 311  THR A CA  1 
ATOM   2340 C C   . THR A 1 311 ? 34.928  -1.463  6.785   1.00 42.46  ? 311  THR A C   1 
ATOM   2341 O O   . THR A 1 311 ? 34.512  -2.628  6.794   1.00 42.00  ? 311  THR A O   1 
ATOM   2342 C CB  . THR A 1 311 ? 36.065  -0.830  4.725   1.00 44.91  ? 311  THR A CB  1 
ATOM   2343 O OG1 . THR A 1 311 ? 35.203  -1.826  4.155   1.00 48.08  ? 311  THR A OG1 1 
ATOM   2344 C CG2 . THR A 1 311 ? 37.386  -0.758  3.958   1.00 41.16  ? 311  THR A CG2 1 
ATOM   2345 N N   . PRO A 1 312 ? 34.231  -0.426  7.281   1.00 40.21  ? 312  PRO A N   1 
ATOM   2346 C CA  . PRO A 1 312 ? 32.867  -0.578  7.800   1.00 40.92  ? 312  PRO A CA  1 
ATOM   2347 C C   . PRO A 1 312 ? 31.940  -1.174  6.755   1.00 41.38  ? 312  PRO A C   1 
ATOM   2348 O O   . PRO A 1 312 ? 31.047  -1.939  7.100   1.00 49.45  ? 312  PRO A O   1 
ATOM   2349 C CB  . PRO A 1 312 ? 32.450  0.860   8.125   1.00 36.38  ? 312  PRO A CB  1 
ATOM   2350 C CG  . PRO A 1 312 ? 33.734  1.557   8.385   1.00 41.82  ? 312  PRO A CG  1 
ATOM   2351 C CD  . PRO A 1 312 ? 34.732  0.949   7.443   1.00 37.10  ? 312  PRO A CD  1 
ATOM   2352 N N   . GLU A 1 313 ? 32.157  -0.826  5.491   1.00 45.05  ? 313  GLU A N   1 
ATOM   2353 C CA  . GLU A 1 313 ? 31.345  -1.349  4.395   1.00 53.80  ? 313  GLU A CA  1 
ATOM   2354 C C   . GLU A 1 313 ? 31.456  -2.876  4.319   1.00 53.75  ? 313  GLU A C   1 
ATOM   2355 O O   . GLU A 1 313 ? 30.456  -3.583  4.214   1.00 52.78  ? 313  GLU A O   1 
ATOM   2356 C CB  . GLU A 1 313 ? 31.763  -0.691  3.069   1.00 66.40  ? 313  GLU A CB  1 
ATOM   2357 C CG  . GLU A 1 313 ? 31.013  -1.174  1.838   1.00 86.13  ? 313  GLU A CG  1 
ATOM   2358 C CD  . GLU A 1 313 ? 31.784  -0.925  0.538   1.00 102.94 ? 313  GLU A CD  1 
ATOM   2359 O OE1 . GLU A 1 313 ? 31.139  -0.778  -0.525  1.00 106.60 ? 313  GLU A OE1 1 
ATOM   2360 O OE2 . GLU A 1 313 ? 33.035  -0.877  0.579   1.00 108.32 ? 313  GLU A OE2 1 
ATOM   2361 N N   . ALA A 1 314 ? 32.674  -3.392  4.394   1.00 46.06  ? 314  ALA A N   1 
ATOM   2362 C CA  . ALA A 1 314 ? 32.853  -4.832  4.385   1.00 46.27  ? 314  ALA A CA  1 
ATOM   2363 C C   . ALA A 1 314 ? 32.288  -5.453  5.655   1.00 50.93  ? 314  ALA A C   1 
ATOM   2364 O O   . ALA A 1 314 ? 31.652  -6.492  5.604   1.00 57.89  ? 314  ALA A O   1 
ATOM   2365 C CB  . ALA A 1 314 ? 34.328  -5.207  4.199   1.00 40.41  ? 314  ALA A CB  1 
ATOM   2366 N N   . LEU A 1 315 ? 32.504  -4.813  6.795   1.00 46.94  ? 315  LEU A N   1 
ATOM   2367 C CA  . LEU A 1 315 ? 32.049  -5.387  8.065   1.00 43.27  ? 315  LEU A CA  1 
ATOM   2368 C C   . LEU A 1 315 ? 30.526  -5.423  8.197   1.00 45.40  ? 315  LEU A C   1 
ATOM   2369 O O   . LEU A 1 315 ? 30.003  -6.344  8.798   1.00 52.00  ? 315  LEU A O   1 
ATOM   2370 C CB  . LEU A 1 315 ? 32.672  -4.671  9.277   1.00 43.72  ? 315  LEU A CB  1 
ATOM   2371 C CG  . LEU A 1 315 ? 34.197  -4.704  9.363   1.00 44.82  ? 315  LEU A CG  1 
ATOM   2372 C CD1 . LEU A 1 315 ? 34.712  -3.928  10.570  1.00 39.25  ? 315  LEU A CD1 1 
ATOM   2373 C CD2 . LEU A 1 315 ? 34.688  -6.159  9.388   1.00 42.73  ? 315  LEU A CD2 1 
ATOM   2374 N N   . ILE A 1 316 ? 29.807  -4.431  7.670   1.00 43.58  ? 316  ILE A N   1 
ATOM   2375 C CA  . ILE A 1 316 ? 28.344  -4.529  7.690   1.00 48.45  ? 316  ILE A CA  1 
ATOM   2376 C C   . ILE A 1 316 ? 27.849  -5.502  6.613   1.00 59.69  ? 316  ILE A C   1 
ATOM   2377 O O   . ILE A 1 316 ? 26.734  -6.000  6.703   1.00 55.92  ? 316  ILE A O   1 
ATOM   2378 C CB  . ILE A 1 316 ? 27.581  -3.166  7.521   1.00 45.11  ? 316  ILE A CB  1 
ATOM   2379 C CG1 . ILE A 1 316 ? 27.866  -2.523  6.158   1.00 54.91  ? 316  ILE A CG1 1 
ATOM   2380 C CG2 . ILE A 1 316 ? 27.893  -2.197  8.649   1.00 47.64  ? 316  ILE A CG2 1 
ATOM   2381 C CD1 . ILE A 1 316 ? 27.133  -1.176  5.931   1.00 47.00  ? 316  ILE A CD1 1 
ATOM   2382 N N   . ASN A 1 317 ? 28.666  -5.756  5.591   1.00 63.39  ? 317  ASN A N   1 
ATOM   2383 C CA  . ASN A 1 317 ? 28.270  -6.676  4.523   1.00 66.47  ? 317  ASN A CA  1 
ATOM   2384 C C   . ASN A 1 317 ? 28.279  -8.119  5.006   1.00 69.12  ? 317  ASN A C   1 
ATOM   2385 O O   . ASN A 1 317 ? 27.464  -8.923  4.569   1.00 77.05  ? 317  ASN A O   1 
ATOM   2386 C CB  . ASN A 1 317 ? 29.182  -6.546  3.293   1.00 65.97  ? 317  ASN A CB  1 
ATOM   2387 C CG  . ASN A 1 317 ? 28.859  -5.326  2.437   1.00 75.06  ? 317  ASN A CG  1 
ATOM   2388 O OD1 . ASN A 1 317 ? 27.807  -4.698  2.589   1.00 81.04  ? 317  ASN A OD1 1 
ATOM   2389 N ND2 . ASN A 1 317 ? 29.775  -4.980  1.532   1.00 75.65  ? 317  ASN A ND2 1 
ATOM   2390 N N   . THR A 1 318 ? 29.191  -8.445  5.918   1.00 64.96  ? 318  THR A N   1 
ATOM   2391 C CA  . THR A 1 318 ? 29.439  -9.841  6.272   1.00 67.14  ? 318  THR A CA  1 
ATOM   2392 C C   . THR A 1 318 ? 29.250  -10.147 7.747   1.00 68.00  ? 318  THR A C   1 
ATOM   2393 O O   . THR A 1 318 ? 29.491  -11.265 8.185   1.00 72.12  ? 318  THR A O   1 
ATOM   2394 C CB  . THR A 1 318 ? 30.871  -10.251 5.909   1.00 72.00  ? 318  THR A CB  1 
ATOM   2395 O OG1 . THR A 1 318 ? 31.795  -9.486  6.695   1.00 73.72  ? 318  THR A OG1 1 
ATOM   2396 C CG2 . THR A 1 318 ? 31.135  -10.009 4.426   1.00 75.41  ? 318  THR A CG2 1 
ATOM   2397 N N   . GLY A 1 319 ? 28.844  -9.158  8.524   1.00 65.10  ? 319  GLY A N   1 
ATOM   2398 C CA  . GLY A 1 319 ? 28.653  -9.380  9.940   1.00 66.64  ? 319  GLY A CA  1 
ATOM   2399 C C   . GLY A 1 319 ? 27.373  -10.142 10.235  1.00 67.93  ? 319  GLY A C   1 
ATOM   2400 O O   . GLY A 1 319 ? 26.441  -10.172 9.426   1.00 58.84  ? 319  GLY A O   1 
ATOM   2401 N N   . ASP A 1 320 ? 27.336  -10.771 11.403  1.00 72.30  ? 320  ASP A N   1 
ATOM   2402 C CA  . ASP A 1 320 ? 26.120  -11.380 11.904  1.00 75.77  ? 320  ASP A CA  1 
ATOM   2403 C C   . ASP A 1 320 ? 25.594  -10.460 13.000  1.00 72.65  ? 320  ASP A C   1 
ATOM   2404 O O   . ASP A 1 320 ? 26.288  -10.211 13.987  1.00 75.22  ? 320  ASP A O   1 
ATOM   2405 C CB  . ASP A 1 320 ? 26.424  -12.771 12.461  1.00 82.16  ? 320  ASP A CB  1 
ATOM   2406 C CG  . ASP A 1 320 ? 25.187  -13.484 12.977  1.00 88.84  ? 320  ASP A CG  1 
ATOM   2407 O OD1 . ASP A 1 320 ? 24.060  -13.048 12.657  1.00 91.12  ? 320  ASP A OD1 1 
ATOM   2408 O OD2 . ASP A 1 320 ? 25.348  -14.490 13.701  1.00 91.46  ? 320  ASP A OD2 1 
ATOM   2409 N N   . PHE A 1 321 ? 24.384  -9.934  12.826  1.00 65.02  ? 321  PHE A N   1 
ATOM   2410 C CA  . PHE A 1 321 ? 23.860  -8.968  13.790  1.00 63.11  ? 321  PHE A CA  1 
ATOM   2411 C C   . PHE A 1 321 ? 22.569  -9.438  14.445  1.00 63.97  ? 321  PHE A C   1 
ATOM   2412 O O   . PHE A 1 321 ? 21.726  -8.629  14.824  1.00 63.31  ? 321  PHE A O   1 
ATOM   2413 C CB  . PHE A 1 321 ? 23.686  -7.587  13.136  1.00 60.44  ? 321  PHE A CB  1 
ATOM   2414 C CG  . PHE A 1 321 ? 24.947  -7.061  12.499  1.00 51.16  ? 321  PHE A CG  1 
ATOM   2415 C CD1 . PHE A 1 321 ? 25.981  -6.573  13.281  1.00 43.97  ? 321  PHE A CD1 1 
ATOM   2416 C CD2 . PHE A 1 321 ? 25.108  -7.085  11.119  1.00 55.81  ? 321  PHE A CD2 1 
ATOM   2417 C CE1 . PHE A 1 321 ? 27.153  -6.106  12.702  1.00 47.66  ? 321  PHE A CE1 1 
ATOM   2418 C CE2 . PHE A 1 321 ? 26.272  -6.614  10.532  1.00 56.90  ? 321  PHE A CE2 1 
ATOM   2419 C CZ  . PHE A 1 321 ? 27.292  -6.117  11.326  1.00 52.17  ? 321  PHE A CZ  1 
ATOM   2420 N N   . GLN A 1 322 ? 22.440  -10.751 14.606  1.00 66.98  ? 322  GLN A N   1 
ATOM   2421 C CA  . GLN A 1 322 ? 21.228  -11.352 15.160  1.00 69.28  ? 322  GLN A CA  1 
ATOM   2422 C C   . GLN A 1 322 ? 20.848  -10.874 16.557  1.00 66.43  ? 322  GLN A C   1 
ATOM   2423 O O   . GLN A 1 322 ? 19.670  -10.679 16.845  1.00 69.69  ? 322  GLN A O   1 
ATOM   2424 C CB  . GLN A 1 322 ? 21.333  -12.876 15.139  1.00 78.01  ? 322  GLN A CB  1 
ATOM   2425 C CG  . GLN A 1 322 ? 21.115  -13.463 13.767  1.00 89.47  ? 322  GLN A CG  1 
ATOM   2426 C CD  . GLN A 1 322 ? 21.625  -14.880 13.652  1.00 97.39  ? 322  GLN A CD  1 
ATOM   2427 O OE1 . GLN A 1 322 ? 21.600  -15.468 12.571  1.00 104.80 ? 322  GLN A OE1 1 
ATOM   2428 N NE2 . GLN A 1 322 ? 22.097  -15.437 14.764  1.00 93.63  ? 322  GLN A NE2 1 
ATOM   2429 N N   . ASP A 1 323 ? 21.824  -10.680 17.432  1.00 65.24  ? 323  ASP A N   1 
ATOM   2430 C CA  . ASP A 1 323 ? 21.488  -10.281 18.794  1.00 73.69  ? 323  ASP A CA  1 
ATOM   2431 C C   . ASP A 1 323 ? 21.293  -8.766  18.974  1.00 66.07  ? 323  ASP A C   1 
ATOM   2432 O O   . ASP A 1 323 ? 21.187  -8.287  20.097  1.00 58.99  ? 323  ASP A O   1 
ATOM   2433 C CB  . ASP A 1 323 ? 22.540  -10.793 19.783  1.00 89.64  ? 323  ASP A CB  1 
ATOM   2434 C CG  . ASP A 1 323 ? 22.093  -10.658 21.241  1.00 104.70 ? 323  ASP A CG  1 
ATOM   2435 O OD1 . ASP A 1 323 ? 22.933  -10.274 22.090  1.00 109.35 ? 323  ASP A OD1 1 
ATOM   2436 O OD2 . ASP A 1 323 ? 20.903  -10.928 21.536  1.00 106.53 ? 323  ASP A OD2 1 
ATOM   2437 N N   . LEU A 1 324 ? 21.226  -8.020  17.876  1.00 65.71  ? 324  LEU A N   1 
ATOM   2438 C CA  . LEU A 1 324 ? 21.269  -6.554  17.953  1.00 55.31  ? 324  LEU A CA  1 
ATOM   2439 C C   . LEU A 1 324 ? 19.924  -5.899  17.650  1.00 49.71  ? 324  LEU A C   1 
ATOM   2440 O O   . LEU A 1 324 ? 19.245  -6.273  16.688  1.00 44.63  ? 324  LEU A O   1 
ATOM   2441 C CB  . LEU A 1 324 ? 22.311  -6.023  16.970  1.00 49.24  ? 324  LEU A CB  1 
ATOM   2442 C CG  . LEU A 1 324 ? 22.649  -4.532  17.027  1.00 54.24  ? 324  LEU A CG  1 
ATOM   2443 C CD1 . LEU A 1 324 ? 23.254  -4.195  18.362  1.00 50.88  ? 324  LEU A CD1 1 
ATOM   2444 C CD2 . LEU A 1 324 ? 23.608  -4.173  15.921  1.00 60.36  ? 324  LEU A CD2 1 
ATOM   2445 N N   . GLN A 1 325 ? 19.536  -4.929  18.473  1.00 47.73  ? 325  GLN A N   1 
ATOM   2446 C CA  . GLN A 1 325 ? 18.414  -4.068  18.114  1.00 48.74  ? 325  GLN A CA  1 
ATOM   2447 C C   . GLN A 1 325 ? 18.921  -2.653  17.885  1.00 46.59  ? 325  GLN A C   1 
ATOM   2448 O O   . GLN A 1 325 ? 19.700  -2.134  18.684  1.00 44.29  ? 325  GLN A O   1 
ATOM   2449 C CB  . GLN A 1 325 ? 17.317  -4.065  19.180  1.00 48.12  ? 325  GLN A CB  1 
ATOM   2450 C CG  . GLN A 1 325 ? 16.768  -5.429  19.517  1.00 52.51  ? 325  GLN A CG  1 
ATOM   2451 C CD  . GLN A 1 325 ? 17.383  -5.956  20.781  1.00 63.60  ? 325  GLN A CD  1 
ATOM   2452 O OE1 . GLN A 1 325 ? 17.348  -5.296  21.826  1.00 56.77  ? 325  GLN A OE1 1 
ATOM   2453 N NE2 . GLN A 1 325 ? 17.979  -7.141  20.697  1.00 72.63  ? 325  GLN A NE2 1 
ATOM   2454 N N   . VAL A 1 326 ? 18.473  -2.029  16.799  1.00 42.48  ? 326  VAL A N   1 
ATOM   2455 C CA  . VAL A 1 326 ? 19.011  -0.732  16.405  1.00 37.76  ? 326  VAL A CA  1 
ATOM   2456 C C   . VAL A 1 326 ? 17.904  0.224   15.997  1.00 39.35  ? 326  VAL A C   1 
ATOM   2457 O O   . VAL A 1 326 ? 16.973  -0.151  15.294  1.00 43.32  ? 326  VAL A O   1 
ATOM   2458 C CB  . VAL A 1 326 ? 20.036  -0.861  15.238  1.00 48.81  ? 326  VAL A CB  1 
ATOM   2459 C CG1 . VAL A 1 326 ? 20.483  0.505   14.761  1.00 47.48  ? 326  VAL A CG1 1 
ATOM   2460 C CG2 . VAL A 1 326 ? 21.246  -1.644  15.680  1.00 49.70  ? 326  VAL A CG2 1 
ATOM   2461 N N   . LEU A 1 327 ? 18.015  1.466   16.439  1.00 36.32  ? 327  LEU A N   1 
ATOM   2462 C CA  . LEU A 1 327 ? 17.136  2.517   15.973  1.00 35.40  ? 327  LEU A CA  1 
ATOM   2463 C C   . LEU A 1 327 ? 18.004  3.492   15.168  1.00 40.41  ? 327  LEU A C   1 
ATOM   2464 O O   . LEU A 1 327 ? 19.076  3.896   15.631  1.00 36.94  ? 327  LEU A O   1 
ATOM   2465 C CB  . LEU A 1 327 ? 16.489  3.212   17.165  1.00 35.84  ? 327  LEU A CB  1 
ATOM   2466 C CG  . LEU A 1 327 ? 15.743  4.534   16.931  1.00 43.08  ? 327  LEU A CG  1 
ATOM   2467 C CD1 . LEU A 1 327 ? 14.652  4.367   15.918  1.00 50.54  ? 327  LEU A CD1 1 
ATOM   2468 C CD2 . LEU A 1 327 ? 15.134  4.966   18.235  1.00 53.40  ? 327  LEU A CD2 1 
ATOM   2469 N N   . VAL A 1 328 ? 17.562  3.855   13.963  1.00 36.50  ? 328  VAL A N   1 
ATOM   2470 C CA  . VAL A 1 328 ? 18.349  4.744   13.106  1.00 35.22  ? 328  VAL A CA  1 
ATOM   2471 C C   . VAL A 1 328 ? 17.437  5.714   12.400  1.00 42.08  ? 328  VAL A C   1 
ATOM   2472 O O   . VAL A 1 328 ? 16.275  5.392   12.121  1.00 44.48  ? 328  VAL A O   1 
ATOM   2473 C CB  . VAL A 1 328 ? 19.130  3.983   11.991  1.00 42.43  ? 328  VAL A CB  1 
ATOM   2474 C CG1 . VAL A 1 328 ? 20.139  3.025   12.575  1.00 37.07  ? 328  VAL A CG1 1 
ATOM   2475 C CG2 . VAL A 1 328 ? 18.164  3.256   11.037  1.00 40.79  ? 328  VAL A CG2 1 
ATOM   2476 N N   . GLY A 1 329 ? 17.965  6.888   12.064  1.00 32.75  ? 329  GLY A N   1 
ATOM   2477 C CA  . GLY A 1 329 ? 17.168  7.846   11.327  1.00 32.12  ? 329  GLY A CA  1 
ATOM   2478 C C   . GLY A 1 329 ? 17.909  9.082   10.897  1.00 35.01  ? 329  GLY A C   1 
ATOM   2479 O O   . GLY A 1 329 ? 19.134  9.186   11.072  1.00 35.39  ? 329  GLY A O   1 
ATOM   2480 N N   . VAL A 1 330 ? 17.154  10.022  10.326  1.00 35.23  ? 330  VAL A N   1 
ATOM   2481 C CA  . VAL A 1 330 ? 17.706  11.225  9.696   1.00 29.10  ? 330  VAL A CA  1 
ATOM   2482 C C   . VAL A 1 330 ? 16.722  12.365  9.894   1.00 35.26  ? 330  VAL A C   1 
ATOM   2483 O O   . VAL A 1 330 ? 15.548  12.122  10.200  1.00 31.65  ? 330  VAL A O   1 
ATOM   2484 C CB  . VAL A 1 330 ? 17.965  11.017  8.175   1.00 33.05  ? 330  VAL A CB  1 
ATOM   2485 C CG1 . VAL A 1 330 ? 18.954  9.851   7.944   1.00 32.28  ? 330  VAL A CG1 1 
ATOM   2486 C CG2 . VAL A 1 330 ? 16.652  10.746  7.418   1.00 32.30  ? 330  VAL A CG2 1 
ATOM   2487 N N   . VAL A 1 331 ? 17.196  13.601  9.751   1.00 29.11  ? 331  VAL A N   1 
ATOM   2488 C CA  . VAL A 1 331 ? 16.297  14.764  9.704   1.00 30.96  ? 331  VAL A CA  1 
ATOM   2489 C C   . VAL A 1 331 ? 15.937  15.078  8.239   1.00 36.95  ? 331  VAL A C   1 
ATOM   2490 O O   . VAL A 1 331 ? 16.605  14.615  7.308   1.00 34.04  ? 331  VAL A O   1 
ATOM   2491 C CB  . VAL A 1 331 ? 16.938  16.014  10.346  1.00 31.97  ? 331  VAL A CB  1 
ATOM   2492 C CG1 . VAL A 1 331 ? 17.293  15.753  11.803  1.00 28.45  ? 331  VAL A CG1 1 
ATOM   2493 C CG2 . VAL A 1 331 ? 18.186  16.444  9.570   1.00 28.01  ? 331  VAL A CG2 1 
ATOM   2494 N N   . LYS A 1 332 ? 14.906  15.888  8.037   1.00 38.08  ? 332  LYS A N   1 
ATOM   2495 C CA  . LYS A 1 332 ? 14.427  16.166  6.702   1.00 35.56  ? 332  LYS A CA  1 
ATOM   2496 C C   . LYS A 1 332 ? 15.462  16.859  5.784   1.00 39.20  ? 332  LYS A C   1 
ATOM   2497 O O   . LYS A 1 332 ? 15.517  16.557  4.598   1.00 38.51  ? 332  LYS A O   1 
ATOM   2498 C CB  . LYS A 1 332 ? 13.092  16.928  6.761   1.00 38.90  ? 332  LYS A CB  1 
ATOM   2499 C CG  . LYS A 1 332 ? 12.485  17.254  5.387   1.00 42.21  ? 332  LYS A CG  1 
ATOM   2500 C CD  . LYS A 1 332 ? 11.083  17.875  5.538   1.00 56.67  ? 332  LYS A CD  1 
ATOM   2501 C CE  . LYS A 1 332 ? 10.859  19.063  4.587   1.00 70.27  ? 332  LYS A CE  1 
ATOM   2502 N NZ  . LYS A 1 332 ? 11.579  20.338  5.020   1.00 70.18  ? 332  LYS A NZ  1 
ATOM   2503 N N   . ASP A 1 333 ? 16.278  17.767  6.323   1.00 35.67  ? 333  ASP A N   1 
ATOM   2504 C CA  . ASP A 1 333 ? 17.272  18.486  5.506   1.00 33.00  ? 333  ASP A CA  1 
ATOM   2505 C C   . ASP A 1 333 ? 18.718  18.362  6.027   1.00 34.27  ? 333  ASP A C   1 
ATOM   2506 O O   . ASP A 1 333 ? 19.308  19.337  6.513   1.00 31.93  ? 333  ASP A O   1 
ATOM   2507 C CB  . ASP A 1 333 ? 16.882  19.958  5.347   1.00 31.42  ? 333  ASP A CB  1 
ATOM   2508 C CG  . ASP A 1 333 ? 15.451  20.123  4.822   1.00 41.64  ? 333  ASP A CG  1 
ATOM   2509 O OD1 . ASP A 1 333 ? 14.511  20.085  5.641   1.00 38.62  ? 333  ASP A OD1 1 
ATOM   2510 O OD2 . ASP A 1 333 ? 15.268  20.269  3.590   1.00 40.23  ? 333  ASP A OD2 1 
ATOM   2511 N N   . GLU A 1 334 ? 19.280  17.160  5.919   1.00 30.19  ? 334  GLU A N   1 
ATOM   2512 C CA  . GLU A 1 334 ? 20.617  16.896  6.449   1.00 31.80  ? 334  GLU A CA  1 
ATOM   2513 C C   . GLU A 1 334 ? 21.663  17.859  5.870   1.00 36.38  ? 334  GLU A C   1 
ATOM   2514 O O   . GLU A 1 334 ? 22.551  18.308  6.579   1.00 33.74  ? 334  GLU A O   1 
ATOM   2515 C CB  . GLU A 1 334 ? 21.026  15.443  6.167   1.00 25.29  ? 334  GLU A CB  1 
ATOM   2516 C CG  . GLU A 1 334 ? 20.220  14.407  6.935   1.00 29.96  ? 334  GLU A CG  1 
ATOM   2517 C CD  . GLU A 1 334 ? 20.607  14.335  8.401   1.00 34.46  ? 334  GLU A CD  1 
ATOM   2518 O OE1 . GLU A 1 334 ? 21.609  14.974  8.802   1.00 34.53  ? 334  GLU A OE1 1 
ATOM   2519 O OE2 . GLU A 1 334 ? 19.912  13.630  9.159   1.00 35.66  ? 334  GLU A OE2 1 
ATOM   2520 N N   . GLY A 1 335 ? 21.539  18.194  4.583   1.00 29.73  ? 335  GLY A N   1 
ATOM   2521 C CA  . GLY A 1 335 ? 22.596  18.892  3.895   1.00 25.78  ? 335  GLY A CA  1 
ATOM   2522 C C   . GLY A 1 335 ? 22.692  20.390  4.089   1.00 31.41  ? 335  GLY A C   1 
ATOM   2523 O O   . GLY A 1 335 ? 23.761  20.967  3.902   1.00 34.87  ? 335  GLY A O   1 
ATOM   2524 N N   . SER A 1 336 ? 21.591  21.032  4.459   1.00 31.32  ? 336  SER A N   1 
ATOM   2525 C CA  . SER A 1 336 ? 21.479  22.480  4.277   1.00 32.14  ? 336  SER A CA  1 
ATOM   2526 C C   . SER A 1 336 ? 22.508  23.310  5.043   1.00 35.99  ? 336  SER A C   1 
ATOM   2527 O O   . SER A 1 336 ? 23.125  24.208  4.477   1.00 33.43  ? 336  SER A O   1 
ATOM   2528 C CB  . SER A 1 336 ? 20.071  22.965  4.635   1.00 27.93  ? 336  SER A CB  1 
ATOM   2529 O OG  . SER A 1 336 ? 19.789  22.664  5.990   1.00 32.88  ? 336  SER A OG  1 
ATOM   2530 N N   A TYR A 1 337 ? 22.709  23.051  6.330   0.70 34.44  ? 337  TYR A N   1 
ATOM   2531 N N   B TYR A 1 337 ? 22.648  22.986  6.328   0.30 35.25  ? 337  TYR A N   1 
ATOM   2532 C CA  A TYR A 1 337 ? 23.628  23.936  7.034   0.70 36.87  ? 337  TYR A CA  1 
ATOM   2533 C CA  B TYR A 1 337 ? 23.602  23.590  7.254   0.30 37.00  ? 337  TYR A CA  1 
ATOM   2534 C C   A TYR A 1 337 ? 25.079  23.737  6.625   0.70 36.56  ? 337  TYR A C   1 
ATOM   2535 C C   B TYR A 1 337 ? 24.991  23.688  6.646   0.30 36.52  ? 337  TYR A C   1 
ATOM   2536 O O   A TYR A 1 337 ? 25.884  24.632  6.827   0.70 37.10  ? 337  TYR A O   1 
ATOM   2537 O O   B TYR A 1 337 ? 25.646  24.723  6.724   0.30 36.04  ? 337  TYR A O   1 
ATOM   2538 C CB  A TYR A 1 337 ? 23.445  23.949  8.560   0.70 38.61  ? 337  TYR A CB  1 
ATOM   2539 C CB  B TYR A 1 337 ? 23.648  22.716  8.514   0.30 38.52  ? 337  TYR A CB  1 
ATOM   2540 C CG  A TYR A 1 337 ? 24.277  22.969  9.351   0.70 38.39  ? 337  TYR A CG  1 
ATOM   2541 C CG  B TYR A 1 337 ? 24.601  23.127  9.618   0.30 37.79  ? 337  TYR A CG  1 
ATOM   2542 C CD1 A TYR A 1 337 ? 25.644  23.113  9.455   0.70 42.41  ? 337  TYR A CD1 1 
ATOM   2543 C CD1 B TYR A 1 337 ? 24.306  24.187  10.460  0.30 36.13  ? 337  TYR A CD1 1 
ATOM   2544 C CD2 A TYR A 1 337 ? 23.677  21.930  10.033  0.70 47.30  ? 337  TYR A CD2 1 
ATOM   2545 C CD2 B TYR A 1 337 ? 25.767  22.413  9.857   0.30 41.98  ? 337  TYR A CD2 1 
ATOM   2546 C CE1 A TYR A 1 337 ? 26.409  22.222  10.192  0.70 46.09  ? 337  TYR A CE1 1 
ATOM   2547 C CE1 B TYR A 1 337 ? 25.163  24.548  11.492  0.30 33.52  ? 337  TYR A CE1 1 
ATOM   2548 C CE2 A TYR A 1 337 ? 24.419  21.036  10.771  0.70 54.58  ? 337  TYR A CE2 1 
ATOM   2549 C CE2 B TYR A 1 337 ? 26.633  22.772  10.887  0.30 40.30  ? 337  TYR A CE2 1 
ATOM   2550 C CZ  A TYR A 1 337 ? 25.787  21.185  10.851  0.70 52.23  ? 337  TYR A CZ  1 
ATOM   2551 C CZ  B TYR A 1 337 ? 26.318  23.840  11.698  0.30 33.05  ? 337  TYR A CZ  1 
ATOM   2552 O OH  A TYR A 1 337 ? 26.518  20.282  11.594  0.70 47.49  ? 337  TYR A OH  1 
ATOM   2553 O OH  B TYR A 1 337 ? 27.156  24.201  12.721  0.30 31.04  ? 337  TYR A OH  1 
ATOM   2554 N N   . PHE A 1 338 ? 25.418  22.598  6.023   1.00 35.77  ? 338  PHE A N   1 
ATOM   2555 C CA  . PHE A 1 338 ? 26.802  22.436  5.539   1.00 32.02  ? 338  PHE A CA  1 
ATOM   2556 C C   . PHE A 1 338 ? 27.176  23.356  4.379   1.00 37.94  ? 338  PHE A C   1 
ATOM   2557 O O   . PHE A 1 338 ? 28.355  23.687  4.193   1.00 41.74  ? 338  PHE A O   1 
ATOM   2558 C CB  . PHE A 1 338 ? 27.065  20.972  5.188   1.00 30.41  ? 338  PHE A CB  1 
ATOM   2559 C CG  . PHE A 1 338 ? 27.043  20.086  6.387   1.00 34.85  ? 338  PHE A CG  1 
ATOM   2560 C CD1 . PHE A 1 338 ? 25.856  19.480  6.800   1.00 30.49  ? 338  PHE A CD1 1 
ATOM   2561 C CD2 . PHE A 1 338 ? 28.197  19.906  7.152   1.00 30.78  ? 338  PHE A CD2 1 
ATOM   2562 C CE1 . PHE A 1 338 ? 25.825  18.665  7.959   1.00 28.33  ? 338  PHE A CE1 1 
ATOM   2563 C CE2 . PHE A 1 338 ? 28.171  19.090  8.306   1.00 34.00  ? 338  PHE A CE2 1 
ATOM   2564 C CZ  . PHE A 1 338 ? 26.981  18.482  8.708   1.00 33.21  ? 338  PHE A CZ  1 
ATOM   2565 N N   . LEU A 1 339 ? 26.170  23.790  3.621   1.00 33.74  ? 339  LEU A N   1 
ATOM   2566 C CA  . LEU A 1 339 ? 26.385  24.643  2.458   1.00 33.74  ? 339  LEU A CA  1 
ATOM   2567 C C   . LEU A 1 339 ? 26.988  26.029  2.781   1.00 42.21  ? 339  LEU A C   1 
ATOM   2568 O O   . LEU A 1 339 ? 27.744  26.568  1.966   1.00 39.41  ? 339  LEU A O   1 
ATOM   2569 C CB  . LEU A 1 339 ? 25.084  24.791  1.640   1.00 31.83  ? 339  LEU A CB  1 
ATOM   2570 C CG  . LEU A 1 339 ? 24.443  23.459  1.263   1.00 37.09  ? 339  LEU A CG  1 
ATOM   2571 C CD1 . LEU A 1 339 ? 23.210  23.637  0.405   1.00 35.22  ? 339  LEU A CD1 1 
ATOM   2572 C CD2 . LEU A 1 339 ? 25.456  22.584  0.559   1.00 39.24  ? 339  LEU A CD2 1 
ATOM   2573 N N   . VAL A 1 340 ? 26.665  26.606  3.944   1.00 39.12  ? 340  VAL A N   1 
ATOM   2574 C CA  . VAL A 1 340 ? 27.230  27.918  4.310   1.00 42.03  ? 340  VAL A CA  1 
ATOM   2575 C C   . VAL A 1 340 ? 28.686  27.874  4.790   1.00 46.46  ? 340  VAL A C   1 
ATOM   2576 O O   . VAL A 1 340 ? 29.311  28.907  4.960   1.00 56.19  ? 340  VAL A O   1 
ATOM   2577 C CB  . VAL A 1 340 ? 26.398  28.651  5.360   1.00 47.67  ? 340  VAL A CB  1 
ATOM   2578 C CG1 . VAL A 1 340 ? 24.938  28.736  4.923   1.00 41.97  ? 340  VAL A CG1 1 
ATOM   2579 C CG2 . VAL A 1 340 ? 26.507  27.949  6.712   1.00 51.01  ? 340  VAL A CG2 1 
ATOM   2580 N N   . TYR A 1 341 ? 29.244  26.692  4.981   1.00 43.30  ? 341  TYR A N   1 
ATOM   2581 C CA  . TYR A 1 341 ? 30.636  26.612  5.407   1.00 55.22  ? 341  TYR A CA  1 
ATOM   2582 C C   . TYR A 1 341 ? 31.565  26.287  4.249   1.00 65.23  ? 341  TYR A C   1 
ATOM   2583 O O   . TYR A 1 341 ? 32.632  25.691  4.457   1.00 70.31  ? 341  TYR A O   1 
ATOM   2584 C CB  . TYR A 1 341 ? 30.824  25.548  6.492   1.00 55.33  ? 341  TYR A CB  1 
ATOM   2585 C CG  . TYR A 1 341 ? 30.217  25.915  7.819   1.00 57.63  ? 341  TYR A CG  1 
ATOM   2586 C CD1 . TYR A 1 341 ? 28.903  25.569  8.123   1.00 46.22  ? 341  TYR A CD1 1 
ATOM   2587 C CD2 . TYR A 1 341 ? 30.964  26.596  8.777   1.00 56.58  ? 341  TYR A CD2 1 
ATOM   2588 C CE1 . TYR A 1 341 ? 28.354  25.898  9.324   1.00 54.17  ? 341  TYR A CE1 1 
ATOM   2589 C CE2 . TYR A 1 341 ? 30.418  26.933  9.991   1.00 55.83  ? 341  TYR A CE2 1 
ATOM   2590 C CZ  . TYR A 1 341 ? 29.112  26.582  10.261  1.00 58.39  ? 341  TYR A CZ  1 
ATOM   2591 O OH  . TYR A 1 341 ? 28.559  26.908  11.471  1.00 61.63  ? 341  TYR A OH  1 
ATOM   2592 N N   . GLY A 1 342 ? 31.171  26.639  3.030   1.00 56.88  ? 342  GLY A N   1 
ATOM   2593 C CA  . GLY A 1 342 ? 32.104  26.475  1.936   1.00 51.33  ? 342  GLY A CA  1 
ATOM   2594 C C   . GLY A 1 342 ? 31.600  26.307  0.524   1.00 51.70  ? 342  GLY A C   1 
ATOM   2595 O O   . GLY A 1 342 ? 32.404  26.085  -0.371  1.00 62.44  ? 342  GLY A O   1 
ATOM   2596 N N   . VAL A 1 343 ? 30.293  26.392  0.301   1.00 43.34  ? 343  VAL A N   1 
ATOM   2597 C CA  . VAL A 1 343 ? 29.812  26.409  -1.073  1.00 42.21  ? 343  VAL A CA  1 
ATOM   2598 C C   . VAL A 1 343 ? 29.435  27.841  -1.446  1.00 40.41  ? 343  VAL A C   1 
ATOM   2599 O O   . VAL A 1 343 ? 28.519  28.419  -0.865  1.00 47.67  ? 343  VAL A O   1 
ATOM   2600 C CB  . VAL A 1 343 ? 28.647  25.415  -1.305  1.00 38.62  ? 343  VAL A CB  1 
ATOM   2601 C CG1 . VAL A 1 343 ? 28.173  25.475  -2.754  1.00 34.24  ? 343  VAL A CG1 1 
ATOM   2602 C CG2 . VAL A 1 343 ? 29.095  24.015  -0.956  1.00 36.22  ? 343  VAL A CG2 1 
ATOM   2603 N N   . PRO A 1 344 ? 30.166  28.429  -2.401  1.00 36.86  ? 344  PRO A N   1 
ATOM   2604 C CA  . PRO A 1 344 ? 29.868  29.811  -2.809  1.00 38.60  ? 344  PRO A CA  1 
ATOM   2605 C C   . PRO A 1 344 ? 28.416  29.963  -3.278  1.00 40.29  ? 344  PRO A C   1 
ATOM   2606 O O   . PRO A 1 344 ? 27.897  29.090  -3.972  1.00 40.35  ? 344  PRO A O   1 
ATOM   2607 C CB  . PRO A 1 344 ? 30.824  30.041  -3.982  1.00 41.19  ? 344  PRO A CB  1 
ATOM   2608 C CG  . PRO A 1 344 ? 31.990  29.047  -3.713  1.00 35.86  ? 344  PRO A CG  1 
ATOM   2609 C CD  . PRO A 1 344 ? 31.286  27.841  -3.164  1.00 34.63  ? 344  PRO A CD  1 
ATOM   2610 N N   . GLY A 1 345 ? 27.782  31.068  -2.902  1.00 36.95  ? 345  GLY A N   1 
ATOM   2611 C CA  . GLY A 1 345 ? 26.392  31.319  -3.224  1.00 34.60  ? 345  GLY A CA  1 
ATOM   2612 C C   . GLY A 1 345 ? 25.491  31.063  -2.036  1.00 37.52  ? 345  GLY A C   1 
ATOM   2613 O O   . GLY A 1 345 ? 24.325  31.468  -2.040  1.00 44.45  ? 345  GLY A O   1 
ATOM   2614 N N   . PHE A 1 346 ? 26.017  30.390  -1.013  1.00 37.26  ? 346  PHE A N   1 
ATOM   2615 C CA  . PHE A 1 346 ? 25.203  30.024  0.151   1.00 43.47  ? 346  PHE A CA  1 
ATOM   2616 C C   . PHE A 1 346 ? 25.498  30.855  1.404   1.00 43.38  ? 346  PHE A C   1 
ATOM   2617 O O   . PHE A 1 346 ? 26.649  31.156  1.709   1.00 48.51  ? 346  PHE A O   1 
ATOM   2618 C CB  . PHE A 1 346 ? 25.302  28.522  0.434   1.00 37.38  ? 346  PHE A CB  1 
ATOM   2619 C CG  . PHE A 1 346 ? 24.681  27.674  -0.643  1.00 39.39  ? 346  PHE A CG  1 
ATOM   2620 C CD1 . PHE A 1 346 ? 25.411  27.324  -1.772  1.00 37.83  ? 346  PHE A CD1 1 
ATOM   2621 C CD2 . PHE A 1 346 ? 23.352  27.254  -0.542  1.00 32.77  ? 346  PHE A CD2 1 
ATOM   2622 C CE1 . PHE A 1 346 ? 24.836  26.538  -2.789  1.00 39.20  ? 346  PHE A CE1 1 
ATOM   2623 C CE2 . PHE A 1 346 ? 22.781  26.479  -1.533  1.00 33.47  ? 346  PHE A CE2 1 
ATOM   2624 C CZ  . PHE A 1 346 ? 23.525  26.120  -2.665  1.00 37.31  ? 346  PHE A CZ  1 
ATOM   2625 N N   . SER A 1 347 ? 24.441  31.212  2.124   1.00 43.63  ? 347  SER A N   1 
ATOM   2626 C CA  . SER A 1 347 ? 24.551  32.091  3.281   1.00 45.69  ? 347  SER A CA  1 
ATOM   2627 C C   . SER A 1 347 ? 23.335  31.967  4.187   1.00 48.52  ? 347  SER A C   1 
ATOM   2628 O O   . SER A 1 347 ? 22.216  31.758  3.718   1.00 44.46  ? 347  SER A O   1 
ATOM   2629 C CB  . SER A 1 347 ? 24.685  33.549  2.823   1.00 48.06  ? 347  SER A CB  1 
ATOM   2630 O OG  . SER A 1 347 ? 24.746  34.412  3.939   1.00 53.20  ? 347  SER A OG  1 
ATOM   2631 N N   . LYS A 1 348 ? 23.544  32.102  5.490   1.00 46.69  ? 348  LYS A N   1 
ATOM   2632 C CA  . LYS A 1 348 ? 22.406  32.072  6.396   1.00 51.19  ? 348  LYS A CA  1 
ATOM   2633 C C   . LYS A 1 348 ? 21.593  33.347  6.237   1.00 43.94  ? 348  LYS A C   1 
ATOM   2634 O O   . LYS A 1 348 ? 20.426  33.376  6.603   1.00 48.41  ? 348  LYS A O   1 
ATOM   2635 C CB  . LYS A 1 348 ? 22.839  31.879  7.868   1.00 47.84  ? 348  LYS A CB  1 
ATOM   2636 C CG  . LYS A 1 348 ? 23.378  33.133  8.550   1.00 45.68  ? 348  LYS A CG  1 
ATOM   2637 C CD  . LYS A 1 348 ? 23.711  32.872  10.035  1.00 51.68  ? 348  LYS A CD  1 
ATOM   2638 C CE  . LYS A 1 348 ? 23.822  34.171  10.840  1.00 48.52  ? 348  LYS A CE  1 
ATOM   2639 N NZ  . LYS A 1 348 ? 22.501  34.913  10.936  1.00 57.68  ? 348  LYS A NZ  1 
ATOM   2640 N N   . ASP A 1 349 ? 22.207  34.393  5.684   1.00 41.71  ? 349  ASP A N   1 
ATOM   2641 C CA  . ASP A 1 349 ? 21.580  35.728  5.666   1.00 44.31  ? 349  ASP A CA  1 
ATOM   2642 C C   . ASP A 1 349 ? 20.788  36.141  4.418   1.00 49.03  ? 349  ASP A C   1 
ATOM   2643 O O   . ASP A 1 349 ? 20.295  37.263  4.358   1.00 45.44  ? 349  ASP A O   1 
ATOM   2644 C CB  . ASP A 1 349 ? 22.612  36.814  5.983   1.00 49.74  ? 349  ASP A CB  1 
ATOM   2645 C CG  . ASP A 1 349 ? 23.155  36.700  7.393   1.00 56.40  ? 349  ASP A CG  1 
ATOM   2646 O OD1 . ASP A 1 349 ? 22.364  36.384  8.322   1.00 47.20  ? 349  ASP A OD1 1 
ATOM   2647 O OD2 . ASP A 1 349 ? 24.377  36.908  7.560   1.00 61.12  ? 349  ASP A OD2 1 
ATOM   2648 N N   . ASN A 1 350 ? 20.684  35.262  3.426   1.00 45.66  ? 350  ASN A N   1 
ATOM   2649 C CA  . ASN A 1 350 ? 19.802  35.505  2.293   1.00 45.74  ? 350  ASN A CA  1 
ATOM   2650 C C   . ASN A 1 350 ? 19.201  34.180  1.864   1.00 45.47  ? 350  ASN A C   1 
ATOM   2651 O O   . ASN A 1 350 ? 19.455  33.168  2.509   1.00 47.30  ? 350  ASN A O   1 
ATOM   2652 C CB  . ASN A 1 350 ? 20.507  36.232  1.131   1.00 43.38  ? 350  ASN A CB  1 
ATOM   2653 C CG  . ASN A 1 350 ? 21.718  35.490  0.605   1.00 52.89  ? 350  ASN A CG  1 
ATOM   2654 O OD1 . ASN A 1 350 ? 21.687  34.271  0.436   1.00 54.31  ? 350  ASN A OD1 1 
ATOM   2655 N ND2 . ASN A 1 350 ? 22.800  36.237  0.330   1.00 60.86  ? 350  ASN A ND2 1 
ATOM   2656 N N   . GLU A 1 351 ? 18.409  34.185  0.796   1.00 37.64  ? 351  GLU A N   1 
ATOM   2657 C CA  . GLU A 1 351 ? 17.697  32.981  0.357   1.00 44.80  ? 351  GLU A CA  1 
ATOM   2658 C C   . GLU A 1 351 ? 18.594  31.978  -0.385  1.00 41.39  ? 351  GLU A C   1 
ATOM   2659 O O   . GLU A 1 351 ? 18.149  30.880  -0.730  1.00 42.13  ? 351  GLU A O   1 
ATOM   2660 C CB  . GLU A 1 351 ? 16.502  33.356  -0.531  1.00 52.15  ? 351  GLU A CB  1 
ATOM   2661 C CG  . GLU A 1 351 ? 15.446  34.157  0.180   1.00 64.54  ? 351  GLU A CG  1 
ATOM   2662 C CD  . GLU A 1 351 ? 14.925  33.428  1.398   1.00 81.18  ? 351  GLU A CD  1 
ATOM   2663 O OE1 . GLU A 1 351 ? 14.426  32.285  1.250   1.00 85.13  ? 351  GLU A OE1 1 
ATOM   2664 O OE2 . GLU A 1 351 ? 15.021  33.998  2.505   1.00 88.95  ? 351  GLU A OE2 1 
ATOM   2665 N N   . SER A 1 352 ? 19.832  32.370  -0.671  1.00 38.67  ? 352  SER A N   1 
ATOM   2666 C CA  . SER A 1 352 ? 20.786  31.467  -1.308  1.00 37.46  ? 352  SER A CA  1 
ATOM   2667 C C   . SER A 1 352 ? 20.278  30.852  -2.626  1.00 39.12  ? 352  SER A C   1 
ATOM   2668 O O   . SER A 1 352 ? 20.522  29.678  -2.909  1.00 39.26  ? 352  SER A O   1 
ATOM   2669 C CB  . SER A 1 352 ? 21.158  30.356  -0.322  1.00 38.73  ? 352  SER A CB  1 
ATOM   2670 O OG  . SER A 1 352 ? 21.889  30.883  0.778   1.00 42.45  ? 352  SER A OG  1 
ATOM   2671 N N   . LEU A 1 353 ? 19.565  31.640  -3.424  1.00 35.44  ? 353  LEU A N   1 
ATOM   2672 C CA  . LEU A 1 353 ? 19.193  31.223  -4.768  1.00 39.08  ? 353  LEU A CA  1 
ATOM   2673 C C   . LEU A 1 353 ? 20.463  31.239  -5.612  1.00 47.88  ? 353  LEU A C   1 
ATOM   2674 O O   . LEU A 1 353 ? 21.106  32.273  -5.744  1.00 60.34  ? 353  LEU A O   1 
ATOM   2675 C CB  . LEU A 1 353 ? 18.153  32.180  -5.358  1.00 43.00  ? 353  LEU A CB  1 
ATOM   2676 C CG  . LEU A 1 353 ? 16.892  32.438  -4.532  1.00 47.44  ? 353  LEU A CG  1 
ATOM   2677 C CD1 . LEU A 1 353 ? 15.912  33.387  -5.240  1.00 50.87  ? 353  LEU A CD1 1 
ATOM   2678 C CD2 . LEU A 1 353 ? 16.220  31.152  -4.192  1.00 45.46  ? 353  LEU A CD2 1 
ATOM   2679 N N   . ILE A 1 354 ? 20.846  30.093  -6.157  1.00 35.41  ? 354  ILE A N   1 
ATOM   2680 C CA  . ILE A 1 354 ? 22.098  30.000  -6.877  1.00 34.96  ? 354  ILE A CA  1 
ATOM   2681 C C   . ILE A 1 354 ? 21.879  29.746  -8.366  1.00 39.65  ? 354  ILE A C   1 
ATOM   2682 O O   . ILE A 1 354 ? 20.783  29.364  -8.805  1.00 35.00  ? 354  ILE A O   1 
ATOM   2683 C CB  . ILE A 1 354 ? 23.004  28.902  -6.267  1.00 36.67  ? 354  ILE A CB  1 
ATOM   2684 C CG1 . ILE A 1 354 ? 22.270  27.546  -6.256  1.00 29.47  ? 354  ILE A CG1 1 
ATOM   2685 C CG2 . ILE A 1 354 ? 23.361  29.285  -4.838  1.00 31.11  ? 354  ILE A CG2 1 
ATOM   2686 C CD1 . ILE A 1 354 ? 23.179  26.353  -6.290  1.00 30.84  ? 354  ILE A CD1 1 
ATOM   2687 N N   . SER A 1 355 ? 22.938  29.966  -9.133  1.00 33.45  ? 355  SER A N   1 
ATOM   2688 C CA  . SER A 1 355 ? 22.927  29.729  -10.568 1.00 37.04  ? 355  SER A CA  1 
ATOM   2689 C C   . SER A 1 355 ? 23.292  28.275  -10.881 1.00 34.17  ? 355  SER A C   1 
ATOM   2690 O O   . SER A 1 355 ? 23.795  27.536  -10.030 1.00 35.01  ? 355  SER A O   1 
ATOM   2691 C CB  . SER A 1 355 ? 23.944  30.651  -11.247 1.00 42.21  ? 355  SER A CB  1 
ATOM   2692 O OG  . SER A 1 355 ? 25.267  30.285  -10.840 1.00 40.20  ? 355  SER A OG  1 
ATOM   2693 N N   . ARG A 1 356 ? 23.062  27.877  -12.121 1.00 33.52  ? 356  ARG A N   1 
ATOM   2694 C CA  . ARG A 1 356 ? 23.487  26.569  -12.579 1.00 39.87  ? 356  ARG A CA  1 
ATOM   2695 C C   . ARG A 1 356 ? 25.000  26.398  -12.415 1.00 38.56  ? 356  ARG A C   1 
ATOM   2696 O O   . ARG A 1 356 ? 25.452  25.358  -11.976 1.00 37.35  ? 356  ARG A O   1 
ATOM   2697 C CB  . ARG A 1 356 ? 23.057  26.341  -14.036 1.00 43.86  ? 356  ARG A CB  1 
ATOM   2698 C CG  . ARG A 1 356 ? 23.436  24.971  -14.546 1.00 52.38  ? 356  ARG A CG  1 
ATOM   2699 C CD  . ARG A 1 356 ? 22.349  24.336  -15.399 1.00 57.42  ? 356  ARG A CD  1 
ATOM   2700 N NE  . ARG A 1 356 ? 22.670  22.931  -15.609 1.00 54.68  ? 356  ARG A NE  1 
ATOM   2701 C CZ  . ARG A 1 356 ? 22.195  21.936  -14.869 1.00 51.27  ? 356  ARG A CZ  1 
ATOM   2702 N NH1 . ARG A 1 356 ? 21.332  22.177  -13.885 1.00 47.60  ? 356  ARG A NH1 1 
ATOM   2703 N NH2 . ARG A 1 356 ? 22.564  20.695  -15.134 1.00 46.03  ? 356  ARG A NH2 1 
ATOM   2704 N N   . ALA A 1 357 ? 25.775  27.422  -12.756 1.00 37.32  ? 357  ALA A N   1 
ATOM   2705 C CA  . ALA A 1 357 ? 27.225  27.349  -12.584 1.00 37.25  ? 357  ALA A CA  1 
ATOM   2706 C C   . ALA A 1 357 ? 27.606  27.102  -11.122 1.00 36.30  ? 357  ALA A C   1 
ATOM   2707 O O   . ALA A 1 357 ? 28.481  26.281  -10.821 1.00 37.79  ? 357  ALA A O   1 
ATOM   2708 C CB  . ALA A 1 357 ? 27.922  28.630  -13.138 1.00 32.30  ? 357  ALA A CB  1 
ATOM   2709 N N   . GLN A 1 358 ? 26.946  27.796  -10.205 1.00 34.12  ? 358  GLN A N   1 
ATOM   2710 C CA  . GLN A 1 358 ? 27.223  27.584  -8.783  1.00 31.04  ? 358  GLN A CA  1 
ATOM   2711 C C   . GLN A 1 358 ? 26.814  26.195  -8.293  1.00 36.03  ? 358  GLN A C   1 
ATOM   2712 O O   . GLN A 1 358 ? 27.382  25.678  -7.324  1.00 34.69  ? 358  GLN A O   1 
ATOM   2713 C CB  . GLN A 1 358 ? 26.557  28.653  -7.916  1.00 36.08  ? 358  GLN A CB  1 
ATOM   2714 C CG  . GLN A 1 358 ? 27.166  30.039  -8.064  1.00 38.32  ? 358  GLN A CG  1 
ATOM   2715 C CD  . GLN A 1 358 ? 26.293  31.108  -7.445  1.00 42.34  ? 358  GLN A CD  1 
ATOM   2716 O OE1 . GLN A 1 358 ? 25.071  31.116  -7.632  1.00 43.35  ? 358  GLN A OE1 1 
ATOM   2717 N NE2 . GLN A 1 358 ? 26.913  32.020  -6.700  1.00 41.50  ? 358  GLN A NE2 1 
ATOM   2718 N N   . PHE A 1 359 ? 25.835  25.588  -8.963  1.00 33.79  ? 359  PHE A N   1 
ATOM   2719 C CA  . PHE A 1 359 ? 25.426  24.232  -8.616  1.00 32.13  ? 359  PHE A CA  1 
ATOM   2720 C C   . PHE A 1 359 ? 26.514  23.230  -9.027  1.00 29.11  ? 359  PHE A C   1 
ATOM   2721 O O   . PHE A 1 359 ? 26.885  22.373  -8.242  1.00 30.97  ? 359  PHE A O   1 
ATOM   2722 C CB  . PHE A 1 359 ? 24.095  23.898  -9.272  1.00 30.90  ? 359  PHE A CB  1 
ATOM   2723 C CG  . PHE A 1 359 ? 23.636  22.488  -9.056  1.00 31.62  ? 359  PHE A CG  1 
ATOM   2724 C CD1 . PHE A 1 359 ? 23.476  21.633  -10.125 1.00 31.75  ? 359  PHE A CD1 1 
ATOM   2725 C CD2 . PHE A 1 359 ? 23.331  22.023  -7.792  1.00 36.03  ? 359  PHE A CD2 1 
ATOM   2726 C CE1 . PHE A 1 359 ? 23.029  20.339  -9.942  1.00 29.99  ? 359  PHE A CE1 1 
ATOM   2727 C CE2 . PHE A 1 359 ? 22.898  20.721  -7.607  1.00 32.22  ? 359  PHE A CE2 1 
ATOM   2728 C CZ  . PHE A 1 359 ? 22.760  19.878  -8.688  1.00 31.05  ? 359  PHE A CZ  1 
ATOM   2729 N N   . LEU A 1 360 ? 27.006  23.340  -10.256 1.00 31.13  ? 360  LEU A N   1 
ATOM   2730 C CA  . LEU A 1 360 ? 28.079  22.462  -10.705 1.00 38.87  ? 360  LEU A CA  1 
ATOM   2731 C C   . LEU A 1 360 ? 29.314  22.620  -9.818  1.00 37.97  ? 360  LEU A C   1 
ATOM   2732 O O   . LEU A 1 360 ? 29.914  21.631  -9.412  1.00 40.05  ? 360  LEU A O   1 
ATOM   2733 C CB  . LEU A 1 360 ? 28.421  22.698  -12.187 1.00 39.52  ? 360  LEU A CB  1 
ATOM   2734 C CG  . LEU A 1 360 ? 27.252  22.849  -13.177 1.00 52.34  ? 360  LEU A CG  1 
ATOM   2735 C CD1 . LEU A 1 360 ? 27.724  22.889  -14.649 1.00 54.90  ? 360  LEU A CD1 1 
ATOM   2736 C CD2 . LEU A 1 360 ? 26.172  21.795  -13.011 1.00 45.74  ? 360  LEU A CD2 1 
ATOM   2737 N N   . ALA A 1 361 ? 29.698  23.858  -9.510  1.00 35.73  ? 361  ALA A N   1 
ATOM   2738 C CA  . ALA A 1 361 ? 30.826  24.076  -8.597  1.00 35.23  ? 361  ALA A CA  1 
ATOM   2739 C C   . ALA A 1 361 ? 30.560  23.471  -7.203  1.00 37.88  ? 361  ALA A C   1 
ATOM   2740 O O   . ALA A 1 361 ? 31.450  22.852  -6.621  1.00 38.38  ? 361  ALA A O   1 
ATOM   2741 C CB  . ALA A 1 361 ? 31.212  25.579  -8.509  1.00 31.91  ? 361  ALA A CB  1 
ATOM   2742 N N   . GLY A 1 362 ? 29.330  23.606  -6.698  1.00 33.86  ? 362  GLY A N   1 
ATOM   2743 C CA  . GLY A 1 362 ? 28.967  23.063  -5.392  1.00 27.70  ? 362  GLY A CA  1 
ATOM   2744 C C   . GLY A 1 362 ? 29.013  21.540  -5.353  1.00 37.17  ? 362  GLY A C   1 
ATOM   2745 O O   . GLY A 1 362 ? 29.414  20.924  -4.347  1.00 33.50  ? 362  GLY A O   1 
ATOM   2746 N N   . VAL A 1 363 ? 28.621  20.918  -6.462  1.00 32.93  ? 363  VAL A N   1 
ATOM   2747 C CA  . VAL A 1 363 ? 28.722  19.468  -6.573  1.00 34.77  ? 363  VAL A CA  1 
ATOM   2748 C C   . VAL A 1 363 ? 30.189  18.985  -6.463  1.00 37.16  ? 363  VAL A C   1 
ATOM   2749 O O   . VAL A 1 363 ? 30.455  17.984  -5.809  1.00 39.25  ? 363  VAL A O   1 
ATOM   2750 C CB  . VAL A 1 363 ? 28.028  18.935  -7.840  1.00 33.87  ? 363  VAL A CB  1 
ATOM   2751 C CG1 . VAL A 1 363 ? 28.479  17.485  -8.136  1.00 26.95  ? 363  VAL A CG1 1 
ATOM   2752 C CG2 . VAL A 1 363 ? 26.498  19.007  -7.658  1.00 31.17  ? 363  VAL A CG2 1 
ATOM   2753 N N   . ARG A 1 364 ? 31.135  19.701  -7.076  1.00 38.14  ? 364  ARG A N   1 
ATOM   2754 C CA  . ARG A 1 364 ? 32.544  19.315  -6.974  1.00 37.21  ? 364  ARG A CA  1 
ATOM   2755 C C   . ARG A 1 364 ? 33.032  19.421  -5.527  1.00 39.30  ? 364  ARG A C   1 
ATOM   2756 O O   . ARG A 1 364 ? 33.861  18.626  -5.094  1.00 38.14  ? 364  ARG A O   1 
ATOM   2757 C CB  . ARG A 1 364 ? 33.450  20.167  -7.870  1.00 34.52  ? 364  ARG A CB  1 
ATOM   2758 C CG  . ARG A 1 364 ? 33.168  20.066  -9.370  1.00 44.66  ? 364  ARG A CG  1 
ATOM   2759 C CD  . ARG A 1 364 ? 32.760  18.661  -9.774  1.00 53.52  ? 364  ARG A CD  1 
ATOM   2760 N NE  . ARG A 1 364 ? 33.827  17.669  -9.627  1.00 58.70  ? 364  ARG A NE  1 
ATOM   2761 C CZ  . ARG A 1 364 ? 34.632  17.300  -10.618 1.00 61.04  ? 364  ARG A CZ  1 
ATOM   2762 N NH1 . ARG A 1 364 ? 34.495  17.862  -11.818 1.00 59.10  ? 364  ARG A NH1 1 
ATOM   2763 N NH2 . ARG A 1 364 ? 35.570  16.379  -10.416 1.00 56.93  ? 364  ARG A NH2 1 
ATOM   2764 N N   . ILE A 1 365 ? 32.523  20.409  -4.795  1.00 35.23  ? 365  ILE A N   1 
ATOM   2765 C CA  . ILE A 1 365 ? 32.863  20.580  -3.376  1.00 35.82  ? 365  ILE A CA  1 
ATOM   2766 C C   . ILE A 1 365 ? 32.149  19.569  -2.475  1.00 36.78  ? 365  ILE A C   1 
ATOM   2767 O O   . ILE A 1 365 ? 32.731  19.061  -1.515  1.00 41.56  ? 365  ILE A O   1 
ATOM   2768 C CB  . ILE A 1 365 ? 32.613  22.043  -2.915  1.00 37.82  ? 365  ILE A CB  1 
ATOM   2769 C CG1 . ILE A 1 365 ? 33.514  22.977  -3.729  1.00 33.06  ? 365  ILE A CG1 1 
ATOM   2770 C CG2 . ILE A 1 365 ? 32.828  22.204  -1.382  1.00 30.63  ? 365  ILE A CG2 1 
ATOM   2771 C CD1 . ILE A 1 365 ? 33.209  24.444  -3.575  1.00 37.53  ? 365  ILE A CD1 1 
ATOM   2772 N N   . GLY A 1 366 ? 30.904  19.245  -2.810  1.00 39.12  ? 366  GLY A N   1 
ATOM   2773 C CA  . GLY A 1 366 ? 30.112  18.317  -2.011  1.00 32.51  ? 366  GLY A CA  1 
ATOM   2774 C C   . GLY A 1 366 ? 30.453  16.859  -2.244  1.00 36.97  ? 366  GLY A C   1 
ATOM   2775 O O   . GLY A 1 366 ? 30.173  16.023  -1.401  1.00 38.02  ? 366  GLY A O   1 
ATOM   2776 N N   . VAL A 1 367 ? 31.041  16.554  -3.398  1.00 35.59  ? 367  VAL A N   1 
ATOM   2777 C CA  . VAL A 1 367 ? 31.453  15.195  -3.714  1.00 33.35  ? 367  VAL A CA  1 
ATOM   2778 C C   . VAL A 1 367 ? 32.902  15.297  -4.141  1.00 34.17  ? 367  VAL A C   1 
ATOM   2779 O O   . VAL A 1 367 ? 33.216  15.131  -5.325  1.00 35.40  ? 367  VAL A O   1 
ATOM   2780 C CB  . VAL A 1 367 ? 30.643  14.591  -4.886  1.00 36.96  ? 367  VAL A CB  1 
ATOM   2781 C CG1 . VAL A 1 367 ? 30.911  13.094  -4.972  1.00 38.13  ? 367  VAL A CG1 1 
ATOM   2782 C CG2 . VAL A 1 367 ? 29.139  14.866  -4.719  1.00 35.63  ? 367  VAL A CG2 1 
ATOM   2783 N N   . PRO A 1 368 ? 33.789  15.609  -3.180  1.00 34.32  ? 368  PRO A N   1 
ATOM   2784 C CA  . PRO A 1 368 ? 35.144  16.010  -3.557  1.00 29.82  ? 368  PRO A CA  1 
ATOM   2785 C C   . PRO A 1 368 ? 35.966  14.841  -4.146  1.00 36.19  ? 368  PRO A C   1 
ATOM   2786 O O   . PRO A 1 368 ? 36.903  15.105  -4.885  1.00 40.42  ? 368  PRO A O   1 
ATOM   2787 C CB  . PRO A 1 368 ? 35.722  16.523  -2.232  1.00 27.94  ? 368  PRO A CB  1 
ATOM   2788 C CG  . PRO A 1 368 ? 34.969  15.749  -1.192  1.00 30.38  ? 368  PRO A CG  1 
ATOM   2789 C CD  . PRO A 1 368 ? 33.573  15.731  -1.718  1.00 30.05  ? 368  PRO A CD  1 
ATOM   2790 N N   . GLN A 1 369 ? 35.598  13.590  -3.864  1.00 38.80  ? 369  GLN A N   1 
ATOM   2791 C CA  . GLN A 1 369 ? 36.272  12.433  -4.488  1.00 41.93  ? 369  GLN A CA  1 
ATOM   2792 C C   . GLN A 1 369 ? 35.830  12.124  -5.904  1.00 43.61  ? 369  GLN A C   1 
ATOM   2793 O O   . GLN A 1 369 ? 36.319  11.159  -6.484  1.00 43.72  ? 369  GLN A O   1 
ATOM   2794 C CB  . GLN A 1 369 ? 36.087  11.121  -3.702  1.00 40.45  ? 369  GLN A CB  1 
ATOM   2795 C CG  . GLN A 1 369 ? 35.201  11.133  -2.475  1.00 59.62  ? 369  GLN A CG  1 
ATOM   2796 C CD  . GLN A 1 369 ? 33.730  11.462  -2.710  1.00 51.57  ? 369  GLN A CD  1 
ATOM   2797 O OE1 . GLN A 1 369 ? 32.884  10.581  -2.904  1.00 53.67  ? 369  GLN A OE1 1 
ATOM   2798 N NE2 . GLN A 1 369 ? 33.416  12.718  -2.590  1.00 38.33  ? 369  GLN A NE2 1 
ATOM   2799 N N   . ALA A 1 370 ? 34.890  12.885  -6.459  1.00 43.61  ? 370  ALA A N   1 
ATOM   2800 C CA  . ALA A 1 370 ? 34.310  12.486  -7.754  1.00 44.20  ? 370  ALA A CA  1 
ATOM   2801 C C   . ALA A 1 370 ? 35.217  12.781  -8.936  1.00 43.29  ? 370  ALA A C   1 
ATOM   2802 O O   . ALA A 1 370 ? 35.794  13.854  -9.024  1.00 52.45  ? 370  ALA A O   1 
ATOM   2803 C CB  . ALA A 1 370 ? 32.930  13.138  -7.977  1.00 36.91  ? 370  ALA A CB  1 
ATOM   2804 N N   . SER A 1 371 ? 35.321  11.830  -9.857  1.00 42.77  ? 371  SER A N   1 
ATOM   2805 C CA  . SER A 1 371 ? 35.843  12.122  -11.192 1.00 42.68  ? 371  SER A CA  1 
ATOM   2806 C C   . SER A 1 371 ? 34.863  13.045  -11.921 1.00 43.16  ? 371  SER A C   1 
ATOM   2807 O O   . SER A 1 371 ? 33.729  13.237  -11.480 1.00 42.83  ? 371  SER A O   1 
ATOM   2808 C CB  . SER A 1 371 ? 36.023  10.832  -11.996 1.00 41.84  ? 371  SER A CB  1 
ATOM   2809 O OG  . SER A 1 371 ? 34.795  10.136  -12.183 1.00 48.27  ? 371  SER A OG  1 
ATOM   2810 N N   . ASP A 1 372 ? 35.297  13.603  -13.039 1.00 42.76  ? 372  ASP A N   1 
ATOM   2811 C CA  . ASP A 1 372 ? 34.442  14.465  -13.845 1.00 45.30  ? 372  ASP A CA  1 
ATOM   2812 C C   . ASP A 1 372 ? 33.144  13.768  -14.272 1.00 48.34  ? 372  ASP A C   1 
ATOM   2813 O O   . ASP A 1 372 ? 32.075  14.368  -14.265 1.00 47.57  ? 372  ASP A O   1 
ATOM   2814 C CB  . ASP A 1 372 ? 35.193  14.946  -15.079 1.00 50.95  ? 372  ASP A CB  1 
ATOM   2815 C CG  . ASP A 1 372 ? 36.193  16.034  -14.767 1.00 59.18  ? 372  ASP A CG  1 
ATOM   2816 O OD1 . ASP A 1 372 ? 36.332  16.393  -13.586 1.00 59.48  ? 372  ASP A OD1 1 
ATOM   2817 O OD2 . ASP A 1 372 ? 36.847  16.534  -15.707 1.00 71.38  ? 372  ASP A OD2 1 
ATOM   2818 N N   . LEU A 1 373 ? 33.238  12.502  -14.649 1.00 51.62  ? 373  LEU A N   1 
ATOM   2819 C CA  . LEU A 1 373 ? 32.055  11.784  -15.097 1.00 52.41  ? 373  LEU A CA  1 
ATOM   2820 C C   . LEU A 1 373 ? 31.105  11.525  -13.929 1.00 48.53  ? 373  LEU A C   1 
ATOM   2821 O O   . LEU A 1 373 ? 29.881  11.643  -14.073 1.00 47.60  ? 373  LEU A O   1 
ATOM   2822 C CB  . LEU A 1 373 ? 32.433  10.470  -15.780 1.00 50.00  ? 373  LEU A CB  1 
ATOM   2823 C CG  . LEU A 1 373 ? 31.232  9.730   -16.379 1.00 57.17  ? 373  LEU A CG  1 
ATOM   2824 C CD1 . LEU A 1 373 ? 30.510  10.600  -17.391 1.00 55.79  ? 373  LEU A CD1 1 
ATOM   2825 C CD2 . LEU A 1 373 ? 31.655  8.422   -17.004 1.00 59.83  ? 373  LEU A CD2 1 
ATOM   2826 N N   . ALA A 1 374 ? 31.661  11.159  -12.776 1.00 44.61  ? 374  ALA A N   1 
ATOM   2827 C CA  . ALA A 1 374 ? 30.841  10.934  -11.592 1.00 39.37  ? 374  ALA A CA  1 
ATOM   2828 C C   . ALA A 1 374 ? 30.104  12.220  -11.229 1.00 41.54  ? 374  ALA A C   1 
ATOM   2829 O O   . ALA A 1 374 ? 28.911  12.192  -10.925 1.00 40.94  ? 374  ALA A O   1 
ATOM   2830 C CB  . ALA A 1 374 ? 31.676  10.424  -10.412 1.00 39.38  ? 374  ALA A CB  1 
ATOM   2831 N N   . ALA A 1 375 ? 30.808  13.350  -11.280 1.00 38.88  ? 375  ALA A N   1 
ATOM   2832 C CA  . ALA A 1 375 ? 30.187  14.623  -10.938 1.00 35.69  ? 375  ALA A CA  1 
ATOM   2833 C C   . ALA A 1 375 ? 29.042  14.896  -11.911 1.00 40.63  ? 375  ALA A C   1 
ATOM   2834 O O   . ALA A 1 375 ? 27.967  15.334  -11.507 1.00 41.64  ? 375  ALA A O   1 
ATOM   2835 C CB  . ALA A 1 375 ? 31.199  15.758  -10.988 1.00 34.68  ? 375  ALA A CB  1 
ATOM   2836 N N   . GLU A 1 376 ? 29.296  14.658  -13.195 1.00 40.23  ? 376  GLU A N   1 
ATOM   2837 C CA  . GLU A 1 376 ? 28.279  14.785  -14.230 1.00 45.33  ? 376  GLU A CA  1 
ATOM   2838 C C   . GLU A 1 376 ? 27.066  13.910  -13.947 1.00 41.32  ? 376  GLU A C   1 
ATOM   2839 O O   . GLU A 1 376 ? 25.937  14.371  -14.087 1.00 37.15  ? 376  GLU A O   1 
ATOM   2840 C CB  . GLU A 1 376 ? 28.850  14.470  -15.622 1.00 54.89  ? 376  GLU A CB  1 
ATOM   2841 C CG  . GLU A 1 376 ? 29.302  15.704  -16.367 1.00 79.19  ? 376  GLU A CG  1 
ATOM   2842 C CD  . GLU A 1 376 ? 28.158  16.684  -16.578 1.00 102.40 ? 376  GLU A CD  1 
ATOM   2843 O OE1 . GLU A 1 376 ? 28.283  17.868  -16.176 1.00 108.09 ? 376  GLU A OE1 1 
ATOM   2844 O OE2 . GLU A 1 376 ? 27.120  16.259  -17.132 1.00 108.96 ? 376  GLU A OE2 1 
ATOM   2845 N N   . ALA A 1 377 ? 27.286  12.662  -13.537 1.00 34.90  ? 377  ALA A N   1 
ATOM   2846 C CA  . ALA A 1 377 ? 26.155  11.801  -13.189 1.00 34.24  ? 377  ALA A CA  1 
ATOM   2847 C C   . ALA A 1 377 ? 25.324  12.425  -12.057 1.00 40.37  ? 377  ALA A C   1 
ATOM   2848 O O   . ALA A 1 377 ? 24.081  12.402  -12.106 1.00 37.05  ? 377  ALA A O   1 
ATOM   2849 C CB  . ALA A 1 377 ? 26.612  10.382  -12.819 1.00 30.40  ? 377  ALA A CB  1 
ATOM   2850 N N   . VAL A 1 378 ? 26.004  13.008  -11.062 1.00 35.82  ? 378  VAL A N   1 
ATOM   2851 C CA  . VAL A 1 378 ? 25.322  13.611  -9.917  1.00 31.75  ? 378  VAL A CA  1 
ATOM   2852 C C   . VAL A 1 378 ? 24.476  14.795  -10.388 1.00 36.27  ? 378  VAL A C   1 
ATOM   2853 O O   . VAL A 1 378 ? 23.284  14.897  -10.052 1.00 33.41  ? 378  VAL A O   1 
ATOM   2854 C CB  . VAL A 1 378 ? 26.303  14.105  -8.817  1.00 32.55  ? 378  VAL A CB  1 
ATOM   2855 C CG1 . VAL A 1 378 ? 25.551  14.866  -7.755  1.00 27.49  ? 378  VAL A CG1 1 
ATOM   2856 C CG2 . VAL A 1 378 ? 27.096  12.937  -8.180  1.00 32.36  ? 378  VAL A CG2 1 
ATOM   2857 N N   . VAL A 1 379 ? 25.087  15.684  -11.170 1.00 33.98  ? 379  VAL A N   1 
ATOM   2858 C CA  . VAL A 1 379 ? 24.368  16.837  -11.713 1.00 42.18  ? 379  VAL A CA  1 
ATOM   2859 C C   . VAL A 1 379 ? 23.143  16.441  -12.566 1.00 45.04  ? 379  VAL A C   1 
ATOM   2860 O O   . VAL A 1 379 ? 22.055  17.008  -12.447 1.00 42.23  ? 379  VAL A O   1 
ATOM   2861 C CB  . VAL A 1 379 ? 25.296  17.705  -12.570 1.00 43.86  ? 379  VAL A CB  1 
ATOM   2862 C CG1 . VAL A 1 379 ? 24.481  18.672  -13.415 1.00 38.55  ? 379  VAL A CG1 1 
ATOM   2863 C CG2 . VAL A 1 379 ? 26.268  18.448  -11.679 1.00 37.68  ? 379  VAL A CG2 1 
ATOM   2864 N N   . LEU A 1 380 ? 23.327  15.453  -13.421 1.00 44.09  ? 380  LEU A N   1 
ATOM   2865 C CA  . LEU A 1 380 ? 22.248  15.009  -14.270 1.00 48.88  ? 380  LEU A CA  1 
ATOM   2866 C C   . LEU A 1 380 ? 21.116  14.413  -13.455 1.00 42.48  ? 380  LEU A C   1 
ATOM   2867 O O   . LEU A 1 380 ? 19.957  14.645  -13.761 1.00 40.69  ? 380  LEU A O   1 
ATOM   2868 C CB  . LEU A 1 380 ? 22.742  14.019  -15.321 1.00 55.21  ? 380  LEU A CB  1 
ATOM   2869 C CG  . LEU A 1 380 ? 23.268  14.682  -16.593 1.00 65.05  ? 380  LEU A CG  1 
ATOM   2870 C CD1 . LEU A 1 380 ? 24.448  15.599  -16.293 1.00 61.93  ? 380  LEU A CD1 1 
ATOM   2871 C CD2 . LEU A 1 380 ? 23.676  13.615  -17.584 1.00 76.37  ? 380  LEU A CD2 1 
ATOM   2872 N N   . HIS A 1 381 ? 21.458  13.662  -12.416 1.00 38.98  ? 381  HIS A N   1 
ATOM   2873 C CA  . HIS A 1 381 ? 20.454  13.059  -11.556 1.00 39.11  ? 381  HIS A CA  1 
ATOM   2874 C C   . HIS A 1 381 ? 19.664  14.076  -10.746 1.00 40.73  ? 381  HIS A C   1 
ATOM   2875 O O   . HIS A 1 381 ? 18.458  13.918  -10.543 1.00 35.35  ? 381  HIS A O   1 
ATOM   2876 C CB  . HIS A 1 381 ? 21.100  12.061  -10.594 1.00 40.96  ? 381  HIS A CB  1 
ATOM   2877 C CG  . HIS A 1 381 ? 20.123  11.401  -9.683  1.00 41.45  ? 381  HIS A CG  1 
ATOM   2878 N ND1 . HIS A 1 381 ? 19.452  10.249  -10.029 1.00 49.56  ? 381  HIS A ND1 1 
ATOM   2879 C CD2 . HIS A 1 381 ? 19.681  11.740  -8.449  1.00 40.45  ? 381  HIS A CD2 1 
ATOM   2880 C CE1 . HIS A 1 381 ? 18.642  9.901   -9.043  1.00 46.40  ? 381  HIS A CE1 1 
ATOM   2881 N NE2 . HIS A 1 381 ? 18.765  10.785  -8.070  1.00 44.75  ? 381  HIS A NE2 1 
ATOM   2882 N N   . TYR A 1 382 ? 20.341  15.115  -10.263 1.00 37.39  ? 382  TYR A N   1 
ATOM   2883 C CA  . TYR A 1 382 ? 19.677  16.090  -9.391  1.00 34.06  ? 382  TYR A CA  1 
ATOM   2884 C C   . TYR A 1 382 ? 19.073  17.289  -10.125 1.00 32.39  ? 382  TYR A C   1 
ATOM   2885 O O   . TYR A 1 382 ? 18.306  18.037  -9.542  1.00 37.20  ? 382  TYR A O   1 
ATOM   2886 C CB  . TYR A 1 382 ? 20.622  16.557  -8.281  1.00 28.53  ? 382  TYR A CB  1 
ATOM   2887 C CG  . TYR A 1 382 ? 20.707  15.567  -7.150  1.00 36.86  ? 382  TYR A CG  1 
ATOM   2888 C CD1 . TYR A 1 382 ? 21.620  14.508  -7.190  1.00 34.36  ? 382  TYR A CD1 1 
ATOM   2889 C CD2 . TYR A 1 382 ? 19.859  15.672  -6.039  1.00 39.54  ? 382  TYR A CD2 1 
ATOM   2890 C CE1 . TYR A 1 382 ? 21.688  13.597  -6.163  1.00 32.96  ? 382  TYR A CE1 1 
ATOM   2891 C CE2 . TYR A 1 382 ? 19.923  14.761  -4.997  1.00 34.05  ? 382  TYR A CE2 1 
ATOM   2892 C CZ  . TYR A 1 382 ? 20.847  13.735  -5.062  1.00 36.01  ? 382  TYR A CZ  1 
ATOM   2893 O OH  . TYR A 1 382 ? 20.918  12.817  -4.049  1.00 38.86  ? 382  TYR A OH  1 
ATOM   2894 N N   . THR A 1 383 ? 19.422  17.471  -11.400 1.00 34.98  ? 383  THR A N   1 
ATOM   2895 C CA  . THR A 1 383 ? 18.875  18.576  -12.182 1.00 31.30  ? 383  THR A CA  1 
ATOM   2896 C C   . THR A 1 383 ? 17.394  18.311  -12.413 1.00 40.97  ? 383  THR A C   1 
ATOM   2897 O O   . THR A 1 383 ? 16.994  17.167  -12.647 1.00 41.31  ? 383  THR A O   1 
ATOM   2898 C CB  . THR A 1 383 ? 19.595  18.693  -13.528 1.00 33.62  ? 383  THR A CB  1 
ATOM   2899 O OG1 . THR A 1 383 ? 20.899  19.240  -13.302 1.00 40.71  ? 383  THR A OG1 1 
ATOM   2900 C CG2 . THR A 1 383 ? 18.807  19.582  -14.547 1.00 31.25  ? 383  THR A CG2 1 
ATOM   2901 N N   . ASP A 1 384 ? 16.578  19.354  -12.322 1.00 41.50  ? 384  ASP A N   1 
ATOM   2902 C CA  . ASP A 1 384 ? 15.197  19.250  -12.780 1.00 43.07  ? 384  ASP A CA  1 
ATOM   2903 C C   . ASP A 1 384 ? 15.144  19.618  -14.268 1.00 40.98  ? 384  ASP A C   1 
ATOM   2904 O O   . ASP A 1 384 ? 15.257  20.803  -14.622 1.00 39.07  ? 384  ASP A O   1 
ATOM   2905 C CB  . ASP A 1 384 ? 14.285  20.156  -11.960 1.00 46.60  ? 384  ASP A CB  1 
ATOM   2906 C CG  . ASP A 1 384 ? 12.845  20.142  -12.475 1.00 58.08  ? 384  ASP A CG  1 
ATOM   2907 O OD1 . ASP A 1 384 ? 12.579  19.480  -13.506 1.00 53.32  ? 384  ASP A OD1 1 
ATOM   2908 O OD2 . ASP A 1 384 ? 11.987  20.806  -11.857 1.00 61.02  ? 384  ASP A OD2 1 
ATOM   2909 N N   . TRP A 1 385 ? 14.994  18.616  -15.146 1.00 38.64  ? 385  TRP A N   1 
ATOM   2910 C CA  . TRP A 1 385 ? 15.130  18.867  -16.588 1.00 41.89  ? 385  TRP A CA  1 
ATOM   2911 C C   . TRP A 1 385 ? 14.001  19.680  -17.236 1.00 45.60  ? 385  TRP A C   1 
ATOM   2912 O O   . TRP A 1 385 ? 14.139  20.155  -18.370 1.00 53.64  ? 385  TRP A O   1 
ATOM   2913 C CB  . TRP A 1 385 ? 15.524  17.596  -17.367 1.00 46.92  ? 385  TRP A CB  1 
ATOM   2914 C CG  . TRP A 1 385 ? 16.898  17.144  -16.968 1.00 39.15  ? 385  TRP A CG  1 
ATOM   2915 C CD1 . TRP A 1 385 ? 17.221  16.142  -16.088 1.00 34.97  ? 385  TRP A CD1 1 
ATOM   2916 C CD2 . TRP A 1 385 ? 18.132  17.737  -17.369 1.00 36.95  ? 385  TRP A CD2 1 
ATOM   2917 N NE1 . TRP A 1 385 ? 18.585  16.061  -15.948 1.00 36.01  ? 385  TRP A NE1 1 
ATOM   2918 C CE2 . TRP A 1 385 ? 19.167  17.030  -16.721 1.00 34.08  ? 385  TRP A CE2 1 
ATOM   2919 C CE3 . TRP A 1 385 ? 18.466  18.788  -18.232 1.00 39.91  ? 385  TRP A CE3 1 
ATOM   2920 C CZ2 . TRP A 1 385 ? 20.515  17.349  -16.897 1.00 45.09  ? 385  TRP A CZ2 1 
ATOM   2921 C CZ3 . TRP A 1 385 ? 19.815  19.108  -18.404 1.00 40.96  ? 385  TRP A CZ3 1 
ATOM   2922 C CH2 . TRP A 1 385 ? 20.816  18.390  -17.743 1.00 43.81  ? 385  TRP A CH2 1 
ATOM   2923 N N   . LEU A 1 386 ? 12.919  19.886  -16.493 1.00 44.47  ? 386  LEU A N   1 
ATOM   2924 C CA  . LEU A 1 386 ? 11.896  20.867  -16.873 1.00 49.76  ? 386  LEU A CA  1 
ATOM   2925 C C   . LEU A 1 386 ? 12.252  22.306  -16.485 1.00 54.37  ? 386  LEU A C   1 
ATOM   2926 O O   . LEU A 1 386 ? 11.714  23.252  -17.049 1.00 58.59  ? 386  LEU A O   1 
ATOM   2927 C CB  . LEU A 1 386 ? 10.570  20.531  -16.203 1.00 51.71  ? 386  LEU A CB  1 
ATOM   2928 C CG  . LEU A 1 386 ? 9.499   19.871  -17.052 1.00 58.56  ? 386  LEU A CG  1 
ATOM   2929 C CD1 . LEU A 1 386 ? 8.256   19.793  -16.203 1.00 55.19  ? 386  LEU A CD1 1 
ATOM   2930 C CD2 . LEU A 1 386 ? 9.247   20.657  -18.365 1.00 51.11  ? 386  LEU A CD2 1 
ATOM   2931 N N   . HIS A 1 387 ? 13.123  22.467  -15.491 1.00 51.18  ? 387  HIS A N   1 
ATOM   2932 C CA  . HIS A 1 387 ? 13.536  23.789  -15.020 1.00 49.17  ? 387  HIS A CA  1 
ATOM   2933 C C   . HIS A 1 387 ? 15.007  23.732  -14.616 1.00 46.20  ? 387  HIS A C   1 
ATOM   2934 O O   . HIS A 1 387 ? 15.347  23.889  -13.442 1.00 42.22  ? 387  HIS A O   1 
ATOM   2935 C CB  . HIS A 1 387 ? 12.702  24.211  -13.810 1.00 50.54  ? 387  HIS A CB  1 
ATOM   2936 C CG  . HIS A 1 387 ? 11.231  24.281  -14.077 1.00 57.16  ? 387  HIS A CG  1 
ATOM   2937 N ND1 . HIS A 1 387 ? 10.328  23.402  -13.515 1.00 52.69  ? 387  HIS A ND1 1 
ATOM   2938 C CD2 . HIS A 1 387 ? 10.504  25.140  -14.827 1.00 61.01  ? 387  HIS A CD2 1 
ATOM   2939 C CE1 . HIS A 1 387 ? 9.108   23.716  -13.911 1.00 58.04  ? 387  HIS A CE1 1 
ATOM   2940 N NE2 . HIS A 1 387 ? 9.187   24.766  -14.708 1.00 62.05  ? 387  HIS A NE2 1 
ATOM   2941 N N   . PRO A 1 388 ? 15.880  23.494  -15.591 1.00 43.41  ? 388  PRO A N   1 
ATOM   2942 C CA  . PRO A 1 388 ? 17.294  23.204  -15.304 1.00 39.83  ? 388  PRO A CA  1 
ATOM   2943 C C   . PRO A 1 388 ? 18.046  24.398  -14.694 1.00 43.23  ? 388  PRO A C   1 
ATOM   2944 O O   . PRO A 1 388 ? 19.099  24.194  -14.076 1.00 45.78  ? 388  PRO A O   1 
ATOM   2945 C CB  . PRO A 1 388 ? 17.893  22.855  -16.683 1.00 39.62  ? 388  PRO A CB  1 
ATOM   2946 C CG  . PRO A 1 388 ? 16.772  23.060  -17.714 1.00 43.21  ? 388  PRO A CG  1 
ATOM   2947 C CD  . PRO A 1 388 ? 15.581  23.661  -17.031 1.00 43.37  ? 388  PRO A CD  1 
ATOM   2948 N N   . GLU A 1 389 ? 17.531  25.609  -14.894 1.00 37.92  ? 389  GLU A N   1 
ATOM   2949 C CA  . GLU A 1 389 ? 18.210  26.828  -14.454 1.00 43.67  ? 389  GLU A CA  1 
ATOM   2950 C C   . GLU A 1 389 ? 17.500  27.513  -13.290 1.00 43.96  ? 389  GLU A C   1 
ATOM   2951 O O   . GLU A 1 389 ? 17.912  28.587  -12.870 1.00 47.50  ? 389  GLU A O   1 
ATOM   2952 C CB  . GLU A 1 389 ? 18.317  27.861  -15.589 1.00 43.41  ? 389  GLU A CB  1 
ATOM   2953 C CG  . GLU A 1 389 ? 18.690  27.324  -16.947 1.00 63.02  ? 389  GLU A CG  1 
ATOM   2954 C CD  . GLU A 1 389 ? 20.191  27.292  -17.179 1.00 78.79  ? 389  GLU A CD  1 
ATOM   2955 O OE1 . GLU A 1 389 ? 20.940  27.850  -16.349 1.00 82.03  ? 389  GLU A OE1 1 
ATOM   2956 O OE2 . GLU A 1 389 ? 20.618  26.714  -18.203 1.00 84.92  ? 389  GLU A OE2 1 
ATOM   2957 N N   . ASP A 1 390 ? 16.416  26.928  -12.794 1.00 38.95  ? 390  ASP A N   1 
ATOM   2958 C CA  . ASP A 1 390 ? 15.688  27.537  -11.677 1.00 40.10  ? 390  ASP A CA  1 
ATOM   2959 C C   . ASP A 1 390 ? 16.480  27.583  -10.351 1.00 35.83  ? 390  ASP A C   1 
ATOM   2960 O O   . ASP A 1 390 ? 16.793  26.557  -9.774  1.00 30.43  ? 390  ASP A O   1 
ATOM   2961 C CB  . ASP A 1 390 ? 14.372  26.819  -11.428 1.00 39.10  ? 390  ASP A CB  1 
ATOM   2962 C CG  . ASP A 1 390 ? 13.568  27.492  -10.364 1.00 44.35  ? 390  ASP A CG  1 
ATOM   2963 O OD1 . ASP A 1 390 ? 13.003  28.566  -10.640 1.00 52.28  ? 390  ASP A OD1 1 
ATOM   2964 O OD2 . ASP A 1 390 ? 13.517  26.970  -9.242  1.00 51.99  ? 390  ASP A OD2 1 
ATOM   2965 N N   . PRO A 1 391 ? 16.763  28.795  -9.848  1.00 39.89  ? 391  PRO A N   1 
ATOM   2966 C CA  . PRO A 1 391 ? 17.638  28.976  -8.681  1.00 38.67  ? 391  PRO A CA  1 
ATOM   2967 C C   . PRO A 1 391 ? 17.117  28.332  -7.391  1.00 39.64  ? 391  PRO A C   1 
ATOM   2968 O O   . PRO A 1 391 ? 17.932  27.898  -6.578  1.00 38.65  ? 391  PRO A O   1 
ATOM   2969 C CB  . PRO A 1 391 ? 17.717  30.503  -8.514  1.00 38.81  ? 391  PRO A CB  1 
ATOM   2970 C CG  . PRO A 1 391 ? 17.249  31.067  -9.801  1.00 45.95  ? 391  PRO A CG  1 
ATOM   2971 C CD  . PRO A 1 391 ? 16.315  30.075  -10.422 1.00 42.74  ? 391  PRO A CD  1 
ATOM   2972 N N   . THR A 1 392 ? 15.802  28.290  -7.190  1.00 37.30  ? 392  THR A N   1 
ATOM   2973 C CA  . THR A 1 392 ? 15.256  27.679  -5.982  1.00 39.45  ? 392  THR A CA  1 
ATOM   2974 C C   . THR A 1 392 ? 15.469  26.173  -6.041  1.00 33.83  ? 392  THR A C   1 
ATOM   2975 O O   . THR A 1 392 ? 15.875  25.580  -5.054  1.00 37.11  ? 392  THR A O   1 
ATOM   2976 C CB  . THR A 1 392 ? 13.733  27.973  -5.770  1.00 45.05  ? 392  THR A CB  1 
ATOM   2977 O OG1 . THR A 1 392 ? 13.519  29.382  -5.660  1.00 45.45  ? 392  THR A OG1 1 
ATOM   2978 C CG2 . THR A 1 392 ? 13.247  27.317  -4.494  1.00 37.42  ? 392  THR A CG2 1 
ATOM   2979 N N   . HIS A 1 393 ? 15.184  25.552  -7.190  1.00 36.10  ? 393  HIS A N   1 
ATOM   2980 C CA  . HIS A 1 393 ? 15.427  24.117  -7.314  1.00 38.95  ? 393  HIS A CA  1 
ATOM   2981 C C   . HIS A 1 393 ? 16.919  23.749  -7.190  1.00 37.59  ? 393  HIS A C   1 
ATOM   2982 O O   . HIS A 1 393 ? 17.260  22.726  -6.620  1.00 38.34  ? 393  HIS A O   1 
ATOM   2983 C CB  . HIS A 1 393 ? 14.911  23.502  -8.624  1.00 38.46  ? 393  HIS A CB  1 
ATOM   2984 C CG  . HIS A 1 393 ? 15.361  22.080  -8.784  1.00 51.76  ? 393  HIS A CG  1 
ATOM   2985 N ND1 . HIS A 1 393 ? 14.722  21.025  -8.162  1.00 56.76  ? 393  HIS A ND1 1 
ATOM   2986 C CD2 . HIS A 1 393 ? 16.464  21.553  -9.378  1.00 48.20  ? 393  HIS A CD2 1 
ATOM   2987 C CE1 . HIS A 1 393 ? 15.374  19.903  -8.422  1.00 56.76  ? 393  HIS A CE1 1 
ATOM   2988 N NE2 . HIS A 1 393 ? 16.437  20.198  -9.154  1.00 53.66  ? 393  HIS A NE2 1 
ATOM   2989 N N   . LEU A 1 394 ? 17.789  24.565  -7.776  1.00 39.43  ? 394  LEU A N   1 
ATOM   2990 C CA  . LEU A 1 394 ? 19.233  24.324  -7.717  1.00 40.47  ? 394  LEU A CA  1 
ATOM   2991 C C   . LEU A 1 394 ? 19.713  24.403  -6.274  1.00 41.20  ? 394  LEU A C   1 
ATOM   2992 O O   . LEU A 1 394 ? 20.476  23.556  -5.818  1.00 38.17  ? 394  LEU A O   1 
ATOM   2993 C CB  . LEU A 1 394 ? 19.986  25.314  -8.612  1.00 28.77  ? 394  LEU A CB  1 
ATOM   2994 C CG  . LEU A 1 394 ? 19.699  25.065  -10.098 1.00 36.72  ? 394  LEU A CG  1 
ATOM   2995 C CD1 . LEU A 1 394 ? 20.202  26.227  -10.963 1.00 35.46  ? 394  LEU A CD1 1 
ATOM   2996 C CD2 . LEU A 1 394 ? 20.286  23.718  -10.578 1.00 30.25  ? 394  LEU A CD2 1 
ATOM   2997 N N   . ARG A 1 395 ? 19.228  25.405  -5.547  1.00 36.39  ? 395  ARG A N   1 
ATOM   2998 C CA  . ARG A 1 395 ? 19.574  25.534  -4.150  1.00 31.80  ? 395  ARG A CA  1 
ATOM   2999 C C   . ARG A 1 395 ? 19.171  24.290  -3.344  1.00 36.42  ? 395  ARG A C   1 
ATOM   3000 O O   . ARG A 1 395 ? 19.999  23.704  -2.655  1.00 37.77  ? 395  ARG A O   1 
ATOM   3001 C CB  . ARG A 1 395 ? 18.951  26.791  -3.560  1.00 34.65  ? 395  ARG A CB  1 
ATOM   3002 C CG  . ARG A 1 395 ? 19.111  26.901  -2.041  1.00 37.53  ? 395  ARG A CG  1 
ATOM   3003 C CD  . ARG A 1 395 ? 17.741  26.757  -1.396  1.00 43.21  ? 395  ARG A CD  1 
ATOM   3004 N NE  . ARG A 1 395 ? 17.154  28.056  -1.260  1.00 42.59  ? 395  ARG A NE  1 
ATOM   3005 C CZ  . ARG A 1 395 ? 15.857  28.312  -1.109  1.00 40.12  ? 395  ARG A CZ  1 
ATOM   3006 N NH1 . ARG A 1 395 ? 14.950  27.346  -1.086  1.00 32.67  ? 395  ARG A NH1 1 
ATOM   3007 N NH2 . ARG A 1 395 ? 15.479  29.571  -1.004  1.00 40.56  ? 395  ARG A NH2 1 
ATOM   3008 N N   . ASP A 1 396 ? 17.908  23.883  -3.447  1.00 32.04  ? 396  ASP A N   1 
ATOM   3009 C CA  . ASP A 1 396 ? 17.418  22.708  -2.726  1.00 33.60  ? 396  ASP A CA  1 
ATOM   3010 C C   . ASP A 1 396 ? 18.059  21.422  -3.231  1.00 34.54  ? 396  ASP A C   1 
ATOM   3011 O O   . ASP A 1 396 ? 18.169  20.456  -2.487  1.00 35.92  ? 396  ASP A O   1 
ATOM   3012 C CB  . ASP A 1 396 ? 15.887  22.596  -2.815  1.00 36.31  ? 396  ASP A CB  1 
ATOM   3013 C CG  . ASP A 1 396 ? 15.172  23.799  -2.191  1.00 44.28  ? 396  ASP A CG  1 
ATOM   3014 O OD1 . ASP A 1 396 ? 15.784  24.508  -1.361  1.00 45.43  ? 396  ASP A OD1 1 
ATOM   3015 O OD2 . ASP A 1 396 ? 13.998  24.035  -2.532  1.00 53.50  ? 396  ASP A OD2 1 
ATOM   3016 N N   . ALA A 1 397 ? 18.477  21.400  -4.496  1.00 30.14  ? 397  ALA A N   1 
ATOM   3017 C CA  . ALA A 1 397 ? 19.097  20.196  -5.025  1.00 34.17  ? 397  ALA A CA  1 
ATOM   3018 C C   . ALA A 1 397 ? 20.516  20.053  -4.458  1.00 37.14  ? 397  ALA A C   1 
ATOM   3019 O O   . ALA A 1 397 ? 20.974  18.943  -4.159  1.00 34.30  ? 397  ALA A O   1 
ATOM   3020 C CB  . ALA A 1 397 ? 19.108  20.203  -6.572  1.00 29.17  ? 397  ALA A CB  1 
ATOM   3021 N N   . MET A 1 398 ? 21.202  21.182  -4.307  1.00 32.19  ? 398  MET A N   1 
ATOM   3022 C CA  . MET A 1 398 ? 22.542  21.190  -3.721  1.00 30.23  ? 398  MET A CA  1 
ATOM   3023 C C   . MET A 1 398 ? 22.488  20.655  -2.285  1.00 34.80  ? 398  MET A C   1 
ATOM   3024 O O   . MET A 1 398 ? 23.322  19.845  -1.868  1.00 31.83  ? 398  MET A O   1 
ATOM   3025 C CB  . MET A 1 398 ? 23.107  22.612  -3.736  1.00 29.23  ? 398  MET A CB  1 
ATOM   3026 C CG  . MET A 1 398 ? 24.594  22.709  -3.347  1.00 30.93  ? 398  MET A CG  1 
ATOM   3027 S SD  . MET A 1 398 ? 25.714  21.914  -4.539  1.00 39.01  ? 398  MET A SD  1 
ATOM   3028 C CE  . MET A 1 398 ? 26.211  20.444  -3.641  1.00 32.62  ? 398  MET A CE  1 
ATOM   3029 N N   . SER A 1 399 ? 21.490  21.110  -1.532  1.00 29.89  ? 399  SER A N   1 
ATOM   3030 C CA  . SER A 1 399 ? 21.274  20.615  -0.177  1.00 33.23  ? 399  SER A CA  1 
ATOM   3031 C C   . SER A 1 399 ? 21.077  19.086  -0.155  1.00 35.82  ? 399  SER A C   1 
ATOM   3032 O O   . SER A 1 399 ? 21.719  18.360  0.620   1.00 32.25  ? 399  SER A O   1 
ATOM   3033 C CB  . SER A 1 399 ? 20.058  21.317  0.463   1.00 30.82  ? 399  SER A CB  1 
ATOM   3034 O OG  . SER A 1 399 ? 19.781  20.712  1.711   1.00 34.05  ? 399  SER A OG  1 
ATOM   3035 N N   . ALA A 1 400 ? 20.195  18.607  -1.022  1.00 34.48  ? 400  ALA A N   1 
ATOM   3036 C CA  . ALA A 1 400 ? 19.900  17.184  -1.119  1.00 35.72  ? 400  ALA A CA  1 
ATOM   3037 C C   . ALA A 1 400 ? 21.123  16.334  -1.532  1.00 32.18  ? 400  ALA A C   1 
ATOM   3038 O O   . ALA A 1 400 ? 21.331  15.240  -0.999  1.00 32.56  ? 400  ALA A O   1 
ATOM   3039 C CB  . ALA A 1 400 ? 18.725  16.956  -2.073  1.00 33.57  ? 400  ALA A CB  1 
ATOM   3040 N N   . VAL A 1 401 ? 21.916  16.828  -2.483  1.00 28.41  ? 401  VAL A N   1 
ATOM   3041 C CA  . VAL A 1 401 ? 23.164  16.146  -2.854  1.00 32.60  ? 401  VAL A CA  1 
ATOM   3042 C C   . VAL A 1 401 ? 24.008  15.853  -1.597  1.00 32.16  ? 401  VAL A C   1 
ATOM   3043 O O   . VAL A 1 401 ? 24.434  14.712  -1.351  1.00 33.02  ? 401  VAL A O   1 
ATOM   3044 C CB  . VAL A 1 401 ? 24.030  16.979  -3.849  1.00 33.67  ? 401  VAL A CB  1 
ATOM   3045 C CG1 . VAL A 1 401 ? 25.483  16.407  -3.919  1.00 27.77  ? 401  VAL A CG1 1 
ATOM   3046 C CG2 . VAL A 1 401 ? 23.371  17.069  -5.250  1.00 27.08  ? 401  VAL A CG2 1 
ATOM   3047 N N   . VAL A 1 402 ? 24.244  16.900  -0.812  1.00 30.31  ? 402  VAL A N   1 
ATOM   3048 C CA  . VAL A 1 402 ? 25.062  16.819  0.377   1.00 29.67  ? 402  VAL A CA  1 
ATOM   3049 C C   . VAL A 1 402 ? 24.432  15.937  1.459   1.00 34.25  ? 402  VAL A C   1 
ATOM   3050 O O   . VAL A 1 402 ? 25.104  15.082  2.035   1.00 32.26  ? 402  VAL A O   1 
ATOM   3051 C CB  . VAL A 1 402 ? 25.383  18.219  0.943   1.00 36.76  ? 402  VAL A CB  1 
ATOM   3052 C CG1 . VAL A 1 402 ? 26.032  18.083  2.342   1.00 32.57  ? 402  VAL A CG1 1 
ATOM   3053 C CG2 . VAL A 1 402 ? 26.320  18.963  -0.025  1.00 35.11  ? 402  VAL A CG2 1 
ATOM   3054 N N   . GLY A 1 403 ? 23.141  16.134  1.727   1.00 28.95  ? 403  GLY A N   1 
ATOM   3055 C CA  . GLY A 1 403 ? 22.455  15.321  2.718   1.00 27.80  ? 403  GLY A CA  1 
ATOM   3056 C C   . GLY A 1 403 ? 22.332  13.851  2.303   1.00 34.31  ? 403  GLY A C   1 
ATOM   3057 O O   . GLY A 1 403 ? 22.491  12.944  3.122   1.00 34.99  ? 403  GLY A O   1 
ATOM   3058 N N   . ASP A 1 404 ? 22.052  13.595  1.029   1.00 32.56  ? 404  ASP A N   1 
ATOM   3059 C CA  . ASP A 1 404 ? 21.905  12.213  0.575   1.00 28.34  ? 404  ASP A CA  1 
ATOM   3060 C C   . ASP A 1 404 ? 23.251  11.486  0.566   1.00 32.40  ? 404  ASP A C   1 
ATOM   3061 O O   . ASP A 1 404 ? 23.358  10.349  1.006   1.00 35.55  ? 404  ASP A O   1 
ATOM   3062 C CB  . ASP A 1 404 ? 21.319  12.184  -0.844  1.00 32.01  ? 404  ASP A CB  1 
ATOM   3063 C CG  . ASP A 1 404 ? 19.874  12.685  -0.889  1.00 37.73  ? 404  ASP A CG  1 
ATOM   3064 O OD1 . ASP A 1 404 ? 19.246  12.862  0.189   1.00 35.72  ? 404  ASP A OD1 1 
ATOM   3065 O OD2 . ASP A 1 404 ? 19.374  12.906  -2.006  1.00 33.12  ? 404  ASP A OD2 1 
ATOM   3066 N N   . HIS A 1 405 ? 24.271  12.141  0.021   1.00 30.12  ? 405  HIS A N   1 
ATOM   3067 C CA  . HIS A 1 405 ? 25.559  11.502  -0.168  1.00 30.31  ? 405  HIS A CA  1 
ATOM   3068 C C   . HIS A 1 405 ? 26.149  11.166  1.209   1.00 36.58  ? 405  HIS A C   1 
ATOM   3069 O O   . HIS A 1 405 ? 26.635  10.072  1.420   1.00 31.09  ? 405  HIS A O   1 
ATOM   3070 C CB  . HIS A 1 405 ? 26.491  12.440  -0.952  1.00 27.77  ? 405  HIS A CB  1 
ATOM   3071 C CG  . HIS A 1 405 ? 27.905  11.953  -1.072  1.00 33.02  ? 405  HIS A CG  1 
ATOM   3072 N ND1 . HIS A 1 405 ? 28.225  10.632  -1.300  1.00 33.18  ? 405  HIS A ND1 1 
ATOM   3073 C CD2 . HIS A 1 405 ? 29.082  12.625  -1.029  1.00 34.85  ? 405  HIS A CD2 1 
ATOM   3074 C CE1 . HIS A 1 405 ? 29.539  10.515  -1.416  1.00 30.61  ? 405  HIS A CE1 1 
ATOM   3075 N NE2 . HIS A 1 405 ? 30.081  11.709  -1.251  1.00 32.58  ? 405  HIS A NE2 1 
ATOM   3076 N N   . ASN A 1 406 ? 26.077  12.112  2.140   1.00 32.65  ? 406  ASN A N   1 
ATOM   3077 C CA  . ASN A 1 406 ? 26.722  11.969  3.453   1.00 31.92  ? 406  ASN A CA  1 
ATOM   3078 C C   . ASN A 1 406 ? 25.928  11.279  4.555   1.00 32.78  ? 406  ASN A C   1 
ATOM   3079 O O   . ASN A 1 406 ? 26.509  10.699  5.463   1.00 31.36  ? 406  ASN A O   1 
ATOM   3080 C CB  . ASN A 1 406 ? 27.177  13.344  3.951   1.00 24.41  ? 406  ASN A CB  1 
ATOM   3081 C CG  . ASN A 1 406 ? 28.289  13.890  3.100   1.00 35.44  ? 406  ASN A CG  1 
ATOM   3082 O OD1 . ASN A 1 406 ? 29.375  13.297  3.027   1.00 32.67  ? 406  ASN A OD1 1 
ATOM   3083 N ND2 . ASN A 1 406 ? 28.017  14.979  2.402   1.00 28.17  ? 406  ASN A ND2 1 
ATOM   3084 N N   . VAL A 1 407 ? 24.606  11.352  4.494   1.00 30.92  ? 407  VAL A N   1 
ATOM   3085 C CA  . VAL A 1 407 ? 23.813  10.872  5.616   1.00 31.96  ? 407  VAL A CA  1 
ATOM   3086 C C   . VAL A 1 407 ? 22.664  9.943   5.208   1.00 34.56  ? 407  VAL A C   1 
ATOM   3087 O O   . VAL A 1 407 ? 22.617  8.804   5.654   1.00 31.72  ? 407  VAL A O   1 
ATOM   3088 C CB  . VAL A 1 407 ? 23.276  12.043  6.466   1.00 32.12  ? 407  VAL A CB  1 
ATOM   3089 C CG1 . VAL A 1 407 ? 22.377  11.538  7.604   1.00 27.31  ? 407  VAL A CG1 1 
ATOM   3090 C CG2 . VAL A 1 407 ? 24.446  12.863  7.038   1.00 28.44  ? 407  VAL A CG2 1 
ATOM   3091 N N   . VAL A 1 408 ? 21.745  10.421  4.368   1.00 31.56  ? 408  VAL A N   1 
ATOM   3092 C CA  . VAL A 1 408 ? 20.546  9.643   4.102   1.00 32.43  ? 408  VAL A CA  1 
ATOM   3093 C C   . VAL A 1 408 ? 20.837  8.314   3.428   1.00 38.27  ? 408  VAL A C   1 
ATOM   3094 O O   . VAL A 1 408 ? 20.304  7.290   3.840   1.00 34.48  ? 408  VAL A O   1 
ATOM   3095 C CB  . VAL A 1 408 ? 19.497  10.384  3.260   1.00 34.56  ? 408  VAL A CB  1 
ATOM   3096 C CG1 . VAL A 1 408 ? 18.238  9.490   3.135   1.00 25.84  ? 408  VAL A CG1 1 
ATOM   3097 C CG2 . VAL A 1 408 ? 19.168  11.728  3.881   1.00 25.57  ? 408  VAL A CG2 1 
ATOM   3098 N N   . CYS A 1 409 ? 21.686  8.318   2.404   1.00 33.49  ? 409  CYS A N   1 
ATOM   3099 C CA  . CYS A 1 409 ? 21.984  7.062   1.742   1.00 36.50  ? 409  CYS A CA  1 
ATOM   3100 C C   . CYS A 1 409 ? 22.896  6.113   2.554   1.00 36.86  ? 409  CYS A C   1 
ATOM   3101 O O   . CYS A 1 409 ? 22.654  4.917   2.579   1.00 37.28  ? 409  CYS A O   1 
ATOM   3102 C CB  . CYS A 1 409 ? 22.440  7.296   0.297   1.00 35.90  ? 409  CYS A CB  1 
ATOM   3103 S SG  . CYS A 1 409 ? 21.111  8.155   -0.669  1.00 37.53  ? 409  CYS A SG  1 
ATOM   3104 N N   . PRO A 1 410 ? 23.929  6.643   3.239   1.00 36.39  ? 410  PRO A N   1 
ATOM   3105 C CA  . PRO A 1 410 ? 24.645  5.738   4.157   1.00 32.03  ? 410  PRO A CA  1 
ATOM   3106 C C   . PRO A 1 410 ? 23.729  5.109   5.225   1.00 33.83  ? 410  PRO A C   1 
ATOM   3107 O O   . PRO A 1 410 ? 23.883  3.937   5.559   1.00 31.39  ? 410  PRO A O   1 
ATOM   3108 C CB  . PRO A 1 410 ? 25.700  6.652   4.801   1.00 26.35  ? 410  PRO A CB  1 
ATOM   3109 C CG  . PRO A 1 410 ? 26.003  7.675   3.658   1.00 32.89  ? 410  PRO A CG  1 
ATOM   3110 C CD  . PRO A 1 410 ? 24.633  7.934   3.049   1.00 34.16  ? 410  PRO A CD  1 
ATOM   3111 N N   . VAL A 1 411 ? 22.777  5.875   5.748   1.00 33.06  ? 411  VAL A N   1 
ATOM   3112 C CA  . VAL A 1 411 ? 21.823  5.318   6.707   1.00 33.42  ? 411  VAL A CA  1 
ATOM   3113 C C   . VAL A 1 411 ? 20.983  4.226   6.021   1.00 39.64  ? 411  VAL A C   1 
ATOM   3114 O O   . VAL A 1 411 ? 20.811  3.122   6.559   1.00 37.98  ? 411  VAL A O   1 
ATOM   3115 C CB  . VAL A 1 411 ? 20.899  6.416   7.301   1.00 34.38  ? 411  VAL A CB  1 
ATOM   3116 C CG1 . VAL A 1 411 ? 19.690  5.787   8.008   1.00 33.15  ? 411  VAL A CG1 1 
ATOM   3117 C CG2 . VAL A 1 411 ? 21.680  7.336   8.225   1.00 30.57  ? 411  VAL A CG2 1 
ATOM   3118 N N   . ALA A 1 412 ? 20.471  4.522   4.825   1.00 37.10  ? 412  ALA A N   1 
ATOM   3119 C CA  . ALA A 1 412 ? 19.687  3.531   4.093   1.00 40.48  ? 412  ALA A CA  1 
ATOM   3120 C C   . ALA A 1 412 ? 20.495  2.244   3.889   1.00 37.56  ? 412  ALA A C   1 
ATOM   3121 O O   . ALA A 1 412 ? 19.995  1.137   4.101   1.00 40.17  ? 412  ALA A O   1 
ATOM   3122 C CB  . ALA A 1 412 ? 19.214  4.089   2.747   1.00 38.94  ? 412  ALA A CB  1 
ATOM   3123 N N   . GLN A 1 413 ? 21.742  2.394   3.467   1.00 33.74  ? 413  GLN A N   1 
ATOM   3124 C CA  . GLN A 1 413 ? 22.606  1.234   3.272   1.00 41.88  ? 413  GLN A CA  1 
ATOM   3125 C C   . GLN A 1 413 ? 22.782  0.439   4.583   1.00 44.95  ? 413  GLN A C   1 
ATOM   3126 O O   . GLN A 1 413 ? 22.674  -0.780  4.587   1.00 39.87  ? 413  GLN A O   1 
ATOM   3127 C CB  . GLN A 1 413 ? 23.977  1.678   2.767   1.00 36.73  ? 413  GLN A CB  1 
ATOM   3128 C CG  . GLN A 1 413 ? 24.920  0.528   2.480   1.00 44.55  ? 413  GLN A CG  1 
ATOM   3129 C CD  . GLN A 1 413 ? 26.157  1.007   1.788   1.00 60.80  ? 413  GLN A CD  1 
ATOM   3130 O OE1 . GLN A 1 413 ? 26.299  0.854   0.574   1.00 67.51  ? 413  GLN A OE1 1 
ATOM   3131 N NE2 . GLN A 1 413 ? 27.045  1.648   2.542   1.00 60.47  ? 413  GLN A NE2 1 
ATOM   3132 N N   . LEU A 1 414 ? 23.074  1.141   5.683   1.00 38.61  ? 414  LEU A N   1 
ATOM   3133 C CA  . LEU A 1 414 ? 23.226  0.501   6.984   1.00 34.26  ? 414  LEU A CA  1 
ATOM   3134 C C   . LEU A 1 414 ? 21.956  -0.241  7.434   1.00 40.74  ? 414  LEU A C   1 
ATOM   3135 O O   . LEU A 1 414 ? 22.020  -1.408  7.822   1.00 40.96  ? 414  LEU A O   1 
ATOM   3136 C CB  . LEU A 1 414 ? 23.666  1.504   8.059   1.00 37.05  ? 414  LEU A CB  1 
ATOM   3137 C CG  . LEU A 1 414 ? 23.806  0.948   9.480   1.00 36.54  ? 414  LEU A CG  1 
ATOM   3138 C CD1 . LEU A 1 414 ? 24.971  -0.077  9.561   1.00 34.71  ? 414  LEU A CD1 1 
ATOM   3139 C CD2 . LEU A 1 414 ? 24.017  2.080   10.459  1.00 37.90  ? 414  LEU A CD2 1 
ATOM   3140 N N   . ALA A 1 415 ? 20.808  0.423   7.383   1.00 37.89  ? 415  ALA A N   1 
ATOM   3141 C CA  . ALA A 1 415 ? 19.566  -0.211  7.821   1.00 39.22  ? 415  ALA A CA  1 
ATOM   3142 C C   . ALA A 1 415 ? 19.300  -1.501  7.055   1.00 43.67  ? 415  ALA A C   1 
ATOM   3143 O O   . ALA A 1 415 ? 18.900  -2.519  7.632   1.00 45.82  ? 415  ALA A O   1 
ATOM   3144 C CB  . ALA A 1 415 ? 18.391  0.746   7.672   1.00 37.99  ? 415  ALA A CB  1 
ATOM   3145 N N   . GLY A 1 416 ? 19.523  -1.448  5.748   1.00 42.31  ? 416  GLY A N   1 
ATOM   3146 C CA  . GLY A 1 416 ? 19.286  -2.594  4.891   1.00 49.16  ? 416  GLY A CA  1 
ATOM   3147 C C   . GLY A 1 416 ? 20.217  -3.762  5.179   1.00 47.37  ? 416  GLY A C   1 
ATOM   3148 O O   . GLY A 1 416 ? 19.766  -4.897  5.294   1.00 48.47  ? 416  GLY A O   1 
ATOM   3149 N N   . ARG A 1 417 ? 21.511  -3.486  5.300   1.00 41.94  ? 417  ARG A N   1 
ATOM   3150 C CA  . ARG A 1 417 ? 22.478  -4.525  5.662   1.00 44.30  ? 417  ARG A CA  1 
ATOM   3151 C C   . ARG A 1 417 ? 22.203  -5.119  7.055   1.00 42.04  ? 417  ARG A C   1 
ATOM   3152 O O   . ARG A 1 417 ? 22.220  -6.323  7.233   1.00 49.33  ? 417  ARG A O   1 
ATOM   3153 C CB  . ARG A 1 417 ? 23.927  -4.010  5.583   1.00 40.11  ? 417  ARG A CB  1 
ATOM   3154 C CG  . ARG A 1 417 ? 24.390  -3.538  4.192   1.00 46.08  ? 417  ARG A CG  1 
ATOM   3155 C CD  . ARG A 1 417 ? 23.800  -4.380  3.067   1.00 59.84  ? 417  ARG A CD  1 
ATOM   3156 N NE  . ARG A 1 417 ? 24.111  -5.797  3.232   1.00 79.84  ? 417  ARG A NE  1 
ATOM   3157 C CZ  . ARG A 1 417 ? 24.745  -6.546  2.334   1.00 92.77  ? 417  ARG A CZ  1 
ATOM   3158 N NH1 . ARG A 1 417 ? 25.133  -6.022  1.176   1.00 96.04  ? 417  ARG A NH1 1 
ATOM   3159 N NH2 . ARG A 1 417 ? 24.982  -7.827  2.593   1.00 94.15  ? 417  ARG A NH2 1 
ATOM   3160 N N   . LEU A 1 418 ? 21.942  -4.274  8.041   1.00 34.24  ? 418  LEU A N   1 
ATOM   3161 C CA  . LEU A 1 418 ? 21.703  -4.765  9.384   1.00 44.32  ? 418  LEU A CA  1 
ATOM   3162 C C   . LEU A 1 418 ? 20.478  -5.698  9.398   1.00 48.73  ? 418  LEU A C   1 
ATOM   3163 O O   . LEU A 1 418 ? 20.509  -6.766  9.999   1.00 50.14  ? 418  LEU A O   1 
ATOM   3164 C CB  . LEU A 1 418 ? 21.490  -3.601  10.350  1.00 43.13  ? 418  LEU A CB  1 
ATOM   3165 C CG  . LEU A 1 418 ? 22.672  -3.120  11.190  1.00 49.20  ? 418  LEU A CG  1 
ATOM   3166 C CD1 . LEU A 1 418 ? 23.996  -3.385  10.514  1.00 53.53  ? 418  LEU A CD1 1 
ATOM   3167 C CD2 . LEU A 1 418 ? 22.499  -1.654  11.500  1.00 39.52  ? 418  LEU A CD2 1 
ATOM   3168 N N   . ALA A 1 419 ? 19.405  -5.270  8.745   1.00 43.85  ? 419  ALA A N   1 
ATOM   3169 C CA  . ALA A 1 419 ? 18.186  -6.052  8.692   1.00 49.22  ? 419  ALA A CA  1 
ATOM   3170 C C   . ALA A 1 419 ? 18.429  -7.379  7.966   1.00 53.60  ? 419  ALA A C   1 
ATOM   3171 O O   . ALA A 1 419 ? 18.045  -8.433  8.460   1.00 54.15  ? 419  ALA A O   1 
ATOM   3172 C CB  . ALA A 1 419 ? 17.071  -5.258  8.008   1.00 48.00  ? 419  ALA A CB  1 
ATOM   3173 N N   . ALA A 1 420 ? 19.083  -7.322  6.804   1.00 53.75  ? 420  ALA A N   1 
ATOM   3174 C CA  . ALA A 1 420 ? 19.328  -8.528  6.009   1.00 56.36  ? 420  ALA A CA  1 
ATOM   3175 C C   . ALA A 1 420 ? 20.120  -9.544  6.810   1.00 61.01  ? 420  ALA A C   1 
ATOM   3176 O O   . ALA A 1 420 ? 20.016  -10.751 6.590   1.00 63.02  ? 420  ALA A O   1 
ATOM   3177 C CB  . ALA A 1 420 ? 20.053  -8.195  4.705   1.00 51.16  ? 420  ALA A CB  1 
ATOM   3178 N N   . GLN A 1 421 ? 20.898  -9.049  7.760   1.00 55.16  ? 421  GLN A N   1 
ATOM   3179 C CA  . GLN A 1 421 ? 21.789  -9.914  8.511   1.00 55.89  ? 421  GLN A CA  1 
ATOM   3180 C C   . GLN A 1 421 ? 21.361  -10.149 9.945   1.00 51.25  ? 421  GLN A C   1 
ATOM   3181 O O   . GLN A 1 421 ? 22.195  -10.427 10.813  1.00 52.97  ? 421  GLN A O   1 
ATOM   3182 C CB  . GLN A 1 421 ? 23.217  -9.390  8.432   1.00 59.51  ? 421  GLN A CB  1 
ATOM   3183 C CG  . GLN A 1 421 ? 23.860  -9.785  7.124   1.00 69.49  ? 421  GLN A CG  1 
ATOM   3184 C CD  . GLN A 1 421 ? 24.731  -8.704  6.595   1.00 77.19  ? 421  GLN A CD  1 
ATOM   3185 O OE1 . GLN A 1 421 ? 24.681  -8.365  5.410   1.00 83.88  ? 421  GLN A OE1 1 
ATOM   3186 N NE2 . GLN A 1 421 ? 25.526  -8.122  7.476   1.00 78.40  ? 421  GLN A NE2 1 
ATOM   3187 N N   . GLY A 1 422 ? 20.060  -10.025 10.188  1.00 50.58  ? 422  GLY A N   1 
ATOM   3188 C CA  . GLY A 1 422 ? 19.481  -10.483 11.436  1.00 49.18  ? 422  GLY A CA  1 
ATOM   3189 C C   . GLY A 1 422 ? 19.126  -9.470  12.503  1.00 53.32  ? 422  GLY A C   1 
ATOM   3190 O O   . GLY A 1 422 ? 18.429  -9.809  13.450  1.00 58.34  ? 422  GLY A O   1 
ATOM   3191 N N   . ALA A 1 423 ? 19.605  -8.236  12.386  1.00 53.94  ? 423  ALA A N   1 
ATOM   3192 C CA  . ALA A 1 423 ? 19.341  -7.259  13.436  1.00 42.54  ? 423  ALA A CA  1 
ATOM   3193 C C   . ALA A 1 423 ? 17.895  -6.842  13.365  1.00 41.21  ? 423  ALA A C   1 
ATOM   3194 O O   . ALA A 1 423 ? 17.275  -6.921  12.309  1.00 48.29  ? 423  ALA A O   1 
ATOM   3195 C CB  . ALA A 1 423 ? 20.248  -6.035  13.280  1.00 43.13  ? 423  ALA A CB  1 
ATOM   3196 N N   . ARG A 1 424 ? 17.353  -6.384  14.484  1.00 43.49  ? 424  ARG A N   1 
ATOM   3197 C CA  . ARG A 1 424 ? 16.036  -5.773  14.462  1.00 48.90  ? 424  ARG A CA  1 
ATOM   3198 C C   . ARG A 1 424 ? 16.239  -4.265  14.339  1.00 44.29  ? 424  ARG A C   1 
ATOM   3199 O O   . ARG A 1 424 ? 16.887  -3.659  15.194  1.00 44.17  ? 424  ARG A O   1 
ATOM   3200 C CB  . ARG A 1 424 ? 15.243  -6.113  15.729  1.00 52.38  ? 424  ARG A CB  1 
ATOM   3201 C CG  . ARG A 1 424 ? 13.785  -5.657  15.672  1.00 66.25  ? 424  ARG A CG  1 
ATOM   3202 C CD  . ARG A 1 424 ? 12.900  -6.462  16.619  1.00 87.53  ? 424  ARG A CD  1 
ATOM   3203 N NE  . ARG A 1 424 ? 13.192  -6.160  18.019  1.00 100.16 ? 424  ARG A NE  1 
ATOM   3204 C CZ  . ARG A 1 424 ? 12.739  -6.863  19.054  1.00 109.86 ? 424  ARG A CZ  1 
ATOM   3205 N NH1 . ARG A 1 424 ? 11.964  -7.923  18.857  1.00 113.94 ? 424  ARG A NH1 1 
ATOM   3206 N NH2 . ARG A 1 424 ? 13.066  -6.505  20.291  1.00 112.72 ? 424  ARG A NH2 1 
ATOM   3207 N N   . VAL A 1 425 ? 15.679  -3.669  13.287  1.00 41.83  ? 425  VAL A N   1 
ATOM   3208 C CA  . VAL A 1 425 ? 15.951  -2.267  12.956  1.00 43.25  ? 425  VAL A CA  1 
ATOM   3209 C C   . VAL A 1 425 ? 14.683  -1.439  12.952  1.00 43.16  ? 425  VAL A C   1 
ATOM   3210 O O   . VAL A 1 425 ? 13.673  -1.872  12.409  1.00 44.16  ? 425  VAL A O   1 
ATOM   3211 C CB  . VAL A 1 425 ? 16.565  -2.137  11.538  1.00 44.46  ? 425  VAL A CB  1 
ATOM   3212 C CG1 . VAL A 1 425 ? 16.943  -0.664  11.246  1.00 32.77  ? 425  VAL A CG1 1 
ATOM   3213 C CG2 . VAL A 1 425 ? 17.759  -3.079  11.371  1.00 38.90  ? 425  VAL A CG2 1 
ATOM   3214 N N   . TYR A 1 426 ? 14.739  -0.248  13.539  1.00 36.27  ? 426  TYR A N   1 
ATOM   3215 C CA  . TYR A 1 426 ? 13.650  0.722   13.441  1.00 34.31  ? 426  TYR A CA  1 
ATOM   3216 C C   . TYR A 1 426 ? 14.199  1.998   12.825  1.00 39.78  ? 426  TYR A C   1 
ATOM   3217 O O   . TYR A 1 426 ? 15.260  2.472   13.228  1.00 43.91  ? 426  TYR A O   1 
ATOM   3218 C CB  . TYR A 1 426 ? 13.057  1.042   14.823  1.00 31.24  ? 426  TYR A CB  1 
ATOM   3219 C CG  . TYR A 1 426 ? 12.338  -0.125  15.466  1.00 44.36  ? 426  TYR A CG  1 
ATOM   3220 C CD1 . TYR A 1 426 ? 13.024  -1.018  16.291  1.00 38.52  ? 426  TYR A CD1 1 
ATOM   3221 C CD2 . TYR A 1 426 ? 10.977  -0.350  15.233  1.00 41.97  ? 426  TYR A CD2 1 
ATOM   3222 C CE1 . TYR A 1 426 ? 12.378  -2.094  16.862  1.00 49.00  ? 426  TYR A CE1 1 
ATOM   3223 C CE2 . TYR A 1 426 ? 10.316  -1.440  15.811  1.00 40.91  ? 426  TYR A CE2 1 
ATOM   3224 C CZ  . TYR A 1 426 ? 11.025  -2.300  16.623  1.00 48.01  ? 426  TYR A CZ  1 
ATOM   3225 O OH  . TYR A 1 426 ? 10.404  -3.371  17.211  1.00 54.28  ? 426  TYR A OH  1 
ATOM   3226 N N   . ALA A 1 427 ? 13.490  2.559   11.854  1.00 33.07  ? 427  ALA A N   1 
ATOM   3227 C CA  . ALA A 1 427 ? 14.003  3.720   11.139  1.00 34.95  ? 427  ALA A CA  1 
ATOM   3228 C C   . ALA A 1 427 ? 13.008  4.872   11.164  1.00 41.71  ? 427  ALA A C   1 
ATOM   3229 O O   . ALA A 1 427 ? 11.788  4.653   11.207  1.00 38.54  ? 427  ALA A O   1 
ATOM   3230 C CB  . ALA A 1 427 ? 14.363  3.349   9.710   1.00 36.05  ? 427  ALA A CB  1 
ATOM   3231 N N   . TYR A 1 428 ? 13.528  6.099   11.134  1.00 32.90  ? 428  TYR A N   1 
ATOM   3232 C CA  . TYR A 1 428 ? 12.671  7.282   11.176  1.00 32.28  ? 428  TYR A CA  1 
ATOM   3233 C C   . TYR A 1 428 ? 13.200  8.415   10.301  1.00 36.28  ? 428  TYR A C   1 
ATOM   3234 O O   . TYR A 1 428 ? 14.395  8.488   9.979   1.00 33.02  ? 428  TYR A O   1 
ATOM   3235 C CB  . TYR A 1 428 ? 12.514  7.810   12.627  1.00 30.93  ? 428  TYR A CB  1 
ATOM   3236 C CG  . TYR A 1 428 ? 13.805  8.424   13.167  1.00 40.92  ? 428  TYR A CG  1 
ATOM   3237 C CD1 . TYR A 1 428 ? 14.217  9.705   12.785  1.00 39.34  ? 428  TYR A CD1 1 
ATOM   3238 C CD2 . TYR A 1 428 ? 14.625  7.707   14.030  1.00 37.00  ? 428  TYR A CD2 1 
ATOM   3239 C CE1 . TYR A 1 428 ? 15.423  10.253  13.264  1.00 35.34  ? 428  TYR A CE1 1 
ATOM   3240 C CE2 . TYR A 1 428 ? 15.807  8.226   14.493  1.00 37.93  ? 428  TYR A CE2 1 
ATOM   3241 C CZ  . TYR A 1 428 ? 16.206  9.494   14.112  1.00 37.37  ? 428  TYR A CZ  1 
ATOM   3242 O OH  . TYR A 1 428 ? 17.393  9.981   14.586  1.00 37.92  ? 428  TYR A OH  1 
ATOM   3243 N N   . ILE A 1 429 ? 12.305  9.335   9.962   1.00 37.73  ? 429  ILE A N   1 
ATOM   3244 C CA  . ILE A 1 429 ? 12.709  10.638  9.454   1.00 33.10  ? 429  ILE A CA  1 
ATOM   3245 C C   . ILE A 1 429 ? 12.098  11.711  10.359  1.00 40.07  ? 429  ILE A C   1 
ATOM   3246 O O   . ILE A 1 429 ? 10.886  11.707  10.612  1.00 36.60  ? 429  ILE A O   1 
ATOM   3247 C CB  . ILE A 1 429 ? 12.311  10.833  7.969   1.00 33.16  ? 429  ILE A CB  1 
ATOM   3248 C CG1 . ILE A 1 429 ? 12.680  12.236  7.506   1.00 31.46  ? 429  ILE A CG1 1 
ATOM   3249 C CG2 . ILE A 1 429 ? 10.808  10.584  7.780   1.00 41.08  ? 429  ILE A CG2 1 
ATOM   3250 C CD1 . ILE A 1 429 ? 12.755  12.372  5.989   1.00 43.26  ? 429  ILE A CD1 1 
ATOM   3251 N N   . PHE A 1 430 ? 12.942  12.612  10.868  1.00 33.26  ? 430  PHE A N   1 
ATOM   3252 C CA  . PHE A 1 430 ? 12.495  13.676  11.749  1.00 34.36  ? 430  PHE A CA  1 
ATOM   3253 C C   . PHE A 1 430 ? 12.158  14.935  10.943  1.00 35.96  ? 430  PHE A C   1 
ATOM   3254 O O   . PHE A 1 430 ? 13.006  15.464  10.238  1.00 35.68  ? 430  PHE A O   1 
ATOM   3255 C CB  . PHE A 1 430 ? 13.573  13.951  12.799  1.00 33.27  ? 430  PHE A CB  1 
ATOM   3256 C CG  . PHE A 1 430 ? 13.237  15.064  13.752  1.00 35.12  ? 430  PHE A CG  1 
ATOM   3257 C CD1 . PHE A 1 430 ? 13.513  16.387  13.421  1.00 34.49  ? 430  PHE A CD1 1 
ATOM   3258 C CD2 . PHE A 1 430 ? 12.699  14.789  15.000  1.00 37.64  ? 430  PHE A CD2 1 
ATOM   3259 C CE1 . PHE A 1 430 ? 13.223  17.415  14.303  1.00 37.63  ? 430  PHE A CE1 1 
ATOM   3260 C CE2 . PHE A 1 430 ? 12.408  15.820  15.898  1.00 35.57  ? 430  PHE A CE2 1 
ATOM   3261 C CZ  . PHE A 1 430 ? 12.664  17.129  15.543  1.00 34.27  ? 430  PHE A CZ  1 
ATOM   3262 N N   . GLU A 1 431 ? 10.928  15.433  11.057  1.00 35.96  ? 431  GLU A N   1 
ATOM   3263 C CA  . GLU A 1 431 ? 10.465  16.451  10.108  1.00 41.93  ? 431  GLU A CA  1 
ATOM   3264 C C   . GLU A 1 431 ? 9.948   17.738  10.740  1.00 44.96  ? 431  GLU A C   1 
ATOM   3265 O O   . GLU A 1 431 ? 9.378   18.571  10.052  1.00 45.08  ? 431  GLU A O   1 
ATOM   3266 C CB  . GLU A 1 431 ? 9.352   15.891  9.226   1.00 44.47  ? 431  GLU A CB  1 
ATOM   3267 C CG  . GLU A 1 431 ? 9.756   14.814  8.267   1.00 49.28  ? 431  GLU A CG  1 
ATOM   3268 C CD  . GLU A 1 431 ? 8.601   14.402  7.356   1.00 50.30  ? 431  GLU A CD  1 
ATOM   3269 O OE1 . GLU A 1 431 ? 7.446   14.367  7.830   1.00 53.15  ? 431  GLU A OE1 1 
ATOM   3270 O OE2 . GLU A 1 431 ? 8.853   14.126  6.165   1.00 54.62  ? 431  GLU A OE2 1 
ATOM   3271 N N   . HIS A 1 432 ? 10.120  17.913  12.041  1.00 42.89  ? 432  HIS A N   1 
ATOM   3272 C CA  . HIS A 1 432 ? 9.597   19.126  12.654  1.00 40.44  ? 432  HIS A CA  1 
ATOM   3273 C C   . HIS A 1 432 ? 10.713  20.160  12.850  1.00 37.92  ? 432  HIS A C   1 
ATOM   3274 O O   . HIS A 1 432 ? 11.755  19.858  13.429  1.00 37.35  ? 432  HIS A O   1 
ATOM   3275 C CB  . HIS A 1 432 ? 8.921   18.811  13.988  1.00 33.17  ? 432  HIS A CB  1 
ATOM   3276 C CG  . HIS A 1 432 ? 8.620   20.029  14.798  1.00 38.04  ? 432  HIS A CG  1 
ATOM   3277 N ND1 . HIS A 1 432 ? 7.655   20.941  14.433  1.00 42.79  ? 432  HIS A ND1 1 
ATOM   3278 C CD2 . HIS A 1 432 ? 9.192   20.515  15.923  1.00 40.23  ? 432  HIS A CD2 1 
ATOM   3279 C CE1 . HIS A 1 432 ? 7.624   21.924  15.316  1.00 41.31  ? 432  HIS A CE1 1 
ATOM   3280 N NE2 . HIS A 1 432 ? 8.549   21.692  16.229  1.00 43.55  ? 432  HIS A NE2 1 
ATOM   3281 N N   . ARG A 1 433 ? 10.496  21.373  12.361  1.00 40.22  ? 433  ARG A N   1 
ATOM   3282 C CA  . ARG A 1 433 ? 11.479  22.442  12.532  1.00 45.76  ? 433  ARG A CA  1 
ATOM   3283 C C   . ARG A 1 433 ? 11.163  23.187  13.837  1.00 46.33  ? 433  ARG A C   1 
ATOM   3284 O O   . ARG A 1 433 ? 10.056  23.693  14.009  1.00 41.25  ? 433  ARG A O   1 
ATOM   3285 C CB  . ARG A 1 433 ? 11.487  23.410  11.324  1.00 40.36  ? 433  ARG A CB  1 
ATOM   3286 C CG  . ARG A 1 433 ? 11.957  24.825  11.704  1.00 46.33  ? 433  ARG A CG  1 
ATOM   3287 C CD  . ARG A 1 433 ? 11.752  25.880  10.608  1.00 42.14  ? 433  ARG A CD  1 
ATOM   3288 N NE  . ARG A 1 433 ? 12.923  25.890  9.782   1.00 57.17  ? 433  ARG A NE  1 
ATOM   3289 C CZ  . ARG A 1 433 ? 13.828  26.855  9.749   1.00 53.26  ? 433  ARG A CZ  1 
ATOM   3290 N NH1 . ARG A 1 433 ? 13.676  27.967  10.459  1.00 43.61  ? 433  ARG A NH1 1 
ATOM   3291 N NH2 . ARG A 1 433 ? 14.885  26.691  8.967   1.00 50.75  ? 433  ARG A NH2 1 
ATOM   3292 N N   . ALA A 1 434 ? 12.124  23.243  14.756  1.00 43.35  ? 434  ALA A N   1 
ATOM   3293 C CA  . ALA A 1 434 ? 11.905  23.946  16.014  1.00 42.93  ? 434  ALA A CA  1 
ATOM   3294 C C   . ALA A 1 434 ? 11.392  25.359  15.760  1.00 43.59  ? 434  ALA A C   1 
ATOM   3295 O O   . ALA A 1 434 ? 11.914  26.061  14.894  1.00 47.72  ? 434  ALA A O   1 
ATOM   3296 C CB  . ALA A 1 434 ? 13.174  23.995  16.806  1.00 37.92  ? 434  ALA A CB  1 
ATOM   3297 N N   . SER A 1 435 ? 10.384  25.774  16.522  1.00 44.70  ? 435  SER A N   1 
ATOM   3298 C CA  . SER A 1 435 ? 9.834   27.131  16.416  1.00 45.57  ? 435  SER A CA  1 
ATOM   3299 C C   . SER A 1 435 ? 10.858  28.180  16.857  1.00 44.60  ? 435  SER A C   1 
ATOM   3300 O O   . SER A 1 435 ? 10.758  29.349  16.510  1.00 42.35  ? 435  SER A O   1 
ATOM   3301 C CB  . SER A 1 435 ? 8.565   27.271  17.264  1.00 42.99  ? 435  SER A CB  1 
ATOM   3302 O OG  . SER A 1 435 ? 8.849   27.131  18.648  1.00 46.26  ? 435  SER A OG  1 
ATOM   3303 N N   . THR A 1 436 ? 11.846  27.743  17.623  1.00 43.65  ? 436  THR A N   1 
ATOM   3304 C CA  . THR A 1 436 ? 12.867  28.633  18.167  1.00 49.05  ? 436  THR A CA  1 
ATOM   3305 C C   . THR A 1 436 ? 14.136  28.704  17.298  1.00 47.79  ? 436  THR A C   1 
ATOM   3306 O O   . THR A 1 436 ? 15.130  29.332  17.684  1.00 46.19  ? 436  THR A O   1 
ATOM   3307 C CB  . THR A 1 436 ? 13.272  28.142  19.560  1.00 47.62  ? 436  THR A CB  1 
ATOM   3308 O OG1 . THR A 1 436 ? 13.736  26.801  19.441  1.00 43.16  ? 436  THR A OG1 1 
ATOM   3309 C CG2 . THR A 1 436 ? 12.069  28.155  20.514  1.00 45.42  ? 436  THR A CG2 1 
ATOM   3310 N N   . LEU A 1 437 ? 14.098  28.067  16.130  1.00 47.89  ? 437  LEU A N   1 
ATOM   3311 C CA  . LEU A 1 437 ? 15.274  27.939  15.256  1.00 46.82  ? 437  LEU A CA  1 
ATOM   3312 C C   . LEU A 1 437 ? 15.757  29.294  14.747  1.00 48.47  ? 437  LEU A C   1 
ATOM   3313 O O   . LEU A 1 437 ? 14.947  30.114  14.310  1.00 49.25  ? 437  LEU A O   1 
ATOM   3314 C CB  . LEU A 1 437 ? 14.929  27.052  14.054  1.00 50.01  ? 437  LEU A CB  1 
ATOM   3315 C CG  . LEU A 1 437 ? 16.028  26.160  13.482  1.00 58.51  ? 437  LEU A CG  1 
ATOM   3316 C CD1 . LEU A 1 437 ? 16.544  25.226  14.538  1.00 54.27  ? 437  LEU A CD1 1 
ATOM   3317 C CD2 . LEU A 1 437 ? 15.497  25.365  12.300  1.00 63.74  ? 437  LEU A CD2 1 
ATOM   3318 N N   . THR A 1 438 ? 17.067  29.538  14.792  1.00 44.59  ? 438  THR A N   1 
ATOM   3319 C CA  . THR A 1 438 ? 17.598  30.829  14.325  1.00 46.34  ? 438  THR A CA  1 
ATOM   3320 C C   . THR A 1 438 ? 18.141  30.782  12.893  1.00 51.27  ? 438  THR A C   1 
ATOM   3321 O O   . THR A 1 438 ? 18.338  31.823  12.277  1.00 56.79  ? 438  THR A O   1 
ATOM   3322 C CB  . THR A 1 438 ? 18.674  31.429  15.280  1.00 54.41  ? 438  THR A CB  1 
ATOM   3323 O OG1 . THR A 1 438 ? 19.735  30.476  15.505  1.00 57.10  ? 438  THR A OG1 1 
ATOM   3324 C CG2 . THR A 1 438 ? 18.039  31.815  16.615  1.00 52.77  ? 438  THR A CG2 1 
ATOM   3325 N N   . TRP A 1 439 ? 18.396  29.584  12.370  1.00 52.55  ? 439  TRP A N   1 
ATOM   3326 C CA  . TRP A 1 439 ? 18.781  29.438  10.959  1.00 51.12  ? 439  TRP A CA  1 
ATOM   3327 C C   . TRP A 1 439 ? 17.579  29.811  10.094  1.00 40.98  ? 439  TRP A C   1 
ATOM   3328 O O   . TRP A 1 439 ? 16.455  29.722  10.554  1.00 48.96  ? 439  TRP A O   1 
ATOM   3329 C CB  . TRP A 1 439 ? 19.247  28.005  10.643  1.00 43.03  ? 439  TRP A CB  1 
ATOM   3330 C CG  . TRP A 1 439 ? 20.487  27.589  11.355  1.00 38.67  ? 439  TRP A CG  1 
ATOM   3331 C CD1 . TRP A 1 439 ? 20.567  26.821  12.484  1.00 44.00  ? 439  TRP A CD1 1 
ATOM   3332 C CD2 . TRP A 1 439 ? 21.842  27.902  10.988  1.00 34.53  ? 439  TRP A CD2 1 
ATOM   3333 N NE1 . TRP A 1 439 ? 21.889  26.643  12.847  1.00 40.11  ? 439  TRP A NE1 1 
ATOM   3334 C CE2 . TRP A 1 439 ? 22.688  27.300  11.947  1.00 35.69  ? 439  TRP A CE2 1 
ATOM   3335 C CE3 . TRP A 1 439 ? 22.420  28.643  9.953   1.00 35.79  ? 439  TRP A CE3 1 
ATOM   3336 C CZ2 . TRP A 1 439 ? 24.082  27.409  11.893  1.00 42.63  ? 439  TRP A CZ2 1 
ATOM   3337 C CZ3 . TRP A 1 439 ? 23.803  28.748  9.898   1.00 39.70  ? 439  TRP A CZ3 1 
ATOM   3338 C CH2 . TRP A 1 439 ? 24.621  28.128  10.859  1.00 44.96  ? 439  TRP A CH2 1 
ATOM   3339 N N   . PRO A 1 440 ? 17.817  30.230  8.837   1.00 43.92  ? 440  PRO A N   1 
ATOM   3340 C CA  . PRO A 1 440 ? 16.729  30.661  7.936   1.00 39.63  ? 440  PRO A CA  1 
ATOM   3341 C C   . PRO A 1 440 ? 15.819  29.510  7.508   1.00 43.88  ? 440  PRO A C   1 
ATOM   3342 O O   . PRO A 1 440 ? 16.207  28.334  7.614   1.00 44.21  ? 440  PRO A O   1 
ATOM   3343 C CB  . PRO A 1 440 ? 17.458  31.183  6.690   1.00 40.44  ? 440  PRO A CB  1 
ATOM   3344 C CG  . PRO A 1 440 ? 18.927  30.997  6.935   1.00 48.67  ? 440  PRO A CG  1 
ATOM   3345 C CD  . PRO A 1 440 ? 19.110  30.122  8.142   1.00 45.96  ? 440  PRO A CD  1 
ATOM   3346 N N   . LEU A 1 441 ? 14.652  29.863  6.983   1.00 36.85  ? 441  LEU A N   1 
ATOM   3347 C CA  . LEU A 1 441 ? 13.644  28.900  6.570   1.00 44.96  ? 441  LEU A CA  1 
ATOM   3348 C C   . LEU A 1 441 ? 14.098  27.969  5.467   1.00 48.91  ? 441  LEU A C   1 
ATOM   3349 O O   . LEU A 1 441 ? 13.716  26.800  5.459   1.00 48.57  ? 441  LEU A O   1 
ATOM   3350 C CB  . LEU A 1 441 ? 12.372  29.620  6.116   1.00 43.27  ? 441  LEU A CB  1 
ATOM   3351 C CG  . LEU A 1 441 ? 11.632  30.292  7.280   1.00 61.29  ? 441  LEU A CG  1 
ATOM   3352 C CD1 . LEU A 1 441 ? 10.638  31.351  6.800   1.00 68.61  ? 441  LEU A CD1 1 
ATOM   3353 C CD2 . LEU A 1 441 ? 10.947  29.251  8.165   1.00 59.18  ? 441  LEU A CD2 1 
ATOM   3354 N N   . TRP A 1 442 ? 14.880  28.482  4.519   1.00 43.88  ? 442  TRP A N   1 
ATOM   3355 C CA  . TRP A 1 442 ? 15.245  27.657  3.369   1.00 42.15  ? 442  TRP A CA  1 
ATOM   3356 C C   . TRP A 1 442 ? 16.038  26.427  3.853   1.00 43.42  ? 442  TRP A C   1 
ATOM   3357 O O   . TRP A 1 442 ? 16.040  25.394  3.184   1.00 39.39  ? 442  TRP A O   1 
ATOM   3358 C CB  . TRP A 1 442 ? 15.987  28.443  2.252   1.00 37.80  ? 442  TRP A CB  1 
ATOM   3359 C CG  . TRP A 1 442 ? 17.429  28.869  2.585   1.00 35.58  ? 442  TRP A CG  1 
ATOM   3360 C CD1 . TRP A 1 442 ? 17.844  30.112  3.015   1.00 40.17  ? 442  TRP A CD1 1 
ATOM   3361 C CD2 . TRP A 1 442 ? 18.614  28.053  2.534   1.00 38.48  ? 442  TRP A CD2 1 
ATOM   3362 N NE1 . TRP A 1 442 ? 19.208  30.115  3.227   1.00 42.19  ? 442  TRP A NE1 1 
ATOM   3363 C CE2 . TRP A 1 442 ? 19.706  28.869  2.937   1.00 38.29  ? 442  TRP A CE2 1 
ATOM   3364 C CE3 . TRP A 1 442 ? 18.863  26.725  2.171   1.00 37.94  ? 442  TRP A CE3 1 
ATOM   3365 C CZ2 . TRP A 1 442 ? 21.016  28.393  2.990   1.00 40.99  ? 442  TRP A CZ2 1 
ATOM   3366 C CZ3 . TRP A 1 442 ? 20.176  26.254  2.216   1.00 35.37  ? 442  TRP A CZ3 1 
ATOM   3367 C CH2 . TRP A 1 442 ? 21.232  27.084  2.637   1.00 41.38  ? 442  TRP A CH2 1 
ATOM   3368 N N   . MET A 1 443 ? 16.671  26.520  5.027   1.00 35.59  ? 443  MET A N   1 
ATOM   3369 C CA  . MET A 1 443 ? 17.420  25.375  5.541   1.00 38.66  ? 443  MET A CA  1 
ATOM   3370 C C   . MET A 1 443 ? 16.509  24.261  6.046   1.00 37.69  ? 443  MET A C   1 
ATOM   3371 O O   . MET A 1 443 ? 16.983  23.175  6.363   1.00 34.02  ? 443  MET A O   1 
ATOM   3372 C CB  . MET A 1 443 ? 18.435  25.776  6.616   1.00 35.29  ? 443  MET A CB  1 
ATOM   3373 C CG  . MET A 1 443 ? 19.544  26.740  6.116   1.00 36.88  ? 443  MET A CG  1 
ATOM   3374 S SD  . MET A 1 443 ? 20.894  26.790  7.315   1.00 48.35  ? 443  MET A SD  1 
ATOM   3375 C CE  . MET A 1 443 ? 22.127  27.753  6.445   1.00 47.38  ? 443  MET A CE  1 
ATOM   3376 N N   . GLY A 1 444 ? 15.206  24.516  6.114   1.00 36.55  ? 444  GLY A N   1 
ATOM   3377 C CA  . GLY A 1 444 ? 14.253  23.476  6.495   1.00 32.47  ? 444  GLY A CA  1 
ATOM   3378 C C   . GLY A 1 444 ? 14.443  22.947  7.911   1.00 36.87  ? 444  GLY A C   1 
ATOM   3379 O O   . GLY A 1 444 ? 14.464  23.712  8.877   1.00 31.49  ? 444  GLY A O   1 
ATOM   3380 N N   . VAL A 1 445 ? 14.575  21.628  8.041   1.00 34.27  ? 445  VAL A N   1 
ATOM   3381 C CA  . VAL A 1 445 ? 14.815  21.003  9.344   1.00 33.53  ? 445  VAL A CA  1 
ATOM   3382 C C   . VAL A 1 445 ? 16.259  20.527  9.347   1.00 33.35  ? 445  VAL A C   1 
ATOM   3383 O O   . VAL A 1 445 ? 16.544  19.443  8.848   1.00 30.49  ? 445  VAL A O   1 
ATOM   3384 C CB  . VAL A 1 445 ? 13.914  19.772  9.565   1.00 34.59  ? 445  VAL A CB  1 
ATOM   3385 C CG1 . VAL A 1 445 ? 14.179  19.174  10.930  1.00 34.45  ? 445  VAL A CG1 1 
ATOM   3386 C CG2 . VAL A 1 445 ? 12.426  20.148  9.430   1.00 37.83  ? 445  VAL A CG2 1 
ATOM   3387 N N   . PRO A 1 446 ? 17.179  21.345  9.881   1.00 28.96  ? 446  PRO A N   1 
ATOM   3388 C CA  . PRO A 1 446 ? 18.583  21.080  9.572   1.00 30.71  ? 446  PRO A CA  1 
ATOM   3389 C C   . PRO A 1 446 ? 19.206  20.013  10.474  1.00 29.92  ? 446  PRO A C   1 
ATOM   3390 O O   . PRO A 1 446 ? 18.651  19.648  11.513  1.00 27.76  ? 446  PRO A O   1 
ATOM   3391 C CB  . PRO A 1 446 ? 19.269  22.456  9.786   1.00 26.81  ? 446  PRO A CB  1 
ATOM   3392 C CG  . PRO A 1 446 ? 18.150  23.448  10.025  1.00 30.28  ? 446  PRO A CG  1 
ATOM   3393 C CD  . PRO A 1 446 ? 17.025  22.604  10.623  1.00 33.41  ? 446  PRO A CD  1 
ATOM   3394 N N   . HIS A 1 447 ? 20.343  19.497  10.017  1.00 32.32  ? 447  HIS A N   1 
ATOM   3395 C CA  . HIS A 1 447 ? 21.153  18.526  10.731  1.00 30.34  ? 447  HIS A CA  1 
ATOM   3396 C C   . HIS A 1 447 ? 21.360  18.977  12.192  1.00 33.47  ? 447  HIS A C   1 
ATOM   3397 O O   . HIS A 1 447 ? 21.671  20.143  12.449  1.00 32.74  ? 447  HIS A O   1 
ATOM   3398 C CB  . HIS A 1 447 ? 22.504  18.449  9.993   1.00 29.91  ? 447  HIS A CB  1 
ATOM   3399 C CG  . HIS A 1 447 ? 23.482  17.487  10.576  1.00 29.45  ? 447  HIS A CG  1 
ATOM   3400 N ND1 . HIS A 1 447 ? 23.419  16.128  10.340  1.00 35.66  ? 447  HIS A ND1 1 
ATOM   3401 C CD2 . HIS A 1 447 ? 24.592  17.690  11.327  1.00 31.38  ? 447  HIS A CD2 1 
ATOM   3402 C CE1 . HIS A 1 447 ? 24.453  15.535  10.916  1.00 31.77  ? 447  HIS A CE1 1 
ATOM   3403 N NE2 . HIS A 1 447 ? 25.176  16.460  11.530  1.00 33.39  ? 447  HIS A NE2 1 
ATOM   3404 N N   . GLY A 1 448 ? 21.164  18.069  13.143  1.00 33.70  ? 448  GLY A N   1 
ATOM   3405 C CA  . GLY A 1 448 ? 21.440  18.376  14.541  1.00 35.33  ? 448  GLY A CA  1 
ATOM   3406 C C   . GLY A 1 448 ? 20.258  18.874  15.356  1.00 39.80  ? 448  GLY A C   1 
ATOM   3407 O O   . GLY A 1 448 ? 20.332  18.928  16.590  1.00 36.84  ? 448  GLY A O   1 
ATOM   3408 N N   . TYR A 1 449 ? 19.163  19.229  14.682  1.00 29.10  ? 449  TYR A N   1 
ATOM   3409 C CA  . TYR A 1 449 ? 18.056  19.900  15.379  1.00 31.74  ? 449  TYR A CA  1 
ATOM   3410 C C   . TYR A 1 449 ? 16.918  18.972  15.810  1.00 36.56  ? 449  TYR A C   1 
ATOM   3411 O O   . TYR A 1 449 ? 15.860  19.432  16.200  1.00 37.18  ? 449  TYR A O   1 
ATOM   3412 C CB  . TYR A 1 449 ? 17.582  21.167  14.626  1.00 30.85  ? 449  TYR A CB  1 
ATOM   3413 C CG  . TYR A 1 449 ? 18.634  22.244  14.755  1.00 39.00  ? 449  TYR A CG  1 
ATOM   3414 C CD1 . TYR A 1 449 ? 19.672  22.334  13.837  1.00 35.73  ? 449  TYR A CD1 1 
ATOM   3415 C CD2 . TYR A 1 449 ? 18.655  23.102  15.851  1.00 40.76  ? 449  TYR A CD2 1 
ATOM   3416 C CE1 . TYR A 1 449 ? 20.674  23.288  13.974  1.00 35.18  ? 449  TYR A CE1 1 
ATOM   3417 C CE2 . TYR A 1 449 ? 19.663  24.065  15.997  1.00 37.93  ? 449  TYR A CE2 1 
ATOM   3418 C CZ  . TYR A 1 449 ? 20.666  24.141  15.058  1.00 37.66  ? 449  TYR A CZ  1 
ATOM   3419 O OH  . TYR A 1 449 ? 21.667  25.064  15.181  1.00 39.96  ? 449  TYR A OH  1 
ATOM   3420 N N   . GLU A 1 450 ? 17.164  17.664  15.781  1.00 31.89  ? 450  GLU A N   1 
ATOM   3421 C CA  . GLU A 1 450 ? 16.267  16.739  16.453  1.00 36.09  ? 450  GLU A CA  1 
ATOM   3422 C C   . GLU A 1 450 ? 16.733  16.542  17.898  1.00 37.31  ? 450  GLU A C   1 
ATOM   3423 O O   . GLU A 1 450 ? 15.950  16.154  18.757  1.00 34.71  ? 450  GLU A O   1 
ATOM   3424 C CB  . GLU A 1 450 ? 16.223  15.382  15.746  1.00 25.36  ? 450  GLU A CB  1 
ATOM   3425 C CG  . GLU A 1 450 ? 17.311  14.415  16.205  1.00 35.14  ? 450  GLU A CG  1 
ATOM   3426 C CD  . GLU A 1 450 ? 18.659  14.671  15.546  1.00 35.39  ? 450  GLU A CD  1 
ATOM   3427 O OE1 . GLU A 1 450 ? 18.939  15.825  15.159  1.00 33.61  ? 450  GLU A OE1 1 
ATOM   3428 O OE2 . GLU A 1 450 ? 19.423  13.702  15.397  1.00 41.02  ? 450  GLU A OE2 1 
ATOM   3429 N N   . ILE A 1 451 ? 18.014  16.806  18.155  1.00 35.46  ? 451  ILE A N   1 
ATOM   3430 C CA  . ILE A 1 451 ? 18.619  16.454  19.439  1.00 33.57  ? 451  ILE A CA  1 
ATOM   3431 C C   . ILE A 1 451 ? 17.901  17.104  20.634  1.00 32.66  ? 451  ILE A C   1 
ATOM   3432 O O   . ILE A 1 451 ? 17.568  16.432  21.603  1.00 32.15  ? 451  ILE A O   1 
ATOM   3433 C CB  . ILE A 1 451 ? 20.126  16.827  19.485  1.00 30.78  ? 451  ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 451 ? 20.904  16.106  18.373  1.00 27.90  ? 451  ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 451 ? 20.704  16.429  20.814  1.00 28.30  ? 451  ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 451 ? 22.389  16.570  18.274  1.00 26.75  ? 451  ILE A CD1 1 
ATOM   3437 N N   . GLU A 1 452 ? 17.669  18.411  20.572  1.00 32.15  ? 452  GLU A N   1 
ATOM   3438 C CA  . GLU A 1 452 ? 17.005  19.108  21.669  1.00 32.11  ? 452  GLU A CA  1 
ATOM   3439 C C   . GLU A 1 452 ? 15.624  18.486  22.002  1.00 34.86  ? 452  GLU A C   1 
ATOM   3440 O O   . GLU A 1 452 ? 15.148  18.593  23.128  1.00 32.95  ? 452  GLU A O   1 
ATOM   3441 C CB  . GLU A 1 452 ? 16.874  20.611  21.347  1.00 34.24  ? 452  GLU A CB  1 
ATOM   3442 C CG  . GLU A 1 452 ? 16.106  20.898  20.037  1.00 36.06  ? 452  GLU A CG  1 
ATOM   3443 C CD  . GLU A 1 452 ? 16.482  22.228  19.409  1.00 42.09  ? 452  GLU A CD  1 
ATOM   3444 O OE1 . GLU A 1 452 ? 15.614  23.109  19.325  1.00 44.55  ? 452  GLU A OE1 1 
ATOM   3445 O OE2 . GLU A 1 452 ? 17.653  22.413  19.016  1.00 45.04  ? 452  GLU A OE2 1 
ATOM   3446 N N   . PHE A 1 453 ? 14.988  17.825  21.039  1.00 28.79  ? 453  PHE A N   1 
ATOM   3447 C CA  . PHE A 1 453 ? 13.690  17.190  21.324  1.00 29.11  ? 453  PHE A CA  1 
ATOM   3448 C C   . PHE A 1 453 ? 13.850  15.829  22.009  1.00 33.04  ? 453  PHE A C   1 
ATOM   3449 O O   . PHE A 1 453 ? 13.094  15.499  22.929  1.00 37.08  ? 453  PHE A O   1 
ATOM   3450 C CB  . PHE A 1 453 ? 12.826  17.087  20.054  1.00 30.58  ? 453  PHE A CB  1 
ATOM   3451 C CG  . PHE A 1 453 ? 12.379  18.422  19.530  1.00 33.75  ? 453  PHE A CG  1 
ATOM   3452 C CD1 . PHE A 1 453 ? 11.159  18.959  19.918  1.00 38.49  ? 453  PHE A CD1 1 
ATOM   3453 C CD2 . PHE A 1 453 ? 13.195  19.161  18.679  1.00 37.79  ? 453  PHE A CD2 1 
ATOM   3454 C CE1 . PHE A 1 453 ? 10.762  20.191  19.473  1.00 35.52  ? 453  PHE A CE1 1 
ATOM   3455 C CE2 . PHE A 1 453 ? 12.797  20.402  18.223  1.00 40.93  ? 453  PHE A CE2 1 
ATOM   3456 C CZ  . PHE A 1 453 ? 11.559  20.913  18.626  1.00 37.16  ? 453  PHE A CZ  1 
ATOM   3457 N N   . ILE A 1 454 ? 14.829  15.043  21.567  1.00 29.05  ? 454  ILE A N   1 
ATOM   3458 C CA  . ILE A 1 454 ? 15.105  13.752  22.193  1.00 28.06  ? 454  ILE A CA  1 
ATOM   3459 C C   . ILE A 1 454 ? 15.502  13.928  23.661  1.00 36.52  ? 454  ILE A C   1 
ATOM   3460 O O   . ILE A 1 454 ? 15.125  13.125  24.520  1.00 35.74  ? 454  ILE A O   1 
ATOM   3461 C CB  . ILE A 1 454 ? 16.242  13.028  21.478  1.00 35.10  ? 454  ILE A CB  1 
ATOM   3462 C CG1 . ILE A 1 454 ? 15.957  12.895  19.967  1.00 42.73  ? 454  ILE A CG1 1 
ATOM   3463 C CG2 . ILE A 1 454 ? 16.530  11.674  22.140  1.00 35.77  ? 454  ILE A CG2 1 
ATOM   3464 C CD1 . ILE A 1 454 ? 14.622  12.334  19.662  1.00 47.89  ? 454  ILE A CD1 1 
ATOM   3465 N N   . PHE A 1 455 ? 16.271  14.975  23.954  1.00 36.94  ? 455  PHE A N   1 
ATOM   3466 C CA  . PHE A 1 455 ? 16.724  15.215  25.324  1.00 33.45  ? 455  PHE A CA  1 
ATOM   3467 C C   . PHE A 1 455 ? 15.659  15.887  26.185  1.00 35.61  ? 455  PHE A C   1 
ATOM   3468 O O   . PHE A 1 455 ? 15.813  15.984  27.393  1.00 38.97  ? 455  PHE A O   1 
ATOM   3469 C CB  . PHE A 1 455 ? 18.045  16.007  25.362  1.00 28.68  ? 455  PHE A CB  1 
ATOM   3470 C CG  . PHE A 1 455 ? 19.272  15.128  25.214  1.00 31.56  ? 455  PHE A CG  1 
ATOM   3471 C CD1 . PHE A 1 455 ? 19.694  14.695  23.954  1.00 26.79  ? 455  PHE A CD1 1 
ATOM   3472 C CD2 . PHE A 1 455 ? 19.977  14.712  26.332  1.00 28.61  ? 455  PHE A CD2 1 
ATOM   3473 C CE1 . PHE A 1 455 ? 20.812  13.865  23.827  1.00 33.04  ? 455  PHE A CE1 1 
ATOM   3474 C CE2 . PHE A 1 455 ? 21.093  13.883  26.221  1.00 32.60  ? 455  PHE A CE2 1 
ATOM   3475 C CZ  . PHE A 1 455 ? 21.512  13.454  24.960  1.00 33.98  ? 455  PHE A CZ  1 
ATOM   3476 N N   . GLY A 1 456 ? 14.596  16.371  25.554  1.00 34.01  ? 456  GLY A N   1 
ATOM   3477 C CA  . GLY A 1 456 ? 13.477  16.926  26.291  1.00 33.81  ? 456  GLY A CA  1 
ATOM   3478 C C   . GLY A 1 456 ? 13.615  18.371  26.723  1.00 37.78  ? 456  GLY A C   1 
ATOM   3479 O O   . GLY A 1 456 ? 12.938  18.795  27.660  1.00 38.75  ? 456  GLY A O   1 
ATOM   3480 N N   . LEU A 1 457 ? 14.468  19.141  26.052  1.00 35.30  ? 457  LEU A N   1 
ATOM   3481 C CA  . LEU A 1 457 ? 14.578  20.575  26.367  1.00 41.42  ? 457  LEU A CA  1 
ATOM   3482 C C   . LEU A 1 457 ? 13.258  21.356  26.294  1.00 42.81  ? 457  LEU A C   1 
ATOM   3483 O O   . LEU A 1 457 ? 13.056  22.314  27.043  1.00 43.31  ? 457  LEU A O   1 
ATOM   3484 C CB  . LEU A 1 457 ? 15.613  21.276  25.483  1.00 40.29  ? 457  LEU A CB  1 
ATOM   3485 C CG  . LEU A 1 457 ? 17.058  21.254  26.017  1.00 42.73  ? 457  LEU A CG  1 
ATOM   3486 C CD1 . LEU A 1 457 ? 17.612  19.826  26.028  1.00 35.78  ? 457  LEU A CD1 1 
ATOM   3487 C CD2 . LEU A 1 457 ? 17.942  22.165  25.172  1.00 38.38  ? 457  LEU A CD2 1 
ATOM   3488 N N   . PRO A 1 458 ? 12.364  20.987  25.369  1.00 36.52  ? 458  PRO A N   1 
ATOM   3489 C CA  . PRO A 1 458 ? 11.154  21.823  25.333  1.00 38.09  ? 458  PRO A CA  1 
ATOM   3490 C C   . PRO A 1 458 ? 10.306  21.745  26.615  1.00 42.07  ? 458  PRO A C   1 
ATOM   3491 O O   . PRO A 1 458 ? 9.386   22.549  26.754  1.00 44.62  ? 458  PRO A O   1 
ATOM   3492 C CB  . PRO A 1 458 ? 10.399  21.292  24.109  1.00 35.43  ? 458  PRO A CB  1 
ATOM   3493 C CG  . PRO A 1 458 ? 11.537  20.834  23.184  1.00 33.95  ? 458  PRO A CG  1 
ATOM   3494 C CD  . PRO A 1 458 ? 12.476  20.136  24.175  1.00 28.53  ? 458  PRO A CD  1 
ATOM   3495 N N   . LEU A 1 459 ? 10.628  20.831  27.535  1.00 39.97  ? 459  LEU A N   1 
ATOM   3496 C CA  . LEU A 1 459 ? 9.939   20.758  28.837  1.00 48.82  ? 459  LEU A CA  1 
ATOM   3497 C C   . LEU A 1 459 ? 10.321  21.905  29.773  1.00 52.64  ? 459  LEU A C   1 
ATOM   3498 O O   . LEU A 1 459 ? 9.664   22.140  30.785  1.00 52.09  ? 459  LEU A O   1 
ATOM   3499 C CB  . LEU A 1 459 ? 10.247  19.435  29.534  1.00 45.53  ? 459  LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 459 ? 9.408   18.205  29.183  1.00 51.26  ? 459  LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 459 ? 9.308   17.984  27.687  1.00 56.51  ? 459  LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 459 ? 10.026  17.014  29.831  1.00 50.70  ? 459  LEU A CD2 1 
ATOM   3503 N N   . ASP A 1 460 ? 11.413  22.589  29.447  1.00 49.68  ? 460  ASP A N   1 
ATOM   3504 C CA  . ASP A 1 460 ? 11.890  23.706  30.241  1.00 44.86  ? 460  ASP A CA  1 
ATOM   3505 C C   . ASP A 1 460 ? 11.136  24.978  29.821  1.00 47.55  ? 460  ASP A C   1 
ATOM   3506 O O   . ASP A 1 460 ? 11.341  25.488  28.722  1.00 45.09  ? 460  ASP A O   1 
ATOM   3507 C CB  . ASP A 1 460 ? 13.393  23.881  30.029  1.00 42.89  ? 460  ASP A CB  1 
ATOM   3508 C CG  . ASP A 1 460 ? 13.979  25.000  30.883  1.00 57.93  ? 460  ASP A CG  1 
ATOM   3509 O OD1 . ASP A 1 460 ? 13.215  25.902  31.315  1.00 58.72  ? 460  ASP A OD1 1 
ATOM   3510 O OD2 . ASP A 1 460 ? 15.209  24.978  31.111  1.00 62.52  ? 460  ASP A OD2 1 
ATOM   3511 N N   . PRO A 1 461 ? 10.279  25.506  30.704  1.00 56.85  ? 461  PRO A N   1 
ATOM   3512 C CA  . PRO A 1 461 ? 9.350   26.596  30.341  1.00 62.10  ? 461  PRO A CA  1 
ATOM   3513 C C   . PRO A 1 461 ? 10.074  27.841  29.838  1.00 58.51  ? 461  PRO A C   1 
ATOM   3514 O O   . PRO A 1 461 ? 9.616   28.455  28.877  1.00 61.18  ? 461  PRO A O   1 
ATOM   3515 C CB  . PRO A 1 461 ? 8.613   26.900  31.652  1.00 63.12  ? 461  PRO A CB  1 
ATOM   3516 C CG  . PRO A 1 461 ? 8.887   25.729  32.546  1.00 68.53  ? 461  PRO A CG  1 
ATOM   3517 C CD  . PRO A 1 461 ? 10.224  25.180  32.137  1.00 64.71  ? 461  PRO A CD  1 
ATOM   3518 N N   . SER A 1 462 ? 11.202  28.179  30.458  1.00 53.01  ? 462  SER A N   1 
ATOM   3519 C CA  . SER A 1 462 ? 12.020  29.316  30.029  1.00 57.07  ? 462  SER A CA  1 
ATOM   3520 C C   . SER A 1 462 ? 12.637  29.229  28.616  1.00 59.57  ? 462  SER A C   1 
ATOM   3521 O O   . SER A 1 462 ? 13.226  30.206  28.138  1.00 60.88  ? 462  SER A O   1 
ATOM   3522 C CB  . SER A 1 462 ? 13.124  29.608  31.055  1.00 56.52  ? 462  SER A CB  1 
ATOM   3523 O OG  . SER A 1 462 ? 14.079  28.566  31.111  1.00 52.69  ? 462  SER A OG  1 
ATOM   3524 N N   . LEU A 1 463 ? 12.508  28.091  27.940  1.00 52.37  ? 463  LEU A N   1 
ATOM   3525 C CA  . LEU A 1 463 ? 13.060  27.991  26.587  1.00 49.25  ? 463  LEU A CA  1 
ATOM   3526 C C   . LEU A 1 463 ? 12.085  28.426  25.476  1.00 49.54  ? 463  LEU A C   1 
ATOM   3527 O O   . LEU A 1 463 ? 12.477  28.559  24.318  1.00 55.69  ? 463  LEU A O   1 
ATOM   3528 C CB  . LEU A 1 463 ? 13.654  26.598  26.307  1.00 47.27  ? 463  LEU A CB  1 
ATOM   3529 C CG  . LEU A 1 463 ? 14.836  26.191  27.197  1.00 55.76  ? 463  LEU A CG  1 
ATOM   3530 C CD1 . LEU A 1 463 ? 15.394  24.818  26.838  1.00 49.08  ? 463  LEU A CD1 1 
ATOM   3531 C CD2 . LEU A 1 463 ? 15.951  27.246  27.161  1.00 58.63  ? 463  LEU A CD2 1 
ATOM   3532 N N   . ASN A 1 464 ? 10.825  28.667  25.814  1.00 49.25  ? 464  ASN A N   1 
ATOM   3533 C CA  . ASN A 1 464 ? 9.904   29.261  24.829  1.00 57.82  ? 464  ASN A CA  1 
ATOM   3534 C C   . ASN A 1 464 ? 9.445   28.332  23.687  1.00 55.13  ? 464  ASN A C   1 
ATOM   3535 O O   . ASN A 1 464 ? 9.005   28.810  22.639  1.00 54.13  ? 464  ASN A O   1 
ATOM   3536 C CB  . ASN A 1 464 ? 10.505  30.546  24.210  1.00 63.13  ? 464  ASN A CB  1 
ATOM   3537 C CG  . ASN A 1 464 ? 10.737  31.660  25.237  1.00 73.19  ? 464  ASN A CG  1 
ATOM   3538 O OD1 . ASN A 1 464 ? 10.149  31.659  26.326  1.00 73.68  ? 464  ASN A OD1 1 
ATOM   3539 N ND2 . ASN A 1 464 ? 11.601  32.625  24.881  1.00 79.20  ? 464  ASN A ND2 1 
ATOM   3540 N N   . TYR A 1 465 ? 9.551   27.016  23.858  1.00 46.64  ? 465  TYR A N   1 
ATOM   3541 C CA  . TYR A 1 465 ? 8.966   26.126  22.861  1.00 45.59  ? 465  TYR A CA  1 
ATOM   3542 C C   . TYR A 1 465 ? 7.445   26.192  23.004  1.00 48.71  ? 465  TYR A C   1 
ATOM   3543 O O   . TYR A 1 465 ? 6.942   26.591  24.051  1.00 47.83  ? 465  TYR A O   1 
ATOM   3544 C CB  . TYR A 1 465 ? 9.430   24.693  23.066  1.00 42.14  ? 465  TYR A CB  1 
ATOM   3545 C CG  . TYR A 1 465 ? 10.872  24.461  22.734  1.00 40.37  ? 465  TYR A CG  1 
ATOM   3546 C CD1 . TYR A 1 465 ? 11.251  24.056  21.459  1.00 35.20  ? 465  TYR A CD1 1 
ATOM   3547 C CD2 . TYR A 1 465 ? 11.869  24.633  23.705  1.00 42.09  ? 465  TYR A CD2 1 
ATOM   3548 C CE1 . TYR A 1 465 ? 12.593  23.834  21.145  1.00 38.93  ? 465  TYR A CE1 1 
ATOM   3549 C CE2 . TYR A 1 465 ? 13.206  24.409  23.405  1.00 44.80  ? 465  TYR A CE2 1 
ATOM   3550 C CZ  . TYR A 1 465 ? 13.563  24.012  22.122  1.00 43.40  ? 465  TYR A CZ  1 
ATOM   3551 O OH  . TYR A 1 465 ? 14.881  23.787  21.816  1.00 44.92  ? 465  TYR A OH  1 
ATOM   3552 N N   . THR A 1 466 ? 6.714   25.792  21.969  1.00 47.14  ? 466  THR A N   1 
ATOM   3553 C CA  . THR A 1 466 ? 5.262   25.758  22.054  1.00 43.87  ? 466  THR A CA  1 
ATOM   3554 C C   . THR A 1 466 ? 4.789   24.562  22.889  1.00 51.23  ? 466  THR A C   1 
ATOM   3555 O O   . THR A 1 466 ? 5.565   23.648  23.208  1.00 46.47  ? 466  THR A O   1 
ATOM   3556 C CB  . THR A 1 466 ? 4.600   25.670  20.675  1.00 45.67  ? 466  THR A CB  1 
ATOM   3557 O OG1 . THR A 1 466 ? 4.928   24.413  20.063  1.00 49.03  ? 466  THR A OG1 1 
ATOM   3558 C CG2 . THR A 1 466 ? 5.024   26.831  19.771  1.00 35.35  ? 466  THR A CG2 1 
ATOM   3559 N N   . THR A 1 467 ? 3.505   24.574  23.237  1.00 47.24  ? 467  THR A N   1 
ATOM   3560 C CA  . THR A 1 467 ? 2.909   23.511  24.025  1.00 47.40  ? 467  THR A CA  1 
ATOM   3561 C C   . THR A 1 467 ? 2.921   22.190  23.260  1.00 44.49  ? 467  THR A C   1 
ATOM   3562 O O   . THR A 1 467 ? 3.147   21.128  23.835  1.00 48.22  ? 467  THR A O   1 
ATOM   3563 C CB  . THR A 1 467 ? 1.461   23.868  24.408  1.00 56.17  ? 467  THR A CB  1 
ATOM   3564 O OG1 . THR A 1 467 ? 1.481   24.930  25.367  1.00 58.08  ? 467  THR A OG1 1 
ATOM   3565 C CG2 . THR A 1 467 ? 0.752   22.660  25.006  1.00 57.12  ? 467  THR A CG2 1 
ATOM   3566 N N   . GLU A 1 468 ? 2.656   22.271  21.964  1.00 42.25  ? 468  GLU A N   1 
ATOM   3567 C CA  . GLU A 1 468 ? 2.688   21.117  21.084  1.00 44.58  ? 468  GLU A CA  1 
ATOM   3568 C C   . GLU A 1 468 ? 4.106   20.542  21.024  1.00 47.19  ? 468  GLU A C   1 
ATOM   3569 O O   . GLU A 1 468 ? 4.286   19.333  20.967  1.00 43.76  ? 468  GLU A O   1 
ATOM   3570 C CB  . GLU A 1 468 ? 2.244   21.510  19.672  1.00 51.05  ? 468  GLU A CB  1 
ATOM   3571 C CG  . GLU A 1 468 ? 0.789   22.001  19.545  1.00 69.19  ? 468  GLU A CG  1 
ATOM   3572 C CD  . GLU A 1 468 ? 0.521   23.341  20.245  1.00 77.49  ? 468  GLU A CD  1 
ATOM   3573 O OE1 . GLU A 1 468 ? -0.492  23.429  20.976  1.00 88.11  ? 468  GLU A OE1 1 
ATOM   3574 O OE2 . GLU A 1 468 ? 1.306   24.302  20.073  1.00 70.97  ? 468  GLU A OE2 1 
ATOM   3575 N N   . GLU A 1 469 ? 5.108   21.418  21.027  1.00 41.53  ? 469  GLU A N   1 
ATOM   3576 C CA  . GLU A 1 469 ? 6.488   20.973  20.998  1.00 44.12  ? 469  GLU A CA  1 
ATOM   3577 C C   . GLU A 1 469 ? 6.813   20.247  22.299  1.00 44.24  ? 469  GLU A C   1 
ATOM   3578 O O   . GLU A 1 469 ? 7.539   19.255  22.292  1.00 38.65  ? 469  GLU A O   1 
ATOM   3579 C CB  . GLU A 1 469 ? 7.437   22.151  20.739  1.00 43.77  ? 469  GLU A CB  1 
ATOM   3580 C CG  . GLU A 1 469 ? 7.383   22.627  19.291  1.00 45.93  ? 469  GLU A CG  1 
ATOM   3581 C CD  . GLU A 1 469 ? 8.311   23.794  19.013  1.00 45.62  ? 469  GLU A CD  1 
ATOM   3582 O OE1 . GLU A 1 469 ? 8.340   24.729  19.838  1.00 44.00  ? 469  GLU A OE1 1 
ATOM   3583 O OE2 . GLU A 1 469 ? 8.999   23.777  17.968  1.00 47.48  ? 469  GLU A OE2 1 
ATOM   3584 N N   . ARG A 1 470 ? 6.229   20.714  23.404  1.00 41.49  ? 470  ARG A N   1 
ATOM   3585 C CA  . ARG A 1 470 ? 6.395   20.064  24.694  1.00 45.16  ? 470  ARG A CA  1 
ATOM   3586 C C   . ARG A 1 470 ? 5.893   18.616  24.635  1.00 50.02  ? 470  ARG A C   1 
ATOM   3587 O O   . ARG A 1 470 ? 6.564   17.683  25.091  1.00 45.28  ? 470  ARG A O   1 
ATOM   3588 C CB  . ARG A 1 470 ? 5.630   20.832  25.776  1.00 45.72  ? 470  ARG A CB  1 
ATOM   3589 C CG  . ARG A 1 470 ? 6.368   20.964  27.090  1.00 52.21  ? 470  ARG A CG  1 
ATOM   3590 C CD  . ARG A 1 470 ? 5.482   20.658  28.325  1.00 98.98  ? 470  ARG A CD  1 
ATOM   3591 N NE  . ARG A 1 470 ? 4.089   21.067  28.149  1.00 100.37 ? 470  ARG A NE  1 
ATOM   3592 C CZ  . ARG A 1 470 ? 3.060   20.224  28.077  1.00 99.32  ? 470  ARG A CZ  1 
ATOM   3593 N NH1 . ARG A 1 470 ? 3.257   18.914  28.186  1.00 94.98  ? 470  ARG A NH1 1 
ATOM   3594 N NH2 . ARG A 1 470 ? 1.829   20.694  27.904  1.00 100.48 ? 470  ARG A NH2 1 
ATOM   3595 N N   . ILE A 1 471 ? 4.707   18.438  24.066  1.00 45.95  ? 471  ILE A N   1 
ATOM   3596 C CA  . ILE A 1 471 ? 4.085   17.122  23.954  1.00 42.77  ? 471  ILE A CA  1 
ATOM   3597 C C   . ILE A 1 471 ? 4.855   16.245  22.979  1.00 41.82  ? 471  ILE A C   1 
ATOM   3598 O O   . ILE A 1 471 ? 5.056   15.051  23.226  1.00 43.02  ? 471  ILE A O   1 
ATOM   3599 C CB  . ILE A 1 471 ? 2.593   17.260  23.506  1.00 53.97  ? 471  ILE A CB  1 
ATOM   3600 C CG1 . ILE A 1 471 ? 1.765   17.889  24.639  1.00 53.90  ? 471  ILE A CG1 1 
ATOM   3601 C CG2 . ILE A 1 471 ? 2.010   15.910  23.080  1.00 44.53  ? 471  ILE A CG2 1 
ATOM   3602 C CD1 . ILE A 1 471 ? 0.530   18.620  24.172  1.00 59.35  ? 471  ILE A CD1 1 
ATOM   3603 N N   . PHE A 1 472 ? 5.285   16.847  21.871  1.00 37.42  ? 472  PHE A N   1 
ATOM   3604 C CA  . PHE A 1 472 ? 6.111   16.155  20.877  1.00 43.16  ? 472  PHE A CA  1 
ATOM   3605 C C   . PHE A 1 472 ? 7.402   15.610  21.514  1.00 39.58  ? 472  PHE A C   1 
ATOM   3606 O O   . PHE A 1 472 ? 7.747   14.440  21.358  1.00 42.25  ? 472  PHE A O   1 
ATOM   3607 C CB  . PHE A 1 472 ? 6.436   17.112  19.730  1.00 39.06  ? 472  PHE A CB  1 
ATOM   3608 C CG  . PHE A 1 472 ? 7.309   16.517  18.654  1.00 42.64  ? 472  PHE A CG  1 
ATOM   3609 C CD1 . PHE A 1 472 ? 6.994   15.292  18.078  1.00 42.06  ? 472  PHE A CD1 1 
ATOM   3610 C CD2 . PHE A 1 472 ? 8.426   17.215  18.183  1.00 38.26  ? 472  PHE A CD2 1 
ATOM   3611 C CE1 . PHE A 1 472 ? 7.800   14.744  17.059  1.00 36.16  ? 472  PHE A CE1 1 
ATOM   3612 C CE2 . PHE A 1 472 ? 9.226   16.690  17.175  1.00 36.31  ? 472  PHE A CE2 1 
ATOM   3613 C CZ  . PHE A 1 472 ? 8.907   15.445  16.608  1.00 38.70  ? 472  PHE A CZ  1 
ATOM   3614 N N   . ALA A 1 473 ? 8.074   16.457  22.281  1.00 39.04  ? 473  ALA A N   1 
ATOM   3615 C CA  . ALA A 1 473 ? 9.301   16.062  22.984  1.00 46.76  ? 473  ALA A CA  1 
ATOM   3616 C C   . ALA A 1 473 ? 9.080   14.865  23.920  1.00 43.77  ? 473  ALA A C   1 
ATOM   3617 O O   . ALA A 1 473 ? 9.869   13.923  23.939  1.00 43.67  ? 473  ALA A O   1 
ATOM   3618 C CB  . ALA A 1 473 ? 9.873   17.258  23.744  1.00 40.71  ? 473  ALA A CB  1 
ATOM   3619 N N   . GLN A 1 474 ? 7.989   14.903  24.677  1.00 43.90  ? 474  GLN A N   1 
ATOM   3620 C CA  . GLN A 1 474 ? 7.599   13.787  25.545  1.00 46.11  ? 474  GLN A CA  1 
ATOM   3621 C C   . GLN A 1 474 ? 7.379   12.484  24.790  1.00 43.68  ? 474  GLN A C   1 
ATOM   3622 O O   . GLN A 1 474 ? 7.773   11.416  25.270  1.00 44.83  ? 474  GLN A O   1 
ATOM   3623 C CB  . GLN A 1 474 ? 6.344   14.138  26.362  1.00 45.03  ? 474  GLN A CB  1 
ATOM   3624 C CG  . GLN A 1 474 ? 6.597   15.183  27.436  1.00 51.18  ? 474  GLN A CG  1 
ATOM   3625 C CD  . GLN A 1 474 ? 5.313   15.799  27.968  1.00 64.14  ? 474  GLN A CD  1 
ATOM   3626 O OE1 . GLN A 1 474 ? 4.385   16.090  27.210  1.00 71.87  ? 474  GLN A OE1 1 
ATOM   3627 N NE2 . GLN A 1 474 ? 5.259   16.008  29.273  1.00 64.02  ? 474  GLN A NE2 1 
ATOM   3628 N N   . ARG A 1 475 ? 6.734   12.552  23.626  1.00 40.39  ? 475  ARG A N   1 
ATOM   3629 C CA  . ARG A 1 475 ? 6.605   11.352  22.791  1.00 45.45  ? 475  ARG A CA  1 
ATOM   3630 C C   . ARG A 1 475 ? 7.980   10.763  22.393  1.00 42.40  ? 475  ARG A C   1 
ATOM   3631 O O   . ARG A 1 475 ? 8.182   9.549   22.452  1.00 40.14  ? 475  ARG A O   1 
ATOM   3632 C CB  . ARG A 1 475 ? 5.815   11.642  21.514  1.00 49.32  ? 475  ARG A CB  1 
ATOM   3633 C CG  . ARG A 1 475 ? 4.329   11.739  21.684  1.00 52.37  ? 475  ARG A CG  1 
ATOM   3634 C CD  . ARG A 1 475 ? 3.677   12.162  20.360  1.00 56.29  ? 475  ARG A CD  1 
ATOM   3635 N NE  . ARG A 1 475 ? 4.089   11.286  19.270  1.00 49.43  ? 475  ARG A NE  1 
ATOM   3636 C CZ  . ARG A 1 475 ? 4.272   11.678  18.014  1.00 44.48  ? 475  ARG A CZ  1 
ATOM   3637 N NH1 . ARG A 1 475 ? 4.077   12.941  17.662  1.00 41.14  ? 475  ARG A NH1 1 
ATOM   3638 N NH2 . ARG A 1 475 ? 4.672   10.802  17.109  1.00 43.73  ? 475  ARG A NH2 1 
ATOM   3639 N N   . LEU A 1 476 ? 8.911   11.619  21.972  1.00 37.40  ? 476  LEU A N   1 
ATOM   3640 C CA  . LEU A 1 476 ? 10.222  11.144  21.503  1.00 34.10  ? 476  LEU A CA  1 
ATOM   3641 C C   . LEU A 1 476 ? 11.030  10.563  22.656  1.00 36.38  ? 476  LEU A C   1 
ATOM   3642 O O   . LEU A 1 476 ? 11.646  9.514   22.517  1.00 43.22  ? 476  LEU A O   1 
ATOM   3643 C CB  . LEU A 1 476 ? 11.010  12.259  20.794  1.00 36.91  ? 476  LEU A CB  1 
ATOM   3644 C CG  . LEU A 1 476 ? 10.361  12.863  19.535  1.00 43.63  ? 476  LEU A CG  1 
ATOM   3645 C CD1 . LEU A 1 476 ? 11.274  13.840  18.888  1.00 48.97  ? 476  LEU A CD1 1 
ATOM   3646 C CD2 . LEU A 1 476 ? 10.006  11.794  18.539  1.00 44.01  ? 476  LEU A CD2 1 
ATOM   3647 N N   . MET A 1 477 ? 11.023  11.244  23.797  1.00 34.71  ? 477  MET A N   1 
ATOM   3648 C CA  . MET A 1 477 ? 11.661  10.702  24.996  1.00 37.60  ? 477  MET A CA  1 
ATOM   3649 C C   . MET A 1 477 ? 11.139  9.311   25.280  1.00 43.19  ? 477  MET A C   1 
ATOM   3650 O O   . MET A 1 477 ? 11.919  8.400   25.593  1.00 43.44  ? 477  MET A O   1 
ATOM   3651 C CB  . MET A 1 477 ? 11.444  11.613  26.209  1.00 39.73  ? 477  MET A CB  1 
ATOM   3652 C CG  . MET A 1 477 ? 12.132  12.966  26.069  1.00 40.57  ? 477  MET A CG  1 
ATOM   3653 S SD  . MET A 1 477 ? 11.556  14.105  27.344  1.00 53.75  ? 477  MET A SD  1 
ATOM   3654 C CE  . MET A 1 477 ? 12.456  13.518  28.753  1.00 46.78  ? 477  MET A CE  1 
ATOM   3655 N N   . LYS A 1 478 ? 9.821   9.143   25.150  1.00 37.65  ? 478  LYS A N   1 
ATOM   3656 C CA  . LYS A 1 478 ? 9.178   7.838   25.366  1.00 43.82  ? 478  LYS A CA  1 
ATOM   3657 C C   . LYS A 1 478 ? 9.674   6.792   24.372  1.00 39.33  ? 478  LYS A C   1 
ATOM   3658 O O   . LYS A 1 478 ? 10.042  5.676   24.776  1.00 38.82  ? 478  LYS A O   1 
ATOM   3659 C CB  . LYS A 1 478 ? 7.638   7.932   25.261  1.00 48.53  ? 478  LYS A CB  1 
ATOM   3660 C CG  . LYS A 1 478 ? 6.890   8.131   26.550  1.00 64.02  ? 478  LYS A CG  1 
ATOM   3661 C CD  . LYS A 1 478 ? 7.021   6.926   27.463  1.00 76.11  ? 478  LYS A CD  1 
ATOM   3662 C CE  . LYS A 1 478 ? 6.192   7.095   28.743  1.00 77.91  ? 478  LYS A CE  1 
ATOM   3663 N NZ  . LYS A 1 478 ? 6.368   8.419   29.423  1.00 75.07  ? 478  LYS A NZ  1 
ATOM   3664 N N   . TYR A 1 479 ? 9.657   7.131   23.076  1.00 39.00  ? 479  TYR A N   1 
ATOM   3665 C CA  . TYR A 1 479 ? 10.147  6.190   22.055  1.00 41.46  ? 479  TYR A CA  1 
ATOM   3666 C C   . TYR A 1 479 ? 11.558  5.749   22.370  1.00 36.43  ? 479  TYR A C   1 
ATOM   3667 O O   . TYR A 1 479 ? 11.844  4.562   22.335  1.00 37.57  ? 479  TYR A O   1 
ATOM   3668 C CB  . TYR A 1 479 ? 10.149  6.777   20.638  1.00 40.75  ? 479  TYR A CB  1 
ATOM   3669 C CG  . TYR A 1 479 ? 8.790   7.070   20.033  1.00 42.29  ? 479  TYR A CG  1 
ATOM   3670 C CD1 . TYR A 1 479 ? 7.719   6.198   20.190  1.00 38.58  ? 479  TYR A CD1 1 
ATOM   3671 C CD2 . TYR A 1 479 ? 8.600   8.214   19.266  1.00 41.80  ? 479  TYR A CD2 1 
ATOM   3672 C CE1 . TYR A 1 479 ? 6.472   6.483   19.607  1.00 39.11  ? 479  TYR A CE1 1 
ATOM   3673 C CE2 . TYR A 1 479 ? 7.395   8.505   18.687  1.00 43.56  ? 479  TYR A CE2 1 
ATOM   3674 C CZ  . TYR A 1 479 ? 6.323   7.647   18.865  1.00 47.19  ? 479  TYR A CZ  1 
ATOM   3675 O OH  . TYR A 1 479 ? 5.126   7.980   18.277  1.00 46.44  ? 479  TYR A OH  1 
ATOM   3676 N N   . TRP A 1 480 ? 12.438  6.712   22.667  1.00 35.66  ? 480  TRP A N   1 
ATOM   3677 C CA  . TRP A 1 480 ? 13.862  6.424   22.873  1.00 37.92  ? 480  TRP A CA  1 
ATOM   3678 C C   . TRP A 1 480 ? 14.056  5.566   24.144  1.00 37.49  ? 480  TRP A C   1 
ATOM   3679 O O   . TRP A 1 480 ? 14.805  4.570   24.143  1.00 34.64  ? 480  TRP A O   1 
ATOM   3680 C CB  . TRP A 1 480 ? 14.681  7.735   22.950  1.00 32.90  ? 480  TRP A CB  1 
ATOM   3681 C CG  . TRP A 1 480 ? 15.416  8.138   21.671  1.00 34.99  ? 480  TRP A CG  1 
ATOM   3682 C CD1 . TRP A 1 480 ? 16.774  8.338   21.534  1.00 32.56  ? 480  TRP A CD1 1 
ATOM   3683 C CD2 . TRP A 1 480 ? 14.844  8.391   20.369  1.00 31.61  ? 480  TRP A CD2 1 
ATOM   3684 N NE1 . TRP A 1 480 ? 17.073  8.686   20.235  1.00 34.63  ? 480  TRP A NE1 1 
ATOM   3685 C CE2 . TRP A 1 480 ? 15.912  8.732   19.503  1.00 31.91  ? 480  TRP A CE2 1 
ATOM   3686 C CE3 . TRP A 1 480 ? 13.537  8.354   19.853  1.00 35.03  ? 480  TRP A CE3 1 
ATOM   3687 C CZ2 . TRP A 1 480 ? 15.715  9.038   18.153  1.00 31.12  ? 480  TRP A CZ2 1 
ATOM   3688 C CZ3 . TRP A 1 480 ? 13.341  8.656   18.510  1.00 33.74  ? 480  TRP A CZ3 1 
ATOM   3689 C CH2 . TRP A 1 480 ? 14.431  8.995   17.675  1.00 39.42  ? 480  TRP A CH2 1 
ATOM   3690 N N   . THR A 1 481 ? 13.358  5.927   25.220  1.00 35.22  ? 481  THR A N   1 
ATOM   3691 C CA  . THR A 1 481 ? 13.474  5.149   26.457  1.00 35.96  ? 481  THR A CA  1 
ATOM   3692 C C   . THR A 1 481 ? 12.766  3.787   26.389  1.00 40.53  ? 481  THR A C   1 
ATOM   3693 O O   . THR A 1 481 ? 13.280  2.804   26.939  1.00 42.66  ? 481  THR A O   1 
ATOM   3694 C CB  . THR A 1 481 ? 13.113  5.969   27.729  1.00 36.57  ? 481  THR A CB  1 
ATOM   3695 O OG1 . THR A 1 481 ? 11.785  6.500   27.622  1.00 42.14  ? 481  THR A OG1 1 
ATOM   3696 C CG2 . THR A 1 481 ? 14.068  7.131   27.867  1.00 36.36  ? 481  THR A CG2 1 
ATOM   3697 N N   . ASN A 1 482 ? 11.619  3.702   25.707  1.00 39.66  ? 482  ASN A N   1 
ATOM   3698 C CA  . ASN A 1 482 ? 11.036  2.371   25.443  1.00 40.77  ? 482  ASN A CA  1 
ATOM   3699 C C   . ASN A 1 482 ? 12.047  1.502   24.713  1.00 41.31  ? 482  ASN A C   1 
ATOM   3700 O O   . ASN A 1 482 ? 12.260  0.344   25.077  1.00 37.87  ? 482  ASN A O   1 
ATOM   3701 C CB  . ASN A 1 482 ? 9.753   2.441   24.615  1.00 40.15  ? 482  ASN A CB  1 
ATOM   3702 C CG  . ASN A 1 482 ? 8.569   2.923   25.419  1.00 45.63  ? 482  ASN A CG  1 
ATOM   3703 O OD1 . ASN A 1 482 ? 8.616   2.949   26.648  1.00 41.30  ? 482  ASN A OD1 1 
ATOM   3704 N ND2 . ASN A 1 482 ? 7.506   3.318   24.733  1.00 47.58  ? 482  ASN A ND2 1 
ATOM   3705 N N   . PHE A 1 483 ? 12.668  2.074   23.679  1.00 38.43  ? 483  PHE A N   1 
ATOM   3706 C CA  . PHE A 1 483 ? 13.658  1.337   22.904  1.00 41.28  ? 483  PHE A CA  1 
ATOM   3707 C C   . PHE A 1 483 ? 14.841  0.881   23.783  1.00 43.64  ? 483  PHE A C   1 
ATOM   3708 O O   . PHE A 1 483 ? 15.270  -0.286  23.729  1.00 38.48  ? 483  PHE A O   1 
ATOM   3709 C CB  . PHE A 1 483 ? 14.162  2.151   21.699  1.00 35.10  ? 483  PHE A CB  1 
ATOM   3710 C CG  . PHE A 1 483 ? 15.233  1.451   20.944  1.00 36.09  ? 483  PHE A CG  1 
ATOM   3711 C CD1 . PHE A 1 483 ? 14.919  0.357   20.122  1.00 37.04  ? 483  PHE A CD1 1 
ATOM   3712 C CD2 . PHE A 1 483 ? 16.561  1.797   21.124  1.00 33.81  ? 483  PHE A CD2 1 
ATOM   3713 C CE1 . PHE A 1 483 ? 15.910  -0.338  19.443  1.00 36.04  ? 483  PHE A CE1 1 
ATOM   3714 C CE2 . PHE A 1 483 ? 17.572  1.101   20.439  1.00 36.04  ? 483  PHE A CE2 1 
ATOM   3715 C CZ  . PHE A 1 483 ? 17.245  0.039   19.593  1.00 35.03  ? 483  PHE A CZ  1 
ATOM   3716 N N   . ALA A 1 484 ? 15.368  1.797   24.593  1.00 38.05  ? 484  ALA A N   1 
ATOM   3717 C CA  . ALA A 1 484 ? 16.432  1.436   25.530  1.00 39.31  ? 484  ALA A CA  1 
ATOM   3718 C C   . ALA A 1 484 ? 15.995  0.302   26.465  1.00 47.79  ? 484  ALA A C   1 
ATOM   3719 O O   . ALA A 1 484 ? 16.772  -0.626  26.725  1.00 39.59  ? 484  ALA A O   1 
ATOM   3720 C CB  . ALA A 1 484 ? 16.896  2.642   26.340  1.00 31.33  ? 484  ALA A CB  1 
ATOM   3721 N N   . ARG A 1 485 ? 14.761  0.380   26.965  1.00 45.56  ? 485  ARG A N   1 
ATOM   3722 C CA  . ARG A 1 485 ? 14.270  -0.600  27.947  1.00 50.62  ? 485  ARG A CA  1 
ATOM   3723 C C   . ARG A 1 485 ? 14.063  -1.995  27.343  1.00 48.94  ? 485  ARG A C   1 
ATOM   3724 O O   . ARG A 1 485 ? 14.416  -2.984  27.962  1.00 50.78  ? 485  ARG A O   1 
ATOM   3725 C CB  . ARG A 1 485 ? 12.961  -0.140  28.625  1.00 57.80  ? 485  ARG A CB  1 
ATOM   3726 C CG  . ARG A 1 485 ? 13.110  0.903   29.745  1.00 70.97  ? 485  ARG A CG  1 
ATOM   3727 C CD  . ARG A 1 485 ? 11.738  1.344   30.342  1.00 85.87  ? 485  ARG A CD  1 
ATOM   3728 N NE  . ARG A 1 485 ? 11.010  2.273   29.467  1.00 85.91  ? 485  ARG A NE  1 
ATOM   3729 C CZ  . ARG A 1 485 ? 10.904  3.594   29.659  1.00 76.67  ? 485  ARG A CZ  1 
ATOM   3730 N NH1 . ARG A 1 485 ? 11.451  4.172   30.725  1.00 68.38  ? 485  ARG A NH1 1 
ATOM   3731 N NH2 . ARG A 1 485 ? 10.229  4.344   28.786  1.00 65.98  ? 485  ARG A NH2 1 
ATOM   3732 N N   . THR A 1 486 ? 13.512  -2.066  26.135  1.00 43.68  ? 486  THR A N   1 
ATOM   3733 C CA  . THR A 1 486 ? 12.994  -3.334  25.598  1.00 49.04  ? 486  THR A CA  1 
ATOM   3734 C C   . THR A 1 486 ? 13.476  -3.658  24.185  1.00 48.91  ? 486  THR A C   1 
ATOM   3735 O O   . THR A 1 486 ? 13.245  -4.744  23.682  1.00 48.69  ? 486  THR A O   1 
ATOM   3736 C CB  . THR A 1 486 ? 11.458  -3.289  25.492  1.00 44.78  ? 486  THR A CB  1 
ATOM   3737 O OG1 . THR A 1 486 ? 11.095  -2.373  24.450  1.00 45.90  ? 486  THR A OG1 1 
ATOM   3738 C CG2 . THR A 1 486 ? 10.820  -2.836  26.824  1.00 34.23  ? 486  THR A CG2 1 
ATOM   3739 N N   . GLY A 1 487 ? 14.111  -2.702  23.524  1.00 48.18  ? 487  GLY A N   1 
ATOM   3740 C CA  . GLY A 1 487 ? 14.519  -2.912  22.146  1.00 45.63  ? 487  GLY A CA  1 
ATOM   3741 C C   . GLY A 1 487 ? 13.406  -2.625  21.156  1.00 48.17  ? 487  GLY A C   1 
ATOM   3742 O O   . GLY A 1 487 ? 13.528  -2.969  19.980  1.00 51.19  ? 487  GLY A O   1 
ATOM   3743 N N   . ASP A 1 488 ? 12.341  -1.970  21.628  1.00 43.75  ? 488  ASP A N   1 
ATOM   3744 C CA  . ASP A 1 488 ? 11.149  -1.683  20.816  1.00 45.81  ? 488  ASP A CA  1 
ATOM   3745 C C   . ASP A 1 488 ? 10.603  -0.291  21.198  1.00 39.78  ? 488  ASP A C   1 
ATOM   3746 O O   . ASP A 1 488 ? 10.264  -0.065  22.347  1.00 43.18  ? 488  ASP A O   1 
ATOM   3747 C CB  . ASP A 1 488 ? 10.092  -2.782  21.062  1.00 47.34  ? 488  ASP A CB  1 
ATOM   3748 C CG  . ASP A 1 488 ? 8.831   -2.643  20.175  1.00 52.63  ? 488  ASP A CG  1 
ATOM   3749 O OD1 . ASP A 1 488 ? 8.582   -1.561  19.601  1.00 53.20  ? 488  ASP A OD1 1 
ATOM   3750 O OD2 . ASP A 1 488 ? 8.065   -3.640  20.071  1.00 51.76  ? 488  ASP A OD2 1 
ATOM   3751 N N   . PRO A 1 489 ? 10.528  0.645   20.235  1.00 42.81  ? 489  PRO A N   1 
ATOM   3752 C CA  . PRO A 1 489 ? 10.089  2.009   20.578  1.00 44.39  ? 489  PRO A CA  1 
ATOM   3753 C C   . PRO A 1 489 ? 8.602   2.080   20.955  1.00 48.06  ? 489  PRO A C   1 
ATOM   3754 O O   . PRO A 1 489 ? 8.158   3.055   21.567  1.00 47.69  ? 489  PRO A O   1 
ATOM   3755 C CB  . PRO A 1 489 ? 10.314  2.812   19.285  1.00 37.54  ? 489  PRO A CB  1 
ATOM   3756 C CG  . PRO A 1 489 ? 10.744  1.836   18.237  1.00 41.94  ? 489  PRO A CG  1 
ATOM   3757 C CD  . PRO A 1 489 ? 10.738  0.454   18.789  1.00 40.45  ? 489  PRO A CD  1 
ATOM   3758 N N   . ASN A 1 490 ? 7.836   1.068   20.570  1.00 42.99  ? 490  ASN A N   1 
ATOM   3759 C CA  . ASN A 1 490 ? 6.390   1.079   20.814  1.00 49.81  ? 490  ASN A CA  1 
ATOM   3760 C C   . ASN A 1 490 ? 6.054   0.859   22.284  1.00 55.83  ? 490  ASN A C   1 
ATOM   3761 O O   . ASN A 1 490 ? 6.746   0.113   22.978  1.00 58.29  ? 490  ASN A O   1 
ATOM   3762 C CB  . ASN A 1 490 ? 5.691   0.009   19.956  1.00 41.92  ? 490  ASN A CB  1 
ATOM   3763 C CG  . ASN A 1 490 ? 5.830   0.275   18.471  1.00 47.21  ? 490  ASN A CG  1 
ATOM   3764 O OD1 . ASN A 1 490 ? 5.276   1.248   17.938  1.00 57.39  ? 490  ASN A OD1 1 
ATOM   3765 N ND2 . ASN A 1 490 ? 6.579   -0.577  17.794  1.00 41.41  ? 490  ASN A ND2 1 
ATOM   3766 N N   . ASP A 1 491 ? 4.997   1.514   22.753  1.00 67.20  ? 491  ASP A N   1 
ATOM   3767 C CA  . ASP A 1 491 ? 4.463   1.265   24.094  1.00 81.01  ? 491  ASP A CA  1 
ATOM   3768 C C   . ASP A 1 491 ? 3.443   0.116   24.059  1.00 81.74  ? 491  ASP A C   1 
ATOM   3769 O O   . ASP A 1 491 ? 2.458   0.179   23.322  1.00 76.99  ? 491  ASP A O   1 
ATOM   3770 C CB  . ASP A 1 491 ? 3.816   2.541   24.647  1.00 95.42  ? 491  ASP A CB  1 
ATOM   3771 C CG  . ASP A 1 491 ? 3.471   2.438   26.130  1.00 107.90 ? 491  ASP A CG  1 
ATOM   3772 O OD1 . ASP A 1 491 ? 2.948   3.431   26.686  1.00 110.04 ? 491  ASP A OD1 1 
ATOM   3773 O OD2 . ASP A 1 491 ? 3.725   1.373   26.740  1.00 110.63 ? 491  ASP A OD2 1 
ATOM   3774 N N   . PRO A 1 492 ? 3.683   -0.946  24.850  1.00 91.21  ? 492  PRO A N   1 
ATOM   3775 C CA  . PRO A 1 492 ? 2.766   -2.100  24.908  1.00 97.89  ? 492  PRO A CA  1 
ATOM   3776 C C   . PRO A 1 492 ? 1.395   -1.726  25.472  1.00 103.51 ? 492  PRO A C   1 
ATOM   3777 O O   . PRO A 1 492 ? 0.365   -2.218  25.008  1.00 100.54 ? 492  PRO A O   1 
ATOM   3778 C CB  . PRO A 1 492 ? 3.468   -3.067  25.869  1.00 94.88  ? 492  PRO A CB  1 
ATOM   3779 C CG  . PRO A 1 492 ? 4.894   -2.601  25.932  1.00 93.87  ? 492  PRO A CG  1 
ATOM   3780 C CD  . PRO A 1 492 ? 4.859   -1.124  25.719  1.00 89.37  ? 492  PRO A CD  1 
ATOM   3781 N N   . ARG A 1 493 ? 1.403   -0.847  26.469  1.00 114.56 ? 493  ARG A N   1 
ATOM   3782 C CA  . ARG A 1 493 ? 0.192   -0.401  27.147  1.00 126.01 ? 493  ARG A CA  1 
ATOM   3783 C C   . ARG A 1 493 ? -0.478  0.730   26.371  1.00 128.65 ? 493  ARG A C   1 
ATOM   3784 O O   . ARG A 1 493 ? -0.917  1.720   26.962  1.00 125.46 ? 493  ARG A O   1 
ATOM   3785 C CB  . ARG A 1 493 ? 0.555   0.088   28.549  1.00 132.98 ? 493  ARG A CB  1 
ATOM   3786 C CG  . ARG A 1 493 ? -0.503  -0.133  29.617  1.00 139.97 ? 493  ARG A CG  1 
ATOM   3787 C CD  . ARG A 1 493 ? 0.033   0.279   30.985  1.00 143.38 ? 493  ARG A CD  1 
ATOM   3788 N NE  . ARG A 1 493 ? 1.374   -0.252  31.226  1.00 144.98 ? 493  ARG A NE  1 
ATOM   3789 C CZ  . ARG A 1 493 ? 2.501   0.409   30.975  1.00 144.38 ? 493  ARG A CZ  1 
ATOM   3790 N NH1 . ARG A 1 493 ? 2.458   1.637   30.477  1.00 143.81 ? 493  ARG A NH1 1 
ATOM   3791 N NH2 . ARG A 1 493 ? 3.674   -0.158  31.222  1.00 143.15 ? 493  ARG A NH2 1 
ATOM   3792 N N   . ASP A 1 494 ? -0.547  0.581   25.049  1.00 133.25 ? 494  ASP A N   1 
ATOM   3793 C CA  . ASP A 1 494 ? -1.128  1.604   24.178  1.00 134.22 ? 494  ASP A CA  1 
ATOM   3794 C C   . ASP A 1 494 ? -1.194  1.142   22.723  1.00 138.09 ? 494  ASP A C   1 
ATOM   3795 O O   . ASP A 1 494 ? -0.423  1.603   21.879  1.00 136.72 ? 494  ASP A O   1 
ATOM   3796 C CB  . ASP A 1 494 ? -0.333  2.910   24.274  1.00 128.65 ? 494  ASP A CB  1 
ATOM   3797 C CG  . ASP A 1 494 ? -0.868  3.987   23.352  1.00 124.80 ? 494  ASP A CG  1 
ATOM   3798 O OD1 . ASP A 1 494 ? -1.992  3.824   22.835  1.00 123.86 ? 494  ASP A OD1 1 
ATOM   3799 O OD2 . ASP A 1 494 ? -0.164  4.998   23.144  1.00 123.52 ? 494  ASP A OD2 1 
ATOM   3800 N N   . SER A 1 495 ? -2.122  0.237   22.434  1.00 143.24 ? 495  SER A N   1 
ATOM   3801 C CA  . SER A 1 495 ? -2.293  -0.273  21.078  1.00 145.96 ? 495  SER A CA  1 
ATOM   3802 C C   . SER A 1 495 ? -3.074  0.701   20.192  1.00 143.80 ? 495  SER A C   1 
ATOM   3803 O O   . SER A 1 495 ? -3.177  0.502   18.981  1.00 143.81 ? 495  SER A O   1 
ATOM   3804 C CB  . SER A 1 495 ? -2.975  -1.643  21.104  1.00 150.27 ? 495  SER A CB  1 
ATOM   3805 O OG  . SER A 1 495 ? -4.095  -1.639  21.972  1.00 152.48 ? 495  SER A OG  1 
ATOM   3806 N N   . LYS A 1 496 ? -3.611  1.756   20.804  1.00 140.37 ? 496  LYS A N   1 
ATOM   3807 C CA  . LYS A 1 496 ? -4.368  2.782   20.083  1.00 134.12 ? 496  LYS A CA  1 
ATOM   3808 C C   . LYS A 1 496 ? -3.482  3.628   19.157  1.00 125.56 ? 496  LYS A C   1 
ATOM   3809 O O   . LYS A 1 496 ? -3.763  3.750   17.962  1.00 124.09 ? 496  LYS A O   1 
ATOM   3810 C CB  . LYS A 1 496 ? -5.121  3.684   21.066  1.00 132.62 ? 496  LYS A CB  1 
ATOM   3811 N N   . SER A 1 497 ? -2.425  4.216   19.718  1.00 116.06 ? 497  SER A N   1 
ATOM   3812 C CA  . SER A 1 497 ? -1.450  4.978   18.937  1.00 103.31 ? 497  SER A CA  1 
ATOM   3813 C C   . SER A 1 497 ? -0.888  4.140   17.790  1.00 92.49  ? 497  SER A C   1 
ATOM   3814 O O   . SER A 1 497 ? -0.640  2.941   17.958  1.00 90.74  ? 497  SER A O   1 
ATOM   3815 C CB  . SER A 1 497 ? -0.300  5.455   19.828  1.00 99.35  ? 497  SER A CB  1 
ATOM   3816 O OG  . SER A 1 497 ? -0.675  6.561   20.628  1.00 98.25  ? 497  SER A OG  1 
ATOM   3817 N N   . PRO A 1 498 ? -0.680  4.769   16.619  1.00 81.28  ? 498  PRO A N   1 
ATOM   3818 C CA  . PRO A 1 498 ? -0.117  4.054   15.468  1.00 75.41  ? 498  PRO A CA  1 
ATOM   3819 C C   . PRO A 1 498 ? 1.182   3.360   15.866  1.00 66.65  ? 498  PRO A C   1 
ATOM   3820 O O   . PRO A 1 498 ? 1.913   3.869   16.716  1.00 62.05  ? 498  PRO A O   1 
ATOM   3821 C CB  . PRO A 1 498 ? 0.148   5.169   14.454  1.00 78.73  ? 498  PRO A CB  1 
ATOM   3822 C CG  . PRO A 1 498 ? -0.822  6.246   14.820  1.00 80.70  ? 498  PRO A CG  1 
ATOM   3823 C CD  . PRO A 1 498 ? -0.940  6.187   16.320  1.00 79.94  ? 498  PRO A CD  1 
ATOM   3824 N N   . GLN A 1 499 ? 1.441   2.194   15.285  1.00 65.30  ? 499  GLN A N   1 
ATOM   3825 C CA  . GLN A 1 499 ? 2.605   1.399   15.648  1.00 59.12  ? 499  GLN A CA  1 
ATOM   3826 C C   . GLN A 1 499 ? 3.776   1.723   14.744  1.00 57.07  ? 499  GLN A C   1 
ATOM   3827 O O   . GLN A 1 499 ? 3.601   2.088   13.588  1.00 57.98  ? 499  GLN A O   1 
ATOM   3828 C CB  . GLN A 1 499 ? 2.295   -0.100  15.578  1.00 61.26  ? 499  GLN A CB  1 
ATOM   3829 C CG  . GLN A 1 499 ? 1.278   -0.577  16.624  1.00 68.66  ? 499  GLN A CG  1 
ATOM   3830 C CD  . GLN A 1 499 ? 1.694   -0.236  18.054  1.00 67.55  ? 499  GLN A CD  1 
ATOM   3831 O OE1 . GLN A 1 499 ? 2.578   -0.878  18.627  1.00 66.98  ? 499  GLN A OE1 1 
ATOM   3832 N NE2 . GLN A 1 499 ? 1.047   0.773   18.637  1.00 64.76  ? 499  GLN A NE2 1 
ATOM   3833 N N   . TRP A 1 500 ? 4.972   1.587   15.297  1.00 54.95  ? 500  TRP A N   1 
ATOM   3834 C CA  . TRP A 1 500 ? 6.208   1.794   14.566  1.00 45.52  ? 500  TRP A CA  1 
ATOM   3835 C C   . TRP A 1 500 ? 6.723   0.423   14.160  1.00 46.16  ? 500  TRP A C   1 
ATOM   3836 O O   . TRP A 1 500 ? 7.250   -0.316  15.005  1.00 44.76  ? 500  TRP A O   1 
ATOM   3837 C CB  . TRP A 1 500 ? 7.215   2.478   15.490  1.00 41.86  ? 500  TRP A CB  1 
ATOM   3838 C CG  . TRP A 1 500 ? 8.491   2.938   14.846  1.00 43.53  ? 500  TRP A CG  1 
ATOM   3839 C CD1 . TRP A 1 500 ? 9.080   2.444   13.713  1.00 44.93  ? 500  TRP A CD1 1 
ATOM   3840 C CD2 . TRP A 1 500 ? 9.359   3.961   15.338  1.00 39.05  ? 500  TRP A CD2 1 
ATOM   3841 N NE1 . TRP A 1 500 ? 10.260  3.118   13.460  1.00 48.75  ? 500  TRP A NE1 1 
ATOM   3842 C CE2 . TRP A 1 500 ? 10.449  4.056   14.444  1.00 44.80  ? 500  TRP A CE2 1 
ATOM   3843 C CE3 . TRP A 1 500 ? 9.313   4.817   16.441  1.00 35.82  ? 500  TRP A CE3 1 
ATOM   3844 C CZ2 . TRP A 1 500 ? 11.485  4.969   14.627  1.00 42.54  ? 500  TRP A CZ2 1 
ATOM   3845 C CZ3 . TRP A 1 500 ? 10.343  5.727   16.620  1.00 37.79  ? 500  TRP A CZ3 1 
ATOM   3846 C CH2 . TRP A 1 500 ? 11.417  5.792   15.720  1.00 39.88  ? 500  TRP A CH2 1 
ATOM   3847 N N   . PRO A 1 501 ? 6.570   0.068   12.871  1.00 43.36  ? 501  PRO A N   1 
ATOM   3848 C CA  . PRO A 1 501 ? 7.000   -1.256  12.412  1.00 43.90  ? 501  PRO A CA  1 
ATOM   3849 C C   . PRO A 1 501 ? 8.512   -1.269  12.210  1.00 45.60  ? 501  PRO A C   1 
ATOM   3850 O O   . PRO A 1 501 ? 9.083   -0.217  11.915  1.00 43.03  ? 501  PRO A O   1 
ATOM   3851 C CB  . PRO A 1 501 ? 6.318   -1.399  11.044  1.00 44.71  ? 501  PRO A CB  1 
ATOM   3852 C CG  . PRO A 1 501 ? 5.816   -0.003  10.669  1.00 45.78  ? 501  PRO A CG  1 
ATOM   3853 C CD  . PRO A 1 501 ? 6.191   0.948   11.752  1.00 46.62  ? 501  PRO A CD  1 
ATOM   3854 N N   . PRO A 1 502 ? 9.145   -2.440  12.353  1.00 43.55  ? 502  PRO A N   1 
ATOM   3855 C CA  . PRO A 1 502 ? 10.566  -2.614  12.019  1.00 38.98  ? 502  PRO A CA  1 
ATOM   3856 C C   . PRO A 1 502 ? 10.857  -2.390  10.533  1.00 46.54  ? 502  PRO A C   1 
ATOM   3857 O O   . PRO A 1 502 ? 10.032  -2.685  9.666   1.00 42.08  ? 502  PRO A O   1 
ATOM   3858 C CB  . PRO A 1 502 ? 10.831  -4.085  12.338  1.00 38.15  ? 502  PRO A CB  1 
ATOM   3859 C CG  . PRO A 1 502 ? 9.739   -4.482  13.320  1.00 45.00  ? 502  PRO A CG  1 
ATOM   3860 C CD  . PRO A 1 502 ? 8.543   -3.658  12.931  1.00 44.09  ? 502  PRO A CD  1 
ATOM   3861 N N   . TYR A 1 503 ? 12.046  -1.872  10.254  1.00 45.63  ? 503  TYR A N   1 
ATOM   3862 C CA  . TYR A 1 503 ? 12.536  -1.731  8.902   1.00 38.27  ? 503  TYR A CA  1 
ATOM   3863 C C   . TYR A 1 503 ? 12.994  -3.100  8.419   1.00 40.18  ? 503  TYR A C   1 
ATOM   3864 O O   . TYR A 1 503 ? 13.678  -3.814  9.148   1.00 45.47  ? 503  TYR A O   1 
ATOM   3865 C CB  . TYR A 1 503 ? 13.722  -0.745  8.898   1.00 35.78  ? 503  TYR A CB  1 
ATOM   3866 C CG  . TYR A 1 503 ? 14.263  -0.472  7.521   1.00 37.64  ? 503  TYR A CG  1 
ATOM   3867 C CD1 . TYR A 1 503 ? 15.303  -1.231  6.996   1.00 40.61  ? 503  TYR A CD1 1 
ATOM   3868 C CD2 . TYR A 1 503 ? 13.728  0.540   6.735   1.00 45.84  ? 503  TYR A CD2 1 
ATOM   3869 C CE1 . TYR A 1 503 ? 15.811  -0.978  5.711   1.00 40.63  ? 503  TYR A CE1 1 
ATOM   3870 C CE2 . TYR A 1 503 ? 14.220  0.798   5.461   1.00 49.60  ? 503  TYR A CE2 1 
ATOM   3871 C CZ  . TYR A 1 503 ? 15.259  0.036   4.956   1.00 46.99  ? 503  TYR A CZ  1 
ATOM   3872 O OH  . TYR A 1 503 ? 15.739  0.294   3.698   1.00 53.32  ? 503  TYR A OH  1 
ATOM   3873 N N   . THR A 1 504 ? 12.632  -3.457  7.189   1.00 46.35  ? 504  THR A N   1 
ATOM   3874 C CA  . THR A 1 504 ? 13.013  -4.737  6.598   1.00 51.84  ? 504  THR A CA  1 
ATOM   3875 C C   . THR A 1 504 ? 13.434  -4.534  5.156   1.00 49.87  ? 504  THR A C   1 
ATOM   3876 O O   . THR A 1 504 ? 13.090  -3.534  4.537   1.00 43.53  ? 504  THR A O   1 
ATOM   3877 C CB  . THR A 1 504 ? 11.847  -5.740  6.591   1.00 56.09  ? 504  THR A CB  1 
ATOM   3878 O OG1 . THR A 1 504 ? 10.730  -5.166  5.898   1.00 53.46  ? 504  THR A OG1 1 
ATOM   3879 C CG2 . THR A 1 504 ? 11.447  -6.099  8.003   1.00 51.50  ? 504  THR A CG2 1 
ATOM   3880 N N   . THR A 1 505 ? 14.181  -5.476  4.605   1.00 51.24  ? 505  THR A N   1 
ATOM   3881 C CA  . THR A 1 505 ? 14.599  -5.312  3.222   1.00 58.17  ? 505  THR A CA  1 
ATOM   3882 C C   . THR A 1 505 ? 13.401  -5.394  2.279   1.00 59.20  ? 505  THR A C   1 
ATOM   3883 O O   . THR A 1 505 ? 13.357  -4.706  1.263   1.00 59.41  ? 505  THR A O   1 
ATOM   3884 C CB  . THR A 1 505 ? 15.701  -6.309  2.822   1.00 63.60  ? 505  THR A CB  1 
ATOM   3885 O OG1 . THR A 1 505 ? 15.276  -7.644  3.110   1.00 60.23  ? 505  THR A OG1 1 
ATOM   3886 C CG2 . THR A 1 505 ? 16.979  -6.013  3.609   1.00 65.06  ? 505  THR A CG2 1 
ATOM   3887 N N   . ALA A 1 506 ? 12.408  -6.199  2.642   1.00 57.84  ? 506  ALA A N   1 
ATOM   3888 C CA  . ALA A 1 506 ? 11.246  -6.380  1.784   1.00 58.43  ? 506  ALA A CA  1 
ATOM   3889 C C   . ALA A 1 506 ? 10.354  -5.150  1.736   1.00 65.01  ? 506  ALA A C   1 
ATOM   3890 O O   . ALA A 1 506 ? 9.986   -4.696  0.653   1.00 73.99  ? 506  ALA A O   1 
ATOM   3891 C CB  . ALA A 1 506 ? 10.442  -7.600  2.213   1.00 56.35  ? 506  ALA A CB  1 
ATOM   3892 N N   . ALA A 1 507 ? 10.000  -4.607  2.898   1.00 58.13  ? 507  ALA A N   1 
ATOM   3893 C CA  . ALA A 1 507 ? 8.998   -3.537  2.947   1.00 53.52  ? 507  ALA A CA  1 
ATOM   3894 C C   . ALA A 1 507 ? 9.593   -2.148  3.183   1.00 48.43  ? 507  ALA A C   1 
ATOM   3895 O O   . ALA A 1 507 ? 8.975   -1.138  2.851   1.00 54.17  ? 507  ALA A O   1 
ATOM   3896 C CB  . ALA A 1 507 ? 7.913   -3.858  3.995   1.00 50.93  ? 507  ALA A CB  1 
ATOM   3897 N N   . GLN A 1 508 ? 10.782  -2.098  3.770   1.00 42.53  ? 508  GLN A N   1 
ATOM   3898 C CA  . GLN A 1 508 ? 11.518  -0.833  3.942   1.00 45.26  ? 508  GLN A CA  1 
ATOM   3899 C C   . GLN A 1 508 ? 10.683  0.252   4.616   1.00 44.66  ? 508  GLN A C   1 
ATOM   3900 O O   . GLN A 1 508 ? 10.685  1.415   4.195   1.00 47.92  ? 508  GLN A O   1 
ATOM   3901 C CB  . GLN A 1 508 ? 12.049  -0.316  2.593   1.00 45.57  ? 508  GLN A CB  1 
ATOM   3902 C CG  . GLN A 1 508 ? 12.727  -1.378  1.729   1.00 50.80  ? 508  GLN A CG  1 
ATOM   3903 C CD  . GLN A 1 508 ? 13.142  -0.859  0.353   1.00 54.85  ? 508  GLN A CD  1 
ATOM   3904 O OE1 . GLN A 1 508 ? 13.773  0.197   0.231   1.00 48.28  ? 508  GLN A OE1 1 
ATOM   3905 N NE2 . GLN A 1 508 ? 12.796  -1.610  -0.687  1.00 56.32  ? 508  GLN A NE2 1 
ATOM   3906 N N   . GLN A 1 509 ? 9.973   -0.130  5.665   1.00 39.59  ? 509  GLN A N   1 
ATOM   3907 C CA  . GLN A 1 509 ? 9.158   0.810   6.411   1.00 44.41  ? 509  GLN A CA  1 
ATOM   3908 C C   . GLN A 1 509 ? 9.958   1.659   7.406   1.00 45.93  ? 509  GLN A C   1 
ATOM   3909 O O   . GLN A 1 509 ? 10.864  1.176   8.087   1.00 47.81  ? 509  GLN A O   1 
ATOM   3910 C CB  . GLN A 1 509 ? 8.045   0.061   7.145   1.00 50.59  ? 509  GLN A CB  1 
ATOM   3911 C CG  . GLN A 1 509 ? 7.021   -0.566  6.229   1.00 50.64  ? 509  GLN A CG  1 
ATOM   3912 C CD  . GLN A 1 509 ? 6.101   -1.502  6.968   1.00 54.73  ? 509  GLN A CD  1 
ATOM   3913 O OE1 . GLN A 1 509 ? 6.510   -2.581  7.406   1.00 51.86  ? 509  GLN A OE1 1 
ATOM   3914 N NE2 . GLN A 1 509 ? 4.852   -1.097  7.117   1.00 55.90  ? 509  GLN A NE2 1 
ATOM   3915 N N   . TYR A 1 510 ? 9.594   2.932   7.477   1.00 40.43  ? 510  TYR A N   1 
ATOM   3916 C CA  . TYR A 1 510 ? 10.104  3.849   8.483   1.00 41.12  ? 510  TYR A CA  1 
ATOM   3917 C C   . TYR A 1 510 ? 8.976   4.813   8.844   1.00 45.76  ? 510  TYR A C   1 
ATOM   3918 O O   . TYR A 1 510 ? 7.968   4.877   8.145   1.00 51.25  ? 510  TYR A O   1 
ATOM   3919 C CB  . TYR A 1 510 ? 11.315  4.617   7.936   1.00 33.68  ? 510  TYR A CB  1 
ATOM   3920 C CG  . TYR A 1 510 ? 11.002  5.511   6.759   1.00 38.61  ? 510  TYR A CG  1 
ATOM   3921 C CD1 . TYR A 1 510 ? 10.806  4.982   5.478   1.00 40.01  ? 510  TYR A CD1 1 
ATOM   3922 C CD2 . TYR A 1 510 ? 10.900  6.884   6.925   1.00 42.60  ? 510  TYR A CD2 1 
ATOM   3923 C CE1 . TYR A 1 510 ? 10.520  5.812   4.392   1.00 42.52  ? 510  TYR A CE1 1 
ATOM   3924 C CE2 . TYR A 1 510 ? 10.623  7.721   5.859   1.00 42.31  ? 510  TYR A CE2 1 
ATOM   3925 C CZ  . TYR A 1 510 ? 10.441  7.191   4.595   1.00 48.88  ? 510  TYR A CZ  1 
ATOM   3926 O OH  . TYR A 1 510 ? 10.176  8.058   3.552   1.00 45.43  ? 510  TYR A OH  1 
ATOM   3927 N N   . VAL A 1 511 ? 9.116   5.551   9.938   1.00 47.20  ? 511  VAL A N   1 
ATOM   3928 C CA  . VAL A 1 511 ? 8.053   6.471   10.317  1.00 37.93  ? 511  VAL A CA  1 
ATOM   3929 C C   . VAL A 1 511 ? 8.517   7.906   10.240  1.00 43.80  ? 511  VAL A C   1 
ATOM   3930 O O   . VAL A 1 511 ? 9.719   8.192   10.337  1.00 41.88  ? 511  VAL A O   1 
ATOM   3931 C CB  . VAL A 1 511 ? 7.513   6.191   11.728  1.00 41.85  ? 511  VAL A CB  1 
ATOM   3932 C CG1 . VAL A 1 511 ? 6.834   4.810   11.773  1.00 36.59  ? 511  VAL A CG1 1 
ATOM   3933 C CG2 . VAL A 1 511 ? 8.629   6.314   12.786  1.00 36.14  ? 511  VAL A CG2 1 
ATOM   3934 N N   . SER A 1 512 ? 7.559   8.804   10.036  1.00 40.62  ? 512  SER A N   1 
ATOM   3935 C CA  . SER A 1 512 ? 7.806   10.234  10.155  1.00 44.06  ? 512  SER A CA  1 
ATOM   3936 C C   . SER A 1 512 ? 7.620   10.681  11.613  1.00 43.39  ? 512  SER A C   1 
ATOM   3937 O O   . SER A 1 512 ? 6.625   10.342  12.260  1.00 42.72  ? 512  SER A O   1 
ATOM   3938 C CB  . SER A 1 512 ? 6.841   11.007  9.260   1.00 45.00  ? 512  SER A CB  1 
ATOM   3939 O OG  . SER A 1 512 ? 5.491   10.676  9.581   1.00 47.10  ? 512  SER A OG  1 
ATOM   3940 N N   . LEU A 1 513 ? 8.577   11.442  12.125  1.00 38.15  ? 513  LEU A N   1 
ATOM   3941 C CA  . LEU A 1 513 ? 8.459   12.052  13.449  1.00 35.25  ? 513  LEU A CA  1 
ATOM   3942 C C   . LEU A 1 513 ? 8.152   13.543  13.314  1.00 37.92  ? 513  LEU A C   1 
ATOM   3943 O O   . LEU A 1 513 ? 9.011   14.338  12.920  1.00 42.80  ? 513  LEU A O   1 
ATOM   3944 C CB  . LEU A 1 513 ? 9.742   11.838  14.267  1.00 38.66  ? 513  LEU A CB  1 
ATOM   3945 C CG  . LEU A 1 513 ? 10.178  10.397  14.546  1.00 37.31  ? 513  LEU A CG  1 
ATOM   3946 C CD1 . LEU A 1 513 ? 11.474  10.395  15.319  1.00 29.30  ? 513  LEU A CD1 1 
ATOM   3947 C CD2 . LEU A 1 513 ? 9.083   9.634   15.311  1.00 34.67  ? 513  LEU A CD2 1 
ATOM   3948 N N   . ASN A 1 514 ? 6.920   13.918  13.639  1.00 42.18  ? 514  ASN A N   1 
ATOM   3949 C CA  . ASN A 1 514 ? 6.507   15.309  13.618  1.00 43.15  ? 514  ASN A CA  1 
ATOM   3950 C C   . ASN A 1 514 ? 5.351   15.504  14.596  1.00 43.85  ? 514  ASN A C   1 
ATOM   3951 O O   . ASN A 1 514 ? 5.071   14.611  15.388  1.00 45.27  ? 514  ASN A O   1 
ATOM   3952 C CB  . ASN A 1 514 ? 6.135   15.766  12.197  1.00 41.91  ? 514  ASN A CB  1 
ATOM   3953 C CG  . ASN A 1 514 ? 5.140   14.830  11.508  1.00 48.08  ? 514  ASN A CG  1 
ATOM   3954 O OD1 . ASN A 1 514 ? 4.099   14.461  12.075  1.00 49.01  ? 514  ASN A OD1 1 
ATOM   3955 N ND2 . ASN A 1 514 ? 5.447   14.463  10.267  1.00 48.75  ? 514  ASN A ND2 1 
ATOM   3956 N N   . LEU A 1 515 ? 4.692   16.660  14.546  1.00 41.14  ? 515  LEU A N   1 
ATOM   3957 C CA  . LEU A 1 515 ? 3.628   16.965  15.509  1.00 45.89  ? 515  LEU A CA  1 
ATOM   3958 C C   . LEU A 1 515 ? 2.422   16.055  15.333  1.00 42.96  ? 515  LEU A C   1 
ATOM   3959 O O   . LEU A 1 515 ? 1.683   15.836  16.264  1.00 47.52  ? 515  LEU A O   1 
ATOM   3960 C CB  . LEU A 1 515 ? 3.197   18.427  15.417  1.00 43.61  ? 515  LEU A CB  1 
ATOM   3961 C CG  . LEU A 1 515 ? 4.347   19.425  15.586  1.00 50.25  ? 515  LEU A CG  1 
ATOM   3962 C CD1 . LEU A 1 515 ? 3.819   20.842  15.648  1.00 45.32  ? 515  LEU A CD1 1 
ATOM   3963 C CD2 . LEU A 1 515 ? 5.191   19.095  16.830  1.00 47.86  ? 515  LEU A CD2 1 
ATOM   3964 N N   . LYS A 1 516 ? 2.247   15.506  14.140  1.00 49.24  ? 516  LYS A N   1 
ATOM   3965 C CA  . LYS A 1 516 ? 1.119   14.613  13.870  1.00 51.41  ? 516  LYS A CA  1 
ATOM   3966 C C   . LYS A 1 516 ? 1.469   13.197  14.312  1.00 49.35  ? 516  LYS A C   1 
ATOM   3967 O O   . LYS A 1 516 ? 2.637   12.888  14.512  1.00 50.62  ? 516  LYS A O   1 
ATOM   3968 C CB  . LYS A 1 516 ? 0.790   14.641  12.380  1.00 49.10  ? 516  LYS A CB  1 
ATOM   3969 C CG  . LYS A 1 516 ? 0.485   16.032  11.845  1.00 57.13  ? 516  LYS A CG  1 
ATOM   3970 C CD  . LYS A 1 516 ? 0.654   16.082  10.319  1.00 69.86  ? 516  LYS A CD  1 
ATOM   3971 C CE  . LYS A 1 516 ? -0.157  14.984  9.617   1.00 81.28  ? 516  LYS A CE  1 
ATOM   3972 N NZ  . LYS A 1 516 ? 0.076   14.936  8.133   1.00 83.96  ? 516  LYS A NZ  1 
ATOM   3973 N N   . PRO A 1 517 ? 0.460   12.333  14.475  1.00 52.30  ? 517  PRO A N   1 
ATOM   3974 C CA  . PRO A 1 517 ? 0.744   10.966  14.936  1.00 47.47  ? 517  PRO A CA  1 
ATOM   3975 C C   . PRO A 1 517 ? 1.602   10.214  13.928  1.00 48.23  ? 517  PRO A C   1 
ATOM   3976 O O   . PRO A 1 517 ? 1.580   10.557  12.741  1.00 47.08  ? 517  PRO A O   1 
ATOM   3977 C CB  . PRO A 1 517 ? -0.654  10.326  15.034  1.00 49.82  ? 517  PRO A CB  1 
ATOM   3978 C CG  . PRO A 1 517 ? -1.594  11.497  15.231  1.00 47.46  ? 517  PRO A CG  1 
ATOM   3979 C CD  . PRO A 1 517 ? -0.988  12.605  14.378  1.00 48.42  ? 517  PRO A CD  1 
ATOM   3980 N N   . LEU A 1 518 ? 2.341   9.206   14.388  1.00 46.31  ? 518  LEU A N   1 
ATOM   3981 C CA  . LEU A 1 518 ? 3.228   8.443   13.510  1.00 47.50  ? 518  LEU A CA  1 
ATOM   3982 C C   . LEU A 1 518 ? 2.565   8.073   12.191  1.00 51.02  ? 518  LEU A C   1 
ATOM   3983 O O   . LEU A 1 518 ? 1.469   7.502   12.170  1.00 56.72  ? 518  LEU A O   1 
ATOM   3984 C CB  . LEU A 1 518 ? 3.675   7.142   14.170  1.00 42.04  ? 518  LEU A CB  1 
ATOM   3985 C CG  . LEU A 1 518 ? 4.737   7.157   15.250  1.00 48.36  ? 518  LEU A CG  1 
ATOM   3986 C CD1 . LEU A 1 518 ? 5.132   5.723   15.508  1.00 49.43  ? 518  LEU A CD1 1 
ATOM   3987 C CD2 . LEU A 1 518 ? 5.935   7.992   14.838  1.00 42.26  ? 518  LEU A CD2 1 
ATOM   3988 N N   . GLU A 1 519 ? 3.246   8.372   11.095  1.00 49.20  ? 519  GLU A N   1 
ATOM   3989 C CA  . GLU A 1 519 ? 2.818   7.899   9.793   1.00 51.88  ? 519  GLU A CA  1 
ATOM   3990 C C   . GLU A 1 519 ? 3.893   6.985   9.211   1.00 53.46  ? 519  GLU A C   1 
ATOM   3991 O O   . GLU A 1 519 ? 5.080   7.302   9.247   1.00 56.31  ? 519  GLU A O   1 
ATOM   3992 C CB  . GLU A 1 519 ? 2.528   9.078   8.877   1.00 58.89  ? 519  GLU A CB  1 
ATOM   3993 C CG  . GLU A 1 519 ? 2.483   8.744   7.395   1.00 71.39  ? 519  GLU A CG  1 
ATOM   3994 C CD  . GLU A 1 519 ? 2.260   9.988   6.550   1.00 77.67  ? 519  GLU A CD  1 
ATOM   3995 O OE1 . GLU A 1 519 ? 1.343   10.771  6.905   1.00 87.11  ? 519  GLU A OE1 1 
ATOM   3996 O OE2 . GLU A 1 519 ? 3.000   10.189  5.554   1.00 68.67  ? 519  GLU A OE2 1 
ATOM   3997 N N   . VAL A 1 520 ? 3.475   5.829   8.718   1.00 45.81  ? 520  VAL A N   1 
ATOM   3998 C CA  . VAL A 1 520 ? 4.393   4.839   8.172   1.00 43.60  ? 520  VAL A CA  1 
ATOM   3999 C C   . VAL A 1 520 ? 4.646   5.132   6.703   1.00 46.89  ? 520  VAL A C   1 
ATOM   4000 O O   . VAL A 1 520 ? 3.710   5.346   5.950   1.00 51.80  ? 520  VAL A O   1 
ATOM   4001 C CB  . VAL A 1 520 ? 3.797   3.424   8.284   1.00 46.61  ? 520  VAL A CB  1 
ATOM   4002 C CG1 . VAL A 1 520 ? 4.705   2.413   7.600   1.00 44.88  ? 520  VAL A CG1 1 
ATOM   4003 C CG2 . VAL A 1 520 ? 3.532   3.066   9.765   1.00 39.24  ? 520  VAL A CG2 1 
ATOM   4004 N N   . ARG A 1 521 ? 5.913   5.162   6.301   1.00 48.57  ? 521  ARG A N   1 
ATOM   4005 C CA  . ARG A 1 521 ? 6.264   5.363   4.902   1.00 47.21  ? 521  ARG A CA  1 
ATOM   4006 C C   . ARG A 1 521 ? 7.158   4.223   4.433   1.00 43.70  ? 521  ARG A C   1 
ATOM   4007 O O   . ARG A 1 521 ? 7.668   3.455   5.249   1.00 43.77  ? 521  ARG A O   1 
ATOM   4008 C CB  . ARG A 1 521 ? 6.942   6.725   4.692   1.00 51.98  ? 521  ARG A CB  1 
ATOM   4009 C CG  . ARG A 1 521 ? 6.133   7.879   5.260   1.00 52.02  ? 521  ARG A CG  1 
ATOM   4010 C CD  . ARG A 1 521 ? 6.683   9.223   4.827   1.00 48.17  ? 521  ARG A CD  1 
ATOM   4011 N NE  . ARG A 1 521 ? 5.999   10.334  5.486   1.00 47.09  ? 521  ARG A NE  1 
ATOM   4012 C CZ  . ARG A 1 521 ? 6.579   11.500  5.756   1.00 51.86  ? 521  ARG A CZ  1 
ATOM   4013 N NH1 . ARG A 1 521 ? 7.856   11.696  5.428   1.00 41.70  ? 521  ARG A NH1 1 
ATOM   4014 N NH2 . ARG A 1 521 ? 5.895   12.463  6.365   1.00 46.86  ? 521  ARG A NH2 1 
ATOM   4015 N N   . ARG A 1 522 ? 7.344   4.111   3.122   1.00 45.02  ? 522  ARG A N   1 
ATOM   4016 C CA  . ARG A 1 522 ? 8.089   2.988   2.569   1.00 52.17  ? 522  ARG A CA  1 
ATOM   4017 C C   . ARG A 1 522 ? 9.232   3.441   1.656   1.00 47.69  ? 522  ARG A C   1 
ATOM   4018 O O   . ARG A 1 522 ? 9.049   4.280   0.782   1.00 46.58  ? 522  ARG A O   1 
ATOM   4019 C CB  . ARG A 1 522 ? 7.142   2.038   1.818   1.00 54.92  ? 522  ARG A CB  1 
ATOM   4020 C CG  . ARG A 1 522 ? 6.104   1.348   2.707   1.00 68.24  ? 522  ARG A CG  1 
ATOM   4021 C CD  . ARG A 1 522 ? 5.449   0.167   1.995   1.00 79.79  ? 522  ARG A CD  1 
ATOM   4022 N NE  . ARG A 1 522 ? 6.378   -0.456  1.052   1.00 95.80  ? 522  ARG A NE  1 
ATOM   4023 C CZ  . ARG A 1 522 ? 6.245   -1.680  0.544   1.00 102.96 ? 522  ARG A CZ  1 
ATOM   4024 N NH1 . ARG A 1 522 ? 5.214   -2.442  0.897   1.00 107.70 ? 522  ARG A NH1 1 
ATOM   4025 N NH2 . ARG A 1 522 ? 7.152   -2.146  -0.314  1.00 97.82  ? 522  ARG A NH2 1 
ATOM   4026 N N   . GLY A 1 523 ? 10.416  2.881   1.865   1.00 45.81  ? 523  GLY A N   1 
ATOM   4027 C CA  . GLY A 1 523 ? 11.546  3.206   1.014   1.00 45.01  ? 523  GLY A CA  1 
ATOM   4028 C C   . GLY A 1 523 ? 12.171  4.537   1.367   1.00 46.59  ? 523  GLY A C   1 
ATOM   4029 O O   . GLY A 1 523 ? 11.568  5.584   1.199   1.00 55.39  ? 523  GLY A O   1 
ATOM   4030 N N   . LEU A 1 524 ? 13.397  4.491   1.861   1.00 48.73  ? 524  LEU A N   1 
ATOM   4031 C CA  . LEU A 1 524 ? 14.105  5.700   2.251   1.00 53.27  ? 524  LEU A CA  1 
ATOM   4032 C C   . LEU A 1 524 ? 14.901  6.232   1.063   1.00 44.90  ? 524  LEU A C   1 
ATOM   4033 O O   . LEU A 1 524 ? 15.979  5.720   0.784   1.00 46.42  ? 524  LEU A O   1 
ATOM   4034 C CB  . LEU A 1 524 ? 15.048  5.357   3.402   1.00 59.69  ? 524  LEU A CB  1 
ATOM   4035 C CG  . LEU A 1 524 ? 15.232  6.410   4.494   1.00 73.59  ? 524  LEU A CG  1 
ATOM   4036 C CD1 . LEU A 1 524 ? 14.151  7.492   4.421   1.00 76.89  ? 524  LEU A CD1 1 
ATOM   4037 C CD2 . LEU A 1 524 ? 15.234  5.717   5.857   1.00 72.65  ? 524  LEU A CD2 1 
ATOM   4038 N N   . ARG A 1 525 ? 14.377  7.247   0.371   1.00 41.92  ? 525  ARG A N   1 
ATOM   4039 C CA  . ARG A 1 525 ? 14.952  7.723   -0.907  1.00 42.76  ? 525  ARG A CA  1 
ATOM   4040 C C   . ARG A 1 525 ? 15.482  6.566   -1.761  1.00 41.00  ? 525  ARG A C   1 
ATOM   4041 O O   . ARG A 1 525 ? 16.637  6.588   -2.211  1.00 40.35  ? 525  ARG A O   1 
ATOM   4042 C CB  . ARG A 1 525 ? 16.118  8.695   -0.674  1.00 44.25  ? 525  ARG A CB  1 
ATOM   4043 C CG  . ARG A 1 525 ? 15.812  9.878   0.173   1.00 56.05  ? 525  ARG A CG  1 
ATOM   4044 C CD  . ARG A 1 525 ? 15.445  11.050  -0.673  1.00 65.90  ? 525  ARG A CD  1 
ATOM   4045 N NE  . ARG A 1 525 ? 16.055  12.267  -0.158  1.00 68.84  ? 525  ARG A NE  1 
ATOM   4046 C CZ  . ARG A 1 525 ? 15.642  12.905  0.927   1.00 70.35  ? 525  ARG A CZ  1 
ATOM   4047 N NH1 . ARG A 1 525 ? 14.612  12.432  1.619   1.00 72.95  ? 525  ARG A NH1 1 
ATOM   4048 N NH2 . ARG A 1 525 ? 16.259  14.017  1.318   1.00 70.01  ? 525  ARG A NH2 1 
ATOM   4049 N N   . ALA A 1 526 ? 14.656  5.551   -1.955  1.00 36.05  ? 526  ALA A N   1 
ATOM   4050 C CA  . ALA A 1 526 ? 15.072  4.321   -2.592  1.00 35.20  ? 526  ALA A CA  1 
ATOM   4051 C C   . ALA A 1 526 ? 15.702  4.491   -3.979  1.00 37.20  ? 526  ALA A C   1 
ATOM   4052 O O   . ALA A 1 526 ? 16.739  3.892   -4.255  1.00 42.82  ? 526  ALA A O   1 
ATOM   4053 C CB  . ALA A 1 526 ? 13.888  3.311   -2.641  1.00 38.10  ? 526  ALA A CB  1 
ATOM   4054 N N   . GLN A 1 527 ? 15.098  5.283   -4.856  1.00 38.01  ? 527  GLN A N   1 
ATOM   4055 C CA  . GLN A 1 527 ? 15.656  5.431   -6.200  1.00 43.26  ? 527  GLN A CA  1 
ATOM   4056 C C   . GLN A 1 527 ? 16.977  6.186   -6.160  1.00 41.30  ? 527  GLN A C   1 
ATOM   4057 O O   . GLN A 1 527 ? 17.967  5.766   -6.755  1.00 41.88  ? 527  GLN A O   1 
ATOM   4058 C CB  . GLN A 1 527 ? 14.687  6.141   -7.169  1.00 50.21  ? 527  GLN A CB  1 
ATOM   4059 C CG  . GLN A 1 527 ? 13.474  5.331   -7.603  1.00 51.49  ? 527  GLN A CG  1 
ATOM   4060 C CD  . GLN A 1 527 ? 13.816  3.937   -8.132  1.00 51.69  ? 527  GLN A CD  1 
ATOM   4061 O OE1 . GLN A 1 527 ? 13.540  2.941   -7.464  1.00 58.78  ? 527  GLN A OE1 1 
ATOM   4062 N NE2 . GLN A 1 527 ? 14.408  3.862   -9.334  1.00 45.41  ? 527  GLN A NE2 1 
ATOM   4063 N N   . THR A 1 528 ? 16.983  7.314   -5.473  1.00 39.06  ? 528  THR A N   1 
ATOM   4064 C CA  . THR A 1 528 ? 18.196  8.120   -5.364  1.00 39.56  ? 528  THR A CA  1 
ATOM   4065 C C   . THR A 1 528 ? 19.326  7.378   -4.620  1.00 40.53  ? 528  THR A C   1 
ATOM   4066 O O   . THR A 1 528 ? 20.493  7.447   -5.009  1.00 42.50  ? 528  THR A O   1 
ATOM   4067 C CB  . THR A 1 528 ? 17.888  9.455   -4.677  1.00 41.17  ? 528  THR A CB  1 
ATOM   4068 O OG1 . THR A 1 528 ? 17.151  10.277  -5.581  1.00 45.70  ? 528  THR A OG1 1 
ATOM   4069 C CG2 . THR A 1 528 ? 19.173  10.189  -4.303  1.00 47.53  ? 528  THR A CG2 1 
ATOM   4070 N N   . CYS A 1 529 ? 18.982  6.638   -3.574  1.00 36.45  ? 529  CYS A N   1 
ATOM   4071 C CA  . CYS A 1 529 ? 20.011  5.911   -2.839  1.00 35.36  ? 529  CYS A CA  1 
ATOM   4072 C C   . CYS A 1 529 ? 20.578  4.727   -3.636  1.00 41.60  ? 529  CYS A C   1 
ATOM   4073 O O   . CYS A 1 529 ? 21.725  4.337   -3.420  1.00 43.60  ? 529  CYS A O   1 
ATOM   4074 C CB  . CYS A 1 529 ? 19.545  5.543   -1.411  1.00 32.55  ? 529  CYS A CB  1 
ATOM   4075 S SG  . CYS A 1 529 ? 19.425  7.050   -0.332  1.00 38.66  ? 529  CYS A SG  1 
ATOM   4076 N N   . ALA A 1 530 ? 19.805  4.185   -4.582  1.00 35.50  ? 530  ALA A N   1 
ATOM   4077 C CA  . ALA A 1 530 ? 20.356  3.182   -5.491  1.00 38.32  ? 530  ALA A CA  1 
ATOM   4078 C C   . ALA A 1 530 ? 21.478  3.797   -6.330  1.00 44.32  ? 530  ALA A C   1 
ATOM   4079 O O   . ALA A 1 530 ? 22.494  3.151   -6.612  1.00 39.61  ? 530  ALA A O   1 
ATOM   4080 C CB  . ALA A 1 530 ? 19.280  2.587   -6.384  1.00 37.07  ? 530  ALA A CB  1 
ATOM   4081 N N   . PHE A 1 531 ? 21.294  5.050   -6.727  1.00 41.43  ? 531  PHE A N   1 
ATOM   4082 C CA  . PHE A 1 531 ? 22.342  5.761   -7.443  1.00 40.18  ? 531  PHE A CA  1 
ATOM   4083 C C   . PHE A 1 531 ? 23.615  5.896   -6.592  1.00 38.46  ? 531  PHE A C   1 
ATOM   4084 O O   . PHE A 1 531 ? 24.706  5.518   -7.022  1.00 41.87  ? 531  PHE A O   1 
ATOM   4085 C CB  . PHE A 1 531 ? 21.840  7.141   -7.883  1.00 38.85  ? 531  PHE A CB  1 
ATOM   4086 C CG  . PHE A 1 531 ? 22.930  8.067   -8.312  1.00 38.65  ? 531  PHE A CG  1 
ATOM   4087 C CD1 . PHE A 1 531 ? 23.456  7.995   -9.602  1.00 42.53  ? 531  PHE A CD1 1 
ATOM   4088 C CD2 . PHE A 1 531 ? 23.446  9.003   -7.426  1.00 39.56  ? 531  PHE A CD2 1 
ATOM   4089 C CE1 . PHE A 1 531 ? 24.467  8.842   -10.010 1.00 39.14  ? 531  PHE A CE1 1 
ATOM   4090 C CE2 . PHE A 1 531 ? 24.462  9.856   -7.826  1.00 37.37  ? 531  PHE A CE2 1 
ATOM   4091 C CZ  . PHE A 1 531 ? 24.974  9.774   -9.119  1.00 38.21  ? 531  PHE A CZ  1 
ATOM   4092 N N   . TRP A 1 532 ? 23.479  6.459   -5.398  1.00 37.12  ? 532  TRP A N   1 
ATOM   4093 C CA  . TRP A 1 532 ? 24.621  6.615   -4.485  1.00 43.52  ? 532  TRP A CA  1 
ATOM   4094 C C   . TRP A 1 532 ? 25.247  5.279   -4.039  1.00 43.13  ? 532  TRP A C   1 
ATOM   4095 O O   . TRP A 1 532 ? 26.462  5.153   -4.009  1.00 40.63  ? 532  TRP A O   1 
ATOM   4096 C CB  . TRP A 1 532 ? 24.246  7.447   -3.240  1.00 33.73  ? 532  TRP A CB  1 
ATOM   4097 C CG  . TRP A 1 532 ? 23.972  8.884   -3.553  1.00 34.55  ? 532  TRP A CG  1 
ATOM   4098 C CD1 . TRP A 1 532 ? 22.761  9.489   -3.610  1.00 32.04  ? 532  TRP A CD1 1 
ATOM   4099 C CD2 . TRP A 1 532 ? 24.941  9.888   -3.890  1.00 33.80  ? 532  TRP A CD2 1 
ATOM   4100 N NE1 . TRP A 1 532 ? 22.904  10.814  -3.933  1.00 33.14  ? 532  TRP A NE1 1 
ATOM   4101 C CE2 . TRP A 1 532 ? 24.235  11.084  -4.118  1.00 34.04  ? 532  TRP A CE2 1 
ATOM   4102 C CE3 . TRP A 1 532 ? 26.340  9.887   -4.025  1.00 27.94  ? 532  TRP A CE3 1 
ATOM   4103 C CZ2 . TRP A 1 532 ? 24.873  12.270  -4.488  1.00 32.88  ? 532  TRP A CZ2 1 
ATOM   4104 C CZ3 . TRP A 1 532 ? 26.979  11.079  -4.377  1.00 27.31  ? 532  TRP A CZ3 1 
ATOM   4105 C CH2 . TRP A 1 532 ? 26.242  12.253  -4.580  1.00 27.97  ? 532  TRP A CH2 1 
ATOM   4106 N N   . ASN A 1 533 ? 24.422  4.290   -3.703  1.00 39.85  ? 533  ASN A N   1 
ATOM   4107 C CA  . ASN A 1 533 ? 24.922  3.074   -3.037  1.00 41.68  ? 533  ASN A CA  1 
ATOM   4108 C C   . ASN A 1 533 ? 25.316  1.944   -3.988  1.00 48.29  ? 533  ASN A C   1 
ATOM   4109 O O   . ASN A 1 533 ? 26.188  1.138   -3.669  1.00 46.58  ? 533  ASN A O   1 
ATOM   4110 C CB  . ASN A 1 533 ? 23.901  2.540   -2.031  1.00 34.27  ? 533  ASN A CB  1 
ATOM   4111 C CG  . ASN A 1 533 ? 23.614  3.517   -0.887  1.00 33.46  ? 533  ASN A CG  1 
ATOM   4112 O OD1 . ASN A 1 533 ? 24.319  4.491   -0.696  1.00 38.61  ? 533  ASN A OD1 1 
ATOM   4113 N ND2 . ASN A 1 533 ? 22.550  3.256   -0.139  1.00 36.37  ? 533  ASN A ND2 1 
ATOM   4114 N N   . ARG A 1 534 ? 24.667  1.884   -5.146  1.00 47.40  ? 534  ARG A N   1 
ATOM   4115 C CA  . ARG A 1 534 ? 24.955  0.848   -6.134  1.00 54.41  ? 534  ARG A CA  1 
ATOM   4116 C C   . ARG A 1 534 ? 25.741  1.341   -7.345  1.00 56.94  ? 534  ARG A C   1 
ATOM   4117 O O   . ARG A 1 534 ? 26.689  0.688   -7.767  1.00 62.16  ? 534  ARG A O   1 
ATOM   4118 C CB  . ARG A 1 534 ? 23.667  0.172   -6.596  1.00 49.99  ? 534  ARG A CB  1 
ATOM   4119 C CG  . ARG A 1 534 ? 22.956  -0.565  -5.478  1.00 52.16  ? 534  ARG A CG  1 
ATOM   4120 C CD  . ARG A 1 534 ? 21.545  -0.950  -5.868  1.00 53.24  ? 534  ARG A CD  1 
ATOM   4121 N NE  . ARG A 1 534 ? 20.814  -1.470  -4.723  1.00 59.29  ? 534  ARG A NE  1 
ATOM   4122 C CZ  . ARG A 1 534 ? 20.742  -2.762  -4.404  1.00 67.21  ? 534  ARG A CZ  1 
ATOM   4123 N NH1 . ARG A 1 534 ? 21.361  -3.678  -5.151  1.00 67.78  ? 534  ARG A NH1 1 
ATOM   4124 N NH2 . ARG A 1 534 ? 20.051  -3.137  -3.334  1.00 62.05  ? 534  ARG A NH2 1 
ATOM   4125 N N   . PHE A 1 535 ? 25.352  2.483   -7.905  1.00 52.08  ? 535  PHE A N   1 
ATOM   4126 C CA  . PHE A 1 535 ? 25.946  2.916   -9.165  1.00 46.41  ? 535  PHE A CA  1 
ATOM   4127 C C   . PHE A 1 535 ? 27.237  3.742   -9.015  1.00 45.05  ? 535  PHE A C   1 
ATOM   4128 O O   . PHE A 1 535 ? 28.225  3.458   -9.689  1.00 43.37  ? 535  PHE A O   1 
ATOM   4129 C CB  . PHE A 1 535 ? 24.922  3.628   -10.066 1.00 39.11  ? 535  PHE A CB  1 
ATOM   4130 C CG  . PHE A 1 535 ? 25.479  4.029   -11.410 1.00 40.03  ? 535  PHE A CG  1 
ATOM   4131 C CD1 . PHE A 1 535 ? 25.754  3.078   -12.372 1.00 43.53  ? 535  PHE A CD1 1 
ATOM   4132 C CD2 . PHE A 1 535 ? 25.780  5.353   -11.684 1.00 44.67  ? 535  PHE A CD2 1 
ATOM   4133 C CE1 . PHE A 1 535 ? 26.301  3.439   -13.598 1.00 46.22  ? 535  PHE A CE1 1 
ATOM   4134 C CE2 . PHE A 1 535 ? 26.315  5.721   -12.913 1.00 45.85  ? 535  PHE A CE2 1 
ATOM   4135 C CZ  . PHE A 1 535 ? 26.575  4.768   -13.865 1.00 44.33  ? 535  PHE A CZ  1 
ATOM   4136 N N   . LEU A 1 536 ? 27.228  4.760   -8.158  1.00 40.41  ? 536  LEU A N   1 
ATOM   4137 C CA  . LEU A 1 536 ? 28.398  5.636   -7.997  1.00 45.94  ? 536  LEU A CA  1 
ATOM   4138 C C   . LEU A 1 536 ? 29.712  4.854   -7.824  1.00 48.39  ? 536  LEU A C   1 
ATOM   4139 O O   . LEU A 1 536 ? 30.690  5.146   -8.505  1.00 50.80  ? 536  LEU A O   1 
ATOM   4140 C CB  . LEU A 1 536 ? 28.227  6.596   -6.814  1.00 49.99  ? 536  LEU A CB  1 
ATOM   4141 C CG  . LEU A 1 536 ? 28.820  8.018   -6.871  1.00 62.11  ? 536  LEU A CG  1 
ATOM   4142 C CD1 . LEU A 1 536 ? 29.322  8.450   -5.485  1.00 63.63  ? 536  LEU A CD1 1 
ATOM   4143 C CD2 . LEU A 1 536 ? 29.940  8.145   -7.873  1.00 64.56  ? 536  LEU A CD2 1 
ATOM   4144 N N   . PRO A 1 537 ? 29.741  3.874   -6.900  1.00 48.65  ? 537  PRO A N   1 
ATOM   4145 C CA  . PRO A 1 537 ? 30.976  3.101   -6.699  1.00 52.12  ? 537  PRO A CA  1 
ATOM   4146 C C   . PRO A 1 537 ? 31.510  2.530   -8.009  1.00 51.34  ? 537  PRO A C   1 
ATOM   4147 O O   . PRO A 1 537 ? 32.689  2.706   -8.301  1.00 55.81  ? 537  PRO A O   1 
ATOM   4148 C CB  . PRO A 1 537 ? 30.538  1.968   -5.758  1.00 49.58  ? 537  PRO A CB  1 
ATOM   4149 C CG  . PRO A 1 537 ? 29.399  2.547   -4.998  1.00 48.62  ? 537  PRO A CG  1 
ATOM   4150 C CD  . PRO A 1 537 ? 28.672  3.446   -5.979  1.00 47.96  ? 537  PRO A CD  1 
ATOM   4151 N N   . LYS A 1 538 ? 30.657  1.870   -8.787  1.00 51.10  ? 538  LYS A N   1 
ATOM   4152 C CA  . LYS A 1 538 ? 31.072  1.320   -10.088 1.00 53.99  ? 538  LYS A CA  1 
ATOM   4153 C C   . LYS A 1 538 ? 31.559  2.384   -11.068 1.00 52.66  ? 538  LYS A C   1 
ATOM   4154 O O   . LYS A 1 538 ? 32.490  2.160   -11.835 1.00 57.84  ? 538  LYS A O   1 
ATOM   4155 C CB  . LYS A 1 538 ? 29.947  0.507   -10.710 1.00 53.13  ? 538  LYS A CB  1 
ATOM   4156 C CG  . LYS A 1 538 ? 29.611  -0.735  -9.908  1.00 58.62  ? 538  LYS A CG  1 
ATOM   4157 C CD  . LYS A 1 538 ? 28.373  -1.430  -10.444 1.00 66.53  ? 538  LYS A CD  1 
ATOM   4158 C CE  . LYS A 1 538 ? 27.901  -2.516  -9.482  1.00 73.67  ? 538  LYS A CE  1 
ATOM   4159 N NZ  . LYS A 1 538 ? 28.874  -3.645  -9.393  1.00 78.18  ? 538  LYS A NZ  1 
ATOM   4160 N N   . LEU A 1 539 ? 30.952  3.558   -11.017 1.00 48.71  ? 539  LEU A N   1 
ATOM   4161 C CA  . LEU A 1 539 ? 31.295  4.622   -11.952 1.00 52.16  ? 539  LEU A CA  1 
ATOM   4162 C C   . LEU A 1 539 ? 32.670  5.210   -11.676 1.00 58.59  ? 539  LEU A C   1 
ATOM   4163 O O   . LEU A 1 539 ? 33.404  5.536   -12.605 1.00 60.03  ? 539  LEU A O   1 
ATOM   4164 C CB  . LEU A 1 539 ? 30.252  5.738   -11.905 1.00 47.37  ? 539  LEU A CB  1 
ATOM   4165 C CG  . LEU A 1 539 ? 30.504  6.912   -12.834 1.00 51.24  ? 539  LEU A CG  1 
ATOM   4166 C CD1 . LEU A 1 539 ? 30.702  6.372   -14.230 1.00 56.05  ? 539  LEU A CD1 1 
ATOM   4167 C CD2 . LEU A 1 539 ? 29.327  7.879   -12.785 1.00 49.09  ? 539  LEU A CD2 1 
ATOM   4168 N N   . LEU A 1 540 ? 33.022  5.380   -10.406 1.00 61.81  ? 540  LEU A N   1 
ATOM   4169 C CA  . LEU A 1 540 ? 34.324  5.972   -10.123 1.00 71.29  ? 540  LEU A CA  1 
ATOM   4170 C C   . LEU A 1 540 ? 35.517  4.987   -10.235 1.00 60.22  ? 540  LEU A C   1 
ATOM   4171 O O   . LEU A 1 540 ? 36.642  5.427   -10.478 1.00 58.28  ? 540  LEU A O   1 
ATOM   4172 C CB  . LEU A 1 540 ? 34.322  6.821   -8.839  1.00 74.89  ? 540  LEU A CB  1 
ATOM   4173 C CG  . LEU A 1 540 ? 33.499  6.327   -7.663  1.00 76.97  ? 540  LEU A CG  1 
ATOM   4174 C CD1 . LEU A 1 540 ? 34.180  5.093   -7.090  1.00 85.63  ? 540  LEU A CD1 1 
ATOM   4175 C CD2 . LEU A 1 540 ? 33.340  7.422   -6.610  1.00 66.97  ? 540  LEU A CD2 1 
ATOM   4176 N N   . SER A 1 541 ? 35.267  3.678   -10.110 1.00 56.18  ? 541  SER A N   1 
ATOM   4177 C CA  . SER A 1 541 ? 36.257  2.659   -10.521 1.00 57.75  ? 541  SER A CA  1 
ATOM   4178 C C   . SER A 1 541 ? 36.620  2.775   -11.998 1.00 72.26  ? 541  SER A C   1 
ATOM   4179 O O   . SER A 1 541 ? 37.791  2.691   -12.365 1.00 83.84  ? 541  SER A O   1 
ATOM   4180 C CB  . SER A 1 541 ? 35.737  1.240   -10.318 1.00 54.30  ? 541  SER A CB  1 
ATOM   4181 O OG  . SER A 1 541 ? 35.197  1.063   -9.038  1.00 62.04  ? 541  SER A OG  1 
ATOM   4182 N N   . ALA A 1 542 ? 35.613  2.939   -12.853 1.00 69.86  ? 542  ALA A N   1 
ATOM   4183 C CA  . ALA A 1 542 ? 35.852  2.957   -14.293 1.00 71.41  ? 542  ALA A CA  1 
ATOM   4184 C C   . ALA A 1 542 ? 36.569  4.234   -14.739 1.00 68.61  ? 542  ALA A C   1 
ATOM   4185 O O   . ALA A 1 542 ? 36.593  5.236   -14.012 1.00 66.77  ? 542  ALA A O   1 
ATOM   4186 C CB  . ALA A 1 542 ? 34.538  2.776   -15.050 1.00 70.12  ? 542  ALA A CB  1 
ATOM   4187 N N   . GLU B 1 4   ? -17.035 5.714   -70.069 1.00 95.93  ? 4    GLU B N   1 
ATOM   4188 C CA  . GLU B 1 4   ? -15.842 6.250   -69.415 1.00 94.15  ? 4    GLU B CA  1 
ATOM   4189 C C   . GLU B 1 4   ? -16.139 7.480   -68.537 1.00 87.29  ? 4    GLU B C   1 
ATOM   4190 O O   . GLU B 1 4   ? -16.636 8.499   -69.019 1.00 84.10  ? 4    GLU B O   1 
ATOM   4191 C CB  . GLU B 1 4   ? -14.772 6.587   -70.460 1.00 100.73 ? 4    GLU B CB  1 
ATOM   4192 C CG  . GLU B 1 4   ? -13.503 7.213   -69.883 1.00 107.89 ? 4    GLU B CG  1 
ATOM   4193 C CD  . GLU B 1 4   ? -12.571 6.192   -69.243 1.00 109.66 ? 4    GLU B CD  1 
ATOM   4194 O OE1 . GLU B 1 4   ? -12.290 6.313   -68.024 1.00 108.67 ? 4    GLU B OE1 1 
ATOM   4195 O OE2 . GLU B 1 4   ? -12.122 5.273   -69.963 1.00 107.52 ? 4    GLU B OE2 1 
ATOM   4196 N N   . ASP B 1 5   ? -15.827 7.379   -67.248 1.00 82.88  ? 5    ASP B N   1 
ATOM   4197 C CA  . ASP B 1 5   ? -16.036 8.481   -66.306 1.00 74.96  ? 5    ASP B CA  1 
ATOM   4198 C C   . ASP B 1 5   ? -14.890 9.480   -66.419 1.00 73.35  ? 5    ASP B C   1 
ATOM   4199 O O   . ASP B 1 5   ? -13.747 9.150   -66.126 1.00 79.80  ? 5    ASP B O   1 
ATOM   4200 C CB  . ASP B 1 5   ? -16.127 7.927   -64.882 1.00 72.36  ? 5    ASP B CB  1 
ATOM   4201 C CG  . ASP B 1 5   ? -16.629 8.952   -63.867 1.00 68.34  ? 5    ASP B CG  1 
ATOM   4202 O OD1 . ASP B 1 5   ? -17.201 8.516   -62.844 1.00 63.02  ? 5    ASP B OD1 1 
ATOM   4203 O OD2 . ASP B 1 5   ? -16.447 10.172  -64.075 1.00 65.57  ? 5    ASP B OD2 1 
ATOM   4204 N N   . PRO B 1 6   ? -15.193 10.709  -66.850 1.00 69.98  ? 6    PRO B N   1 
ATOM   4205 C CA  . PRO B 1 6   ? -14.188 11.756  -67.077 1.00 67.76  ? 6    PRO B CA  1 
ATOM   4206 C C   . PRO B 1 6   ? -13.430 12.100  -65.800 1.00 67.25  ? 6    PRO B C   1 
ATOM   4207 O O   . PRO B 1 6   ? -12.277 12.542  -65.871 1.00 69.37  ? 6    PRO B O   1 
ATOM   4208 C CB  . PRO B 1 6   ? -15.027 12.970  -67.512 1.00 70.99  ? 6    PRO B CB  1 
ATOM   4209 C CG  . PRO B 1 6   ? -16.347 12.418  -67.904 1.00 71.72  ? 6    PRO B CG  1 
ATOM   4210 C CD  . PRO B 1 6   ? -16.563 11.196  -67.072 1.00 70.71  ? 6    PRO B CD  1 
ATOM   4211 N N   . GLN B 1 7   ? -14.079 11.916  -64.651 1.00 61.96  ? 7    GLN B N   1 
ATOM   4212 C CA  . GLN B 1 7   ? -13.430 12.134  -63.362 1.00 63.60  ? 7    GLN B CA  1 
ATOM   4213 C C   . GLN B 1 7   ? -12.289 11.157  -63.175 1.00 60.58  ? 7    GLN B C   1 
ATOM   4214 O O   . GLN B 1 7   ? -11.335 11.450  -62.467 1.00 59.50  ? 7    GLN B O   1 
ATOM   4215 C CB  . GLN B 1 7   ? -14.426 11.957  -62.210 1.00 69.56  ? 7    GLN B CB  1 
ATOM   4216 C CG  . GLN B 1 7   ? -15.460 13.065  -62.110 1.00 67.72  ? 7    GLN B CG  1 
ATOM   4217 C CD  . GLN B 1 7   ? -14.818 14.382  -61.767 1.00 67.26  ? 7    GLN B CD  1 
ATOM   4218 O OE1 . GLN B 1 7   ? -14.018 14.459  -60.840 1.00 65.28  ? 7    GLN B OE1 1 
ATOM   4219 N NE2 . GLN B 1 7   ? -15.145 15.424  -62.521 1.00 68.64  ? 7    GLN B NE2 1 
ATOM   4220 N N   . LEU B 1 8   ? -12.402 9.990   -63.805 1.00 56.97  ? 8    LEU B N   1 
ATOM   4221 C CA  . LEU B 1 8   ? -11.459 8.901   -63.579 1.00 57.12  ? 8    LEU B CA  1 
ATOM   4222 C C   . LEU B 1 8   ? -10.361 8.841   -64.631 1.00 56.65  ? 8    LEU B C   1 
ATOM   4223 O O   . LEU B 1 8   ? -9.560  7.909   -64.650 1.00 57.45  ? 8    LEU B O   1 
ATOM   4224 C CB  . LEU B 1 8   ? -12.192 7.566   -63.524 1.00 53.30  ? 8    LEU B CB  1 
ATOM   4225 C CG  . LEU B 1 8   ? -13.183 7.434   -62.372 1.00 53.13  ? 8    LEU B CG  1 
ATOM   4226 C CD1 . LEU B 1 8   ? -13.742 6.009   -62.301 1.00 52.89  ? 8    LEU B CD1 1 
ATOM   4227 C CD2 . LEU B 1 8   ? -12.508 7.833   -61.079 1.00 46.93  ? 8    LEU B CD2 1 
ATOM   4228 N N   . LEU B 1 9   ? -10.318 9.846   -65.494 1.00 53.46  ? 9    LEU B N   1 
ATOM   4229 C CA  . LEU B 1 9   ? -9.342  9.876   -66.570 1.00 51.89  ? 9    LEU B CA  1 
ATOM   4230 C C   . LEU B 1 9   ? -8.422  11.078  -66.379 1.00 54.11  ? 9    LEU B C   1 
ATOM   4231 O O   . LEU B 1 9   ? -8.888  12.209  -66.292 1.00 52.00  ? 9    LEU B O   1 
ATOM   4232 C CB  . LEU B 1 9   ? -10.065 9.951   -67.916 1.00 52.50  ? 9    LEU B CB  1 
ATOM   4233 C CG  . LEU B 1 9   ? -9.549  9.072   -69.047 1.00 63.42  ? 9    LEU B CG  1 
ATOM   4234 C CD1 . LEU B 1 9   ? -10.180 9.519   -70.375 1.00 68.75  ? 9    LEU B CD1 1 
ATOM   4235 C CD2 . LEU B 1 9   ? -8.016  9.105   -69.126 1.00 59.45  ? 9    LEU B CD2 1 
ATOM   4236 N N   . VAL B 1 10  ? -7.116  10.830  -66.305 1.00 50.40  ? 10   VAL B N   1 
ATOM   4237 C CA  . VAL B 1 10  ? -6.152  11.890  -66.025 1.00 48.25  ? 10   VAL B CA  1 
ATOM   4238 C C   . VAL B 1 10  ? -4.901  11.784  -66.906 1.00 52.84  ? 10   VAL B C   1 
ATOM   4239 O O   . VAL B 1 10  ? -4.394  10.685  -67.154 1.00 50.86  ? 10   VAL B O   1 
ATOM   4240 C CB  . VAL B 1 10  ? -5.704  11.845  -64.541 1.00 57.69  ? 10   VAL B CB  1 
ATOM   4241 C CG1 . VAL B 1 10  ? -4.743  12.983  -64.231 1.00 52.56  ? 10   VAL B CG1 1 
ATOM   4242 C CG2 . VAL B 1 10  ? -6.914  11.927  -63.628 1.00 67.67  ? 10   VAL B CG2 1 
ATOM   4243 N N   . ARG B 1 11  ? -4.400  12.929  -67.363 1.00 47.74  ? 11   ARG B N   1 
ATOM   4244 C CA  . ARG B 1 11  ? -3.152  12.963  -68.108 1.00 50.61  ? 11   ARG B CA  1 
ATOM   4245 C C   . ARG B 1 11  ? -2.014  13.486  -67.253 1.00 48.35  ? 11   ARG B C   1 
ATOM   4246 O O   . ARG B 1 11  ? -2.095  14.572  -66.698 1.00 45.69  ? 11   ARG B O   1 
ATOM   4247 C CB  . ARG B 1 11  ? -3.269  13.800  -69.385 1.00 52.77  ? 11   ARG B CB  1 
ATOM   4248 C CG  . ARG B 1 11  ? -1.906  14.071  -70.017 1.00 63.90  ? 11   ARG B CG  1 
ATOM   4249 C CD  . ARG B 1 11  ? -1.997  14.577  -71.448 1.00 75.67  ? 11   ARG B CD  1 
ATOM   4250 N NE  . ARG B 1 11  ? -1.977  13.482  -72.414 1.00 88.85  ? 11   ARG B NE  1 
ATOM   4251 C CZ  . ARG B 1 11  ? -3.056  13.018  -73.036 1.00 99.04  ? 11   ARG B CZ  1 
ATOM   4252 N NH1 . ARG B 1 11  ? -4.249  13.559  -72.800 1.00 102.17 ? 11   ARG B NH1 1 
ATOM   4253 N NH2 . ARG B 1 11  ? -2.942  12.017  -73.899 1.00 101.18 ? 11   ARG B NH2 1 
ATOM   4254 N N   . VAL B 1 12  ? -0.952  12.699  -67.141 1.00 48.91  ? 12   VAL B N   1 
ATOM   4255 C CA  . VAL B 1 12  ? 0.245   13.147  -66.440 1.00 48.25  ? 12   VAL B CA  1 
ATOM   4256 C C   . VAL B 1 12  ? 1.370   13.252  -67.462 1.00 53.61  ? 12   VAL B C   1 
ATOM   4257 O O   . VAL B 1 12  ? 1.197   12.866  -68.615 1.00 60.33  ? 12   VAL B O   1 
ATOM   4258 C CB  . VAL B 1 12  ? 0.640   12.196  -65.267 1.00 40.74  ? 12   VAL B CB  1 
ATOM   4259 C CG1 . VAL B 1 12  ? -0.301  12.374  -64.101 1.00 37.71  ? 12   VAL B CG1 1 
ATOM   4260 C CG2 . VAL B 1 12  ? 0.690   10.709  -65.713 1.00 38.64  ? 12   VAL B CG2 1 
ATOM   4261 N N   . ARG B 1 13  ? 2.520   13.766  -67.049 1.00 46.70  ? 13   ARG B N   1 
ATOM   4262 C CA  . ARG B 1 13  ? 3.635   13.899  -67.968 1.00 50.47  ? 13   ARG B CA  1 
ATOM   4263 C C   . ARG B 1 13  ? 3.964   12.612  -68.745 1.00 51.71  ? 13   ARG B C   1 
ATOM   4264 O O   . ARG B 1 13  ? 4.348   12.685  -69.908 1.00 46.24  ? 13   ARG B O   1 
ATOM   4265 C CB  . ARG B 1 13  ? 4.874   14.424  -67.243 1.00 51.72  ? 13   ARG B CB  1 
ATOM   4266 C CG  . ARG B 1 13  ? 4.790   15.916  -66.924 1.00 65.74  ? 13   ARG B CG  1 
ATOM   4267 C CD  . ARG B 1 13  ? 6.153   16.464  -66.552 1.00 82.97  ? 13   ARG B CD  1 
ATOM   4268 N NE  . ARG B 1 13  ? 6.084   17.829  -66.034 1.00 97.07  ? 13   ARG B NE  1 
ATOM   4269 C CZ  . ARG B 1 13  ? 7.125   18.486  -65.528 1.00 103.83 ? 13   ARG B CZ  1 
ATOM   4270 N NH1 . ARG B 1 13  ? 8.317   17.901  -65.472 1.00 105.42 ? 13   ARG B NH1 1 
ATOM   4271 N NH2 . ARG B 1 13  ? 6.979   19.725  -65.075 1.00 103.78 ? 13   ARG B NH2 1 
ATOM   4272 N N   . GLY B 1 14  ? 3.814   11.448  -68.113 1.00 41.22  ? 14   GLY B N   1 
ATOM   4273 C CA  . GLY B 1 14  ? 4.126   10.186  -68.765 1.00 39.53  ? 14   GLY B CA  1 
ATOM   4274 C C   . GLY B 1 14  ? 3.056   9.638   -69.695 1.00 45.91  ? 14   GLY B C   1 
ATOM   4275 O O   . GLY B 1 14  ? 3.308   8.718   -70.474 1.00 45.43  ? 14   GLY B O   1 
ATOM   4276 N N   . GLY B 1 15  ? 1.858   10.207  -69.626 1.00 45.79  ? 15   GLY B N   1 
ATOM   4277 C CA  . GLY B 1 15  ? 0.754   9.739   -70.443 1.00 45.84  ? 15   GLY B CA  1 
ATOM   4278 C C   . GLY B 1 15  ? -0.560  9.707   -69.690 1.00 47.55  ? 15   GLY B C   1 
ATOM   4279 O O   . GLY B 1 15  ? -0.716  10.358  -68.650 1.00 48.37  ? 15   GLY B O   1 
ATOM   4280 N N   . GLN B 1 16  ? -1.505  8.928   -70.203 1.00 46.13  ? 16   GLN B N   1 
ATOM   4281 C CA  . GLN B 1 16  ? -2.839  8.877   -69.620 1.00 46.63  ? 16   GLN B CA  1 
ATOM   4282 C C   . GLN B 1 16  ? -3.025  7.747   -68.624 1.00 44.67  ? 16   GLN B C   1 
ATOM   4283 O O   . GLN B 1 16  ? -2.443  6.680   -68.776 1.00 42.76  ? 16   GLN B O   1 
ATOM   4284 C CB  . GLN B 1 16  ? -3.895  8.748   -70.713 1.00 47.80  ? 16   GLN B CB  1 
ATOM   4285 C CG  . GLN B 1 16  ? -3.904  9.901   -71.659 1.00 55.42  ? 16   GLN B CG  1 
ATOM   4286 C CD  . GLN B 1 16  ? -5.300  10.429  -71.831 1.00 73.65  ? 16   GLN B CD  1 
ATOM   4287 O OE1 . GLN B 1 16  ? -6.019  10.045  -72.771 1.00 71.80  ? 16   GLN B OE1 1 
ATOM   4288 N NE2 . GLN B 1 16  ? -5.724  11.284  -70.890 1.00 74.80  ? 16   GLN B NE2 1 
ATOM   4289 N N   . LEU B 1 17  ? -3.869  8.002   -67.627 1.00 37.91  ? 17   LEU B N   1 
ATOM   4290 C CA  . LEU B 1 17  ? -4.143  7.079   -66.547 1.00 37.90  ? 17   LEU B CA  1 
ATOM   4291 C C   . LEU B 1 17  ? -5.639  6.936   -66.420 1.00 46.77  ? 17   LEU B C   1 
ATOM   4292 O O   . LEU B 1 17  ? -6.374  7.898   -66.660 1.00 45.82  ? 17   LEU B O   1 
ATOM   4293 C CB  . LEU B 1 17  ? -3.634  7.668   -65.222 1.00 37.95  ? 17   LEU B CB  1 
ATOM   4294 C CG  . LEU B 1 17  ? -2.133  7.910   -65.116 1.00 47.35  ? 17   LEU B CG  1 
ATOM   4295 C CD1 . LEU B 1 17  ? -1.812  8.726   -63.886 1.00 43.02  ? 17   LEU B CD1 1 
ATOM   4296 C CD2 . LEU B 1 17  ? -1.394  6.560   -65.112 1.00 48.09  ? 17   LEU B CD2 1 
ATOM   4297 N N   . ARG B 1 18  ? -6.093  5.754   -66.019 1.00 43.39  ? 18   ARG B N   1 
ATOM   4298 C CA  . ARG B 1 18  ? -7.500  5.564   -65.675 1.00 44.13  ? 18   ARG B CA  1 
ATOM   4299 C C   . ARG B 1 18  ? -7.560  5.083   -64.234 1.00 43.25  ? 18   ARG B C   1 
ATOM   4300 O O   . ARG B 1 18  ? -6.968  4.052   -63.897 1.00 47.27  ? 18   ARG B O   1 
ATOM   4301 C CB  . ARG B 1 18  ? -8.170  4.540   -66.601 1.00 43.58  ? 18   ARG B CB  1 
ATOM   4302 C CG  . ARG B 1 18  ? -9.619  4.219   -66.244 1.00 53.36  ? 18   ARG B CG  1 
ATOM   4303 C CD  . ARG B 1 18  ? -10.300 3.467   -67.371 1.00 72.90  ? 18   ARG B CD  1 
ATOM   4304 N NE  . ARG B 1 18  ? -9.355  2.554   -68.015 1.00 87.01  ? 18   ARG B NE  1 
ATOM   4305 C CZ  . ARG B 1 18  ? -8.988  2.628   -69.291 1.00 88.26  ? 18   ARG B CZ  1 
ATOM   4306 N NH1 . ARG B 1 18  ? -9.505  3.562   -70.084 1.00 78.47  ? 18   ARG B NH1 1 
ATOM   4307 N NH2 . ARG B 1 18  ? -8.106  1.756   -69.773 1.00 96.06  ? 18   ARG B NH2 1 
ATOM   4308 N N   . GLY B 1 19  ? -8.248  5.843   -63.386 1.00 41.91  ? 19   GLY B N   1 
ATOM   4309 C CA  . GLY B 1 19  ? -8.415  5.484   -61.989 1.00 44.87  ? 19   GLY B CA  1 
ATOM   4310 C C   . GLY B 1 19  ? -9.712  4.720   -61.760 1.00 53.38  ? 19   GLY B C   1 
ATOM   4311 O O   . GLY B 1 19  ? -10.359 4.258   -62.706 1.00 51.45  ? 19   GLY B O   1 
ATOM   4312 N N   . ILE B 1 20  ? -10.094 4.583   -60.497 1.00 49.88  ? 20   ILE B N   1 
ATOM   4313 C CA  . ILE B 1 20  ? -11.327 3.888   -60.155 1.00 46.60  ? 20   ILE B CA  1 
ATOM   4314 C C   . ILE B 1 20  ? -12.121 4.691   -59.114 1.00 47.54  ? 20   ILE B C   1 
ATOM   4315 O O   . ILE B 1 20  ? -11.536 5.338   -58.251 1.00 52.35  ? 20   ILE B O   1 
ATOM   4316 C CB  . ILE B 1 20  ? -11.049 2.436   -59.683 1.00 43.77  ? 20   ILE B CB  1 
ATOM   4317 C CG1 . ILE B 1 20  ? -12.337 1.769   -59.210 1.00 50.96  ? 20   ILE B CG1 1 
ATOM   4318 C CG2 . ILE B 1 20  ? -9.996  2.384   -58.572 1.00 40.28  ? 20   ILE B CG2 1 
ATOM   4319 C CD1 . ILE B 1 20  ? -12.168 0.282   -58.919 1.00 50.54  ? 20   ILE B CD1 1 
ATOM   4320 N N   . ARG B 1 21  ? -13.446 4.677   -59.219 1.00 50.13  ? 21   ARG B N   1 
ATOM   4321 C CA  . ARG B 1 21  ? -14.303 5.349   -58.247 1.00 50.92  ? 21   ARG B CA  1 
ATOM   4322 C C   . ARG B 1 21  ? -14.482 4.426   -57.055 1.00 50.48  ? 21   ARG B C   1 
ATOM   4323 O O   . ARG B 1 21  ? -14.927 3.287   -57.204 1.00 49.18  ? 21   ARG B O   1 
ATOM   4324 C CB  . ARG B 1 21  ? -15.670 5.684   -58.850 1.00 60.13  ? 21   ARG B CB  1 
ATOM   4325 C CG  . ARG B 1 21  ? -16.502 6.677   -58.028 1.00 65.85  ? 21   ARG B CG  1 
ATOM   4326 C CD  . ARG B 1 21  ? -17.882 6.915   -58.650 1.00 74.60  ? 21   ARG B CD  1 
ATOM   4327 N NE  . ARG B 1 21  ? -18.889 5.994   -58.125 1.00 84.84  ? 21   ARG B NE  1 
ATOM   4328 C CZ  . ARG B 1 21  ? -19.956 6.370   -57.422 1.00 96.33  ? 21   ARG B CZ  1 
ATOM   4329 N NH1 . ARG B 1 21  ? -20.180 7.656   -57.172 1.00 96.76  ? 21   ARG B NH1 1 
ATOM   4330 N NH2 . ARG B 1 21  ? -20.812 5.460   -56.974 1.00 101.55 ? 21   ARG B NH2 1 
ATOM   4331 N N   . LEU B 1 22  ? -14.105 4.901   -55.874 1.00 43.45  ? 22   LEU B N   1 
ATOM   4332 C CA  . LEU B 1 22  ? -14.218 4.075   -54.681 1.00 52.15  ? 22   LEU B CA  1 
ATOM   4333 C C   . LEU B 1 22  ? -15.303 4.631   -53.782 1.00 53.61  ? 22   LEU B C   1 
ATOM   4334 O O   . LEU B 1 22  ? -15.691 5.788   -53.907 1.00 58.94  ? 22   LEU B O   1 
ATOM   4335 C CB  . LEU B 1 22  ? -12.892 4.003   -53.922 1.00 50.11  ? 22   LEU B CB  1 
ATOM   4336 C CG  . LEU B 1 22  ? -11.737 3.220   -54.552 1.00 57.29  ? 22   LEU B CG  1 
ATOM   4337 C CD1 . LEU B 1 22  ? -10.515 3.303   -53.654 1.00 58.37  ? 22   LEU B CD1 1 
ATOM   4338 C CD2 . LEU B 1 22  ? -12.096 1.770   -54.818 1.00 55.60  ? 22   LEU B CD2 1 
ATOM   4339 N N   . LYS B 1 23  ? -15.789 3.796   -52.877 1.00 56.32  ? 23   LYS B N   1 
ATOM   4340 C CA  . LYS B 1 23  ? -16.842 4.197   -51.954 1.00 61.09  ? 23   LYS B CA  1 
ATOM   4341 C C   . LYS B 1 23  ? -16.250 4.439   -50.561 1.00 58.24  ? 23   LYS B C   1 
ATOM   4342 O O   . LYS B 1 23  ? -15.613 3.558   -49.982 1.00 49.47  ? 23   LYS B O   1 
ATOM   4343 C CB  . LYS B 1 23  ? -17.937 3.126   -51.920 1.00 65.09  ? 23   LYS B CB  1 
ATOM   4344 C CG  . LYS B 1 23  ? -19.021 3.342   -50.881 1.00 81.00  ? 23   LYS B CG  1 
ATOM   4345 C CD  . LYS B 1 23  ? -19.853 4.592   -51.170 1.00 89.06  ? 23   LYS B CD  1 
ATOM   4346 C CE  . LYS B 1 23  ? -20.937 4.788   -50.116 1.00 88.39  ? 23   LYS B CE  1 
ATOM   4347 N NZ  . LYS B 1 23  ? -21.477 6.174   -50.131 1.00 89.46  ? 23   LYS B NZ  1 
ATOM   4348 N N   . ALA B 1 24  ? -16.421 5.657   -50.053 1.00 53.69  ? 24   ALA B N   1 
ATOM   4349 C CA  . ALA B 1 24  ? -16.141 5.959   -48.655 1.00 50.28  ? 24   ALA B CA  1 
ATOM   4350 C C   . ALA B 1 24  ? -17.496 6.124   -47.974 1.00 60.26  ? 24   ALA B C   1 
ATOM   4351 O O   . ALA B 1 24  ? -18.496 6.372   -48.652 1.00 64.14  ? 24   ALA B O   1 
ATOM   4352 C CB  . ALA B 1 24  ? -15.304 7.233   -48.531 1.00 45.83  ? 24   ALA B CB  1 
ATOM   4353 N N   . PRO B 1 25  ? -17.544 5.978   -46.638 1.00 61.12  ? 25   PRO B N   1 
ATOM   4354 C CA  . PRO B 1 25  ? -18.834 6.003   -45.932 1.00 59.44  ? 25   PRO B CA  1 
ATOM   4355 C C   . PRO B 1 25  ? -19.705 7.190   -46.335 1.00 58.63  ? 25   PRO B C   1 
ATOM   4356 O O   . PRO B 1 25  ? -20.904 7.030   -46.515 1.00 64.60  ? 25   PRO B O   1 
ATOM   4357 C CB  . PRO B 1 25  ? -18.429 6.103   -44.457 1.00 57.13  ? 25   PRO B CB  1 
ATOM   4358 C CG  . PRO B 1 25  ? -17.074 5.492   -44.406 1.00 58.29  ? 25   PRO B CG  1 
ATOM   4359 C CD  . PRO B 1 25  ? -16.409 5.815   -45.714 1.00 57.24  ? 25   PRO B CD  1 
ATOM   4360 N N   . GLY B 1 26  ? -19.099 8.356   -46.508 1.00 63.11  ? 26   GLY B N   1 
ATOM   4361 C CA  . GLY B 1 26  ? -19.847 9.567   -46.778 1.00 60.70  ? 26   GLY B CA  1 
ATOM   4362 C C   . GLY B 1 26  ? -19.958 9.952   -48.237 1.00 62.53  ? 26   GLY B C   1 
ATOM   4363 O O   . GLY B 1 26  ? -20.555 10.984  -48.548 1.00 64.71  ? 26   GLY B O   1 
ATOM   4364 N N   . GLY B 1 27  ? -19.395 9.140   -49.131 1.00 58.13  ? 27   GLY B N   1 
ATOM   4365 C CA  . GLY B 1 27  ? -19.429 9.445   -50.556 1.00 57.91  ? 27   GLY B CA  1 
ATOM   4366 C C   . GLY B 1 27  ? -18.323 8.800   -51.382 1.00 61.38  ? 27   GLY B C   1 
ATOM   4367 O O   . GLY B 1 27  ? -17.505 8.049   -50.853 1.00 65.40  ? 27   GLY B O   1 
ATOM   4368 N N   . PRO B 1 28  ? -18.284 9.097   -52.693 1.00 57.94  ? 28   PRO B N   1 
ATOM   4369 C CA  . PRO B 1 28  ? -17.287 8.480   -53.572 1.00 53.97  ? 28   PRO B CA  1 
ATOM   4370 C C   . PRO B 1 28  ? -15.943 9.195   -53.485 1.00 55.18  ? 28   PRO B C   1 
ATOM   4371 O O   . PRO B 1 28  ? -15.898 10.376  -53.147 1.00 51.69  ? 28   PRO B O   1 
ATOM   4372 C CB  . PRO B 1 28  ? -17.864 8.697   -54.976 1.00 49.52  ? 28   PRO B CB  1 
ATOM   4373 C CG  . PRO B 1 28  ? -19.105 9.575   -54.793 1.00 48.77  ? 28   PRO B CG  1 
ATOM   4374 C CD  . PRO B 1 28  ? -19.143 10.057  -53.410 1.00 51.62  ? 28   PRO B CD  1 
ATOM   4375 N N   . VAL B 1 29  ? -14.866 8.481   -53.801 1.00 49.81  ? 29   VAL B N   1 
ATOM   4376 C CA  . VAL B 1 29  ? -13.565 9.111   -53.982 1.00 50.29  ? 29   VAL B CA  1 
ATOM   4377 C C   . VAL B 1 29  ? -12.945 8.584   -55.275 1.00 50.38  ? 29   VAL B C   1 
ATOM   4378 O O   . VAL B 1 29  ? -13.308 7.508   -55.748 1.00 51.95  ? 29   VAL B O   1 
ATOM   4379 C CB  . VAL B 1 29  ? -12.614 8.860   -52.774 1.00 53.39  ? 29   VAL B CB  1 
ATOM   4380 C CG1 . VAL B 1 29  ? -13.242 9.390   -51.485 1.00 52.06  ? 29   VAL B CG1 1 
ATOM   4381 C CG2 . VAL B 1 29  ? -12.300 7.388   -52.636 1.00 53.99  ? 29   VAL B CG2 1 
ATOM   4382 N N   . SER B 1 30  ? -12.033 9.351   -55.859 1.00 43.73  ? 30   SER B N   1 
ATOM   4383 C CA  . SER B 1 30  ? -11.307 8.890   -57.034 1.00 50.80  ? 30   SER B CA  1 
ATOM   4384 C C   . SER B 1 30  ? -9.963  8.318   -56.603 1.00 52.53  ? 30   SER B C   1 
ATOM   4385 O O   . SER B 1 30  ? -9.190  8.979   -55.911 1.00 50.66  ? 30   SER B O   1 
ATOM   4386 C CB  . SER B 1 30  ? -11.094 10.038  -58.021 1.00 52.89  ? 30   SER B CB  1 
ATOM   4387 O OG  . SER B 1 30  ? -12.332 10.625  -58.391 1.00 58.42  ? 30   SER B OG  1 
ATOM   4388 N N   . ALA B 1 31  ? -9.674  7.086   -56.994 1.00 48.85  ? 31   ALA B N   1 
ATOM   4389 C CA  . ALA B 1 31  ? -8.384  6.504   -56.637 1.00 39.14  ? 31   ALA B CA  1 
ATOM   4390 C C   . ALA B 1 31  ? -7.586  6.119   -57.886 1.00 46.35  ? 31   ALA B C   1 
ATOM   4391 O O   . ALA B 1 31  ? -8.126  5.526   -58.822 1.00 44.20  ? 31   ALA B O   1 
ATOM   4392 C CB  . ALA B 1 31  ? -8.586  5.307   -55.736 1.00 36.52  ? 31   ALA B CB  1 
ATOM   4393 N N   . PHE B 1 32  ? -6.308  6.488   -57.899 1.00 48.37  ? 32   PHE B N   1 
ATOM   4394 C CA  . PHE B 1 32  ? -5.405  6.127   -58.986 1.00 42.65  ? 32   PHE B CA  1 
ATOM   4395 C C   . PHE B 1 32  ? -4.254  5.364   -58.346 1.00 44.45  ? 32   PHE B C   1 
ATOM   4396 O O   . PHE B 1 32  ? -3.361  5.952   -57.721 1.00 43.29  ? 32   PHE B O   1 
ATOM   4397 C CB  . PHE B 1 32  ? -4.927  7.378   -59.729 1.00 44.77  ? 32   PHE B CB  1 
ATOM   4398 C CG  . PHE B 1 32  ? -6.062  8.236   -60.272 1.00 42.35  ? 32   PHE B CG  1 
ATOM   4399 C CD1 . PHE B 1 32  ? -6.708  9.154   -59.458 1.00 43.14  ? 32   PHE B CD1 1 
ATOM   4400 C CD2 . PHE B 1 32  ? -6.481  8.107   -61.590 1.00 43.96  ? 32   PHE B CD2 1 
ATOM   4401 C CE1 . PHE B 1 32  ? -7.749  9.925   -59.950 1.00 46.26  ? 32   PHE B CE1 1 
ATOM   4402 C CE2 . PHE B 1 32  ? -7.510  8.875   -62.089 1.00 51.38  ? 32   PHE B CE2 1 
ATOM   4403 C CZ  . PHE B 1 32  ? -8.152  9.789   -61.269 1.00 45.25  ? 32   PHE B CZ  1 
ATOM   4404 N N   . LEU B 1 33  ? -4.321  4.045   -58.480 1.00 38.96  ? 33   LEU B N   1 
ATOM   4405 C CA  . LEU B 1 33  ? -3.479  3.109   -57.752 1.00 42.99  ? 33   LEU B CA  1 
ATOM   4406 C C   . LEU B 1 33  ? -2.481  2.444   -58.700 1.00 41.78  ? 33   LEU B C   1 
ATOM   4407 O O   . LEU B 1 33  ? -2.830  2.142   -59.834 1.00 46.41  ? 33   LEU B O   1 
ATOM   4408 C CB  . LEU B 1 33  ? -4.368  2.034   -57.121 1.00 43.35  ? 33   LEU B CB  1 
ATOM   4409 C CG  . LEU B 1 33  ? -5.536  2.556   -56.281 1.00 43.72  ? 33   LEU B CG  1 
ATOM   4410 C CD1 . LEU B 1 33  ? -6.325  1.405   -55.716 1.00 39.42  ? 33   LEU B CD1 1 
ATOM   4411 C CD2 . LEU B 1 33  ? -5.036  3.454   -55.145 1.00 39.20  ? 33   LEU B CD2 1 
ATOM   4412 N N   . GLY B 1 34  ? -1.244  2.232   -58.242 1.00 42.78  ? 34   GLY B N   1 
ATOM   4413 C CA  . GLY B 1 34  ? -0.225  1.569   -59.046 1.00 40.03  ? 34   GLY B CA  1 
ATOM   4414 C C   . GLY B 1 34  ? 0.321   2.378   -60.218 1.00 36.90  ? 34   GLY B C   1 
ATOM   4415 O O   . GLY B 1 34  ? 0.567   1.826   -61.272 1.00 41.13  ? 34   GLY B O   1 
ATOM   4416 N N   . ILE B 1 35  ? 0.501   3.685   -60.039 1.00 39.80  ? 35   ILE B N   1 
ATOM   4417 C CA  . ILE B 1 35  ? 1.107   4.549   -61.051 1.00 33.16  ? 35   ILE B CA  1 
ATOM   4418 C C   . ILE B 1 35  ? 2.628   4.393   -60.997 1.00 37.50  ? 35   ILE B C   1 
ATOM   4419 O O   . ILE B 1 35  ? 3.222   4.619   -59.949 1.00 37.01  ? 35   ILE B O   1 
ATOM   4420 C CB  . ILE B 1 35  ? 0.783   6.044   -60.763 1.00 37.95  ? 35   ILE B CB  1 
ATOM   4421 C CG1 . ILE B 1 35  ? -0.736  6.270   -60.668 1.00 38.79  ? 35   ILE B CG1 1 
ATOM   4422 C CG2 . ILE B 1 35  ? 1.407   6.952   -61.815 1.00 31.93  ? 35   ILE B CG2 1 
ATOM   4423 C CD1 . ILE B 1 35  ? -1.119  7.630   -60.070 1.00 34.30  ? 35   ILE B CD1 1 
ATOM   4424 N N   . PRO B 1 36  ? 3.270   4.024   -62.124 1.00 36.21  ? 36   PRO B N   1 
ATOM   4425 C CA  . PRO B 1 36  ? 4.728   3.838   -62.061 1.00 35.66  ? 36   PRO B CA  1 
ATOM   4426 C C   . PRO B 1 36  ? 5.403   5.192   -62.004 1.00 35.66  ? 36   PRO B C   1 
ATOM   4427 O O   . PRO B 1 36  ? 5.041   6.067   -62.780 1.00 36.16  ? 36   PRO B O   1 
ATOM   4428 C CB  . PRO B 1 36  ? 5.080   3.181   -63.407 1.00 31.03  ? 36   PRO B CB  1 
ATOM   4429 C CG  . PRO B 1 36  ? 3.819   3.314   -64.288 1.00 35.67  ? 36   PRO B CG  1 
ATOM   4430 C CD  . PRO B 1 36  ? 2.739   3.987   -63.502 1.00 35.12  ? 36   PRO B CD  1 
ATOM   4431 N N   . PHE B 1 37  ? 6.359   5.373   -61.108 1.00 36.09  ? 37   PHE B N   1 
ATOM   4432 C CA  . PHE B 1 37  ? 7.097   6.631   -61.094 1.00 40.48  ? 37   PHE B CA  1 
ATOM   4433 C C   . PHE B 1 37  ? 8.565   6.405   -61.401 1.00 38.08  ? 37   PHE B C   1 
ATOM   4434 O O   . PHE B 1 37  ? 9.339   7.344   -61.506 1.00 35.80  ? 37   PHE B O   1 
ATOM   4435 C CB  . PHE B 1 37  ? 6.915   7.357   -59.762 1.00 38.09  ? 37   PHE B CB  1 
ATOM   4436 C CG  . PHE B 1 37  ? 7.516   6.643   -58.581 1.00 37.44  ? 37   PHE B CG  1 
ATOM   4437 C CD1 . PHE B 1 37  ? 8.849   6.863   -58.217 1.00 33.09  ? 37   PHE B CD1 1 
ATOM   4438 C CD2 . PHE B 1 37  ? 6.745   5.777   -57.813 1.00 36.13  ? 37   PHE B CD2 1 
ATOM   4439 C CE1 . PHE B 1 37  ? 9.402   6.224   -57.103 1.00 37.24  ? 37   PHE B CE1 1 
ATOM   4440 C CE2 . PHE B 1 37  ? 7.290   5.127   -56.696 1.00 35.30  ? 37   PHE B CE2 1 
ATOM   4441 C CZ  . PHE B 1 37  ? 8.623   5.358   -56.338 1.00 35.85  ? 37   PHE B CZ  1 
ATOM   4442 N N   . ALA B 1 38  ? 8.944   5.143   -61.572 1.00 38.24  ? 38   ALA B N   1 
ATOM   4443 C CA  . ALA B 1 38  ? 10.322  4.825   -61.924 1.00 41.23  ? 38   ALA B CA  1 
ATOM   4444 C C   . ALA B 1 38  ? 10.407  3.633   -62.865 1.00 42.58  ? 38   ALA B C   1 
ATOM   4445 O O   . ALA B 1 38  ? 9.508   2.781   -62.903 1.00 42.01  ? 38   ALA B O   1 
ATOM   4446 C CB  . ALA B 1 38  ? 11.136  4.556   -60.662 1.00 36.39  ? 38   ALA B CB  1 
ATOM   4447 N N   . GLU B 1 39  ? 11.495  3.578   -63.622 1.00 37.10  ? 39   GLU B N   1 
ATOM   4448 C CA  . GLU B 1 39  ? 11.863  2.343   -64.302 1.00 40.53  ? 39   GLU B CA  1 
ATOM   4449 C C   . GLU B 1 39  ? 12.057  1.222   -63.277 1.00 40.44  ? 39   GLU B C   1 
ATOM   4450 O O   . GLU B 1 39  ? 12.752  1.401   -62.282 1.00 38.98  ? 39   GLU B O   1 
ATOM   4451 C CB  . GLU B 1 39  ? 13.152  2.540   -65.083 1.00 33.42  ? 39   GLU B CB  1 
ATOM   4452 C CG  . GLU B 1 39  ? 12.998  3.489   -66.253 1.00 34.49  ? 39   GLU B CG  1 
ATOM   4453 C CD  . GLU B 1 39  ? 12.084  2.937   -67.326 1.00 44.10  ? 39   GLU B CD  1 
ATOM   4454 O OE1 . GLU B 1 39  ? 12.526  2.052   -68.085 1.00 46.47  ? 39   GLU B OE1 1 
ATOM   4455 O OE2 . GLU B 1 39  ? 10.923  3.388   -67.415 1.00 43.78  ? 39   GLU B OE2 1 
ATOM   4456 N N   . PRO B 1 40  ? 11.449  0.054   -63.520 1.00 36.17  ? 40   PRO B N   1 
ATOM   4457 C CA  . PRO B 1 40  ? 11.645  -1.087  -62.616 1.00 37.60  ? 40   PRO B CA  1 
ATOM   4458 C C   . PRO B 1 40  ? 13.134  -1.286  -62.274 1.00 40.23  ? 40   PRO B C   1 
ATOM   4459 O O   . PRO B 1 40  ? 13.968  -1.392  -63.170 1.00 41.74  ? 40   PRO B O   1 
ATOM   4460 C CB  . PRO B 1 40  ? 11.124  -2.265  -63.430 1.00 36.69  ? 40   PRO B CB  1 
ATOM   4461 C CG  . PRO B 1 40  ? 10.081  -1.643  -64.324 1.00 40.26  ? 40   PRO B CG  1 
ATOM   4462 C CD  . PRO B 1 40  ? 10.648  -0.296  -64.702 1.00 35.50  ? 40   PRO B CD  1 
ATOM   4463 N N   . PRO B 1 41  ? 13.468  -1.317  -60.975 1.00 36.24  ? 41   PRO B N   1 
ATOM   4464 C CA  . PRO B 1 41  ? 14.882  -1.383  -60.573 1.00 37.52  ? 41   PRO B CA  1 
ATOM   4465 C C   . PRO B 1 41  ? 15.399  -2.823  -60.591 1.00 38.65  ? 41   PRO B C   1 
ATOM   4466 O O   . PRO B 1 41  ? 15.868  -3.320  -59.569 1.00 40.07  ? 41   PRO B O   1 
ATOM   4467 C CB  . PRO B 1 41  ? 14.848  -0.846  -59.138 1.00 38.83  ? 41   PRO B CB  1 
ATOM   4468 C CG  . PRO B 1 41  ? 13.474  -1.250  -58.649 1.00 41.71  ? 41   PRO B CG  1 
ATOM   4469 C CD  . PRO B 1 41  ? 12.585  -0.978  -59.842 1.00 33.93  ? 41   PRO B CD  1 
ATOM   4470 N N   . VAL B 1 42  ? 15.315  -3.480  -61.744 1.00 41.80  ? 42   VAL B N   1 
ATOM   4471 C CA  . VAL B 1 42  ? 15.598  -4.912  -61.823 1.00 44.16  ? 42   VAL B CA  1 
ATOM   4472 C C   . VAL B 1 42  ? 16.847  -5.215  -62.659 1.00 45.91  ? 42   VAL B C   1 
ATOM   4473 O O   . VAL B 1 42  ? 17.325  -4.364  -63.413 1.00 44.60  ? 42   VAL B O   1 
ATOM   4474 C CB  . VAL B 1 42  ? 14.379  -5.691  -62.380 1.00 38.86  ? 42   VAL B CB  1 
ATOM   4475 C CG1 . VAL B 1 42  ? 13.135  -5.405  -61.524 1.00 37.84  ? 42   VAL B CG1 1 
ATOM   4476 C CG2 . VAL B 1 42  ? 14.120  -5.325  -63.850 1.00 35.33  ? 42   VAL B CG2 1 
ATOM   4477 N N   . GLY B 1 43  ? 17.369  -6.430  -62.521 1.00 46.04  ? 43   GLY B N   1 
ATOM   4478 C CA  . GLY B 1 43  ? 18.554  -6.831  -63.258 1.00 43.85  ? 43   GLY B CA  1 
ATOM   4479 C C   . GLY B 1 43  ? 19.753  -6.017  -62.817 1.00 49.28  ? 43   GLY B C   1 
ATOM   4480 O O   . GLY B 1 43  ? 20.142  -6.045  -61.639 1.00 51.48  ? 43   GLY B O   1 
ATOM   4481 N N   . SER B 1 44  ? 20.328  -5.283  -63.766 1.00 50.10  ? 44   SER B N   1 
ATOM   4482 C CA  . SER B 1 44  ? 21.524  -4.471  -63.538 1.00 51.92  ? 44   SER B CA  1 
ATOM   4483 C C   . SER B 1 44  ? 21.220  -3.197  -62.751 1.00 52.66  ? 44   SER B C   1 
ATOM   4484 O O   . SER B 1 44  ? 22.134  -2.522  -62.274 1.00 52.81  ? 44   SER B O   1 
ATOM   4485 C CB  . SER B 1 44  ? 22.138  -4.071  -64.877 1.00 56.91  ? 44   SER B CB  1 
ATOM   4486 O OG  . SER B 1 44  ? 21.330  -3.087  -65.514 1.00 53.95  ? 44   SER B OG  1 
ATOM   4487 N N   . ARG B 1 45  ? 19.942  -2.849  -62.640 1.00 46.99  ? 45   ARG B N   1 
ATOM   4488 C CA  . ARG B 1 45  ? 19.559  -1.660  -61.879 1.00 48.08  ? 45   ARG B CA  1 
ATOM   4489 C C   . ARG B 1 45  ? 19.408  -1.940  -60.379 1.00 49.77  ? 45   ARG B C   1 
ATOM   4490 O O   . ARG B 1 45  ? 19.197  -1.018  -59.588 1.00 45.11  ? 45   ARG B O   1 
ATOM   4491 C CB  . ARG B 1 45  ? 18.277  -1.044  -62.449 1.00 41.70  ? 45   ARG B CB  1 
ATOM   4492 C CG  . ARG B 1 45  ? 18.437  -0.591  -63.899 1.00 50.15  ? 45   ARG B CG  1 
ATOM   4493 C CD  . ARG B 1 45  ? 17.284  0.285   -64.365 1.00 64.88  ? 45   ARG B CD  1 
ATOM   4494 N NE  . ARG B 1 45  ? 16.111  -0.505  -64.738 1.00 78.91  ? 45   ARG B NE  1 
ATOM   4495 C CZ  . ARG B 1 45  ? 15.542  -0.490  -65.942 1.00 80.43  ? 45   ARG B CZ  1 
ATOM   4496 N NH1 . ARG B 1 45  ? 14.475  -1.248  -66.180 1.00 72.56  ? 45   ARG B NH1 1 
ATOM   4497 N NH2 . ARG B 1 45  ? 16.029  0.297   -66.899 1.00 82.94  ? 45   ARG B NH2 1 
ATOM   4498 N N   . ARG B 1 46  ? 19.518  -3.207  -59.985 1.00 45.04  ? 46   ARG B N   1 
ATOM   4499 C CA  . ARG B 1 46  ? 19.470  -3.534  -58.568 1.00 48.68  ? 46   ARG B CA  1 
ATOM   4500 C C   . ARG B 1 46  ? 20.544  -2.737  -57.818 1.00 48.84  ? 46   ARG B C   1 
ATOM   4501 O O   . ARG B 1 46  ? 21.647  -2.549  -58.332 1.00 44.60  ? 46   ARG B O   1 
ATOM   4502 C CB  . ARG B 1 46  ? 19.649  -5.034  -58.329 1.00 48.74  ? 46   ARG B CB  1 
ATOM   4503 C CG  . ARG B 1 46  ? 19.518  -5.424  -56.855 1.00 47.63  ? 46   ARG B CG  1 
ATOM   4504 C CD  . ARG B 1 46  ? 19.793  -6.901  -56.658 1.00 48.90  ? 46   ARG B CD  1 
ATOM   4505 N NE  . ARG B 1 46  ? 18.633  -7.758  -56.913 1.00 42.00  ? 46   ARG B NE  1 
ATOM   4506 C CZ  . ARG B 1 46  ? 18.693  -9.084  -56.904 1.00 45.75  ? 46   ARG B CZ  1 
ATOM   4507 N NH1 . ARG B 1 46  ? 19.858  -9.694  -56.680 1.00 45.66  ? 46   ARG B NH1 1 
ATOM   4508 N NH2 . ARG B 1 46  ? 17.609  -9.803  -57.129 1.00 40.56  ? 46   ARG B NH2 1 
ATOM   4509 N N   . PHE B 1 47  ? 20.195  -2.256  -56.620 1.00 45.31  ? 47   PHE B N   1 
ATOM   4510 C CA  . PHE B 1 47  ? 21.077  -1.442  -55.778 1.00 43.58  ? 47   PHE B CA  1 
ATOM   4511 C C   . PHE B 1 47  ? 21.356  -0.032  -56.329 1.00 40.76  ? 47   PHE B C   1 
ATOM   4512 O O   . PHE B 1 47  ? 22.004  0.760   -55.666 1.00 41.02  ? 47   PHE B O   1 
ATOM   4513 C CB  . PHE B 1 47  ? 22.418  -2.153  -55.502 1.00 44.72  ? 47   PHE B CB  1 
ATOM   4514 C CG  . PHE B 1 47  ? 22.276  -3.577  -55.035 1.00 46.21  ? 47   PHE B CG  1 
ATOM   4515 C CD1 . PHE B 1 47  ? 21.550  -3.881  -53.891 1.00 42.11  ? 47   PHE B CD1 1 
ATOM   4516 C CD2 . PHE B 1 47  ? 22.883  -4.616  -55.733 1.00 47.20  ? 47   PHE B CD2 1 
ATOM   4517 C CE1 . PHE B 1 47  ? 21.411  -5.205  -53.448 1.00 43.76  ? 47   PHE B CE1 1 
ATOM   4518 C CE2 . PHE B 1 47  ? 22.755  -5.946  -55.303 1.00 45.72  ? 47   PHE B CE2 1 
ATOM   4519 C CZ  . PHE B 1 47  ? 22.017  -6.240  -54.157 1.00 44.37  ? 47   PHE B CZ  1 
ATOM   4520 N N   . MET B 1 48  ? 20.885  0.278   -57.536 1.00 36.99  ? 48   MET B N   1 
ATOM   4521 C CA  . MET B 1 48  ? 21.198  1.569   -58.154 1.00 38.75  ? 48   MET B CA  1 
ATOM   4522 C C   . MET B 1 48  ? 20.087  2.587   -57.885 1.00 39.11  ? 48   MET B C   1 
ATOM   4523 O O   . MET B 1 48  ? 18.942  2.198   -57.676 1.00 35.67  ? 48   MET B O   1 
ATOM   4524 C CB  . MET B 1 48  ? 21.388  1.418   -59.666 1.00 38.65  ? 48   MET B CB  1 
ATOM   4525 C CG  . MET B 1 48  ? 22.446  0.393   -60.091 1.00 47.72  ? 48   MET B CG  1 
ATOM   4526 S SD  . MET B 1 48  ? 23.109  0.773   -61.747 1.00 62.89  ? 48   MET B SD  1 
ATOM   4527 C CE  . MET B 1 48  ? 24.062  2.223   -61.283 1.00 60.51  ? 48   MET B CE  1 
ATOM   4528 N N   . PRO B 1 49  ? 20.430  3.888   -57.901 1.00 42.31  ? 49   PRO B N   1 
ATOM   4529 C CA  . PRO B 1 49  ? 19.454  4.980   -57.794 1.00 37.86  ? 49   PRO B CA  1 
ATOM   4530 C C   . PRO B 1 49  ? 18.330  4.757   -58.798 1.00 44.71  ? 49   PRO B C   1 
ATOM   4531 O O   . PRO B 1 49  ? 18.582  4.167   -59.851 1.00 39.93  ? 49   PRO B O   1 
ATOM   4532 C CB  . PRO B 1 49  ? 20.259  6.215   -58.214 1.00 39.39  ? 49   PRO B CB  1 
ATOM   4533 C CG  . PRO B 1 49  ? 21.682  5.874   -57.866 1.00 42.35  ? 49   PRO B CG  1 
ATOM   4534 C CD  . PRO B 1 49  ? 21.812  4.385   -58.064 1.00 45.43  ? 49   PRO B CD  1 
ATOM   4535 N N   . PRO B 1 50  ? 17.104  5.230   -58.489 1.00 39.98  ? 50   PRO B N   1 
ATOM   4536 C CA  . PRO B 1 50  ? 16.014  5.025   -59.453 1.00 35.37  ? 50   PRO B CA  1 
ATOM   4537 C C   . PRO B 1 50  ? 16.156  5.956   -60.648 1.00 41.24  ? 50   PRO B C   1 
ATOM   4538 O O   . PRO B 1 50  ? 16.776  7.008   -60.533 1.00 43.38  ? 50   PRO B O   1 
ATOM   4539 C CB  . PRO B 1 50  ? 14.757  5.385   -58.648 1.00 28.85  ? 50   PRO B CB  1 
ATOM   4540 C CG  . PRO B 1 50  ? 15.280  6.389   -57.610 1.00 35.94  ? 50   PRO B CG  1 
ATOM   4541 C CD  . PRO B 1 50  ? 16.622  5.811   -57.218 1.00 34.77  ? 50   PRO B CD  1 
ATOM   4542 N N   . GLU B 1 51  ? 15.607  5.548   -61.786 1.00 37.88  ? 51   GLU B N   1 
ATOM   4543 C CA  . GLU B 1 51  ? 15.492  6.408   -62.954 1.00 40.74  ? 51   GLU B CA  1 
ATOM   4544 C C   . GLU B 1 51  ? 14.009  6.666   -63.208 1.00 40.23  ? 51   GLU B C   1 
ATOM   4545 O O   . GLU B 1 51  ? 13.164  5.826   -62.893 1.00 38.61  ? 51   GLU B O   1 
ATOM   4546 C CB  . GLU B 1 51  ? 16.124  5.724   -64.169 1.00 46.56  ? 51   GLU B CB  1 
ATOM   4547 C CG  . GLU B 1 51  ? 17.569  5.327   -63.953 1.00 62.06  ? 51   GLU B CG  1 
ATOM   4548 C CD  . GLU B 1 51  ? 18.107  4.418   -65.056 1.00 87.49  ? 51   GLU B CD  1 
ATOM   4549 O OE1 . GLU B 1 51  ? 17.301  3.767   -65.770 1.00 90.29  ? 51   GLU B OE1 1 
ATOM   4550 O OE2 . GLU B 1 51  ? 19.349  4.355   -65.206 1.00 98.87  ? 51   GLU B OE2 1 
ATOM   4551 N N   . PRO B 1 52  ? 13.685  7.829   -63.779 1.00 40.54  ? 52   PRO B N   1 
ATOM   4552 C CA  . PRO B 1 52  ? 12.297  8.214   -64.081 1.00 39.24  ? 52   PRO B CA  1 
ATOM   4553 C C   . PRO B 1 52  ? 11.608  7.247   -65.044 1.00 39.84  ? 52   PRO B C   1 
ATOM   4554 O O   . PRO B 1 52  ? 12.222  6.795   -66.020 1.00 42.41  ? 52   PRO B O   1 
ATOM   4555 C CB  . PRO B 1 52  ? 12.451  9.579   -64.761 1.00 48.05  ? 52   PRO B CB  1 
ATOM   4556 C CG  . PRO B 1 52  ? 13.804  10.097  -64.293 1.00 52.39  ? 52   PRO B CG  1 
ATOM   4557 C CD  . PRO B 1 52  ? 14.662  8.876   -64.127 1.00 47.18  ? 52   PRO B CD  1 
ATOM   4558 N N   . LYS B 1 53  ? 10.341  6.950   -64.782 1.00 40.42  ? 53   LYS B N   1 
ATOM   4559 C CA  . LYS B 1 53  ? 9.568   6.077   -65.655 1.00 46.21  ? 53   LYS B CA  1 
ATOM   4560 C C   . LYS B 1 53  ? 9.487   6.648   -67.069 1.00 44.76  ? 53   LYS B C   1 
ATOM   4561 O O   . LYS B 1 53  ? 9.207   7.826   -67.241 1.00 45.79  ? 53   LYS B O   1 
ATOM   4562 C CB  . LYS B 1 53  ? 8.167   5.863   -65.080 1.00 46.73  ? 53   LYS B CB  1 
ATOM   4563 C CG  . LYS B 1 53  ? 7.203   5.130   -66.024 1.00 46.15  ? 53   LYS B CG  1 
ATOM   4564 C CD  . LYS B 1 53  ? 7.538   3.647   -66.111 1.00 38.33  ? 53   LYS B CD  1 
ATOM   4565 C CE  . LYS B 1 53  ? 6.582   2.932   -67.059 1.00 41.15  ? 53   LYS B CE  1 
ATOM   4566 N NZ  . LYS B 1 53  ? 6.976   3.163   -68.472 1.00 41.37  ? 53   LYS B NZ  1 
ATOM   4567 N N   . ARG B 1 54  ? 9.756   5.820   -68.079 1.00 42.29  ? 54   ARG B N   1 
ATOM   4568 C CA  . ARG B 1 54  ? 9.587   6.248   -69.470 1.00 40.10  ? 54   ARG B CA  1 
ATOM   4569 C C   . ARG B 1 54  ? 8.101   6.464   -69.772 1.00 42.95  ? 54   ARG B C   1 
ATOM   4570 O O   . ARG B 1 54  ? 7.237   5.784   -69.214 1.00 37.88  ? 54   ARG B O   1 
ATOM   4571 C CB  . ARG B 1 54  ? 10.160  5.215   -70.452 1.00 44.35  ? 54   ARG B CB  1 
ATOM   4572 C CG  . ARG B 1 54  ? 11.676  5.053   -70.421 1.00 40.80  ? 54   ARG B CG  1 
ATOM   4573 C CD  . ARG B 1 54  ? 12.121  3.808   -71.237 1.00 44.34  ? 54   ARG B CD  1 
ATOM   4574 N NE  . ARG B 1 54  ? 11.395  2.610   -70.791 1.00 49.48  ? 54   ARG B NE  1 
ATOM   4575 C CZ  . ARG B 1 54  ? 10.621  1.840   -71.563 1.00 49.37  ? 54   ARG B CZ  1 
ATOM   4576 N NH1 . ARG B 1 54  ? 9.995   0.795   -71.031 1.00 44.21  ? 54   ARG B NH1 1 
ATOM   4577 N NH2 . ARG B 1 54  ? 10.487  2.092   -72.866 1.00 44.12  ? 54   ARG B NH2 1 
ATOM   4578 N N   . PRO B 1 55  ? 7.798   7.415   -70.656 1.00 48.38  ? 55   PRO B N   1 
ATOM   4579 C CA  . PRO B 1 55  ? 6.420   7.679   -71.101 1.00 50.76  ? 55   PRO B CA  1 
ATOM   4580 C C   . PRO B 1 55  ? 5.766   6.418   -71.671 1.00 44.17  ? 55   PRO B C   1 
ATOM   4581 O O   . PRO B 1 55  ? 6.453   5.586   -72.241 1.00 46.05  ? 55   PRO B O   1 
ATOM   4582 C CB  . PRO B 1 55  ? 6.607   8.712   -72.217 1.00 55.20  ? 55   PRO B CB  1 
ATOM   4583 C CG  . PRO B 1 55  ? 7.905   9.390   -71.886 1.00 57.40  ? 55   PRO B CG  1 
ATOM   4584 C CD  . PRO B 1 55  ? 8.776   8.346   -71.241 1.00 50.21  ? 55   PRO B CD  1 
ATOM   4585 N N   . TRP B 1 56  ? 4.460   6.276   -71.516 1.00 41.27  ? 56   TRP B N   1 
ATOM   4586 C CA  . TRP B 1 56  ? 3.755   5.113   -72.050 1.00 44.50  ? 56   TRP B CA  1 
ATOM   4587 C C   . TRP B 1 56  ? 2.688   5.549   -73.053 1.00 47.52  ? 56   TRP B C   1 
ATOM   4588 O O   . TRP B 1 56  ? 2.237   6.696   -73.031 1.00 50.84  ? 56   TRP B O   1 
ATOM   4589 C CB  . TRP B 1 56  ? 3.095   4.313   -70.924 1.00 40.94  ? 56   TRP B CB  1 
ATOM   4590 C CG  . TRP B 1 56  ? 2.176   5.151   -70.106 1.00 42.75  ? 56   TRP B CG  1 
ATOM   4591 C CD1 . TRP B 1 56  ? 0.853   5.400   -70.351 1.00 44.10  ? 56   TRP B CD1 1 
ATOM   4592 C CD2 . TRP B 1 56  ? 2.510   5.878   -68.910 1.00 41.68  ? 56   TRP B CD2 1 
ATOM   4593 N NE1 . TRP B 1 56  ? 0.348   6.237   -69.381 1.00 46.69  ? 56   TRP B NE1 1 
ATOM   4594 C CE2 . TRP B 1 56  ? 1.345   6.545   -68.488 1.00 47.10  ? 56   TRP B CE2 1 
ATOM   4595 C CE3 . TRP B 1 56  ? 3.684   6.028   -68.159 1.00 40.06  ? 56   TRP B CE3 1 
ATOM   4596 C CZ2 . TRP B 1 56  ? 1.318   7.349   -67.338 1.00 40.34  ? 56   TRP B CZ2 1 
ATOM   4597 C CZ3 . TRP B 1 56  ? 3.662   6.830   -67.037 1.00 45.79  ? 56   TRP B CZ3 1 
ATOM   4598 C CH2 . TRP B 1 56  ? 2.486   7.484   -66.637 1.00 44.26  ? 56   TRP B CH2 1 
ATOM   4599 N N   . SER B 1 57  ? 2.285   4.623   -73.919 1.00 43.94  ? 57   SER B N   1 
ATOM   4600 C CA  . SER B 1 57  ? 1.233   4.863   -74.910 1.00 46.88  ? 57   SER B CA  1 
ATOM   4601 C C   . SER B 1 57  ? -0.155  4.500   -74.367 1.00 46.47  ? 57   SER B C   1 
ATOM   4602 O O   . SER B 1 57  ? -0.272  3.711   -73.433 1.00 44.35  ? 57   SER B O   1 
ATOM   4603 C CB  . SER B 1 57  ? 1.502   3.996   -76.139 1.00 50.36  ? 57   SER B CB  1 
ATOM   4604 O OG  . SER B 1 57  ? 1.370   2.629   -75.774 1.00 47.83  ? 57   SER B OG  1 
ATOM   4605 N N   . GLY B 1 58  ? -1.207  5.045   -74.976 1.00 43.84  ? 58   GLY B N   1 
ATOM   4606 C CA  . GLY B 1 58  ? -2.565  4.706   -74.579 1.00 43.17  ? 58   GLY B CA  1 
ATOM   4607 C C   . GLY B 1 58  ? -2.936  5.083   -73.149 1.00 44.49  ? 58   GLY B C   1 
ATOM   4608 O O   . GLY B 1 58  ? -2.375  6.017   -72.579 1.00 44.55  ? 58   GLY B O   1 
ATOM   4609 N N   . VAL B 1 59  ? -3.887  4.356   -72.562 1.00 49.37  ? 59   VAL B N   1 
ATOM   4610 C CA  . VAL B 1 59  ? -4.357  4.664   -71.212 1.00 47.87  ? 59   VAL B CA  1 
ATOM   4611 C C   . VAL B 1 59  ? -3.906  3.605   -70.225 1.00 48.06  ? 59   VAL B C   1 
ATOM   4612 O O   . VAL B 1 59  ? -4.348  2.455   -70.297 1.00 51.72  ? 59   VAL B O   1 
ATOM   4613 C CB  . VAL B 1 59  ? -5.907  4.777   -71.141 1.00 45.68  ? 59   VAL B CB  1 
ATOM   4614 C CG1 . VAL B 1 59  ? -6.353  5.252   -69.753 1.00 36.65  ? 59   VAL B CG1 1 
ATOM   4615 C CG2 . VAL B 1 59  ? -6.437  5.703   -72.229 1.00 43.63  ? 59   VAL B CG2 1 
ATOM   4616 N N   . LEU B 1 60  ? -3.026  3.997   -69.306 1.00 48.48  ? 60   LEU B N   1 
ATOM   4617 C CA  . LEU B 1 60  ? -2.509  3.081   -68.278 1.00 44.97  ? 60   LEU B CA  1 
ATOM   4618 C C   . LEU B 1 60  ? -3.558  2.788   -67.196 1.00 42.23  ? 60   LEU B C   1 
ATOM   4619 O O   . LEU B 1 60  ? -4.142  3.690   -66.615 1.00 45.91  ? 60   LEU B O   1 
ATOM   4620 C CB  . LEU B 1 60  ? -1.228  3.632   -67.650 1.00 41.70  ? 60   LEU B CB  1 
ATOM   4621 C CG  . LEU B 1 60  ? -0.446  2.637   -66.771 1.00 50.55  ? 60   LEU B CG  1 
ATOM   4622 C CD1 . LEU B 1 60  ? -0.103  1.389   -67.590 1.00 55.95  ? 60   LEU B CD1 1 
ATOM   4623 C CD2 . LEU B 1 60  ? 0.823   3.234   -66.233 1.00 49.58  ? 60   LEU B CD2 1 
ATOM   4624 N N   . ASP B 1 61  ? -3.793  1.519   -66.936 1.00 43.68  ? 61   ASP B N   1 
ATOM   4625 C CA  . ASP B 1 61  ? -4.766  1.136   -65.940 1.00 49.54  ? 61   ASP B CA  1 
ATOM   4626 C C   . ASP B 1 61  ? -4.208  1.352   -64.523 1.00 47.01  ? 61   ASP B C   1 
ATOM   4627 O O   . ASP B 1 61  ? -3.264  0.687   -64.111 1.00 50.20  ? 61   ASP B O   1 
ATOM   4628 C CB  . ASP B 1 61  ? -5.159  -0.325  -66.162 1.00 58.72  ? 61   ASP B CB  1 
ATOM   4629 C CG  . ASP B 1 61  ? -5.847  -0.921  -64.967 1.00 71.05  ? 61   ASP B CG  1 
ATOM   4630 O OD1 . ASP B 1 61  ? -5.624  -2.116  -64.667 1.00 77.76  ? 61   ASP B OD1 1 
ATOM   4631 O OD2 . ASP B 1 61  ? -6.596  -0.182  -64.309 1.00 73.87  ? 61   ASP B OD2 1 
ATOM   4632 N N   . ALA B 1 62  ? -4.792  2.292   -63.789 1.00 43.00  ? 62   ALA B N   1 
ATOM   4633 C CA  . ALA B 1 62  ? -4.392  2.578   -62.407 1.00 39.76  ? 62   ALA B CA  1 
ATOM   4634 C C   . ALA B 1 62  ? -5.570  2.351   -61.465 1.00 45.14  ? 62   ALA B C   1 
ATOM   4635 O O   . ALA B 1 62  ? -5.984  3.254   -60.732 1.00 39.78  ? 62   ALA B O   1 
ATOM   4636 C CB  . ALA B 1 62  ? -3.894  4.008   -62.290 1.00 34.07  ? 62   ALA B CB  1 
ATOM   4637 N N   . THR B 1 63  ? -6.130  1.149   -61.509 1.00 42.12  ? 63   THR B N   1 
ATOM   4638 C CA  . THR B 1 63  ? -7.333  0.861   -60.751 1.00 45.58  ? 63   THR B CA  1 
ATOM   4639 C C   . THR B 1 63  ? -7.042  -0.132  -59.643 1.00 46.99  ? 63   THR B C   1 
ATOM   4640 O O   . THR B 1 63  ? -7.929  -0.480  -58.876 1.00 49.37  ? 63   THR B O   1 
ATOM   4641 C CB  . THR B 1 63  ? -8.471  0.302   -61.651 1.00 47.39  ? 63   THR B CB  1 
ATOM   4642 O OG1 . THR B 1 63  ? -8.137  -1.019  -62.097 1.00 50.21  ? 63   THR B OG1 1 
ATOM   4643 C CG2 . THR B 1 63  ? -8.701  1.204   -62.863 1.00 45.06  ? 63   THR B CG2 1 
ATOM   4644 N N   . THR B 1 64  ? -5.796  -0.581  -59.553 1.00 42.05  ? 64   THR B N   1 
ATOM   4645 C CA  . THR B 1 64  ? -5.444  -1.580  -58.559 1.00 46.65  ? 64   THR B CA  1 
ATOM   4646 C C   . THR B 1 64  ? -4.012  -1.384  -58.031 1.00 42.74  ? 64   THR B C   1 
ATOM   4647 O O   . THR B 1 64  ? -3.152  -0.901  -58.758 1.00 39.73  ? 64   THR B O   1 
ATOM   4648 C CB  . THR B 1 64  ? -5.569  -2.972  -59.165 1.00 56.50  ? 64   THR B CB  1 
ATOM   4649 O OG1 . THR B 1 64  ? -5.358  -3.946  -58.142 1.00 77.22  ? 64   THR B OG1 1 
ATOM   4650 C CG2 . THR B 1 64  ? -4.525  -3.163  -60.234 1.00 44.92  ? 64   THR B CG2 1 
ATOM   4651 N N   . PHE B 1 65  ? -3.767  -1.762  -56.775 1.00 38.12  ? 65   PHE B N   1 
ATOM   4652 C CA  . PHE B 1 65  ? -2.442  -1.634  -56.169 1.00 43.57  ? 65   PHE B CA  1 
ATOM   4653 C C   . PHE B 1 65  ? -1.446  -2.503  -56.916 1.00 44.00  ? 65   PHE B C   1 
ATOM   4654 O O   . PHE B 1 65  ? -1.778  -3.602  -57.342 1.00 43.01  ? 65   PHE B O   1 
ATOM   4655 C CB  . PHE B 1 65  ? -2.458  -2.082  -54.699 1.00 41.73  ? 65   PHE B CB  1 
ATOM   4656 C CG  . PHE B 1 65  ? -3.120  -1.110  -53.756 1.00 41.38  ? 65   PHE B CG  1 
ATOM   4657 C CD1 . PHE B 1 65  ? -2.611  0.171   -53.579 1.00 40.67  ? 65   PHE B CD1 1 
ATOM   4658 C CD2 . PHE B 1 65  ? -4.239  -1.495  -53.015 1.00 41.57  ? 65   PHE B CD2 1 
ATOM   4659 C CE1 . PHE B 1 65  ? -3.225  1.070   -52.706 1.00 39.56  ? 65   PHE B CE1 1 
ATOM   4660 C CE2 . PHE B 1 65  ? -4.852  -0.617  -52.129 1.00 36.88  ? 65   PHE B CE2 1 
ATOM   4661 C CZ  . PHE B 1 65  ? -4.349  0.670   -51.976 1.00 39.36  ? 65   PHE B CZ  1 
ATOM   4662 N N   . GLN B 1 66  ? -0.215  -2.029  -57.039 1.00 45.21  ? 66   GLN B N   1 
ATOM   4663 C CA  . GLN B 1 66  ? 0.855   -2.817  -57.662 1.00 38.85  ? 66   GLN B CA  1 
ATOM   4664 C C   . GLN B 1 66  ? 1.574   -3.721  -56.655 1.00 42.78  ? 66   GLN B C   1 
ATOM   4665 O O   . GLN B 1 66  ? 1.217   -3.768  -55.477 1.00 41.28  ? 66   GLN B O   1 
ATOM   4666 C CB  . GLN B 1 66  ? 1.873   -1.888  -58.326 1.00 40.47  ? 66   GLN B CB  1 
ATOM   4667 C CG  . GLN B 1 66  ? 1.638   -1.646  -59.804 1.00 41.51  ? 66   GLN B CG  1 
ATOM   4668 C CD  . GLN B 1 66  ? 2.007   -2.855  -60.638 1.00 48.23  ? 66   GLN B CD  1 
ATOM   4669 O OE1 . GLN B 1 66  ? 2.614   -3.812  -60.136 1.00 49.81  ? 66   GLN B OE1 1 
ATOM   4670 N NE2 . GLN B 1 66  ? 1.641   -2.827  -61.915 1.00 47.65  ? 66   GLN B NE2 1 
ATOM   4671 N N   . ASN B 1 67  ? 2.595   -4.433  -57.132 1.00 43.09  ? 67   ASN B N   1 
ATOM   4672 C CA  . ASN B 1 67  ? 3.368   -5.346  -56.303 1.00 39.43  ? 67   ASN B CA  1 
ATOM   4673 C C   . ASN B 1 67  ? 4.098   -4.669  -55.148 1.00 40.69  ? 67   ASN B C   1 
ATOM   4674 O O   . ASN B 1 67  ? 4.462   -3.494  -55.220 1.00 45.52  ? 67   ASN B O   1 
ATOM   4675 C CB  . ASN B 1 67  ? 4.403   -6.081  -57.148 1.00 35.74  ? 67   ASN B CB  1 
ATOM   4676 C CG  . ASN B 1 67  ? 3.770   -6.933  -58.238 1.00 51.69  ? 67   ASN B CG  1 
ATOM   4677 O OD1 . ASN B 1 67  ? 2.732   -7.576  -58.027 1.00 48.52  ? 67   ASN B OD1 1 
ATOM   4678 N ND2 . ASN B 1 67  ? 4.399   -6.943  -59.410 1.00 51.01  ? 67   ASN B ND2 1 
ATOM   4679 N N   . VAL B 1 68  ? 4.332   -5.447  -54.101 1.00 34.31  ? 68   VAL B N   1 
ATOM   4680 C CA  . VAL B 1 68  ? 5.047   -5.000  -52.919 1.00 35.30  ? 68   VAL B CA  1 
ATOM   4681 C C   . VAL B 1 68  ? 6.542   -5.242  -53.131 1.00 35.85  ? 68   VAL B C   1 
ATOM   4682 O O   . VAL B 1 68  ? 6.940   -6.286  -53.649 1.00 36.60  ? 68   VAL B O   1 
ATOM   4683 C CB  . VAL B 1 68  ? 4.529   -5.764  -51.671 1.00 41.25  ? 68   VAL B CB  1 
ATOM   4684 C CG1 . VAL B 1 68  ? 5.460   -5.564  -50.482 1.00 45.07  ? 68   VAL B CG1 1 
ATOM   4685 C CG2 . VAL B 1 68  ? 3.116   -5.319  -51.338 1.00 34.38  ? 68   VAL B CG2 1 
ATOM   4686 N N   . CYS B 1 69  ? 7.364   -4.263  -52.773 1.00 36.45  ? 69   CYS B N   1 
ATOM   4687 C CA  . CYS B 1 69  ? 8.809   -4.395  -52.905 1.00 33.14  ? 69   CYS B CA  1 
ATOM   4688 C C   . CYS B 1 69  ? 9.284   -5.635  -52.164 1.00 42.11  ? 69   CYS B C   1 
ATOM   4689 O O   . CYS B 1 69  ? 8.786   -5.936  -51.071 1.00 41.37  ? 69   CYS B O   1 
ATOM   4690 C CB  . CYS B 1 69  ? 9.518   -3.144  -52.373 1.00 32.15  ? 69   CYS B CB  1 
ATOM   4691 S SG  . CYS B 1 69  ? 9.305   -1.619  -53.379 1.00 38.20  ? 69   CYS B SG  1 
ATOM   4692 N N   . TYR B 1 70  ? 10.237  -6.355  -52.760 1.00 45.12  ? 70   TYR B N   1 
ATOM   4693 C CA  . TYR B 1 70  ? 10.687  -7.637  -52.208 1.00 41.25  ? 70   TYR B CA  1 
ATOM   4694 C C   . TYR B 1 70  ? 11.228  -7.513  -50.775 1.00 42.24  ? 70   TYR B C   1 
ATOM   4695 O O   . TYR B 1 70  ? 12.040  -6.645  -50.476 1.00 42.18  ? 70   TYR B O   1 
ATOM   4696 C CB  . TYR B 1 70  ? 11.688  -8.343  -53.134 1.00 38.97  ? 70   TYR B CB  1 
ATOM   4697 C CG  . TYR B 1 70  ? 11.550  -9.842  -53.001 1.00 43.64  ? 70   TYR B CG  1 
ATOM   4698 C CD1 . TYR B 1 70  ? 10.789  -10.579 -53.897 1.00 45.27  ? 70   TYR B CD1 1 
ATOM   4699 C CD2 . TYR B 1 70  ? 12.121  -10.508 -51.924 1.00 44.94  ? 70   TYR B CD2 1 
ATOM   4700 C CE1 . TYR B 1 70  ? 10.632  -11.967 -53.739 1.00 45.56  ? 70   TYR B CE1 1 
ATOM   4701 C CE2 . TYR B 1 70  ? 11.969  -11.866 -51.756 1.00 46.86  ? 70   TYR B CE2 1 
ATOM   4702 C CZ  . TYR B 1 70  ? 11.226  -12.597 -52.663 1.00 45.16  ? 70   TYR B CZ  1 
ATOM   4703 O OH  . TYR B 1 70  ? 11.096  -13.955 -52.464 1.00 48.33  ? 70   TYR B OH  1 
ATOM   4704 N N   . GLN B 1 71  ? 10.758  -8.378  -49.885 1.00 44.69  ? 71   GLN B N   1 
ATOM   4705 C CA  . GLN B 1 71  ? 11.009  -8.203  -48.455 1.00 41.38  ? 71   GLN B CA  1 
ATOM   4706 C C   . GLN B 1 71  ? 10.731  -9.467  -47.669 1.00 43.89  ? 71   GLN B C   1 
ATOM   4707 O O   . GLN B 1 71  ? 9.946   -10.335 -48.095 1.00 41.06  ? 71   GLN B O   1 
ATOM   4708 C CB  . GLN B 1 71  ? 10.119  -7.089  -47.880 1.00 33.04  ? 71   GLN B CB  1 
ATOM   4709 C CG  . GLN B 1 71  ? 8.624   -7.447  -47.824 1.00 32.80  ? 71   GLN B CG  1 
ATOM   4710 C CD  . GLN B 1 71  ? 7.744   -6.198  -47.542 1.00 36.94  ? 71   GLN B CD  1 
ATOM   4711 O OE1 . GLN B 1 71  ? 7.097   -6.088  -46.504 1.00 36.54  ? 71   GLN B OE1 1 
ATOM   4712 N NE2 . GLN B 1 71  ? 7.769   -5.250  -48.455 1.00 36.94  ? 71   GLN B NE2 1 
ATOM   4713 N N   . TYR B 1 72  ? 11.372  -9.543  -46.509 1.00 45.06  ? 72   TYR B N   1 
ATOM   4714 C CA  . TYR B 1 72  ? 11.116  -10.579 -45.515 1.00 44.23  ? 72   TYR B CA  1 
ATOM   4715 C C   . TYR B 1 72  ? 9.662   -10.546 -45.054 1.00 48.07  ? 72   TYR B C   1 
ATOM   4716 O O   . TYR B 1 72  ? 9.040   -9.474  -44.940 1.00 43.42  ? 72   TYR B O   1 
ATOM   4717 C CB  . TYR B 1 72  ? 12.028  -10.357 -44.308 1.00 45.82  ? 72   TYR B CB  1 
ATOM   4718 C CG  . TYR B 1 72  ? 11.809  -11.341 -43.196 1.00 55.66  ? 72   TYR B CG  1 
ATOM   4719 C CD1 . TYR B 1 72  ? 11.072  -10.994 -42.069 1.00 56.76  ? 72   TYR B CD1 1 
ATOM   4720 C CD2 . TYR B 1 72  ? 12.322  -12.635 -43.280 1.00 58.79  ? 72   TYR B CD2 1 
ATOM   4721 C CE1 . TYR B 1 72  ? 10.863  -11.907 -41.044 1.00 57.30  ? 72   TYR B CE1 1 
ATOM   4722 C CE2 . TYR B 1 72  ? 12.119  -13.547 -42.270 1.00 61.35  ? 72   TYR B CE2 1 
ATOM   4723 C CZ  . TYR B 1 72  ? 11.392  -13.180 -41.153 1.00 62.68  ? 72   TYR B CZ  1 
ATOM   4724 O OH  . TYR B 1 72  ? 11.194  -14.099 -40.151 1.00 67.68  ? 72   TYR B OH  1 
ATOM   4725 N N   . VAL B 1 73  ? 9.122   -11.723 -44.781 1.00 46.87  ? 73   VAL B N   1 
ATOM   4726 C CA  . VAL B 1 73  ? 7.738   -11.841 -44.344 1.00 51.18  ? 73   VAL B CA  1 
ATOM   4727 C C   . VAL B 1 73  ? 7.694   -12.405 -42.922 1.00 55.21  ? 73   VAL B C   1 
ATOM   4728 O O   . VAL B 1 73  ? 8.310   -13.433 -42.640 1.00 55.83  ? 73   VAL B O   1 
ATOM   4729 C CB  . VAL B 1 73  ? 6.923   -12.727 -45.310 1.00 51.98  ? 73   VAL B CB  1 
ATOM   4730 C CG1 . VAL B 1 73  ? 5.588   -13.063 -44.715 1.00 52.26  ? 73   VAL B CG1 1 
ATOM   4731 C CG2 . VAL B 1 73  ? 6.737   -12.020 -46.652 1.00 55.56  ? 73   VAL B CG2 1 
ATOM   4732 N N   . ASP B 1 74  ? 6.980   -11.712 -42.034 1.00 54.73  ? 74   ASP B N   1 
ATOM   4733 C CA  . ASP B 1 74  ? 6.843   -12.108 -40.624 1.00 54.34  ? 74   ASP B CA  1 
ATOM   4734 C C   . ASP B 1 74  ? 6.002   -13.380 -40.487 1.00 54.54  ? 74   ASP B C   1 
ATOM   4735 O O   . ASP B 1 74  ? 4.865   -13.429 -40.955 1.00 63.49  ? 74   ASP B O   1 
ATOM   4736 C CB  . ASP B 1 74  ? 6.208   -10.959 -39.832 1.00 57.57  ? 74   ASP B CB  1 
ATOM   4737 C CG  . ASP B 1 74  ? 6.086   -11.245 -38.337 1.00 66.61  ? 74   ASP B CG  1 
ATOM   4738 O OD1 . ASP B 1 74  ? 5.662   -10.322 -37.608 1.00 68.23  ? 74   ASP B OD1 1 
ATOM   4739 O OD2 . ASP B 1 74  ? 6.397   -12.368 -37.885 1.00 73.08  ? 74   ASP B OD2 1 
ATOM   4740 N N   . THR B 1 75  ? 6.571   -14.404 -39.858 1.00 52.41  ? 75   THR B N   1 
ATOM   4741 C CA  . THR B 1 75  ? 5.885   -15.688 -39.665 1.00 60.34  ? 75   THR B CA  1 
ATOM   4742 C C   . THR B 1 75  ? 5.900   -16.144 -38.200 1.00 60.80  ? 75   THR B C   1 
ATOM   4743 O O   . THR B 1 75  ? 5.703   -17.319 -37.913 1.00 61.05  ? 75   THR B O   1 
ATOM   4744 C CB  . THR B 1 75  ? 6.522   -16.803 -40.521 1.00 66.75  ? 75   THR B CB  1 
ATOM   4745 O OG1 . THR B 1 75  ? 7.949   -16.803 -40.330 1.00 69.40  ? 75   THR B OG1 1 
ATOM   4746 C CG2 . THR B 1 75  ? 6.181   -16.615 -42.014 1.00 60.20  ? 75   THR B CG2 1 
ATOM   4747 N N   . LEU B 1 76  ? 6.126   -15.213 -37.276 1.00 62.33  ? 76   LEU B N   1 
ATOM   4748 C CA  . LEU B 1 76  ? 6.205   -15.548 -35.852 1.00 64.64  ? 76   LEU B CA  1 
ATOM   4749 C C   . LEU B 1 76  ? 4.894   -16.137 -35.318 1.00 66.00  ? 76   LEU B C   1 
ATOM   4750 O O   . LEU B 1 76  ? 4.903   -17.097 -34.551 1.00 70.36  ? 76   LEU B O   1 
ATOM   4751 C CB  . LEU B 1 76  ? 6.619   -14.323 -35.027 1.00 67.53  ? 76   LEU B CB  1 
ATOM   4752 C CG  . LEU B 1 76  ? 6.586   -14.480 -33.501 1.00 68.34  ? 76   LEU B CG  1 
ATOM   4753 C CD1 . LEU B 1 76  ? 7.523   -15.593 -33.052 1.00 65.44  ? 76   LEU B CD1 1 
ATOM   4754 C CD2 . LEU B 1 76  ? 6.937   -13.167 -32.810 1.00 64.33  ? 76   LEU B CD2 1 
ATOM   4755 N N   . TYR B 1 77  ? 3.770   -15.558 -35.723 1.00 63.75  ? 77   TYR B N   1 
ATOM   4756 C CA  . TYR B 1 77  ? 2.466   -16.086 -35.351 1.00 61.55  ? 77   TYR B CA  1 
ATOM   4757 C C   . TYR B 1 77  ? 1.607   -16.230 -36.602 1.00 60.71  ? 77   TYR B C   1 
ATOM   4758 O O   . TYR B 1 77  ? 0.832   -15.331 -36.935 1.00 54.87  ? 77   TYR B O   1 
ATOM   4759 C CB  . TYR B 1 77  ? 1.761   -15.161 -34.357 1.00 65.21  ? 77   TYR B CB  1 
ATOM   4760 C CG  . TYR B 1 77  ? 2.506   -14.893 -33.063 1.00 62.16  ? 77   TYR B CG  1 
ATOM   4761 C CD1 . TYR B 1 77  ? 2.618   -15.872 -32.081 1.00 59.85  ? 77   TYR B CD1 1 
ATOM   4762 C CD2 . TYR B 1 77  ? 3.057   -13.642 -32.807 1.00 58.41  ? 77   TYR B CD2 1 
ATOM   4763 C CE1 . TYR B 1 77  ? 3.289   -15.621 -30.890 1.00 59.58  ? 77   TYR B CE1 1 
ATOM   4764 C CE2 . TYR B 1 77  ? 3.722   -13.375 -31.625 1.00 58.79  ? 77   TYR B CE2 1 
ATOM   4765 C CZ  . TYR B 1 77  ? 3.837   -14.362 -30.671 1.00 65.08  ? 77   TYR B CZ  1 
ATOM   4766 O OH  . TYR B 1 77  ? 4.499   -14.081 -29.505 1.00 68.83  ? 77   TYR B OH  1 
ATOM   4767 N N   . PRO B 1 78  ? 1.726   -17.375 -37.293 1.00 69.68  ? 78   PRO B N   1 
ATOM   4768 C CA  . PRO B 1 78  ? 1.029   -17.598 -38.567 1.00 70.66  ? 78   PRO B CA  1 
ATOM   4769 C C   . PRO B 1 78  ? -0.474  -17.337 -38.460 1.00 69.89  ? 78   PRO B C   1 
ATOM   4770 O O   . PRO B 1 78  ? -1.126  -17.905 -37.582 1.00 66.30  ? 78   PRO B O   1 
ATOM   4771 C CB  . PRO B 1 78  ? 1.287   -19.082 -38.857 1.00 72.12  ? 78   PRO B CB  1 
ATOM   4772 C CG  . PRO B 1 78  ? 2.525   -19.417 -38.082 1.00 75.85  ? 78   PRO B CG  1 
ATOM   4773 C CD  . PRO B 1 78  ? 2.450   -18.576 -36.838 1.00 75.03  ? 78   PRO B CD  1 
ATOM   4774 N N   . GLY B 1 79  ? -1.000  -16.467 -39.322 1.00 69.92  ? 79   GLY B N   1 
ATOM   4775 C CA  . GLY B 1 79  ? -2.427  -16.208 -39.382 1.00 70.45  ? 79   GLY B CA  1 
ATOM   4776 C C   . GLY B 1 79  ? -3.007  -15.325 -38.291 1.00 70.98  ? 79   GLY B C   1 
ATOM   4777 O O   . GLY B 1 79  ? -4.216  -15.076 -38.283 1.00 70.85  ? 79   GLY B O   1 
ATOM   4778 N N   . PHE B 1 80  ? -2.158  -14.865 -37.368 1.00 65.36  ? 80   PHE B N   1 
ATOM   4779 C CA  . PHE B 1 80  ? -2.569  -13.925 -36.320 1.00 61.52  ? 80   PHE B CA  1 
ATOM   4780 C C   . PHE B 1 80  ? -2.780  -12.536 -36.934 1.00 57.81  ? 80   PHE B C   1 
ATOM   4781 O O   . PHE B 1 80  ? -1.889  -12.005 -37.593 1.00 56.09  ? 80   PHE B O   1 
ATOM   4782 C CB  . PHE B 1 80  ? -1.497  -13.880 -35.219 1.00 62.48  ? 80   PHE B CB  1 
ATOM   4783 C CG  . PHE B 1 80  ? -1.737  -12.829 -34.151 1.00 62.46  ? 80   PHE B CG  1 
ATOM   4784 C CD1 . PHE B 1 80  ? -2.913  -12.819 -33.404 1.00 58.27  ? 80   PHE B CD1 1 
ATOM   4785 C CD2 . PHE B 1 80  ? -0.764  -11.872 -33.872 1.00 59.49  ? 80   PHE B CD2 1 
ATOM   4786 C CE1 . PHE B 1 80  ? -3.125  -11.863 -32.409 1.00 59.02  ? 80   PHE B CE1 1 
ATOM   4787 C CE2 . PHE B 1 80  ? -0.968  -10.911 -32.876 1.00 58.41  ? 80   PHE B CE2 1 
ATOM   4788 C CZ  . PHE B 1 80  ? -2.149  -10.905 -32.146 1.00 58.97  ? 80   PHE B CZ  1 
ATOM   4789 N N   . GLU B 1 81  ? -3.955  -11.951 -36.726 1.00 58.40  ? 81   GLU B N   1 
ATOM   4790 C CA  . GLU B 1 81  ? -4.244  -10.616 -37.258 1.00 64.49  ? 81   GLU B CA  1 
ATOM   4791 C C   . GLU B 1 81  ? -3.159  -9.576  -36.931 1.00 62.89  ? 81   GLU B C   1 
ATOM   4792 O O   . GLU B 1 81  ? -2.762  -8.789  -37.789 1.00 60.61  ? 81   GLU B O   1 
ATOM   4793 C CB  . GLU B 1 81  ? -5.592  -10.113 -36.742 1.00 73.99  ? 81   GLU B CB  1 
ATOM   4794 C CG  . GLU B 1 81  ? -5.987  -8.752  -37.288 1.00 83.88  ? 81   GLU B CG  1 
ATOM   4795 C CD  . GLU B 1 81  ? -6.668  -8.843  -38.646 1.00 96.37  ? 81   GLU B CD  1 
ATOM   4796 O OE1 . GLU B 1 81  ? -7.865  -9.203  -38.673 1.00 100.59 ? 81   GLU B OE1 1 
ATOM   4797 O OE2 . GLU B 1 81  ? -6.017  -8.547  -39.679 1.00 98.73  ? 81   GLU B OE2 1 
ATOM   4798 N N   . GLY B 1 82  ? -2.690  -9.576  -35.686 1.00 61.44  ? 82   GLY B N   1 
ATOM   4799 C CA  . GLY B 1 82  ? -1.742  -8.573  -35.221 1.00 58.50  ? 82   GLY B CA  1 
ATOM   4800 C C   . GLY B 1 82  ? -0.408  -8.530  -35.952 1.00 57.06  ? 82   GLY B C   1 
ATOM   4801 O O   . GLY B 1 82  ? 0.261   -7.503  -35.960 1.00 51.87  ? 82   GLY B O   1 
ATOM   4802 N N   . THR B 1 83  ? -0.006  -9.641  -36.559 1.00 57.91  ? 83   THR B N   1 
ATOM   4803 C CA  . THR B 1 83  ? 1.225   -9.654  -37.341 1.00 58.47  ? 83   THR B CA  1 
ATOM   4804 C C   . THR B 1 83  ? 0.909   -9.550  -38.829 1.00 55.43  ? 83   THR B C   1 
ATOM   4805 O O   . THR B 1 83  ? 1.582   -8.830  -39.567 1.00 50.03  ? 83   THR B O   1 
ATOM   4806 C CB  . THR B 1 83  ? 2.075   -10.922 -37.079 1.00 60.32  ? 83   THR B CB  1 
ATOM   4807 O OG1 . THR B 1 83  ? 1.237   -12.088 -37.132 1.00 66.29  ? 83   THR B OG1 1 
ATOM   4808 C CG2 . THR B 1 83  ? 2.758   -10.848 -35.714 1.00 55.97  ? 83   THR B CG2 1 
ATOM   4809 N N   . GLU B 1 84  ? -0.138  -10.251 -39.252 1.00 53.61  ? 84   GLU B N   1 
ATOM   4810 C CA  . GLU B 1 84  ? -0.457  -10.380 -40.667 1.00 55.36  ? 84   GLU B CA  1 
ATOM   4811 C C   . GLU B 1 84  ? -0.840  -9.051  -41.290 1.00 56.35  ? 84   GLU B C   1 
ATOM   4812 O O   . GLU B 1 84  ? -0.563  -8.816  -42.468 1.00 58.13  ? 84   GLU B O   1 
ATOM   4813 C CB  . GLU B 1 84  ? -1.576  -11.398 -40.879 1.00 56.74  ? 84   GLU B CB  1 
ATOM   4814 C CG  . GLU B 1 84  ? -1.204  -12.818 -40.474 1.00 71.20  ? 84   GLU B CG  1 
ATOM   4815 C CD  . GLU B 1 84  ? -0.241  -13.482 -41.451 1.00 83.66  ? 84   GLU B CD  1 
ATOM   4816 O OE1 . GLU B 1 84  ? -0.054  -12.942 -42.571 1.00 87.03  ? 84   GLU B OE1 1 
ATOM   4817 O OE2 . GLU B 1 84  ? 0.323   -14.548 -41.096 1.00 83.38  ? 84   GLU B OE2 1 
ATOM   4818 N N   . MET B 1 85  ? -1.467  -8.176  -40.507 1.00 53.11  ? 85   MET B N   1 
ATOM   4819 C CA  . MET B 1 85  ? -1.908  -6.886  -41.039 1.00 51.81  ? 85   MET B CA  1 
ATOM   4820 C C   . MET B 1 85  ? -0.722  -6.024  -41.489 1.00 47.76  ? 85   MET B C   1 
ATOM   4821 O O   . MET B 1 85  ? -0.895  -5.048  -42.219 1.00 49.76  ? 85   MET B O   1 
ATOM   4822 C CB  . MET B 1 85  ? -2.782  -6.125  -40.034 1.00 49.91  ? 85   MET B CB  1 
ATOM   4823 C CG  . MET B 1 85  ? -2.049  -5.639  -38.800 1.00 58.86  ? 85   MET B CG  1 
ATOM   4824 S SD  . MET B 1 85  ? -3.032  -4.493  -37.787 1.00 65.14  ? 85   MET B SD  1 
ATOM   4825 C CE  . MET B 1 85  ? -2.637  -2.947  -38.574 1.00 40.02  ? 85   MET B CE  1 
ATOM   4826 N N   . TRP B 1 86  ? 0.482   -6.390  -41.064 1.00 41.00  ? 86   TRP B N   1 
ATOM   4827 C CA  . TRP B 1 86  ? 1.664   -5.659  -41.508 1.00 44.42  ? 86   TRP B CA  1 
ATOM   4828 C C   . TRP B 1 86  ? 2.347   -6.315  -42.704 1.00 48.34  ? 86   TRP B C   1 
ATOM   4829 O O   . TRP B 1 86  ? 3.149   -5.671  -43.364 1.00 46.27  ? 86   TRP B O   1 
ATOM   4830 C CB  . TRP B 1 86  ? 2.650   -5.453  -40.349 1.00 45.40  ? 86   TRP B CB  1 
ATOM   4831 C CG  . TRP B 1 86  ? 1.982   -4.785  -39.179 1.00 49.15  ? 86   TRP B CG  1 
ATOM   4832 C CD1 . TRP B 1 86  ? 1.571   -5.383  -38.031 1.00 43.87  ? 86   TRP B CD1 1 
ATOM   4833 C CD2 . TRP B 1 86  ? 1.604   -3.402  -39.072 1.00 44.13  ? 86   TRP B CD2 1 
ATOM   4834 N NE1 . TRP B 1 86  ? 0.985   -4.462  -37.202 1.00 44.92  ? 86   TRP B NE1 1 
ATOM   4835 C CE2 . TRP B 1 86  ? 0.989   -3.238  -37.814 1.00 45.45  ? 86   TRP B CE2 1 
ATOM   4836 C CE3 . TRP B 1 86  ? 1.748   -2.285  -39.906 1.00 45.94  ? 86   TRP B CE3 1 
ATOM   4837 C CZ2 . TRP B 1 86  ? 0.498   -1.995  -37.364 1.00 41.77  ? 86   TRP B CZ2 1 
ATOM   4838 C CZ3 . TRP B 1 86  ? 1.265   -1.044  -39.458 1.00 46.85  ? 86   TRP B CZ3 1 
ATOM   4839 C CH2 . TRP B 1 86  ? 0.645   -0.915  -38.199 1.00 43.26  ? 86   TRP B CH2 1 
ATOM   4840 N N   . ASN B 1 87  ? 2.015   -7.583  -42.976 1.00 47.13  ? 87   ASN B N   1 
ATOM   4841 C CA  . ASN B 1 87  ? 2.641   -8.360  -44.053 1.00 49.08  ? 87   ASN B CA  1 
ATOM   4842 C C   . ASN B 1 87  ? 2.141   -7.975  -45.449 1.00 47.04  ? 87   ASN B C   1 
ATOM   4843 O O   . ASN B 1 87  ? 1.040   -7.470  -45.589 1.00 51.55  ? 87   ASN B O   1 
ATOM   4844 C CB  . ASN B 1 87  ? 2.456   -9.873  -43.829 1.00 42.25  ? 87   ASN B CB  1 
ATOM   4845 C CG  . ASN B 1 87  ? 3.450   -10.445 -42.832 1.00 53.30  ? 87   ASN B CG  1 
ATOM   4846 O OD1 . ASN B 1 87  ? 4.496   -9.849  -42.554 1.00 57.54  ? 87   ASN B OD1 1 
ATOM   4847 N ND2 . ASN B 1 87  ? 3.132   -11.613 -42.293 1.00 54.75  ? 87   ASN B ND2 1 
ATOM   4848 N N   . PRO B 1 88  ? 2.955   -8.229  -46.486 1.00 47.63  ? 88   PRO B N   1 
ATOM   4849 C CA  . PRO B 1 88  ? 2.547   -7.876  -47.857 1.00 46.28  ? 88   PRO B CA  1 
ATOM   4850 C C   . PRO B 1 88  ? 1.151   -8.401  -48.167 1.00 48.13  ? 88   PRO B C   1 
ATOM   4851 O O   . PRO B 1 88  ? 0.812   -9.538  -47.810 1.00 45.46  ? 88   PRO B O   1 
ATOM   4852 C CB  . PRO B 1 88  ? 3.566   -8.601  -48.726 1.00 39.54  ? 88   PRO B CB  1 
ATOM   4853 C CG  . PRO B 1 88  ? 4.785   -8.727  -47.841 1.00 48.49  ? 88   PRO B CG  1 
ATOM   4854 C CD  . PRO B 1 88  ? 4.261   -8.913  -46.447 1.00 48.03  ? 88   PRO B CD  1 
ATOM   4855 N N   . ASN B 1 89  ? 0.341   -7.568  -48.810 1.00 44.67  ? 89   ASN B N   1 
ATOM   4856 C CA  . ASN B 1 89  ? -1.002  -7.974  -49.184 1.00 49.59  ? 89   ASN B CA  1 
ATOM   4857 C C   . ASN B 1 89  ? -1.164  -7.975  -50.709 1.00 49.92  ? 89   ASN B C   1 
ATOM   4858 O O   . ASN B 1 89  ? -2.288  -7.956  -51.223 1.00 52.35  ? 89   ASN B O   1 
ATOM   4859 C CB  . ASN B 1 89  ? -2.052  -7.099  -48.482 1.00 48.40  ? 89   ASN B CB  1 
ATOM   4860 C CG  . ASN B 1 89  ? -2.026  -5.665  -48.961 1.00 50.22  ? 89   ASN B CG  1 
ATOM   4861 O OD1 . ASN B 1 89  ? -1.015  -5.202  -49.478 1.00 44.18  ? 89   ASN B OD1 1 
ATOM   4862 N ND2 . ASN B 1 89  ? -3.148  -4.958  -48.816 1.00 55.33  ? 89   ASN B ND2 1 
ATOM   4863 N N   . ARG B 1 90  ? -0.028  -7.973  -51.414 1.00 40.91  ? 90   ARG B N   1 
ATOM   4864 C CA  . ARG B 1 90  ? 0.042   -8.211  -52.871 1.00 44.32  ? 90   ARG B CA  1 
ATOM   4865 C C   . ARG B 1 90  ? 1.321   -8.987  -53.133 1.00 46.39  ? 90   ARG B C   1 
ATOM   4866 O O   . ARG B 1 90  ? 2.152   -9.115  -52.236 1.00 43.97  ? 90   ARG B O   1 
ATOM   4867 C CB  . ARG B 1 90  ? 0.085   -6.910  -53.679 1.00 46.97  ? 90   ARG B CB  1 
ATOM   4868 C CG  . ARG B 1 90  ? -1.150  -6.037  -53.575 1.00 51.09  ? 90   ARG B CG  1 
ATOM   4869 C CD  . ARG B 1 90  ? -2.331  -6.721  -54.236 1.00 55.80  ? 90   ARG B CD  1 
ATOM   4870 N NE  . ARG B 1 90  ? -3.496  -5.850  -54.353 1.00 58.86  ? 90   ARG B NE  1 
ATOM   4871 C CZ  . ARG B 1 90  ? -4.385  -5.641  -53.383 1.00 59.80  ? 90   ARG B CZ  1 
ATOM   4872 N NH1 . ARG B 1 90  ? -4.237  -6.235  -52.201 1.00 55.12  ? 90   ARG B NH1 1 
ATOM   4873 N NH2 . ARG B 1 90  ? -5.421  -4.827  -53.594 1.00 55.98  ? 90   ARG B NH2 1 
ATOM   4874 N N   . GLU B 1 91  ? 1.495   -9.484  -54.353 1.00 49.46  ? 91   GLU B N   1 
ATOM   4875 C CA  . GLU B 1 91  ? 2.677   -10.285 -54.690 1.00 55.04  ? 91   GLU B CA  1 
ATOM   4876 C C   . GLU B 1 91  ? 3.967   -9.507  -54.480 1.00 45.64  ? 91   GLU B C   1 
ATOM   4877 O O   . GLU B 1 91  ? 4.019   -8.300  -54.726 1.00 44.30  ? 91   GLU B O   1 
ATOM   4878 C CB  . GLU B 1 91  ? 2.624   -10.768 -56.147 1.00 58.77  ? 91   GLU B CB  1 
ATOM   4879 C CG  . GLU B 1 91  ? 1.468   -11.709 -56.460 1.00 71.31  ? 91   GLU B CG  1 
ATOM   4880 C CD  . GLU B 1 91  ? 1.770   -13.164 -56.126 1.00 83.33  ? 91   GLU B CD  1 
ATOM   4881 O OE1 . GLU B 1 91  ? 2.807   -13.439 -55.478 1.00 77.89  ? 91   GLU B OE1 1 
ATOM   4882 O OE2 . GLU B 1 91  ? 0.960   -14.035 -56.526 1.00 95.59  ? 91   GLU B OE2 1 
ATOM   4883 N N   . LEU B 1 92  ? 4.998   -10.208 -54.020 1.00 39.23  ? 92   LEU B N   1 
ATOM   4884 C CA  . LEU B 1 92  ? 6.336   -9.650  -53.913 1.00 43.70  ? 92   LEU B CA  1 
ATOM   4885 C C   . LEU B 1 92  ? 6.982   -9.509  -55.297 1.00 48.45  ? 92   LEU B C   1 
ATOM   4886 O O   . LEU B 1 92  ? 6.855   -10.381 -56.144 1.00 54.81  ? 92   LEU B O   1 
ATOM   4887 C CB  . LEU B 1 92  ? 7.204   -10.551 -53.033 1.00 41.89  ? 92   LEU B CB  1 
ATOM   4888 C CG  . LEU B 1 92  ? 6.786   -10.710 -51.564 1.00 48.91  ? 92   LEU B CG  1 
ATOM   4889 C CD1 . LEU B 1 92  ? 7.796   -11.567 -50.822 1.00 45.47  ? 92   LEU B CD1 1 
ATOM   4890 C CD2 . LEU B 1 92  ? 6.622   -9.373  -50.874 1.00 45.80  ? 92   LEU B CD2 1 
ATOM   4891 N N   . SER B 1 93  ? 7.699   -8.418  -55.515 1.00 46.59  ? 93   SER B N   1 
ATOM   4892 C CA  . SER B 1 93  ? 8.476   -8.248  -56.737 1.00 40.43  ? 93   SER B CA  1 
ATOM   4893 C C   . SER B 1 93  ? 9.502   -7.128  -56.528 1.00 43.64  ? 93   SER B C   1 
ATOM   4894 O O   . SER B 1 93  ? 9.246   -6.178  -55.783 1.00 39.91  ? 93   SER B O   1 
ATOM   4895 C CB  . SER B 1 93  ? 7.541   -7.896  -57.897 1.00 36.59  ? 93   SER B CB  1 
ATOM   4896 O OG  . SER B 1 93  ? 8.236   -7.796  -59.117 1.00 38.36  ? 93   SER B OG  1 
ATOM   4897 N N   . GLU B 1 94  ? 10.654  -7.231  -57.186 1.00 40.55  ? 94   GLU B N   1 
ATOM   4898 C CA  . GLU B 1 94  ? 11.577  -6.101  -57.261 1.00 36.41  ? 94   GLU B CA  1 
ATOM   4899 C C   . GLU B 1 94  ? 11.006  -5.005  -58.157 1.00 40.48  ? 94   GLU B C   1 
ATOM   4900 O O   . GLU B 1 94  ? 11.346  -3.840  -58.018 1.00 40.12  ? 94   GLU B O   1 
ATOM   4901 C CB  . GLU B 1 94  ? 12.944  -6.552  -57.759 1.00 38.00  ? 94   GLU B CB  1 
ATOM   4902 C CG  . GLU B 1 94  ? 13.680  -7.384  -56.734 1.00 36.91  ? 94   GLU B CG  1 
ATOM   4903 C CD  . GLU B 1 94  ? 15.059  -7.799  -57.194 1.00 45.01  ? 94   GLU B CD  1 
ATOM   4904 O OE1 . GLU B 1 94  ? 15.974  -6.937  -57.278 1.00 42.99  ? 94   GLU B OE1 1 
ATOM   4905 O OE2 . GLU B 1 94  ? 15.219  -9.004  -57.464 1.00 43.27  ? 94   GLU B OE2 1 
ATOM   4906 N N   . ASP B 1 95  ? 10.132  -5.392  -59.082 1.00 38.04  ? 95   ASP B N   1 
ATOM   4907 C CA  . ASP B 1 95  ? 9.412   -4.429  -59.891 1.00 39.51  ? 95   ASP B CA  1 
ATOM   4908 C C   . ASP B 1 95  ? 8.294   -3.841  -59.019 1.00 37.76  ? 95   ASP B C   1 
ATOM   4909 O O   . ASP B 1 95  ? 7.180   -4.343  -59.002 1.00 40.52  ? 95   ASP B O   1 
ATOM   4910 C CB  . ASP B 1 95  ? 8.870   -5.106  -61.155 1.00 34.25  ? 95   ASP B CB  1 
ATOM   4911 C CG  . ASP B 1 95  ? 8.067   -4.167  -62.033 1.00 38.81  ? 95   ASP B CG  1 
ATOM   4912 O OD1 . ASP B 1 95  ? 7.883   -2.987  -61.668 1.00 38.46  ? 95   ASP B OD1 1 
ATOM   4913 O OD2 . ASP B 1 95  ? 7.609   -4.622  -63.095 1.00 43.26  ? 95   ASP B OD2 1 
ATOM   4914 N N   . CYS B 1 96  ? 8.602   -2.784  -58.275 1.00 32.53  ? 96   CYS B N   1 
ATOM   4915 C CA  . CYS B 1 96  ? 7.665   -2.307  -57.241 1.00 39.59  ? 96   CYS B CA  1 
ATOM   4916 C C   . CYS B 1 96  ? 7.556   -0.794  -57.077 1.00 39.60  ? 96   CYS B C   1 
ATOM   4917 O O   . CYS B 1 96  ? 6.887   -0.325  -56.154 1.00 38.35  ? 96   CYS B O   1 
ATOM   4918 C CB  . CYS B 1 96  ? 8.030   -2.904  -55.875 1.00 30.58  ? 96   CYS B CB  1 
ATOM   4919 S SG  . CYS B 1 96  ? 9.660   -2.362  -55.254 1.00 38.67  ? 96   CYS B SG  1 
ATOM   4920 N N   . LEU B 1 97  ? 8.211   -0.027  -57.943 1.00 36.50  ? 97   LEU B N   1 
ATOM   4921 C CA  . LEU B 1 97  ? 8.224   1.423   -57.744 1.00 38.76  ? 97   LEU B CA  1 
ATOM   4922 C C   . LEU B 1 97  ? 6.973   2.084   -58.351 1.00 40.11  ? 97   LEU B C   1 
ATOM   4923 O O   . LEU B 1 97  ? 7.000   2.605   -59.479 1.00 35.72  ? 97   LEU B O   1 
ATOM   4924 C CB  . LEU B 1 97  ? 9.520   2.034   -58.276 1.00 32.52  ? 97   LEU B CB  1 
ATOM   4925 C CG  . LEU B 1 97  ? 10.784  1.584   -57.515 1.00 39.33  ? 97   LEU B CG  1 
ATOM   4926 C CD1 . LEU B 1 97  ? 12.009  2.301   -58.045 1.00 31.50  ? 97   LEU B CD1 1 
ATOM   4927 C CD2 . LEU B 1 97  ? 10.641  1.813   -55.978 1.00 33.08  ? 97   LEU B CD2 1 
ATOM   4928 N N   . TYR B 1 98  ? 5.882   2.035   -57.589 1.00 36.96  ? 98   TYR B N   1 
ATOM   4929 C CA  . TYR B 1 98  ? 4.598   2.616   -57.985 1.00 35.76  ? 98   TYR B CA  1 
ATOM   4930 C C   . TYR B 1 98  ? 4.082   3.443   -56.826 1.00 41.44  ? 98   TYR B C   1 
ATOM   4931 O O   . TYR B 1 98  ? 4.447   3.190   -55.679 1.00 38.68  ? 98   TYR B O   1 
ATOM   4932 C CB  . TYR B 1 98  ? 3.590   1.509   -58.349 1.00 35.39  ? 98   TYR B CB  1 
ATOM   4933 C CG  . TYR B 1 98  ? 4.093   0.619   -59.474 1.00 39.76  ? 98   TYR B CG  1 
ATOM   4934 C CD1 . TYR B 1 98  ? 3.747   0.874   -60.806 1.00 41.48  ? 98   TYR B CD1 1 
ATOM   4935 C CD2 . TYR B 1 98  ? 4.939   -0.446  -59.211 1.00 41.74  ? 98   TYR B CD2 1 
ATOM   4936 C CE1 . TYR B 1 98  ? 4.217   0.076   -61.842 1.00 45.10  ? 98   TYR B CE1 1 
ATOM   4937 C CE2 . TYR B 1 98  ? 5.426   -1.250  -60.237 1.00 45.10  ? 98   TYR B CE2 1 
ATOM   4938 C CZ  . TYR B 1 98  ? 5.061   -0.987  -61.550 1.00 51.00  ? 98   TYR B CZ  1 
ATOM   4939 O OH  . TYR B 1 98  ? 5.564   -1.781  -62.557 1.00 45.13  ? 98   TYR B OH  1 
ATOM   4940 N N   . LEU B 1 99  ? 3.247   4.435   -57.129 1.00 35.05  ? 99   LEU B N   1 
ATOM   4941 C CA  . LEU B 1 99  ? 2.624   5.256   -56.106 1.00 37.19  ? 99   LEU B CA  1 
ATOM   4942 C C   . LEU B 1 99  ? 1.105   5.309   -56.301 1.00 42.00  ? 99   LEU B C   1 
ATOM   4943 O O   . LEU B 1 99  ? 0.579   4.930   -57.354 1.00 39.44  ? 99   LEU B O   1 
ATOM   4944 C CB  . LEU B 1 99  ? 3.214   6.681   -56.073 1.00 35.22  ? 99   LEU B CB  1 
ATOM   4945 C CG  . LEU B 1 99  ? 3.224   7.550   -57.340 1.00 39.88  ? 99   LEU B CG  1 
ATOM   4946 C CD1 . LEU B 1 99  ? 1.867   8.155   -57.624 1.00 37.56  ? 99   LEU B CD1 1 
ATOM   4947 C CD2 . LEU B 1 99  ? 4.294   8.667   -57.248 1.00 35.07  ? 99   LEU B CD2 1 
ATOM   4948 N N   . ASN B 1 100 ? 0.415   5.792   -55.274 1.00 38.49  ? 100  ASN B N   1 
ATOM   4949 C CA  . ASN B 1 100 ? -1.033  5.816   -55.254 1.00 41.51  ? 100  ASN B CA  1 
ATOM   4950 C C   . ASN B 1 100 ? -1.528  7.225   -54.944 1.00 45.86  ? 100  ASN B C   1 
ATOM   4951 O O   . ASN B 1 100 ? -0.920  7.942   -54.148 1.00 42.71  ? 100  ASN B O   1 
ATOM   4952 C CB  . ASN B 1 100 ? -1.548  4.844   -54.190 1.00 39.75  ? 100  ASN B CB  1 
ATOM   4953 C CG  . ASN B 1 100 ? -0.876  3.463   -54.270 1.00 37.60  ? 100  ASN B CG  1 
ATOM   4954 O OD1 . ASN B 1 100 ? -1.008  2.744   -55.266 1.00 38.77  ? 100  ASN B OD1 1 
ATOM   4955 N ND2 . ASN B 1 100 ? -0.191  3.079   -53.201 1.00 33.01  ? 100  ASN B ND2 1 
ATOM   4956 N N   . VAL B 1 101 ? -2.633  7.619   -55.571 1.00 43.10  ? 101  VAL B N   1 
ATOM   4957 C CA  . VAL B 1 101 ? -3.238  8.918   -55.318 1.00 41.40  ? 101  VAL B CA  1 
ATOM   4958 C C   . VAL B 1 101 ? -4.742  8.744   -55.042 1.00 44.00  ? 101  VAL B C   1 
ATOM   4959 O O   . VAL B 1 101 ? -5.458  8.120   -55.836 1.00 44.80  ? 101  VAL B O   1 
ATOM   4960 C CB  . VAL B 1 101 ? -3.059  9.859   -56.543 1.00 43.63  ? 101  VAL B CB  1 
ATOM   4961 C CG1 . VAL B 1 101 ? -3.746  11.201  -56.312 1.00 34.10  ? 101  VAL B CG1 1 
ATOM   4962 C CG2 . VAL B 1 101 ? -1.567  10.039  -56.913 1.00 35.20  ? 101  VAL B CG2 1 
ATOM   4963 N N   . TRP B 1 102 ? -5.211  9.270   -53.912 1.00 40.86  ? 102  TRP B N   1 
ATOM   4964 C CA  . TRP B 1 102 ? -6.643  9.420   -53.661 1.00 37.84  ? 102  TRP B CA  1 
ATOM   4965 C C   . TRP B 1 102 ? -6.974  10.906  -53.707 1.00 46.35  ? 102  TRP B C   1 
ATOM   4966 O O   . TRP B 1 102 ? -6.222  11.722  -53.169 1.00 46.65  ? 102  TRP B O   1 
ATOM   4967 C CB  . TRP B 1 102 ? -7.035  8.901   -52.267 1.00 39.88  ? 102  TRP B CB  1 
ATOM   4968 C CG  . TRP B 1 102 ? -6.941  7.422   -52.077 1.00 40.22  ? 102  TRP B CG  1 
ATOM   4969 C CD1 . TRP B 1 102 ? -7.953  6.506   -52.217 1.00 37.63  ? 102  TRP B CD1 1 
ATOM   4970 C CD2 . TRP B 1 102 ? -5.778  6.682   -51.681 1.00 38.56  ? 102  TRP B CD2 1 
ATOM   4971 N NE1 . TRP B 1 102 ? -7.481  5.241   -51.939 1.00 42.57  ? 102  TRP B NE1 1 
ATOM   4972 C CE2 . TRP B 1 102 ? -6.150  5.322   -51.613 1.00 39.01  ? 102  TRP B CE2 1 
ATOM   4973 C CE3 . TRP B 1 102 ? -4.456  7.038   -51.381 1.00 41.08  ? 102  TRP B CE3 1 
ATOM   4974 C CZ2 . TRP B 1 102 ? -5.247  4.320   -51.265 1.00 36.27  ? 102  TRP B CZ2 1 
ATOM   4975 C CZ3 . TRP B 1 102 ? -3.562  6.043   -51.029 1.00 38.38  ? 102  TRP B CZ3 1 
ATOM   4976 C CH2 . TRP B 1 102 ? -3.959  4.705   -50.964 1.00 38.68  ? 102  TRP B CH2 1 
ATOM   4977 N N   . THR B 1 103 ? -8.103  11.253  -54.328 1.00 44.65  ? 103  THR B N   1 
ATOM   4978 C CA  . THR B 1 103 ? -8.583  12.633  -54.372 1.00 47.72  ? 103  THR B CA  1 
ATOM   4979 C C   . THR B 1 103 ? -10.094 12.614  -54.185 1.00 52.98  ? 103  THR B C   1 
ATOM   4980 O O   . THR B 1 103 ? -10.726 11.574  -54.359 1.00 50.62  ? 103  THR B O   1 
ATOM   4981 C CB  . THR B 1 103 ? -8.280  13.343  -55.722 1.00 54.96  ? 103  THR B CB  1 
ATOM   4982 O OG1 . THR B 1 103 ? -9.141  12.826  -56.745 1.00 62.54  ? 103  THR B OG1 1 
ATOM   4983 C CG2 . THR B 1 103 ? -6.847  13.121  -56.145 1.00 57.17  ? 103  THR B CG2 1 
ATOM   4984 N N   . PRO B 1 104 ? -10.675 13.761  -53.810 1.00 48.04  ? 104  PRO B N   1 
ATOM   4985 C CA  . PRO B 1 104 ? -12.135 13.894  -53.775 1.00 48.49  ? 104  PRO B CA  1 
ATOM   4986 C C   . PRO B 1 104 ? -12.743 13.645  -55.159 1.00 49.61  ? 104  PRO B C   1 
ATOM   4987 O O   . PRO B 1 104 ? -12.104 13.908  -56.174 1.00 52.25  ? 104  PRO B O   1 
ATOM   4988 C CB  . PRO B 1 104 ? -12.338 15.356  -53.363 1.00 46.69  ? 104  PRO B CB  1 
ATOM   4989 C CG  . PRO B 1 104 ? -11.080 15.715  -52.618 1.00 47.06  ? 104  PRO B CG  1 
ATOM   4990 C CD  . PRO B 1 104 ? -9.994  14.981  -53.350 1.00 43.19  ? 104  PRO B CD  1 
ATOM   4991 N N   . TYR B 1 105 ? -13.960 13.119  -55.172 1.00 53.08  ? 105  TYR B N   1 
ATOM   4992 C CA  . TYR B 1 105 ? -14.767 12.945  -56.372 1.00 51.81  ? 105  TYR B CA  1 
ATOM   4993 C C   . TYR B 1 105 ? -16.025 13.791  -56.168 1.00 58.32  ? 105  TYR B C   1 
ATOM   4994 O O   . TYR B 1 105 ? -16.788 13.539  -55.234 1.00 57.54  ? 105  TYR B O   1 
ATOM   4995 C CB  . TYR B 1 105 ? -15.159 11.471  -56.499 1.00 45.26  ? 105  TYR B CB  1 
ATOM   4996 C CG  . TYR B 1 105 ? -15.972 11.118  -57.730 1.00 50.57  ? 105  TYR B CG  1 
ATOM   4997 C CD1 . TYR B 1 105 ? -15.453 10.272  -58.707 1.00 51.38  ? 105  TYR B CD1 1 
ATOM   4998 C CD2 . TYR B 1 105 ? -17.263 11.618  -57.912 1.00 53.46  ? 105  TYR B CD2 1 
ATOM   4999 C CE1 . TYR B 1 105 ? -16.180 9.941   -59.836 1.00 55.19  ? 105  TYR B CE1 1 
ATOM   5000 C CE2 . TYR B 1 105 ? -17.999 11.294  -59.036 1.00 56.19  ? 105  TYR B CE2 1 
ATOM   5001 C CZ  . TYR B 1 105 ? -17.452 10.451  -59.995 1.00 62.02  ? 105  TYR B CZ  1 
ATOM   5002 O OH  . TYR B 1 105 ? -18.178 10.119  -61.117 1.00 65.99  ? 105  TYR B OH  1 
ATOM   5003 N N   . PRO B 1 106 ? -16.248 14.807  -57.022 1.00 62.81  ? 106  PRO B N   1 
ATOM   5004 C CA  . PRO B 1 106 ? -15.455 15.192  -58.200 1.00 62.79  ? 106  PRO B CA  1 
ATOM   5005 C C   . PRO B 1 106 ? -14.131 15.779  -57.758 1.00 58.25  ? 106  PRO B C   1 
ATOM   5006 O O   . PRO B 1 106 ? -13.998 16.133  -56.582 1.00 51.32  ? 106  PRO B O   1 
ATOM   5007 C CB  . PRO B 1 106 ? -16.292 16.299  -58.858 1.00 57.94  ? 106  PRO B CB  1 
ATOM   5008 C CG  . PRO B 1 106 ? -17.482 16.507  -57.977 1.00 59.08  ? 106  PRO B CG  1 
ATOM   5009 C CD  . PRO B 1 106 ? -17.244 15.834  -56.677 1.00 53.80  ? 106  PRO B CD  1 
ATOM   5010 N N   . ARG B 1 107 ? -13.172 15.894  -58.671 1.00 61.65  ? 107  ARG B N   1 
ATOM   5011 C CA  . ARG B 1 107 ? -11.841 16.314  -58.259 1.00 68.74  ? 107  ARG B CA  1 
ATOM   5012 C C   . ARG B 1 107 ? -11.832 17.803  -57.928 1.00 69.99  ? 107  ARG B C   1 
ATOM   5013 O O   . ARG B 1 107 ? -12.532 18.585  -58.569 1.00 74.52  ? 107  ARG B O   1 
ATOM   5014 C CB  . ARG B 1 107 ? -10.769 15.909  -59.281 1.00 68.54  ? 107  ARG B CB  1 
ATOM   5015 C CG  . ARG B 1 107 ? -10.378 16.944  -60.315 1.00 72.43  ? 107  ARG B CG  1 
ATOM   5016 C CD  . ARG B 1 107 ? -9.231  16.380  -61.156 1.00 76.08  ? 107  ARG B CD  1 
ATOM   5017 N NE  . ARG B 1 107 ? -9.557  15.032  -61.627 1.00 75.45  ? 107  ARG B NE  1 
ATOM   5018 C CZ  . ARG B 1 107 ? -9.492  14.634  -62.894 1.00 72.93  ? 107  ARG B CZ  1 
ATOM   5019 N NH1 . ARG B 1 107 ? -9.831  13.395  -63.217 1.00 71.87  ? 107  ARG B NH1 1 
ATOM   5020 N NH2 . ARG B 1 107 ? -9.068  15.460  -63.839 1.00 74.60  ? 107  ARG B NH2 1 
ATOM   5021 N N   . PRO B 1 108 ? -11.050 18.186  -56.907 1.00 65.70  ? 108  PRO B N   1 
ATOM   5022 C CA  . PRO B 1 108 ? -11.060 19.529  -56.314 1.00 69.67  ? 108  PRO B CA  1 
ATOM   5023 C C   . PRO B 1 108 ? -11.144 20.656  -57.346 1.00 77.10  ? 108  PRO B C   1 
ATOM   5024 O O   . PRO B 1 108 ? -10.416 20.649  -58.343 1.00 77.16  ? 108  PRO B O   1 
ATOM   5025 C CB  . PRO B 1 108 ? -9.724  19.592  -55.573 1.00 65.18  ? 108  PRO B CB  1 
ATOM   5026 C CG  . PRO B 1 108 ? -9.432  18.178  -55.213 1.00 63.93  ? 108  PRO B CG  1 
ATOM   5027 C CD  . PRO B 1 108 ? -10.010 17.325  -56.316 1.00 59.29  ? 108  PRO B CD  1 
ATOM   5028 N N   . ALA B 1 109 ? -12.028 21.617  -57.085 1.00 80.27  ? 109  ALA B N   1 
ATOM   5029 C CA  . ALA B 1 109 ? -12.196 22.789  -57.938 1.00 82.34  ? 109  ALA B CA  1 
ATOM   5030 C C   . ALA B 1 109 ? -11.019 23.753  -57.804 1.00 76.39  ? 109  ALA B C   1 
ATOM   5031 O O   . ALA B 1 109 ? -10.654 24.446  -58.758 1.00 74.34  ? 109  ALA B O   1 
ATOM   5032 C CB  . ALA B 1 109 ? -13.497 23.502  -57.600 1.00 84.78  ? 109  ALA B CB  1 
ATOM   5033 N N   . SER B 1 110 ? -10.440 23.813  -56.611 1.00 66.20  ? 110  SER B N   1 
ATOM   5034 C CA  . SER B 1 110 ? -9.243  24.613  -56.407 1.00 64.02  ? 110  SER B CA  1 
ATOM   5035 C C   . SER B 1 110 ? -8.111  23.730  -55.869 1.00 59.20  ? 110  SER B C   1 
ATOM   5036 O O   . SER B 1 110 ? -8.361  22.675  -55.297 1.00 60.02  ? 110  SER B O   1 
ATOM   5037 C CB  . SER B 1 110 ? -9.538  25.788  -55.470 1.00 67.32  ? 110  SER B CB  1 
ATOM   5038 O OG  . SER B 1 110 ? -10.270 25.362  -54.335 1.00 73.70  ? 110  SER B OG  1 
ATOM   5039 N N   . PRO B 1 111 ? -6.859  24.147  -56.084 1.00 52.09  ? 111  PRO B N   1 
ATOM   5040 C CA  . PRO B 1 111 ? -5.706  23.388  -55.605 1.00 52.06  ? 111  PRO B CA  1 
ATOM   5041 C C   . PRO B 1 111 ? -5.835  23.049  -54.123 1.00 53.97  ? 111  PRO B C   1 
ATOM   5042 O O   . PRO B 1 111 ? -6.074  23.930  -53.306 1.00 56.12  ? 111  PRO B O   1 
ATOM   5043 C CB  . PRO B 1 111 ? -4.541  24.353  -55.840 1.00 51.65  ? 111  PRO B CB  1 
ATOM   5044 C CG  . PRO B 1 111 ? -4.959  25.142  -57.011 1.00 54.33  ? 111  PRO B CG  1 
ATOM   5045 C CD  . PRO B 1 111 ? -6.449  25.345  -56.832 1.00 56.27  ? 111  PRO B CD  1 
ATOM   5046 N N   . THR B 1 112 ? -5.673  21.768  -53.802 1.00 50.94  ? 112  THR B N   1 
ATOM   5047 C CA  . THR B 1 112 ? -5.924  21.232  -52.473 1.00 48.02  ? 112  THR B CA  1 
ATOM   5048 C C   . THR B 1 112 ? -4.604  20.775  -51.826 1.00 43.71  ? 112  THR B C   1 
ATOM   5049 O O   . THR B 1 112 ? -3.777  20.182  -52.499 1.00 41.74  ? 112  THR B O   1 
ATOM   5050 C CB  . THR B 1 112 ? -6.851  20.010  -52.601 1.00 48.07  ? 112  THR B CB  1 
ATOM   5051 O OG1 . THR B 1 112 ? -8.014  20.395  -53.329 1.00 62.94  ? 112  THR B OG1 1 
ATOM   5052 C CG2 . THR B 1 112 ? -7.265  19.496  -51.252 1.00 45.81  ? 112  THR B CG2 1 
ATOM   5053 N N   . PRO B 1 113 ? -4.416  21.046  -50.523 1.00 42.56  ? 113  PRO B N   1 
ATOM   5054 C CA  . PRO B 1 113 ? -3.243  20.540  -49.793 1.00 42.35  ? 113  PRO B CA  1 
ATOM   5055 C C   . PRO B 1 113 ? -3.010  19.056  -50.023 1.00 41.87  ? 113  PRO B C   1 
ATOM   5056 O O   . PRO B 1 113 ? -3.956  18.276  -50.083 1.00 48.60  ? 113  PRO B O   1 
ATOM   5057 C CB  . PRO B 1 113 ? -3.595  20.802  -48.327 1.00 38.89  ? 113  PRO B CB  1 
ATOM   5058 C CG  . PRO B 1 113 ? -4.453  22.051  -48.401 1.00 47.06  ? 113  PRO B CG  1 
ATOM   5059 C CD  . PRO B 1 113 ? -5.236  21.955  -49.697 1.00 45.16  ? 113  PRO B CD  1 
ATOM   5060 N N   . VAL B 1 114 ? -1.745  18.681  -50.164 1.00 35.35  ? 114  VAL B N   1 
ATOM   5061 C CA  . VAL B 1 114 ? -1.381  17.298  -50.429 1.00 37.30  ? 114  VAL B CA  1 
ATOM   5062 C C   . VAL B 1 114 ? -0.675  16.686  -49.223 1.00 39.66  ? 114  VAL B C   1 
ATOM   5063 O O   . VAL B 1 114 ? 0.251   17.286  -48.658 1.00 36.75  ? 114  VAL B O   1 
ATOM   5064 C CB  . VAL B 1 114 ? -0.420  17.205  -51.628 1.00 40.08  ? 114  VAL B CB  1 
ATOM   5065 C CG1 . VAL B 1 114 ? -0.046  15.754  -51.887 1.00 33.90  ? 114  VAL B CG1 1 
ATOM   5066 C CG2 . VAL B 1 114 ? -1.048  17.873  -52.881 1.00 34.16  ? 114  VAL B CG2 1 
ATOM   5067 N N   . LEU B 1 115 ? -1.103  15.492  -48.832 1.00 33.87  ? 115  LEU B N   1 
ATOM   5068 C CA  . LEU B 1 115 ? -0.376  14.728  -47.824 1.00 34.25  ? 115  LEU B CA  1 
ATOM   5069 C C   . LEU B 1 115 ? 0.278   13.540  -48.502 1.00 39.91  ? 115  LEU B C   1 
ATOM   5070 O O   . LEU B 1 115 ? -0.377  12.833  -49.273 1.00 44.34  ? 115  LEU B O   1 
ATOM   5071 C CB  . LEU B 1 115 ? -1.310  14.220  -46.724 1.00 35.81  ? 115  LEU B CB  1 
ATOM   5072 C CG  . LEU B 1 115 ? -1.796  15.267  -45.711 1.00 47.44  ? 115  LEU B CG  1 
ATOM   5073 C CD1 . LEU B 1 115 ? -2.893  16.125  -46.338 1.00 48.40  ? 115  LEU B CD1 1 
ATOM   5074 C CD2 . LEU B 1 115 ? -2.305  14.624  -44.440 1.00 50.71  ? 115  LEU B CD2 1 
ATOM   5075 N N   . ILE B 1 116 ? 1.559   13.319  -48.201 1.00 33.82  ? 116  ILE B N   1 
ATOM   5076 C CA  . ILE B 1 116 ? 2.296   12.183  -48.744 1.00 35.68  ? 116  ILE B CA  1 
ATOM   5077 C C   . ILE B 1 116 ? 2.720   11.239  -47.627 1.00 34.84  ? 116  ILE B C   1 
ATOM   5078 O O   . ILE B 1 116 ? 3.508   11.608  -46.765 1.00 33.13  ? 116  ILE B O   1 
ATOM   5079 C CB  . ILE B 1 116 ? 3.553   12.631  -49.528 1.00 35.97  ? 116  ILE B CB  1 
ATOM   5080 C CG1 . ILE B 1 116 ? 3.193   13.672  -50.596 1.00 38.18  ? 116  ILE B CG1 1 
ATOM   5081 C CG2 . ILE B 1 116 ? 4.238   11.416  -50.176 1.00 28.34  ? 116  ILE B CG2 1 
ATOM   5082 C CD1 . ILE B 1 116 ? 4.374   14.126  -51.442 1.00 27.71  ? 116  ILE B CD1 1 
ATOM   5083 N N   . TRP B 1 117 ? 2.177   10.029  -47.643 1.00 32.33  ? 117  TRP B N   1 
ATOM   5084 C CA  . TRP B 1 117 ? 2.506   9.012   -46.663 1.00 28.93  ? 117  TRP B CA  1 
ATOM   5085 C C   . TRP B 1 117 ? 3.718   8.164   -47.023 1.00 33.34  ? 117  TRP B C   1 
ATOM   5086 O O   . TRP B 1 117 ? 3.869   7.711   -48.152 1.00 32.07  ? 117  TRP B O   1 
ATOM   5087 C CB  . TRP B 1 117 ? 1.339   8.063   -46.519 1.00 27.26  ? 117  TRP B CB  1 
ATOM   5088 C CG  . TRP B 1 117 ? 1.590   6.968   -45.561 1.00 29.74  ? 117  TRP B CG  1 
ATOM   5089 C CD1 . TRP B 1 117 ? 1.802   5.651   -45.852 1.00 33.18  ? 117  TRP B CD1 1 
ATOM   5090 C CD2 . TRP B 1 117 ? 1.645   7.083   -44.125 1.00 30.91  ? 117  TRP B CD2 1 
ATOM   5091 N NE1 . TRP B 1 117 ? 1.999   4.936   -44.682 1.00 38.86  ? 117  TRP B NE1 1 
ATOM   5092 C CE2 . TRP B 1 117 ? 1.892   5.791   -43.611 1.00 32.48  ? 117  TRP B CE2 1 
ATOM   5093 C CE3 . TRP B 1 117 ? 1.508   8.155   -43.227 1.00 28.81  ? 117  TRP B CE3 1 
ATOM   5094 C CZ2 . TRP B 1 117 ? 2.002   5.540   -42.238 1.00 30.27  ? 117  TRP B CZ2 1 
ATOM   5095 C CZ3 . TRP B 1 117 ? 1.599   7.900   -41.854 1.00 26.09  ? 117  TRP B CZ3 1 
ATOM   5096 C CH2 . TRP B 1 117 ? 1.856   6.601   -41.381 1.00 32.04  ? 117  TRP B CH2 1 
ATOM   5097 N N   . ILE B 1 118 ? 4.547   7.907   -46.029 1.00 35.73  ? 118  ILE B N   1 
ATOM   5098 C CA  . ILE B 1 118 ? 5.722   7.067   -46.186 1.00 34.72  ? 118  ILE B CA  1 
ATOM   5099 C C   . ILE B 1 118 ? 5.671   6.003   -45.090 1.00 33.50  ? 118  ILE B C   1 
ATOM   5100 O O   . ILE B 1 118 ? 5.851   6.300   -43.898 1.00 30.93  ? 118  ILE B O   1 
ATOM   5101 C CB  . ILE B 1 118 ? 7.010   7.878   -46.033 1.00 34.40  ? 118  ILE B CB  1 
ATOM   5102 C CG1 . ILE B 1 118 ? 7.011   9.068   -47.023 1.00 33.64  ? 118  ILE B CG1 1 
ATOM   5103 C CG2 . ILE B 1 118 ? 8.235   6.962   -46.202 1.00 28.84  ? 118  ILE B CG2 1 
ATOM   5104 C CD1 . ILE B 1 118 ? 8.295   9.929   -46.959 1.00 30.98  ? 118  ILE B CD1 1 
ATOM   5105 N N   . TYR B 1 119 ? 5.432   4.765   -45.494 1.00 27.48  ? 119  TYR B N   1 
ATOM   5106 C CA  . TYR B 1 119 ? 5.235   3.686   -44.533 1.00 35.82  ? 119  TYR B CA  1 
ATOM   5107 C C   . TYR B 1 119 ? 6.501   3.384   -43.779 1.00 35.29  ? 119  TYR B C   1 
ATOM   5108 O O   . TYR B 1 119 ? 7.589   3.750   -44.229 1.00 29.05  ? 119  TYR B O   1 
ATOM   5109 C CB  . TYR B 1 119 ? 4.724   2.404   -45.206 1.00 32.12  ? 119  TYR B CB  1 
ATOM   5110 C CG  . TYR B 1 119 ? 5.566   1.881   -46.360 1.00 34.88  ? 119  TYR B CG  1 
ATOM   5111 C CD1 . TYR B 1 119 ? 6.774   1.221   -46.131 1.00 33.97  ? 119  TYR B CD1 1 
ATOM   5112 C CD2 . TYR B 1 119 ? 5.129   2.011   -47.673 1.00 37.09  ? 119  TYR B CD2 1 
ATOM   5113 C CE1 . TYR B 1 119 ? 7.531   0.714   -47.191 1.00 37.40  ? 119  TYR B CE1 1 
ATOM   5114 C CE2 . TYR B 1 119 ? 5.876   1.517   -48.740 1.00 33.51  ? 119  TYR B CE2 1 
ATOM   5115 C CZ  . TYR B 1 119 ? 7.072   0.872   -48.495 1.00 37.51  ? 119  TYR B CZ  1 
ATOM   5116 O OH  . TYR B 1 119 ? 7.802   0.376   -49.551 1.00 36.53  ? 119  TYR B OH  1 
ATOM   5117 N N   . GLY B 1 120 ? 6.341   2.721   -42.632 1.00 32.52  ? 120  GLY B N   1 
ATOM   5118 C CA  . GLY B 1 120 ? 7.468   2.204   -41.871 1.00 35.03  ? 120  GLY B CA  1 
ATOM   5119 C C   . GLY B 1 120 ? 7.556   0.688   -42.012 1.00 37.73  ? 120  GLY B C   1 
ATOM   5120 O O   . GLY B 1 120 ? 6.948   0.109   -42.920 1.00 36.06  ? 120  GLY B O   1 
ATOM   5121 N N   . GLY B 1 121 ? 8.307   0.044   -41.120 1.00 35.71  ? 121  GLY B N   1 
ATOM   5122 C CA  . GLY B 1 121 ? 8.654   -1.364  -41.286 1.00 37.04  ? 121  GLY B CA  1 
ATOM   5123 C C   . GLY B 1 121 ? 10.161  -1.629  -41.192 1.00 37.39  ? 121  GLY B C   1 
ATOM   5124 O O   . GLY B 1 121 ? 10.670  -2.597  -41.782 1.00 36.78  ? 121  GLY B O   1 
ATOM   5125 N N   . GLY B 1 122 ? 10.875  -0.768  -40.461 1.00 35.51  ? 122  GLY B N   1 
ATOM   5126 C CA  . GLY B 1 122 ? 12.280  -1.001  -40.135 1.00 37.29  ? 122  GLY B CA  1 
ATOM   5127 C C   . GLY B 1 122 ? 13.232  -0.908  -41.317 1.00 37.51  ? 122  GLY B C   1 
ATOM   5128 O O   . GLY B 1 122 ? 14.397  -1.323  -41.235 1.00 38.67  ? 122  GLY B O   1 
ATOM   5129 N N   . PHE B 1 123 ? 12.727  -0.372  -42.424 1.00 33.19  ? 123  PHE B N   1 
ATOM   5130 C CA  . PHE B 1 123 ? 13.506  -0.247  -43.652 1.00 36.88  ? 123  PHE B CA  1 
ATOM   5131 C C   . PHE B 1 123 ? 13.738  -1.608  -44.300 1.00 34.63  ? 123  PHE B C   1 
ATOM   5132 O O   . PHE B 1 123 ? 14.493  -1.694  -45.261 1.00 39.99  ? 123  PHE B O   1 
ATOM   5133 C CB  . PHE B 1 123 ? 14.874  0.425   -43.406 1.00 35.89  ? 123  PHE B CB  1 
ATOM   5134 C CG  . PHE B 1 123 ? 14.799  1.925   -43.115 1.00 33.95  ? 123  PHE B CG  1 
ATOM   5135 C CD1 . PHE B 1 123 ? 14.406  2.821   -44.104 1.00 34.10  ? 123  PHE B CD1 1 
ATOM   5136 C CD2 . PHE B 1 123 ? 15.172  2.428   -41.860 1.00 34.40  ? 123  PHE B CD2 1 
ATOM   5137 C CE1 . PHE B 1 123 ? 14.346  4.190   -43.844 1.00 30.61  ? 123  PHE B CE1 1 
ATOM   5138 C CE2 . PHE B 1 123 ? 15.144  3.783   -41.599 1.00 30.04  ? 123  PHE B CE2 1 
ATOM   5139 C CZ  . PHE B 1 123 ? 14.716  4.671   -42.602 1.00 29.56  ? 123  PHE B CZ  1 
ATOM   5140 N N   . TYR B 1 124 ? 13.110  -2.661  -43.762 1.00 34.04  ? 124  TYR B N   1 
ATOM   5141 C CA  . TYR B 1 124 ? 13.208  -4.011  -44.343 1.00 33.77  ? 124  TYR B CA  1 
ATOM   5142 C C   . TYR B 1 124 ? 11.870  -4.544  -44.837 1.00 38.09  ? 124  TYR B C   1 
ATOM   5143 O O   . TYR B 1 124 ? 11.801  -5.640  -45.388 1.00 38.75  ? 124  TYR B O   1 
ATOM   5144 C CB  . TYR B 1 124 ? 13.831  -5.021  -43.363 1.00 37.68  ? 124  TYR B CB  1 
ATOM   5145 C CG  . TYR B 1 124 ? 12.926  -5.422  -42.214 1.00 41.04  ? 124  TYR B CG  1 
ATOM   5146 C CD1 . TYR B 1 124 ? 11.957  -6.411  -42.369 1.00 40.82  ? 124  TYR B CD1 1 
ATOM   5147 C CD2 . TYR B 1 124 ? 13.052  -4.810  -40.962 1.00 40.65  ? 124  TYR B CD2 1 
ATOM   5148 C CE1 . TYR B 1 124 ? 11.132  -6.776  -41.310 1.00 36.36  ? 124  TYR B CE1 1 
ATOM   5149 C CE2 . TYR B 1 124 ? 12.227  -5.158  -39.905 1.00 38.67  ? 124  TYR B CE2 1 
ATOM   5150 C CZ  . TYR B 1 124 ? 11.271  -6.134  -40.083 1.00 40.30  ? 124  TYR B CZ  1 
ATOM   5151 O OH  . TYR B 1 124 ? 10.472  -6.480  -39.017 1.00 40.54  ? 124  TYR B OH  1 
ATOM   5152 N N   . SER B 1 125 ? 10.808  -3.771  -44.641 1.00 38.04  ? 125  SER B N   1 
ATOM   5153 C CA  . SER B 1 125 ? 9.477   -4.264  -44.945 1.00 34.25  ? 125  SER B CA  1 
ATOM   5154 C C   . SER B 1 125 ? 8.503   -3.117  -45.086 1.00 36.39  ? 125  SER B C   1 
ATOM   5155 O O   . SER B 1 125 ? 8.856   -1.951  -44.845 1.00 31.93  ? 125  SER B O   1 
ATOM   5156 C CB  . SER B 1 125 ? 9.004   -5.220  -43.844 1.00 39.99  ? 125  SER B CB  1 
ATOM   5157 O OG  . SER B 1 125 ? 8.800   -4.542  -42.611 1.00 38.89  ? 125  SER B OG  1 
ATOM   5158 N N   . GLY B 1 126 ? 7.271   -3.453  -45.457 1.00 33.24  ? 126  GLY B N   1 
ATOM   5159 C CA  . GLY B 1 126 ? 6.206   -2.477  -45.562 1.00 32.66  ? 126  GLY B CA  1 
ATOM   5160 C C   . GLY B 1 126 ? 5.721   -2.322  -46.992 1.00 38.88  ? 126  GLY B C   1 
ATOM   5161 O O   . GLY B 1 126 ? 6.372   -2.802  -47.912 1.00 37.02  ? 126  GLY B O   1 
ATOM   5162 N N   . ALA B 1 127 ? 4.584   -1.645  -47.169 1.00 35.70  ? 127  ALA B N   1 
ATOM   5163 C CA  . ALA B 1 127 ? 3.987   -1.441  -48.487 1.00 36.83  ? 127  ALA B CA  1 
ATOM   5164 C C   . ALA B 1 127 ? 2.896   -0.378  -48.371 1.00 38.41  ? 127  ALA B C   1 
ATOM   5165 O O   . ALA B 1 127 ? 2.250   -0.269  -47.340 1.00 36.82  ? 127  ALA B O   1 
ATOM   5166 C CB  . ALA B 1 127 ? 3.392   -2.737  -49.016 1.00 40.39  ? 127  ALA B CB  1 
ATOM   5167 N N   . ALA B 1 128 ? 2.677   0.382   -49.438 1.00 35.21  ? 128  ALA B N   1 
ATOM   5168 C CA  . ALA B 1 128 ? 1.697   1.461   -49.404 1.00 31.31  ? 128  ALA B CA  1 
ATOM   5169 C C   . ALA B 1 128 ? 0.277   0.924   -49.573 1.00 39.01  ? 128  ALA B C   1 
ATOM   5170 O O   . ALA B 1 128 ? -0.690  1.668   -49.448 1.00 40.05  ? 128  ALA B O   1 
ATOM   5171 C CB  . ALA B 1 128 ? 2.027   2.535   -50.477 1.00 25.27  ? 128  ALA B CB  1 
ATOM   5172 N N   . SER B 1 129 ? 0.159   -0.381  -49.823 1.00 40.17  ? 129  SER B N   1 
ATOM   5173 C CA  . SER B 1 129 ? -1.142  -1.013  -50.093 1.00 35.46  ? 129  SER B CA  1 
ATOM   5174 C C   . SER B 1 129 ? -1.864  -1.584  -48.856 1.00 38.73  ? 129  SER B C   1 
ATOM   5175 O O   . SER B 1 129 ? -2.995  -2.072  -48.971 1.00 40.89  ? 129  SER B O   1 
ATOM   5176 C CB  . SER B 1 129 ? -0.996  -2.105  -51.166 1.00 37.17  ? 129  SER B CB  1 
ATOM   5177 O OG  . SER B 1 129 ? -0.024  -3.071  -50.804 1.00 40.49  ? 129  SER B OG  1 
ATOM   5178 N N   . LEU B 1 130 ? -1.231  -1.517  -47.680 1.00 33.86  ? 130  LEU B N   1 
ATOM   5179 C CA  . LEU B 1 130 ? -1.870  -2.020  -46.463 1.00 40.00  ? 130  LEU B CA  1 
ATOM   5180 C C   . LEU B 1 130 ? -3.184  -1.294  -46.171 1.00 45.17  ? 130  LEU B C   1 
ATOM   5181 O O   . LEU B 1 130 ? -3.311  -0.085  -46.438 1.00 44.71  ? 130  LEU B O   1 
ATOM   5182 C CB  . LEU B 1 130 ? -0.932  -1.935  -45.259 1.00 43.75  ? 130  LEU B CB  1 
ATOM   5183 C CG  . LEU B 1 130 ? 0.436   -2.603  -45.435 1.00 46.03  ? 130  LEU B CG  1 
ATOM   5184 C CD1 . LEU B 1 130 ? 1.217   -2.560  -44.131 1.00 47.42  ? 130  LEU B CD1 1 
ATOM   5185 C CD2 . LEU B 1 130 ? 0.292   -4.033  -45.945 1.00 41.02  ? 130  LEU B CD2 1 
ATOM   5186 N N   . ASP B 1 131 ? -4.164  -2.041  -45.654 1.00 45.30  ? 131  ASP B N   1 
ATOM   5187 C CA  . ASP B 1 131 ? -5.473  -1.473  -45.293 1.00 51.31  ? 131  ASP B CA  1 
ATOM   5188 C C   . ASP B 1 131 ? -5.380  -0.243  -44.382 1.00 45.05  ? 131  ASP B C   1 
ATOM   5189 O O   . ASP B 1 131 ? -6.105  0.725   -44.594 1.00 46.03  ? 131  ASP B O   1 
ATOM   5190 C CB  . ASP B 1 131 ? -6.382  -2.510  -44.625 1.00 52.48  ? 131  ASP B CB  1 
ATOM   5191 C CG  . ASP B 1 131 ? -6.738  -3.672  -45.542 1.00 61.21  ? 131  ASP B CG  1 
ATOM   5192 O OD1 . ASP B 1 131 ? -6.493  -3.600  -46.776 1.00 58.01  ? 131  ASP B OD1 1 
ATOM   5193 O OD2 . ASP B 1 131 ? -7.275  -4.668  -45.008 1.00 65.78  ? 131  ASP B OD2 1 
ATOM   5194 N N   . VAL B 1 132 ? -4.500  -0.272  -43.379 1.00 42.86  ? 132  VAL B N   1 
ATOM   5195 C CA  . VAL B 1 132 ? -4.376  0.875   -42.459 1.00 43.53  ? 132  VAL B CA  1 
ATOM   5196 C C   . VAL B 1 132 ? -3.799  2.137   -43.088 1.00 44.95  ? 132  VAL B C   1 
ATOM   5197 O O   . VAL B 1 132 ? -3.727  3.169   -42.417 1.00 44.00  ? 132  VAL B O   1 
ATOM   5198 C CB  . VAL B 1 132 ? -3.531  0.575   -41.203 1.00 43.16  ? 132  VAL B CB  1 
ATOM   5199 C CG1 . VAL B 1 132 ? -4.287  -0.331  -40.256 1.00 44.54  ? 132  VAL B CG1 1 
ATOM   5200 C CG2 . VAL B 1 132 ? -2.156  -0.003  -41.588 1.00 40.23  ? 132  VAL B CG2 1 
ATOM   5201 N N   . TYR B 1 133 ? -3.373  2.057   -44.353 1.00 38.97  ? 133  TYR B N   1 
ATOM   5202 C CA  . TYR B 1 133 ? -2.897  3.245   -45.066 1.00 39.98  ? 133  TYR B CA  1 
ATOM   5203 C C   . TYR B 1 133 ? -3.892  3.740   -46.120 1.00 37.56  ? 133  TYR B C   1 
ATOM   5204 O O   . TYR B 1 133 ? -3.560  4.552   -46.976 1.00 41.75  ? 133  TYR B O   1 
ATOM   5205 C CB  . TYR B 1 133 ? -1.545  2.984   -45.735 1.00 34.59  ? 133  TYR B CB  1 
ATOM   5206 C CG  . TYR B 1 133 ? -0.485  2.422   -44.814 1.00 37.55  ? 133  TYR B CG  1 
ATOM   5207 C CD1 . TYR B 1 133 ? -0.453  2.763   -43.457 1.00 33.24  ? 133  TYR B CD1 1 
ATOM   5208 C CD2 . TYR B 1 133 ? 0.497   1.560   -45.305 1.00 33.03  ? 133  TYR B CD2 1 
ATOM   5209 C CE1 . TYR B 1 133 ? 0.522   2.253   -42.620 1.00 34.73  ? 133  TYR B CE1 1 
ATOM   5210 C CE2 . TYR B 1 133 ? 1.482   1.043   -44.474 1.00 33.14  ? 133  TYR B CE2 1 
ATOM   5211 C CZ  . TYR B 1 133 ? 1.490   1.397   -43.136 1.00 33.89  ? 133  TYR B CZ  1 
ATOM   5212 O OH  . TYR B 1 133 ? 2.457   0.898   -42.316 1.00 33.93  ? 133  TYR B OH  1 
ATOM   5213 N N   . ASP B 1 134 ? -5.106  3.227   -46.063 1.00 39.59  ? 134  ASP B N   1 
ATOM   5214 C CA  . ASP B 1 134 ? -6.147  3.559   -47.032 1.00 38.51  ? 134  ASP B CA  1 
ATOM   5215 C C   . ASP B 1 134 ? -6.495  5.048   -46.983 1.00 39.65  ? 134  ASP B C   1 
ATOM   5216 O O   . ASP B 1 134 ? -7.032  5.529   -45.979 1.00 37.87  ? 134  ASP B O   1 
ATOM   5217 C CB  . ASP B 1 134 ? -7.379  2.748   -46.673 1.00 41.43  ? 134  ASP B CB  1 
ATOM   5218 C CG  . ASP B 1 134 ? -8.484  2.842   -47.712 1.00 46.94  ? 134  ASP B CG  1 
ATOM   5219 O OD1 . ASP B 1 134 ? -8.544  3.824   -48.483 1.00 45.42  ? 134  ASP B OD1 1 
ATOM   5220 O OD2 . ASP B 1 134 ? -9.309  1.913   -47.737 1.00 51.65  ? 134  ASP B OD2 1 
ATOM   5221 N N   . GLY B 1 135 ? -6.230  5.769   -48.066 1.00 39.39  ? 135  GLY B N   1 
ATOM   5222 C CA  . GLY B 1 135 ? -6.422  7.212   -48.067 1.00 42.55  ? 135  GLY B CA  1 
ATOM   5223 C C   . GLY B 1 135 ? -7.829  7.697   -48.404 1.00 41.41  ? 135  GLY B C   1 
ATOM   5224 O O   . GLY B 1 135 ? -8.059  8.896   -48.531 1.00 40.66  ? 135  GLY B O   1 
ATOM   5225 N N   . ARG B 1 136 ? -8.789  6.796   -48.556 1.00 39.67  ? 136  ARG B N   1 
ATOM   5226 C CA  . ARG B 1 136 ? -10.088 7.259   -49.025 1.00 42.84  ? 136  ARG B CA  1 
ATOM   5227 C C   . ARG B 1 136 ? -10.789 8.124   -47.979 1.00 50.59  ? 136  ARG B C   1 
ATOM   5228 O O   . ARG B 1 136 ? -11.532 9.039   -48.341 1.00 47.41  ? 136  ARG B O   1 
ATOM   5229 C CB  . ARG B 1 136 ? -10.985 6.101   -49.462 1.00 44.45  ? 136  ARG B CB  1 
ATOM   5230 C CG  . ARG B 1 136 ? -11.586 5.335   -48.311 1.00 48.29  ? 136  ARG B CG  1 
ATOM   5231 C CD  . ARG B 1 136 ? -11.420 3.865   -48.541 1.00 54.74  ? 136  ARG B CD  1 
ATOM   5232 N NE  . ARG B 1 136 ? -12.529 3.298   -49.258 1.00 56.47  ? 136  ARG B NE  1 
ATOM   5233 C CZ  . ARG B 1 136 ? -12.456 2.236   -50.059 1.00 58.40  ? 136  ARG B CZ  1 
ATOM   5234 N NH1 . ARG B 1 136 ? -11.301 1.604   -50.283 1.00 50.41  ? 136  ARG B NH1 1 
ATOM   5235 N NH2 . ARG B 1 136 ? -13.562 1.809   -50.648 1.00 49.49  ? 136  ARG B NH2 1 
ATOM   5236 N N   . PHE B 1 137 ? -10.547 7.857   -46.692 1.00 45.44  ? 137  PHE B N   1 
ATOM   5237 C CA  . PHE B 1 137 ? -11.265 8.581   -45.642 1.00 41.77  ? 137  PHE B CA  1 
ATOM   5238 C C   . PHE B 1 137 ? -10.788 10.020  -45.549 1.00 45.87  ? 137  PHE B C   1 
ATOM   5239 O O   . PHE B 1 137 ? -11.604 10.935  -45.477 1.00 46.14  ? 137  PHE B O   1 
ATOM   5240 C CB  . PHE B 1 137 ? -11.167 7.863   -44.290 1.00 39.30  ? 137  PHE B CB  1 
ATOM   5241 C CG  . PHE B 1 137 ? -11.555 6.412   -44.359 1.00 43.33  ? 137  PHE B CG  1 
ATOM   5242 C CD1 . PHE B 1 137 ? -12.888 6.043   -44.384 1.00 44.87  ? 137  PHE B CD1 1 
ATOM   5243 C CD2 . PHE B 1 137 ? -10.585 5.418   -44.435 1.00 46.64  ? 137  PHE B CD2 1 
ATOM   5244 C CE1 . PHE B 1 137 ? -13.252 4.700   -44.464 1.00 50.80  ? 137  PHE B CE1 1 
ATOM   5245 C CE2 . PHE B 1 137 ? -10.938 4.069   -44.518 1.00 48.48  ? 137  PHE B CE2 1 
ATOM   5246 C CZ  . PHE B 1 137 ? -12.273 3.711   -44.535 1.00 48.34  ? 137  PHE B CZ  1 
ATOM   5247 N N   . LEU B 1 138 ? -9.469  10.220  -45.568 1.00 41.48  ? 138  LEU B N   1 
ATOM   5248 C CA  . LEU B 1 138 ? -8.907  11.573  -45.546 1.00 43.41  ? 138  LEU B CA  1 
ATOM   5249 C C   . LEU B 1 138 ? -9.357  12.383  -46.771 1.00 43.90  ? 138  LEU B C   1 
ATOM   5250 O O   . LEU B 1 138 ? -9.741  13.542  -46.642 1.00 47.08  ? 138  LEU B O   1 
ATOM   5251 C CB  . LEU B 1 138 ? -7.371  11.545  -45.401 1.00 40.33  ? 138  LEU B CB  1 
ATOM   5252 C CG  . LEU B 1 138 ? -6.881  11.107  -44.010 1.00 35.57  ? 138  LEU B CG  1 
ATOM   5253 C CD1 . LEU B 1 138 ? -5.446  10.597  -44.026 1.00 31.45  ? 138  LEU B CD1 1 
ATOM   5254 C CD2 . LEU B 1 138 ? -7.048  12.229  -43.002 1.00 37.93  ? 138  LEU B CD2 1 
ATOM   5255 N N   . ALA B 1 139 ? -9.337  11.764  -47.950 1.00 38.76  ? 139  ALA B N   1 
ATOM   5256 C CA  . ALA B 1 139 ? -9.828  12.415  -49.167 1.00 42.17  ? 139  ALA B CA  1 
ATOM   5257 C C   . ALA B 1 139 ? -11.325 12.764  -49.101 1.00 49.93  ? 139  ALA B C   1 
ATOM   5258 O O   . ALA B 1 139 ? -11.734 13.882  -49.437 1.00 51.70  ? 139  ALA B O   1 
ATOM   5259 C CB  . ALA B 1 139 ? -9.553  11.538  -50.401 1.00 37.43  ? 139  ALA B CB  1 
ATOM   5260 N N   . GLN B 1 140 ? -12.146 11.806  -48.691 1.00 44.26  ? 140  GLN B N   1 
ATOM   5261 C CA  . GLN B 1 140 ? -13.581 12.046  -48.659 1.00 45.82  ? 140  GLN B CA  1 
ATOM   5262 C C   . GLN B 1 140 ? -13.964 13.060  -47.589 1.00 49.90  ? 140  GLN B C   1 
ATOM   5263 O O   . GLN B 1 140 ? -14.620 14.052  -47.878 1.00 55.00  ? 140  GLN B O   1 
ATOM   5264 C CB  . GLN B 1 140 ? -14.361 10.749  -48.464 1.00 45.06  ? 140  GLN B CB  1 
ATOM   5265 C CG  . GLN B 1 140 ? -15.768 10.803  -49.074 1.00 49.14  ? 140  GLN B CG  1 
ATOM   5266 C CD  . GLN B 1 140 ? -16.761 11.610  -48.250 1.00 54.08  ? 140  GLN B CD  1 
ATOM   5267 O OE1 . GLN B 1 140 ? -16.722 11.612  -47.016 1.00 55.80  ? 140  GLN B OE1 1 
ATOM   5268 N NE2 . GLN B 1 140 ? -17.669 12.289  -48.935 1.00 59.14  ? 140  GLN B NE2 1 
ATOM   5269 N N   . VAL B 1 141 ? -13.549 12.815  -46.354 1.00 50.09  ? 141  VAL B N   1 
ATOM   5270 C CA  . VAL B 1 141 ? -14.018 13.636  -45.244 1.00 51.26  ? 141  VAL B CA  1 
ATOM   5271 C C   . VAL B 1 141 ? -13.381 15.009  -45.200 1.00 48.95  ? 141  VAL B C   1 
ATOM   5272 O O   . VAL B 1 141 ? -14.072 15.996  -44.977 1.00 48.55  ? 141  VAL B O   1 
ATOM   5273 C CB  . VAL B 1 141 ? -13.831 12.945  -43.900 1.00 51.28  ? 141  VAL B CB  1 
ATOM   5274 C CG1 . VAL B 1 141 ? -14.225 13.910  -42.741 1.00 38.04  ? 141  VAL B CG1 1 
ATOM   5275 C CG2 . VAL B 1 141 ? -14.649 11.662  -43.876 1.00 46.07  ? 141  VAL B CG2 1 
ATOM   5276 N N   . GLU B 1 142 ? -12.073 15.068  -45.440 1.00 44.04  ? 142  GLU B N   1 
ATOM   5277 C CA  . GLU B 1 142 ? -11.320 16.314  -45.348 1.00 34.93  ? 142  GLU B CA  1 
ATOM   5278 C C   . GLU B 1 142 ? -10.998 16.961  -46.698 1.00 41.17  ? 142  GLU B C   1 
ATOM   5279 O O   . GLU B 1 142 ? -10.337 18.001  -46.753 1.00 45.39  ? 142  GLU B O   1 
ATOM   5280 C CB  . GLU B 1 142 ? -10.018 16.060  -44.581 1.00 38.34  ? 142  GLU B CB  1 
ATOM   5281 C CG  . GLU B 1 142 ? -10.274 15.627  -43.167 1.00 43.67  ? 142  GLU B CG  1 
ATOM   5282 C CD  . GLU B 1 142 ? -10.822 16.771  -42.326 1.00 54.74  ? 142  GLU B CD  1 
ATOM   5283 O OE1 . GLU B 1 142 ? -10.735 17.943  -42.768 1.00 57.05  ? 142  GLU B OE1 1 
ATOM   5284 O OE2 . GLU B 1 142 ? -11.328 16.496  -41.223 1.00 59.94  ? 142  GLU B OE2 1 
ATOM   5285 N N   . GLY B 1 143 ? -11.450 16.352  -47.788 1.00 37.81  ? 143  GLY B N   1 
ATOM   5286 C CA  . GLY B 1 143 ? -11.179 16.908  -49.100 1.00 42.34  ? 143  GLY B CA  1 
ATOM   5287 C C   . GLY B 1 143 ? -9.689  16.984  -49.429 1.00 47.03  ? 143  GLY B C   1 
ATOM   5288 O O   . GLY B 1 143 ? -9.279  17.784  -50.251 1.00 49.91  ? 143  GLY B O   1 
ATOM   5289 N N   . ALA B 1 144 ? -8.881  16.143  -48.794 1.00 44.19  ? 144  ALA B N   1 
ATOM   5290 C CA  . ALA B 1 144 ? -7.433  16.114  -49.041 1.00 42.73  ? 144  ALA B CA  1 
ATOM   5291 C C   . ALA B 1 144 ? -7.032  15.303  -50.292 1.00 44.02  ? 144  ALA B C   1 
ATOM   5292 O O   . ALA B 1 144 ? -7.717  14.352  -50.671 1.00 42.09  ? 144  ALA B O   1 
ATOM   5293 C CB  . ALA B 1 144 ? -6.735  15.542  -47.831 1.00 37.67  ? 144  ALA B CB  1 
ATOM   5294 N N   . VAL B 1 145 ? -5.918  15.679  -50.916 1.00 38.39  ? 145  VAL B N   1 
ATOM   5295 C CA  . VAL B 1 145 ? -5.268  14.808  -51.871 1.00 36.49  ? 145  VAL B CA  1 
ATOM   5296 C C   . VAL B 1 145 ? -4.204  13.989  -51.159 1.00 41.49  ? 145  VAL B C   1 
ATOM   5297 O O   . VAL B 1 145 ? -3.271  14.531  -50.546 1.00 41.50  ? 145  VAL B O   1 
ATOM   5298 C CB  . VAL B 1 145 ? -4.645  15.577  -53.036 1.00 40.67  ? 145  VAL B CB  1 
ATOM   5299 C CG1 . VAL B 1 145 ? -3.804  14.614  -53.924 1.00 29.19  ? 145  VAL B CG1 1 
ATOM   5300 C CG2 . VAL B 1 145 ? -5.747  16.246  -53.863 1.00 35.10  ? 145  VAL B CG2 1 
ATOM   5301 N N   . LEU B 1 146 ? -4.352  12.675  -51.214 1.00 37.29  ? 146  LEU B N   1 
ATOM   5302 C CA  . LEU B 1 146 ? -3.455  11.820  -50.464 1.00 34.85  ? 146  LEU B CA  1 
ATOM   5303 C C   . LEU B 1 146 ? -2.604  10.945  -51.383 1.00 41.14  ? 146  LEU B C   1 
ATOM   5304 O O   . LEU B 1 146 ? -3.135  10.276  -52.270 1.00 39.91  ? 146  LEU B O   1 
ATOM   5305 C CB  . LEU B 1 146 ? -4.227  10.975  -49.445 1.00 41.64  ? 146  LEU B CB  1 
ATOM   5306 C CG  . LEU B 1 146 ? -3.225  10.416  -48.438 1.00 56.23  ? 146  LEU B CG  1 
ATOM   5307 C CD1 . LEU B 1 146 ? -3.651  10.684  -47.012 1.00 48.09  ? 146  LEU B CD1 1 
ATOM   5308 C CD2 . LEU B 1 146 ? -2.937  8.925   -48.706 1.00 58.80  ? 146  LEU B CD2 1 
ATOM   5309 N N   . VAL B 1 147 ? -1.286  10.974  -51.170 1.00 37.58  ? 147  VAL B N   1 
ATOM   5310 C CA  . VAL B 1 147 ? -0.352  10.184  -51.973 1.00 40.15  ? 147  VAL B CA  1 
ATOM   5311 C C   . VAL B 1 147 ? 0.443   9.200   -51.106 1.00 37.14  ? 147  VAL B C   1 
ATOM   5312 O O   . VAL B 1 147 ? 0.829   9.520   -49.999 1.00 40.45  ? 147  VAL B O   1 
ATOM   5313 C CB  . VAL B 1 147 ? 0.626   11.103  -52.740 1.00 40.33  ? 147  VAL B CB  1 
ATOM   5314 C CG1 . VAL B 1 147 ? 1.643   10.289  -53.562 1.00 33.82  ? 147  VAL B CG1 1 
ATOM   5315 C CG2 . VAL B 1 147 ? -0.147  12.054  -53.640 1.00 41.22  ? 147  VAL B CG2 1 
ATOM   5316 N N   . SER B 1 148 ? 0.685   7.998   -51.607 1.00 37.50  ? 148  SER B N   1 
ATOM   5317 C CA  . SER B 1 148 ? 1.632   7.100   -50.961 1.00 35.75  ? 148  SER B CA  1 
ATOM   5318 C C   . SER B 1 148 ? 2.432   6.352   -52.025 1.00 39.07  ? 148  SER B C   1 
ATOM   5319 O O   . SER B 1 148 ? 1.891   5.998   -53.082 1.00 34.97  ? 148  SER B O   1 
ATOM   5320 C CB  . SER B 1 148 ? 0.908   6.102   -50.052 1.00 35.40  ? 148  SER B CB  1 
ATOM   5321 O OG  . SER B 1 148 ? -0.049  5.358   -50.796 1.00 39.83  ? 148  SER B OG  1 
ATOM   5322 N N   . MET B 1 149 ? 3.713   6.100   -51.743 1.00 32.96  ? 149  MET B N   1 
ATOM   5323 C CA  . MET B 1 149 ? 4.565   5.410   -52.714 1.00 35.63  ? 149  MET B CA  1 
ATOM   5324 C C   . MET B 1 149 ? 5.186   4.164   -52.095 1.00 40.34  ? 149  MET B C   1 
ATOM   5325 O O   . MET B 1 149 ? 5.400   4.096   -50.882 1.00 41.16  ? 149  MET B O   1 
ATOM   5326 C CB  . MET B 1 149 ? 5.691   6.338   -53.214 1.00 34.80  ? 149  MET B CB  1 
ATOM   5327 C CG  . MET B 1 149 ? 6.947   6.392   -52.286 1.00 38.86  ? 149  MET B CG  1 
ATOM   5328 S SD  . MET B 1 149 ? 6.720   7.139   -50.641 1.00 35.68  ? 149  MET B SD  1 
ATOM   5329 C CE  . MET B 1 149 ? 6.700   8.892   -51.086 1.00 28.86  ? 149  MET B CE  1 
ATOM   5330 N N   . ASN B 1 150 ? 5.470   3.174   -52.928 1.00 41.73  ? 150  ASN B N   1 
ATOM   5331 C CA  . ASN B 1 150 ? 6.352   2.095   -52.519 1.00 33.98  ? 150  ASN B CA  1 
ATOM   5332 C C   . ASN B 1 150 ? 7.796   2.561   -52.669 1.00 35.10  ? 150  ASN B C   1 
ATOM   5333 O O   . ASN B 1 150 ? 8.096   3.329   -53.568 1.00 33.17  ? 150  ASN B O   1 
ATOM   5334 C CB  . ASN B 1 150 ? 6.124   0.873   -53.391 1.00 36.96  ? 150  ASN B CB  1 
ATOM   5335 C CG  . ASN B 1 150 ? 4.927   0.060   -52.955 1.00 41.48  ? 150  ASN B CG  1 
ATOM   5336 O OD1 . ASN B 1 150 ? 4.240   0.390   -51.978 1.00 39.47  ? 150  ASN B OD1 1 
ATOM   5337 N ND2 . ASN B 1 150 ? 4.669   -1.013  -53.679 1.00 36.32  ? 150  ASN B ND2 1 
ATOM   5338 N N   . TYR B 1 151 ? 8.688   2.097   -51.796 1.00 28.61  ? 151  TYR B N   1 
ATOM   5339 C CA  . TYR B 1 151 ? 10.108  2.355   -51.970 1.00 31.22  ? 151  TYR B CA  1 
ATOM   5340 C C   . TYR B 1 151 ? 10.848  1.065   -51.615 1.00 33.43  ? 151  TYR B C   1 
ATOM   5341 O O   . TYR B 1 151 ? 10.367  0.278   -50.815 1.00 34.61  ? 151  TYR B O   1 
ATOM   5342 C CB  . TYR B 1 151 ? 10.576  3.541   -51.112 1.00 32.69  ? 151  TYR B CB  1 
ATOM   5343 C CG  . TYR B 1 151 ? 10.382  3.353   -49.611 1.00 33.45  ? 151  TYR B CG  1 
ATOM   5344 C CD1 . TYR B 1 151 ? 9.186   3.697   -48.987 1.00 33.54  ? 151  TYR B CD1 1 
ATOM   5345 C CD2 . TYR B 1 151 ? 11.409  2.835   -48.818 1.00 31.03  ? 151  TYR B CD2 1 
ATOM   5346 C CE1 . TYR B 1 151 ? 9.015   3.518   -47.605 1.00 31.14  ? 151  TYR B CE1 1 
ATOM   5347 C CE2 . TYR B 1 151 ? 11.248  2.661   -47.448 1.00 35.05  ? 151  TYR B CE2 1 
ATOM   5348 C CZ  . TYR B 1 151 ? 10.053  2.996   -46.849 1.00 34.15  ? 151  TYR B CZ  1 
ATOM   5349 O OH  . TYR B 1 151 ? 9.915   2.790   -45.494 1.00 31.94  ? 151  TYR B OH  1 
ATOM   5350 N N   . ARG B 1 152 ? 12.008  0.848   -52.219 1.00 33.84  ? 152  ARG B N   1 
ATOM   5351 C CA  . ARG B 1 152 ? 12.764  -0.369  -51.970 1.00 34.56  ? 152  ARG B CA  1 
ATOM   5352 C C   . ARG B 1 152 ? 13.205  -0.493  -50.518 1.00 39.83  ? 152  ARG B C   1 
ATOM   5353 O O   . ARG B 1 152 ? 13.675  0.481   -49.904 1.00 34.27  ? 152  ARG B O   1 
ATOM   5354 C CB  . ARG B 1 152 ? 13.957  -0.442  -52.911 1.00 37.28  ? 152  ARG B CB  1 
ATOM   5355 C CG  . ARG B 1 152 ? 13.588  -0.913  -54.338 1.00 36.19  ? 152  ARG B CG  1 
ATOM   5356 C CD  . ARG B 1 152 ? 14.798  -0.814  -55.250 1.00 38.28  ? 152  ARG B CD  1 
ATOM   5357 N NE  . ARG B 1 152 ? 15.059  0.583   -55.562 1.00 35.38  ? 152  ARG B NE  1 
ATOM   5358 C CZ  . ARG B 1 152 ? 16.127  1.023   -56.206 1.00 38.69  ? 152  ARG B CZ  1 
ATOM   5359 N NH1 . ARG B 1 152 ? 17.079  0.165   -56.607 1.00 31.84  ? 152  ARG B NH1 1 
ATOM   5360 N NH2 . ARG B 1 152 ? 16.239  2.330   -56.437 1.00 29.97  ? 152  ARG B NH2 1 
ATOM   5361 N N   . VAL B 1 153 ? 13.029  -1.692  -49.966 1.00 29.42  ? 153  VAL B N   1 
ATOM   5362 C CA  . VAL B 1 153 ? 13.450  -1.964  -48.592 1.00 29.64  ? 153  VAL B CA  1 
ATOM   5363 C C   . VAL B 1 153 ? 14.552  -3.051  -48.560 1.00 38.86  ? 153  VAL B C   1 
ATOM   5364 O O   . VAL B 1 153 ? 14.917  -3.633  -49.608 1.00 38.99  ? 153  VAL B O   1 
ATOM   5365 C CB  . VAL B 1 153 ? 12.233  -2.360  -47.728 1.00 38.80  ? 153  VAL B CB  1 
ATOM   5366 C CG1 . VAL B 1 153 ? 11.253  -1.156  -47.576 1.00 27.28  ? 153  VAL B CG1 1 
ATOM   5367 C CG2 . VAL B 1 153 ? 11.499  -3.530  -48.363 1.00 36.77  ? 153  VAL B CG2 1 
ATOM   5368 N N   . GLY B 1 154 ? 15.088  -3.308  -47.369 1.00 38.64  ? 154  GLY B N   1 
ATOM   5369 C CA  . GLY B 1 154 ? 16.147  -4.299  -47.177 1.00 35.66  ? 154  GLY B CA  1 
ATOM   5370 C C   . GLY B 1 154 ? 17.382  -4.043  -48.029 1.00 36.63  ? 154  GLY B C   1 
ATOM   5371 O O   . GLY B 1 154 ? 17.720  -2.888  -48.329 1.00 36.99  ? 154  GLY B O   1 
ATOM   5372 N N   . THR B 1 155 ? 18.068  -5.120  -48.418 1.00 36.53  ? 155  THR B N   1 
ATOM   5373 C CA  . THR B 1 155 ? 19.230  -4.996  -49.287 1.00 42.53  ? 155  THR B CA  1 
ATOM   5374 C C   . THR B 1 155 ? 18.900  -4.222  -50.579 1.00 41.12  ? 155  THR B C   1 
ATOM   5375 O O   . THR B 1 155 ? 19.666  -3.354  -51.017 1.00 38.28  ? 155  THR B O   1 
ATOM   5376 C CB  . THR B 1 155 ? 19.812  -6.375  -49.662 1.00 45.26  ? 155  THR B CB  1 
ATOM   5377 O OG1 . THR B 1 155 ? 18.837  -7.107  -50.403 1.00 46.35  ? 155  THR B OG1 1 
ATOM   5378 C CG2 . THR B 1 155 ? 20.178  -7.167  -48.418 1.00 39.91  ? 155  THR B CG2 1 
ATOM   5379 N N   . PHE B 1 156 ? 17.755  -4.519  -51.183 1.00 38.31  ? 156  PHE B N   1 
ATOM   5380 C CA  . PHE B 1 156 ? 17.389  -3.868  -52.442 1.00 41.09  ? 156  PHE B CA  1 
ATOM   5381 C C   . PHE B 1 156 ? 17.360  -2.359  -52.316 1.00 36.68  ? 156  PHE B C   1 
ATOM   5382 O O   . PHE B 1 156 ? 17.668  -1.650  -53.267 1.00 35.97  ? 156  PHE B O   1 
ATOM   5383 C CB  . PHE B 1 156 ? 16.043  -4.411  -52.957 1.00 39.45  ? 156  PHE B CB  1 
ATOM   5384 C CG  . PHE B 1 156 ? 15.984  -5.902  -52.915 1.00 44.03  ? 156  PHE B CG  1 
ATOM   5385 C CD1 . PHE B 1 156 ? 16.614  -6.662  -53.914 1.00 38.54  ? 156  PHE B CD1 1 
ATOM   5386 C CD2 . PHE B 1 156 ? 15.397  -6.552  -51.834 1.00 36.84  ? 156  PHE B CD2 1 
ATOM   5387 C CE1 . PHE B 1 156 ? 16.603  -8.039  -53.855 1.00 44.08  ? 156  PHE B CE1 1 
ATOM   5388 C CE2 . PHE B 1 156 ? 15.395  -7.934  -51.762 1.00 40.17  ? 156  PHE B CE2 1 
ATOM   5389 C CZ  . PHE B 1 156 ? 16.000  -8.681  -52.770 1.00 46.29  ? 156  PHE B CZ  1 
ATOM   5390 N N   . GLY B 1 157 ? 16.986  -1.868  -51.140 1.00 34.48  ? 157  GLY B N   1 
ATOM   5391 C CA  . GLY B 1 157 ? 16.866  -0.436  -50.936 1.00 39.77  ? 157  GLY B CA  1 
ATOM   5392 C C   . GLY B 1 157 ? 18.046  0.210   -50.223 1.00 38.55  ? 157  GLY B C   1 
ATOM   5393 O O   . GLY B 1 157 ? 18.267  1.412   -50.369 1.00 33.23  ? 157  GLY B O   1 
ATOM   5394 N N   . PHE B 1 158 ? 18.810  -0.573  -49.456 1.00 36.08  ? 158  PHE B N   1 
ATOM   5395 C CA  . PHE B 1 158 ? 19.775  0.042   -48.530 1.00 44.38  ? 158  PHE B CA  1 
ATOM   5396 C C   . PHE B 1 158 ? 21.144  -0.616  -48.430 1.00 43.50  ? 158  PHE B C   1 
ATOM   5397 O O   . PHE B 1 158 ? 22.025  -0.109  -47.728 1.00 45.80  ? 158  PHE B O   1 
ATOM   5398 C CB  . PHE B 1 158 ? 19.144  0.285   -47.129 1.00 30.72  ? 158  PHE B CB  1 
ATOM   5399 C CG  . PHE B 1 158 ? 17.961  1.219   -47.179 1.00 32.23  ? 158  PHE B CG  1 
ATOM   5400 C CD1 . PHE B 1 158 ? 18.153  2.585   -47.276 1.00 33.97  ? 158  PHE B CD1 1 
ATOM   5401 C CD2 . PHE B 1 158 ? 16.660  0.722   -47.215 1.00 34.64  ? 158  PHE B CD2 1 
ATOM   5402 C CE1 . PHE B 1 158 ? 17.073  3.441   -47.382 1.00 28.80  ? 158  PHE B CE1 1 
ATOM   5403 C CE2 . PHE B 1 158 ? 15.573  1.571   -47.310 1.00 32.94  ? 158  PHE B CE2 1 
ATOM   5404 C CZ  . PHE B 1 158 ? 15.781  2.932   -47.404 1.00 36.31  ? 158  PHE B CZ  1 
ATOM   5405 N N   . LEU B 1 159 ? 21.344  -1.723  -49.136 1.00 40.31  ? 159  LEU B N   1 
ATOM   5406 C CA  . LEU B 1 159 ? 22.689  -2.278  -49.205 1.00 45.39  ? 159  LEU B CA  1 
ATOM   5407 C C   . LEU B 1 159 ? 23.638  -1.285  -49.894 1.00 49.23  ? 159  LEU B C   1 
ATOM   5408 O O   . LEU B 1 159 ? 23.317  -0.718  -50.939 1.00 48.44  ? 159  LEU B O   1 
ATOM   5409 C CB  . LEU B 1 159 ? 22.700  -3.625  -49.903 1.00 43.12  ? 159  LEU B CB  1 
ATOM   5410 C CG  . LEU B 1 159 ? 24.072  -4.302  -49.975 1.00 43.88  ? 159  LEU B CG  1 
ATOM   5411 C CD1 . LEU B 1 159 ? 23.951  -5.807  -49.751 1.00 41.88  ? 159  LEU B CD1 1 
ATOM   5412 C CD2 . LEU B 1 159 ? 24.717  -3.986  -51.323 1.00 45.45  ? 159  LEU B CD2 1 
ATOM   5413 N N   . ALA B 1 160 ? 24.805  -1.078  -49.297 1.00 47.99  ? 160  ALA B N   1 
ATOM   5414 C CA  . ALA B 1 160 ? 25.697  -0.012  -49.718 1.00 42.68  ? 160  ALA B CA  1 
ATOM   5415 C C   . ALA B 1 160 ? 27.168  -0.431  -49.649 1.00 44.14  ? 160  ALA B C   1 
ATOM   5416 O O   . ALA B 1 160 ? 27.624  -0.937  -48.638 1.00 43.49  ? 160  ALA B O   1 
ATOM   5417 C CB  . ALA B 1 160 ? 25.489  1.191   -48.829 1.00 39.74  ? 160  ALA B CB  1 
ATOM   5418 N N   . LEU B 1 161 ? 27.906  -0.190  -50.722 1.00 42.45  ? 161  LEU B N   1 
ATOM   5419 C CA  . LEU B 1 161 ? 29.363  -0.196  -50.643 1.00 48.22  ? 161  LEU B CA  1 
ATOM   5420 C C   . LEU B 1 161 ? 29.796  1.242   -50.840 1.00 46.46  ? 161  LEU B C   1 
ATOM   5421 O O   . LEU B 1 161 ? 30.006  1.691   -51.968 1.00 50.24  ? 161  LEU B O   1 
ATOM   5422 C CB  . LEU B 1 161 ? 29.956  -1.157  -51.674 1.00 49.33  ? 161  LEU B CB  1 
ATOM   5423 C CG  . LEU B 1 161 ? 29.584  -2.547  -51.148 1.00 55.30  ? 161  LEU B CG  1 
ATOM   5424 C CD1 . LEU B 1 161 ? 28.996  -3.451  -52.185 1.00 64.84  ? 161  LEU B CD1 1 
ATOM   5425 C CD2 . LEU B 1 161 ? 30.749  -3.205  -50.407 1.00 54.86  ? 161  LEU B CD2 1 
ATOM   5426 N N   . PRO B 1 162 ? 29.884  1.985   -49.729 1.00 45.81  ? 162  PRO B N   1 
ATOM   5427 C CA  . PRO B 1 162 ? 29.974  3.450   -49.788 1.00 49.73  ? 162  PRO B CA  1 
ATOM   5428 C C   . PRO B 1 162 ? 31.155  3.866   -50.637 1.00 53.54  ? 162  PRO B C   1 
ATOM   5429 O O   . PRO B 1 162 ? 32.231  3.271   -50.527 1.00 52.98  ? 162  PRO B O   1 
ATOM   5430 C CB  . PRO B 1 162 ? 30.158  3.857   -48.318 1.00 50.85  ? 162  PRO B CB  1 
ATOM   5431 C CG  . PRO B 1 162 ? 29.580  2.715   -47.537 1.00 47.64  ? 162  PRO B CG  1 
ATOM   5432 C CD  . PRO B 1 162 ? 29.913  1.482   -48.346 1.00 44.50  ? 162  PRO B CD  1 
ATOM   5433 N N   . GLY B 1 163 ? 30.944  4.843   -51.510 1.00 53.62  ? 163  GLY B N   1 
ATOM   5434 C CA  . GLY B 1 163 ? 31.967  5.209   -52.471 1.00 58.26  ? 163  GLY B CA  1 
ATOM   5435 C C   . GLY B 1 163 ? 31.855  4.493   -53.810 1.00 59.17  ? 163  GLY B C   1 
ATOM   5436 O O   . GLY B 1 163 ? 32.347  4.991   -54.823 1.00 59.15  ? 163  GLY B O   1 
ATOM   5437 N N   . SER B 1 164 ? 31.208  3.331   -53.836 1.00 55.18  ? 164  SER B N   1 
ATOM   5438 C CA  . SER B 1 164 ? 31.052  2.610   -55.097 1.00 51.93  ? 164  SER B CA  1 
ATOM   5439 C C   . SER B 1 164 ? 30.088  3.345   -56.010 1.00 55.86  ? 164  SER B C   1 
ATOM   5440 O O   . SER B 1 164 ? 29.286  4.171   -55.560 1.00 57.93  ? 164  SER B O   1 
ATOM   5441 C CB  . SER B 1 164 ? 30.555  1.189   -54.865 1.00 51.31  ? 164  SER B CB  1 
ATOM   5442 O OG  . SER B 1 164 ? 29.175  1.179   -54.543 1.00 51.61  ? 164  SER B OG  1 
ATOM   5443 N N   . ARG B 1 165 ? 30.175  3.048   -57.298 1.00 60.00  ? 165  ARG B N   1 
ATOM   5444 C CA  . ARG B 1 165 ? 29.308  3.677   -58.275 1.00 63.68  ? 165  ARG B CA  1 
ATOM   5445 C C   . ARG B 1 165 ? 27.958  2.957   -58.323 1.00 58.92  ? 165  ARG B C   1 
ATOM   5446 O O   . ARG B 1 165 ? 26.910  3.579   -58.507 1.00 62.30  ? 165  ARG B O   1 
ATOM   5447 C CB  . ARG B 1 165 ? 29.970  3.650   -59.657 1.00 72.70  ? 165  ARG B CB  1 
ATOM   5448 C CG  . ARG B 1 165 ? 29.275  4.541   -60.674 1.00 89.02  ? 165  ARG B CG  1 
ATOM   5449 C CD  . ARG B 1 165 ? 29.557  4.109   -62.108 1.00 103.54 ? 165  ARG B CD  1 
ATOM   5450 N NE  . ARG B 1 165 ? 28.597  4.695   -63.045 1.00 112.85 ? 165  ARG B NE  1 
ATOM   5451 C CZ  . ARG B 1 165 ? 27.360  4.237   -63.236 1.00 116.04 ? 165  ARG B CZ  1 
ATOM   5452 N NH1 . ARG B 1 165 ? 26.921  3.183   -62.557 1.00 114.20 ? 165  ARG B NH1 1 
ATOM   5453 N NH2 . ARG B 1 165 ? 26.558  4.835   -64.108 1.00 117.15 ? 165  ARG B NH2 1 
ATOM   5454 N N   . GLU B 1 166 ? 27.995  1.643   -58.132 1.00 52.92  ? 166  GLU B N   1 
ATOM   5455 C CA  . GLU B 1 166 ? 26.850  0.796   -58.436 1.00 61.84  ? 166  GLU B CA  1 
ATOM   5456 C C   . GLU B 1 166 ? 26.029  0.374   -57.219 1.00 58.33  ? 166  GLU B C   1 
ATOM   5457 O O   . GLU B 1 166 ? 24.953  -0.204  -57.384 1.00 52.36  ? 166  GLU B O   1 
ATOM   5458 C CB  . GLU B 1 166 ? 27.300  -0.437  -59.225 1.00 70.72  ? 166  GLU B CB  1 
ATOM   5459 C CG  . GLU B 1 166 ? 28.507  -1.131  -58.629 1.00 83.89  ? 166  GLU B CG  1 
ATOM   5460 C CD  . GLU B 1 166 ? 29.829  -0.618  -59.184 1.00 89.29  ? 166  GLU B CD  1 
ATOM   5461 O OE1 . GLU B 1 166 ? 30.022  -0.693  -60.419 1.00 91.30  ? 166  GLU B OE1 1 
ATOM   5462 O OE2 . GLU B 1 166 ? 30.676  -0.163  -58.381 1.00 83.12  ? 166  GLU B OE2 1 
ATOM   5463 N N   . ALA B 1 167 ? 26.542  0.646   -56.016 1.00 49.25  ? 167  ALA B N   1 
ATOM   5464 C CA  . ALA B 1 167 ? 25.774  0.475   -54.781 1.00 47.21  ? 167  ALA B CA  1 
ATOM   5465 C C   . ALA B 1 167 ? 26.086  1.601   -53.788 1.00 50.44  ? 167  ALA B C   1 
ATOM   5466 O O   . ALA B 1 167 ? 26.690  1.368   -52.736 1.00 51.70  ? 167  ALA B O   1 
ATOM   5467 C CB  . ALA B 1 167 ? 26.067  -0.881  -54.157 1.00 41.55  ? 167  ALA B CB  1 
ATOM   5468 N N   . PRO B 1 168 ? 25.700  2.832   -54.136 1.00 46.98  ? 168  PRO B N   1 
ATOM   5469 C CA  . PRO B 1 168 ? 26.018  4.022   -53.331 1.00 45.37  ? 168  PRO B CA  1 
ATOM   5470 C C   . PRO B 1 168 ? 25.302  4.068   -51.977 1.00 45.94  ? 168  PRO B C   1 
ATOM   5471 O O   . PRO B 1 168 ? 25.725  4.810   -51.102 1.00 46.89  ? 168  PRO B O   1 
ATOM   5472 C CB  . PRO B 1 168 ? 25.518  5.177   -54.214 1.00 43.78  ? 168  PRO B CB  1 
ATOM   5473 C CG  . PRO B 1 168 ? 24.455  4.529   -55.109 1.00 40.63  ? 168  PRO B CG  1 
ATOM   5474 C CD  . PRO B 1 168 ? 25.089  3.196   -55.428 1.00 43.73  ? 168  PRO B CD  1 
ATOM   5475 N N   . GLY B 1 169 ? 24.226  3.302   -51.810 1.00 45.22  ? 169  GLY B N   1 
ATOM   5476 C CA  . GLY B 1 169 ? 23.440  3.374   -50.589 1.00 40.56  ? 169  GLY B CA  1 
ATOM   5477 C C   . GLY B 1 169 ? 22.308  4.395   -50.674 1.00 37.59  ? 169  GLY B C   1 
ATOM   5478 O O   . GLY B 1 169 ? 22.254  5.216   -51.605 1.00 41.01  ? 169  GLY B O   1 
ATOM   5479 N N   . ASN B 1 170 ? 21.392  4.323   -49.715 1.00 35.21  ? 170  ASN B N   1 
ATOM   5480 C CA  . ASN B 1 170 ? 20.230  5.220   -49.664 1.00 37.94  ? 170  ASN B CA  1 
ATOM   5481 C C   . ASN B 1 170 ? 19.301  5.231   -50.891 1.00 39.33  ? 170  ASN B C   1 
ATOM   5482 O O   . ASN B 1 170 ? 18.526  6.180   -51.077 1.00 40.76  ? 170  ASN B O   1 
ATOM   5483 C CB  . ASN B 1 170 ? 20.708  6.637   -49.342 1.00 39.41  ? 170  ASN B CB  1 
ATOM   5484 C CG  . ASN B 1 170 ? 21.461  6.696   -48.020 1.00 42.86  ? 170  ASN B CG  1 
ATOM   5485 O OD1 . ASN B 1 170 ? 21.165  5.936   -47.115 1.00 42.04  ? 170  ASN B OD1 1 
ATOM   5486 N ND2 . ASN B 1 170 ? 22.446  7.582   -47.915 1.00 42.53  ? 170  ASN B ND2 1 
ATOM   5487 N N   . VAL B 1 171 ? 19.347  4.191   -51.725 1.00 37.33  ? 171  VAL B N   1 
ATOM   5488 C CA  . VAL B 1 171 ? 18.559  4.237   -52.951 1.00 33.69  ? 171  VAL B CA  1 
ATOM   5489 C C   . VAL B 1 171 ? 17.058  4.155   -52.658 1.00 39.59  ? 171  VAL B C   1 
ATOM   5490 O O   . VAL B 1 171 ? 16.250  4.739   -53.376 1.00 41.10  ? 171  VAL B O   1 
ATOM   5491 C CB  . VAL B 1 171 ? 19.005  3.213   -54.030 1.00 38.00  ? 171  VAL B CB  1 
ATOM   5492 C CG1 . VAL B 1 171 ? 20.522  3.286   -54.260 1.00 34.64  ? 171  VAL B CG1 1 
ATOM   5493 C CG2 . VAL B 1 171 ? 18.529  1.788   -53.701 1.00 29.34  ? 171  VAL B CG2 1 
ATOM   5494 N N   . GLY B 1 172 ? 16.694  3.454   -51.588 1.00 38.75  ? 172  GLY B N   1 
ATOM   5495 C CA  . GLY B 1 172 ? 15.326  3.488   -51.087 1.00 30.43  ? 172  GLY B CA  1 
ATOM   5496 C C   . GLY B 1 172 ? 14.849  4.894   -50.723 1.00 34.90  ? 172  GLY B C   1 
ATOM   5497 O O   . GLY B 1 172 ? 13.680  5.217   -50.928 1.00 35.83  ? 172  GLY B O   1 
ATOM   5498 N N   . LEU B 1 173 ? 15.737  5.745   -50.187 1.00 38.05  ? 173  LEU B N   1 
ATOM   5499 C CA  . LEU B 1 173 ? 15.365  7.147   -49.934 1.00 30.53  ? 173  LEU B CA  1 
ATOM   5500 C C   . LEU B 1 173 ? 15.281  7.945   -51.243 1.00 36.81  ? 173  LEU B C   1 
ATOM   5501 O O   . LEU B 1 173 ? 14.432  8.846   -51.397 1.00 37.02  ? 173  LEU B O   1 
ATOM   5502 C CB  . LEU B 1 173 ? 16.322  7.834   -48.931 1.00 26.47  ? 173  LEU B CB  1 
ATOM   5503 C CG  . LEU B 1 173 ? 16.314  7.340   -47.473 1.00 36.74  ? 173  LEU B CG  1 
ATOM   5504 C CD1 . LEU B 1 173 ? 17.495  7.895   -46.680 1.00 33.68  ? 173  LEU B CD1 1 
ATOM   5505 C CD2 . LEU B 1 173 ? 15.018  7.695   -46.769 1.00 33.15  ? 173  LEU B CD2 1 
ATOM   5506 N N   . LEU B 1 174 ? 16.161  7.624   -52.187 1.00 32.23  ? 174  LEU B N   1 
ATOM   5507 C CA  . LEU B 1 174 ? 16.035  8.173   -53.545 1.00 35.60  ? 174  LEU B CA  1 
ATOM   5508 C C   . LEU B 1 174 ? 14.706  7.784   -54.224 1.00 35.63  ? 174  LEU B C   1 
ATOM   5509 O O   . LEU B 1 174 ? 14.145  8.579   -54.967 1.00 32.68  ? 174  LEU B O   1 
ATOM   5510 C CB  . LEU B 1 174 ? 17.238  7.800   -54.425 1.00 36.05  ? 174  LEU B CB  1 
ATOM   5511 C CG  . LEU B 1 174 ? 18.535  8.428   -53.887 1.00 43.11  ? 174  LEU B CG  1 
ATOM   5512 C CD1 . LEU B 1 174 ? 19.769  7.921   -54.621 1.00 39.25  ? 174  LEU B CD1 1 
ATOM   5513 C CD2 . LEU B 1 174 ? 18.454  9.941   -53.944 1.00 34.48  ? 174  LEU B CD2 1 
ATOM   5514 N N   . ASP B 1 175 ? 14.190  6.583   -53.956 1.00 35.76  ? 175  ASP B N   1 
ATOM   5515 C CA  . ASP B 1 175 ? 12.903  6.205   -54.534 1.00 33.79  ? 175  ASP B CA  1 
ATOM   5516 C C   . ASP B 1 175 ? 11.852  7.180   -54.006 1.00 36.10  ? 175  ASP B C   1 
ATOM   5517 O O   . ASP B 1 175 ? 11.054  7.722   -54.775 1.00 35.94  ? 175  ASP B O   1 
ATOM   5518 C CB  . ASP B 1 175 ? 12.500  4.780   -54.145 1.00 28.79  ? 175  ASP B CB  1 
ATOM   5519 C CG  . ASP B 1 175 ? 13.431  3.715   -54.709 1.00 33.69  ? 175  ASP B CG  1 
ATOM   5520 O OD1 . ASP B 1 175 ? 14.172  4.000   -55.677 1.00 35.01  ? 175  ASP B OD1 1 
ATOM   5521 O OD2 . ASP B 1 175 ? 13.407  2.576   -54.175 1.00 35.64  ? 175  ASP B OD2 1 
ATOM   5522 N N   . GLN B 1 176 ? 11.864  7.398   -52.689 1.00 34.39  ? 176  GLN B N   1 
ATOM   5523 C CA  . GLN B 1 176 ? 10.919  8.302   -52.047 1.00 31.77  ? 176  GLN B CA  1 
ATOM   5524 C C   . GLN B 1 176 ? 11.013  9.680   -52.676 1.00 35.98  ? 176  GLN B C   1 
ATOM   5525 O O   . GLN B 1 176 ? 9.993   10.307  -52.988 1.00 32.04  ? 176  GLN B O   1 
ATOM   5526 C CB  . GLN B 1 176 ? 11.226  8.424   -50.550 1.00 32.84  ? 176  GLN B CB  1 
ATOM   5527 C CG  . GLN B 1 176 ? 10.882  7.196   -49.748 1.00 32.99  ? 176  GLN B CG  1 
ATOM   5528 C CD  . GLN B 1 176 ? 11.412  7.264   -48.334 1.00 33.94  ? 176  GLN B CD  1 
ATOM   5529 O OE1 . GLN B 1 176 ? 11.733  8.344   -47.839 1.00 34.42  ? 176  GLN B OE1 1 
ATOM   5530 N NE2 . GLN B 1 176 ? 11.505  6.102   -47.671 1.00 30.99  ? 176  GLN B NE2 1 
ATOM   5531 N N   . ARG B 1 177 ? 12.245  10.167  -52.817 1.00 29.14  ? 177  ARG B N   1 
ATOM   5532 C CA  . ARG B 1 177 ? 12.493  11.494  -53.377 1.00 32.97  ? 177  ARG B CA  1 
ATOM   5533 C C   . ARG B 1 177 ? 11.979  11.623  -54.816 1.00 38.35  ? 177  ARG B C   1 
ATOM   5534 O O   . ARG B 1 177 ? 11.398  12.651  -55.190 1.00 36.10  ? 177  ARG B O   1 
ATOM   5535 C CB  . ARG B 1 177 ? 13.989  11.850  -53.323 1.00 29.17  ? 177  ARG B CB  1 
ATOM   5536 C CG  . ARG B 1 177 ? 14.336  13.132  -54.090 1.00 36.96  ? 177  ARG B CG  1 
ATOM   5537 C CD  . ARG B 1 177 ? 15.834  13.433  -54.017 1.00 35.07  ? 177  ARG B CD  1 
ATOM   5538 N NE  . ARG B 1 177 ? 16.167  13.856  -52.668 1.00 42.67  ? 177  ARG B NE  1 
ATOM   5539 C CZ  . ARG B 1 177 ? 17.399  13.904  -52.167 1.00 46.65  ? 177  ARG B CZ  1 
ATOM   5540 N NH1 . ARG B 1 177 ? 18.448  13.544  -52.914 1.00 48.56  ? 177  ARG B NH1 1 
ATOM   5541 N NH2 . ARG B 1 177 ? 17.578  14.318  -50.917 1.00 36.80  ? 177  ARG B NH2 1 
ATOM   5542 N N   . LEU B 1 178 ? 12.194  10.583  -55.619 1.00 35.48  ? 178  LEU B N   1 
ATOM   5543 C CA  . LEU B 1 178 ? 11.697  10.587  -56.992 1.00 37.41  ? 178  LEU B CA  1 
ATOM   5544 C C   . LEU B 1 178 ? 10.164  10.697  -56.999 1.00 35.85  ? 178  LEU B C   1 
ATOM   5545 O O   . LEU B 1 178 ? 9.593   11.425  -57.813 1.00 35.47  ? 178  LEU B O   1 
ATOM   5546 C CB  . LEU B 1 178 ? 12.185  9.354   -57.775 1.00 33.50  ? 178  LEU B CB  1 
ATOM   5547 C CG  . LEU B 1 178 ? 11.823  9.296   -59.264 1.00 39.64  ? 178  LEU B CG  1 
ATOM   5548 C CD1 . LEU B 1 178 ? 12.355  10.506  -59.985 1.00 37.15  ? 178  LEU B CD1 1 
ATOM   5549 C CD2 . LEU B 1 178 ? 12.346  8.003   -59.930 1.00 36.99  ? 178  LEU B CD2 1 
ATOM   5550 N N   . ALA B 1 179 ? 9.509   9.994   -56.077 1.00 33.32  ? 179  ALA B N   1 
ATOM   5551 C CA  . ALA B 1 179 ? 8.054   10.091  -55.923 1.00 36.12  ? 179  ALA B CA  1 
ATOM   5552 C C   . ALA B 1 179 ? 7.634   11.506  -55.523 1.00 32.13  ? 179  ALA B C   1 
ATOM   5553 O O   . ALA B 1 179 ? 6.666   12.037  -56.053 1.00 39.79  ? 179  ALA B O   1 
ATOM   5554 C CB  . ALA B 1 179 ? 7.540   9.061   -54.906 1.00 30.56  ? 179  ALA B CB  1 
ATOM   5555 N N   . LEU B 1 180 ? 8.375   12.120  -54.600 1.00 35.69  ? 180  LEU B N   1 
ATOM   5556 C CA  . LEU B 1 180 ? 8.174   13.541  -54.248 1.00 38.50  ? 180  LEU B CA  1 
ATOM   5557 C C   . LEU B 1 180 ? 8.285   14.477  -55.474 1.00 37.44  ? 180  LEU B C   1 
ATOM   5558 O O   . LEU B 1 180 ? 7.486   15.401  -55.620 1.00 38.57  ? 180  LEU B O   1 
ATOM   5559 C CB  . LEU B 1 180 ? 9.154   13.990  -53.127 1.00 26.73  ? 180  LEU B CB  1 
ATOM   5560 C CG  . LEU B 1 180 ? 8.747   13.816  -51.648 1.00 35.62  ? 180  LEU B CG  1 
ATOM   5561 C CD1 . LEU B 1 180 ? 7.973   12.533  -51.369 1.00 40.26  ? 180  LEU B CD1 1 
ATOM   5562 C CD2 . LEU B 1 180 ? 9.937   13.962  -50.675 1.00 36.32  ? 180  LEU B CD2 1 
ATOM   5563 N N   . GLN B 1 181 ? 9.283   14.250  -56.336 1.00 41.40  ? 181  GLN B N   1 
ATOM   5564 C CA  . GLN B 1 181 ? 9.450   15.023  -57.584 1.00 40.51  ? 181  GLN B CA  1 
ATOM   5565 C C   . GLN B 1 181 ? 8.231   14.813  -58.485 1.00 42.06  ? 181  GLN B C   1 
ATOM   5566 O O   . GLN B 1 181 ? 7.689   15.757  -59.078 1.00 36.99  ? 181  GLN B O   1 
ATOM   5567 C CB  . GLN B 1 181 ? 10.728  14.607  -58.337 1.00 50.19  ? 181  GLN B CB  1 
ATOM   5568 C CG  . GLN B 1 181 ? 11.987  15.440  -58.016 1.00 62.96  ? 181  GLN B CG  1 
ATOM   5569 C CD  . GLN B 1 181 ? 13.304  14.617  -57.985 1.00 75.19  ? 181  GLN B CD  1 
ATOM   5570 O OE1 . GLN B 1 181 ? 13.361  13.466  -58.434 1.00 76.20  ? 181  GLN B OE1 1 
ATOM   5571 N NE2 . GLN B 1 181 ? 14.356  15.217  -57.441 1.00 66.32  ? 181  GLN B NE2 1 
ATOM   5572 N N   . TRP B 1 182 ? 7.791   13.564  -58.559 1.00 35.77  ? 182  TRP B N   1 
ATOM   5573 C CA  . TRP B 1 182 ? 6.633   13.214  -59.359 1.00 40.08  ? 182  TRP B CA  1 
ATOM   5574 C C   . TRP B 1 182 ? 5.411   14.003  -58.893 1.00 36.61  ? 182  TRP B C   1 
ATOM   5575 O O   . TRP B 1 182 ? 4.664   14.537  -59.716 1.00 41.99  ? 182  TRP B O   1 
ATOM   5576 C CB  . TRP B 1 182 ? 6.378   11.702  -59.310 1.00 34.17  ? 182  TRP B CB  1 
ATOM   5577 C CG  . TRP B 1 182 ? 5.298   11.256  -60.223 1.00 40.80  ? 182  TRP B CG  1 
ATOM   5578 C CD1 . TRP B 1 182 ? 5.448   10.726  -61.487 1.00 37.11  ? 182  TRP B CD1 1 
ATOM   5579 C CD2 . TRP B 1 182 ? 3.890   11.287  -59.966 1.00 41.08  ? 182  TRP B CD2 1 
ATOM   5580 N NE1 . TRP B 1 182 ? 4.219   10.431  -62.015 1.00 39.50  ? 182  TRP B NE1 1 
ATOM   5581 C CE2 . TRP B 1 182 ? 3.247   10.764  -61.107 1.00 44.95  ? 182  TRP B CE2 1 
ATOM   5582 C CE3 . TRP B 1 182 ? 3.108   11.706  -58.880 1.00 37.12  ? 182  TRP B CE3 1 
ATOM   5583 C CZ2 . TRP B 1 182 ? 1.865   10.643  -61.190 1.00 47.04  ? 182  TRP B CZ2 1 
ATOM   5584 C CZ3 . TRP B 1 182 ? 1.741   11.585  -58.964 1.00 35.22  ? 182  TRP B CZ3 1 
ATOM   5585 C CH2 . TRP B 1 182 ? 1.129   11.062  -60.108 1.00 42.31  ? 182  TRP B CH2 1 
ATOM   5586 N N   . VAL B 1 183 ? 5.223   14.087  -57.580 1.00 37.19  ? 183  VAL B N   1 
ATOM   5587 C CA  . VAL B 1 183 ? 4.140   14.895  -57.024 1.00 38.99  ? 183  VAL B CA  1 
ATOM   5588 C C   . VAL B 1 183 ? 4.244   16.373  -57.466 1.00 41.69  ? 183  VAL B C   1 
ATOM   5589 O O   . VAL B 1 183 ? 3.249   16.977  -57.892 1.00 36.48  ? 183  VAL B O   1 
ATOM   5590 C CB  . VAL B 1 183 ? 4.034   14.762  -55.481 1.00 34.15  ? 183  VAL B CB  1 
ATOM   5591 C CG1 . VAL B 1 183 ? 3.109   15.889  -54.877 1.00 28.63  ? 183  VAL B CG1 1 
ATOM   5592 C CG2 . VAL B 1 183 ? 3.518   13.375  -55.130 1.00 29.03  ? 183  VAL B CG2 1 
ATOM   5593 N N   . GLN B 1 184 ? 5.443   16.942  -57.396 1.00 34.90  ? 184  GLN B N   1 
ATOM   5594 C CA  . GLN B 1 184 ? 5.636   18.328  -57.851 1.00 38.01  ? 184  GLN B CA  1 
ATOM   5595 C C   . GLN B 1 184 ? 5.198   18.532  -59.300 1.00 42.92  ? 184  GLN B C   1 
ATOM   5596 O O   . GLN B 1 184 ? 4.498   19.506  -59.614 1.00 39.39  ? 184  GLN B O   1 
ATOM   5597 C CB  . GLN B 1 184 ? 7.096   18.766  -57.672 1.00 34.60  ? 184  GLN B CB  1 
ATOM   5598 C CG  . GLN B 1 184 ? 7.461   19.004  -56.236 1.00 42.22  ? 184  GLN B CG  1 
ATOM   5599 C CD  . GLN B 1 184 ? 6.652   20.152  -55.656 1.00 47.07  ? 184  GLN B CD  1 
ATOM   5600 O OE1 . GLN B 1 184 ? 6.723   21.276  -56.147 1.00 49.83  ? 184  GLN B OE1 1 
ATOM   5601 N NE2 . GLN B 1 184 ? 5.865   19.869  -54.633 1.00 41.98  ? 184  GLN B NE2 1 
ATOM   5602 N N   . GLU B 1 185 ? 5.600   17.606  -60.174 1.00 40.06  ? 185  GLU B N   1 
ATOM   5603 C CA  . GLU B 1 185 ? 5.358   17.752  -61.613 1.00 46.69  ? 185  GLU B CA  1 
ATOM   5604 C C   . GLU B 1 185 ? 3.935   17.398  -62.050 1.00 44.18  ? 185  GLU B C   1 
ATOM   5605 O O   . GLU B 1 185 ? 3.494   17.848  -63.101 1.00 48.05  ? 185  GLU B O   1 
ATOM   5606 C CB  . GLU B 1 185 ? 6.331   16.882  -62.426 1.00 50.30  ? 185  GLU B CB  1 
ATOM   5607 C CG  . GLU B 1 185 ? 7.794   17.183  -62.185 1.00 65.28  ? 185  GLU B CG  1 
ATOM   5608 C CD  . GLU B 1 185 ? 8.721   16.145  -62.800 1.00 75.39  ? 185  GLU B CD  1 
ATOM   5609 O OE1 . GLU B 1 185 ? 8.227   15.202  -63.456 1.00 83.11  ? 185  GLU B OE1 1 
ATOM   5610 O OE2 . GLU B 1 185 ? 9.950   16.273  -62.620 1.00 78.76  ? 185  GLU B OE2 1 
ATOM   5611 N N   . ASN B 1 186 ? 3.231   16.575  -61.279 1.00 39.18  ? 186  ASN B N   1 
ATOM   5612 C CA  . ASN B 1 186 ? 1.981   15.989  -61.775 1.00 37.04  ? 186  ASN B CA  1 
ATOM   5613 C C   . ASN B 1 186 ? 0.753   16.173  -60.889 1.00 38.53  ? 186  ASN B C   1 
ATOM   5614 O O   . ASN B 1 186 ? -0.363  15.965  -61.337 1.00 41.39  ? 186  ASN B O   1 
ATOM   5615 C CB  . ASN B 1 186 ? 2.185   14.488  -62.032 1.00 39.75  ? 186  ASN B CB  1 
ATOM   5616 C CG  . ASN B 1 186 ? 3.219   14.221  -63.123 1.00 43.10  ? 186  ASN B CG  1 
ATOM   5617 O OD1 . ASN B 1 186 ? 3.005   14.554  -64.275 1.00 48.01  ? 186  ASN B OD1 1 
ATOM   5618 N ND2 . ASN B 1 186 ? 4.346   13.633  -62.750 1.00 43.60  ? 186  ASN B ND2 1 
ATOM   5619 N N   . ILE B 1 187 ? 0.948   16.517  -59.620 1.00 37.47  ? 187  ILE B N   1 
ATOM   5620 C CA  . ILE B 1 187 ? -0.173  16.462  -58.680 1.00 40.53  ? 187  ILE B CA  1 
ATOM   5621 C C   . ILE B 1 187 ? -1.248  17.493  -59.016 1.00 39.32  ? 187  ILE B C   1 
ATOM   5622 O O   . ILE B 1 187 ? -2.423  17.299  -58.705 1.00 45.36  ? 187  ILE B O   1 
ATOM   5623 C CB  . ILE B 1 187 ? 0.278   16.641  -57.216 1.00 40.11  ? 187  ILE B CB  1 
ATOM   5624 C CG1 . ILE B 1 187 ? -0.696  15.936  -56.259 1.00 40.23  ? 187  ILE B CG1 1 
ATOM   5625 C CG2 . ILE B 1 187 ? 0.434   18.136  -56.887 1.00 35.74  ? 187  ILE B CG2 1 
ATOM   5626 C CD1 . ILE B 1 187 ? -0.921  14.467  -56.559 1.00 37.69  ? 187  ILE B CD1 1 
ATOM   5627 N N   . ALA B 1 188 ? -0.854  18.585  -59.660 1.00 36.29  ? 188  ALA B N   1 
ATOM   5628 C CA  . ALA B 1 188 ? -1.837  19.569  -60.086 1.00 42.43  ? 188  ALA B CA  1 
ATOM   5629 C C   . ALA B 1 188 ? -2.898  18.945  -60.995 1.00 45.45  ? 188  ALA B C   1 
ATOM   5630 O O   . ALA B 1 188 ? -4.043  19.389  -60.999 1.00 48.36  ? 188  ALA B O   1 
ATOM   5631 C CB  . ALA B 1 188 ? -1.163  20.745  -60.772 1.00 46.02  ? 188  ALA B CB  1 
ATOM   5632 N N   . ALA B 1 189 ? -2.543  17.903  -61.751 1.00 43.36  ? 189  ALA B N   1 
ATOM   5633 C CA  . ALA B 1 189 ? -3.520  17.309  -62.675 1.00 45.53  ? 189  ALA B CA  1 
ATOM   5634 C C   . ALA B 1 189 ? -4.669  16.621  -61.939 1.00 44.91  ? 189  ALA B C   1 
ATOM   5635 O O   . ALA B 1 189 ? -5.723  16.354  -62.514 1.00 48.65  ? 189  ALA B O   1 
ATOM   5636 C CB  . ALA B 1 189 ? -2.845  16.329  -63.640 1.00 44.95  ? 189  ALA B CB  1 
ATOM   5637 N N   . PHE B 1 190 ? -4.457  16.329  -60.664 1.00 45.15  ? 190  PHE B N   1 
ATOM   5638 C CA  . PHE B 1 190 ? -5.451  15.649  -59.847 1.00 42.99  ? 190  PHE B CA  1 
ATOM   5639 C C   . PHE B 1 190 ? -6.148  16.672  -58.971 1.00 44.76  ? 190  PHE B C   1 
ATOM   5640 O O   . PHE B 1 190 ? -6.955  16.320  -58.115 1.00 46.90  ? 190  PHE B O   1 
ATOM   5641 C CB  . PHE B 1 190 ? -4.765  14.615  -58.938 1.00 42.19  ? 190  PHE B CB  1 
ATOM   5642 C CG  . PHE B 1 190 ? -4.033  13.536  -59.684 1.00 44.43  ? 190  PHE B CG  1 
ATOM   5643 C CD1 . PHE B 1 190 ? -2.736  13.743  -60.147 1.00 40.02  ? 190  PHE B CD1 1 
ATOM   5644 C CD2 . PHE B 1 190 ? -4.631  12.300  -59.908 1.00 46.91  ? 190  PHE B CD2 1 
ATOM   5645 C CE1 . PHE B 1 190 ? -2.061  12.739  -60.832 1.00 38.84  ? 190  PHE B CE1 1 
ATOM   5646 C CE2 . PHE B 1 190 ? -3.961  11.294  -60.607 1.00 42.20  ? 190  PHE B CE2 1 
ATOM   5647 C CZ  . PHE B 1 190 ? -2.680  11.515  -61.062 1.00 36.82  ? 190  PHE B CZ  1 
ATOM   5648 N N   . GLY B 1 191 ? -5.788  17.939  -59.144 1.00 46.29  ? 191  GLY B N   1 
ATOM   5649 C CA  . GLY B 1 191 ? -6.278  18.995  -58.270 1.00 45.44  ? 191  GLY B CA  1 
ATOM   5650 C C   . GLY B 1 191 ? -5.436  19.246  -57.024 1.00 51.63  ? 191  GLY B C   1 
ATOM   5651 O O   . GLY B 1 191 ? -5.824  20.036  -56.161 1.00 50.31  ? 191  GLY B O   1 
ATOM   5652 N N   . GLY B 1 192 ? -4.287  18.581  -56.908 1.00 46.05  ? 192  GLY B N   1 
ATOM   5653 C CA  . GLY B 1 192 ? -3.417  18.791  -55.757 1.00 35.84  ? 192  GLY B CA  1 
ATOM   5654 C C   . GLY B 1 192 ? -2.671  20.107  -55.887 1.00 44.46  ? 192  GLY B C   1 
ATOM   5655 O O   . GLY B 1 192 ? -2.443  20.569  -57.005 1.00 54.17  ? 192  GLY B O   1 
ATOM   5656 N N   . ASP B 1 193 ? -2.296  20.715  -54.760 1.00 40.92  ? 193  ASP B N   1 
ATOM   5657 C CA  . ASP B 1 193 ? -1.518  21.960  -54.759 1.00 40.86  ? 193  ASP B CA  1 
ATOM   5658 C C   . ASP B 1 193 ? -0.050  21.655  -54.474 1.00 44.60  ? 193  ASP B C   1 
ATOM   5659 O O   . ASP B 1 193 ? 0.316   21.394  -53.337 1.00 49.51  ? 193  ASP B O   1 
ATOM   5660 C CB  . ASP B 1 193 ? -2.075  22.917  -53.695 1.00 47.67  ? 193  ASP B CB  1 
ATOM   5661 C CG  . ASP B 1 193 ? -1.315  24.250  -53.622 1.00 50.40  ? 193  ASP B CG  1 
ATOM   5662 O OD1 . ASP B 1 193 ? -0.307  24.420  -54.333 1.00 47.15  ? 193  ASP B OD1 1 
ATOM   5663 O OD2 . ASP B 1 193 ? -1.733  25.132  -52.836 1.00 50.17  ? 193  ASP B OD2 1 
ATOM   5664 N N   . PRO B 1 194 ? 0.803   21.702  -55.509 1.00 47.37  ? 194  PRO B N   1 
ATOM   5665 C CA  . PRO B 1 194 ? 2.214   21.330  -55.322 1.00 41.81  ? 194  PRO B CA  1 
ATOM   5666 C C   . PRO B 1 194 ? 2.941   22.299  -54.384 1.00 39.45  ? 194  PRO B C   1 
ATOM   5667 O O   . PRO B 1 194 ? 4.024   21.993  -53.861 1.00 39.57  ? 194  PRO B O   1 
ATOM   5668 C CB  . PRO B 1 194 ? 2.811   21.429  -56.734 1.00 45.69  ? 194  PRO B CB  1 
ATOM   5669 C CG  . PRO B 1 194 ? 1.660   21.806  -57.667 1.00 44.46  ? 194  PRO B CG  1 
ATOM   5670 C CD  . PRO B 1 194 ? 0.534   22.298  -56.833 1.00 42.23  ? 194  PRO B CD  1 
ATOM   5671 N N   . MET B 1 195 ? 2.351   23.467  -54.172 1.00 42.06  ? 195  MET B N   1 
ATOM   5672 C CA  . MET B 1 195 ? 2.902   24.429  -53.220 1.00 47.52  ? 195  MET B CA  1 
ATOM   5673 C C   . MET B 1 195 ? 2.445   24.191  -51.772 1.00 48.38  ? 195  MET B C   1 
ATOM   5674 O O   . MET B 1 195 ? 2.804   24.950  -50.870 1.00 46.63  ? 195  MET B O   1 
ATOM   5675 C CB  . MET B 1 195 ? 2.596   25.861  -53.654 1.00 45.73  ? 195  MET B CB  1 
ATOM   5676 C CG  . MET B 1 195 ? 3.273   26.245  -54.961 1.00 47.45  ? 195  MET B CG  1 
ATOM   5677 S SD  . MET B 1 195 ? 3.199   28.019  -55.248 1.00 76.00  ? 195  MET B SD  1 
ATOM   5678 C CE  . MET B 1 195 ? 1.435   28.266  -55.400 1.00 71.05  ? 195  MET B CE  1 
ATOM   5679 N N   . SER B 1 196 ? 1.656   23.146  -51.550 1.00 40.30  ? 196  SER B N   1 
ATOM   5680 C CA  . SER B 1 196 ? 1.338   22.751  -50.181 1.00 43.19  ? 196  SER B CA  1 
ATOM   5681 C C   . SER B 1 196 ? 1.404   21.238  -50.001 1.00 43.54  ? 196  SER B C   1 
ATOM   5682 O O   . SER B 1 196 ? 0.402   20.519  -50.125 1.00 40.08  ? 196  SER B O   1 
ATOM   5683 C CB  . SER B 1 196 ? -0.019  23.305  -49.737 1.00 51.60  ? 196  SER B CB  1 
ATOM   5684 O OG  . SER B 1 196 ? -0.348  22.823  -48.449 1.00 47.62  ? 196  SER B OG  1 
ATOM   5685 N N   . VAL B 1 197 ? 2.605   20.763  -49.700 1.00 38.16  ? 197  VAL B N   1 
ATOM   5686 C CA  . VAL B 1 197 ? 2.833   19.343  -49.569 1.00 34.24  ? 197  VAL B CA  1 
ATOM   5687 C C   . VAL B 1 197 ? 3.350   19.035  -48.174 1.00 35.56  ? 197  VAL B C   1 
ATOM   5688 O O   . VAL B 1 197 ? 4.307   19.633  -47.710 1.00 34.09  ? 197  VAL B O   1 
ATOM   5689 C CB  . VAL B 1 197 ? 3.823   18.837  -50.653 1.00 39.19  ? 197  VAL B CB  1 
ATOM   5690 C CG1 . VAL B 1 197 ? 4.249   17.404  -50.371 1.00 30.55  ? 197  VAL B CG1 1 
ATOM   5691 C CG2 . VAL B 1 197 ? 3.200   18.999  -52.072 1.00 33.30  ? 197  VAL B CG2 1 
ATOM   5692 N N   . THR B 1 198 ? 2.706   18.088  -47.515 1.00 35.51  ? 198  THR B N   1 
ATOM   5693 C CA  . THR B 1 198 ? 3.083   17.671  -46.181 1.00 31.63  ? 198  THR B CA  1 
ATOM   5694 C C   . THR B 1 198 ? 3.461   16.205  -46.211 1.00 35.53  ? 198  THR B C   1 
ATOM   5695 O O   . THR B 1 198 ? 2.664   15.368  -46.626 1.00 36.97  ? 198  THR B O   1 
ATOM   5696 C CB  . THR B 1 198 ? 1.887   17.844  -45.215 1.00 31.13  ? 198  THR B CB  1 
ATOM   5697 O OG1 . THR B 1 198 ? 1.501   19.222  -45.185 1.00 38.92  ? 198  THR B OG1 1 
ATOM   5698 C CG2 . THR B 1 198 ? 2.233   17.384  -43.792 1.00 26.39  ? 198  THR B CG2 1 
ATOM   5699 N N   . LEU B 1 199 ? 4.676   15.886  -45.780 1.00 32.78  ? 199  LEU B N   1 
ATOM   5700 C CA  . LEU B 1 199 ? 5.074   14.486  -45.620 1.00 28.65  ? 199  LEU B CA  1 
ATOM   5701 C C   . LEU B 1 199 ? 4.599   13.982  -44.264 1.00 34.34  ? 199  LEU B C   1 
ATOM   5702 O O   . LEU B 1 199 ? 4.730   14.678  -43.272 1.00 31.21  ? 199  LEU B O   1 
ATOM   5703 C CB  . LEU B 1 199 ? 6.605   14.362  -45.659 1.00 25.27  ? 199  LEU B CB  1 
ATOM   5704 C CG  . LEU B 1 199 ? 7.313   15.011  -46.845 1.00 36.53  ? 199  LEU B CG  1 
ATOM   5705 C CD1 . LEU B 1 199 ? 8.821   14.727  -46.777 1.00 31.60  ? 199  LEU B CD1 1 
ATOM   5706 C CD2 . LEU B 1 199 ? 6.722   14.474  -48.159 1.00 36.76  ? 199  LEU B CD2 1 
ATOM   5707 N N   . PHE B 1 200 ? 4.036   12.786  -44.208 1.00 34.14  ? 200  PHE B N   1 
ATOM   5708 C CA  . PHE B 1 200 ? 3.864   12.146  -42.910 1.00 32.61  ? 200  PHE B CA  1 
ATOM   5709 C C   . PHE B 1 200 ? 4.251   10.669  -42.998 1.00 39.59  ? 200  PHE B C   1 
ATOM   5710 O O   . PHE B 1 200 ? 4.120   10.052  -44.050 1.00 38.17  ? 200  PHE B O   1 
ATOM   5711 C CB  . PHE B 1 200 ? 2.478   12.414  -42.275 1.00 30.00  ? 200  PHE B CB  1 
ATOM   5712 C CG  . PHE B 1 200 ? 1.280   11.729  -42.961 1.00 35.77  ? 200  PHE B CG  1 
ATOM   5713 C CD1 . PHE B 1 200 ? 1.086   11.796  -44.333 1.00 32.66  ? 200  PHE B CD1 1 
ATOM   5714 C CD2 . PHE B 1 200 ? 0.304   11.092  -42.190 1.00 34.27  ? 200  PHE B CD2 1 
ATOM   5715 C CE1 . PHE B 1 200 ? -0.034  11.210  -44.925 1.00 37.52  ? 200  PHE B CE1 1 
ATOM   5716 C CE2 . PHE B 1 200 ? -0.806  10.501  -42.767 1.00 36.80  ? 200  PHE B CE2 1 
ATOM   5717 C CZ  . PHE B 1 200 ? -0.982  10.552  -44.138 1.00 41.07  ? 200  PHE B CZ  1 
ATOM   5718 N N   . GLY B 1 201 ? 4.780   10.130  -41.906 1.00 36.76  ? 201  GLY B N   1 
ATOM   5719 C CA  . GLY B 1 201 ? 5.192   8.742   -41.860 1.00 35.37  ? 201  GLY B CA  1 
ATOM   5720 C C   . GLY B 1 201 ? 5.290   8.239   -40.433 1.00 39.04  ? 201  GLY B C   1 
ATOM   5721 O O   . GLY B 1 201 ? 5.232   9.018   -39.489 1.00 37.61  ? 201  GLY B O   1 
ATOM   5722 N N   . GLU B 1 202 ? 5.428   6.929   -40.279 1.00 33.55  ? 202  GLU B N   1 
ATOM   5723 C CA  . GLU B 1 202 ? 5.485   6.310   -38.967 1.00 35.18  ? 202  GLU B CA  1 
ATOM   5724 C C   . GLU B 1 202 ? 6.715   5.400   -38.890 1.00 35.65  ? 202  GLU B C   1 
ATOM   5725 O O   . GLU B 1 202 ? 7.064   4.739   -39.872 1.00 35.01  ? 202  GLU B O   1 
ATOM   5726 C CB  . GLU B 1 202 ? 4.190   5.542   -38.686 1.00 34.87  ? 202  GLU B CB  1 
ATOM   5727 C CG  . GLU B 1 202 ? 4.022   5.032   -37.265 1.00 35.72  ? 202  GLU B CG  1 
ATOM   5728 C CD  . GLU B 1 202 ? 4.581   3.643   -37.104 1.00 43.00  ? 202  GLU B CD  1 
ATOM   5729 O OE1 . GLU B 1 202 ? 4.874   3.021   -38.144 1.00 40.69  ? 202  GLU B OE1 1 
ATOM   5730 O OE2 . GLU B 1 202 ? 4.728   3.172   -35.953 1.00 46.64  ? 202  GLU B OE2 1 
HETATM 5731 N N   . SBG B 1 203 ? 7.381   5.407   -37.734 1.00 30.67  ? 203  SBG B N   1 
HETATM 5732 C CA  . SBG B 1 203 ? 8.579   4.598   -37.481 1.00 30.99  ? 203  SBG B CA  1 
HETATM 5733 C CB  . SBG B 1 203 ? 8.127   3.144   -37.390 1.00 27.54  ? 203  SBG B CB  1 
HETATM 5734 O OG  . SBG B 1 203 ? 9.140   2.374   -36.756 1.00 34.25  ? 203  SBG B OG  1 
HETATM 5735 C C   . SBG B 1 203 ? 9.660   4.837   -38.542 1.00 33.72  ? 203  SBG B C   1 
HETATM 5736 O O   . SBG B 1 203 ? 10.084  5.962   -38.674 1.00 35.69  ? 203  SBG B O   1 
HETATM 5737 O O2  . SBG B 1 203 ? 9.619   1.085   -38.838 1.00 37.33  ? 203  SBG B O2  1 
HETATM 5738 P P1  . SBG B 1 203 ? 9.402   0.895   -37.351 1.00 35.96  ? 203  SBG B P1  1 
HETATM 5739 O O1  . SBG B 1 203 ? 8.347   -0.009  -36.785 1.00 39.81  ? 203  SBG B O1  1 
HETATM 5740 C C1  . SBG B 1 203 ? 11.001  0.467   -36.594 1.00 31.67  ? 203  SBG B C1  1 
ATOM   5741 N N   . ALA B 1 204 ? 10.088  3.817   -39.299 1.00 33.19  ? 204  ALA B N   1 
ATOM   5742 C CA  . ALA B 1 204 ? 11.059  4.051   -40.377 1.00 34.94  ? 204  ALA B CA  1 
ATOM   5743 C C   . ALA B 1 204 ? 10.538  5.058   -41.422 1.00 32.91  ? 204  ALA B C   1 
ATOM   5744 O O   . ALA B 1 204 ? 11.314  5.818   -42.001 1.00 30.96  ? 204  ALA B O   1 
ATOM   5745 C CB  . ALA B 1 204 ? 11.498  2.749   -41.037 1.00 35.94  ? 204  ALA B CB  1 
ATOM   5746 N N   . GLY B 1 205 ? 9.222   5.117   -41.612 1.00 31.83  ? 205  GLY B N   1 
ATOM   5747 C CA  . GLY B 1 205 ? 8.646   6.177   -42.433 1.00 28.99  ? 205  GLY B CA  1 
ATOM   5748 C C   . GLY B 1 205 ? 8.913   7.575   -41.859 1.00 31.41  ? 205  GLY B C   1 
ATOM   5749 O O   . GLY B 1 205 ? 9.193   8.524   -42.611 1.00 34.53  ? 205  GLY B O   1 
ATOM   5750 N N   . ALA B 1 206 ? 8.797   7.716   -40.534 1.00 31.62  ? 206  ALA B N   1 
ATOM   5751 C CA  . ALA B 1 206 ? 9.073   9.003   -39.854 1.00 27.73  ? 206  ALA B CA  1 
ATOM   5752 C C   . ALA B 1 206 ? 10.552  9.360   -39.938 1.00 32.72  ? 206  ALA B C   1 
ATOM   5753 O O   . ALA B 1 206 ? 10.906  10.516  -40.166 1.00 36.16  ? 206  ALA B O   1 
ATOM   5754 C CB  . ALA B 1 206 ? 8.622   8.948   -38.384 1.00 26.68  ? 206  ALA B CB  1 
ATOM   5755 N N   . ALA B 1 207 ? 11.421  8.365   -39.747 1.00 28.52  ? 207  ALA B N   1 
ATOM   5756 C CA  . ALA B 1 207 ? 12.860  8.575   -39.901 1.00 31.59  ? 207  ALA B CA  1 
ATOM   5757 C C   . ALA B 1 207 ? 13.153  9.033   -41.331 1.00 37.43  ? 207  ALA B C   1 
ATOM   5758 O O   . ALA B 1 207 ? 13.975  9.943   -41.541 1.00 33.55  ? 207  ALA B O   1 
ATOM   5759 C CB  . ALA B 1 207 ? 13.630  7.302   -39.559 1.00 29.06  ? 207  ALA B CB  1 
ATOM   5760 N N   . SER B 1 208 ? 12.442  8.437   -42.306 1.00 27.65  ? 208  SER B N   1 
ATOM   5761 C CA  . SER B 1 208 ? 12.590  8.837   -43.730 1.00 29.34  ? 208  SER B CA  1 
ATOM   5762 C C   . SER B 1 208 ? 12.233  10.299  -43.902 1.00 34.64  ? 208  SER B C   1 
ATOM   5763 O O   . SER B 1 208 ? 12.985  11.070  -44.493 1.00 35.24  ? 208  SER B O   1 
ATOM   5764 C CB  . SER B 1 208 ? 11.747  7.959   -44.687 1.00 25.08  ? 208  SER B CB  1 
ATOM   5765 O OG  . SER B 1 208 ? 12.199  6.611   -44.662 1.00 30.36  ? 208  SER B OG  1 
ATOM   5766 N N   . VAL B 1 209 ? 11.065  10.676  -43.396 1.00 33.65  ? 209  VAL B N   1 
ATOM   5767 C CA  . VAL B 1 209 ? 10.653  12.085  -43.392 1.00 32.43  ? 209  VAL B CA  1 
ATOM   5768 C C   . VAL B 1 209 ? 11.744  12.985  -42.795 1.00 27.21  ? 209  VAL B C   1 
ATOM   5769 O O   . VAL B 1 209 ? 12.128  13.985  -43.399 1.00 37.15  ? 209  VAL B O   1 
ATOM   5770 C CB  . VAL B 1 209 ? 9.314   12.259  -42.642 1.00 29.48  ? 209  VAL B CB  1 
ATOM   5771 C CG1 . VAL B 1 209 ? 9.025   13.739  -42.334 1.00 30.84  ? 209  VAL B CG1 1 
ATOM   5772 C CG2 . VAL B 1 209 ? 8.173   11.611  -43.451 1.00 26.28  ? 209  VAL B CG2 1 
ATOM   5773 N N   . GLY B 1 210 ? 12.245  12.631  -41.613 1.00 27.53  ? 210  GLY B N   1 
ATOM   5774 C CA  . GLY B 1 210 ? 13.353  13.375  -41.015 1.00 29.77  ? 210  GLY B CA  1 
ATOM   5775 C C   . GLY B 1 210 ? 14.601  13.459  -41.894 1.00 36.78  ? 210  GLY B C   1 
ATOM   5776 O O   . GLY B 1 210 ? 15.308  14.479  -41.933 1.00 36.53  ? 210  GLY B O   1 
ATOM   5777 N N   . MET B 1 211 ? 14.881  12.391  -42.627 1.00 31.88  ? 211  MET B N   1 
ATOM   5778 C CA  . MET B 1 211 ? 16.003  12.426  -43.544 1.00 36.95  ? 211  MET B CA  1 
ATOM   5779 C C   . MET B 1 211 ? 15.769  13.369  -44.722 1.00 40.64  ? 211  MET B C   1 
ATOM   5780 O O   . MET B 1 211 ? 16.706  14.040  -45.171 1.00 33.73  ? 211  MET B O   1 
ATOM   5781 C CB  . MET B 1 211 ? 16.410  11.016  -43.952 1.00 36.16  ? 211  MET B CB  1 
ATOM   5782 C CG  . MET B 1 211 ? 17.193  10.377  -42.785 1.00 37.05  ? 211  MET B CG  1 
ATOM   5783 S SD  . MET B 1 211 ? 17.411  8.652   -43.003 1.00 52.23  ? 211  MET B SD  1 
ATOM   5784 C CE  . MET B 1 211 ? 17.654  8.154   -41.301 1.00 41.57  ? 211  MET B CE  1 
ATOM   5785 N N   . HIS B 1 212 ? 14.525  13.474  -45.184 1.00 30.80  ? 212  HIS B N   1 
ATOM   5786 C CA  . HIS B 1 212 ? 14.214  14.473  -46.210 1.00 32.92  ? 212  HIS B CA  1 
ATOM   5787 C C   . HIS B 1 212 ? 14.357  15.897  -45.669 1.00 40.20  ? 212  HIS B C   1 
ATOM   5788 O O   . HIS B 1 212 ? 14.786  16.789  -46.392 1.00 38.32  ? 212  HIS B O   1 
ATOM   5789 C CB  . HIS B 1 212 ? 12.839  14.245  -46.855 1.00 32.03  ? 212  HIS B CB  1 
ATOM   5790 C CG  . HIS B 1 212 ? 12.770  12.981  -47.654 1.00 33.94  ? 212  HIS B CG  1 
ATOM   5791 N ND1 . HIS B 1 212 ? 13.447  12.815  -48.847 1.00 33.97  ? 212  HIS B ND1 1 
ATOM   5792 C CD2 . HIS B 1 212 ? 12.150  11.805  -47.405 1.00 28.77  ? 212  HIS B CD2 1 
ATOM   5793 C CE1 . HIS B 1 212 ? 13.218  11.600  -49.312 1.00 33.56  ? 212  HIS B CE1 1 
ATOM   5794 N NE2 . HIS B 1 212 ? 12.438  10.964  -48.455 1.00 30.77  ? 212  HIS B NE2 1 
ATOM   5795 N N   . ILE B 1 213 ? 14.025  16.102  -44.397 1.00 36.58  ? 213  ILE B N   1 
ATOM   5796 C CA  . ILE B 1 213 ? 14.234  17.409  -43.768 1.00 34.97  ? 213  ILE B CA  1 
ATOM   5797 C C   . ILE B 1 213 ? 15.733  17.756  -43.763 1.00 38.58  ? 213  ILE B C   1 
ATOM   5798 O O   . ILE B 1 213 ? 16.123  18.906  -43.965 1.00 39.86  ? 213  ILE B O   1 
ATOM   5799 C CB  . ILE B 1 213 ? 13.690  17.429  -42.310 1.00 28.29  ? 213  ILE B CB  1 
ATOM   5800 C CG1 . ILE B 1 213 ? 12.149  17.501  -42.300 1.00 28.80  ? 213  ILE B CG1 1 
ATOM   5801 C CG2 . ILE B 1 213 ? 14.312  18.590  -41.518 1.00 28.00  ? 213  ILE B CG2 1 
ATOM   5802 C CD1 . ILE B 1 213 ? 11.531  17.150  -40.929 1.00 33.46  ? 213  ILE B CD1 1 
ATOM   5803 N N   . LEU B 1 214 ? 16.562  16.737  -43.558 1.00 35.47  ? 214  LEU B N   1 
ATOM   5804 C CA  . LEU B 1 214 ? 18.002  16.904  -43.391 1.00 36.06  ? 214  LEU B CA  1 
ATOM   5805 C C   . LEU B 1 214 ? 18.813  16.827  -44.689 1.00 44.32  ? 214  LEU B C   1 
ATOM   5806 O O   . LEU B 1 214 ? 20.035  16.958  -44.655 1.00 44.09  ? 214  LEU B O   1 
ATOM   5807 C CB  . LEU B 1 214 ? 18.543  15.870  -42.387 1.00 33.59  ? 214  LEU B CB  1 
ATOM   5808 C CG  . LEU B 1 214 ? 17.957  15.995  -40.976 1.00 37.89  ? 214  LEU B CG  1 
ATOM   5809 C CD1 . LEU B 1 214 ? 18.465  14.906  -40.044 1.00 36.81  ? 214  LEU B CD1 1 
ATOM   5810 C CD2 . LEU B 1 214 ? 18.290  17.373  -40.415 1.00 40.53  ? 214  LEU B CD2 1 
ATOM   5811 N N   . SER B 1 215 ? 18.152  16.611  -45.824 1.00 42.75  ? 215  SER B N   1 
ATOM   5812 C CA  . SER B 1 215 ? 18.867  16.510  -47.097 1.00 41.93  ? 215  SER B CA  1 
ATOM   5813 C C   . SER B 1 215 ? 18.402  17.570  -48.103 1.00 43.49  ? 215  SER B C   1 
ATOM   5814 O O   . SER B 1 215 ? 17.261  17.559  -48.571 1.00 41.71  ? 215  SER B O   1 
ATOM   5815 C CB  . SER B 1 215 ? 18.738  15.109  -47.683 1.00 38.50  ? 215  SER B CB  1 
ATOM   5816 O OG  . SER B 1 215 ? 19.419  15.011  -48.927 1.00 39.98  ? 215  SER B OG  1 
ATOM   5817 N N   . LEU B 1 216 ? 19.303  18.484  -48.424 1.00 46.25  ? 216  LEU B N   1 
ATOM   5818 C CA  . LEU B 1 216 ? 18.970  19.677  -49.200 1.00 49.34  ? 216  LEU B CA  1 
ATOM   5819 C C   . LEU B 1 216 ? 18.136  19.450  -50.471 1.00 44.67  ? 216  LEU B C   1 
ATOM   5820 O O   . LEU B 1 216 ? 17.128  20.111  -50.673 1.00 49.70  ? 216  LEU B O   1 
ATOM   5821 C CB  . LEU B 1 216 ? 20.241  20.471  -49.517 1.00 61.95  ? 216  LEU B CB  1 
ATOM   5822 C CG  . LEU B 1 216 ? 20.022  21.891  -50.043 1.00 73.14  ? 216  LEU B CG  1 
ATOM   5823 C CD1 . LEU B 1 216 ? 19.114  22.683  -49.105 1.00 74.43  ? 216  LEU B CD1 1 
ATOM   5824 C CD2 . LEU B 1 216 ? 21.355  22.593  -50.235 1.00 71.87  ? 216  LEU B CD2 1 
ATOM   5825 N N   . PRO B 1 217 ? 18.546  18.520  -51.337 1.00 44.00  ? 217  PRO B N   1 
ATOM   5826 C CA  . PRO B 1 217 ? 17.728  18.343  -52.548 1.00 46.00  ? 217  PRO B CA  1 
ATOM   5827 C C   . PRO B 1 217 ? 16.261  17.935  -52.268 1.00 46.56  ? 217  PRO B C   1 
ATOM   5828 O O   . PRO B 1 217 ? 15.408  18.146  -53.121 1.00 44.44  ? 217  PRO B O   1 
ATOM   5829 C CB  . PRO B 1 217 ? 18.477  17.249  -53.330 1.00 41.65  ? 217  PRO B CB  1 
ATOM   5830 C CG  . PRO B 1 217 ? 19.914  17.300  -52.787 1.00 41.16  ? 217  PRO B CG  1 
ATOM   5831 C CD  . PRO B 1 217 ? 19.761  17.680  -51.336 1.00 42.30  ? 217  PRO B CD  1 
ATOM   5832 N N   . SER B 1 218 ? 15.963  17.373  -51.100 1.00 43.90  ? 218  SER B N   1 
ATOM   5833 C CA  . SER B 1 218 ? 14.573  17.048  -50.784 1.00 38.72  ? 218  SER B CA  1 
ATOM   5834 C C   . SER B 1 218 ? 13.758  18.269  -50.370 1.00 40.60  ? 218  SER B C   1 
ATOM   5835 O O   . SER B 1 218 ? 12.537  18.245  -50.462 1.00 41.52  ? 218  SER B O   1 
ATOM   5836 C CB  . SER B 1 218 ? 14.487  16.007  -49.681 1.00 37.32  ? 218  SER B CB  1 
ATOM   5837 O OG  . SER B 1 218 ? 14.822  14.708  -50.144 1.00 40.55  ? 218  SER B OG  1 
ATOM   5838 N N   . ARG B 1 219 ? 14.426  19.337  -49.926 1.00 46.24  ? 219  ARG B N   1 
ATOM   5839 C CA  . ARG B 1 219 ? 13.729  20.440  -49.240 1.00 47.17  ? 219  ARG B CA  1 
ATOM   5840 C C   . ARG B 1 219 ? 12.816  21.281  -50.122 1.00 45.72  ? 219  ARG B C   1 
ATOM   5841 O O   . ARG B 1 219 ? 11.862  21.883  -49.640 1.00 43.77  ? 219  ARG B O   1 
ATOM   5842 C CB  . ARG B 1 219 ? 14.709  21.337  -48.468 1.00 48.16  ? 219  ARG B CB  1 
ATOM   5843 C CG  . ARG B 1 219 ? 15.242  20.694  -47.190 1.00 49.83  ? 219  ARG B CG  1 
ATOM   5844 C CD  . ARG B 1 219 ? 14.128  20.359  -46.196 1.00 56.39  ? 219  ARG B CD  1 
ATOM   5845 N NE  . ARG B 1 219 ? 13.484  21.549  -45.643 1.00 63.51  ? 219  ARG B NE  1 
ATOM   5846 C CZ  . ARG B 1 219 ? 13.962  22.248  -44.614 1.00 69.63  ? 219  ARG B CZ  1 
ATOM   5847 N NH1 . ARG B 1 219 ? 15.091  21.876  -44.020 1.00 67.49  ? 219  ARG B NH1 1 
ATOM   5848 N NH2 . ARG B 1 219 ? 13.320  23.324  -44.179 1.00 71.37  ? 219  ARG B NH2 1 
ATOM   5849 N N   . SER B 1 220 ? 13.101  21.321  -51.412 1.00 44.51  ? 220  SER B N   1 
ATOM   5850 C CA  . SER B 1 220 ? 12.242  22.039  -52.326 1.00 44.30  ? 220  SER B CA  1 
ATOM   5851 C C   . SER B 1 220 ? 10.999  21.210  -52.681 1.00 47.01  ? 220  SER B C   1 
ATOM   5852 O O   . SER B 1 220 ? 10.145  21.657  -53.444 1.00 46.84  ? 220  SER B O   1 
ATOM   5853 C CB  . SER B 1 220 ? 13.017  22.387  -53.594 1.00 50.43  ? 220  SER B CB  1 
ATOM   5854 O OG  . SER B 1 220 ? 13.427  21.205  -54.273 1.00 61.21  ? 220  SER B OG  1 
ATOM   5855 N N   . LEU B 1 221 ? 10.888  20.002  -52.142 1.00 40.12  ? 221  LEU B N   1 
ATOM   5856 C CA  . LEU B 1 221 ? 9.790   19.119  -52.570 1.00 39.32  ? 221  LEU B CA  1 
ATOM   5857 C C   . LEU B 1 221 ? 8.645   18.991  -51.562 1.00 37.54  ? 221  LEU B C   1 
ATOM   5858 O O   . LEU B 1 221 ? 7.719   18.204  -51.764 1.00 43.79  ? 221  LEU B O   1 
ATOM   5859 C CB  . LEU B 1 221 ? 10.337  17.731  -52.942 1.00 35.49  ? 221  LEU B CB  1 
ATOM   5860 C CG  . LEU B 1 221 ? 11.545  17.769  -53.885 1.00 40.86  ? 221  LEU B CG  1 
ATOM   5861 C CD1 . LEU B 1 221 ? 12.230  16.424  -54.027 1.00 40.66  ? 221  LEU B CD1 1 
ATOM   5862 C CD2 . LEU B 1 221 ? 11.150  18.332  -55.251 1.00 39.73  ? 221  LEU B CD2 1 
ATOM   5863 N N   . PHE B 1 222 ? 8.722   19.744  -50.464 1.00 38.09  ? 222  PHE B N   1 
ATOM   5864 C CA  . PHE B 1 222 ? 7.678   19.717  -49.436 1.00 33.98  ? 222  PHE B CA  1 
ATOM   5865 C C   . PHE B 1 222 ? 7.798   20.914  -48.515 1.00 34.66  ? 222  PHE B C   1 
ATOM   5866 O O   . PHE B 1 222 ? 8.805   21.604  -48.521 1.00 43.38  ? 222  PHE B O   1 
ATOM   5867 C CB  . PHE B 1 222 ? 7.720   18.403  -48.619 1.00 27.89  ? 222  PHE B CB  1 
ATOM   5868 C CG  . PHE B 1 222 ? 8.923   18.273  -47.711 1.00 34.75  ? 222  PHE B CG  1 
ATOM   5869 C CD1 . PHE B 1 222 ? 10.163  17.892  -48.226 1.00 34.15  ? 222  PHE B CD1 1 
ATOM   5870 C CD2 . PHE B 1 222 ? 8.807   18.521  -46.339 1.00 35.50  ? 222  PHE B CD2 1 
ATOM   5871 C CE1 . PHE B 1 222 ? 11.270  17.772  -47.400 1.00 41.38  ? 222  PHE B CE1 1 
ATOM   5872 C CE2 . PHE B 1 222 ? 9.910   18.392  -45.492 1.00 38.20  ? 222  PHE B CE2 1 
ATOM   5873 C CZ  . PHE B 1 222 ? 11.147  18.017  -46.024 1.00 43.21  ? 222  PHE B CZ  1 
ATOM   5874 N N   . HIS B 1 223 ? 6.788   21.130  -47.686 1.00 37.71  ? 223  HIS B N   1 
ATOM   5875 C CA  . HIS B 1 223 ? 6.725   22.336  -46.876 1.00 39.58  ? 223  HIS B CA  1 
ATOM   5876 C C   . HIS B 1 223 ? 6.614   22.086  -45.385 1.00 37.18  ? 223  HIS B C   1 
ATOM   5877 O O   . HIS B 1 223 ? 7.062   22.907  -44.596 1.00 45.51  ? 223  HIS B O   1 
ATOM   5878 C CB  . HIS B 1 223 ? 5.579   23.205  -47.379 1.00 36.69  ? 223  HIS B CB  1 
ATOM   5879 C CG  . HIS B 1 223 ? 5.521   23.256  -48.869 1.00 43.17  ? 223  HIS B CG  1 
ATOM   5880 N ND1 . HIS B 1 223 ? 6.197   24.206  -49.605 1.00 45.31  ? 223  HIS B ND1 1 
ATOM   5881 C CD2 . HIS B 1 223 ? 4.939   22.422  -49.763 1.00 35.83  ? 223  HIS B CD2 1 
ATOM   5882 C CE1 . HIS B 1 223 ? 6.011   23.969  -50.891 1.00 44.17  ? 223  HIS B CE1 1 
ATOM   5883 N NE2 . HIS B 1 223 ? 5.247   22.896  -51.012 1.00 43.65  ? 223  HIS B NE2 1 
ATOM   5884 N N   . ARG B 1 224 ? 6.018   20.965  -44.996 1.00 34.72  ? 224  ARG B N   1 
ATOM   5885 C CA  . ARG B 1 224 ? 5.815   20.664  -43.575 1.00 36.09  ? 224  ARG B CA  1 
ATOM   5886 C C   . ARG B 1 224 ? 5.974   19.158  -43.430 1.00 37.95  ? 224  ARG B C   1 
ATOM   5887 O O   . ARG B 1 224 ? 5.894   18.457  -44.431 1.00 34.77  ? 224  ARG B O   1 
ATOM   5888 C CB  . ARG B 1 224 ? 4.406   21.082  -43.128 1.00 38.50  ? 224  ARG B CB  1 
ATOM   5889 C CG  . ARG B 1 224 ? 4.114   22.542  -43.297 1.00 51.41  ? 224  ARG B CG  1 
ATOM   5890 C CD  . ARG B 1 224 ? 2.667   22.866  -43.012 1.00 50.47  ? 224  ARG B CD  1 
ATOM   5891 N NE  . ARG B 1 224 ? 1.891   22.907  -44.231 1.00 55.57  ? 224  ARG B NE  1 
ATOM   5892 C CZ  . ARG B 1 224 ? 2.029   23.836  -45.171 1.00 58.49  ? 224  ARG B CZ  1 
ATOM   5893 N NH1 . ARG B 1 224 ? 2.927   24.802  -45.031 1.00 54.51  ? 224  ARG B NH1 1 
ATOM   5894 N NH2 . ARG B 1 224 ? 1.272   23.792  -46.257 1.00 63.16  ? 224  ARG B NH2 1 
ATOM   5895 N N   . ALA B 1 225 ? 6.168   18.670  -42.201 1.00 36.50  ? 225  ALA B N   1 
ATOM   5896 C CA  . ALA B 1 225 ? 6.433   17.248  -41.956 1.00 34.77  ? 225  ALA B CA  1 
ATOM   5897 C C   . ALA B 1 225 ? 5.788   16.770  -40.665 1.00 38.01  ? 225  ALA B C   1 
ATOM   5898 O O   . ALA B 1 225 ? 5.681   17.522  -39.680 1.00 36.33  ? 225  ALA B O   1 
ATOM   5899 C CB  . ALA B 1 225 ? 7.934   17.008  -41.896 1.00 35.81  ? 225  ALA B CB  1 
ATOM   5900 N N   . VAL B 1 226 ? 5.374   15.512  -40.668 1.00 38.65  ? 226  VAL B N   1 
ATOM   5901 C CA  . VAL B 1 226 ? 4.856   14.860  -39.474 1.00 35.33  ? 226  VAL B CA  1 
ATOM   5902 C C   . VAL B 1 226 ? 5.685   13.613  -39.242 1.00 35.81  ? 226  VAL B C   1 
ATOM   5903 O O   . VAL B 1 226 ? 5.800   12.793  -40.137 1.00 33.25  ? 226  VAL B O   1 
ATOM   5904 C CB  . VAL B 1 226 ? 3.396   14.418  -39.646 1.00 36.14  ? 226  VAL B CB  1 
ATOM   5905 C CG1 . VAL B 1 226 ? 2.864   13.791  -38.322 1.00 30.75  ? 226  VAL B CG1 1 
ATOM   5906 C CG2 . VAL B 1 226 ? 2.523   15.599  -40.140 1.00 25.74  ? 226  VAL B CG2 1 
ATOM   5907 N N   . LEU B 1 227 ? 6.277   13.486  -38.053 1.00 34.77  ? 227  LEU B N   1 
ATOM   5908 C CA  . LEU B 1 227 ? 7.050   12.302  -37.696 1.00 34.47  ? 227  LEU B CA  1 
ATOM   5909 C C   . LEU B 1 227 ? 6.342   11.570  -36.569 1.00 36.09  ? 227  LEU B C   1 
ATOM   5910 O O   . LEU B 1 227 ? 6.349   12.027  -35.418 1.00 34.00  ? 227  LEU B O   1 
ATOM   5911 C CB  . LEU B 1 227 ? 8.499   12.653  -37.289 1.00 34.93  ? 227  LEU B CB  1 
ATOM   5912 C CG  . LEU B 1 227 ? 9.383   13.182  -38.434 1.00 38.57  ? 227  LEU B CG  1 
ATOM   5913 C CD1 . LEU B 1 227 ? 9.039   14.636  -38.716 1.00 34.96  ? 227  LEU B CD1 1 
ATOM   5914 C CD2 . LEU B 1 227 ? 10.902  13.053  -38.140 1.00 33.75  ? 227  LEU B CD2 1 
ATOM   5915 N N   . GLN B 1 228 ? 5.725   10.438  -36.908 1.00 29.68  ? 228  GLN B N   1 
ATOM   5916 C CA  . GLN B 1 228 ? 5.048   9.585   -35.926 1.00 33.24  ? 228  GLN B CA  1 
ATOM   5917 C C   . GLN B 1 228 ? 5.927   8.424   -35.460 1.00 33.91  ? 228  GLN B C   1 
ATOM   5918 O O   . GLN B 1 228 ? 6.270   7.549   -36.263 1.00 35.83  ? 228  GLN B O   1 
ATOM   5919 C CB  . GLN B 1 228 ? 3.750   9.016   -36.523 1.00 28.08  ? 228  GLN B CB  1 
ATOM   5920 C CG  . GLN B 1 228 ? 2.794   10.089  -37.048 1.00 35.44  ? 228  GLN B CG  1 
ATOM   5921 C CD  . GLN B 1 228 ? 1.653   9.512   -37.900 1.00 37.30  ? 228  GLN B CD  1 
ATOM   5922 O OE1 . GLN B 1 228 ? 1.121   10.184  -38.789 1.00 35.67  ? 228  GLN B OE1 1 
ATOM   5923 N NE2 . GLN B 1 228 ? 1.274   8.271   -37.623 1.00 33.14  ? 228  GLN B NE2 1 
ATOM   5924 N N   . SER B 1 229 ? 6.284   8.414   -34.173 1.00 29.13  ? 229  SER B N   1 
ATOM   5925 C CA  . SER B 1 229 ? 7.010   7.287   -33.573 1.00 28.53  ? 229  SER B CA  1 
ATOM   5926 C C   . SER B 1 229 ? 8.314   6.949   -34.313 1.00 32.91  ? 229  SER B C   1 
ATOM   5927 O O   . SER B 1 229 ? 8.619   5.779   -34.530 1.00 31.90  ? 229  SER B O   1 
ATOM   5928 C CB  . SER B 1 229 ? 6.137   6.029   -33.568 1.00 31.75  ? 229  SER B CB  1 
ATOM   5929 O OG  . SER B 1 229 ? 4.971   6.178   -32.781 1.00 32.87  ? 229  SER B OG  1 
ATOM   5930 N N   . GLY B 1 230 ? 9.083   7.955   -34.704 1.00 33.15  ? 230  GLY B N   1 
ATOM   5931 C CA  . GLY B 1 230 ? 10.327  7.699   -35.421 1.00 33.08  ? 230  GLY B CA  1 
ATOM   5932 C C   . GLY B 1 230 ? 11.109  8.962   -35.738 1.00 29.80  ? 230  GLY B C   1 
ATOM   5933 O O   . GLY B 1 230 ? 10.542  10.047  -35.836 1.00 32.08  ? 230  GLY B O   1 
ATOM   5934 N N   . THR B 1 231 ? 12.415  8.824   -35.919 1.00 27.23  ? 231  THR B N   1 
ATOM   5935 C CA  . THR B 1 231 ? 13.289  9.981   -36.095 1.00 29.34  ? 231  THR B CA  1 
ATOM   5936 C C   . THR B 1 231 ? 14.511  9.574   -36.883 1.00 28.94  ? 231  THR B C   1 
ATOM   5937 O O   . THR B 1 231 ? 14.901  8.403   -36.870 1.00 32.60  ? 231  THR B O   1 
ATOM   5938 C CB  . THR B 1 231 ? 13.805  10.541  -34.715 1.00 44.03  ? 231  THR B CB  1 
ATOM   5939 O OG1 . THR B 1 231 ? 14.363  9.472   -33.953 1.00 40.23  ? 231  THR B OG1 1 
ATOM   5940 C CG2 . THR B 1 231 ? 12.687  11.151  -33.904 1.00 37.17  ? 231  THR B CG2 1 
ATOM   5941 N N   . PRO B 1 232 ? 15.138  10.542  -37.557 1.00 35.01  ? 232  PRO B N   1 
ATOM   5942 C CA  . PRO B 1 232 ? 16.372  10.210  -38.278 1.00 32.85  ? 232  PRO B CA  1 
ATOM   5943 C C   . PRO B 1 232 ? 17.538  10.021  -37.320 1.00 38.49  ? 232  PRO B C   1 
ATOM   5944 O O   . PRO B 1 232 ? 18.447  9.241   -37.603 1.00 38.93  ? 232  PRO B O   1 
ATOM   5945 C CB  . PRO B 1 232 ? 16.585  11.414  -39.207 1.00 27.02  ? 232  PRO B CB  1 
ATOM   5946 C CG  . PRO B 1 232 ? 15.828  12.582  -38.504 1.00 35.59  ? 232  PRO B CG  1 
ATOM   5947 C CD  . PRO B 1 232 ? 14.696  11.944  -37.746 1.00 32.83  ? 232  PRO B CD  1 
ATOM   5948 N N   . ASN B 1 233 ? 17.520  10.733  -36.203 1.00 39.41  ? 233  ASN B N   1 
ATOM   5949 C CA  . ASN B 1 233 ? 18.521  10.531  -35.156 1.00 35.48  ? 233  ASN B CA  1 
ATOM   5950 C C   . ASN B 1 233 ? 18.174  9.279   -34.374 1.00 38.03  ? 233  ASN B C   1 
ATOM   5951 O O   . ASN B 1 233 ? 17.101  8.705   -34.568 1.00 36.25  ? 233  ASN B O   1 
ATOM   5952 C CB  . ASN B 1 233 ? 18.591  11.738  -34.208 1.00 31.19  ? 233  ASN B CB  1 
ATOM   5953 C CG  . ASN B 1 233 ? 17.197  12.206  -33.734 1.00 33.58  ? 233  ASN B CG  1 
ATOM   5954 O OD1 . ASN B 1 233 ? 16.344  12.595  -34.540 1.00 32.47  ? 233  ASN B OD1 1 
ATOM   5955 N ND2 . ASN B 1 233 ? 16.982  12.193  -32.427 1.00 26.52  ? 233  ASN B ND2 1 
ATOM   5956 N N   . GLY B 1 234 ? 19.066  8.864   -33.473 1.00 38.03  ? 234  GLY B N   1 
ATOM   5957 C CA  . GLY B 1 234 ? 18.791  7.708   -32.639 1.00 35.81  ? 234  GLY B CA  1 
ATOM   5958 C C   . GLY B 1 234 ? 19.582  6.486   -33.067 1.00 38.62  ? 234  GLY B C   1 
ATOM   5959 O O   . GLY B 1 234 ? 20.345  6.556   -34.019 1.00 39.82  ? 234  GLY B O   1 
ATOM   5960 N N   . PRO B 1 235 ? 19.387  5.361   -32.372 1.00 40.88  ? 235  PRO B N   1 
ATOM   5961 C CA  . PRO B 1 235 ? 20.303  4.223   -32.460 1.00 45.53  ? 235  PRO B CA  1 
ATOM   5962 C C   . PRO B 1 235 ? 20.059  3.277   -33.644 1.00 47.47  ? 235  PRO B C   1 
ATOM   5963 O O   . PRO B 1 235 ? 20.956  2.475   -33.908 1.00 45.08  ? 235  PRO B O   1 
ATOM   5964 C CB  . PRO B 1 235 ? 20.046  3.463   -31.146 1.00 48.13  ? 235  PRO B CB  1 
ATOM   5965 C CG  . PRO B 1 235 ? 18.797  4.104   -30.520 1.00 47.85  ? 235  PRO B CG  1 
ATOM   5966 C CD  . PRO B 1 235 ? 18.241  5.085   -31.488 1.00 41.48  ? 235  PRO B CD  1 
ATOM   5967 N N   . TRP B 1 236 ? 18.910  3.355   -34.330 1.00 35.26  ? 236  TRP B N   1 
ATOM   5968 C CA  . TRP B 1 236 ? 18.571  2.336   -35.336 1.00 38.00  ? 236  TRP B CA  1 
ATOM   5969 C C   . TRP B 1 236 ? 18.419  2.828   -36.788 1.00 43.57  ? 236  TRP B C   1 
ATOM   5970 O O   . TRP B 1 236 ? 18.511  2.024   -37.722 1.00 42.35  ? 236  TRP B O   1 
ATOM   5971 C CB  . TRP B 1 236 ? 17.291  1.589   -34.936 1.00 31.41  ? 236  TRP B CB  1 
ATOM   5972 C CG  . TRP B 1 236 ? 16.131  2.516   -34.717 1.00 41.52  ? 236  TRP B CG  1 
ATOM   5973 C CD1 . TRP B 1 236 ? 15.778  3.118   -33.536 1.00 43.39  ? 236  TRP B CD1 1 
ATOM   5974 C CD2 . TRP B 1 236 ? 15.177  2.967   -35.699 1.00 36.94  ? 236  TRP B CD2 1 
ATOM   5975 N NE1 . TRP B 1 236 ? 14.661  3.904   -33.719 1.00 43.21  ? 236  TRP B NE1 1 
ATOM   5976 C CE2 . TRP B 1 236 ? 14.268  3.833   -35.030 1.00 35.43  ? 236  TRP B CE2 1 
ATOM   5977 C CE3 . TRP B 1 236 ? 14.992  2.713   -37.069 1.00 37.11  ? 236  TRP B CE3 1 
ATOM   5978 C CZ2 . TRP B 1 236 ? 13.196  4.453   -35.683 1.00 30.32  ? 236  TRP B CZ2 1 
ATOM   5979 C CZ3 . TRP B 1 236 ? 13.919  3.342   -37.738 1.00 35.23  ? 236  TRP B CZ3 1 
ATOM   5980 C CH2 . TRP B 1 236 ? 13.039  4.209   -37.038 1.00 36.28  ? 236  TRP B CH2 1 
ATOM   5981 N N   . ALA B 1 237 ? 18.155  4.122   -36.975 1.00 39.48  ? 237  ALA B N   1 
ATOM   5982 C CA  . ALA B 1 237 ? 17.757  4.646   -38.283 1.00 40.61  ? 237  ALA B CA  1 
ATOM   5983 C C   . ALA B 1 237 ? 18.905  4.838   -39.270 1.00 39.53  ? 237  ALA B C   1 
ATOM   5984 O O   . ALA B 1 237 ? 18.651  4.976   -40.460 1.00 42.60  ? 237  ALA B O   1 
ATOM   5985 C CB  . ALA B 1 237 ? 16.909  5.984   -38.147 1.00 25.28  ? 237  ALA B CB  1 
ATOM   5986 N N   . THR B 1 238 ? 20.153  4.865   -38.792 1.00 38.76  ? 238  THR B N   1 
ATOM   5987 C CA  . THR B 1 238 ? 21.301  5.028   -39.682 1.00 35.30  ? 238  THR B CA  1 
ATOM   5988 C C   . THR B 1 238 ? 22.473  4.145   -39.259 1.00 40.90  ? 238  THR B C   1 
ATOM   5989 O O   . THR B 1 238 ? 22.560  3.727   -38.115 1.00 43.19  ? 238  THR B O   1 
ATOM   5990 C CB  . THR B 1 238 ? 21.821  6.485   -39.705 1.00 36.89  ? 238  THR B CB  1 
ATOM   5991 O OG1 . THR B 1 238 ? 22.222  6.866   -38.380 1.00 39.88  ? 238  THR B OG1 1 
ATOM   5992 C CG2 . THR B 1 238 ? 20.747  7.474   -40.221 1.00 32.91  ? 238  THR B CG2 1 
ATOM   5993 N N   . VAL B 1 239 ? 23.372  3.858   -40.194 1.00 34.25  ? 239  VAL B N   1 
ATOM   5994 C CA  . VAL B 1 239 ? 24.666  3.281   -39.861 1.00 36.58  ? 239  VAL B CA  1 
ATOM   5995 C C   . VAL B 1 239 ? 25.757  4.120   -40.522 1.00 39.13  ? 239  VAL B C   1 
ATOM   5996 O O   . VAL B 1 239 ? 25.514  4.835   -41.503 1.00 44.08  ? 239  VAL B O   1 
ATOM   5997 C CB  . VAL B 1 239 ? 24.794  1.814   -40.325 1.00 40.25  ? 239  VAL B CB  1 
ATOM   5998 C CG1 . VAL B 1 239 ? 23.808  0.934   -39.567 1.00 40.44  ? 239  VAL B CG1 1 
ATOM   5999 C CG2 . VAL B 1 239 ? 24.575  1.704   -41.856 1.00 39.25  ? 239  VAL B CG2 1 
ATOM   6000 N N   . SER B 1 240 ? 26.958  4.039   -39.979 1.00 39.78  ? 240  SER B N   1 
ATOM   6001 C CA  . SER B 1 240 ? 28.100  4.710   -40.573 1.00 46.00  ? 240  SER B CA  1 
ATOM   6002 C C   . SER B 1 240 ? 28.467  3.996   -41.870 1.00 50.56  ? 240  SER B C   1 
ATOM   6003 O O   . SER B 1 240 ? 28.014  2.864   -42.118 1.00 45.59  ? 240  SER B O   1 
ATOM   6004 C CB  . SER B 1 240 ? 29.288  4.645   -39.610 1.00 45.41  ? 240  SER B CB  1 
ATOM   6005 O OG  . SER B 1 240 ? 29.723  3.304   -39.481 1.00 45.07  ? 240  SER B OG  1 
ATOM   6006 N N   . ALA B 1 241 ? 29.302  4.646   -42.681 1.00 48.16  ? 241  ALA B N   1 
ATOM   6007 C CA  . ALA B 1 241 ? 29.804  4.038   -43.915 1.00 50.82  ? 241  ALA B CA  1 
ATOM   6008 C C   . ALA B 1 241 ? 30.514  2.718   -43.636 1.00 54.57  ? 241  ALA B C   1 
ATOM   6009 O O   . ALA B 1 241 ? 30.289  1.728   -44.337 1.00 56.43  ? 241  ALA B O   1 
ATOM   6010 C CB  . ALA B 1 241 ? 30.727  4.988   -44.647 1.00 45.04  ? 241  ALA B CB  1 
ATOM   6011 N N   . GLY B 1 242 ? 31.348  2.707   -42.596 1.00 54.20  ? 242  GLY B N   1 
ATOM   6012 C CA  . GLY B 1 242 ? 32.122  1.534   -42.233 1.00 49.99  ? 242  GLY B CA  1 
ATOM   6013 C C   . GLY B 1 242 ? 31.267  0.338   -41.861 1.00 49.91  ? 242  GLY B C   1 
ATOM   6014 O O   . GLY B 1 242 ? 31.544  -0.787  -42.275 1.00 50.74  ? 242  GLY B O   1 
ATOM   6015 N N   . GLU B 1 243 ? 30.228  0.565   -41.067 1.00 47.56  ? 243  GLU B N   1 
ATOM   6016 C CA  . GLU B 1 243 ? 29.364  -0.542  -40.667 1.00 50.70  ? 243  GLU B CA  1 
ATOM   6017 C C   . GLU B 1 243 ? 28.522  -1.051  -41.846 1.00 51.54  ? 243  GLU B C   1 
ATOM   6018 O O   . GLU B 1 243 ? 28.238  -2.246  -41.928 1.00 48.29  ? 243  GLU B O   1 
ATOM   6019 C CB  . GLU B 1 243 ? 28.484  -0.165  -39.467 1.00 50.75  ? 243  GLU B CB  1 
ATOM   6020 C CG  . GLU B 1 243 ? 27.439  -1.227  -39.079 1.00 51.18  ? 243  GLU B CG  1 
ATOM   6021 C CD  . GLU B 1 243 ? 28.052  -2.479  -38.455 1.00 52.11  ? 243  GLU B CD  1 
ATOM   6022 O OE1 . GLU B 1 243 ? 27.288  -3.393  -38.056 1.00 48.16  ? 243  GLU B OE1 1 
ATOM   6023 O OE2 . GLU B 1 243 ? 29.296  -2.551  -38.356 1.00 52.56  ? 243  GLU B OE2 1 
ATOM   6024 N N   . ALA B 1 244 ? 28.122  -0.152  -42.749 1.00 50.22  ? 244  ALA B N   1 
ATOM   6025 C CA  . ALA B 1 244 ? 27.394  -0.562  -43.965 1.00 46.93  ? 244  ALA B CA  1 
ATOM   6026 C C   . ALA B 1 244 ? 28.278  -1.452  -44.837 1.00 51.48  ? 244  ALA B C   1 
ATOM   6027 O O   . ALA B 1 244 ? 27.866  -2.531  -45.269 1.00 47.51  ? 244  ALA B O   1 
ATOM   6028 C CB  . ALA B 1 244 ? 26.920  0.648   -44.763 1.00 36.68  ? 244  ALA B CB  1 
ATOM   6029 N N   . ARG B 1 245 ? 29.497  -0.989  -45.090 1.00 49.20  ? 245  ARG B N   1 
ATOM   6030 C CA  . ARG B 1 245 ? 30.443  -1.748  -45.887 1.00 48.78  ? 245  ARG B CA  1 
ATOM   6031 C C   . ARG B 1 245 ? 30.627  -3.137  -45.274 1.00 53.95  ? 245  ARG B C   1 
ATOM   6032 O O   . ARG B 1 245 ? 30.632  -4.147  -45.977 1.00 55.26  ? 245  ARG B O   1 
ATOM   6033 C CB  . ARG B 1 245 ? 31.783  -1.008  -45.986 1.00 50.99  ? 245  ARG B CB  1 
ATOM   6034 C CG  . ARG B 1 245 ? 32.882  -1.817  -46.672 1.00 52.58  ? 245  ARG B CG  1 
ATOM   6035 C CD  . ARG B 1 245 ? 33.993  -0.923  -47.180 1.00 49.74  ? 245  ARG B CD  1 
ATOM   6036 N NE  . ARG B 1 245 ? 33.531  -0.044  -48.247 1.00 54.10  ? 245  ARG B NE  1 
ATOM   6037 C CZ  . ARG B 1 245 ? 33.498  -0.387  -49.532 1.00 60.02  ? 245  ARG B CZ  1 
ATOM   6038 N NH1 . ARG B 1 245 ? 33.058  0.473   -50.446 1.00 58.38  ? 245  ARG B NH1 1 
ATOM   6039 N NH2 . ARG B 1 245 ? 33.913  -1.589  -49.907 1.00 61.47  ? 245  ARG B NH2 1 
ATOM   6040 N N   . ARG B 1 246 ? 30.756  -3.179  -43.955 1.00 52.10  ? 246  ARG B N   1 
ATOM   6041 C CA  . ARG B 1 246 ? 30.932  -4.431  -43.233 1.00 54.44  ? 246  ARG B CA  1 
ATOM   6042 C C   . ARG B 1 246 ? 29.755  -5.372  -43.475 1.00 51.33  ? 246  ARG B C   1 
ATOM   6043 O O   . ARG B 1 246 ? 29.933  -6.554  -43.806 1.00 47.02  ? 246  ARG B O   1 
ATOM   6044 C CB  . ARG B 1 246 ? 31.053  -4.141  -41.743 1.00 52.29  ? 246  ARG B CB  1 
ATOM   6045 C CG  . ARG B 1 246 ? 31.804  -5.181  -40.935 1.00 54.27  ? 246  ARG B CG  1 
ATOM   6046 C CD  . ARG B 1 246 ? 31.219  -5.283  -39.506 1.00 59.17  ? 246  ARG B CD  1 
ATOM   6047 N NE  . ARG B 1 246 ? 30.566  -6.577  -39.353 1.00 63.65  ? 246  ARG B NE  1 
ATOM   6048 C CZ  . ARG B 1 246 ? 29.314  -6.787  -38.964 1.00 58.90  ? 246  ARG B CZ  1 
ATOM   6049 N NH1 . ARG B 1 246 ? 28.517  -5.787  -38.624 1.00 41.41  ? 246  ARG B NH1 1 
ATOM   6050 N NH2 . ARG B 1 246 ? 28.874  -8.038  -38.884 1.00 66.52  ? 246  ARG B NH2 1 
ATOM   6051 N N   . ARG B 1 247 ? 28.550  -4.834  -43.314 1.00 45.22  ? 247  ARG B N   1 
ATOM   6052 C CA  . ARG B 1 247 ? 27.324  -5.611  -43.469 1.00 39.38  ? 247  ARG B CA  1 
ATOM   6053 C C   . ARG B 1 247 ? 27.140  -6.117  -44.891 1.00 41.66  ? 247  ARG B C   1 
ATOM   6054 O O   . ARG B 1 247 ? 26.770  -7.273  -45.090 1.00 48.76  ? 247  ARG B O   1 
ATOM   6055 C CB  . ARG B 1 247 ? 26.100  -4.805  -43.006 1.00 42.30  ? 247  ARG B CB  1 
ATOM   6056 C CG  . ARG B 1 247 ? 26.063  -4.591  -41.479 1.00 41.17  ? 247  ARG B CG  1 
ATOM   6057 C CD  . ARG B 1 247 ? 24.920  -3.712  -41.057 1.00 40.87  ? 247  ARG B CD  1 
ATOM   6058 N NE  . ARG B 1 247 ? 25.045  -3.345  -39.659 1.00 46.87  ? 247  ARG B NE  1 
ATOM   6059 C CZ  . ARG B 1 247 ? 24.054  -2.856  -38.920 1.00 48.69  ? 247  ARG B CZ  1 
ATOM   6060 N NH1 . ARG B 1 247 ? 22.857  -2.679  -39.469 1.00 44.19  ? 247  ARG B NH1 1 
ATOM   6061 N NH2 . ARG B 1 247 ? 24.266  -2.541  -37.636 1.00 39.69  ? 247  ARG B NH2 1 
ATOM   6062 N N   . ALA B 1 248 ? 27.417  -5.268  -45.876 1.00 43.78  ? 248  ALA B N   1 
ATOM   6063 C CA  . ALA B 1 248 ? 27.286  -5.667  -47.285 1.00 46.91  ? 248  ALA B CA  1 
ATOM   6064 C C   . ALA B 1 248 ? 28.297  -6.763  -47.648 1.00 55.59  ? 248  ALA B C   1 
ATOM   6065 O O   . ALA B 1 248 ? 27.948  -7.752  -48.294 1.00 54.13  ? 248  ALA B O   1 
ATOM   6066 C CB  . ALA B 1 248 ? 27.457  -4.466  -48.202 1.00 40.06  ? 248  ALA B CB  1 
ATOM   6067 N N   . THR B 1 249 ? 29.549  -6.580  -47.232 1.00 58.20  ? 249  THR B N   1 
ATOM   6068 C CA  . THR B 1 249 ? 30.589  -7.569  -47.510 1.00 59.55  ? 249  THR B CA  1 
ATOM   6069 C C   . THR B 1 249 ? 30.300  -8.908  -46.809 1.00 55.27  ? 249  THR B C   1 
ATOM   6070 O O   . THR B 1 249 ? 30.511  -9.969  -47.384 1.00 59.22  ? 249  THR B O   1 
ATOM   6071 C CB  . THR B 1 249 ? 31.995  -7.056  -47.138 1.00 64.78  ? 249  THR B CB  1 
ATOM   6072 O OG1 . THR B 1 249 ? 32.146  -7.080  -45.720 1.00 84.67  ? 249  THR B OG1 1 
ATOM   6073 C CG2 . THR B 1 249 ? 32.199  -5.630  -47.626 1.00 50.87  ? 249  THR B CG2 1 
ATOM   6074 N N   . LEU B 1 250 ? 29.802  -8.862  -45.574 1.00 51.28  ? 250  LEU B N   1 
ATOM   6075 C CA  . LEU B 1 250 ? 29.373  -10.091 -44.907 1.00 48.22  ? 250  LEU B CA  1 
ATOM   6076 C C   . LEU B 1 250 ? 28.248  -10.799 -45.678 1.00 55.70  ? 250  LEU B C   1 
ATOM   6077 O O   . LEU B 1 250 ? 28.296  -12.020 -45.911 1.00 55.65  ? 250  LEU B O   1 
ATOM   6078 C CB  . LEU B 1 250 ? 28.959  -9.823  -43.458 1.00 41.49  ? 250  LEU B CB  1 
ATOM   6079 C CG  . LEU B 1 250 ? 28.613  -11.076 -42.645 1.00 48.11  ? 250  LEU B CG  1 
ATOM   6080 C CD1 . LEU B 1 250 ? 29.698  -12.139 -42.790 1.00 49.13  ? 250  LEU B CD1 1 
ATOM   6081 C CD2 . LEU B 1 250 ? 28.404  -10.742 -41.175 1.00 46.18  ? 250  LEU B CD2 1 
ATOM   6082 N N   . LEU B 1 251 ? 27.234  -10.037 -46.080 1.00 51.74  ? 251  LEU B N   1 
ATOM   6083 C CA  . LEU B 1 251 ? 26.129  -10.626 -46.827 1.00 52.02  ? 251  LEU B CA  1 
ATOM   6084 C C   . LEU B 1 251 ? 26.620  -11.284 -48.121 1.00 51.62  ? 251  LEU B C   1 
ATOM   6085 O O   . LEU B 1 251 ? 26.205  -12.387 -48.457 1.00 51.96  ? 251  LEU B O   1 
ATOM   6086 C CB  . LEU B 1 251 ? 25.060  -9.591  -47.141 1.00 51.82  ? 251  LEU B CB  1 
ATOM   6087 C CG  . LEU B 1 251 ? 23.921  -10.219 -47.939 1.00 55.48  ? 251  LEU B CG  1 
ATOM   6088 C CD1 . LEU B 1 251 ? 22.927  -10.871 -46.987 1.00 51.93  ? 251  LEU B CD1 1 
ATOM   6089 C CD2 . LEU B 1 251 ? 23.245  -9.172  -48.782 1.00 62.18  ? 251  LEU B CD2 1 
ATOM   6090 N N   . ALA B 1 252 ? 27.508  -10.605 -48.840 1.00 54.66  ? 252  ALA B N   1 
ATOM   6091 C CA  . ALA B 1 252 ? 28.054  -11.157 -50.073 1.00 57.08  ? 252  ALA B CA  1 
ATOM   6092 C C   . ALA B 1 252 ? 28.769  -12.470 -49.768 1.00 60.24  ? 252  ALA B C   1 
ATOM   6093 O O   . ALA B 1 252 ? 28.529  -13.477 -50.417 1.00 62.58  ? 252  ALA B O   1 
ATOM   6094 C CB  . ALA B 1 252 ? 29.000  -10.173 -50.725 1.00 56.06  ? 252  ALA B CB  1 
ATOM   6095 N N   . ARG B 1 253 ? 29.649  -12.449 -48.777 1.00 57.43  ? 253  ARG B N   1 
ATOM   6096 C CA  . ARG B 1 253 ? 30.303  -13.667 -48.327 1.00 63.47  ? 253  ARG B CA  1 
ATOM   6097 C C   . ARG B 1 253 ? 29.274  -14.775 -48.102 1.00 64.81  ? 253  ARG B C   1 
ATOM   6098 O O   . ARG B 1 253 ? 29.440  -15.889 -48.596 1.00 59.13  ? 253  ARG B O   1 
ATOM   6099 C CB  . ARG B 1 253 ? 31.072  -13.406 -47.039 1.00 63.96  ? 253  ARG B CB  1 
ATOM   6100 C CG  . ARG B 1 253 ? 31.802  -14.613 -46.506 1.00 76.89  ? 253  ARG B CG  1 
ATOM   6101 C CD  . ARG B 1 253 ? 32.405  -14.325 -45.139 1.00 89.40  ? 253  ARG B CD  1 
ATOM   6102 N NE  . ARG B 1 253 ? 33.208  -15.449 -44.675 1.00 103.18 ? 253  ARG B NE  1 
ATOM   6103 C CZ  . ARG B 1 253 ? 32.704  -16.538 -44.104 1.00 108.09 ? 253  ARG B CZ  1 
ATOM   6104 N NH1 . ARG B 1 253 ? 31.391  -16.641 -43.923 1.00 104.94 ? 253  ARG B NH1 1 
ATOM   6105 N NH2 . ARG B 1 253 ? 33.514  -17.521 -43.716 1.00 107.63 ? 253  ARG B NH2 1 
ATOM   6106 N N   . LEU B 1 254 ? 28.197  -14.452 -47.383 1.00 62.97  ? 254  LEU B N   1 
ATOM   6107 C CA  . LEU B 1 254 ? 27.179  -15.440 -47.022 1.00 57.82  ? 254  LEU B CA  1 
ATOM   6108 C C   . LEU B 1 254 ? 26.429  -16.038 -48.214 1.00 62.33  ? 254  LEU B C   1 
ATOM   6109 O O   . LEU B 1 254 ? 25.976  -17.181 -48.151 1.00 62.29  ? 254  LEU B O   1 
ATOM   6110 C CB  . LEU B 1 254 ? 26.182  -14.859 -46.016 1.00 53.05  ? 254  LEU B CB  1 
ATOM   6111 C CG  . LEU B 1 254 ? 26.742  -14.563 -44.624 1.00 55.77  ? 254  LEU B CG  1 
ATOM   6112 C CD1 . LEU B 1 254 ? 25.710  -13.900 -43.748 1.00 48.28  ? 254  LEU B CD1 1 
ATOM   6113 C CD2 . LEU B 1 254 ? 27.279  -15.855 -43.972 1.00 54.56  ? 254  LEU B CD2 1 
ATOM   6114 N N   . VAL B 1 255 ? 26.286  -15.278 -49.294 1.00 55.07  ? 255  VAL B N   1 
ATOM   6115 C CA  . VAL B 1 255 ? 25.634  -15.828 -50.474 1.00 56.82  ? 255  VAL B CA  1 
ATOM   6116 C C   . VAL B 1 255 ? 26.650  -16.286 -51.515 1.00 62.14  ? 255  VAL B C   1 
ATOM   6117 O O   . VAL B 1 255 ? 26.298  -16.527 -52.666 1.00 65.68  ? 255  VAL B O   1 
ATOM   6118 C CB  . VAL B 1 255 ? 24.622  -14.840 -51.102 1.00 56.39  ? 255  VAL B CB  1 
ATOM   6119 C CG1 . VAL B 1 255 ? 23.653  -14.336 -50.030 1.00 53.87  ? 255  VAL B CG1 1 
ATOM   6120 C CG2 . VAL B 1 255 ? 25.349  -13.671 -51.765 1.00 56.48  ? 255  VAL B CG2 1 
ATOM   6121 N N   . GLY B 1 256 ? 27.909  -16.403 -51.106 1.00 66.74  ? 256  GLY B N   1 
ATOM   6122 C CA  . GLY B 1 256 ? 28.950  -16.911 -51.983 1.00 68.01  ? 256  GLY B CA  1 
ATOM   6123 C C   . GLY B 1 256 ? 29.517  -15.921 -52.986 1.00 64.61  ? 256  GLY B C   1 
ATOM   6124 O O   . GLY B 1 256 ? 29.917  -16.313 -54.069 1.00 67.94  ? 256  GLY B O   1 
ATOM   6125 N N   . CYS B 1 257 ? 29.580  -14.646 -52.623 1.00 65.96  ? 257  CYS B N   1 
ATOM   6126 C CA  . CYS B 1 257 ? 30.146  -13.632 -53.511 1.00 71.89  ? 257  CYS B CA  1 
ATOM   6127 C C   . CYS B 1 257 ? 31.476  -13.081 -52.992 1.00 79.54  ? 257  CYS B C   1 
ATOM   6128 O O   . CYS B 1 257 ? 32.490  -13.131 -53.695 1.00 86.72  ? 257  CYS B O   1 
ATOM   6129 C CB  . CYS B 1 257 ? 29.144  -12.486 -53.744 1.00 65.42  ? 257  CYS B CB  1 
ATOM   6130 S SG  . CYS B 1 257 ? 27.783  -12.907 -54.846 1.00 70.24  ? 257  CYS B SG  1 
ATOM   6131 N N   . ASN B 1 265 ? 37.531  -3.767  -55.988 1.00 104.31 ? 265  ASN B N   1 
ATOM   6132 C CA  . ASN B 1 265 ? 36.692  -4.848  -56.484 1.00 99.84  ? 265  ASN B CA  1 
ATOM   6133 C C   . ASN B 1 265 ? 35.271  -4.795  -55.929 1.00 82.53  ? 265  ASN B C   1 
ATOM   6134 O O   . ASN B 1 265 ? 34.593  -5.822  -55.849 1.00 82.89  ? 265  ASN B O   1 
ATOM   6135 C CB  . ASN B 1 265 ? 37.323  -6.211  -56.183 1.00 109.92 ? 265  ASN B CB  1 
ATOM   6136 C CG  . ASN B 1 265 ? 37.375  -6.516  -54.695 1.00 115.82 ? 265  ASN B CG  1 
ATOM   6137 O OD1 . ASN B 1 265 ? 38.009  -5.796  -53.924 1.00 118.50 ? 265  ASN B OD1 1 
ATOM   6138 N ND2 . ASN B 1 265 ? 36.711  -7.592  -54.287 1.00 116.42 ? 265  ASN B ND2 1 
ATOM   6139 N N   . ASP B 1 266 ? 34.820  -3.605  -55.543 1.00 64.35  ? 266  ASP B N   1 
ATOM   6140 C CA  . ASP B 1 266 ? 33.397  -3.419  -55.249 1.00 57.17  ? 266  ASP B CA  1 
ATOM   6141 C C   . ASP B 1 266 ? 32.559  -3.893  -56.442 1.00 63.94  ? 266  ASP B C   1 
ATOM   6142 O O   . ASP B 1 266 ? 31.534  -4.549  -56.271 1.00 59.42  ? 266  ASP B O   1 
ATOM   6143 C CB  . ASP B 1 266 ? 33.081  -1.959  -54.927 1.00 54.69  ? 266  ASP B CB  1 
ATOM   6144 C CG  . ASP B 1 266 ? 33.375  -1.601  -53.465 1.00 62.14  ? 266  ASP B CG  1 
ATOM   6145 O OD1 . ASP B 1 266 ? 33.582  -2.533  -52.656 1.00 64.41  ? 266  ASP B OD1 1 
ATOM   6146 O OD2 . ASP B 1 266 ? 33.402  -0.395  -53.122 1.00 61.72  ? 266  ASP B OD2 1 
ATOM   6147 N N   . THR B 1 267 ? 33.026  -3.587  -57.650 1.00 67.35  ? 267  THR B N   1 
ATOM   6148 C CA  . THR B 1 267 ? 32.295  -3.912  -58.871 1.00 63.89  ? 267  THR B CA  1 
ATOM   6149 C C   . THR B 1 267 ? 32.029  -5.405  -59.001 1.00 67.71  ? 267  THR B C   1 
ATOM   6150 O O   . THR B 1 267 ? 30.915  -5.825  -59.313 1.00 67.88  ? 267  THR B O   1 
ATOM   6151 C CB  . THR B 1 267 ? 33.040  -3.412  -60.118 1.00 67.00  ? 267  THR B CB  1 
ATOM   6152 O OG1 . THR B 1 267 ? 33.003  -1.983  -60.144 1.00 70.13  ? 267  THR B OG1 1 
ATOM   6153 C CG2 . THR B 1 267 ? 32.395  -3.949  -61.394 1.00 64.13  ? 267  THR B CG2 1 
ATOM   6154 N N   . GLU B 1 268 ? 33.051  -6.210  -58.755 1.00 68.62  ? 268  GLU B N   1 
ATOM   6155 C CA  . GLU B 1 268 ? 32.886  -7.649  -58.868 1.00 68.88  ? 268  GLU B CA  1 
ATOM   6156 C C   . GLU B 1 268 ? 31.895  -8.141  -57.815 1.00 61.26  ? 268  GLU B C   1 
ATOM   6157 O O   . GLU B 1 268 ? 31.056  -8.996  -58.082 1.00 61.64  ? 268  GLU B O   1 
ATOM   6158 C CB  . GLU B 1 268 ? 34.238  -8.372  -58.731 1.00 66.51  ? 268  GLU B CB  1 
ATOM   6159 N N   . LEU B 1 269 ? 31.986  -7.587  -56.617 1.00 55.33  ? 269  LEU B N   1 
ATOM   6160 C CA  . LEU B 1 269 ? 31.148  -8.036  -55.525 1.00 52.31  ? 269  LEU B CA  1 
ATOM   6161 C C   . LEU B 1 269 ? 29.678  -7.707  -55.816 1.00 54.55  ? 269  LEU B C   1 
ATOM   6162 O O   . LEU B 1 269 ? 28.790  -8.549  -55.673 1.00 55.67  ? 269  LEU B O   1 
ATOM   6163 C CB  . LEU B 1 269 ? 31.620  -7.386  -54.224 1.00 54.55  ? 269  LEU B CB  1 
ATOM   6164 C CG  . LEU B 1 269 ? 30.953  -7.847  -52.933 1.00 59.91  ? 269  LEU B CG  1 
ATOM   6165 C CD1 . LEU B 1 269 ? 31.928  -7.760  -51.762 1.00 56.05  ? 269  LEU B CD1 1 
ATOM   6166 C CD2 . LEU B 1 269 ? 29.697  -7.026  -52.665 1.00 59.93  ? 269  LEU B CD2 1 
ATOM   6167 N N   . ILE B 1 270 ? 29.432  -6.483  -56.254 1.00 54.38  ? 270  ILE B N   1 
ATOM   6168 C CA  . ILE B 1 270 ? 28.081  -6.043  -56.569 1.00 51.05  ? 270  ILE B CA  1 
ATOM   6169 C C   . ILE B 1 270 ? 27.527  -6.783  -57.787 1.00 57.18  ? 270  ILE B C   1 
ATOM   6170 O O   . ILE B 1 270 ? 26.357  -7.168  -57.813 1.00 52.68  ? 270  ILE B O   1 
ATOM   6171 C CB  . ILE B 1 270 ? 28.050  -4.529  -56.757 1.00 56.64  ? 270  ILE B CB  1 
ATOM   6172 C CG1 . ILE B 1 270 ? 28.532  -3.861  -55.460 1.00 56.40  ? 270  ILE B CG1 1 
ATOM   6173 C CG2 . ILE B 1 270 ? 26.639  -4.056  -57.094 1.00 57.21  ? 270  ILE B CG2 1 
ATOM   6174 C CD1 . ILE B 1 270 ? 28.994  -2.434  -55.622 1.00 53.94  ? 270  ILE B CD1 1 
ATOM   6175 N N   . ALA B 1 271 ? 28.379  -7.034  -58.774 1.00 60.17  ? 271  ALA B N   1 
ATOM   6176 C CA  . ALA B 1 271 ? 27.954  -7.803  -59.937 1.00 60.91  ? 271  ALA B CA  1 
ATOM   6177 C C   . ALA B 1 271 ? 27.458  -9.192  -59.532 1.00 59.22  ? 271  ALA B C   1 
ATOM   6178 O O   . ALA B 1 271 ? 26.420  -9.667  -60.017 1.00 58.36  ? 271  ALA B O   1 
ATOM   6179 C CB  . ALA B 1 271 ? 29.077  -7.909  -60.950 1.00 58.68  ? 271  ALA B CB  1 
ATOM   6180 N N   . CYS B 1 272 ? 28.195  -9.841  -58.637 1.00 55.89  ? 272  CYS B N   1 
ATOM   6181 C CA  . CYS B 1 272 ? 27.795  -11.162 -58.161 1.00 60.76  ? 272  CYS B CA  1 
ATOM   6182 C C   . CYS B 1 272 ? 26.500  -11.092 -57.327 1.00 59.73  ? 272  CYS B C   1 
ATOM   6183 O O   . CYS B 1 272 ? 25.599  -11.918 -57.488 1.00 64.91  ? 272  CYS B O   1 
ATOM   6184 C CB  . CYS B 1 272 ? 28.940  -11.840 -57.390 1.00 63.71  ? 272  CYS B CB  1 
ATOM   6185 S SG  . CYS B 1 272 ? 28.544  -13.475 -56.686 1.00 64.29  ? 272  CYS B SG  1 
ATOM   6186 N N   . LEU B 1 273 ? 26.388  -10.095 -56.460 1.00 52.82  ? 273  LEU B N   1 
ATOM   6187 C CA  . LEU B 1 273 ? 25.129  -9.897  -55.732 1.00 52.36  ? 273  LEU B CA  1 
ATOM   6188 C C   . LEU B 1 273 ? 23.942  -9.718  -56.672 1.00 49.77  ? 273  LEU B C   1 
ATOM   6189 O O   . LEU B 1 273 ? 22.861  -10.218 -56.395 1.00 49.94  ? 273  LEU B O   1 
ATOM   6190 C CB  . LEU B 1 273 ? 25.213  -8.711  -54.774 1.00 48.15  ? 273  LEU B CB  1 
ATOM   6191 C CG  . LEU B 1 273 ? 26.051  -8.970  -53.526 1.00 48.48  ? 273  LEU B CG  1 
ATOM   6192 C CD1 . LEU B 1 273 ? 26.371  -7.657  -52.813 1.00 48.18  ? 273  LEU B CD1 1 
ATOM   6193 C CD2 . LEU B 1 273 ? 25.335  -9.952  -52.600 1.00 46.99  ? 273  LEU B CD2 1 
ATOM   6194 N N   . ARG B 1 274 ? 24.146  -9.019  -57.784 1.00 48.11  ? 274  ARG B N   1 
ATOM   6195 C CA  . ARG B 1 274 ? 23.084  -8.862  -58.784 1.00 50.42  ? 274  ARG B CA  1 
ATOM   6196 C C   . ARG B 1 274 ? 22.673  -10.152 -59.504 1.00 50.08  ? 274  ARG B C   1 
ATOM   6197 O O   . ARG B 1 274 ? 21.588  -10.218 -60.065 1.00 47.09  ? 274  ARG B O   1 
ATOM   6198 C CB  . ARG B 1 274 ? 23.429  -7.781  -59.809 1.00 46.29  ? 274  ARG B CB  1 
ATOM   6199 C CG  . ARG B 1 274 ? 23.331  -6.371  -59.239 1.00 46.02  ? 274  ARG B CG  1 
ATOM   6200 C CD  . ARG B 1 274 ? 23.272  -5.355  -60.362 1.00 47.36  ? 274  ARG B CD  1 
ATOM   6201 N NE  . ARG B 1 274 ? 24.313  -5.657  -61.325 1.00 59.48  ? 274  ARG B NE  1 
ATOM   6202 C CZ  . ARG B 1 274 ? 25.453  -4.986  -61.419 1.00 63.93  ? 274  ARG B CZ  1 
ATOM   6203 N NH1 . ARG B 1 274 ? 25.683  -3.947  -60.614 1.00 56.35  ? 274  ARG B NH1 1 
ATOM   6204 N NH2 . ARG B 1 274 ? 26.351  -5.350  -62.328 1.00 65.42  ? 274  ARG B NH2 1 
ATOM   6205 N N   . THR B 1 275 ? 23.509  -11.185 -59.482 1.00 51.80  ? 275  THR B N   1 
ATOM   6206 C CA  . THR B 1 275 ? 23.077  -12.455 -60.065 1.00 50.90  ? 275  THR B CA  1 
ATOM   6207 C C   . THR B 1 275 ? 22.135  -13.211 -59.131 1.00 52.83  ? 275  THR B C   1 
ATOM   6208 O O   . THR B 1 275 ? 21.428  -14.113 -59.563 1.00 57.65  ? 275  THR B O   1 
ATOM   6209 C CB  . THR B 1 275 ? 24.259  -13.398 -60.413 1.00 51.97  ? 275  THR B CB  1 
ATOM   6210 O OG1 . THR B 1 275 ? 24.908  -13.829 -59.205 1.00 50.55  ? 275  THR B OG1 1 
ATOM   6211 C CG2 . THR B 1 275 ? 25.261  -12.703 -61.332 1.00 45.43  ? 275  THR B CG2 1 
ATOM   6212 N N   . ARG B 1 276 ? 22.119  -12.855 -57.850 1.00 47.66  ? 276  ARG B N   1 
ATOM   6213 C CA  . ARG B 1 276 ? 21.381  -13.664 -56.884 1.00 49.17  ? 276  ARG B CA  1 
ATOM   6214 C C   . ARG B 1 276 ? 19.866  -13.434 -56.917 1.00 53.40  ? 276  ARG B C   1 
ATOM   6215 O O   . ARG B 1 276 ? 19.400  -12.291 -56.989 1.00 52.26  ? 276  ARG B O   1 
ATOM   6216 C CB  . ARG B 1 276 ? 21.933  -13.449 -55.460 1.00 51.80  ? 276  ARG B CB  1 
ATOM   6217 C CG  . ARG B 1 276 ? 23.385  -13.921 -55.260 1.00 56.11  ? 276  ARG B CG  1 
ATOM   6218 C CD  . ARG B 1 276 ? 23.517  -15.432 -55.455 1.00 59.22  ? 276  ARG B CD  1 
ATOM   6219 N NE  . ARG B 1 276 ? 24.833  -15.946 -55.078 1.00 67.34  ? 276  ARG B NE  1 
ATOM   6220 C CZ  . ARG B 1 276 ? 25.822  -16.194 -55.938 1.00 72.06  ? 276  ARG B CZ  1 
ATOM   6221 N NH1 . ARG B 1 276 ? 25.660  -15.963 -57.235 1.00 73.45  ? 276  ARG B NH1 1 
ATOM   6222 N NH2 . ARG B 1 276 ? 26.983  -16.663 -55.500 1.00 71.09  ? 276  ARG B NH2 1 
ATOM   6223 N N   . PRO B 1 277 ? 19.092  -14.526 -56.849 1.00 52.92  ? 277  PRO B N   1 
ATOM   6224 C CA  . PRO B 1 277 ? 17.633  -14.444 -56.742 1.00 50.53  ? 277  PRO B CA  1 
ATOM   6225 C C   . PRO B 1 277 ? 17.233  -13.698 -55.458 1.00 50.38  ? 277  PRO B C   1 
ATOM   6226 O O   . PRO B 1 277 ? 17.918  -13.787 -54.434 1.00 49.29  ? 277  PRO B O   1 
ATOM   6227 C CB  . PRO B 1 277 ? 17.192  -15.922 -56.680 1.00 48.70  ? 277  PRO B CB  1 
ATOM   6228 C CG  . PRO B 1 277 ? 18.338  -16.703 -57.190 1.00 48.59  ? 277  PRO B CG  1 
ATOM   6229 C CD  . PRO B 1 277 ? 19.571  -15.918 -56.832 1.00 54.73  ? 277  PRO B CD  1 
ATOM   6230 N N   . ALA B 1 278 ? 16.125  -12.970 -55.515 1.00 49.68  ? 278  ALA B N   1 
ATOM   6231 C CA  . ALA B 1 278 ? 15.759  -12.085 -54.420 1.00 48.29  ? 278  ALA B CA  1 
ATOM   6232 C C   . ALA B 1 278 ? 15.696  -12.801 -53.072 1.00 47.70  ? 278  ALA B C   1 
ATOM   6233 O O   . ALA B 1 278 ? 16.235  -12.301 -52.080 1.00 48.04  ? 278  ALA B O   1 
ATOM   6234 C CB  . ALA B 1 278 ? 14.434  -11.365 -54.716 1.00 46.54  ? 278  ALA B CB  1 
ATOM   6235 N N   . GLN B 1 279 ? 15.049  -13.965 -53.033 1.00 46.76  ? 279  GLN B N   1 
ATOM   6236 C CA  . GLN B 1 279 ? 14.905  -14.700 -51.778 1.00 48.22  ? 279  GLN B CA  1 
ATOM   6237 C C   . GLN B 1 279 ? 16.244  -15.138 -51.166 1.00 50.97  ? 279  GLN B C   1 
ATOM   6238 O O   . GLN B 1 279 ? 16.334  -15.322 -49.954 1.00 48.61  ? 279  GLN B O   1 
ATOM   6239 C CB  . GLN B 1 279 ? 13.966  -15.903 -51.929 1.00 47.00  ? 279  GLN B CB  1 
ATOM   6240 C CG  . GLN B 1 279 ? 13.516  -16.491 -50.589 1.00 48.84  ? 279  GLN B CG  1 
ATOM   6241 C CD  . GLN B 1 279 ? 12.899  -15.446 -49.635 1.00 53.85  ? 279  GLN B CD  1 
ATOM   6242 O OE1 . GLN B 1 279 ? 12.217  -14.517 -50.064 1.00 49.65  ? 279  GLN B OE1 1 
ATOM   6243 N NE2 . GLN B 1 279 ? 13.135  -15.617 -48.336 1.00 50.62  ? 279  GLN B NE2 1 
ATOM   6244 N N   . ASP B 1 280 ? 17.284  -15.291 -51.982 1.00 49.59  ? 280  ASP B N   1 
ATOM   6245 C CA  . ASP B 1 280 ? 18.596  -15.627 -51.423 1.00 55.27  ? 280  ASP B CA  1 
ATOM   6246 C C   . ASP B 1 280 ? 19.123  -14.474 -50.562 1.00 55.69  ? 280  ASP B C   1 
ATOM   6247 O O   . ASP B 1 280 ? 19.671  -14.696 -49.483 1.00 56.48  ? 280  ASP B O   1 
ATOM   6248 C CB  . ASP B 1 280 ? 19.617  -15.998 -52.506 1.00 53.60  ? 280  ASP B CB  1 
ATOM   6249 C CG  . ASP B 1 280 ? 19.262  -17.286 -53.237 1.00 65.67  ? 280  ASP B CG  1 
ATOM   6250 O OD1 . ASP B 1 280 ? 18.258  -17.935 -52.869 1.00 70.99  ? 280  ASP B OD1 1 
ATOM   6251 O OD2 . ASP B 1 280 ? 19.989  -17.649 -54.188 1.00 68.91  ? 280  ASP B OD2 1 
ATOM   6252 N N   . LEU B 1 281 ? 18.960  -13.246 -51.037 1.00 53.48  ? 281  LEU B N   1 
ATOM   6253 C CA  . LEU B 1 281 ? 19.365  -12.082 -50.253 1.00 51.48  ? 281  LEU B CA  1 
ATOM   6254 C C   . LEU B 1 281 ? 18.570  -12.008 -48.942 1.00 49.79  ? 281  LEU B C   1 
ATOM   6255 O O   . LEU B 1 281 ? 19.148  -11.912 -47.857 1.00 48.79  ? 281  LEU B O   1 
ATOM   6256 C CB  . LEU B 1 281 ? 19.224  -10.797 -51.079 1.00 52.62  ? 281  LEU B CB  1 
ATOM   6257 C CG  . LEU B 1 281 ? 20.452  -10.417 -51.925 1.00 53.43  ? 281  LEU B CG  1 
ATOM   6258 C CD1 . LEU B 1 281 ? 21.302  -11.619 -52.263 1.00 49.71  ? 281  LEU B CD1 1 
ATOM   6259 C CD2 . LEU B 1 281 ? 20.078  -9.661  -53.177 1.00 46.71  ? 281  LEU B CD2 1 
ATOM   6260 N N   . VAL B 1 282 ? 17.246  -12.079 -49.047 1.00 48.79  ? 282  VAL B N   1 
ATOM   6261 C CA  . VAL B 1 282 ? 16.379  -12.044 -47.876 1.00 54.27  ? 282  VAL B CA  1 
ATOM   6262 C C   . VAL B 1 282 ? 16.707  -13.171 -46.873 1.00 56.16  ? 282  VAL B C   1 
ATOM   6263 O O   . VAL B 1 282 ? 16.665  -12.974 -45.652 1.00 51.25  ? 282  VAL B O   1 
ATOM   6264 C CB  . VAL B 1 282 ? 14.885  -12.060 -48.288 1.00 46.64  ? 282  VAL B CB  1 
ATOM   6265 C CG1 . VAL B 1 282 ? 13.985  -12.141 -47.065 1.00 45.84  ? 282  VAL B CG1 1 
ATOM   6266 C CG2 . VAL B 1 282 ? 14.560  -10.826 -49.088 1.00 39.37  ? 282  VAL B CG2 1 
ATOM   6267 N N   . ASP B 1 283 ? 17.058  -14.345 -47.388 1.00 58.02  ? 283  ASP B N   1 
ATOM   6268 C CA  . ASP B 1 283 ? 17.429  -15.462 -46.517 1.00 54.93  ? 283  ASP B CA  1 
ATOM   6269 C C   . ASP B 1 283 ? 18.529  -15.121 -45.509 1.00 52.46  ? 283  ASP B C   1 
ATOM   6270 O O   . ASP B 1 283 ? 18.537  -15.653 -44.403 1.00 53.85  ? 283  ASP B O   1 
ATOM   6271 C CB  . ASP B 1 283 ? 17.869  -16.677 -47.340 1.00 60.56  ? 283  ASP B CB  1 
ATOM   6272 C CG  . ASP B 1 283 ? 16.699  -17.448 -47.922 1.00 65.28  ? 283  ASP B CG  1 
ATOM   6273 O OD1 . ASP B 1 283 ? 15.550  -17.189 -47.495 1.00 61.66  ? 283  ASP B OD1 1 
ATOM   6274 O OD2 . ASP B 1 283 ? 16.933  -18.316 -48.803 1.00 70.15  ? 283  ASP B OD2 1 
ATOM   6275 N N   . HIS B 1 284 ? 19.469  -14.261 -45.893 1.00 50.80  ? 284  HIS B N   1 
ATOM   6276 C CA  . HIS B 1 284 ? 20.636  -13.986 -45.048 1.00 50.48  ? 284  HIS B CA  1 
ATOM   6277 C C   . HIS B 1 284 ? 20.677  -12.570 -44.488 1.00 53.38  ? 284  HIS B C   1 
ATOM   6278 O O   . HIS B 1 284 ? 21.623  -12.192 -43.800 1.00 54.50  ? 284  HIS B O   1 
ATOM   6279 C CB  . HIS B 1 284 ? 21.925  -14.236 -45.826 1.00 60.87  ? 284  HIS B CB  1 
ATOM   6280 C CG  . HIS B 1 284 ? 22.208  -15.683 -46.070 1.00 67.08  ? 284  HIS B CG  1 
ATOM   6281 N ND1 . HIS B 1 284 ? 22.704  -16.516 -45.091 1.00 69.84  ? 284  HIS B ND1 1 
ATOM   6282 C CD2 . HIS B 1 284 ? 22.063  -16.446 -47.179 1.00 67.40  ? 284  HIS B CD2 1 
ATOM   6283 C CE1 . HIS B 1 284 ? 22.853  -17.731 -45.587 1.00 72.77  ? 284  HIS B CE1 1 
ATOM   6284 N NE2 . HIS B 1 284 ? 22.471  -17.716 -46.851 1.00 72.00  ? 284  HIS B NE2 1 
ATOM   6285 N N   . GLU B 1 285 ? 19.656  -11.777 -44.769 1.00 53.19  ? 285  GLU B N   1 
ATOM   6286 C CA  . GLU B 1 285 ? 19.749  -10.381 -44.409 1.00 49.66  ? 285  GLU B CA  1 
ATOM   6287 C C   . GLU B 1 285 ? 19.825  -10.185 -42.891 1.00 52.39  ? 285  GLU B C   1 
ATOM   6288 O O   . GLU B 1 285 ? 20.569  -9.322  -42.426 1.00 48.92  ? 285  GLU B O   1 
ATOM   6289 C CB  . GLU B 1 285 ? 18.630  -9.558  -45.054 1.00 51.22  ? 285  GLU B CB  1 
ATOM   6290 C CG  . GLU B 1 285 ? 17.301  -9.589  -44.337 1.00 55.50  ? 285  GLU B CG  1 
ATOM   6291 C CD  . GLU B 1 285 ? 16.302  -8.607  -44.958 1.00 64.68  ? 285  GLU B CD  1 
ATOM   6292 O OE1 . GLU B 1 285 ? 15.093  -8.727  -44.683 1.00 66.49  ? 285  GLU B OE1 1 
ATOM   6293 O OE2 . GLU B 1 285 ? 16.727  -7.723  -45.728 1.00 62.39  ? 285  GLU B OE2 1 
ATOM   6294 N N   . TRP B 1 286 ? 19.086  -10.988 -42.123 1.00 47.27  ? 286  TRP B N   1 
ATOM   6295 C CA  . TRP B 1 286 ? 19.072  -10.819 -40.667 1.00 50.59  ? 286  TRP B CA  1 
ATOM   6296 C C   . TRP B 1 286 ? 20.353  -11.326 -39.996 1.00 59.69  ? 286  TRP B C   1 
ATOM   6297 O O   . TRP B 1 286 ? 20.569  -11.087 -38.811 1.00 70.99  ? 286  TRP B O   1 
ATOM   6298 C CB  . TRP B 1 286 ? 17.854  -11.497 -40.033 1.00 49.92  ? 286  TRP B CB  1 
ATOM   6299 N N   . HIS B 1 287 ? 21.211  -12.002 -40.754 1.00 50.68  ? 287  HIS B N   1 
ATOM   6300 C CA  . HIS B 1 287 ? 22.415  -12.607 -40.194 1.00 50.83  ? 287  HIS B CA  1 
ATOM   6301 C C   . HIS B 1 287 ? 23.623  -11.683 -40.099 1.00 55.72  ? 287  HIS B C   1 
ATOM   6302 O O   . HIS B 1 287 ? 24.701  -12.132 -39.698 1.00 61.00  ? 287  HIS B O   1 
ATOM   6303 C CB  . HIS B 1 287 ? 22.816  -13.846 -41.001 1.00 55.34  ? 287  HIS B CB  1 
ATOM   6304 C CG  . HIS B 1 287 ? 21.791  -14.930 -40.993 1.00 61.32  ? 287  HIS B CG  1 
ATOM   6305 N ND1 . HIS B 1 287 ? 21.650  -15.831 -42.027 1.00 70.63  ? 287  HIS B ND1 1 
ATOM   6306 C CD2 . HIS B 1 287 ? 20.847  -15.255 -40.077 1.00 62.84  ? 287  HIS B CD2 1 
ATOM   6307 C CE1 . HIS B 1 287 ? 20.669  -16.669 -41.745 1.00 74.99  ? 287  HIS B CE1 1 
ATOM   6308 N NE2 . HIS B 1 287 ? 20.159  -16.335 -40.572 1.00 73.95  ? 287  HIS B NE2 1 
ATOM   6309 N N   . VAL B 1 288 ? 23.475  -10.412 -40.468 1.00 50.84  ? 288  VAL B N   1 
ATOM   6310 C CA  . VAL B 1 288 ? 24.642  -9.515  -40.481 1.00 52.11  ? 288  VAL B CA  1 
ATOM   6311 C C   . VAL B 1 288 ? 24.713  -8.499  -39.330 1.00 51.80  ? 288  VAL B C   1 
ATOM   6312 O O   . VAL B 1 288 ? 25.661  -7.710  -39.245 1.00 55.14  ? 288  VAL B O   1 
ATOM   6313 C CB  . VAL B 1 288 ? 24.812  -8.801  -41.851 1.00 45.44  ? 288  VAL B CB  1 
ATOM   6314 C CG1 . VAL B 1 288 ? 24.758  -9.820  -42.980 1.00 53.13  ? 288  VAL B CG1 1 
ATOM   6315 C CG2 . VAL B 1 288 ? 23.753  -7.703  -42.044 1.00 40.73  ? 288  VAL B CG2 1 
ATOM   6316 N N   . LEU B 1 289 ? 23.713  -8.503  -38.453 1.00 51.89  ? 289  LEU B N   1 
ATOM   6317 C CA  . LEU B 1 289 ? 23.750  -7.647  -37.273 1.00 47.73  ? 289  LEU B CA  1 
ATOM   6318 C C   . LEU B 1 289 ? 24.911  -8.051  -36.362 1.00 54.40  ? 289  LEU B C   1 
ATOM   6319 O O   . LEU B 1 289 ? 25.162  -9.236  -36.152 1.00 53.30  ? 289  LEU B O   1 
ATOM   6320 C CB  . LEU B 1 289 ? 22.419  -7.704  -36.520 1.00 49.28  ? 289  LEU B CB  1 
ATOM   6321 C CG  . LEU B 1 289 ? 21.258  -7.031  -37.265 1.00 48.90  ? 289  LEU B CG  1 
ATOM   6322 C CD1 . LEU B 1 289 ? 19.915  -7.324  -36.620 1.00 47.83  ? 289  LEU B CD1 1 
ATOM   6323 C CD2 . LEU B 1 289 ? 21.492  -5.522  -37.370 1.00 43.70  ? 289  LEU B CD2 1 
ATOM   6324 N N   . PRO B 1 290 ? 25.629  -7.060  -35.816 1.00 54.12  ? 290  PRO B N   1 
ATOM   6325 C CA  . PRO B 1 290 ? 26.780  -7.324  -34.946 1.00 49.99  ? 290  PRO B CA  1 
ATOM   6326 C C   . PRO B 1 290 ? 26.400  -7.988  -33.609 1.00 55.78  ? 290  PRO B C   1 
ATOM   6327 O O   . PRO B 1 290 ? 27.213  -8.739  -33.077 1.00 59.25  ? 290  PRO B O   1 
ATOM   6328 C CB  . PRO B 1 290 ? 27.342  -5.921  -34.700 1.00 46.07  ? 290  PRO B CB  1 
ATOM   6329 C CG  . PRO B 1 290 ? 26.134  -5.035  -34.834 1.00 43.70  ? 290  PRO B CG  1 
ATOM   6330 C CD  . PRO B 1 290 ? 25.444  -5.616  -36.030 1.00 44.39  ? 290  PRO B CD  1 
ATOM   6331 N N   . GLN B 1 291 ? 25.208  -7.727  -33.071 1.00 50.34  ? 291  GLN B N   1 
ATOM   6332 C CA  . GLN B 1 291 ? 24.811  -8.351  -31.798 1.00 52.39  ? 291  GLN B CA  1 
ATOM   6333 C C   . GLN B 1 291 ? 23.408  -8.946  -31.844 1.00 50.29  ? 291  GLN B C   1 
ATOM   6334 O O   . GLN B 1 291 ? 22.606  -8.594  -32.695 1.00 51.20  ? 291  GLN B O   1 
ATOM   6335 C CB  . GLN B 1 291 ? 24.901  -7.360  -30.612 1.00 49.13  ? 291  GLN B CB  1 
ATOM   6336 C CG  . GLN B 1 291 ? 26.290  -6.759  -30.347 1.00 59.01  ? 291  GLN B CG  1 
ATOM   6337 C CD  . GLN B 1 291 ? 26.548  -5.465  -31.128 1.00 70.49  ? 291  GLN B CD  1 
ATOM   6338 O OE1 . GLN B 1 291 ? 27.685  -4.980  -31.196 1.00 73.89  ? 291  GLN B OE1 1 
ATOM   6339 N NE2 . GLN B 1 291 ? 25.490  -4.901  -31.715 1.00 66.29  ? 291  GLN B NE2 1 
ATOM   6340 N N   . GLU B 1 292 ? 23.114  -9.856  -30.922 1.00 52.00  ? 292  GLU B N   1 
ATOM   6341 C CA  . GLU B 1 292 ? 21.738  -10.265 -30.718 1.00 55.80  ? 292  GLU B CA  1 
ATOM   6342 C C   . GLU B 1 292 ? 21.005  -9.009  -30.260 1.00 52.48  ? 292  GLU B C   1 
ATOM   6343 O O   . GLU B 1 292 ? 21.441  -8.343  -29.324 1.00 60.38  ? 292  GLU B O   1 
ATOM   6344 C CB  . GLU B 1 292 ? 21.629  -11.349 -29.644 1.00 61.93  ? 292  GLU B CB  1 
ATOM   6345 C CG  . GLU B 1 292 ? 20.343  -12.164 -29.768 1.00 74.04  ? 292  GLU B CG  1 
ATOM   6346 C CD  . GLU B 1 292 ? 19.956  -12.899 -28.491 1.00 85.53  ? 292  GLU B CD  1 
ATOM   6347 O OE1 . GLU B 1 292 ? 20.799  -13.010 -27.568 1.00 83.79  ? 292  GLU B OE1 1 
ATOM   6348 O OE2 . GLU B 1 292 ? 18.797  -13.370 -28.421 1.00 91.06  ? 292  GLU B OE2 1 
ATOM   6349 N N   . SER B 1 293 ? 19.903  -8.678  -30.910 1.00 46.10  ? 293  SER B N   1 
ATOM   6350 C CA  . SER B 1 293 ? 19.228  -7.430  -30.603 1.00 49.01  ? 293  SER B CA  1 
ATOM   6351 C C   . SER B 1 293 ? 17.761  -7.428  -30.999 1.00 47.91  ? 293  SER B C   1 
ATOM   6352 O O   . SER B 1 293 ? 17.283  -8.350  -31.666 1.00 46.64  ? 293  SER B O   1 
ATOM   6353 C CB  . SER B 1 293 ? 19.966  -6.266  -31.267 1.00 47.09  ? 293  SER B CB  1 
ATOM   6354 O OG  . SER B 1 293 ? 20.345  -6.590  -32.590 1.00 48.41  ? 293  SER B OG  1 
ATOM   6355 N N   . ILE B 1 294 ? 17.042  -6.407  -30.542 1.00 44.09  ? 294  ILE B N   1 
ATOM   6356 C CA  . ILE B 1 294 ? 15.735  -6.095  -31.096 1.00 45.79  ? 294  ILE B CA  1 
ATOM   6357 C C   . ILE B 1 294 ? 15.752  -4.612  -31.452 1.00 45.40  ? 294  ILE B C   1 
ATOM   6358 O O   . ILE B 1 294 ? 16.601  -3.875  -30.961 1.00 43.81  ? 294  ILE B O   1 
ATOM   6359 C CB  . ILE B 1 294 ? 14.578  -6.416  -30.122 1.00 49.15  ? 294  ILE B CB  1 
ATOM   6360 C CG1 . ILE B 1 294 ? 14.796  -5.706  -28.787 1.00 45.06  ? 294  ILE B CG1 1 
ATOM   6361 C CG2 . ILE B 1 294 ? 14.450  -7.924  -29.913 1.00 52.00  ? 294  ILE B CG2 1 
ATOM   6362 C CD1 . ILE B 1 294 ? 13.606  -5.805  -27.861 1.00 41.20  ? 294  ILE B CD1 1 
ATOM   6363 N N   . PHE B 1 295 ? 14.834  -4.194  -32.321 1.00 44.87  ? 295  PHE B N   1 
ATOM   6364 C CA  . PHE B 1 295 ? 14.738  -2.802  -32.758 1.00 40.68  ? 295  PHE B CA  1 
ATOM   6365 C C   . PHE B 1 295 ? 16.047  -2.413  -33.423 1.00 44.99  ? 295  PHE B C   1 
ATOM   6366 O O   . PHE B 1 295 ? 16.555  -1.286  -33.268 1.00 43.54  ? 295  PHE B O   1 
ATOM   6367 C CB  . PHE B 1 295 ? 14.401  -1.862  -31.589 1.00 34.54  ? 295  PHE B CB  1 
ATOM   6368 C CG  . PHE B 1 295 ? 13.438  -0.746  -31.968 1.00 37.43  ? 295  PHE B CG  1 
ATOM   6369 C CD1 . PHE B 1 295 ? 13.668  0.038   -33.100 1.00 29.22  ? 295  PHE B CD1 1 
ATOM   6370 C CD2 . PHE B 1 295 ? 12.286  -0.512  -31.218 1.00 36.89  ? 295  PHE B CD2 1 
ATOM   6371 C CE1 . PHE B 1 295 ? 12.774  1.029   -33.462 1.00 35.01  ? 295  PHE B CE1 1 
ATOM   6372 C CE2 . PHE B 1 295 ? 11.382  0.491   -31.577 1.00 36.08  ? 295  PHE B CE2 1 
ATOM   6373 C CZ  . PHE B 1 295 ? 11.636  1.265   -32.691 1.00 38.18  ? 295  PHE B CZ  1 
ATOM   6374 N N   . ARG B 1 296 ? 16.600  -3.374  -34.156 1.00 40.06  ? 296  ARG B N   1 
ATOM   6375 C CA  . ARG B 1 296 ? 17.823  -3.159  -34.920 1.00 41.76  ? 296  ARG B CA  1 
ATOM   6376 C C   . ARG B 1 296 ? 17.651  -3.815  -36.301 1.00 43.00  ? 296  ARG B C   1 
ATOM   6377 O O   . ARG B 1 296 ? 17.075  -4.902  -36.419 1.00 44.56  ? 296  ARG B O   1 
ATOM   6378 C CB  . ARG B 1 296 ? 19.025  -3.717  -34.160 1.00 48.98  ? 296  ARG B CB  1 
ATOM   6379 C CG  . ARG B 1 296 ? 20.262  -2.816  -34.178 1.00 59.72  ? 296  ARG B CG  1 
ATOM   6380 C CD  . ARG B 1 296 ? 20.539  -2.077  -32.857 1.00 50.83  ? 296  ARG B CD  1 
ATOM   6381 N NE  . ARG B 1 296 ? 19.418  -1.271  -32.462 1.00 56.92  ? 296  ARG B NE  1 
ATOM   6382 C CZ  . ARG B 1 296 ? 19.379  -0.408  -31.446 1.00 49.86  ? 296  ARG B CZ  1 
ATOM   6383 N NH1 . ARG B 1 296 ? 20.415  -0.171  -30.652 1.00 49.19  ? 296  ARG B NH1 1 
ATOM   6384 N NH2 . ARG B 1 296 ? 18.248  0.227   -31.236 1.00 42.90  ? 296  ARG B NH2 1 
ATOM   6385 N N   . PHE B 1 297 ? 18.120  -3.148  -37.349 1.00 40.43  ? 297  PHE B N   1 
ATOM   6386 C CA  . PHE B 1 297 ? 17.829  -3.587  -38.722 1.00 39.97  ? 297  PHE B CA  1 
ATOM   6387 C C   . PHE B 1 297 ? 19.081  -3.542  -39.587 1.00 46.14  ? 297  PHE B C   1 
ATOM   6388 O O   . PHE B 1 297 ? 19.900  -2.621  -39.480 1.00 39.51  ? 297  PHE B O   1 
ATOM   6389 C CB  . PHE B 1 297 ? 16.686  -2.749  -39.308 1.00 39.45  ? 297  PHE B CB  1 
ATOM   6390 C CG  . PHE B 1 297 ? 15.569  -2.505  -38.320 1.00 37.54  ? 297  PHE B CG  1 
ATOM   6391 C CD1 . PHE B 1 297 ? 14.734  -3.548  -37.929 1.00 36.50  ? 297  PHE B CD1 1 
ATOM   6392 C CD2 . PHE B 1 297 ? 15.393  -1.256  -37.735 1.00 39.43  ? 297  PHE B CD2 1 
ATOM   6393 C CE1 . PHE B 1 297 ? 13.721  -3.335  -36.985 1.00 38.77  ? 297  PHE B CE1 1 
ATOM   6394 C CE2 . PHE B 1 297 ? 14.375  -1.030  -36.803 1.00 37.23  ? 297  PHE B CE2 1 
ATOM   6395 C CZ  . PHE B 1 297 ? 13.537  -2.077  -36.432 1.00 36.33  ? 297  PHE B CZ  1 
ATOM   6396 N N   . SER B 1 298 ? 19.239  -4.563  -40.421 1.00 44.18  ? 298  SER B N   1 
ATOM   6397 C CA  . SER B 1 298 ? 20.492  -4.796  -41.132 1.00 47.58  ? 298  SER B CA  1 
ATOM   6398 C C   . SER B 1 298 ? 20.847  -3.742  -42.174 1.00 42.56  ? 298  SER B C   1 
ATOM   6399 O O   . SER B 1 298 ? 21.968  -3.235  -42.205 1.00 44.30  ? 298  SER B O   1 
ATOM   6400 C CB  . SER B 1 298 ? 20.462  -6.176  -41.778 1.00 48.72  ? 298  SER B CB  1 
ATOM   6401 O OG  . SER B 1 298 ? 20.444  -7.160  -40.764 1.00 51.39  ? 298  SER B OG  1 
ATOM   6402 N N   . PHE B 1 299 ? 19.890  -3.406  -43.020 1.00 33.13  ? 299  PHE B N   1 
ATOM   6403 C CA  . PHE B 1 299 ? 20.140  -2.465  -44.102 1.00 36.52  ? 299  PHE B CA  1 
ATOM   6404 C C   . PHE B 1 299 ? 19.229  -1.233  -43.977 1.00 42.03  ? 299  PHE B C   1 
ATOM   6405 O O   . PHE B 1 299 ? 18.024  -1.307  -44.198 1.00 41.14  ? 299  PHE B O   1 
ATOM   6406 C CB  . PHE B 1 299 ? 20.035  -3.188  -45.455 1.00 31.64  ? 299  PHE B CB  1 
ATOM   6407 C CG  . PHE B 1 299 ? 21.013  -4.358  -45.574 1.00 36.05  ? 299  PHE B CG  1 
ATOM   6408 C CD1 . PHE B 1 299 ? 22.336  -4.137  -45.924 1.00 33.39  ? 299  PHE B CD1 1 
ATOM   6409 C CD2 . PHE B 1 299 ? 20.620  -5.651  -45.256 1.00 38.42  ? 299  PHE B CD2 1 
ATOM   6410 C CE1 . PHE B 1 299 ? 23.245  -5.195  -45.993 1.00 45.45  ? 299  PHE B CE1 1 
ATOM   6411 C CE2 . PHE B 1 299 ? 21.515  -6.715  -45.314 1.00 41.66  ? 299  PHE B CE2 1 
ATOM   6412 C CZ  . PHE B 1 299 ? 22.830  -6.492  -45.687 1.00 41.34  ? 299  PHE B CZ  1 
ATOM   6413 N N   . VAL B 1 300 ? 19.836  -0.117  -43.584 1.00 36.37  ? 300  VAL B N   1 
ATOM   6414 C CA  . VAL B 1 300 ? 19.133  1.124   -43.282 1.00 30.70  ? 300  VAL B CA  1 
ATOM   6415 C C   . VAL B 1 300 ? 19.910  2.252   -43.953 1.00 29.74  ? 300  VAL B C   1 
ATOM   6416 O O   . VAL B 1 300 ? 20.986  2.017   -44.498 1.00 36.70  ? 300  VAL B O   1 
ATOM   6417 C CB  . VAL B 1 300 ? 19.069  1.378   -41.737 1.00 33.04  ? 300  VAL B CB  1 
ATOM   6418 C CG1 . VAL B 1 300 ? 18.397  0.209   -40.998 1.00 31.49  ? 300  VAL B CG1 1 
ATOM   6419 C CG2 . VAL B 1 300 ? 20.460  1.589   -41.188 1.00 34.25  ? 300  VAL B CG2 1 
ATOM   6420 N N   . PRO B 1 301 ? 19.358  3.477   -43.942 1.00 34.01  ? 301  PRO B N   1 
ATOM   6421 C CA  . PRO B 1 301 ? 20.075  4.625   -44.496 1.00 33.60  ? 301  PRO B CA  1 
ATOM   6422 C C   . PRO B 1 301 ? 21.507  4.701   -43.962 1.00 42.17  ? 301  PRO B C   1 
ATOM   6423 O O   . PRO B 1 301 ? 21.750  4.399   -42.792 1.00 38.36  ? 301  PRO B O   1 
ATOM   6424 C CB  . PRO B 1 301 ? 19.263  5.800   -43.965 1.00 34.09  ? 301  PRO B CB  1 
ATOM   6425 C CG  . PRO B 1 301 ? 17.839  5.267   -44.018 1.00 33.81  ? 301  PRO B CG  1 
ATOM   6426 C CD  . PRO B 1 301 ? 17.966  3.824   -43.569 1.00 29.66  ? 301  PRO B CD  1 
ATOM   6427 N N   . VAL B 1 302 ? 22.442  5.088   -44.821 1.00 41.22  ? 302  VAL B N   1 
ATOM   6428 C CA  . VAL B 1 302 ? 23.846  5.147   -44.451 1.00 33.07  ? 302  VAL B CA  1 
ATOM   6429 C C   . VAL B 1 302 ? 24.364  6.582   -44.484 1.00 38.77  ? 302  VAL B C   1 
ATOM   6430 O O   . VAL B 1 302 ? 24.027  7.352   -45.382 1.00 40.77  ? 302  VAL B O   1 
ATOM   6431 C CB  . VAL B 1 302 ? 24.714  4.245   -45.372 1.00 38.77  ? 302  VAL B CB  1 
ATOM   6432 C CG1 . VAL B 1 302 ? 24.553  4.653   -46.841 1.00 37.94  ? 302  VAL B CG1 1 
ATOM   6433 C CG2 . VAL B 1 302 ? 26.189  4.283   -44.947 1.00 39.11  ? 302  VAL B CG2 1 
ATOM   6434 N N   . VAL B 1 303 ? 25.167  6.955   -43.493 1.00 43.35  ? 303  VAL B N   1 
ATOM   6435 C CA  . VAL B 1 303 ? 25.776  8.281   -43.500 1.00 39.70  ? 303  VAL B CA  1 
ATOM   6436 C C   . VAL B 1 303 ? 26.849  8.273   -44.585 1.00 45.55  ? 303  VAL B C   1 
ATOM   6437 O O   . VAL B 1 303 ? 27.975  7.850   -44.344 1.00 49.40  ? 303  VAL B O   1 
ATOM   6438 C CB  . VAL B 1 303 ? 26.383  8.637   -42.131 1.00 43.13  ? 303  VAL B CB  1 
ATOM   6439 C CG1 . VAL B 1 303 ? 27.005  10.038  -42.162 1.00 41.27  ? 303  VAL B CG1 1 
ATOM   6440 C CG2 . VAL B 1 303 ? 25.311  8.549   -41.051 1.00 33.99  ? 303  VAL B CG2 1 
ATOM   6441 N N   . ASP B 1 304 ? 26.476  8.734   -45.779 1.00 45.38  ? 304  ASP B N   1 
ATOM   6442 C CA  . ASP B 1 304 ? 27.287  8.588   -46.995 1.00 46.79  ? 304  ASP B CA  1 
ATOM   6443 C C   . ASP B 1 304 ? 28.094  9.836   -47.334 1.00 46.52  ? 304  ASP B C   1 
ATOM   6444 O O   . ASP B 1 304 ? 28.984  9.793   -48.170 1.00 49.75  ? 304  ASP B O   1 
ATOM   6445 C CB  . ASP B 1 304 ? 26.399  8.203   -48.205 1.00 37.90  ? 304  ASP B CB  1 
ATOM   6446 C CG  . ASP B 1 304 ? 25.232  9.173   -48.420 1.00 40.88  ? 304  ASP B CG  1 
ATOM   6447 O OD1 . ASP B 1 304 ? 24.982  10.034  -47.542 1.00 43.06  ? 304  ASP B OD1 1 
ATOM   6448 O OD2 . ASP B 1 304 ? 24.549  9.072   -49.465 1.00 44.38  ? 304  ASP B OD2 1 
ATOM   6449 N N   . GLY B 1 305 ? 27.793  10.946  -46.676 1.00 50.74  ? 305  GLY B N   1 
ATOM   6450 C CA  . GLY B 1 305 ? 28.410  12.207  -47.038 1.00 49.90  ? 305  GLY B CA  1 
ATOM   6451 C C   . GLY B 1 305 ? 27.792  12.753  -48.313 1.00 52.32  ? 305  GLY B C   1 
ATOM   6452 O O   . GLY B 1 305 ? 28.325  13.672  -48.928 1.00 54.48  ? 305  GLY B O   1 
ATOM   6453 N N   . ASP B 1 306 ? 26.654  12.193  -48.709 1.00 47.14  ? 306  ASP B N   1 
ATOM   6454 C CA  . ASP B 1 306 ? 25.969  12.649  -49.910 1.00 47.49  ? 306  ASP B CA  1 
ATOM   6455 C C   . ASP B 1 306 ? 24.500  12.941  -49.585 1.00 46.80  ? 306  ASP B C   1 
ATOM   6456 O O   . ASP B 1 306 ? 24.164  14.069  -49.244 1.00 47.43  ? 306  ASP B O   1 
ATOM   6457 C CB  . ASP B 1 306 ? 26.112  11.618  -51.037 1.00 47.02  ? 306  ASP B CB  1 
ATOM   6458 C CG  . ASP B 1 306 ? 25.540  12.111  -52.352 1.00 58.91  ? 306  ASP B CG  1 
ATOM   6459 O OD1 . ASP B 1 306 ? 25.151  13.299  -52.439 1.00 62.52  ? 306  ASP B OD1 1 
ATOM   6460 O OD2 . ASP B 1 306 ? 25.481  11.307  -53.304 1.00 64.64  ? 306  ASP B OD2 1 
ATOM   6461 N N   . PHE B 1 307 ? 23.629  11.935  -49.665 1.00 43.34  ? 307  PHE B N   1 
ATOM   6462 C CA  . PHE B 1 307 ? 22.258  12.126  -49.175 1.00 45.91  ? 307  PHE B CA  1 
ATOM   6463 C C   . PHE B 1 307 ? 22.283  12.757  -47.771 1.00 42.26  ? 307  PHE B C   1 
ATOM   6464 O O   . PHE B 1 307 ? 21.609  13.745  -47.503 1.00 41.58  ? 307  PHE B O   1 
ATOM   6465 C CB  . PHE B 1 307 ? 21.443  10.815  -49.167 1.00 37.50  ? 307  PHE B CB  1 
ATOM   6466 C CG  . PHE B 1 307 ? 19.937  11.046  -49.124 1.00 37.23  ? 307  PHE B CG  1 
ATOM   6467 C CD1 . PHE B 1 307 ? 19.316  11.446  -47.947 1.00 38.72  ? 307  PHE B CD1 1 
ATOM   6468 C CD2 . PHE B 1 307 ? 19.162  10.903  -50.266 1.00 34.04  ? 307  PHE B CD2 1 
ATOM   6469 C CE1 . PHE B 1 307 ? 17.931  11.685  -47.901 1.00 39.84  ? 307  PHE B CE1 1 
ATOM   6470 C CE2 . PHE B 1 307 ? 17.792  11.140  -50.227 1.00 39.94  ? 307  PHE B CE2 1 
ATOM   6471 C CZ  . PHE B 1 307 ? 17.180  11.540  -49.036 1.00 36.72  ? 307  PHE B CZ  1 
ATOM   6472 N N   . LEU B 1 308 ? 23.063  12.161  -46.884 1.00 39.90  ? 308  LEU B N   1 
ATOM   6473 C CA  . LEU B 1 308 ? 23.296  12.705  -45.553 1.00 42.67  ? 308  LEU B CA  1 
ATOM   6474 C C   . LEU B 1 308 ? 24.718  13.240  -45.505 1.00 44.70  ? 308  LEU B C   1 
ATOM   6475 O O   . LEU B 1 308 ? 25.678  12.470  -45.516 1.00 47.87  ? 308  LEU B O   1 
ATOM   6476 C CB  . LEU B 1 308 ? 23.126  11.609  -44.497 1.00 35.78  ? 308  LEU B CB  1 
ATOM   6477 C CG  . LEU B 1 308 ? 21.707  11.050  -44.392 1.00 42.75  ? 308  LEU B CG  1 
ATOM   6478 C CD1 . LEU B 1 308 ? 21.667  9.842   -43.436 1.00 38.52  ? 308  LEU B CD1 1 
ATOM   6479 C CD2 . LEU B 1 308 ? 20.723  12.181  -43.956 1.00 34.11  ? 308  LEU B CD2 1 
ATOM   6480 N N   . SER B 1 309 ? 24.861  14.555  -45.458 1.00 45.22  ? 309  SER B N   1 
ATOM   6481 C CA  . SER B 1 309 ? 26.202  15.150  -45.438 1.00 52.28  ? 309  SER B CA  1 
ATOM   6482 C C   . SER B 1 309 ? 26.962  14.857  -44.136 1.00 51.72  ? 309  SER B C   1 
ATOM   6483 O O   . SER B 1 309 ? 28.174  15.025  -44.070 1.00 58.29  ? 309  SER B O   1 
ATOM   6484 C CB  . SER B 1 309 ? 26.116  16.653  -45.668 1.00 52.09  ? 309  SER B CB  1 
ATOM   6485 O OG  . SER B 1 309 ? 25.393  17.258  -44.614 1.00 59.22  ? 309  SER B OG  1 
ATOM   6486 N N   . ASP B 1 310 ? 26.248  14.394  -43.115 1.00 50.88  ? 310  ASP B N   1 
ATOM   6487 C CA  . ASP B 1 310 ? 26.839  14.079  -41.812 1.00 45.37  ? 310  ASP B CA  1 
ATOM   6488 C C   . ASP B 1 310 ? 25.803  13.270  -41.023 1.00 44.86  ? 310  ASP B C   1 
ATOM   6489 O O   . ASP B 1 310 ? 24.707  13.006  -41.526 1.00 47.52  ? 310  ASP B O   1 
ATOM   6490 C CB  . ASP B 1 310 ? 27.186  15.378  -41.079 1.00 50.56  ? 310  ASP B CB  1 
ATOM   6491 C CG  . ASP B 1 310 ? 28.294  15.213  -40.027 1.00 61.88  ? 310  ASP B CG  1 
ATOM   6492 O OD1 . ASP B 1 310 ? 28.540  14.086  -39.537 1.00 65.36  ? 310  ASP B OD1 1 
ATOM   6493 O OD2 . ASP B 1 310 ? 28.911  16.244  -39.681 1.00 60.91  ? 310  ASP B OD2 1 
ATOM   6494 N N   . THR B 1 311 ? 26.140  12.866  -39.805 1.00 40.46  ? 311  THR B N   1 
ATOM   6495 C CA  . THR B 1 311 ? 25.203  12.132  -38.970 1.00 45.60  ? 311  THR B CA  1 
ATOM   6496 C C   . THR B 1 311 ? 23.974  12.996  -38.729 1.00 48.02  ? 311  THR B C   1 
ATOM   6497 O O   . THR B 1 311 ? 24.071  14.218  -38.687 1.00 51.69  ? 311  THR B O   1 
ATOM   6498 C CB  . THR B 1 311 ? 25.796  11.788  -37.594 1.00 45.06  ? 311  THR B CB  1 
ATOM   6499 O OG1 . THR B 1 311 ? 26.073  13.000  -36.899 1.00 52.34  ? 311  THR B OG1 1 
ATOM   6500 C CG2 . THR B 1 311 ? 27.078  10.981  -37.733 1.00 40.14  ? 311  THR B CG2 1 
ATOM   6501 N N   . PRO B 1 312 ? 22.807  12.360  -38.589 1.00 47.22  ? 312  PRO B N   1 
ATOM   6502 C CA  . PRO B 1 312 ? 21.599  13.132  -38.300 1.00 44.84  ? 312  PRO B CA  1 
ATOM   6503 C C   . PRO B 1 312 ? 21.774  13.950  -37.032 1.00 45.58  ? 312  PRO B C   1 
ATOM   6504 O O   . PRO B 1 312 ? 21.303  15.087  -36.961 1.00 42.12  ? 312  PRO B O   1 
ATOM   6505 C CB  . PRO B 1 312 ? 20.542  12.059  -38.098 1.00 41.46  ? 312  PRO B CB  1 
ATOM   6506 C CG  . PRO B 1 312 ? 21.007  10.928  -38.949 1.00 44.69  ? 312  PRO B CG  1 
ATOM   6507 C CD  . PRO B 1 312 ? 22.511  10.953  -38.915 1.00 38.83  ? 312  PRO B CD  1 
ATOM   6508 N N   A GLU B 1 313 ? 22.443  13.380  -36.039 0.50 45.56  ? 313  GLU B N   1 
ATOM   6509 N N   B GLU B 1 313 ? 22.433  13.369  -36.035 0.50 45.52  ? 313  GLU B N   1 
ATOM   6510 C CA  A GLU B 1 313 ? 22.713  14.110  -34.804 0.50 48.92  ? 313  GLU B CA  1 
ATOM   6511 C CA  B GLU B 1 313 ? 22.741  14.093  -34.804 0.50 48.79  ? 313  GLU B CA  1 
ATOM   6512 C C   A GLU B 1 313 ? 23.478  15.410  -35.078 0.50 47.65  ? 313  GLU B C   1 
ATOM   6513 C C   B GLU B 1 313 ? 23.451  15.410  -35.118 0.50 47.68  ? 313  GLU B C   1 
ATOM   6514 O O   A GLU B 1 313 ? 23.090  16.475  -34.610 0.50 49.26  ? 313  GLU B O   1 
ATOM   6515 O O   B GLU B 1 313 ? 23.006  16.480  -34.713 0.50 49.17  ? 313  GLU B O   1 
ATOM   6516 C CB  A GLU B 1 313 ? 23.458  13.228  -33.798 0.50 47.47  ? 313  GLU B CB  1 
ATOM   6517 C CB  B GLU B 1 313 ? 23.605  13.241  -33.869 0.50 47.80  ? 313  GLU B CB  1 
ATOM   6518 C CG  A GLU B 1 313 ? 22.548  12.259  -33.061 0.50 42.09  ? 313  GLU B CG  1 
ATOM   6519 C CG  B GLU B 1 313 ? 24.379  14.057  -32.851 0.50 47.42  ? 313  GLU B CG  1 
ATOM   6520 C CD  A GLU B 1 313 ? 22.326  10.956  -33.813 0.50 41.96  ? 313  GLU B CD  1 
ATOM   6521 C CD  B GLU B 1 313 ? 24.916  13.214  -31.712 0.50 54.80  ? 313  GLU B CD  1 
ATOM   6522 O OE1 A GLU B 1 313 ? 21.593  10.109  -33.264 0.50 25.89  ? 313  GLU B OE1 1 
ATOM   6523 O OE1 B GLU B 1 313 ? 26.139  12.963  -31.680 0.50 53.48  ? 313  GLU B OE1 1 
ATOM   6524 O OE2 A GLU B 1 313 ? 22.877  10.774  -34.938 0.50 39.93  ? 313  GLU B OE2 1 
ATOM   6525 O OE2 B GLU B 1 313 ? 24.111  12.795  -30.852 0.50 60.00  ? 313  GLU B OE2 1 
ATOM   6526 N N   . ALA B 1 314 ? 24.550  15.324  -35.855 1.00 44.56  ? 314  ALA B N   1 
ATOM   6527 C CA  . ALA B 1 314 ? 25.291  16.517  -36.241 1.00 51.70  ? 314  ALA B CA  1 
ATOM   6528 C C   . ALA B 1 314 ? 24.409  17.494  -37.028 1.00 59.51  ? 314  ALA B C   1 
ATOM   6529 O O   . ALA B 1 314 ? 24.485  18.706  -36.820 1.00 58.62  ? 314  ALA B O   1 
ATOM   6530 C CB  . ALA B 1 314 ? 26.520  16.148  -37.056 1.00 43.50  ? 314  ALA B CB  1 
ATOM   6531 N N   . LEU B 1 315 ? 23.575  16.967  -37.927 1.00 55.59  ? 315  LEU B N   1 
ATOM   6532 C CA  . LEU B 1 315 ? 22.758  17.813  -38.797 1.00 47.70  ? 315  LEU B CA  1 
ATOM   6533 C C   . LEU B 1 315 ? 21.610  18.533  -38.078 1.00 48.03  ? 315  LEU B C   1 
ATOM   6534 O O   . LEU B 1 315 ? 21.308  19.674  -38.415 1.00 50.41  ? 315  LEU B O   1 
ATOM   6535 C CB  . LEU B 1 315 ? 22.249  17.039  -40.021 1.00 44.18  ? 315  LEU B CB  1 
ATOM   6536 C CG  . LEU B 1 315 ? 23.328  16.506  -40.968 1.00 43.97  ? 315  LEU B CG  1 
ATOM   6537 C CD1 . LEU B 1 315 ? 22.736  15.649  -42.074 1.00 42.27  ? 315  LEU B CD1 1 
ATOM   6538 C CD2 . LEU B 1 315 ? 24.125  17.664  -41.559 1.00 48.27  ? 315  LEU B CD2 1 
ATOM   6539 N N   . ILE B 1 316 ? 20.978  17.896  -37.088 1.00 49.13  ? 316  ILE B N   1 
ATOM   6540 C CA  . ILE B 1 316 ? 19.920  18.583  -36.334 1.00 49.61  ? 316  ILE B CA  1 
ATOM   6541 C C   . ILE B 1 316 ? 20.497  19.597  -35.349 1.00 59.51  ? 316  ILE B C   1 
ATOM   6542 O O   . ILE B 1 316 ? 19.807  20.525  -34.948 1.00 65.93  ? 316  ILE B O   1 
ATOM   6543 C CB  . ILE B 1 316 ? 18.983  17.632  -35.548 1.00 44.61  ? 316  ILE B CB  1 
ATOM   6544 C CG1 . ILE B 1 316 ? 19.742  16.962  -34.402 1.00 49.52  ? 316  ILE B CG1 1 
ATOM   6545 C CG2 . ILE B 1 316 ? 18.320  16.620  -36.467 1.00 44.56  ? 316  ILE B CG2 1 
ATOM   6546 C CD1 . ILE B 1 316 ? 18.925  15.934  -33.608 1.00 47.88  ? 316  ILE B CD1 1 
ATOM   6547 N N   . ASN B 1 317 ? 21.754  19.411  -34.950 1.00 62.10  ? 317  ASN B N   1 
ATOM   6548 C CA  . ASN B 1 317 ? 22.392  20.325  -34.004 1.00 61.56  ? 317  ASN B CA  1 
ATOM   6549 C C   . ASN B 1 317 ? 22.767  21.636  -34.667 1.00 63.14  ? 317  ASN B C   1 
ATOM   6550 O O   . ASN B 1 317 ? 22.808  22.669  -34.017 1.00 66.28  ? 317  ASN B O   1 
ATOM   6551 C CB  . ASN B 1 317 ? 23.647  19.709  -33.377 1.00 60.00  ? 317  ASN B CB  1 
ATOM   6552 C CG  . ASN B 1 317 ? 23.332  18.591  -32.391 1.00 63.67  ? 317  ASN B CG  1 
ATOM   6553 O OD1 . ASN B 1 317 ? 22.170  18.332  -32.077 1.00 71.53  ? 317  ASN B OD1 1 
ATOM   6554 N ND2 . ASN B 1 317 ? 24.376  17.922  -31.894 1.00 57.21  ? 317  ASN B ND2 1 
ATOM   6555 N N   . THR B 1 318 ? 23.031  21.596  -35.967 1.00 63.51  ? 318  THR B N   1 
ATOM   6556 C CA  . THR B 1 318 ? 23.563  22.765  -36.655 1.00 66.38  ? 318  THR B CA  1 
ATOM   6557 C C   . THR B 1 318 ? 22.644  23.323  -37.738 1.00 66.12  ? 318  THR B C   1 
ATOM   6558 O O   . THR B 1 318 ? 22.902  24.396  -38.290 1.00 69.41  ? 318  THR B O   1 
ATOM   6559 C CB  . THR B 1 318 ? 24.931  22.451  -37.278 1.00 70.69  ? 318  THR B CB  1 
ATOM   6560 O OG1 . THR B 1 318 ? 24.785  21.410  -38.256 1.00 67.06  ? 318  THR B OG1 1 
ATOM   6561 C CG2 . THR B 1 318 ? 25.903  22.001  -36.193 1.00 73.67  ? 318  THR B CG2 1 
ATOM   6562 N N   . GLY B 1 319 ? 21.568  22.606  -38.039 1.00 57.57  ? 319  GLY B N   1 
ATOM   6563 C CA  . GLY B 1 319 ? 20.650  23.054  -39.068 1.00 54.48  ? 319  GLY B CA  1 
ATOM   6564 C C   . GLY B 1 319 ? 19.988  24.385  -38.768 1.00 56.39  ? 319  GLY B C   1 
ATOM   6565 O O   . GLY B 1 319 ? 19.952  24.838  -37.621 1.00 55.21  ? 319  GLY B O   1 
ATOM   6566 N N   . ASP B 1 320 ? 19.480  25.020  -39.818 1.00 61.99  ? 320  ASP B N   1 
ATOM   6567 C CA  . ASP B 1 320 ? 18.592  26.168  -39.685 1.00 68.05  ? 320  ASP B CA  1 
ATOM   6568 C C   . ASP B 1 320 ? 17.198  25.735  -40.134 1.00 62.12  ? 320  ASP B C   1 
ATOM   6569 O O   . ASP B 1 320 ? 16.989  25.385  -41.302 1.00 61.52  ? 320  ASP B O   1 
ATOM   6570 C CB  . ASP B 1 320 ? 19.075  27.328  -40.552 1.00 75.30  ? 320  ASP B CB  1 
ATOM   6571 C CG  . ASP B 1 320 ? 18.137  28.520  -40.502 1.00 82.29  ? 320  ASP B CG  1 
ATOM   6572 O OD1 . ASP B 1 320 ? 17.410  28.671  -39.498 1.00 82.58  ? 320  ASP B OD1 1 
ATOM   6573 O OD2 . ASP B 1 320 ? 18.129  29.310  -41.465 1.00 88.08  ? 320  ASP B OD2 1 
ATOM   6574 N N   . PHE B 1 321 ? 16.247  25.737  -39.207 1.00 55.06  ? 321  PHE B N   1 
ATOM   6575 C CA  . PHE B 1 321 ? 14.930  25.190  -39.518 1.00 52.54  ? 321  PHE B CA  1 
ATOM   6576 C C   . PHE B 1 321 ? 13.825  26.227  -39.384 1.00 52.39  ? 321  PHE B C   1 
ATOM   6577 O O   . PHE B 1 321 ? 12.657  25.888  -39.140 1.00 55.15  ? 321  PHE B O   1 
ATOM   6578 C CB  . PHE B 1 321 ? 14.641  23.976  -38.635 1.00 50.33  ? 321  PHE B CB  1 
ATOM   6579 C CG  . PHE B 1 321 ? 15.663  22.879  -38.754 1.00 45.91  ? 321  PHE B CG  1 
ATOM   6580 C CD1 . PHE B 1 321 ? 15.706  22.067  -39.884 1.00 49.89  ? 321  PHE B CD1 1 
ATOM   6581 C CD2 . PHE B 1 321 ? 16.564  22.642  -37.734 1.00 47.15  ? 321  PHE B CD2 1 
ATOM   6582 C CE1 . PHE B 1 321 ? 16.650  21.046  -39.996 1.00 45.59  ? 321  PHE B CE1 1 
ATOM   6583 C CE2 . PHE B 1 321 ? 17.506  21.617  -37.846 1.00 49.69  ? 321  PHE B CE2 1 
ATOM   6584 C CZ  . PHE B 1 321 ? 17.540  20.824  -38.978 1.00 45.28  ? 321  PHE B CZ  1 
ATOM   6585 N N   . GLN B 1 322 ? 14.190  27.489  -39.574 1.00 50.50  ? 322  GLN B N   1 
ATOM   6586 C CA  . GLN B 1 322 ? 13.268  28.592  -39.332 1.00 60.61  ? 322  GLN B CA  1 
ATOM   6587 C C   . GLN B 1 322 ? 11.983  28.575  -40.163 1.00 60.46  ? 322  GLN B C   1 
ATOM   6588 O O   . GLN B 1 322 ? 10.937  29.006  -39.676 1.00 68.05  ? 322  GLN B O   1 
ATOM   6589 C CB  . GLN B 1 322 ? 13.983  29.933  -39.446 1.00 67.27  ? 322  GLN B CB  1 
ATOM   6590 C CG  . GLN B 1 322 ? 15.040  30.096  -38.382 1.00 81.45  ? 322  GLN B CG  1 
ATOM   6591 C CD  . GLN B 1 322 ? 15.360  31.537  -38.092 1.00 94.24  ? 322  GLN B CD  1 
ATOM   6592 O OE1 . GLN B 1 322 ? 15.392  31.956  -36.930 1.00 100.19 ? 322  GLN B OE1 1 
ATOM   6593 N NE2 . GLN B 1 322 ? 15.596  32.314  -39.144 1.00 94.77  ? 322  GLN B NE2 1 
ATOM   6594 N N   . ASP B 1 323 ? 12.033  28.069  -41.393 1.00 51.16  ? 323  ASP B N   1 
ATOM   6595 C CA  . ASP B 1 323 ? 10.811  28.067  -42.212 1.00 56.49  ? 323  ASP B CA  1 
ATOM   6596 C C   . ASP B 1 323 ? 10.097  26.712  -42.228 1.00 58.49  ? 323  ASP B C   1 
ATOM   6597 O O   . ASP B 1 323 ? 9.394   26.388  -43.185 1.00 64.88  ? 323  ASP B O   1 
ATOM   6598 C CB  . ASP B 1 323 ? 11.092  28.539  -43.646 1.00 66.14  ? 323  ASP B CB  1 
ATOM   6599 N N   . LEU B 1 324 ? 10.257  25.940  -41.156 1.00 51.76  ? 324  LEU B N   1 
ATOM   6600 C CA  . LEU B 1 324 ? 9.734   24.580  -41.098 1.00 48.70  ? 324  LEU B CA  1 
ATOM   6601 C C   . LEU B 1 324 ? 8.690   24.400  -39.984 1.00 44.74  ? 324  LEU B C   1 
ATOM   6602 O O   . LEU B 1 324 ? 8.847   24.935  -38.886 1.00 45.34  ? 324  LEU B O   1 
ATOM   6603 C CB  . LEU B 1 324 ? 10.892  23.610  -40.865 1.00 51.58  ? 324  LEU B CB  1 
ATOM   6604 C CG  . LEU B 1 324 ? 10.494  22.141  -40.854 1.00 50.56  ? 324  LEU B CG  1 
ATOM   6605 C CD1 . LEU B 1 324 ? 9.797   21.799  -42.171 1.00 52.49  ? 324  LEU B CD1 1 
ATOM   6606 C CD2 . LEU B 1 324 ? 11.721  21.287  -40.627 1.00 51.14  ? 324  LEU B CD2 1 
ATOM   6607 N N   . GLN B 1 325 ? 7.624   23.664  -40.278 1.00 39.39  ? 325  GLN B N   1 
ATOM   6608 C CA  . GLN B 1 325 ? 6.687   23.238  -39.249 1.00 38.92  ? 325  GLN B CA  1 
ATOM   6609 C C   . GLN B 1 325 ? 6.687   21.723  -39.171 1.00 37.02  ? 325  GLN B C   1 
ATOM   6610 O O   . GLN B 1 325 ? 6.702   21.048  -40.198 1.00 32.36  ? 325  GLN B O   1 
ATOM   6611 C CB  . GLN B 1 325 ? 5.268   23.749  -39.517 1.00 36.90  ? 325  GLN B CB  1 
ATOM   6612 C CG  . GLN B 1 325 ? 5.154   25.276  -39.652 1.00 39.23  ? 325  GLN B CG  1 
ATOM   6613 C CD  . GLN B 1 325 ? 5.029   25.710  -41.099 1.00 46.53  ? 325  GLN B CD  1 
ATOM   6614 O OE1 . GLN B 1 325 ? 4.545   24.965  -41.946 1.00 53.66  ? 325  GLN B OE1 1 
ATOM   6615 N NE2 . GLN B 1 325 ? 5.470   26.905  -41.388 1.00 54.39  ? 325  GLN B NE2 1 
ATOM   6616 N N   . VAL B 1 326 ? 6.668   21.205  -37.948 1.00 31.78  ? 326  VAL B N   1 
ATOM   6617 C CA  . VAL B 1 326 ? 6.774   19.779  -37.700 1.00 34.69  ? 326  VAL B CA  1 
ATOM   6618 C C   . VAL B 1 326 ? 5.807   19.372  -36.611 1.00 34.15  ? 326  VAL B C   1 
ATOM   6619 O O   . VAL B 1 326 ? 5.667   20.051  -35.601 1.00 38.47  ? 326  VAL B O   1 
ATOM   6620 C CB  . VAL B 1 326 ? 8.208   19.376  -37.240 1.00 44.51  ? 326  VAL B CB  1 
ATOM   6621 C CG1 . VAL B 1 326 ? 8.373   17.884  -37.323 1.00 47.70  ? 326  VAL B CG1 1 
ATOM   6622 C CG2 . VAL B 1 326 ? 9.241   20.032  -38.095 1.00 43.99  ? 326  VAL B CG2 1 
ATOM   6623 N N   . LEU B 1 327 ? 5.122   18.264  -36.842 1.00 36.57  ? 327  LEU B N   1 
ATOM   6624 C CA  . LEU B 1 327 ? 4.286   17.645  -35.843 1.00 36.02  ? 327  LEU B CA  1 
ATOM   6625 C C   . LEU B 1 327 ? 4.967   16.310  -35.529 1.00 38.02  ? 327  LEU B C   1 
ATOM   6626 O O   . LEU B 1 327 ? 5.267   15.546  -36.444 1.00 37.11  ? 327  LEU B O   1 
ATOM   6627 C CB  . LEU B 1 327 ? 2.868   17.458  -36.396 1.00 35.14  ? 327  LEU B CB  1 
ATOM   6628 C CG  . LEU B 1 327 ? 1.922   16.507  -35.646 1.00 38.74  ? 327  LEU B CG  1 
ATOM   6629 C CD1 . LEU B 1 327 ? 1.606   17.064  -34.286 1.00 44.37  ? 327  LEU B CD1 1 
ATOM   6630 C CD2 . LEU B 1 327 ? 0.620   16.287  -36.443 1.00 38.22  ? 327  LEU B CD2 1 
ATOM   6631 N N   . VAL B 1 328 ? 5.267   16.051  -34.256 1.00 30.09  ? 328  VAL B N   1 
ATOM   6632 C CA  . VAL B 1 328 ? 5.925   14.803  -33.880 1.00 32.10  ? 328  VAL B CA  1 
ATOM   6633 C C   . VAL B 1 328 ? 5.249   14.240  -32.640 1.00 35.77  ? 328  VAL B C   1 
ATOM   6634 O O   . VAL B 1 328 ? 4.715   14.994  -31.816 1.00 37.82  ? 328  VAL B O   1 
ATOM   6635 C CB  . VAL B 1 328 ? 7.425   14.988  -33.532 1.00 36.14  ? 328  VAL B CB  1 
ATOM   6636 C CG1 . VAL B 1 328 ? 8.165   15.657  -34.660 1.00 40.35  ? 328  VAL B CG1 1 
ATOM   6637 C CG2 . VAL B 1 328 ? 7.561   15.818  -32.252 1.00 42.75  ? 328  VAL B CG2 1 
ATOM   6638 N N   . GLY B 1 329 ? 5.298   12.917  -32.493 1.00 30.51  ? 329  GLY B N   1 
ATOM   6639 C CA  . GLY B 1 329 ? 4.728   12.267  -31.330 1.00 40.10  ? 329  GLY B CA  1 
ATOM   6640 C C   . GLY B 1 329 ? 5.048   10.789  -31.219 1.00 38.58  ? 329  GLY B C   1 
ATOM   6641 O O   . GLY B 1 329 ? 5.704   10.228  -32.091 1.00 36.65  ? 329  GLY B O   1 
ATOM   6642 N N   . VAL B 1 330 ? 4.577   10.173  -30.132 1.00 34.42  ? 330  VAL B N   1 
ATOM   6643 C CA  . VAL B 1 330 ? 4.843   8.767   -29.817 1.00 28.09  ? 330  VAL B CA  1 
ATOM   6644 C C   . VAL B 1 330 ? 3.544   8.152   -29.299 1.00 35.95  ? 330  VAL B C   1 
ATOM   6645 O O   . VAL B 1 330 ? 2.589   8.881   -28.994 1.00 35.18  ? 330  VAL B O   1 
ATOM   6646 C CB  . VAL B 1 330 ? 5.922   8.645   -28.710 1.00 34.69  ? 330  VAL B CB  1 
ATOM   6647 C CG1 . VAL B 1 330 ? 7.213   9.372   -29.111 1.00 31.65  ? 330  VAL B CG1 1 
ATOM   6648 C CG2 . VAL B 1 330 ? 5.409   9.239   -27.406 1.00 33.89  ? 330  VAL B CG2 1 
ATOM   6649 N N   . VAL B 1 331 ? 3.497   6.825   -29.181 1.00 30.13  ? 331  VAL B N   1 
ATOM   6650 C CA  . VAL B 1 331 ? 2.375   6.165   -28.511 1.00 34.72  ? 331  VAL B CA  1 
ATOM   6651 C C   . VAL B 1 331 ? 2.789   5.854   -27.073 1.00 41.91  ? 331  VAL B C   1 
ATOM   6652 O O   . VAL B 1 331 ? 3.966   5.929   -26.743 1.00 34.38  ? 331  VAL B O   1 
ATOM   6653 C CB  . VAL B 1 331 ? 1.921   4.868   -29.231 1.00 39.95  ? 331  VAL B CB  1 
ATOM   6654 C CG1 . VAL B 1 331 ? 1.444   5.195   -30.660 1.00 36.49  ? 331  VAL B CG1 1 
ATOM   6655 C CG2 . VAL B 1 331 ? 3.040   3.770   -29.214 1.00 26.39  ? 331  VAL B CG2 1 
ATOM   6656 N N   . LYS B 1 332 ? 1.832   5.498   -26.220 1.00 40.71  ? 332  LYS B N   1 
ATOM   6657 C CA  . LYS B 1 332 ? 2.145   5.291   -24.811 1.00 42.41  ? 332  LYS B CA  1 
ATOM   6658 C C   . LYS B 1 332 ? 3.075   4.085   -24.554 1.00 41.59  ? 332  LYS B C   1 
ATOM   6659 O O   . LYS B 1 332 ? 3.874   4.116   -23.619 1.00 37.22  ? 332  LYS B O   1 
ATOM   6660 C CB  . LYS B 1 332 ? 0.857   5.199   -23.982 1.00 45.97  ? 332  LYS B CB  1 
ATOM   6661 C CG  . LYS B 1 332 ? 1.041   4.914   -22.492 1.00 45.59  ? 332  LYS B CG  1 
ATOM   6662 C CD  . LYS B 1 332 ? -0.321  4.920   -21.768 1.00 59.59  ? 332  LYS B CD  1 
ATOM   6663 C CE  . LYS B 1 332 ? -0.399  3.869   -20.647 1.00 72.13  ? 332  LYS B CE  1 
ATOM   6664 N NZ  . LYS B 1 332 ? -0.656  2.450   -21.153 1.00 75.65  ? 332  LYS B NZ  1 
ATOM   6665 N N   . ASP B 1 333 ? 2.994   3.040   -25.373 1.00 34.22  ? 333  ASP B N   1 
ATOM   6666 C CA  . ASP B 1 333 ? 3.830   1.851   -25.123 1.00 38.58  ? 333  ASP B CA  1 
ATOM   6667 C C   . ASP B 1 333 ? 4.661   1.432   -26.323 1.00 40.16  ? 333  ASP B C   1 
ATOM   6668 O O   . ASP B 1 333 ? 4.512   0.331   -26.839 1.00 40.77  ? 333  ASP B O   1 
ATOM   6669 C CB  . ASP B 1 333 ? 2.981   0.677   -24.631 1.00 39.74  ? 333  ASP B CB  1 
ATOM   6670 C CG  . ASP B 1 333 ? 2.193   1.025   -23.384 1.00 43.80  ? 333  ASP B CG  1 
ATOM   6671 O OD1 . ASP B 1 333 ? 0.991   1.321   -23.515 1.00 49.61  ? 333  ASP B OD1 1 
ATOM   6672 O OD2 . ASP B 1 333 ? 2.784   1.055   -22.277 1.00 43.91  ? 333  ASP B OD2 1 
ATOM   6673 N N   . GLU B 1 334 ? 5.557   2.317   -26.749 1.00 38.31  ? 334  GLU B N   1 
ATOM   6674 C CA  . GLU B 1 334 ? 6.383   2.067   -27.924 1.00 36.31  ? 334  GLU B CA  1 
ATOM   6675 C C   . GLU B 1 334 ? 7.086   0.703   -27.918 1.00 38.18  ? 334  GLU B C   1 
ATOM   6676 O O   . GLU B 1 334 ? 7.155   0.054   -28.951 1.00 38.99  ? 334  GLU B O   1 
ATOM   6677 C CB  . GLU B 1 334 ? 7.428   3.171   -28.095 1.00 32.83  ? 334  GLU B CB  1 
ATOM   6678 C CG  . GLU B 1 334 ? 6.861   4.544   -28.480 1.00 36.25  ? 334  GLU B CG  1 
ATOM   6679 C CD  . GLU B 1 334 ? 6.348   4.611   -29.931 1.00 41.46  ? 334  GLU B CD  1 
ATOM   6680 O OE1 . GLU B 1 334 ? 6.696   3.730   -30.746 1.00 39.33  ? 334  GLU B OE1 1 
ATOM   6681 O OE2 . GLU B 1 334 ? 5.597   5.558   -30.258 1.00 37.96  ? 334  GLU B OE2 1 
ATOM   6682 N N   . GLY B 1 335 ? 7.601   0.270   -26.768 1.00 28.21  ? 335  GLY B N   1 
ATOM   6683 C CA  . GLY B 1 335 ? 8.528   -0.842  -26.755 1.00 34.33  ? 335  GLY B CA  1 
ATOM   6684 C C   . GLY B 1 335 ? 7.889   -2.225  -26.771 1.00 37.52  ? 335  GLY B C   1 
ATOM   6685 O O   . GLY B 1 335 ? 8.538   -3.213  -27.119 1.00 42.34  ? 335  GLY B O   1 
ATOM   6686 N N   . SER B 1 336 ? 6.615   -2.301  -26.399 1.00 38.44  ? 336  SER B N   1 
ATOM   6687 C CA  . SER B 1 336 ? 6.038   -3.571  -25.962 1.00 39.98  ? 336  SER B CA  1 
ATOM   6688 C C   . SER B 1 336 ? 6.014   -4.646  -27.055 1.00 47.89  ? 336  SER B C   1 
ATOM   6689 O O   . SER B 1 336 ? 6.339   -5.806  -26.810 1.00 47.91  ? 336  SER B O   1 
ATOM   6690 C CB  . SER B 1 336 ? 4.632   -3.342  -25.417 1.00 38.08  ? 336  SER B CB  1 
ATOM   6691 O OG  . SER B 1 336 ? 3.752   -2.966  -26.469 1.00 40.40  ? 336  SER B OG  1 
ATOM   6692 N N   A TYR B 1 337 ? 5.636   -4.290  -28.275 0.70 49.69  ? 337  TYR B N   1 
ATOM   6693 N N   B TYR B 1 337 ? 5.612   -4.223  -28.248 0.70 49.73  ? 337  TYR B N   1 
ATOM   6694 C CA  A TYR B 1 337 ? 5.534   -5.348  -29.273 0.70 49.95  ? 337  TYR B CA  1 
ATOM   6695 C CA  B TYR B 1 337 ? 5.543   -5.065  -29.434 0.30 49.44  ? 337  TYR B CA  1 
ATOM   6696 C C   A TYR B 1 337 ? 6.889   -5.885  -29.747 0.70 47.20  ? 337  TYR B C   1 
ATOM   6697 C C   B TYR B 1 337 ? 6.845   -5.829  -29.676 0.30 47.77  ? 337  TYR B C   1 
ATOM   6698 O O   A TYR B 1 337 ? 6.961   -7.000  -30.238 0.70 48.52  ? 337  TYR B O   1 
ATOM   6699 O O   B TYR B 1 337 ? 6.836   -7.030  -29.931 0.30 47.79  ? 337  TYR B O   1 
ATOM   6700 C CB  A TYR B 1 337 ? 4.558   -5.006  -30.416 0.70 48.76  ? 337  TYR B CB  1 
ATOM   6701 C CB  B TYR B 1 337 ? 5.231   -4.165  -30.632 0.30 48.51  ? 337  TYR B CB  1 
ATOM   6702 C CG  A TYR B 1 337 ? 5.143   -4.411  -31.671 0.70 49.09  ? 337  TYR B CG  1 
ATOM   6703 C CG  B TYR B 1 337 ? 4.896   -4.868  -31.921 0.30 50.41  ? 337  TYR B CG  1 
ATOM   6704 C CD1 A TYR B 1 337 ? 6.136   -5.065  -32.391 0.70 52.95  ? 337  TYR B CD1 1 
ATOM   6705 C CD1 B TYR B 1 337 ? 3.585   -4.961  -32.356 0.30 51.27  ? 337  TYR B CD1 1 
ATOM   6706 C CD2 A TYR B 1 337 ? 4.660   -3.219  -32.168 0.70 54.27  ? 337  TYR B CD2 1 
ATOM   6707 C CD2 B TYR B 1 337 ? 5.891   -5.413  -32.720 0.30 53.47  ? 337  TYR B CD2 1 
ATOM   6708 C CE1 A TYR B 1 337 ? 6.651   -4.527  -33.553 0.70 50.60  ? 337  TYR B CE1 1 
ATOM   6709 C CE1 B TYR B 1 337 ? 3.271   -5.588  -33.544 0.30 50.69  ? 337  TYR B CE1 1 
ATOM   6710 C CE2 A TYR B 1 337 ? 5.167   -2.673  -33.325 0.70 57.11  ? 337  TYR B CE2 1 
ATOM   6711 C CE2 B TYR B 1 337 ? 5.583   -6.046  -33.910 0.30 52.86  ? 337  TYR B CE2 1 
ATOM   6712 C CZ  A TYR B 1 337 ? 6.160   -3.330  -34.015 0.70 53.36  ? 337  TYR B CZ  1 
ATOM   6713 C CZ  B TYR B 1 337 ? 4.271   -6.130  -34.313 0.30 50.58  ? 337  TYR B CZ  1 
ATOM   6714 O OH  A TYR B 1 337 ? 6.652   -2.763  -35.172 0.70 54.20  ? 337  TYR B OH  1 
ATOM   6715 O OH  B TYR B 1 337 ? 3.950   -6.752  -35.492 0.30 52.75  ? 337  TYR B OH  1 
ATOM   6716 N N   . PHE B 1 338 ? 7.961   -5.117  -29.574 1.00 45.24  ? 338  PHE B N   1 
ATOM   6717 C CA  . PHE B 1 338 ? 9.274   -5.613  -29.972 1.00 45.00  ? 338  PHE B CA  1 
ATOM   6718 C C   . PHE B 1 338 ? 9.821   -6.695  -29.058 1.00 50.13  ? 338  PHE B C   1 
ATOM   6719 O O   . PHE B 1 338 ? 10.696  -7.455  -29.464 1.00 55.60  ? 338  PHE B O   1 
ATOM   6720 C CB  . PHE B 1 338 ? 10.280  -4.460  -30.089 1.00 41.32  ? 338  PHE B CB  1 
ATOM   6721 C CG  . PHE B 1 338 ? 9.910   -3.463  -31.141 1.00 44.36  ? 338  PHE B CG  1 
ATOM   6722 C CD1 . PHE B 1 338 ? 9.088   -2.385  -30.829 1.00 38.15  ? 338  PHE B CD1 1 
ATOM   6723 C CD2 . PHE B 1 338 ? 10.338  -3.633  -32.459 1.00 38.32  ? 338  PHE B CD2 1 
ATOM   6724 C CE1 . PHE B 1 338 ? 8.717   -1.474  -31.815 1.00 45.48  ? 338  PHE B CE1 1 
ATOM   6725 C CE2 . PHE B 1 338 ? 9.976   -2.735  -33.439 1.00 37.82  ? 338  PHE B CE2 1 
ATOM   6726 C CZ  . PHE B 1 338 ? 9.158   -1.644  -33.114 1.00 40.46  ? 338  PHE B CZ  1 
ATOM   6727 N N   . LEU B 1 339 ? 9.300   -6.774  -27.836 1.00 47.19  ? 339  LEU B N   1 
ATOM   6728 C CA  . LEU B 1 339 ? 9.826   -7.726  -26.858 1.00 50.35  ? 339  LEU B CA  1 
ATOM   6729 C C   . LEU B 1 339 ? 9.597   -9.193  -27.283 1.00 54.62  ? 339  LEU B C   1 
ATOM   6730 O O   . LEU B 1 339 ? 10.443  -10.057 -27.021 1.00 53.97  ? 339  LEU B O   1 
ATOM   6731 C CB  . LEU B 1 339 ? 9.266   -7.440  -25.449 1.00 44.15  ? 339  LEU B CB  1 
ATOM   6732 C CG  . LEU B 1 339 ? 9.490   -6.000  -24.954 1.00 44.64  ? 339  LEU B CG  1 
ATOM   6733 C CD1 . LEU B 1 339 ? 8.944   -5.763  -23.511 1.00 40.91  ? 339  LEU B CD1 1 
ATOM   6734 C CD2 . LEU B 1 339 ? 10.962  -5.622  -25.042 1.00 40.84  ? 339  LEU B CD2 1 
ATOM   6735 N N   . VAL B 1 340 ? 8.474   -9.465  -27.953 1.00 53.19  ? 340  VAL B N   1 
ATOM   6736 C CA  . VAL B 1 340 ? 8.136   -10.836 -28.352 1.00 59.63  ? 340  VAL B CA  1 
ATOM   6737 C C   . VAL B 1 340 ? 8.919   -11.375 -29.558 1.00 59.98  ? 340  VAL B C   1 
ATOM   6738 O O   . VAL B 1 340 ? 8.739   -12.524 -29.951 1.00 62.17  ? 340  VAL B O   1 
ATOM   6739 C CB  . VAL B 1 340 ? 6.610   -11.028 -28.606 1.00 48.59  ? 340  VAL B CB  1 
ATOM   6740 C CG1 . VAL B 1 340 ? 5.785   -10.385 -27.473 1.00 45.04  ? 340  VAL B CG1 1 
ATOM   6741 C CG2 . VAL B 1 340 ? 6.213   -10.461 -29.955 1.00 44.60  ? 340  VAL B CG2 1 
ATOM   6742 N N   . TYR B 1 341 ? 9.794   -10.558 -30.130 1.00 60.70  ? 341  TYR B N   1 
ATOM   6743 C CA  . TYR B 1 341 ? 10.577  -10.974 -31.291 1.00 62.91  ? 341  TYR B CA  1 
ATOM   6744 C C   . TYR B 1 341 ? 12.039  -11.223 -30.961 1.00 67.26  ? 341  TYR B C   1 
ATOM   6745 O O   . TYR B 1 341 ? 12.902  -11.063 -31.828 1.00 70.05  ? 341  TYR B O   1 
ATOM   6746 C CB  . TYR B 1 341 ? 10.534  -9.906  -32.381 1.00 61.02  ? 341  TYR B CB  1 
ATOM   6747 C CG  . TYR B 1 341 ? 9.234   -9.828  -33.132 1.00 59.69  ? 341  TYR B CG  1 
ATOM   6748 C CD1 . TYR B 1 341 ? 8.233   -8.944  -32.733 1.00 54.72  ? 341  TYR B CD1 1 
ATOM   6749 C CD2 . TYR B 1 341 ? 9.009   -10.624 -34.255 1.00 54.95  ? 341  TYR B CD2 1 
ATOM   6750 C CE1 . TYR B 1 341 ? 7.043   -8.857  -33.419 1.00 58.02  ? 341  TYR B CE1 1 
ATOM   6751 C CE2 . TYR B 1 341 ? 7.816   -10.538 -34.955 1.00 58.46  ? 341  TYR B CE2 1 
ATOM   6752 C CZ  . TYR B 1 341 ? 6.838   -9.656  -34.528 1.00 61.28  ? 341  TYR B CZ  1 
ATOM   6753 O OH  . TYR B 1 341 ? 5.651   -9.574  -35.206 1.00 64.16  ? 341  TYR B OH  1 
ATOM   6754 N N   . GLY B 1 342 ? 12.343  -11.591 -29.725 1.00 63.94  ? 342  GLY B N   1 
ATOM   6755 C CA  . GLY B 1 342 ? 13.732  -11.841 -29.398 1.00 70.28  ? 342  GLY B CA  1 
ATOM   6756 C C   . GLY B 1 342 ? 14.167  -11.703 -27.953 1.00 69.64  ? 342  GLY B C   1 
ATOM   6757 O O   . GLY B 1 342 ? 15.322  -11.995 -27.634 1.00 69.62  ? 342  GLY B O   1 
ATOM   6758 N N   . VAL B 1 343 ? 13.268  -11.253 -27.081 1.00 62.87  ? 343  VAL B N   1 
ATOM   6759 C CA  . VAL B 1 343 ? 13.574  -11.230 -25.655 1.00 57.85  ? 343  VAL B CA  1 
ATOM   6760 C C   . VAL B 1 343 ? 12.942  -12.417 -24.927 1.00 55.93  ? 343  VAL B C   1 
ATOM   6761 O O   . VAL B 1 343 ? 11.717  -12.561 -24.906 1.00 57.58  ? 343  VAL B O   1 
ATOM   6762 C CB  . VAL B 1 343 ? 13.151  -9.923  -24.989 1.00 54.09  ? 343  VAL B CB  1 
ATOM   6763 C CG1 . VAL B 1 343 ? 13.630  -9.912  -23.543 1.00 53.10  ? 343  VAL B CG1 1 
ATOM   6764 C CG2 . VAL B 1 343 ? 13.722  -8.730  -25.761 1.00 49.69  ? 343  VAL B CG2 1 
ATOM   6765 N N   . PRO B 1 344 ? 13.782  -13.276 -24.333 1.00 52.54  ? 344  PRO B N   1 
ATOM   6766 C CA  . PRO B 1 344 ? 13.267  -14.454 -23.622 1.00 58.88  ? 344  PRO B CA  1 
ATOM   6767 C C   . PRO B 1 344 ? 12.332  -14.057 -22.488 1.00 59.54  ? 344  PRO B C   1 
ATOM   6768 O O   . PRO B 1 344 ? 12.619  -13.101 -21.748 1.00 58.28  ? 344  PRO B O   1 
ATOM   6769 C CB  . PRO B 1 344 ? 14.536  -15.121 -23.067 1.00 55.15  ? 344  PRO B CB  1 
ATOM   6770 C CG  . PRO B 1 344 ? 15.612  -14.695 -23.990 1.00 58.13  ? 344  PRO B CG  1 
ATOM   6771 C CD  . PRO B 1 344 ? 15.253  -13.258 -24.368 1.00 53.19  ? 344  PRO B CD  1 
ATOM   6772 N N   . GLY B 1 345 ? 11.216  -14.773 -22.377 1.00 53.15  ? 345  GLY B N   1 
ATOM   6773 C CA  . GLY B 1 345 ? 10.246  -14.545 -21.320 1.00 55.67  ? 345  GLY B CA  1 
ATOM   6774 C C   . GLY B 1 345 ? 9.021   -13.797 -21.811 1.00 60.04  ? 345  GLY B C   1 
ATOM   6775 O O   . GLY B 1 345 ? 7.994   -13.757 -21.130 1.00 66.76  ? 345  GLY B O   1 
ATOM   6776 N N   . PHE B 1 346 ? 9.130   -13.199 -22.995 1.00 55.37  ? 346  PHE B N   1 
ATOM   6777 C CA  . PHE B 1 346 ? 8.043   -12.399 -23.554 1.00 53.21  ? 346  PHE B CA  1 
ATOM   6778 C C   . PHE B 1 346 ? 7.278   -13.111 -24.665 1.00 59.23  ? 346  PHE B C   1 
ATOM   6779 O O   . PHE B 1 346 ? 7.864   -13.689 -25.593 1.00 62.67  ? 346  PHE B O   1 
ATOM   6780 C CB  . PHE B 1 346 ? 8.561   -11.042 -24.037 1.00 45.66  ? 346  PHE B CB  1 
ATOM   6781 C CG  . PHE B 1 346 ? 9.035   -10.154 -22.916 1.00 46.46  ? 346  PHE B CG  1 
ATOM   6782 C CD1 . PHE B 1 346 ? 10.335  -10.247 -22.442 1.00 44.23  ? 346  PHE B CD1 1 
ATOM   6783 C CD2 . PHE B 1 346 ? 8.172   -9.250  -22.320 1.00 43.20  ? 346  PHE B CD2 1 
ATOM   6784 C CE1 . PHE B 1 346 ? 10.766  -9.451  -21.404 1.00 45.84  ? 346  PHE B CE1 1 
ATOM   6785 C CE2 . PHE B 1 346 ? 8.591   -8.456  -21.296 1.00 45.33  ? 346  PHE B CE2 1 
ATOM   6786 C CZ  . PHE B 1 346 ? 9.897   -8.553  -20.834 1.00 50.00  ? 346  PHE B CZ  1 
ATOM   6787 N N   . SER B 1 347 ? 5.956   -13.051 -24.565 1.00 58.87  ? 347  SER B N   1 
ATOM   6788 C CA  . SER B 1 347 ? 5.086   -13.696 -25.536 1.00 59.57  ? 347  SER B CA  1 
ATOM   6789 C C   . SER B 1 347 ? 3.754   -12.990 -25.548 1.00 58.55  ? 347  SER B C   1 
ATOM   6790 O O   . SER B 1 347 ? 3.335   -12.433 -24.533 1.00 58.36  ? 347  SER B O   1 
ATOM   6791 C CB  . SER B 1 347 ? 4.866   -15.164 -25.156 1.00 61.18  ? 347  SER B CB  1 
ATOM   6792 O OG  . SER B 1 347 ? 3.704   -15.676 -25.791 1.00 65.20  ? 347  SER B OG  1 
ATOM   6793 N N   . LYS B 1 348 ? 3.077   -13.031 -26.690 1.00 60.69  ? 348  LYS B N   1 
ATOM   6794 C CA  . LYS B 1 348 ? 1.758   -12.433 -26.801 1.00 58.49  ? 348  LYS B CA  1 
ATOM   6795 C C   . LYS B 1 348 ? 0.695   -13.306 -26.146 1.00 62.56  ? 348  LYS B C   1 
ATOM   6796 O O   . LYS B 1 348 ? -0.422  -12.854 -25.909 1.00 66.50  ? 348  LYS B O   1 
ATOM   6797 C CB  . LYS B 1 348 ? 1.402   -12.200 -28.268 1.00 56.19  ? 348  LYS B CB  1 
ATOM   6798 C CG  . LYS B 1 348 ? 0.765   -13.384 -28.946 1.00 60.39  ? 348  LYS B CG  1 
ATOM   6799 C CD  . LYS B 1 348 ? 0.311   -13.027 -30.358 1.00 61.71  ? 348  LYS B CD  1 
ATOM   6800 C CE  . LYS B 1 348 ? -0.300  -14.234 -31.065 1.00 60.05  ? 348  LYS B CE  1 
ATOM   6801 N NZ  . LYS B 1 348 ? -1.456  -14.765 -30.303 1.00 61.68  ? 348  LYS B NZ  1 
ATOM   6802 N N   . ASP B 1 349 ? 1.051   -14.553 -25.843 1.00 63.09  ? 349  ASP B N   1 
ATOM   6803 C CA  . ASP B 1 349 ? 0.067   -15.554 -25.429 1.00 63.52  ? 349  ASP B CA  1 
ATOM   6804 C C   . ASP B 1 349 ? -0.028  -15.779 -23.922 1.00 65.35  ? 349  ASP B C   1 
ATOM   6805 O O   . ASP B 1 349 ? -0.837  -16.596 -23.461 1.00 61.99  ? 349  ASP B O   1 
ATOM   6806 C CB  . ASP B 1 349 ? 0.323   -16.879 -26.160 1.00 60.93  ? 349  ASP B CB  1 
ATOM   6807 C CG  . ASP B 1 349 ? -0.052  -16.805 -27.626 1.00 68.08  ? 349  ASP B CG  1 
ATOM   6808 O OD1 . ASP B 1 349 ? -1.048  -16.108 -27.936 1.00 70.09  ? 349  ASP B OD1 1 
ATOM   6809 O OD2 . ASP B 1 349 ? 0.647   -17.423 -28.465 1.00 69.37  ? 349  ASP B OD2 1 
ATOM   6810 N N   . ASN B 1 350 ? 0.821   -15.083 -23.169 1.00 61.15  ? 350  ASN B N   1 
ATOM   6811 C CA  . ASN B 1 350 ? 0.725   -15.045 -21.709 1.00 61.36  ? 350  ASN B CA  1 
ATOM   6812 C C   . ASN B 1 350 ? 1.068   -13.641 -21.220 1.00 62.30  ? 350  ASN B C   1 
ATOM   6813 O O   . ASN B 1 350 ? 1.331   -12.750 -22.031 1.00 60.58  ? 350  ASN B O   1 
ATOM   6814 C CB  . ASN B 1 350 ? 1.590   -16.131 -21.031 1.00 64.20  ? 350  ASN B CB  1 
ATOM   6815 C CG  . ASN B 1 350 ? 3.090   -16.027 -21.371 1.00 74.53  ? 350  ASN B CG  1 
ATOM   6816 O OD1 . ASN B 1 350 ? 3.667   -14.936 -21.414 1.00 66.69  ? 350  ASN B OD1 1 
ATOM   6817 N ND2 . ASN B 1 350 ? 3.729   -17.189 -21.574 1.00 83.02  ? 350  ASN B ND2 1 
ATOM   6818 N N   . GLU B 1 351 ? 1.061   -13.440 -19.908 1.00 61.77  ? 351  GLU B N   1 
ATOM   6819 C CA  . GLU B 1 351 ? 1.259   -12.112 -19.337 1.00 66.45  ? 351  GLU B CA  1 
ATOM   6820 C C   . GLU B 1 351 ? 2.722   -11.655 -19.260 1.00 59.83  ? 351  GLU B C   1 
ATOM   6821 O O   . GLU B 1 351 ? 3.006   -10.547 -18.805 1.00 56.17  ? 351  GLU B O   1 
ATOM   6822 C CB  . GLU B 1 351 ? 0.580   -12.008 -17.974 1.00 73.27  ? 351  GLU B CB  1 
ATOM   6823 C CG  . GLU B 1 351 ? -0.930  -11.880 -18.079 1.00 86.95  ? 351  GLU B CG  1 
ATOM   6824 C CD  . GLU B 1 351 ? -1.604  -11.738 -16.726 1.00 103.89 ? 351  GLU B CD  1 
ATOM   6825 O OE1 . GLU B 1 351 ? -1.193  -12.440 -15.773 1.00 109.48 ? 351  GLU B OE1 1 
ATOM   6826 O OE2 . GLU B 1 351 ? -2.549  -10.924 -16.617 1.00 109.09 ? 351  GLU B OE2 1 
ATOM   6827 N N   . SER B 1 352 ? 3.632   -12.505 -19.721 1.00 53.34  ? 352  SER B N   1 
ATOM   6828 C CA  . SER B 1 352 ? 5.048   -12.169 -19.809 1.00 53.65  ? 352  SER B CA  1 
ATOM   6829 C C   . SER B 1 352 ? 5.588   -11.582 -18.507 1.00 57.57  ? 352  SER B C   1 
ATOM   6830 O O   . SER B 1 352 ? 6.221   -10.516 -18.500 1.00 56.03  ? 352  SER B O   1 
ATOM   6831 C CB  . SER B 1 352 ? 5.306   -11.214 -20.977 1.00 50.65  ? 352  SER B CB  1 
ATOM   6832 O OG  . SER B 1 352 ? 4.899   -11.798 -22.202 1.00 55.02  ? 352  SER B OG  1 
ATOM   6833 N N   . LEU B 1 353 ? 5.334   -12.290 -17.410 1.00 56.83  ? 353  LEU B N   1 
ATOM   6834 C CA  . LEU B 1 353 ? 5.842   -11.899 -16.109 1.00 58.96  ? 353  LEU B CA  1 
ATOM   6835 C C   . LEU B 1 353 ? 7.254   -12.442 -15.947 1.00 65.32  ? 353  LEU B C   1 
ATOM   6836 O O   . LEU B 1 353 ? 7.457   -13.634 -15.733 1.00 74.34  ? 353  LEU B O   1 
ATOM   6837 C CB  . LEU B 1 353 ? 4.927   -12.400 -14.995 1.00 61.56  ? 353  LEU B CB  1 
ATOM   6838 C CG  . LEU B 1 353 ? 3.528   -11.778 -14.959 1.00 64.06  ? 353  LEU B CG  1 
ATOM   6839 C CD1 . LEU B 1 353 ? 2.770   -12.229 -13.714 1.00 66.82  ? 353  LEU B CD1 1 
ATOM   6840 C CD2 . LEU B 1 353 ? 3.621   -10.267 -14.986 1.00 62.09  ? 353  LEU B CD2 1 
ATOM   6841 N N   . ILE B 1 354 ? 8.234   -11.553 -16.045 1.00 61.17  ? 354  ILE B N   1 
ATOM   6842 C CA  . ILE B 1 354 ? 9.624   -11.971 -16.081 1.00 55.44  ? 354  ILE B CA  1 
ATOM   6843 C C   . ILE B 1 354 ? 10.345  -11.849 -14.732 1.00 57.15  ? 354  ILE B C   1 
ATOM   6844 O O   . ILE B 1 354 ? 9.854   -11.224 -13.788 1.00 54.16  ? 354  ILE B O   1 
ATOM   6845 C CB  . ILE B 1 354 ? 10.390  -11.214 -17.174 1.00 53.33  ? 354  ILE B CB  1 
ATOM   6846 C CG1 . ILE B 1 354 ? 10.295  -9.705  -16.941 1.00 50.13  ? 354  ILE B CG1 1 
ATOM   6847 C CG2 . ILE B 1 354 ? 9.798   -11.551 -18.532 1.00 53.87  ? 354  ILE B CG2 1 
ATOM   6848 C CD1 . ILE B 1 354 ? 11.355  -8.898  -17.669 1.00 50.81  ? 354  ILE B CD1 1 
ATOM   6849 N N   . SER B 1 355 ? 11.505  -12.489 -14.653 1.00 58.22  ? 355  SER B N   1 
ATOM   6850 C CA  . SER B 1 355 ? 12.323  -12.453 -13.461 1.00 58.71  ? 355  SER B CA  1 
ATOM   6851 C C   . SER B 1 355 ? 13.327  -11.325 -13.600 1.00 58.05  ? 355  SER B C   1 
ATOM   6852 O O   . SER B 1 355 ? 13.486  -10.749 -14.683 1.00 54.13  ? 355  SER B O   1 
ATOM   6853 C CB  . SER B 1 355 ? 13.085  -13.761 -13.321 1.00 62.13  ? 355  SER B CB  1 
ATOM   6854 O OG  . SER B 1 355 ? 14.009  -13.903 -14.390 1.00 69.31  ? 355  SER B OG  1 
ATOM   6855 N N   . ARG B 1 356 ? 14.021  -11.032 -12.506 1.00 55.55  ? 356  ARG B N   1 
ATOM   6856 C CA  . ARG B 1 356 ? 15.084  -10.048 -12.531 1.00 56.96  ? 356  ARG B CA  1 
ATOM   6857 C C   . ARG B 1 356 ? 16.191  -10.456 -13.514 1.00 59.66  ? 356  ARG B C   1 
ATOM   6858 O O   . ARG B 1 356 ? 16.699  -9.622  -14.263 1.00 58.50  ? 356  ARG B O   1 
ATOM   6859 C CB  . ARG B 1 356 ? 15.642  -9.818  -11.123 1.00 55.72  ? 356  ARG B CB  1 
ATOM   6860 C CG  . ARG B 1 356 ? 16.620  -8.674  -11.083 1.00 60.47  ? 356  ARG B CG  1 
ATOM   6861 C CD  . ARG B 1 356 ? 16.598  -7.889  -9.795  1.00 55.18  ? 356  ARG B CD  1 
ATOM   6862 N NE  . ARG B 1 356 ? 17.522  -6.766  -9.913  1.00 64.88  ? 356  ARG B NE  1 
ATOM   6863 C CZ  . ARG B 1 356 ? 17.199  -5.583  -10.432 1.00 62.86  ? 356  ARG B CZ  1 
ATOM   6864 N NH1 . ARG B 1 356 ? 15.964  -5.369  -10.857 1.00 53.54  ? 356  ARG B NH1 1 
ATOM   6865 N NH2 . ARG B 1 356 ? 18.105  -4.615  -10.516 1.00 64.45  ? 356  ARG B NH2 1 
ATOM   6866 N N   . ALA B 1 357 ? 16.541  -11.741 -13.530 1.00 55.71  ? 357  ALA B N   1 
ATOM   6867 C CA  . ALA B 1 357 ? 17.587  -12.239 -14.424 1.00 51.76  ? 357  ALA B CA  1 
ATOM   6868 C C   . ALA B 1 357 ? 17.220  -12.028 -15.878 1.00 49.95  ? 357  ALA B C   1 
ATOM   6869 O O   . ALA B 1 357 ? 18.063  -11.674 -16.690 1.00 54.01  ? 357  ALA B O   1 
ATOM   6870 C CB  . ALA B 1 357 ? 17.868  -13.728 -14.161 1.00 54.54  ? 357  ALA B CB  1 
ATOM   6871 N N   . GLN B 1 358 ? 15.954  -12.271 -16.206 1.00 49.55  ? 358  GLN B N   1 
ATOM   6872 C CA  . GLN B 1 358 ? 15.476  -12.084 -17.560 1.00 49.71  ? 358  GLN B CA  1 
ATOM   6873 C C   . GLN B 1 358 ? 15.452  -10.591 -17.922 1.00 54.34  ? 358  GLN B C   1 
ATOM   6874 O O   . GLN B 1 358 ? 15.601  -10.227 -19.099 1.00 48.18  ? 358  GLN B O   1 
ATOM   6875 C CB  . GLN B 1 358 ? 14.089  -12.702 -17.714 1.00 50.69  ? 358  GLN B CB  1 
ATOM   6876 C CG  . GLN B 1 358 ? 14.083  -14.210 -17.549 1.00 63.32  ? 358  GLN B CG  1 
ATOM   6877 C CD  . GLN B 1 358 ? 12.708  -14.809 -17.742 1.00 61.84  ? 358  GLN B CD  1 
ATOM   6878 O OE1 . GLN B 1 358 ? 11.747  -14.393 -17.093 1.00 66.56  ? 358  GLN B OE1 1 
ATOM   6879 N NE2 . GLN B 1 358 ? 12.604  -15.797 -18.632 1.00 58.76  ? 358  GLN B NE2 1 
ATOM   6880 N N   . PHE B 1 359 ? 15.259  -9.737  -16.912 1.00 50.42  ? 359  PHE B N   1 
ATOM   6881 C CA  . PHE B 1 359 ? 15.297  -8.285  -17.130 1.00 48.02  ? 359  PHE B CA  1 
ATOM   6882 C C   . PHE B 1 359 ? 16.705  -7.856  -17.543 1.00 48.92  ? 359  PHE B C   1 
ATOM   6883 O O   . PHE B 1 359 ? 16.869  -7.168  -18.553 1.00 48.21  ? 359  PHE B O   1 
ATOM   6884 C CB  . PHE B 1 359 ? 14.818  -7.503  -15.895 1.00 40.98  ? 359  PHE B CB  1 
ATOM   6885 C CG  . PHE B 1 359 ? 14.910  -5.993  -16.048 1.00 43.30  ? 359  PHE B CG  1 
ATOM   6886 C CD1 . PHE B 1 359 ? 15.572  -5.223  -15.104 1.00 43.92  ? 359  PHE B CD1 1 
ATOM   6887 C CD2 . PHE B 1 359 ? 14.343  -5.349  -17.144 1.00 49.29  ? 359  PHE B CD2 1 
ATOM   6888 C CE1 . PHE B 1 359 ? 15.656  -3.839  -15.241 1.00 47.17  ? 359  PHE B CE1 1 
ATOM   6889 C CE2 . PHE B 1 359 ? 14.432  -3.956  -17.296 1.00 50.17  ? 359  PHE B CE2 1 
ATOM   6890 C CZ  . PHE B 1 359 ? 15.086  -3.203  -16.345 1.00 45.69  ? 359  PHE B CZ  1 
ATOM   6891 N N   . LEU B 1 360 ? 17.716  -8.279  -16.780 1.00 49.15  ? 360  LEU B N   1 
ATOM   6892 C CA  . LEU B 1 360 ? 19.094  -7.938  -17.116 1.00 56.17  ? 360  LEU B CA  1 
ATOM   6893 C C   . LEU B 1 360 ? 19.468  -8.481  -18.501 1.00 58.09  ? 360  LEU B C   1 
ATOM   6894 O O   . LEU B 1 360 ? 20.151  -7.811  -19.264 1.00 59.13  ? 360  LEU B O   1 
ATOM   6895 C CB  . LEU B 1 360 ? 20.093  -8.457  -16.070 1.00 57.31  ? 360  LEU B CB  1 
ATOM   6896 C CG  . LEU B 1 360 ? 19.845  -8.374  -14.558 1.00 62.60  ? 360  LEU B CG  1 
ATOM   6897 C CD1 . LEU B 1 360 ? 21.156  -8.612  -13.817 1.00 61.39  ? 360  LEU B CD1 1 
ATOM   6898 C CD2 . LEU B 1 360 ? 19.196  -7.070  -14.096 1.00 58.95  ? 360  LEU B CD2 1 
ATOM   6899 N N   . ALA B 1 361 ? 19.037  -9.700  -18.816 1.00 52.77  ? 361  ALA B N   1 
ATOM   6900 C CA  . ALA B 1 361 ? 19.326  -10.273 -20.126 1.00 52.13  ? 361  ALA B CA  1 
ATOM   6901 C C   . ALA B 1 361 ? 18.569  -9.508  -21.210 1.00 52.91  ? 361  ALA B C   1 
ATOM   6902 O O   . ALA B 1 361 ? 19.095  -9.266  -22.293 1.00 56.13  ? 361  ALA B O   1 
ATOM   6903 C CB  . ALA B 1 361 ? 18.977  -11.774 -20.167 1.00 53.44  ? 361  ALA B CB  1 
ATOM   6904 N N   . GLY B 1 362 ? 17.331  -9.129  -20.907 1.00 51.86  ? 362  GLY B N   1 
ATOM   6905 C CA  . GLY B 1 362 ? 16.519  -8.352  -21.826 1.00 47.84  ? 362  GLY B CA  1 
ATOM   6906 C C   . GLY B 1 362 ? 17.179  -7.036  -22.174 1.00 49.86  ? 362  GLY B C   1 
ATOM   6907 O O   . GLY B 1 362 ? 17.165  -6.621  -23.336 1.00 47.09  ? 362  GLY B O   1 
ATOM   6908 N N   . VAL B 1 363 ? 17.768  -6.385  -21.170 1.00 51.08  ? 363  VAL B N   1 
ATOM   6909 C CA  . VAL B 1 363 ? 18.456  -5.106  -21.376 1.00 48.16  ? 363  VAL B CA  1 
ATOM   6910 C C   . VAL B 1 363 ? 19.683  -5.211  -22.306 1.00 48.38  ? 363  VAL B C   1 
ATOM   6911 O O   . VAL B 1 363 ? 19.938  -4.295  -23.078 1.00 47.67  ? 363  VAL B O   1 
ATOM   6912 C CB  . VAL B 1 363 ? 18.843  -4.434  -20.036 1.00 45.64  ? 363  VAL B CB  1 
ATOM   6913 C CG1 . VAL B 1 363 ? 19.754  -3.249  -20.272 1.00 44.14  ? 363  VAL B CG1 1 
ATOM   6914 C CG2 . VAL B 1 363 ? 17.592  -4.016  -19.260 1.00 44.40  ? 363  VAL B CG2 1 
ATOM   6915 N N   . ARG B 1 364 ? 20.434  -6.314  -22.241 1.00 47.66  ? 364  ARG B N   1 
ATOM   6916 C CA  . ARG B 1 364 ? 21.581  -6.492  -23.144 1.00 49.24  ? 364  ARG B CA  1 
ATOM   6917 C C   . ARG B 1 364 ? 21.132  -6.632  -24.598 1.00 51.27  ? 364  ARG B C   1 
ATOM   6918 O O   . ARG B 1 364 ? 21.880  -6.321  -25.526 1.00 51.61  ? 364  ARG B O   1 
ATOM   6919 C CB  . ARG B 1 364 ? 22.406  -7.719  -22.773 1.00 52.44  ? 364  ARG B CB  1 
ATOM   6920 C CG  . ARG B 1 364 ? 22.892  -7.768  -21.329 1.00 60.89  ? 364  ARG B CG  1 
ATOM   6921 C CD  . ARG B 1 364 ? 23.461  -6.435  -20.879 1.00 65.93  ? 364  ARG B CD  1 
ATOM   6922 N NE  . ARG B 1 364 ? 24.566  -5.973  -21.717 1.00 68.95  ? 364  ARG B NE  1 
ATOM   6923 C CZ  . ARG B 1 364 ? 25.853  -6.088  -21.391 1.00 68.90  ? 364  ARG B CZ  1 
ATOM   6924 N NH1 . ARG B 1 364 ? 26.198  -6.665  -20.238 1.00 67.39  ? 364  ARG B NH1 1 
ATOM   6925 N NH2 . ARG B 1 364 ? 26.790  -5.629  -22.217 1.00 56.64  ? 364  ARG B NH2 1 
ATOM   6926 N N   . ILE B 1 365 ? 19.910  -7.110  -24.791 1.00 43.36  ? 365  ILE B N   1 
ATOM   6927 C CA  . ILE B 1 365 ? 19.380  -7.319  -26.125 1.00 43.99  ? 365  ILE B CA  1 
ATOM   6928 C C   . ILE B 1 365 ? 18.727  -6.054  -26.665 1.00 47.37  ? 365  ILE B C   1 
ATOM   6929 O O   . ILE B 1 365 ? 18.789  -5.783  -27.869 1.00 48.65  ? 365  ILE B O   1 
ATOM   6930 C CB  . ILE B 1 365 ? 18.380  -8.501  -26.145 1.00 47.85  ? 365  ILE B CB  1 
ATOM   6931 C CG1 . ILE B 1 365 ? 19.096  -9.789  -25.717 1.00 49.81  ? 365  ILE B CG1 1 
ATOM   6932 C CG2 . ILE B 1 365 ? 17.737  -8.664  -27.523 1.00 41.64  ? 365  ILE B CG2 1 
ATOM   6933 C CD1 . ILE B 1 365 ? 18.223  -11.016 -25.763 1.00 48.95  ? 365  ILE B CD1 1 
ATOM   6934 N N   . GLY B 1 366 ? 18.124  -5.273  -25.768 1.00 47.10  ? 366  GLY B N   1 
ATOM   6935 C CA  . GLY B 1 366 ? 17.436  -4.047  -26.148 1.00 39.07  ? 366  GLY B CA  1 
ATOM   6936 C C   . GLY B 1 366 ? 18.394  -2.878  -26.272 1.00 45.49  ? 366  GLY B C   1 
ATOM   6937 O O   . GLY B 1 366 ? 18.077  -1.857  -26.872 1.00 44.22  ? 366  GLY B O   1 
ATOM   6938 N N   . VAL B 1 367 ? 19.576  -3.018  -25.683 1.00 43.01  ? 367  VAL B N   1 
ATOM   6939 C CA  . VAL B 1 367 ? 20.582  -1.987  -25.808 1.00 41.76  ? 367  VAL B CA  1 
ATOM   6940 C C   . VAL B 1 367 ? 21.867  -2.673  -26.194 1.00 42.99  ? 367  VAL B C   1 
ATOM   6941 O O   . VAL B 1 367 ? 22.843  -2.628  -25.454 1.00 38.05  ? 367  VAL B O   1 
ATOM   6942 C CB  . VAL B 1 367 ? 20.785  -1.215  -24.493 1.00 43.00  ? 367  VAL B CB  1 
ATOM   6943 C CG1 . VAL B 1 367 ? 21.637  0.024   -24.736 1.00 39.23  ? 367  VAL B CG1 1 
ATOM   6944 C CG2 . VAL B 1 367 ? 19.435  -0.842  -23.889 1.00 42.62  ? 367  VAL B CG2 1 
ATOM   6945 N N   . PRO B 1 368 ? 21.867  -3.304  -27.376 1.00 44.09  ? 368  PRO B N   1 
ATOM   6946 C CA  . PRO B 1 368 ? 22.931  -4.212  -27.827 1.00 44.83  ? 368  PRO B CA  1 
ATOM   6947 C C   . PRO B 1 368 ? 24.282  -3.527  -27.903 1.00 54.62  ? 368  PRO B C   1 
ATOM   6948 O O   . PRO B 1 368 ? 25.304  -4.210  -27.871 1.00 56.78  ? 368  PRO B O   1 
ATOM   6949 C CB  . PRO B 1 368 ? 22.474  -4.610  -29.234 1.00 44.72  ? 368  PRO B CB  1 
ATOM   6950 C CG  . PRO B 1 368 ? 21.510  -3.486  -29.649 1.00 47.59  ? 368  PRO B CG  1 
ATOM   6951 C CD  . PRO B 1 368 ? 20.797  -3.168  -28.383 1.00 43.21  ? 368  PRO B CD  1 
ATOM   6952 N N   . GLN B 1 369 ? 24.285  -2.199  -27.998 1.00 53.79  ? 369  GLN B N   1 
ATOM   6953 C CA  . GLN B 1 369 ? 25.526  -1.442  -28.132 1.00 52.35  ? 369  GLN B CA  1 
ATOM   6954 C C   . GLN B 1 369 ? 26.171  -1.109  -26.777 1.00 54.30  ? 369  GLN B C   1 
ATOM   6955 O O   . GLN B 1 369 ? 27.298  -0.606  -26.729 1.00 55.38  ? 369  GLN B O   1 
ATOM   6956 C CB  . GLN B 1 369 ? 25.282  -0.165  -28.948 1.00 54.36  ? 369  GLN B CB  1 
ATOM   6957 C CG  . GLN B 1 369 ? 25.444  -0.321  -30.495 1.00 112.51 ? 369  GLN B CG  1 
ATOM   6958 C CD  . GLN B 1 369 ? 24.409  -1.250  -31.199 1.00 68.13  ? 369  GLN B CD  1 
ATOM   6959 O OE1 . GLN B 1 369 ? 23.300  -0.821  -31.596 1.00 51.41  ? 369  GLN B OE1 1 
ATOM   6960 N NE2 . GLN B 1 369 ? 24.809  -2.510  -31.403 1.00 61.34  ? 369  GLN B NE2 1 
ATOM   6961 N N   . ALA B 1 370 ? 25.474  -1.418  -25.683 1.00 46.87  ? 370  ALA B N   1 
ATOM   6962 C CA  . ALA B 1 370 ? 25.936  -1.052  -24.336 1.00 45.84  ? 370  ALA B CA  1 
ATOM   6963 C C   . ALA B 1 370 ? 27.112  -1.861  -23.819 1.00 51.56  ? 370  ALA B C   1 
ATOM   6964 O O   . ALA B 1 370 ? 27.150  -3.085  -23.956 1.00 53.90  ? 370  ALA B O   1 
ATOM   6965 C CB  . ALA B 1 370 ? 24.789  -1.156  -23.331 1.00 47.48  ? 370  ALA B CB  1 
ATOM   6966 N N   . SER B 1 371 ? 28.056  -1.168  -23.192 1.00 50.37  ? 371  SER B N   1 
ATOM   6967 C CA  . SER B 1 371 ? 29.061  -1.801  -22.337 1.00 52.10  ? 371  SER B CA  1 
ATOM   6968 C C   . SER B 1 371 ? 28.398  -2.343  -21.065 1.00 54.90  ? 371  SER B C   1 
ATOM   6969 O O   . SER B 1 371 ? 27.291  -1.937  -20.717 1.00 52.12  ? 371  SER B O   1 
ATOM   6970 C CB  . SER B 1 371 ? 30.101  -0.763  -21.922 1.00 56.31  ? 371  SER B CB  1 
ATOM   6971 O OG  . SER B 1 371 ? 29.497  0.297   -21.179 1.00 52.86  ? 371  SER B OG  1 
ATOM   6972 N N   . ASP B 1 372 ? 29.086  -3.242  -20.368 1.00 52.28  ? 372  ASP B N   1 
ATOM   6973 C CA  . ASP B 1 372 ? 28.615  -3.779  -19.093 1.00 53.27  ? 372  ASP B CA  1 
ATOM   6974 C C   . ASP B 1 372 ? 28.119  -2.682  -18.153 1.00 56.37  ? 372  ASP B C   1 
ATOM   6975 O O   . ASP B 1 372 ? 27.042  -2.796  -17.546 1.00 55.94  ? 372  ASP B O   1 
ATOM   6976 C CB  . ASP B 1 372 ? 29.746  -4.555  -18.403 1.00 62.69  ? 372  ASP B CB  1 
ATOM   6977 C CG  . ASP B 1 372 ? 29.937  -5.954  -18.983 1.00 72.82  ? 372  ASP B CG  1 
ATOM   6978 O OD1 . ASP B 1 372 ? 29.189  -6.313  -19.917 1.00 75.79  ? 372  ASP B OD1 1 
ATOM   6979 O OD2 . ASP B 1 372 ? 30.827  -6.695  -18.506 1.00 72.54  ? 372  ASP B OD2 1 
ATOM   6980 N N   . LEU B 1 373 ? 28.916  -1.626  -18.027 1.00 53.78  ? 373  LEU B N   1 
ATOM   6981 C CA  . LEU B 1 373 ? 28.602  -0.534  -17.117 1.00 52.26  ? 373  LEU B CA  1 
ATOM   6982 C C   . LEU B 1 373 ? 27.383  0.261   -17.580 1.00 52.26  ? 373  LEU B C   1 
ATOM   6983 O O   . LEU B 1 373 ? 26.568  0.686   -16.757 1.00 50.58  ? 373  LEU B O   1 
ATOM   6984 C CB  . LEU B 1 373 ? 29.797  0.400   -16.961 1.00 48.81  ? 373  LEU B CB  1 
ATOM   6985 C CG  . LEU B 1 373 ? 29.559  1.518   -15.947 1.00 52.19  ? 373  LEU B CG  1 
ATOM   6986 C CD1 . LEU B 1 373 ? 29.275  0.942   -14.574 1.00 50.95  ? 373  LEU B CD1 1 
ATOM   6987 C CD2 . LEU B 1 373 ? 30.764  2.429   -15.894 1.00 57.18  ? 373  LEU B CD2 1 
ATOM   6988 N N   . ALA B 1 374 ? 27.272  0.465   -18.893 1.00 48.96  ? 374  ALA B N   1 
ATOM   6989 C CA  . ALA B 1 374 ? 26.129  1.170   -19.469 1.00 49.81  ? 374  ALA B CA  1 
ATOM   6990 C C   . ALA B 1 374 ? 24.857  0.386   -19.206 1.00 47.14  ? 374  ALA B C   1 
ATOM   6991 O O   . ALA B 1 374 ? 23.855  0.959   -18.805 1.00 45.38  ? 374  ALA B O   1 
ATOM   6992 C CB  . ALA B 1 374 ? 26.318  1.409   -20.985 1.00 41.08  ? 374  ALA B CB  1 
ATOM   6993 N N   . ALA B 1 375 ? 24.907  -0.926  -19.428 1.00 44.75  ? 375  ALA B N   1 
ATOM   6994 C CA  . ALA B 1 375 ? 23.747  -1.790  -19.220 1.00 45.44  ? 375  ALA B CA  1 
ATOM   6995 C C   . ALA B 1 375 ? 23.377  -1.813  -17.738 1.00 48.69  ? 375  ALA B C   1 
ATOM   6996 O O   . ALA B 1 375 ? 22.224  -1.984  -17.371 1.00 52.24  ? 375  ALA B O   1 
ATOM   6997 C CB  . ALA B 1 375 ? 24.036  -3.196  -19.719 1.00 44.71  ? 375  ALA B CB  1 
ATOM   6998 N N   . GLU B 1 376 ? 24.372  -1.633  -16.885 1.00 47.26  ? 376  GLU B N   1 
ATOM   6999 C CA  . GLU B 1 376 ? 24.139  -1.589  -15.456 1.00 50.27  ? 376  GLU B CA  1 
ATOM   7000 C C   . GLU B 1 376 ? 23.435  -0.268  -15.104 1.00 53.05  ? 376  GLU B C   1 
ATOM   7001 O O   . GLU B 1 376 ? 22.459  -0.248  -14.348 1.00 51.67  ? 376  GLU B O   1 
ATOM   7002 C CB  . GLU B 1 376 ? 25.475  -1.694  -14.726 1.00 56.77  ? 376  GLU B CB  1 
ATOM   7003 C CG  . GLU B 1 376 ? 25.406  -2.387  -13.399 1.00 74.72  ? 376  GLU B CG  1 
ATOM   7004 C CD  . GLU B 1 376 ? 26.647  -3.229  -13.140 1.00 90.69  ? 376  GLU B CD  1 
ATOM   7005 O OE1 . GLU B 1 376 ? 27.348  -3.584  -14.116 1.00 89.13  ? 376  GLU B OE1 1 
ATOM   7006 O OE2 . GLU B 1 376 ? 26.915  -3.541  -11.959 1.00 98.02  ? 376  GLU B OE2 1 
ATOM   7007 N N   . ALA B 1 377 ? 23.937  0.835   -15.654 1.00 43.67  ? 377  ALA B N   1 
ATOM   7008 C CA  . ALA B 1 377 ? 23.271  2.119   -15.482 1.00 43.84  ? 377  ALA B CA  1 
ATOM   7009 C C   . ALA B 1 377 ? 21.795  1.994   -15.875 1.00 44.61  ? 377  ALA B C   1 
ATOM   7010 O O   . ALA B 1 377 ? 20.923  2.500   -15.170 1.00 43.85  ? 377  ALA B O   1 
ATOM   7011 C CB  . ALA B 1 377 ? 23.957  3.192   -16.302 1.00 37.03  ? 377  ALA B CB  1 
ATOM   7012 N N   . VAL B 1 378 ? 21.514  1.313   -16.990 1.00 44.43  ? 378  VAL B N   1 
ATOM   7013 C CA  . VAL B 1 378 ? 20.132  1.201   -17.476 1.00 38.77  ? 378  VAL B CA  1 
ATOM   7014 C C   . VAL B 1 378 ? 19.278  0.419   -16.487 1.00 43.14  ? 378  VAL B C   1 
ATOM   7015 O O   . VAL B 1 378 ? 18.194  0.858   -16.097 1.00 41.93  ? 378  VAL B O   1 
ATOM   7016 C CB  . VAL B 1 378 ? 20.042  0.525   -18.867 1.00 40.26  ? 378  VAL B CB  1 
ATOM   7017 C CG1 . VAL B 1 378 ? 18.589  0.168   -19.203 1.00 35.23  ? 378  VAL B CG1 1 
ATOM   7018 C CG2 . VAL B 1 378 ? 20.630  1.420   -19.923 1.00 43.99  ? 378  VAL B CG2 1 
ATOM   7019 N N   . VAL B 1 379 ? 19.772  -0.750  -16.094 1.00 45.70  ? 379  VAL B N   1 
ATOM   7020 C CA  . VAL B 1 379 ? 19.082  -1.589  -15.122 1.00 47.37  ? 379  VAL B CA  1 
ATOM   7021 C C   . VAL B 1 379 ? 18.785  -0.821  -13.834 1.00 47.48  ? 379  VAL B C   1 
ATOM   7022 O O   . VAL B 1 379 ? 17.678  -0.883  -13.311 1.00 45.64  ? 379  VAL B O   1 
ATOM   7023 C CB  . VAL B 1 379 ? 19.913  -2.858  -14.793 1.00 48.19  ? 379  VAL B CB  1 
ATOM   7024 C CG1 . VAL B 1 379 ? 19.319  -3.608  -13.603 1.00 45.55  ? 379  VAL B CG1 1 
ATOM   7025 C CG2 . VAL B 1 379 ? 20.010  -3.762  -16.022 1.00 40.12  ? 379  VAL B CG2 1 
ATOM   7026 N N   . LEU B 1 380 ? 19.770  -0.085  -13.333 1.00 49.53  ? 380  LEU B N   1 
ATOM   7027 C CA  . LEU B 1 380 ? 19.598  0.630   -12.074 1.00 53.48  ? 380  LEU B CA  1 
ATOM   7028 C C   . LEU B 1 380 ? 18.573  1.762   -12.198 1.00 51.80  ? 380  LEU B C   1 
ATOM   7029 O O   . LEU B 1 380 ? 17.822  2.040   -11.261 1.00 48.30  ? 380  LEU B O   1 
ATOM   7030 C CB  . LEU B 1 380 ? 20.937  1.150   -11.554 1.00 60.18  ? 380  LEU B CB  1 
ATOM   7031 C CG  . LEU B 1 380 ? 22.013  0.069   -11.367 1.00 70.30  ? 380  LEU B CG  1 
ATOM   7032 C CD1 . LEU B 1 380 ? 23.269  0.646   -10.716 1.00 73.83  ? 380  LEU B CD1 1 
ATOM   7033 C CD2 . LEU B 1 380 ? 21.491  -1.126  -10.564 1.00 70.50  ? 380  LEU B CD2 1 
ATOM   7034 N N   . HIS B 1 381 ? 18.530  2.393   -13.364 1.00 48.70  ? 381  HIS B N   1 
ATOM   7035 C CA  . HIS B 1 381 ? 17.608  3.500   -13.598 1.00 44.81  ? 381  HIS B CA  1 
ATOM   7036 C C   . HIS B 1 381 ? 16.172  3.013   -13.684 1.00 43.59  ? 381  HIS B C   1 
ATOM   7037 O O   . HIS B 1 381 ? 15.257  3.682   -13.227 1.00 42.21  ? 381  HIS B O   1 
ATOM   7038 C CB  . HIS B 1 381 ? 17.959  4.237   -14.901 1.00 40.45  ? 381  HIS B CB  1 
ATOM   7039 C CG  . HIS B 1 381 ? 17.091  5.421   -15.167 1.00 39.95  ? 381  HIS B CG  1 
ATOM   7040 N ND1 . HIS B 1 381 ? 17.299  6.646   -14.568 1.00 49.74  ? 381  HIS B ND1 1 
ATOM   7041 C CD2 . HIS B 1 381 ? 15.991  5.563   -15.944 1.00 43.08  ? 381  HIS B CD2 1 
ATOM   7042 C CE1 . HIS B 1 381 ? 16.371  7.496   -14.975 1.00 49.21  ? 381  HIS B CE1 1 
ATOM   7043 N NE2 . HIS B 1 381 ? 15.564  6.863   -15.809 1.00 47.99  ? 381  HIS B NE2 1 
ATOM   7044 N N   . TYR B 1 382 ? 15.976  1.844   -14.283 1.00 39.90  ? 382  TYR B N   1 
ATOM   7045 C CA  . TYR B 1 382 ? 14.631  1.360   -14.562 1.00 41.52  ? 382  TYR B CA  1 
ATOM   7046 C C   . TYR B 1 382 ? 14.101  0.407   -13.499 1.00 46.81  ? 382  TYR B C   1 
ATOM   7047 O O   . TYR B 1 382 ? 12.899  0.133   -13.453 1.00 49.90  ? 382  TYR B O   1 
ATOM   7048 C CB  . TYR B 1 382 ? 14.565  0.711   -15.956 1.00 41.51  ? 382  TYR B CB  1 
ATOM   7049 C CG  . TYR B 1 382 ? 14.433  1.711   -17.075 1.00 36.67  ? 382  TYR B CG  1 
ATOM   7050 C CD1 . TYR B 1 382 ? 15.554  2.357   -17.586 1.00 37.38  ? 382  TYR B CD1 1 
ATOM   7051 C CD2 . TYR B 1 382 ? 13.190  2.031   -17.608 1.00 41.95  ? 382  TYR B CD2 1 
ATOM   7052 C CE1 . TYR B 1 382 ? 15.454  3.269   -18.611 1.00 36.18  ? 382  TYR B CE1 1 
ATOM   7053 C CE2 . TYR B 1 382 ? 13.064  2.957   -18.647 1.00 38.37  ? 382  TYR B CE2 1 
ATOM   7054 C CZ  . TYR B 1 382 ? 14.209  3.565   -19.146 1.00 43.54  ? 382  TYR B CZ  1 
ATOM   7055 O OH  . TYR B 1 382 ? 14.128  4.482   -20.166 1.00 40.70  ? 382  TYR B OH  1 
ATOM   7056 N N   . THR B 1 383 ? 14.993  -0.099  -12.649 1.00 50.27  ? 383  THR B N   1 
ATOM   7057 C CA  . THR B 1 383 ? 14.566  -0.921  -11.525 1.00 44.39  ? 383  THR B CA  1 
ATOM   7058 C C   . THR B 1 383 ? 13.756  -0.064  -10.582 1.00 48.24  ? 383  THR B C   1 
ATOM   7059 O O   . THR B 1 383 ? 14.145  1.068   -10.278 1.00 44.89  ? 383  THR B O   1 
ATOM   7060 C CB  . THR B 1 383 ? 15.760  -1.534  -10.774 1.00 43.16  ? 383  THR B CB  1 
ATOM   7061 O OG1 . THR B 1 383 ? 16.354  -2.545  -11.589 1.00 46.14  ? 383  THR B OG1 1 
ATOM   7062 C CG2 . THR B 1 383 ? 15.327  -2.164  -9.438  1.00 40.27  ? 383  THR B CG2 1 
ATOM   7063 N N   . ASP B 1 384 ? 12.612  -0.589  -10.150 1.00 50.86  ? 384  ASP B N   1 
ATOM   7064 C CA  . ASP B 1 384 ? 11.870  0.012   -9.047  1.00 52.84  ? 384  ASP B CA  1 
ATOM   7065 C C   . ASP B 1 384 ? 12.410  -0.567  -7.734  1.00 50.67  ? 384  ASP B C   1 
ATOM   7066 O O   . ASP B 1 384 ? 12.144  -1.730  -7.404  1.00 44.68  ? 384  ASP B O   1 
ATOM   7067 C CB  . ASP B 1 384 ? 10.372  -0.245  -9.179  1.00 51.51  ? 384  ASP B CB  1 
ATOM   7068 C CG  . ASP B 1 384 ? 9.560   0.469   -8.097  1.00 66.18  ? 384  ASP B CG  1 
ATOM   7069 O OD1 . ASP B 1 384 ? 10.032  0.535   -6.940  1.00 58.91  ? 384  ASP B OD1 1 
ATOM   7070 O OD2 . ASP B 1 384 ? 8.453   0.972   -8.405  1.00 74.21  ? 384  ASP B OD2 1 
ATOM   7071 N N   . TRP B 1 385 ? 13.180  0.246   -7.006  1.00 44.35  ? 385  TRP B N   1 
ATOM   7072 C CA  . TRP B 1 385 ? 13.904  -0.219  -5.814  1.00 52.67  ? 385  TRP B CA  1 
ATOM   7073 C C   . TRP B 1 385 ? 13.021  -0.514  -4.590  1.00 55.29  ? 385  TRP B C   1 
ATOM   7074 O O   . TRP B 1 385 ? 13.464  -1.137  -3.622  1.00 54.68  ? 385  TRP B O   1 
ATOM   7075 C CB  . TRP B 1 385 ? 15.122  0.695   -5.500  1.00 54.08  ? 385  TRP B CB  1 
ATOM   7076 C CG  . TRP B 1 385 ? 16.154  0.566   -6.586  1.00 48.52  ? 385  TRP B CG  1 
ATOM   7077 C CD1 . TRP B 1 385 ? 16.383  1.440   -7.621  1.00 43.78  ? 385  TRP B CD1 1 
ATOM   7078 C CD2 . TRP B 1 385 ? 17.016  -0.555  -6.814  1.00 45.93  ? 385  TRP B CD2 1 
ATOM   7079 N NE1 . TRP B 1 385 ? 17.361  0.947   -8.447  1.00 44.74  ? 385  TRP B NE1 1 
ATOM   7080 C CE2 . TRP B 1 385 ? 17.766  -0.277  -7.977  1.00 45.72  ? 385  TRP B CE2 1 
ATOM   7081 C CE3 . TRP B 1 385 ? 17.237  -1.763  -6.140  1.00 49.32  ? 385  TRP B CE3 1 
ATOM   7082 C CZ2 . TRP B 1 385 ? 18.726  -1.162  -8.479  1.00 52.14  ? 385  TRP B CZ2 1 
ATOM   7083 C CZ3 . TRP B 1 385 ? 18.192  -2.646  -6.644  1.00 53.37  ? 385  TRP B CZ3 1 
ATOM   7084 C CH2 . TRP B 1 385 ? 18.925  -2.337  -7.799  1.00 54.69  ? 385  TRP B CH2 1 
ATOM   7085 N N   . LEU B 1 386 ? 11.758  -0.109  -4.653  1.00 64.09  ? 386  LEU B N   1 
ATOM   7086 C CA  . LEU B 1 386 ? 10.775  -0.580  -3.673  1.00 70.74  ? 386  LEU B CA  1 
ATOM   7087 C C   . LEU B 1 386 ? 10.341  -2.009  -3.986  1.00 69.37  ? 386  LEU B C   1 
ATOM   7088 O O   . LEU B 1 386 ? 10.051  -2.789  -3.082  1.00 71.77  ? 386  LEU B O   1 
ATOM   7089 C CB  . LEU B 1 386 ? 9.559   0.340   -3.646  1.00 70.38  ? 386  LEU B CB  1 
ATOM   7090 C CG  . LEU B 1 386 ? 9.840   1.658   -2.942  1.00 75.90  ? 386  LEU B CG  1 
ATOM   7091 C CD1 . LEU B 1 386 ? 8.840   2.732   -3.365  1.00 76.72  ? 386  LEU B CD1 1 
ATOM   7092 C CD2 . LEU B 1 386 ? 9.834   1.421   -1.436  1.00 81.25  ? 386  LEU B CD2 1 
ATOM   7093 N N   . HIS B 1 387 ? 10.298  -2.341  -5.275  1.00 68.69  ? 387  HIS B N   1 
ATOM   7094 C CA  . HIS B 1 387 ? 9.840   -3.655  -5.729  1.00 69.19  ? 387  HIS B CA  1 
ATOM   7095 C C   . HIS B 1 387 ? 10.802  -4.210  -6.766  1.00 62.09  ? 387  HIS B C   1 
ATOM   7096 O O   . HIS B 1 387 ? 10.414  -4.430  -7.907  1.00 57.67  ? 387  HIS B O   1 
ATOM   7097 C CB  . HIS B 1 387 ? 8.446   -3.545  -6.353  1.00 67.47  ? 387  HIS B CB  1 
ATOM   7098 C CG  . HIS B 1 387 ? 7.485   -2.729  -5.546  1.00 72.05  ? 387  HIS B CG  1 
ATOM   7099 N ND1 . HIS B 1 387 ? 7.158   -1.429  -5.870  1.00 76.67  ? 387  HIS B ND1 1 
ATOM   7100 C CD2 . HIS B 1 387 ? 6.793   -3.023  -4.419  1.00 75.24  ? 387  HIS B CD2 1 
ATOM   7101 C CE1 . HIS B 1 387 ? 6.302   -0.957  -4.979  1.00 77.02  ? 387  HIS B CE1 1 
ATOM   7102 N NE2 . HIS B 1 387 ? 6.063   -1.905  -4.090  1.00 80.79  ? 387  HIS B NE2 1 
ATOM   7103 N N   . PRO B 1 388 ? 12.066  -4.428  -6.372  1.00 60.67  ? 388  PRO B N   1 
ATOM   7104 C CA  . PRO B 1 388 ? 13.130  -4.773  -7.324  1.00 58.70  ? 388  PRO B CA  1 
ATOM   7105 C C   . PRO B 1 388 ? 12.910  -6.102  -8.037  1.00 58.60  ? 388  PRO B C   1 
ATOM   7106 O O   . PRO B 1 388 ? 13.514  -6.312  -9.086  1.00 59.86  ? 388  PRO B O   1 
ATOM   7107 C CB  . PRO B 1 388 ? 14.378  -4.863  -6.431  1.00 58.30  ? 388  PRO B CB  1 
ATOM   7108 C CG  . PRO B 1 388 ? 13.831  -5.121  -5.048  1.00 57.44  ? 388  PRO B CG  1 
ATOM   7109 C CD  . PRO B 1 388 ? 12.591  -4.285  -5.001  1.00 60.07  ? 388  PRO B CD  1 
ATOM   7110 N N   . GLU B 1 389 ? 12.078  -6.978  -7.479  1.00 61.36  ? 389  GLU B N   1 
ATOM   7111 C CA  . GLU B 1 389 ? 11.909  -8.332  -8.028  1.00 68.41  ? 389  GLU B CA  1 
ATOM   7112 C C   . GLU B 1 389 ? 10.507  -8.567  -8.587  1.00 64.51  ? 389  GLU B C   1 
ATOM   7113 O O   . GLU B 1 389 ? 10.212  -9.650  -9.102  1.00 64.71  ? 389  GLU B O   1 
ATOM   7114 C CB  . GLU B 1 389 ? 12.200  -9.397  -6.960  1.00 70.45  ? 389  GLU B CB  1 
ATOM   7115 C CG  . GLU B 1 389 ? 13.489  -9.189  -6.182  1.00 85.13  ? 389  GLU B CG  1 
ATOM   7116 C CD  . GLU B 1 389 ? 14.657  -9.988  -6.733  1.00 96.43  ? 389  GLU B CD  1 
ATOM   7117 O OE1 . GLU B 1 389 ? 14.433  -10.897 -7.559  1.00 98.18  ? 389  GLU B OE1 1 
ATOM   7118 O OE2 . GLU B 1 389 ? 15.805  -9.711  -6.327  1.00 103.80 ? 389  GLU B OE2 1 
ATOM   7119 N N   . ASP B 1 390 ? 9.642   -7.563  -8.468  1.00 53.82  ? 390  ASP B N   1 
ATOM   7120 C CA  . ASP B 1 390 ? 8.276   -7.705  -8.940  1.00 55.46  ? 390  ASP B CA  1 
ATOM   7121 C C   . ASP B 1 390 ? 8.244   -7.915  -10.447 1.00 55.45  ? 390  ASP B C   1 
ATOM   7122 O O   . ASP B 1 390 ? 8.727   -7.079  -11.198 1.00 54.54  ? 390  ASP B O   1 
ATOM   7123 C CB  . ASP B 1 390 ? 7.446   -6.481  -8.596  1.00 60.97  ? 390  ASP B CB  1 
ATOM   7124 C CG  . ASP B 1 390 ? 6.013   -6.630  -9.036  1.00 66.10  ? 390  ASP B CG  1 
ATOM   7125 O OD1 . ASP B 1 390 ? 5.328   -7.517  -8.477  1.00 69.89  ? 390  ASP B OD1 1 
ATOM   7126 O OD2 . ASP B 1 390 ? 5.581   -5.888  -9.947  1.00 59.64  ? 390  ASP B OD2 1 
ATOM   7127 N N   . PRO B 1 391 ? 7.669   -9.040  -10.893 1.00 54.97  ? 391  PRO B N   1 
ATOM   7128 C CA  . PRO B 1 391 ? 7.661   -9.375  -12.324 1.00 50.54  ? 391  PRO B CA  1 
ATOM   7129 C C   . PRO B 1 391 ? 6.819   -8.430  -13.204 1.00 53.27  ? 391  PRO B C   1 
ATOM   7130 O O   . PRO B 1 391 ? 7.170   -8.243  -14.355 1.00 54.21  ? 391  PRO B O   1 
ATOM   7131 C CB  . PRO B 1 391 ? 7.122   -10.818 -12.347 1.00 53.39  ? 391  PRO B CB  1 
ATOM   7132 C CG  . PRO B 1 391 ? 7.427   -11.356 -10.961 1.00 57.14  ? 391  PRO B CG  1 
ATOM   7133 C CD  . PRO B 1 391 ? 7.222   -10.167 -10.054 1.00 57.43  ? 391  PRO B CD  1 
ATOM   7134 N N   . THR B 1 392 ? 5.742   -7.852  -12.681 1.00 55.78  ? 392  THR B N   1 
ATOM   7135 C CA  . THR B 1 392 ? 4.947   -6.876  -13.431 1.00 51.81  ? 392  THR B CA  1 
ATOM   7136 C C   . THR B 1 392 ? 5.739   -5.585  -13.710 1.00 54.46  ? 392  THR B C   1 
ATOM   7137 O O   . THR B 1 392 ? 5.660   -5.022  -14.804 1.00 56.34  ? 392  THR B O   1 
ATOM   7138 C CB  . THR B 1 392 ? 3.625   -6.529  -12.681 1.00 60.41  ? 392  THR B CB  1 
ATOM   7139 O OG1 . THR B 1 392 ? 2.732   -7.649  -12.732 1.00 65.02  ? 392  THR B OG1 1 
ATOM   7140 C CG2 . THR B 1 392 ? 2.939   -5.325  -13.300 1.00 53.50  ? 392  THR B CG2 1 
ATOM   7141 N N   . HIS B 1 393 ? 6.494   -5.119  -12.717 1.00 55.90  ? 393  HIS B N   1 
ATOM   7142 C CA  . HIS B 1 393 ? 7.299   -3.909  -12.864 1.00 57.13  ? 393  HIS B CA  1 
ATOM   7143 C C   . HIS B 1 393 ? 8.423   -4.192  -13.826 1.00 52.02  ? 393  HIS B C   1 
ATOM   7144 O O   . HIS B 1 393 ? 8.736   -3.362  -14.670 1.00 50.30  ? 393  HIS B O   1 
ATOM   7145 C CB  . HIS B 1 393 ? 7.916   -3.463  -11.537 1.00 63.53  ? 393  HIS B CB  1 
ATOM   7146 C CG  . HIS B 1 393 ? 6.982   -2.708  -10.643 1.00 72.81  ? 393  HIS B CG  1 
ATOM   7147 N ND1 . HIS B 1 393 ? 6.193   -3.326  -9.696  1.00 74.98  ? 393  HIS B ND1 1 
ATOM   7148 C CD2 . HIS B 1 393 ? 6.740   -1.381  -10.524 1.00 75.20  ? 393  HIS B CD2 1 
ATOM   7149 C CE1 . HIS B 1 393 ? 5.493   -2.414  -9.044  1.00 74.41  ? 393  HIS B CE1 1 
ATOM   7150 N NE2 . HIS B 1 393 ? 5.810   -1.225  -9.524  1.00 72.62  ? 393  HIS B NE2 1 
ATOM   7151 N N   . LEU B 1 394 ? 9.036   -5.365  -13.687 1.00 48.51  ? 394  LEU B N   1 
ATOM   7152 C CA  . LEU B 1 394 ? 10.170  -5.724  -14.526 1.00 50.70  ? 394  LEU B CA  1 
ATOM   7153 C C   . LEU B 1 394 ? 9.761   -5.853  -15.990 1.00 51.37  ? 394  LEU B C   1 
ATOM   7154 O O   . LEU B 1 394 ? 10.508  -5.479  -16.891 1.00 51.28  ? 394  LEU B O   1 
ATOM   7155 C CB  . LEU B 1 394 ? 10.837  -7.009  -14.034 1.00 47.69  ? 394  LEU B CB  1 
ATOM   7156 C CG  . LEU B 1 394 ? 11.504  -6.864  -12.670 1.00 51.98  ? 394  LEU B CG  1 
ATOM   7157 C CD1 . LEU B 1 394 ? 11.886  -8.239  -12.116 1.00 55.18  ? 394  LEU B CD1 1 
ATOM   7158 C CD2 . LEU B 1 394 ? 12.712  -5.919  -12.741 1.00 44.83  ? 394  LEU B CD2 1 
ATOM   7159 N N   . ARG B 1 395 ? 8.568   -6.377  -16.222 1.00 50.71  ? 395  ARG B N   1 
ATOM   7160 C CA  . ARG B 1 395 ? 8.066   -6.523  -17.577 1.00 49.72  ? 395  ARG B CA  1 
ATOM   7161 C C   . ARG B 1 395 ? 7.801   -5.144  -18.194 1.00 48.85  ? 395  ARG B C   1 
ATOM   7162 O O   . ARG B 1 395 ? 8.215   -4.863  -19.324 1.00 45.04  ? 395  ARG B O   1 
ATOM   7163 C CB  . ARG B 1 395 ? 6.805   -7.382  -17.583 1.00 48.33  ? 395  ARG B CB  1 
ATOM   7164 C CG  . ARG B 1 395 ? 6.083   -7.432  -18.923 1.00 51.84  ? 395  ARG B CG  1 
ATOM   7165 C CD  . ARG B 1 395 ? 4.762   -6.704  -18.834 1.00 54.49  ? 395  ARG B CD  1 
ATOM   7166 N NE  . ARG B 1 395 ? 3.728   -7.598  -18.363 1.00 57.20  ? 395  ARG B NE  1 
ATOM   7167 C CZ  . ARG B 1 395 ? 2.644   -7.228  -17.688 1.00 57.40  ? 395  ARG B CZ  1 
ATOM   7168 N NH1 . ARG B 1 395 ? 2.431   -5.953  -17.380 1.00 41.56  ? 395  ARG B NH1 1 
ATOM   7169 N NH2 . ARG B 1 395 ? 1.771   -8.158  -17.313 1.00 61.46  ? 395  ARG B NH2 1 
ATOM   7170 N N   . ASP B 1 396 ? 7.137   -4.281  -17.435 1.00 44.20  ? 396  ASP B N   1 
ATOM   7171 C CA  . ASP B 1 396 ? 6.804   -2.945  -17.924 1.00 43.82  ? 396  ASP B CA  1 
ATOM   7172 C C   . ASP B 1 396 ? 8.047   -2.075  -18.076 1.00 46.11  ? 396  ASP B C   1 
ATOM   7173 O O   . ASP B 1 396 ? 8.091   -1.201  -18.932 1.00 49.35  ? 396  ASP B O   1 
ATOM   7174 C CB  . ASP B 1 396 ? 5.763   -2.281  -17.020 1.00 43.39  ? 396  ASP B CB  1 
ATOM   7175 C CG  . ASP B 1 396 ? 4.414   -3.005  -17.054 1.00 59.45  ? 396  ASP B CG  1 
ATOM   7176 O OD1 . ASP B 1 396 ? 4.199   -3.833  -17.974 1.00 59.76  ? 396  ASP B OD1 1 
ATOM   7177 O OD2 . ASP B 1 396 ? 3.568   -2.752  -16.167 1.00 63.86  ? 396  ASP B OD2 1 
ATOM   7178 N N   . ALA B 1 397 ? 9.057   -2.327  -17.247 1.00 46.00  ? 397  ALA B N   1 
ATOM   7179 C CA  . ALA B 1 397 ? 10.317  -1.600  -17.333 1.00 43.63  ? 397  ALA B CA  1 
ATOM   7180 C C   . ALA B 1 397 ? 11.063  -2.002  -18.608 1.00 44.03  ? 397  ALA B C   1 
ATOM   7181 O O   . ALA B 1 397 ? 11.626  -1.155  -19.299 1.00 43.79  ? 397  ALA B O   1 
ATOM   7182 C CB  . ALA B 1 397 ? 11.182  -1.863  -16.091 1.00 35.22  ? 397  ALA B CB  1 
ATOM   7183 N N   . MET B 1 398 ? 11.052  -3.298  -18.914 1.00 45.70  ? 398  MET B N   1 
ATOM   7184 C CA  . MET B 1 398 ? 11.696  -3.820  -20.120 1.00 42.99  ? 398  MET B CA  1 
ATOM   7185 C C   . MET B 1 398 ? 11.102  -3.146  -21.355 1.00 45.31  ? 398  MET B C   1 
ATOM   7186 O O   . MET B 1 398 ? 11.832  -2.730  -22.261 1.00 44.56  ? 398  MET B O   1 
ATOM   7187 C CB  . MET B 1 398 ? 11.512  -5.340  -20.199 1.00 44.17  ? 398  MET B CB  1 
ATOM   7188 C CG  . MET B 1 398 ? 12.358  -6.045  -21.246 1.00 43.12  ? 398  MET B CG  1 
ATOM   7189 S SD  . MET B 1 398 ? 14.132  -5.779  -21.069 1.00 52.58  ? 398  MET B SD  1 
ATOM   7190 C CE  . MET B 1 398 ? 14.477  -4.687  -22.439 1.00 46.91  ? 398  MET B CE  1 
ATOM   7191 N N   . SER B 1 399 ? 9.775   -3.027  -21.383 1.00 44.57  ? 399  SER B N   1 
ATOM   7192 C CA  . SER B 1 399 ? 9.103   -2.317  -22.464 1.00 46.29  ? 399  SER B CA  1 
ATOM   7193 C C   . SER B 1 399 ? 9.528   -0.838  -22.537 1.00 41.35  ? 399  SER B C   1 
ATOM   7194 O O   . SER B 1 399 ? 9.873   -0.339  -23.611 1.00 38.39  ? 399  SER B O   1 
ATOM   7195 C CB  . SER B 1 399 ? 7.591   -2.417  -22.306 1.00 46.29  ? 399  SER B CB  1 
ATOM   7196 O OG  . SER B 1 399 ? 6.941   -1.541  -23.207 1.00 40.67  ? 399  SER B OG  1 
ATOM   7197 N N   . ALA B 1 400 ? 9.511   -0.146  -21.399 1.00 40.49  ? 400  ALA B N   1 
ATOM   7198 C CA  . ALA B 1 400 ? 9.945   1.260   -21.358 1.00 41.20  ? 400  ALA B CA  1 
ATOM   7199 C C   . ALA B 1 400 ? 11.381  1.427   -21.840 1.00 36.97  ? 400  ALA B C   1 
ATOM   7200 O O   . ALA B 1 400 ? 11.687  2.362   -22.582 1.00 39.23  ? 400  ALA B O   1 
ATOM   7201 C CB  . ALA B 1 400 ? 9.792   1.849   -19.948 1.00 37.37  ? 400  ALA B CB  1 
ATOM   7202 N N   . VAL B 1 401 ? 12.277  0.539   -21.410 1.00 32.93  ? 401  VAL B N   1 
ATOM   7203 C CA  . VAL B 1 401 ? 13.663  0.645   -21.865 1.00 35.39  ? 401  VAL B CA  1 
ATOM   7204 C C   . VAL B 1 401 ? 13.731  0.680   -23.400 1.00 35.53  ? 401  VAL B C   1 
ATOM   7205 O O   . VAL B 1 401 ? 14.431  1.499   -23.996 1.00 33.60  ? 401  VAL B O   1 
ATOM   7206 C CB  . VAL B 1 401 ? 14.528  -0.531  -21.362 1.00 36.92  ? 401  VAL B CB  1 
ATOM   7207 C CG1 . VAL B 1 401 ? 15.801  -0.604  -22.168 1.00 31.35  ? 401  VAL B CG1 1 
ATOM   7208 C CG2 . VAL B 1 401 ? 14.844  -0.385  -19.882 1.00 33.85  ? 401  VAL B CG2 1 
ATOM   7209 N N   . VAL B 1 402 ? 12.987  -0.218  -24.038 1.00 40.66  ? 402  VAL B N   1 
ATOM   7210 C CA  . VAL B 1 402 ? 13.051  -0.367  -25.480 1.00 37.08  ? 402  VAL B CA  1 
ATOM   7211 C C   . VAL B 1 402 ? 12.392  0.832   -26.163 1.00 38.62  ? 402  VAL B C   1 
ATOM   7212 O O   . VAL B 1 402 ? 12.933  1.386   -27.119 1.00 37.48  ? 402  VAL B O   1 
ATOM   7213 C CB  . VAL B 1 402 ? 12.398  -1.702  -25.946 1.00 40.34  ? 402  VAL B CB  1 
ATOM   7214 C CG1 . VAL B 1 402 ? 12.161  -1.704  -27.480 1.00 29.85  ? 402  VAL B CG1 1 
ATOM   7215 C CG2 . VAL B 1 402 ? 13.254  -2.902  -25.493 1.00 36.61  ? 402  VAL B CG2 1 
ATOM   7216 N N   . GLY B 1 403 ? 11.236  1.246   -25.658 1.00 41.95  ? 403  GLY B N   1 
ATOM   7217 C CA  . GLY B 1 403 ? 10.525  2.377   -26.241 1.00 37.88  ? 403  GLY B CA  1 
ATOM   7218 C C   . GLY B 1 403 ? 11.221  3.713   -26.034 1.00 40.29  ? 403  GLY B C   1 
ATOM   7219 O O   . GLY B 1 403 ? 11.229  4.565   -26.931 1.00 35.11  ? 403  GLY B O   1 
ATOM   7220 N N   . ASP B 1 404 ? 11.798  3.906   -24.847 1.00 35.54  ? 404  ASP B N   1 
ATOM   7221 C CA  . ASP B 1 404 ? 12.457  5.162   -24.528 1.00 36.92  ? 404  ASP B CA  1 
ATOM   7222 C C   . ASP B 1 404 ? 13.724  5.273   -25.349 1.00 33.90  ? 404  ASP B C   1 
ATOM   7223 O O   . ASP B 1 404 ? 13.977  6.307   -25.962 1.00 33.64  ? 404  ASP B O   1 
ATOM   7224 C CB  . ASP B 1 404 ? 12.788  5.266   -23.020 1.00 36.91  ? 404  ASP B CB  1 
ATOM   7225 C CG  . ASP B 1 404 ? 11.544  5.335   -22.147 1.00 41.95  ? 404  ASP B CG  1 
ATOM   7226 O OD1 . ASP B 1 404 ? 10.446  5.561   -22.709 1.00 42.45  ? 404  ASP B OD1 1 
ATOM   7227 O OD2 . ASP B 1 404 ? 11.661  5.177   -20.901 1.00 39.50  ? 404  ASP B OD2 1 
ATOM   7228 N N   . HIS B 1 405 ? 14.536  4.217   -25.332 1.00 34.57  ? 405  HIS B N   1 
ATOM   7229 C CA  . HIS B 1 405 ? 15.825  4.223   -26.029 1.00 31.09  ? 405  HIS B CA  1 
ATOM   7230 C C   . HIS B 1 405 ? 15.624  4.389   -27.547 1.00 35.36  ? 405  HIS B C   1 
ATOM   7231 O O   . HIS B 1 405 ? 16.335  5.143   -28.191 1.00 32.75  ? 405  HIS B O   1 
ATOM   7232 C CB  . HIS B 1 405 ? 16.572  2.911   -25.765 1.00 32.04  ? 405  HIS B CB  1 
ATOM   7233 C CG  . HIS B 1 405 ? 17.875  2.784   -26.501 1.00 38.14  ? 405  HIS B CG  1 
ATOM   7234 N ND1 . HIS B 1 405 ? 18.774  3.823   -26.615 1.00 42.85  ? 405  HIS B ND1 1 
ATOM   7235 C CD2 . HIS B 1 405 ? 18.450  1.724   -27.117 1.00 42.51  ? 405  HIS B CD2 1 
ATOM   7236 C CE1 . HIS B 1 405 ? 19.837  3.413   -27.285 1.00 42.72  ? 405  HIS B CE1 1 
ATOM   7237 N NE2 . HIS B 1 405 ? 19.672  2.140   -27.590 1.00 38.42  ? 405  HIS B NE2 1 
ATOM   7238 N N   . ASN B 1 406 ? 14.647  3.688   -28.116 1.00 31.74  ? 406  ASN B N   1 
ATOM   7239 C CA  . ASN B 1 406 ? 14.482  3.712   -29.569 1.00 32.71  ? 406  ASN B CA  1 
ATOM   7240 C C   . ASN B 1 406 ? 13.580  4.787   -30.140 1.00 36.14  ? 406  ASN B C   1 
ATOM   7241 O O   . ASN B 1 406 ? 13.802  5.231   -31.253 1.00 36.21  ? 406  ASN B O   1 
ATOM   7242 C CB  . ASN B 1 406 ? 14.047  2.344   -30.072 1.00 32.42  ? 406  ASN B CB  1 
ATOM   7243 C CG  . ASN B 1 406 ? 15.135  1.317   -29.880 1.00 36.89  ? 406  ASN B CG  1 
ATOM   7244 O OD1 . ASN B 1 406 ? 16.217  1.465   -30.444 1.00 34.72  ? 406  ASN B OD1 1 
ATOM   7245 N ND2 . ASN B 1 406 ? 14.892  0.323   -29.011 1.00 34.11  ? 406  ASN B ND2 1 
ATOM   7246 N N   . VAL B 1 407 ? 12.568  5.198   -29.387 1.00 34.83  ? 407  VAL B N   1 
ATOM   7247 C CA  . VAL B 1 407 ? 11.600  6.157   -29.902 1.00 35.21  ? 407  VAL B CA  1 
ATOM   7248 C C   . VAL B 1 407 ? 11.416  7.442   -29.057 1.00 37.98  ? 407  VAL B C   1 
ATOM   7249 O O   . VAL B 1 407 ? 11.624  8.550   -29.562 1.00 35.98  ? 407  VAL B O   1 
ATOM   7250 C CB  . VAL B 1 407 ? 10.239  5.495   -30.127 1.00 33.09  ? 407  VAL B CB  1 
ATOM   7251 C CG1 . VAL B 1 407 ? 9.258   6.492   -30.748 1.00 31.12  ? 407  VAL B CG1 1 
ATOM   7252 C CG2 . VAL B 1 407 ? 10.383  4.259   -31.014 1.00 30.26  ? 407  VAL B CG2 1 
ATOM   7253 N N   . VAL B 1 408 ? 11.018  7.305   -27.793 1.00 34.36  ? 408  VAL B N   1 
ATOM   7254 C CA  . VAL B 1 408 ? 10.593  8.485   -27.037 1.00 32.41  ? 408  VAL B CA  1 
ATOM   7255 C C   . VAL B 1 408 ? 11.731  9.494   -26.840 1.00 37.27  ? 408  VAL B C   1 
ATOM   7256 O O   . VAL B 1 408 ? 11.569  10.695  -27.057 1.00 34.15  ? 408  VAL B O   1 
ATOM   7257 C CB  . VAL B 1 408 ? 10.022  8.121   -25.659 1.00 36.45  ? 408  VAL B CB  1 
ATOM   7258 C CG1 . VAL B 1 408 ? 9.609   9.393   -24.906 1.00 32.71  ? 408  VAL B CG1 1 
ATOM   7259 C CG2 . VAL B 1 408 ? 8.848   7.155   -25.804 1.00 32.87  ? 408  VAL B CG2 1 
ATOM   7260 N N   . CYS B 1 409 ? 12.893  9.013   -26.440 1.00 28.90  ? 409  CYS B N   1 
ATOM   7261 C CA  . CYS B 1 409 ? 13.967  9.944   -26.182 1.00 32.42  ? 409  CYS B CA  1 
ATOM   7262 C C   . CYS B 1 409 ? 14.545  10.546  -27.467 1.00 37.42  ? 409  CYS B C   1 
ATOM   7263 O O   . CYS B 1 409 ? 14.829  11.755  -27.494 1.00 37.35  ? 409  CYS B O   1 
ATOM   7264 C CB  . CYS B 1 409 ? 15.012  9.321   -25.248 1.00 29.35  ? 409  CYS B CB  1 
ATOM   7265 S SG  . CYS B 1 409 ? 14.278  8.975   -23.600 1.00 38.95  ? 409  CYS B SG  1 
ATOM   7266 N N   . PRO B 1 410 ? 14.699  9.727   -28.538 1.00 35.11  ? 410  PRO B N   1 
ATOM   7267 C CA  . PRO B 1 410 ? 15.060  10.329  -29.835 1.00 38.82  ? 410  PRO B CA  1 
ATOM   7268 C C   . PRO B 1 410 ? 14.059  11.393  -30.312 1.00 35.15  ? 410  PRO B C   1 
ATOM   7269 O O   . PRO B 1 410 ? 14.476  12.424  -30.848 1.00 30.98  ? 410  PRO B O   1 
ATOM   7270 C CB  . PRO B 1 410 ? 15.081  9.128   -30.788 1.00 35.82  ? 410  PRO B CB  1 
ATOM   7271 C CG  . PRO B 1 410 ? 15.528  7.994   -29.898 1.00 36.37  ? 410  PRO B CG  1 
ATOM   7272 C CD  . PRO B 1 410 ? 14.840  8.255   -28.568 1.00 36.10  ? 410  PRO B CD  1 
ATOM   7273 N N   . VAL B 1 411 ? 12.765  11.158  -30.110 1.00 34.15  ? 411  VAL B N   1 
ATOM   7274 C CA  . VAL B 1 411 ? 11.762  12.142  -30.486 1.00 32.41  ? 411  VAL B CA  1 
ATOM   7275 C C   . VAL B 1 411 ? 11.911  13.417  -29.626 1.00 36.47  ? 411  VAL B C   1 
ATOM   7276 O O   . VAL B 1 411 ? 11.867  14.549  -30.152 1.00 34.45  ? 411  VAL B O   1 
ATOM   7277 C CB  . VAL B 1 411 ? 10.315  11.571  -30.392 1.00 33.47  ? 411  VAL B CB  1 
ATOM   7278 C CG1 . VAL B 1 411 ? 9.322   12.689  -30.378 1.00 30.76  ? 411  VAL B CG1 1 
ATOM   7279 C CG2 . VAL B 1 411 ? 10.029  10.636  -31.545 1.00 32.64  ? 411  VAL B CG2 1 
ATOM   7280 N N   . ALA B 1 412 ? 12.105  13.245  -28.316 1.00 32.30  ? 412  ALA B N   1 
ATOM   7281 C CA  . ALA B 1 412 ? 12.237  14.413  -27.417 1.00 34.55  ? 412  ALA B CA  1 
ATOM   7282 C C   . ALA B 1 412 ? 13.461  15.224  -27.806 1.00 33.21  ? 412  ALA B C   1 
ATOM   7283 O O   . ALA B 1 412 ? 13.450  16.462  -27.819 1.00 33.18  ? 412  ALA B O   1 
ATOM   7284 C CB  . ALA B 1 412 ? 12.328  13.987  -25.949 1.00 33.99  ? 412  ALA B CB  1 
ATOM   7285 N N   . GLN B 1 413 ? 14.525  14.515  -28.150 1.00 34.25  ? 413  GLN B N   1 
ATOM   7286 C CA  . GLN B 1 413 ? 15.738  15.193  -28.588 1.00 34.48  ? 413  GLN B CA  1 
ATOM   7287 C C   . GLN B 1 413 ? 15.530  15.989  -29.884 1.00 33.56  ? 413  GLN B C   1 
ATOM   7288 O O   . GLN B 1 413 ? 15.938  17.148  -29.990 1.00 36.03  ? 413  GLN B O   1 
ATOM   7289 C CB  . GLN B 1 413 ? 16.860  14.192  -28.777 1.00 36.05  ? 413  GLN B CB  1 
ATOM   7290 C CG  . GLN B 1 413 ? 18.095  14.828  -29.355 1.00 43.85  ? 413  GLN B CG  1 
ATOM   7291 C CD  . GLN B 1 413 ? 19.236  13.867  -29.400 1.00 57.54  ? 413  GLN B CD  1 
ATOM   7292 O OE1 . GLN B 1 413 ? 20.144  13.932  -28.575 1.00 69.14  ? 413  GLN B OE1 1 
ATOM   7293 N NE2 . GLN B 1 413 ? 19.195  12.943  -30.350 1.00 60.86  ? 413  GLN B NE2 1 
ATOM   7294 N N   . LEU B 1 414 ? 14.892  15.365  -30.867 1.00 33.74  ? 414  LEU B N   1 
ATOM   7295 C CA  . LEU B 1 414 ? 14.612  16.038  -32.128 1.00 34.73  ? 414  LEU B CA  1 
ATOM   7296 C C   . LEU B 1 414 ? 13.711  17.266  -31.932 1.00 36.31  ? 414  LEU B C   1 
ATOM   7297 O O   . LEU B 1 414 ? 13.999  18.354  -32.443 1.00 38.07  ? 414  LEU B O   1 
ATOM   7298 C CB  . LEU B 1 414 ? 13.963  15.066  -33.112 1.00 37.99  ? 414  LEU B CB  1 
ATOM   7299 C CG  . LEU B 1 414 ? 13.504  15.702  -34.425 1.00 38.25  ? 414  LEU B CG  1 
ATOM   7300 C CD1 . LEU B 1 414 ? 14.717  16.026  -35.314 1.00 36.78  ? 414  LEU B CD1 1 
ATOM   7301 C CD2 . LEU B 1 414 ? 12.557  14.761  -35.145 1.00 35.84  ? 414  LEU B CD2 1 
ATOM   7302 N N   . ALA B 1 415 ? 12.622  17.091  -31.190 1.00 31.52  ? 415  ALA B N   1 
ATOM   7303 C CA  . ALA B 1 415 ? 11.705  18.196  -30.916 1.00 36.57  ? 415  ALA B CA  1 
ATOM   7304 C C   . ALA B 1 415 ? 12.451  19.386  -30.303 1.00 37.32  ? 415  ALA B C   1 
ATOM   7305 O O   . ALA B 1 415 ? 12.251  20.533  -30.696 1.00 39.20  ? 415  ALA B O   1 
ATOM   7306 C CB  . ALA B 1 415 ? 10.596  17.745  -30.006 1.00 36.65  ? 415  ALA B CB  1 
ATOM   7307 N N   . GLY B 1 416 ? 13.323  19.105  -29.346 1.00 35.27  ? 416  GLY B N   1 
ATOM   7308 C CA  . GLY B 1 416 ? 14.089  20.149  -28.692 1.00 34.58  ? 416  GLY B CA  1 
ATOM   7309 C C   . GLY B 1 416 ? 15.061  20.834  -29.639 1.00 38.60  ? 416  GLY B C   1 
ATOM   7310 O O   . GLY B 1 416 ? 15.167  22.057  -29.645 1.00 42.45  ? 416  GLY B O   1 
ATOM   7311 N N   . ARG B 1 417 ? 15.774  20.058  -30.449 1.00 39.53  ? 417  ARG B N   1 
ATOM   7312 C CA  . ARG B 1 417 ? 16.714  20.658  -31.393 1.00 36.77  ? 417  ARG B CA  1 
ATOM   7313 C C   . ARG B 1 417 ? 15.988  21.471  -32.469 1.00 38.13  ? 417  ARG B C   1 
ATOM   7314 O O   . ARG B 1 417 ? 16.383  22.597  -32.774 1.00 38.36  ? 417  ARG B O   1 
ATOM   7315 C CB  . ARG B 1 417 ? 17.600  19.606  -32.065 1.00 36.90  ? 417  ARG B CB  1 
ATOM   7316 C CG  . ARG B 1 417 ? 18.506  18.809  -31.139 1.00 40.95  ? 417  ARG B CG  1 
ATOM   7317 C CD  . ARG B 1 417 ? 19.333  19.670  -30.202 1.00 54.93  ? 417  ARG B CD  1 
ATOM   7318 N NE  . ARG B 1 417 ? 20.058  20.720  -30.916 1.00 76.11  ? 417  ARG B NE  1 
ATOM   7319 C CZ  . ARG B 1 417 ? 21.119  21.367  -30.435 1.00 87.33  ? 417  ARG B CZ  1 
ATOM   7320 N NH1 . ARG B 1 417 ? 21.606  21.064  -29.235 1.00 90.79  ? 417  ARG B NH1 1 
ATOM   7321 N NH2 . ARG B 1 417 ? 21.705  22.311  -31.162 1.00 86.33  ? 417  ARG B NH2 1 
ATOM   7322 N N   . LEU B 1 418 ? 14.948  20.902  -33.068 1.00 33.93  ? 418  LEU B N   1 
ATOM   7323 C CA  . LEU B 1 418 ? 14.184  21.643  -34.076 1.00 37.70  ? 418  LEU B CA  1 
ATOM   7324 C C   . LEU B 1 418 ? 13.647  22.963  -33.502 1.00 41.86  ? 418  LEU B C   1 
ATOM   7325 O O   . LEU B 1 418 ? 13.771  24.024  -34.140 1.00 38.97  ? 418  LEU B O   1 
ATOM   7326 C CB  . LEU B 1 418 ? 13.039  20.799  -34.643 1.00 41.14  ? 418  LEU B CB  1 
ATOM   7327 C CG  . LEU B 1 418 ? 13.444  19.555  -35.438 1.00 41.73  ? 418  LEU B CG  1 
ATOM   7328 C CD1 . LEU B 1 418 ? 12.226  18.841  -35.956 1.00 44.07  ? 418  LEU B CD1 1 
ATOM   7329 C CD2 . LEU B 1 418 ? 14.370  19.921  -36.574 1.00 46.22  ? 418  LEU B CD2 1 
ATOM   7330 N N   . ALA B 1 419 ? 13.066  22.904  -32.300 1.00 40.34  ? 419  ALA B N   1 
ATOM   7331 C CA  . ALA B 1 419 ? 12.500  24.104  -31.689 1.00 42.11  ? 419  ALA B CA  1 
ATOM   7332 C C   . ALA B 1 419 ? 13.577  25.151  -31.371 1.00 48.43  ? 419  ALA B C   1 
ATOM   7333 O O   . ALA B 1 419 ? 13.369  26.344  -31.583 1.00 49.47  ? 419  ALA B O   1 
ATOM   7334 C CB  . ALA B 1 419 ? 11.668  23.763  -30.448 1.00 35.79  ? 419  ALA B CB  1 
ATOM   7335 N N   . ALA B 1 420 ? 14.735  24.711  -30.887 1.00 48.24  ? 420  ALA B N   1 
ATOM   7336 C CA  . ALA B 1 420 ? 15.826  25.650  -30.586 1.00 45.36  ? 420  ALA B CA  1 
ATOM   7337 C C   . ALA B 1 420 ? 16.370  26.301  -31.857 1.00 53.11  ? 420  ALA B C   1 
ATOM   7338 O O   . ALA B 1 420 ? 16.818  27.438  -31.817 1.00 56.80  ? 420  ALA B O   1 
ATOM   7339 C CB  . ALA B 1 420 ? 16.962  24.955  -29.814 1.00 36.16  ? 420  ALA B CB  1 
ATOM   7340 N N   . GLN B 1 421 ? 16.336  25.579  -32.977 1.00 46.86  ? 421  GLN B N   1 
ATOM   7341 C CA  . GLN B 1 421 ? 16.871  26.086  -34.239 1.00 41.68  ? 421  GLN B CA  1 
ATOM   7342 C C   . GLN B 1 421 ? 15.811  26.739  -35.138 1.00 48.21  ? 421  GLN B C   1 
ATOM   7343 O O   . GLN B 1 421 ? 15.940  26.746  -36.372 1.00 44.79  ? 421  GLN B O   1 
ATOM   7344 C CB  . GLN B 1 421 ? 17.556  24.963  -35.008 1.00 50.22  ? 421  GLN B CB  1 
ATOM   7345 C CG  . GLN B 1 421 ? 19.060  24.956  -34.903 1.00 67.03  ? 421  GLN B CG  1 
ATOM   7346 C CD  . GLN B 1 421 ? 19.544  24.330  -33.639 1.00 74.03  ? 421  GLN B CD  1 
ATOM   7347 O OE1 . GLN B 1 421 ? 20.025  25.017  -32.745 1.00 79.72  ? 421  GLN B OE1 1 
ATOM   7348 N NE2 . GLN B 1 421 ? 19.421  23.013  -33.546 1.00 72.30  ? 421  GLN B NE2 1 
ATOM   7349 N N   . GLY B 1 422 ? 14.749  27.260  -34.534 1.00 47.70  ? 422  GLY B N   1 
ATOM   7350 C CA  . GLY B 1 422 ? 13.791  28.038  -35.290 1.00 46.03  ? 422  GLY B CA  1 
ATOM   7351 C C   . GLY B 1 422 ? 12.571  27.350  -35.886 1.00 49.71  ? 422  GLY B C   1 
ATOM   7352 O O   . GLY B 1 422 ? 11.758  28.019  -36.512 1.00 50.50  ? 422  GLY B O   1 
ATOM   7353 N N   . ALA B 1 423 ? 12.429  26.036  -35.718 1.00 47.12  ? 423  ALA B N   1 
ATOM   7354 C CA  . ALA B 1 423 ? 11.249  25.345  -36.244 1.00 43.07  ? 423  ALA B CA  1 
ATOM   7355 C C   . ALA B 1 423 ? 9.990   25.578  -35.400 1.00 41.77  ? 423  ALA B C   1 
ATOM   7356 O O   . ALA B 1 423 ? 10.054  25.768  -34.196 1.00 44.73  ? 423  ALA B O   1 
ATOM   7357 C CB  . ALA B 1 423 ? 11.504  23.835  -36.372 1.00 35.52  ? 423  ALA B CB  1 
ATOM   7358 N N   . ARG B 1 424 ? 8.836   25.513  -36.037 1.00 37.54  ? 424  ARG B N   1 
ATOM   7359 C CA  . ARG B 1 424 ? 7.591   25.495  -35.298 1.00 41.52  ? 424  ARG B CA  1 
ATOM   7360 C C   . ARG B 1 424 ? 7.239   24.022  -35.058 1.00 41.10  ? 424  ARG B C   1 
ATOM   7361 O O   . ARG B 1 424 ? 7.083   23.271  -36.003 1.00 38.13  ? 424  ARG B O   1 
ATOM   7362 C CB  . ARG B 1 424 ? 6.526   26.170  -36.130 1.00 47.69  ? 424  ARG B CB  1 
ATOM   7363 C CG  . ARG B 1 424 ? 5.200   26.337  -35.471 1.00 65.06  ? 424  ARG B CG  1 
ATOM   7364 C CD  . ARG B 1 424 ? 4.398   27.283  -36.336 1.00 77.49  ? 424  ARG B CD  1 
ATOM   7365 N NE  . ARG B 1 424 ? 3.263   27.847  -35.633 1.00 76.69  ? 424  ARG B NE  1 
ATOM   7366 C CZ  . ARG B 1 424 ? 3.351   28.569  -34.521 1.00 62.27  ? 424  ARG B CZ  1 
ATOM   7367 N NH1 . ARG B 1 424 ? 4.522   28.816  -33.945 1.00 60.51  ? 424  ARG B NH1 1 
ATOM   7368 N NH2 . ARG B 1 424 ? 2.246   29.026  -33.982 1.00 51.73  ? 424  ARG B NH2 1 
ATOM   7369 N N   . VAL B 1 425 ? 7.156   23.606  -33.799 1.00 36.09  ? 425  VAL B N   1 
ATOM   7370 C CA  . VAL B 1 425 ? 7.011   22.194  -33.472 1.00 34.58  ? 425  VAL B CA  1 
ATOM   7371 C C   . VAL B 1 425 ? 5.768   21.950  -32.625 1.00 35.01  ? 425  VAL B C   1 
ATOM   7372 O O   . VAL B 1 425 ? 5.490   22.709  -31.698 1.00 36.12  ? 425  VAL B O   1 
ATOM   7373 C CB  . VAL B 1 425 ? 8.213   21.673  -32.653 1.00 36.58  ? 425  VAL B CB  1 
ATOM   7374 C CG1 . VAL B 1 425 ? 8.037   20.170  -32.349 1.00 33.79  ? 425  VAL B CG1 1 
ATOM   7375 C CG2 . VAL B 1 425 ? 9.540   21.968  -33.368 1.00 28.06  ? 425  VAL B CG2 1 
ATOM   7376 N N   . TYR B 1 426 ? 5.036   20.886  -32.942 1.00 29.92  ? 426  TYR B N   1 
ATOM   7377 C CA  . TYR B 1 426 ? 3.926   20.422  -32.113 1.00 31.63  ? 426  TYR B CA  1 
ATOM   7378 C C   . TYR B 1 426 ? 4.164   18.967  -31.766 1.00 35.62  ? 426  TYR B C   1 
ATOM   7379 O O   . TYR B 1 426 ? 4.569   18.189  -32.622 1.00 36.33  ? 426  TYR B O   1 
ATOM   7380 C CB  . TYR B 1 426 ? 2.599   20.537  -32.863 1.00 31.42  ? 426  TYR B CB  1 
ATOM   7381 C CG  . TYR B 1 426 ? 2.181   21.967  -33.148 1.00 32.85  ? 426  TYR B CG  1 
ATOM   7382 C CD1 . TYR B 1 426 ? 2.546   22.584  -34.336 1.00 27.11  ? 426  TYR B CD1 1 
ATOM   7383 C CD2 . TYR B 1 426 ? 1.418   22.698  -32.223 1.00 29.21  ? 426  TYR B CD2 1 
ATOM   7384 C CE1 . TYR B 1 426 ? 2.167   23.894  -34.615 1.00 30.09  ? 426  TYR B CE1 1 
ATOM   7385 C CE2 . TYR B 1 426 ? 1.040   24.014  -32.491 1.00 32.19  ? 426  TYR B CE2 1 
ATOM   7386 C CZ  . TYR B 1 426 ? 1.421   24.598  -33.689 1.00 35.04  ? 426  TYR B CZ  1 
ATOM   7387 O OH  . TYR B 1 426 ? 1.068   25.885  -33.975 1.00 39.14  ? 426  TYR B OH  1 
ATOM   7388 N N   . ALA B 1 427 ? 3.882   18.591  -30.524 1.00 34.32  ? 427  ALA B N   1 
ATOM   7389 C CA  . ALA B 1 427 ? 4.208   17.256  -30.046 1.00 33.10  ? 427  ALA B CA  1 
ATOM   7390 C C   . ALA B 1 427 ? 3.023   16.607  -29.334 1.00 36.04  ? 427  ALA B C   1 
ATOM   7391 O O   . ALA B 1 427 ? 2.176   17.306  -28.782 1.00 33.52  ? 427  ALA B O   1 
ATOM   7392 C CB  . ALA B 1 427 ? 5.421   17.318  -29.137 1.00 35.57  ? 427  ALA B CB  1 
ATOM   7393 N N   . TYR B 1 428 ? 2.955   15.274  -29.361 1.00 26.48  ? 428  TYR B N   1 
ATOM   7394 C CA  . TYR B 1 428 ? 1.826   14.560  -28.762 1.00 34.08  ? 428  TYR B CA  1 
ATOM   7395 C C   . TYR B 1 428 ? 2.282   13.226  -28.195 1.00 38.36  ? 428  TYR B C   1 
ATOM   7396 O O   . TYR B 1 428 ? 3.342   12.711  -28.559 1.00 30.79  ? 428  TYR B O   1 
ATOM   7397 C CB  . TYR B 1 428 ? 0.685   14.288  -29.786 1.00 32.69  ? 428  TYR B CB  1 
ATOM   7398 C CG  . TYR B 1 428 ? 1.101   13.302  -30.878 1.00 37.18  ? 428  TYR B CG  1 
ATOM   7399 C CD1 . TYR B 1 428 ? 1.093   11.922  -30.659 1.00 37.76  ? 428  TYR B CD1 1 
ATOM   7400 C CD2 . TYR B 1 428 ? 1.554   13.764  -32.109 1.00 35.84  ? 428  TYR B CD2 1 
ATOM   7401 C CE1 . TYR B 1 428 ? 1.520   11.036  -31.654 1.00 37.42  ? 428  TYR B CE1 1 
ATOM   7402 C CE2 . TYR B 1 428 ? 1.975   12.903  -33.091 1.00 36.97  ? 428  TYR B CE2 1 
ATOM   7403 C CZ  . TYR B 1 428 ? 1.954   11.547  -32.867 1.00 37.84  ? 428  TYR B CZ  1 
ATOM   7404 O OH  . TYR B 1 428 ? 2.413   10.735  -33.868 1.00 32.42  ? 428  TYR B OH  1 
ATOM   7405 N N   . ILE B 1 429 ? 1.452   12.676  -27.314 1.00 36.69  ? 429  ILE B N   1 
ATOM   7406 C CA  . ILE B 1 429 ? 1.532   11.278  -26.925 1.00 38.67  ? 429  ILE B CA  1 
ATOM   7407 C C   . ILE B 1 429 ? 0.148   10.685  -27.161 1.00 34.48  ? 429  ILE B C   1 
ATOM   7408 O O   . ILE B 1 429 ? -0.862  11.230  -26.699 1.00 39.61  ? 429  ILE B O   1 
ATOM   7409 C CB  . ILE B 1 429 ? 1.963   11.095  -25.449 1.00 42.08  ? 429  ILE B CB  1 
ATOM   7410 C CG1 . ILE B 1 429 ? 1.995   9.614   -25.089 1.00 48.99  ? 429  ILE B CG1 1 
ATOM   7411 C CG2 . ILE B 1 429 ? 1.028   11.858  -24.490 1.00 45.84  ? 429  ILE B CG2 1 
ATOM   7412 C CD1 . ILE B 1 429 ? 2.738   9.330   -23.798 1.00 54.43  ? 429  ILE B CD1 1 
ATOM   7413 N N   . PHE B 1 430 ? 0.101   9.598   -27.926 1.00 33.00  ? 430  PHE B N   1 
ATOM   7414 C CA  . PHE B 1 430 ? -1.152  8.951   -28.277 1.00 34.19  ? 430  PHE B CA  1 
ATOM   7415 C C   . PHE B 1 430 ? -1.466  7.836   -27.252 1.00 36.92  ? 430  PHE B C   1 
ATOM   7416 O O   . PHE B 1 430 ? -0.660  6.928   -27.038 1.00 38.70  ? 430  PHE B O   1 
ATOM   7417 C CB  . PHE B 1 430 ? -1.038  8.416   -29.698 1.00 30.34  ? 430  PHE B CB  1 
ATOM   7418 C CG  . PHE B 1 430 ? -2.260  7.701   -30.173 1.00 36.06  ? 430  PHE B CG  1 
ATOM   7419 C CD1 . PHE B 1 430 ? -2.439  6.349   -29.894 1.00 40.26  ? 430  PHE B CD1 1 
ATOM   7420 C CD2 . PHE B 1 430 ? -3.226  8.366   -30.926 1.00 37.50  ? 430  PHE B CD2 1 
ATOM   7421 C CE1 . PHE B 1 430 ? -3.571  5.675   -30.343 1.00 42.68  ? 430  PHE B CE1 1 
ATOM   7422 C CE2 . PHE B 1 430 ? -4.357  7.696   -31.387 1.00 40.41  ? 430  PHE B CE2 1 
ATOM   7423 C CZ  . PHE B 1 430 ? -4.535  6.355   -31.087 1.00 40.37  ? 430  PHE B CZ  1 
ATOM   7424 N N   . GLU B 1 431 ? -2.617  7.920   -26.592 1.00 35.39  ? 431  GLU B N   1 
ATOM   7425 C CA  . GLU B 1 431 ? -2.855  7.074   -25.421 1.00 40.63  ? 431  GLU B CA  1 
ATOM   7426 C C   . GLU B 1 431 ? -4.121  6.236   -25.485 1.00 44.09  ? 431  GLU B C   1 
ATOM   7427 O O   . GLU B 1 431 ? -4.549  5.699   -24.476 1.00 48.39  ? 431  GLU B O   1 
ATOM   7428 C CB  . GLU B 1 431 ? -2.909  7.912   -24.140 1.00 38.52  ? 431  GLU B CB  1 
ATOM   7429 C CG  . GLU B 1 431 ? -1.598  8.527   -23.724 1.00 43.28  ? 431  GLU B CG  1 
ATOM   7430 C CD  . GLU B 1 431 ? -1.716  9.297   -22.423 1.00 48.46  ? 431  GLU B CD  1 
ATOM   7431 O OE1 . GLU B 1 431 ? -2.799  9.871   -22.145 1.00 59.05  ? 431  GLU B OE1 1 
ATOM   7432 O OE2 . GLU B 1 431 ? -0.731  9.317   -21.668 1.00 55.03  ? 431  GLU B OE2 1 
ATOM   7433 N N   . HIS B 1 432 ? -4.736  6.135   -26.652 1.00 46.92  ? 432  HIS B N   1 
ATOM   7434 C CA  . HIS B 1 432 ? -5.930  5.313   -26.760 1.00 44.00  ? 432  HIS B CA  1 
ATOM   7435 C C   . HIS B 1 432 ? -5.645  3.933   -27.342 1.00 42.56  ? 432  HIS B C   1 
ATOM   7436 O O   . HIS B 1 432 ? -5.102  3.834   -28.432 1.00 39.93  ? 432  HIS B O   1 
ATOM   7437 C CB  . HIS B 1 432 ? -6.973  5.979   -27.632 1.00 40.01  ? 432  HIS B CB  1 
ATOM   7438 C CG  . HIS B 1 432 ? -8.171  5.116   -27.844 1.00 45.90  ? 432  HIS B CG  1 
ATOM   7439 N ND1 . HIS B 1 432 ? -9.053  4.816   -26.830 1.00 52.41  ? 432  HIS B ND1 1 
ATOM   7440 C CD2 . HIS B 1 432 ? -8.604  4.438   -28.934 1.00 49.15  ? 432  HIS B CD2 1 
ATOM   7441 C CE1 . HIS B 1 432 ? -9.999  4.016   -27.293 1.00 50.70  ? 432  HIS B CE1 1 
ATOM   7442 N NE2 . HIS B 1 432 ? -9.751  3.774   -28.568 1.00 51.60  ? 432  HIS B NE2 1 
ATOM   7443 N N   . ARG B 1 433 ? -6.041  2.883   -26.626 1.00 46.88  ? 433  ARG B N   1 
ATOM   7444 C CA  . ARG B 1 433 ? -5.909  1.495   -27.101 1.00 51.28  ? 433  ARG B CA  1 
ATOM   7445 C C   . ARG B 1 433 ? -7.145  1.056   -27.892 1.00 50.69  ? 433  ARG B C   1 
ATOM   7446 O O   . ARG B 1 433 ? -8.244  0.987   -27.335 1.00 46.75  ? 433  ARG B O   1 
ATOM   7447 C CB  . ARG B 1 433 ? -5.718  0.544   -25.911 1.00 55.21  ? 433  ARG B CB  1 
ATOM   7448 C CG  . ARG B 1 433 ? -5.526  -0.906  -26.301 1.00 52.35  ? 433  ARG B CG  1 
ATOM   7449 C CD  . ARG B 1 433 ? -5.405  -1.820  -25.090 1.00 53.35  ? 433  ARG B CD  1 
ATOM   7450 N NE  . ARG B 1 433 ? -5.714  -3.211  -25.434 1.00 54.13  ? 433  ARG B NE  1 
ATOM   7451 C CZ  . ARG B 1 433 ? -4.802  -4.150  -25.675 1.00 55.42  ? 433  ARG B CZ  1 
ATOM   7452 N NH1 . ARG B 1 433 ? -3.501  -3.863  -25.594 1.00 44.56  ? 433  ARG B NH1 1 
ATOM   7453 N NH2 . ARG B 1 433 ? -5.192  -5.387  -25.987 1.00 54.81  ? 433  ARG B NH2 1 
ATOM   7454 N N   . ALA B 1 434 ? -6.970  0.758   -29.180 1.00 41.14  ? 434  ALA B N   1 
ATOM   7455 C CA  . ALA B 1 434 ? -8.097  0.341   -30.028 1.00 43.50  ? 434  ALA B CA  1 
ATOM   7456 C C   . ALA B 1 434 ? -8.887  -0.801  -29.391 1.00 52.15  ? 434  ALA B C   1 
ATOM   7457 O O   . ALA B 1 434 ? -8.312  -1.784  -28.925 1.00 50.84  ? 434  ALA B O   1 
ATOM   7458 C CB  . ALA B 1 434 ? -7.603  -0.071  -31.415 1.00 41.11  ? 434  ALA B CB  1 
ATOM   7459 N N   . SER B 1 435 ? -10.208 -0.661  -29.373 1.00 54.78  ? 435  SER B N   1 
ATOM   7460 C CA  . SER B 1 435 ? -11.082 -1.693  -28.826 1.00 54.84  ? 435  SER B CA  1 
ATOM   7461 C C   . SER B 1 435 ? -10.909 -3.017  -29.571 1.00 53.93  ? 435  SER B C   1 
ATOM   7462 O O   . SER B 1 435 ? -11.099 -4.085  -28.999 1.00 55.03  ? 435  SER B O   1 
ATOM   7463 C CB  . SER B 1 435 ? -12.546 -1.243  -28.890 1.00 50.78  ? 435  SER B CB  1 
ATOM   7464 O OG  . SER B 1 435 ? -12.920 -0.978  -30.232 1.00 53.02  ? 435  SER B OG  1 
ATOM   7465 N N   . THR B 1 436 ? -10.530 -2.938  -30.842 1.00 54.55  ? 436  THR B N   1 
ATOM   7466 C CA  . THR B 1 436 ? -10.380 -4.125  -31.680 1.00 56.98  ? 436  THR B CA  1 
ATOM   7467 C C   . THR B 1 436 ? -8.988  -4.777  -31.640 1.00 59.57  ? 436  THR B C   1 
ATOM   7468 O O   . THR B 1 436 ? -8.746  -5.765  -32.344 1.00 56.03  ? 436  THR B O   1 
ATOM   7469 C CB  . THR B 1 436 ? -10.720 -3.795  -33.148 1.00 54.75  ? 436  THR B CB  1 
ATOM   7470 O OG1 . THR B 1 436 ? -9.987  -2.636  -33.549 1.00 53.40  ? 436  THR B OG1 1 
ATOM   7471 C CG2 . THR B 1 436 ? -12.213 -3.505  -33.300 1.00 54.07  ? 436  THR B CG2 1 
ATOM   7472 N N   . LEU B 1 437 ? -8.078  -4.236  -30.829 1.00 55.19  ? 437  LEU B N   1 
ATOM   7473 C CA  . LEU B 1 437 ? -6.698  -4.724  -30.807 1.00 55.22  ? 437  LEU B CA  1 
ATOM   7474 C C   . LEU B 1 437 ? -6.611  -6.215  -30.457 1.00 59.23  ? 437  LEU B C   1 
ATOM   7475 O O   . LEU B 1 437 ? -7.243  -6.671  -29.501 1.00 55.37  ? 437  LEU B O   1 
ATOM   7476 C CB  . LEU B 1 437 ? -5.873  -3.918  -29.808 1.00 57.56  ? 437  LEU B CB  1 
ATOM   7477 C CG  . LEU B 1 437 ? -4.361  -3.939  -30.009 1.00 65.93  ? 437  LEU B CG  1 
ATOM   7478 C CD1 . LEU B 1 437 ? -4.003  -3.349  -31.352 1.00 63.53  ? 437  LEU B CD1 1 
ATOM   7479 C CD2 . LEU B 1 437 ? -3.659  -3.183  -28.891 1.00 68.33  ? 437  LEU B CD2 1 
ATOM   7480 N N   . THR B 1 438 ? -5.821  -6.973  -31.214 1.00 55.65  ? 438  THR B N   1 
ATOM   7481 C CA  . THR B 1 438 ? -5.689  -8.407  -30.941 1.00 61.38  ? 438  THR B CA  1 
ATOM   7482 C C   . THR B 1 438 ? -4.472  -8.785  -30.088 1.00 59.75  ? 438  THR B C   1 
ATOM   7483 O O   . THR B 1 438 ? -4.399  -9.900  -29.580 1.00 65.55  ? 438  THR B O   1 
ATOM   7484 C CB  . THR B 1 438 ? -5.715  -9.249  -32.238 1.00 65.13  ? 438  THR B CB  1 
ATOM   7485 O OG1 . THR B 1 438 ? -4.550  -8.967  -33.032 1.00 63.91  ? 438  THR B OG1 1 
ATOM   7486 C CG2 . THR B 1 438 ? -6.973  -8.933  -33.043 1.00 57.76  ? 438  THR B CG2 1 
ATOM   7487 N N   . TRP B 1 439 ? -3.513  -7.871  -29.944 1.00 54.47  ? 439  TRP B N   1 
ATOM   7488 C CA  . TRP B 1 439 ? -2.410  -8.074  -29.001 1.00 51.63  ? 439  TRP B CA  1 
ATOM   7489 C C   . TRP B 1 439 ? -2.959  -8.048  -27.573 1.00 49.99  ? 439  TRP B C   1 
ATOM   7490 O O   . TRP B 1 439 ? -3.969  -7.391  -27.312 1.00 55.09  ? 439  TRP B O   1 
ATOM   7491 C CB  . TRP B 1 439 ? -1.321  -6.995  -29.174 1.00 47.03  ? 439  TRP B CB  1 
ATOM   7492 C CG  . TRP B 1 439 ? -0.666  -6.998  -30.531 1.00 42.87  ? 439  TRP B CG  1 
ATOM   7493 C CD1 . TRP B 1 439 ? -0.990  -6.205  -31.600 1.00 43.61  ? 439  TRP B CD1 1 
ATOM   7494 C CD2 . TRP B 1 439 ? 0.414   -7.840  -30.970 1.00 45.46  ? 439  TRP B CD2 1 
ATOM   7495 N NE1 . TRP B 1 439 ? -0.178  -6.497  -32.670 1.00 46.90  ? 439  TRP B NE1 1 
ATOM   7496 C CE2 . TRP B 1 439 ? 0.697   -7.493  -32.311 1.00 50.61  ? 439  TRP B CE2 1 
ATOM   7497 C CE3 . TRP B 1 439 ? 1.173   -8.850  -30.359 1.00 47.99  ? 439  TRP B CE3 1 
ATOM   7498 C CZ2 . TRP B 1 439 ? 1.709   -8.127  -33.057 1.00 50.52  ? 439  TRP B CZ2 1 
ATOM   7499 C CZ3 . TRP B 1 439 ? 2.183   -9.471  -31.095 1.00 50.45  ? 439  TRP B CZ3 1 
ATOM   7500 C CH2 . TRP B 1 439 ? 2.443   -9.103  -32.430 1.00 50.41  ? 439  TRP B CH2 1 
ATOM   7501 N N   . PRO B 1 440 ? -2.298  -8.758  -26.643 1.00 50.13  ? 440  PRO B N   1 
ATOM   7502 C CA  . PRO B 1 440 ? -2.729  -8.827  -25.236 1.00 50.21  ? 440  PRO B CA  1 
ATOM   7503 C C   . PRO B 1 440 ? -2.674  -7.472  -24.519 1.00 55.25  ? 440  PRO B C   1 
ATOM   7504 O O   . PRO B 1 440 ? -2.008  -6.526  -24.974 1.00 49.41  ? 440  PRO B O   1 
ATOM   7505 C CB  . PRO B 1 440 ? -1.700  -9.778  -24.609 1.00 52.53  ? 440  PRO B CB  1 
ATOM   7506 C CG  . PRO B 1 440 ? -0.490  -9.621  -25.497 1.00 53.25  ? 440  PRO B CG  1 
ATOM   7507 C CD  . PRO B 1 440 ? -1.089  -9.570  -26.870 1.00 49.19  ? 440  PRO B CD  1 
ATOM   7508 N N   . LEU B 1 441 ? -3.356  -7.399  -23.382 1.00 51.85  ? 441  LEU B N   1 
ATOM   7509 C CA  . LEU B 1 441 ? -3.476  -6.162  -22.629 1.00 51.52  ? 441  LEU B CA  1 
ATOM   7510 C C   . LEU B 1 441 ? -2.153  -5.592  -22.113 1.00 53.88  ? 441  LEU B C   1 
ATOM   7511 O O   . LEU B 1 441 ? -2.003  -4.370  -21.991 1.00 50.42  ? 441  LEU B O   1 
ATOM   7512 C CB  . LEU B 1 441 ? -4.420  -6.356  -21.446 1.00 56.10  ? 441  LEU B CB  1 
ATOM   7513 C CG  . LEU B 1 441 ? -5.911  -6.222  -21.755 1.00 70.27  ? 441  LEU B CG  1 
ATOM   7514 C CD1 . LEU B 1 441 ? -6.765  -6.780  -20.610 1.00 69.72  ? 441  LEU B CD1 1 
ATOM   7515 C CD2 . LEU B 1 441 ? -6.241  -4.756  -22.038 1.00 72.00  ? 441  LEU B CD2 1 
ATOM   7516 N N   . TRP B 1 442 ? -1.206  -6.460  -21.776 1.00 50.42  ? 442  TRP B N   1 
ATOM   7517 C CA  . TRP B 1 442 ? 0.006   -5.969  -21.131 1.00 51.97  ? 442  TRP B CA  1 
ATOM   7518 C C   . TRP B 1 442 ? 0.813   -5.100  -22.098 1.00 49.91  ? 442  TRP B C   1 
ATOM   7519 O O   . TRP B 1 442 ? 1.669   -4.344  -21.665 1.00 50.49  ? 442  TRP B O   1 
ATOM   7520 C CB  . TRP B 1 442 ? 0.860   -7.105  -20.527 1.00 46.43  ? 442  TRP B CB  1 
ATOM   7521 C CG  . TRP B 1 442 ? 1.535   -8.000  -21.536 1.00 50.07  ? 442  TRP B CG  1 
ATOM   7522 C CD1 . TRP B 1 442 ? 1.111   -9.238  -21.953 1.00 52.45  ? 442  TRP B CD1 1 
ATOM   7523 C CD2 . TRP B 1 442 ? 2.759   -7.736  -22.249 1.00 50.11  ? 442  TRP B CD2 1 
ATOM   7524 N NE1 . TRP B 1 442 ? 1.989   -9.748  -22.883 1.00 52.03  ? 442  TRP B NE1 1 
ATOM   7525 C CE2 . TRP B 1 442 ? 3.007   -8.849  -23.081 1.00 51.13  ? 442  TRP B CE2 1 
ATOM   7526 C CE3 . TRP B 1 442 ? 3.668   -6.664  -22.264 1.00 50.34  ? 442  TRP B CE3 1 
ATOM   7527 C CZ2 . TRP B 1 442 ? 4.126   -8.924  -23.919 1.00 52.15  ? 442  TRP B CZ2 1 
ATOM   7528 C CZ3 . TRP B 1 442 ? 4.777   -6.743  -23.094 1.00 49.74  ? 442  TRP B CZ3 1 
ATOM   7529 C CH2 . TRP B 1 442 ? 4.993   -7.868  -23.916 1.00 50.27  ? 442  TRP B CH2 1 
ATOM   7530 N N   . MET B 1 443 ? 0.528   -5.205  -23.399 1.00 48.18  ? 443  MET B N   1 
ATOM   7531 C CA  . MET B 1 443 ? 1.257   -4.433  -24.404 1.00 45.23  ? 443  MET B CA  1 
ATOM   7532 C C   . MET B 1 443 ? 0.748   -2.991  -24.476 1.00 44.92  ? 443  MET B C   1 
ATOM   7533 O O   . MET B 1 443 ? 1.334   -2.163  -25.170 1.00 47.05  ? 443  MET B O   1 
ATOM   7534 C CB  . MET B 1 443 ? 1.178   -5.085  -25.793 1.00 42.50  ? 443  MET B CB  1 
ATOM   7535 C CG  . MET B 1 443 ? 1.866   -6.443  -25.888 1.00 47.81  ? 443  MET B CG  1 
ATOM   7536 S SD  . MET B 1 443 ? 2.127   -6.949  -27.607 1.00 50.54  ? 443  MET B SD  1 
ATOM   7537 C CE  . MET B 1 443 ? 3.231   -8.344  -27.399 1.00 58.64  ? 443  MET B CE  1 
ATOM   7538 N N   . GLY B 1 444 ? -0.347  -2.707  -23.772 1.00 44.94  ? 444  GLY B N   1 
ATOM   7539 C CA  . GLY B 1 444 ? -0.895  -1.358  -23.685 1.00 45.88  ? 444  GLY B CA  1 
ATOM   7540 C C   . GLY B 1 444 ? -1.330  -0.752  -25.013 1.00 45.18  ? 444  GLY B C   1 
ATOM   7541 O O   . GLY B 1 444 ? -2.136  -1.341  -25.748 1.00 42.80  ? 444  GLY B O   1 
ATOM   7542 N N   . VAL B 1 445 ? -0.803  0.434   -25.311 1.00 37.01  ? 445  VAL B N   1 
ATOM   7543 C CA  . VAL B 1 445 ? -1.050  1.104   -26.589 1.00 42.17  ? 445  VAL B CA  1 
ATOM   7544 C C   . VAL B 1 445 ? 0.195   0.938   -27.455 1.00 40.81  ? 445  VAL B C   1 
ATOM   7545 O O   . VAL B 1 445 ? 1.123   1.727   -27.353 1.00 43.98  ? 445  VAL B O   1 
ATOM   7546 C CB  . VAL B 1 445 ? -1.326  2.611   -26.395 1.00 42.10  ? 445  VAL B CB  1 
ATOM   7547 C CG1 . VAL B 1 445 ? -1.722  3.252   -27.712 1.00 39.53  ? 445  VAL B CG1 1 
ATOM   7548 C CG2 . VAL B 1 445 ? -2.396  2.833   -25.341 1.00 41.70  ? 445  VAL B CG2 1 
ATOM   7549 N N   . PRO B 1 446 ? 0.230   -0.112  -28.288 1.00 37.86  ? 446  PRO B N   1 
ATOM   7550 C CA  . PRO B 1 446 ? 1.493   -0.516  -28.913 1.00 33.56  ? 446  PRO B CA  1 
ATOM   7551 C C   . PRO B 1 446 ? 1.893   0.319   -30.121 1.00 38.27  ? 446  PRO B C   1 
ATOM   7552 O O   . PRO B 1 446 ? 1.051   0.961   -30.747 1.00 38.03  ? 446  PRO B O   1 
ATOM   7553 C CB  . PRO B 1 446 ? 1.240   -1.984  -29.346 1.00 35.02  ? 446  PRO B CB  1 
ATOM   7554 C CG  . PRO B 1 446 ? -0.094  -2.379  -28.725 1.00 37.50  ? 446  PRO B CG  1 
ATOM   7555 C CD  . PRO B 1 446 ? -0.850  -1.079  -28.548 1.00 36.99  ? 446  PRO B CD  1 
ATOM   7556 N N   . HIS B 1 447 ? 3.194   0.309   -30.407 1.00 32.42  ? 447  HIS B N   1 
ATOM   7557 C CA  . HIS B 1 447 ? 3.786   0.910   -31.600 1.00 37.30  ? 447  HIS B CA  1 
ATOM   7558 C C   . HIS B 1 447 ? 2.910   0.611   -32.824 1.00 43.53  ? 447  HIS B C   1 
ATOM   7559 O O   . HIS B 1 447 ? 2.506   -0.521  -33.029 1.00 37.71  ? 447  HIS B O   1 
ATOM   7560 C CB  . HIS B 1 447 ? 5.196   0.320   -31.752 1.00 31.64  ? 447  HIS B CB  1 
ATOM   7561 C CG  . HIS B 1 447 ? 5.960   0.809   -32.940 1.00 40.93  ? 447  HIS B CG  1 
ATOM   7562 N ND1 . HIS B 1 447 ? 6.629   2.016   -32.949 1.00 38.22  ? 447  HIS B ND1 1 
ATOM   7563 C CD2 . HIS B 1 447 ? 6.225   0.219   -34.135 1.00 37.63  ? 447  HIS B CD2 1 
ATOM   7564 C CE1 . HIS B 1 447 ? 7.250   2.160   -34.107 1.00 39.11  ? 447  HIS B CE1 1 
ATOM   7565 N NE2 . HIS B 1 447 ? 7.011   1.089   -34.847 1.00 41.43  ? 447  HIS B NE2 1 
ATOM   7566 N N   . GLY B 1 448 ? 2.576   1.632   -33.610 1.00 41.04  ? 448  GLY B N   1 
ATOM   7567 C CA  . GLY B 1 448 ? 1.867   1.418   -34.867 1.00 34.86  ? 448  GLY B CA  1 
ATOM   7568 C C   . GLY B 1 448 ? 0.348   1.554   -34.818 1.00 38.84  ? 448  GLY B C   1 
ATOM   7569 O O   . GLY B 1 448 ? -0.313  1.700   -35.855 1.00 38.00  ? 448  GLY B O   1 
ATOM   7570 N N   . TYR B 1 449 ? -0.215  1.551   -33.618 1.00 34.33  ? 449  TYR B N   1 
ATOM   7571 C CA  . TYR B 1 449 ? -1.666  1.443   -33.483 1.00 37.09  ? 449  TYR B CA  1 
ATOM   7572 C C   . TYR B 1 449 ? -2.423  2.775   -33.359 1.00 40.62  ? 449  TYR B C   1 
ATOM   7573 O O   . TYR B 1 449 ? -3.619  2.798   -33.077 1.00 40.75  ? 449  TYR B O   1 
ATOM   7574 C CB  . TYR B 1 449 ? -2.035  0.395   -32.417 1.00 37.92  ? 449  TYR B CB  1 
ATOM   7575 C CG  . TYR B 1 449 ? -1.758  -0.982  -32.981 1.00 43.49  ? 449  TYR B CG  1 
ATOM   7576 C CD1 . TYR B 1 449 ? -0.546  -1.629  -32.750 1.00 42.99  ? 449  TYR B CD1 1 
ATOM   7577 C CD2 . TYR B 1 449 ? -2.672  -1.587  -33.832 1.00 44.36  ? 449  TYR B CD2 1 
ATOM   7578 C CE1 . TYR B 1 449 ? -0.285  -2.894  -33.323 1.00 42.10  ? 449  TYR B CE1 1 
ATOM   7579 C CE2 . TYR B 1 449 ? -2.429  -2.824  -34.395 1.00 46.67  ? 449  TYR B CE2 1 
ATOM   7580 C CZ  . TYR B 1 449 ? -1.241  -3.474  -34.142 1.00 46.66  ? 449  TYR B CZ  1 
ATOM   7581 O OH  . TYR B 1 449 ? -1.023  -4.703  -34.721 1.00 54.68  ? 449  TYR B OH  1 
ATOM   7582 N N   . GLU B 1 450 ? -1.720  3.869   -33.648 1.00 31.16  ? 450  GLU B N   1 
ATOM   7583 C CA  . GLU B 1 450 ? -2.352  5.167   -33.835 1.00 35.91  ? 450  GLU B CA  1 
ATOM   7584 C C   . GLU B 1 450 ? -2.694  5.378   -35.321 1.00 36.42  ? 450  GLU B C   1 
ATOM   7585 O O   . GLU B 1 450 ? -3.550  6.188   -35.661 1.00 42.41  ? 450  GLU B O   1 
ATOM   7586 C CB  . GLU B 1 450 ? -1.437  6.301   -33.330 1.00 32.33  ? 450  GLU B CB  1 
ATOM   7587 C CG  . GLU B 1 450 ? -0.451  6.852   -34.372 1.00 34.31  ? 450  GLU B CG  1 
ATOM   7588 C CD  . GLU B 1 450 ? 0.751   5.948   -34.609 1.00 42.79  ? 450  GLU B CD  1 
ATOM   7589 O OE1 . GLU B 1 450 ? 0.688   4.738   -34.264 1.00 41.94  ? 450  GLU B OE1 1 
ATOM   7590 O OE2 . GLU B 1 450 ? 1.766   6.448   -35.148 1.00 40.07  ? 450  GLU B OE2 1 
ATOM   7591 N N   . ILE B 1 451 ? -2.025  4.642   -36.204 1.00 33.83  ? 451  ILE B N   1 
ATOM   7592 C CA  . ILE B 1 451 ? -2.160  4.895   -37.643 1.00 33.37  ? 451  ILE B CA  1 
ATOM   7593 C C   . ILE B 1 451 ? -3.598  4.747   -38.173 1.00 35.22  ? 451  ILE B C   1 
ATOM   7594 O O   . ILE B 1 451 ? -4.079  5.572   -38.941 1.00 40.59  ? 451  ILE B O   1 
ATOM   7595 C CB  . ILE B 1 451 ? -1.236  3.994   -38.463 1.00 36.78  ? 451  ILE B CB  1 
ATOM   7596 C CG1 . ILE B 1 451 ? 0.225   4.189   -38.021 1.00 39.22  ? 451  ILE B CG1 1 
ATOM   7597 C CG2 . ILE B 1 451 ? -1.401  4.299   -39.935 1.00 29.40  ? 451  ILE B CG2 1 
ATOM   7598 C CD1 . ILE B 1 451 ? 1.214   3.316   -38.818 1.00 33.52  ? 451  ILE B CD1 1 
ATOM   7599 N N   . GLU B 1 452 ? -4.280  3.700   -37.742 1.00 36.31  ? 452  GLU B N   1 
ATOM   7600 C CA  . GLU B 1 452 ? -5.635  3.435   -38.218 1.00 41.37  ? 452  GLU B CA  1 
ATOM   7601 C C   . GLU B 1 452 ? -6.592  4.584   -37.879 1.00 42.20  ? 452  GLU B C   1 
ATOM   7602 O O   . GLU B 1 452 ? -7.504  4.863   -38.649 1.00 46.24  ? 452  GLU B O   1 
ATOM   7603 C CB  . GLU B 1 452 ? -6.142  2.107   -37.663 1.00 39.01  ? 452  GLU B CB  1 
ATOM   7604 C CG  . GLU B 1 452 ? -6.109  1.988   -36.129 1.00 46.67  ? 452  GLU B CG  1 
ATOM   7605 C CD  . GLU B 1 452 ? -5.975  0.532   -35.680 1.00 58.19  ? 452  GLU B CD  1 
ATOM   7606 O OE1 . GLU B 1 452 ? -6.882  0.017   -34.993 1.00 60.41  ? 452  GLU B OE1 1 
ATOM   7607 O OE2 . GLU B 1 452 ? -4.968  -0.111  -36.042 1.00 57.55  ? 452  GLU B OE2 1 
ATOM   7608 N N   . PHE B 1 453 ? -6.361  5.252   -36.741 1.00 38.27  ? 453  PHE B N   1 
ATOM   7609 C CA  . PHE B 1 453 ? -7.175  6.396   -36.316 1.00 36.05  ? 453  PHE B CA  1 
ATOM   7610 C C   . PHE B 1 453 ? -6.883  7.651   -37.128 1.00 38.37  ? 453  PHE B C   1 
ATOM   7611 O O   . PHE B 1 453 ? -7.809  8.351   -37.525 1.00 37.87  ? 453  PHE B O   1 
ATOM   7612 C CB  . PHE B 1 453 ? -6.995  6.673   -34.810 1.00 40.71  ? 453  PHE B CB  1 
ATOM   7613 C CG  . PHE B 1 453 ? -7.517  5.573   -33.938 1.00 40.77  ? 453  PHE B CG  1 
ATOM   7614 C CD1 . PHE B 1 453 ? -8.842  5.553   -33.554 1.00 41.68  ? 453  PHE B CD1 1 
ATOM   7615 C CD2 . PHE B 1 453 ? -6.692  4.529   -33.549 1.00 42.65  ? 453  PHE B CD2 1 
ATOM   7616 C CE1 . PHE B 1 453 ? -9.336  4.530   -32.772 1.00 45.82  ? 453  PHE B CE1 1 
ATOM   7617 C CE2 . PHE B 1 453 ? -7.176  3.498   -32.767 1.00 39.67  ? 453  PHE B CE2 1 
ATOM   7618 C CZ  . PHE B 1 453 ? -8.502  3.495   -32.380 1.00 44.41  ? 453  PHE B CZ  1 
ATOM   7619 N N   . ILE B 1 454 ? -5.599  7.931   -37.380 1.00 32.79  ? 454  ILE B N   1 
ATOM   7620 C CA  . ILE B 1 454 ? -5.206  9.051   -38.248 1.00 31.87  ? 454  ILE B CA  1 
ATOM   7621 C C   . ILE B 1 454 ? -5.757  8.892   -39.675 1.00 36.38  ? 454  ILE B C   1 
ATOM   7622 O O   . ILE B 1 454 ? -6.162  9.873   -40.303 1.00 35.97  ? 454  ILE B O   1 
ATOM   7623 C CB  . ILE B 1 454 ? -3.667  9.168   -38.385 1.00 38.63  ? 454  ILE B CB  1 
ATOM   7624 C CG1 . ILE B 1 454 ? -2.975  9.368   -37.016 1.00 41.77  ? 454  ILE B CG1 1 
ATOM   7625 C CG2 . ILE B 1 454 ? -3.301  10.249  -39.406 1.00 38.54  ? 454  ILE B CG2 1 
ATOM   7626 C CD1 . ILE B 1 454 ? -3.615  10.390  -36.128 1.00 49.88  ? 454  ILE B CD1 1 
ATOM   7627 N N   . PHE B 1 455 ? -5.746  7.669   -40.205 1.00 37.55  ? 455  PHE B N   1 
ATOM   7628 C CA  . PHE B 1 455 ? -6.253  7.443   -41.579 1.00 38.29  ? 455  PHE B CA  1 
ATOM   7629 C C   . PHE B 1 455 ? -7.765  7.388   -41.628 1.00 37.66  ? 455  PHE B C   1 
ATOM   7630 O O   . PHE B 1 455 ? -8.359  7.371   -42.705 1.00 40.24  ? 455  PHE B O   1 
ATOM   7631 C CB  . PHE B 1 455 ? -5.631  6.194   -42.235 1.00 33.17  ? 455  PHE B CB  1 
ATOM   7632 C CG  . PHE B 1 455 ? -4.308  6.481   -42.914 1.00 39.35  ? 455  PHE B CG  1 
ATOM   7633 C CD1 . PHE B 1 455 ? -3.140  6.546   -42.177 1.00 32.12  ? 455  PHE B CD1 1 
ATOM   7634 C CD2 . PHE B 1 455 ? -4.253  6.742   -44.277 1.00 38.23  ? 455  PHE B CD2 1 
ATOM   7635 C CE1 . PHE B 1 455 ? -1.925  6.843   -42.797 1.00 39.89  ? 455  PHE B CE1 1 
ATOM   7636 C CE2 . PHE B 1 455 ? -3.047  7.035   -44.905 1.00 33.71  ? 455  PHE B CE2 1 
ATOM   7637 C CZ  . PHE B 1 455 ? -1.875  7.078   -44.160 1.00 34.39  ? 455  PHE B CZ  1 
ATOM   7638 N N   . GLY B 1 456 ? -8.378  7.328   -40.448 1.00 38.59  ? 456  GLY B N   1 
ATOM   7639 C CA  . GLY B 1 456 ? -9.829  7.407   -40.338 1.00 41.90  ? 456  GLY B CA  1 
ATOM   7640 C C   . GLY B 1 456 ? -10.603 6.113   -40.505 1.00 44.24  ? 456  GLY B C   1 
ATOM   7641 O O   . GLY B 1 456 ? -11.809 6.144   -40.777 1.00 42.63  ? 456  GLY B O   1 
ATOM   7642 N N   . LEU B 1 457 ? -9.932  4.978   -40.322 1.00 43.83  ? 457  LEU B N   1 
ATOM   7643 C CA  . LEU B 1 457 ? -10.588 3.669   -40.487 1.00 45.28  ? 457  LEU B CA  1 
ATOM   7644 C C   . LEU B 1 457 ? -11.833 3.456   -39.615 1.00 49.19  ? 457  LEU B C   1 
ATOM   7645 O O   . LEU B 1 457 ? -12.779 2.795   -40.042 1.00 52.71  ? 457  LEU B O   1 
ATOM   7646 C CB  . LEU B 1 457 ? -9.598  2.519   -40.275 1.00 46.25  ? 457  LEU B CB  1 
ATOM   7647 C CG  . LEU B 1 457 ? -8.862  2.043   -41.537 1.00 47.31  ? 457  LEU B CG  1 
ATOM   7648 C CD1 . LEU B 1 457 ? -7.831  3.074   -42.025 1.00 38.06  ? 457  LEU B CD1 1 
ATOM   7649 C CD2 . LEU B 1 457 ? -8.200  0.698   -41.283 1.00 47.85  ? 457  LEU B CD2 1 
ATOM   7650 N N   . PRO B 1 458 ? -11.837 3.996   -38.383 1.00 42.10  ? 458  PRO B N   1 
ATOM   7651 C CA  . PRO B 1 458 ? -13.051 3.826   -37.582 1.00 43.01  ? 458  PRO B CA  1 
ATOM   7652 C C   . PRO B 1 458 ? -14.311 4.362   -38.268 1.00 50.51  ? 458  PRO B C   1 
ATOM   7653 O O   . PRO B 1 458 ? -15.422 4.025   -37.849 1.00 58.80  ? 458  PRO B O   1 
ATOM   7654 C CB  . PRO B 1 458 ? -12.732 4.629   -36.315 1.00 42.57  ? 458  PRO B CB  1 
ATOM   7655 C CG  . PRO B 1 458 ? -11.263 4.428   -36.154 1.00 44.71  ? 458  PRO B CG  1 
ATOM   7656 C CD  . PRO B 1 458 ? -10.695 4.436   -37.559 1.00 41.32  ? 458  PRO B CD  1 
ATOM   7657 N N   . LEU B 1 459 ? -14.149 5.177   -39.304 1.00 47.83  ? 459  LEU B N   1 
ATOM   7658 C CA  . LEU B 1 459 ? -15.301 5.773   -39.972 1.00 51.57  ? 459  LEU B CA  1 
ATOM   7659 C C   . LEU B 1 459 ? -16.049 4.737   -40.819 1.00 56.11  ? 459  LEU B C   1 
ATOM   7660 O O   . LEU B 1 459 ? -17.146 4.982   -41.287 1.00 61.08  ? 459  LEU B O   1 
ATOM   7661 C CB  . LEU B 1 459 ? -14.888 6.976   -40.823 1.00 48.77  ? 459  LEU B CB  1 
ATOM   7662 C CG  . LEU B 1 459 ? -14.904 8.350   -40.148 1.00 54.79  ? 459  LEU B CG  1 
ATOM   7663 C CD1 . LEU B 1 459 ? -13.822 8.456   -39.091 1.00 58.07  ? 459  LEU B CD1 1 
ATOM   7664 C CD2 . LEU B 1 459 ? -14.725 9.440   -41.186 1.00 50.13  ? 459  LEU B CD2 1 
ATOM   7665 N N   . ASP B 1 460 ? -15.440 3.576   -41.009 1.00 64.57  ? 460  ASP B N   1 
ATOM   7666 C CA  . ASP B 1 460 ? -16.064 2.497   -41.755 1.00 63.99  ? 460  ASP B CA  1 
ATOM   7667 C C   . ASP B 1 460 ? -16.770 1.589   -40.764 1.00 65.45  ? 460  ASP B C   1 
ATOM   7668 O O   . ASP B 1 460 ? -16.113 0.897   -39.984 1.00 57.55  ? 460  ASP B O   1 
ATOM   7669 C CB  . ASP B 1 460 ? -15.014 1.710   -42.536 1.00 68.75  ? 460  ASP B CB  1 
ATOM   7670 C CG  . ASP B 1 460 ? -15.606 0.522   -43.277 1.00 79.14  ? 460  ASP B CG  1 
ATOM   7671 O OD1 . ASP B 1 460 ? -16.845 0.329   -43.214 1.00 81.07  ? 460  ASP B OD1 1 
ATOM   7672 O OD2 . ASP B 1 460 ? -14.829 -0.220  -43.920 1.00 78.82  ? 460  ASP B OD2 1 
ATOM   7673 N N   . PRO B 1 461 ? -18.118 1.586   -40.800 1.00 72.17  ? 461  PRO B N   1 
ATOM   7674 C CA  . PRO B 1 461 ? -18.964 0.894   -39.812 1.00 72.81  ? 461  PRO B CA  1 
ATOM   7675 C C   . PRO B 1 461 ? -18.660 -0.596  -39.751 1.00 69.52  ? 461  PRO B C   1 
ATOM   7676 O O   . PRO B 1 461 ? -18.644 -1.176  -38.668 1.00 71.88  ? 461  PRO B O   1 
ATOM   7677 C CB  . PRO B 1 461 ? -20.392 1.120   -40.335 1.00 70.97  ? 461  PRO B CB  1 
ATOM   7678 C CG  . PRO B 1 461 ? -20.292 2.279   -41.274 1.00 73.77  ? 461  PRO B CG  1 
ATOM   7679 C CD  . PRO B 1 461 ? -18.912 2.209   -41.873 1.00 71.67  ? 461  PRO B CD  1 
ATOM   7680 N N   . SER B 1 462 ? -18.402 -1.195  -40.907 1.00 61.78  ? 462  SER B N   1 
ATOM   7681 C CA  . SER B 1 462 ? -18.107 -2.620  -40.986 1.00 65.16  ? 462  SER B CA  1 
ATOM   7682 C C   . SER B 1 462 ? -16.839 -3.034  -40.238 1.00 66.77  ? 462  SER B C   1 
ATOM   7683 O O   . SER B 1 462 ? -16.544 -4.228  -40.155 1.00 65.84  ? 462  SER B O   1 
ATOM   7684 C CB  . SER B 1 462 ? -17.990 -3.048  -42.451 1.00 68.56  ? 462  SER B CB  1 
ATOM   7685 O OG  . SER B 1 462 ? -16.844 -2.471  -43.050 1.00 72.52  ? 462  SER B OG  1 
ATOM   7686 N N   . LEU B 1 463 ? -16.085 -2.067  -39.700 1.00 58.13  ? 463  LEU B N   1 
ATOM   7687 C CA  . LEU B 1 463 ? -14.863 -2.410  -38.978 1.00 55.79  ? 463  LEU B CA  1 
ATOM   7688 C C   . LEU B 1 463 ? -15.057 -2.624  -37.468 1.00 59.81  ? 463  LEU B C   1 
ATOM   7689 O O   . LEU B 1 463 ? -14.167 -3.156  -36.796 1.00 67.21  ? 463  LEU B O   1 
ATOM   7690 C CB  . LEU B 1 463 ? -13.735 -1.407  -39.262 1.00 55.38  ? 463  LEU B CB  1 
ATOM   7691 C CG  . LEU B 1 463 ? -13.161 -1.421  -40.686 1.00 56.37  ? 463  LEU B CG  1 
ATOM   7692 C CD1 . LEU B 1 463 ? -11.978 -0.450  -40.844 1.00 52.48  ? 463  LEU B CD1 1 
ATOM   7693 C CD2 . LEU B 1 463 ? -12.747 -2.832  -41.077 1.00 56.32  ? 463  LEU B CD2 1 
ATOM   7694 N N   . ASN B 1 464 ? -16.206 -2.211  -36.937 1.00 53.63  ? 464  ASN B N   1 
ATOM   7695 C CA  . ASN B 1 464 ? -16.577 -2.551  -35.556 1.00 62.79  ? 464  ASN B CA  1 
ATOM   7696 C C   . ASN B 1 464 ? -15.931 -1.716  -34.440 1.00 61.93  ? 464  ASN B C   1 
ATOM   7697 O O   . ASN B 1 464 ? -15.969 -2.098  -33.265 1.00 61.74  ? 464  ASN B O   1 
ATOM   7698 C CB  . ASN B 1 464 ? -16.345 -4.049  -35.279 1.00 77.47  ? 464  ASN B CB  1 
ATOM   7699 C CG  . ASN B 1 464 ? -17.172 -4.954  -36.184 1.00 87.03  ? 464  ASN B CG  1 
ATOM   7700 O OD1 . ASN B 1 464 ? -18.239 -4.567  -36.670 1.00 89.45  ? 464  ASN B OD1 1 
ATOM   7701 N ND2 . ASN B 1 464 ? -16.679 -6.171  -36.413 1.00 90.55  ? 464  ASN B ND2 1 
ATOM   7702 N N   . TYR B 1 465 ? -15.332 -0.585  -34.796 1.00 57.25  ? 465  TYR B N   1 
ATOM   7703 C CA  . TYR B 1 465 ? -14.860 0.350   -33.788 1.00 51.38  ? 465  TYR B CA  1 
ATOM   7704 C C   . TYR B 1 465 ? -16.065 0.929   -33.050 1.00 52.70  ? 465  TYR B C   1 
ATOM   7705 O O   . TYR B 1 465 ? -17.166 0.943   -33.582 1.00 54.97  ? 465  TYR B O   1 
ATOM   7706 C CB  . TYR B 1 465 ? -14.084 1.486   -34.455 1.00 48.76  ? 465  TYR B CB  1 
ATOM   7707 C CG  . TYR B 1 465 ? -12.753 1.089   -35.033 1.00 39.27  ? 465  TYR B CG  1 
ATOM   7708 C CD1 . TYR B 1 465 ? -11.592 1.146   -34.255 1.00 50.51  ? 465  TYR B CD1 1 
ATOM   7709 C CD2 . TYR B 1 465 ? -12.638 0.693   -36.358 1.00 40.39  ? 465  TYR B CD2 1 
ATOM   7710 C CE1 . TYR B 1 465 ? -10.350 0.803   -34.785 1.00 48.43  ? 465  TYR B CE1 1 
ATOM   7711 C CE2 . TYR B 1 465 ? -11.400 0.341   -36.901 1.00 46.40  ? 465  TYR B CE2 1 
ATOM   7712 C CZ  . TYR B 1 465 ? -10.263 0.403   -36.107 1.00 50.13  ? 465  TYR B CZ  1 
ATOM   7713 O OH  . TYR B 1 465 ? -9.039  0.070   -36.632 1.00 50.87  ? 465  TYR B OH  1 
ATOM   7714 N N   . THR B 1 466 ? -15.871 1.418   -31.834 1.00 55.10  ? 466  THR B N   1 
ATOM   7715 C CA  . THR B 1 466 ? -16.974 2.047   -31.114 1.00 57.15  ? 466  THR B CA  1 
ATOM   7716 C C   . THR B 1 466 ? -17.284 3.434   -31.661 1.00 61.50  ? 466  THR B C   1 
ATOM   7717 O O   . THR B 1 466 ? -16.490 4.032   -32.387 1.00 58.43  ? 466  THR B O   1 
ATOM   7718 C CB  . THR B 1 466 ? -16.669 2.207   -29.624 1.00 57.17  ? 466  THR B CB  1 
ATOM   7719 O OG1 . THR B 1 466 ? -15.621 3.182   -29.446 1.00 53.43  ? 466  THR B OG1 1 
ATOM   7720 C CG2 . THR B 1 466 ? -16.263 0.869   -29.029 1.00 53.25  ? 466  THR B CG2 1 
ATOM   7721 N N   . THR B 1 467 ? -18.444 3.948   -31.283 1.00 63.89  ? 467  THR B N   1 
ATOM   7722 C CA  . THR B 1 467 ? -18.868 5.273   -31.699 1.00 62.62  ? 467  THR B CA  1 
ATOM   7723 C C   . THR B 1 467 ? -17.915 6.377   -31.212 1.00 57.18  ? 467  THR B C   1 
ATOM   7724 O O   . THR B 1 467 ? -17.658 7.338   -31.937 1.00 56.37  ? 467  THR B O   1 
ATOM   7725 C CB  . THR B 1 467 ? -20.329 5.555   -31.258 1.00 70.62  ? 467  THR B CB  1 
ATOM   7726 O OG1 . THR B 1 467 ? -20.741 6.832   -31.756 1.00 72.96  ? 467  THR B OG1 1 
ATOM   7727 C CG2 . THR B 1 467 ? -20.453 5.537   -29.741 1.00 68.99  ? 467  THR B CG2 1 
ATOM   7728 N N   . GLU B 1 468 ? -17.395 6.232   -29.994 1.00 55.94  ? 468  GLU B N   1 
ATOM   7729 C CA  . GLU B 1 468 ? -16.435 7.185   -29.430 1.00 53.49  ? 468  GLU B CA  1 
ATOM   7730 C C   . GLU B 1 468 ? -15.146 7.168   -30.255 1.00 54.57  ? 468  GLU B C   1 
ATOM   7731 O O   . GLU B 1 468 ? -14.450 8.180   -30.393 1.00 47.55  ? 468  GLU B O   1 
ATOM   7732 C CB  . GLU B 1 468 ? -16.102 6.837   -27.972 1.00 54.01  ? 468  GLU B CB  1 
ATOM   7733 C CG  . GLU B 1 468 ? -17.204 7.125   -26.947 1.00 74.82  ? 468  GLU B CG  1 
ATOM   7734 C CD  . GLU B 1 468 ? -18.301 6.039   -26.890 1.00 93.16  ? 468  GLU B CD  1 
ATOM   7735 O OE1 . GLU B 1 468 ? -18.110 4.927   -27.441 1.00 91.26  ? 468  GLU B OE1 1 
ATOM   7736 O OE2 . GLU B 1 468 ? -19.361 6.303   -26.275 1.00 103.21 ? 468  GLU B OE2 1 
ATOM   7737 N N   . GLU B 1 469 ? -14.825 6.001   -30.793 1.00 52.56  ? 469  GLU B N   1 
ATOM   7738 C CA  . GLU B 1 469 ? -13.623 5.864   -31.595 1.00 50.06  ? 469  GLU B CA  1 
ATOM   7739 C C   . GLU B 1 469 ? -13.779 6.544   -32.952 1.00 50.26  ? 469  GLU B C   1 
ATOM   7740 O O   . GLU B 1 469 ? -12.826 7.119   -33.479 1.00 47.02  ? 469  GLU B O   1 
ATOM   7741 C CB  . GLU B 1 469 ? -13.243 4.397   -31.736 1.00 45.17  ? 469  GLU B CB  1 
ATOM   7742 C CG  . GLU B 1 469 ? -12.410 3.920   -30.566 1.00 48.67  ? 469  GLU B CG  1 
ATOM   7743 C CD  . GLU B 1 469 ? -12.199 2.431   -30.592 1.00 54.79  ? 469  GLU B CD  1 
ATOM   7744 O OE1 . GLU B 1 469 ? -13.048 1.727   -31.182 1.00 56.21  ? 469  GLU B OE1 1 
ATOM   7745 O OE2 . GLU B 1 469 ? -11.194 1.966   -30.013 1.00 55.83  ? 469  GLU B OE2 1 
ATOM   7746 N N   . ARG B 1 470 ? -14.991 6.501   -33.499 1.00 44.40  ? 470  ARG B N   1 
ATOM   7747 C CA  . ARG B 1 470 ? -15.269 7.203   -34.735 1.00 49.27  ? 470  ARG B CA  1 
ATOM   7748 C C   . ARG B 1 470 ? -15.078 8.707   -34.507 1.00 50.29  ? 470  ARG B C   1 
ATOM   7749 O O   . ARG B 1 470 ? -14.391 9.387   -35.274 1.00 50.32  ? 470  ARG B O   1 
ATOM   7750 C CB  . ARG B 1 470 ? -16.688 6.877   -35.202 1.00 57.17  ? 470  ARG B CB  1 
ATOM   7751 C CG  . ARG B 1 470 ? -16.978 7.214   -36.645 1.00 72.13  ? 470  ARG B CG  1 
ATOM   7752 C CD  . ARG B 1 470 ? -17.865 8.436   -36.751 1.00 87.49  ? 470  ARG B CD  1 
ATOM   7753 N NE  . ARG B 1 470 ? -19.122 8.244   -36.031 1.00 94.43  ? 470  ARG B NE  1 
ATOM   7754 C CZ  . ARG B 1 470 ? -19.945 9.229   -35.693 1.00 94.76  ? 470  ARG B CZ  1 
ATOM   7755 N NH1 . ARG B 1 470 ? -19.646 10.482  -36.018 1.00 90.93  ? 470  ARG B NH1 1 
ATOM   7756 N NH2 . ARG B 1 470 ? -21.064 8.961   -35.030 1.00 95.55  ? 470  ARG B NH2 1 
ATOM   7757 N N   . ILE B 1 471 ? -15.665 9.215   -33.429 1.00 44.74  ? 471  ILE B N   1 
ATOM   7758 C CA  . ILE B 1 471 ? -15.548 10.628  -33.062 1.00 47.76  ? 471  ILE B CA  1 
ATOM   7759 C C   . ILE B 1 471 ? -14.071 11.037  -32.868 1.00 48.51  ? 471  ILE B C   1 
ATOM   7760 O O   . ILE B 1 471 ? -13.622 12.077  -33.354 1.00 51.76  ? 471  ILE B O   1 
ATOM   7761 C CB  . ILE B 1 471 ? -16.394 10.920  -31.784 1.00 47.01  ? 471  ILE B CB  1 
ATOM   7762 C CG1 . ILE B 1 471 ? -17.894 10.759  -32.091 1.00 48.23  ? 471  ILE B CG1 1 
ATOM   7763 C CG2 . ILE B 1 471 ? -16.080 12.287  -31.214 1.00 45.83  ? 471  ILE B CG2 1 
ATOM   7764 C CD1 . ILE B 1 471 ? -18.715 10.400  -30.879 1.00 51.26  ? 471  ILE B CD1 1 
ATOM   7765 N N   . PHE B 1 472 ? -13.327 10.187  -32.172 1.00 43.74  ? 472  PHE B N   1 
ATOM   7766 C CA  . PHE B 1 472 ? -11.915 10.393  -31.902 1.00 42.41  ? 472  PHE B CA  1 
ATOM   7767 C C   . PHE B 1 472 ? -11.105 10.401  -33.212 1.00 44.93  ? 472  PHE B C   1 
ATOM   7768 O O   . PHE B 1 472 ? -10.250 11.269  -33.407 1.00 42.14  ? 472  PHE B O   1 
ATOM   7769 C CB  . PHE B 1 472 ? -11.442 9.302   -30.933 1.00 47.13  ? 472  PHE B CB  1 
ATOM   7770 C CG  . PHE B 1 472 ? -9.961  9.298   -30.647 1.00 45.15  ? 472  PHE B CG  1 
ATOM   7771 C CD1 . PHE B 1 472 ? -9.332  10.406  -30.117 1.00 39.60  ? 472  PHE B CD1 1 
ATOM   7772 C CD2 . PHE B 1 472 ? -9.214  8.143   -30.852 1.00 43.17  ? 472  PHE B CD2 1 
ATOM   7773 C CE1 . PHE B 1 472 ? -7.953  10.390  -29.821 1.00 35.01  ? 472  PHE B CE1 1 
ATOM   7774 C CE2 . PHE B 1 472 ? -7.848  8.114   -30.573 1.00 44.11  ? 472  PHE B CE2 1 
ATOM   7775 C CZ  . PHE B 1 472 ? -7.220  9.247   -30.046 1.00 35.72  ? 472  PHE B CZ  1 
ATOM   7776 N N   . ALA B 1 473 ? -11.382 9.458   -34.112 1.00 45.28  ? 473  ALA B N   1 
ATOM   7777 C CA  . ALA B 1 473 ? -10.681 9.424   -35.399 1.00 44.43  ? 473  ALA B CA  1 
ATOM   7778 C C   . ALA B 1 473 ? -10.934 10.710  -36.195 1.00 47.22  ? 473  ALA B C   1 
ATOM   7779 O O   . ALA B 1 473 ? -10.027 11.253  -36.836 1.00 45.52  ? 473  ALA B O   1 
ATOM   7780 C CB  . ALA B 1 473 ? -11.078 8.208   -36.211 1.00 37.42  ? 473  ALA B CB  1 
ATOM   7781 N N   . GLN B 1 474 ? -12.165 11.204  -36.143 1.00 40.60  ? 474  GLN B N   1 
ATOM   7782 C CA  . GLN B 1 474 ? -12.509 12.445  -36.834 1.00 46.05  ? 474  GLN B CA  1 
ATOM   7783 C C   . GLN B 1 474 ? -11.724 13.641  -36.279 1.00 44.93  ? 474  GLN B C   1 
ATOM   7784 O O   . GLN B 1 474 ? -11.277 14.496  -37.044 1.00 47.98  ? 474  GLN B O   1 
ATOM   7785 C CB  . GLN B 1 474 ? -14.026 12.700  -36.798 1.00 46.68  ? 474  GLN B CB  1 
ATOM   7786 C CG  . GLN B 1 474 ? -14.828 11.599  -37.511 1.00 52.48  ? 474  GLN B CG  1 
ATOM   7787 C CD  . GLN B 1 474 ? -16.330 11.874  -37.571 1.00 61.48  ? 474  GLN B CD  1 
ATOM   7788 O OE1 . GLN B 1 474 ? -16.990 12.030  -36.544 1.00 62.10  ? 474  GLN B OE1 1 
ATOM   7789 N NE2 . GLN B 1 474 ? -16.871 11.930  -38.783 1.00 65.93  ? 474  GLN B NE2 1 
ATOM   7790 N N   . ARG B 1 475 ? -11.552 13.691  -34.959 1.00 37.33  ? 475  ARG B N   1 
ATOM   7791 C CA  . ARG B 1 475 ? -10.699 14.697  -34.340 1.00 42.87  ? 475  ARG B CA  1 
ATOM   7792 C C   . ARG B 1 475 ? -9.275  14.621  -34.883 1.00 39.67  ? 475  ARG B C   1 
ATOM   7793 O O   . ARG B 1 475 ? -8.671  15.649  -35.212 1.00 39.84  ? 475  ARG B O   1 
ATOM   7794 C CB  . ARG B 1 475 ? -10.654 14.546  -32.810 1.00 50.73  ? 475  ARG B CB  1 
ATOM   7795 C CG  . ARG B 1 475 ? -11.918 14.957  -32.069 1.00 55.73  ? 475  ARG B CG  1 
ATOM   7796 C CD  . ARG B 1 475 ? -11.777 14.711  -30.560 1.00 54.31  ? 475  ARG B CD  1 
ATOM   7797 N NE  . ARG B 1 475 ? -10.539 15.293  -30.048 1.00 48.49  ? 475  ARG B NE  1 
ATOM   7798 C CZ  . ARG B 1 475 ? -9.802  14.767  -29.072 1.00 45.29  ? 475  ARG B CZ  1 
ATOM   7799 N NH1 . ARG B 1 475 ? -10.174 13.631  -28.487 1.00 40.68  ? 475  ARG B NH1 1 
ATOM   7800 N NH2 . ARG B 1 475 ? -8.671  15.364  -28.697 1.00 39.86  ? 475  ARG B NH2 1 
ATOM   7801 N N   . LEU B 1 476 ? -8.728  13.412  -34.971 1.00 38.17  ? 476  LEU B N   1 
ATOM   7802 C CA  . LEU B 1 476 ? -7.319  13.270  -35.385 1.00 36.88  ? 476  LEU B CA  1 
ATOM   7803 C C   . LEU B 1 476 ? -7.129  13.638  -36.856 1.00 40.15  ? 476  LEU B C   1 
ATOM   7804 O O   . LEU B 1 476 ? -6.145  14.277  -37.219 1.00 40.37  ? 476  LEU B O   1 
ATOM   7805 C CB  . LEU B 1 476 ? -6.772  11.871  -35.076 1.00 37.64  ? 476  LEU B CB  1 
ATOM   7806 C CG  . LEU B 1 476 ? -6.759  11.514  -33.582 1.00 45.54  ? 476  LEU B CG  1 
ATOM   7807 C CD1 . LEU B 1 476 ? -6.015  10.231  -33.339 1.00 51.43  ? 476  LEU B CD1 1 
ATOM   7808 C CD2 . LEU B 1 476 ? -6.150  12.638  -32.758 1.00 43.48  ? 476  LEU B CD2 1 
ATOM   7809 N N   . MET B 1 477 ? -8.097  13.268  -37.691 1.00 38.09  ? 477  MET B N   1 
ATOM   7810 C CA  . MET B 1 477 ? -8.051  13.627  -39.094 1.00 35.85  ? 477  MET B CA  1 
ATOM   7811 C C   . MET B 1 477 ? -8.070  15.145  -39.244 1.00 39.89  ? 477  MET B C   1 
ATOM   7812 O O   . MET B 1 477 ? -7.403  15.691  -40.120 1.00 43.07  ? 477  MET B O   1 
ATOM   7813 C CB  . MET B 1 477 ? -9.222  13.002  -39.852 1.00 36.64  ? 477  MET B CB  1 
ATOM   7814 C CG  . MET B 1 477 ? -9.202  11.462  -39.938 1.00 45.55  ? 477  MET B CG  1 
ATOM   7815 S SD  . MET B 1 477 ? -10.805 10.822  -40.516 1.00 52.57  ? 477  MET B SD  1 
ATOM   7816 C CE  . MET B 1 477 ? -10.662 11.160  -42.259 1.00 35.47  ? 477  MET B CE  1 
ATOM   7817 N N   . LYS B 1 478 ? -8.848  15.814  -38.391 1.00 35.47  ? 478  LYS B N   1 
ATOM   7818 C CA  . LYS B 1 478 ? -8.881  17.279  -38.357 1.00 42.60  ? 478  LYS B CA  1 
ATOM   7819 C C   . LYS B 1 478 ? -7.526  17.887  -37.970 1.00 38.13  ? 478  LYS B C   1 
ATOM   7820 O O   . LYS B 1 478 ? -7.038  18.772  -38.662 1.00 37.99  ? 478  LYS B O   1 
ATOM   7821 C CB  . LYS B 1 478 ? -9.973  17.792  -37.408 1.00 48.71  ? 478  LYS B CB  1 
ATOM   7822 C CG  . LYS B 1 478 ? -11.150 18.428  -38.096 1.00 66.81  ? 478  LYS B CG  1 
ATOM   7823 C CD  . LYS B 1 478 ? -10.817 19.836  -38.570 1.00 77.43  ? 478  LYS B CD  1 
ATOM   7824 C CE  . LYS B 1 478 ? -11.926 20.392  -39.467 1.00 82.52  ? 478  LYS B CE  1 
ATOM   7825 N NZ  . LYS B 1 478 ? -12.234 19.510  -40.651 1.00 74.66  ? 478  LYS B NZ  1 
ATOM   7826 N N   . TYR B 1 479 ? -6.926  17.431  -36.870 1.00 39.74  ? 479  TYR B N   1 
ATOM   7827 C CA  . TYR B 1 479 ? -5.603  17.947  -36.488 1.00 37.25  ? 479  TYR B CA  1 
ATOM   7828 C C   . TYR B 1 479 ? -4.567  17.772  -37.609 1.00 40.49  ? 479  TYR B C   1 
ATOM   7829 O O   . TYR B 1 479 ? -3.870  18.727  -37.983 1.00 39.01  ? 479  TYR B O   1 
ATOM   7830 C CB  . TYR B 1 479 ? -5.065  17.240  -35.262 1.00 31.09  ? 479  TYR B CB  1 
ATOM   7831 C CG  . TYR B 1 479 ? -5.820  17.434  -33.975 1.00 36.15  ? 479  TYR B CG  1 
ATOM   7832 C CD1 . TYR B 1 479 ? -6.288  18.678  -33.586 1.00 35.95  ? 479  TYR B CD1 1 
ATOM   7833 C CD2 . TYR B 1 479 ? -6.002  16.363  -33.105 1.00 33.19  ? 479  TYR B CD2 1 
ATOM   7834 C CE1 . TYR B 1 479 ? -6.958  18.837  -32.370 1.00 37.21  ? 479  TYR B CE1 1 
ATOM   7835 C CE2 . TYR B 1 479 ? -6.653  16.512  -31.898 1.00 28.87  ? 479  TYR B CE2 1 
ATOM   7836 C CZ  . TYR B 1 479 ? -7.128  17.742  -31.534 1.00 38.23  ? 479  TYR B CZ  1 
ATOM   7837 O OH  . TYR B 1 479 ? -7.776  17.850  -30.327 1.00 43.08  ? 479  TYR B OH  1 
ATOM   7838 N N   . TRP B 1 480 ? -4.445  16.544  -38.119 1.00 35.55  ? 480  TRP B N   1 
ATOM   7839 C CA  . TRP B 1 480 ? -3.479  16.256  -39.185 1.00 35.75  ? 480  TRP B CA  1 
ATOM   7840 C C   . TRP B 1 480 ? -3.726  17.119  -40.440 1.00 39.33  ? 480  TRP B C   1 
ATOM   7841 O O   . TRP B 1 480 ? -2.789  17.720  -40.969 1.00 33.43  ? 480  TRP B O   1 
ATOM   7842 C CB  . TRP B 1 480 ? -3.478  14.759  -39.542 1.00 33.52  ? 480  TRP B CB  1 
ATOM   7843 C CG  . TRP B 1 480 ? -2.364  13.963  -38.872 1.00 34.89  ? 480  TRP B CG  1 
ATOM   7844 C CD1 . TRP B 1 480 ? -1.360  13.265  -39.495 1.00 32.39  ? 480  TRP B CD1 1 
ATOM   7845 C CD2 . TRP B 1 480 ? -2.162  13.784  -37.465 1.00 33.00  ? 480  TRP B CD2 1 
ATOM   7846 N NE1 . TRP B 1 480 ? -0.550  12.660  -38.557 1.00 32.84  ? 480  TRP B NE1 1 
ATOM   7847 C CE2 . TRP B 1 480 ? -1.023  12.963  -37.305 1.00 35.89  ? 480  TRP B CE2 1 
ATOM   7848 C CE3 . TRP B 1 480 ? -2.835  14.239  -36.320 1.00 36.44  ? 480  TRP B CE3 1 
ATOM   7849 C CZ2 . TRP B 1 480 ? -0.537  12.597  -36.047 1.00 32.44  ? 480  TRP B CZ2 1 
ATOM   7850 C CZ3 . TRP B 1 480 ? -2.355  13.867  -35.076 1.00 35.56  ? 480  TRP B CZ3 1 
ATOM   7851 C CH2 . TRP B 1 480 ? -1.220  13.052  -34.950 1.00 34.35  ? 480  TRP B CH2 1 
ATOM   7852 N N   . THR B 1 481 ? -4.978  17.212  -40.900 1.00 34.92  ? 481  THR B N   1 
ATOM   7853 C CA  . THR B 1 481 ? -5.241  17.998  -42.110 1.00 37.46  ? 481  THR B CA  1 
ATOM   7854 C C   . THR B 1 481 ? -5.165  19.508  -41.837 1.00 40.46  ? 481  THR B C   1 
ATOM   7855 O O   . THR B 1 481 ? -4.692  20.270  -42.684 1.00 41.59  ? 481  THR B O   1 
ATOM   7856 C CB  . THR B 1 481 ? -6.543  17.586  -42.835 1.00 38.80  ? 481  THR B CB  1 
ATOM   7857 O OG1 . THR B 1 481 ? -7.657  17.662  -41.933 1.00 41.28  ? 481  THR B OG1 1 
ATOM   7858 C CG2 . THR B 1 481 ? -6.418  16.145  -43.361 1.00 37.55  ? 481  THR B CG2 1 
ATOM   7859 N N   . ASN B 1 482 ? -5.580  19.938  -40.647 1.00 40.12  ? 482  ASN B N   1 
ATOM   7860 C CA  . ASN B 1 482 ? -5.352  21.331  -40.250 1.00 43.24  ? 482  ASN B CA  1 
ATOM   7861 C C   . ASN B 1 482 ? -3.873  21.620  -40.299 1.00 38.89  ? 482  ASN B C   1 
ATOM   7862 O O   . ASN B 1 482 ? -3.457  22.670  -40.780 1.00 38.63  ? 482  ASN B O   1 
ATOM   7863 C CB  . ASN B 1 482 ? -5.870  21.647  -38.840 1.00 39.62  ? 482  ASN B CB  1 
ATOM   7864 C CG  . ASN B 1 482 ? -7.366  21.944  -38.819 1.00 43.53  ? 482  ASN B CG  1 
ATOM   7865 O OD1 . ASN B 1 482 ? -7.983  22.154  -39.857 1.00 38.29  ? 482  ASN B OD1 1 
ATOM   7866 N ND2 . ASN B 1 482 ? -7.948  21.959  -37.627 1.00 52.11  ? 482  ASN B ND2 1 
ATOM   7867 N N   . PHE B 1 483 ? -3.081  20.690  -39.782 1.00 34.93  ? 483  PHE B N   1 
ATOM   7868 C CA  . PHE B 1 483 ? -1.638  20.872  -39.823 1.00 38.24  ? 483  PHE B CA  1 
ATOM   7869 C C   . PHE B 1 483 ? -1.148  20.929  -41.278 1.00 37.66  ? 483  PHE B C   1 
ATOM   7870 O O   . PHE B 1 483 ? -0.351  21.794  -41.619 1.00 37.97  ? 483  PHE B O   1 
ATOM   7871 C CB  . PHE B 1 483 ? -0.882  19.793  -39.021 1.00 34.00  ? 483  PHE B CB  1 
ATOM   7872 C CG  . PHE B 1 483 ? 0.620   19.918  -39.124 1.00 36.55  ? 483  PHE B CG  1 
ATOM   7873 C CD1 . PHE B 1 483 ? 1.313   20.835  -38.330 1.00 34.23  ? 483  PHE B CD1 1 
ATOM   7874 C CD2 . PHE B 1 483 ? 1.330   19.165  -40.050 1.00 35.58  ? 483  PHE B CD2 1 
ATOM   7875 C CE1 . PHE B 1 483 ? 2.692   20.967  -38.430 1.00 39.62  ? 483  PHE B CE1 1 
ATOM   7876 C CE2 . PHE B 1 483 ? 2.726   19.292  -40.162 1.00 39.42  ? 483  PHE B CE2 1 
ATOM   7877 C CZ  . PHE B 1 483 ? 3.405   20.194  -39.357 1.00 34.80  ? 483  PHE B CZ  1 
ATOM   7878 N N   . ALA B 1 484 ? -1.623  20.021  -42.133 1.00 37.18  ? 484  ALA B N   1 
ATOM   7879 C CA  . ALA B 1 484 ? -1.222  20.037  -43.555 1.00 35.20  ? 484  ALA B CA  1 
ATOM   7880 C C   . ALA B 1 484 ? -1.518  21.388  -44.210 1.00 41.80  ? 484  ALA B C   1 
ATOM   7881 O O   . ALA B 1 484 ? -0.685  21.922  -44.949 1.00 35.51  ? 484  ALA B O   1 
ATOM   7882 C CB  . ALA B 1 484 ? -1.917  18.924  -44.326 1.00 30.74  ? 484  ALA B CB  1 
ATOM   7883 N N   . ARG B 1 485 ? -2.705  21.935  -43.917 1.00 38.40  ? 485  ARG B N   1 
ATOM   7884 C CA  . ARG B 1 485 ? -3.185  23.178  -44.538 1.00 44.50  ? 485  ARG B CA  1 
ATOM   7885 C C   . ARG B 1 485 ? -2.400  24.401  -44.101 1.00 45.62  ? 485  ARG B C   1 
ATOM   7886 O O   . ARG B 1 485 ? -2.141  25.291  -44.919 1.00 45.46  ? 485  ARG B O   1 
ATOM   7887 C CB  . ARG B 1 485 ? -4.686  23.434  -44.237 1.00 36.36  ? 485  ARG B CB  1 
ATOM   7888 C CG  . ARG B 1 485 ? -5.692  22.616  -45.062 1.00 52.19  ? 485  ARG B CG  1 
ATOM   7889 C CD  . ARG B 1 485 ? -7.181  22.939  -44.687 1.00 65.54  ? 485  ARG B CD  1 
ATOM   7890 N NE  . ARG B 1 485 ? -7.607  22.265  -43.455 1.00 69.67  ? 485  ARG B NE  1 
ATOM   7891 C CZ  . ARG B 1 485 ? -8.356  21.157  -43.399 1.00 69.94  ? 485  ARG B CZ  1 
ATOM   7892 N NH1 . ARG B 1 485 ? -8.804  20.584  -44.517 1.00 66.47  ? 485  ARG B NH1 1 
ATOM   7893 N NH2 . ARG B 1 485 ? -8.668  20.621  -42.212 1.00 58.21  ? 485  ARG B NH2 1 
ATOM   7894 N N   . THR B 1 486 ? -2.030  24.445  -42.817 1.00 44.51  ? 486  THR B N   1 
ATOM   7895 C CA  . THR B 1 486 ? -1.575  25.691  -42.203 1.00 44.31  ? 486  THR B CA  1 
ATOM   7896 C C   . THR B 1 486 ? -0.306  25.580  -41.379 1.00 42.99  ? 486  THR B C   1 
ATOM   7897 O O   . THR B 1 486 ? 0.264   26.587  -40.992 1.00 39.44  ? 486  THR B O   1 
ATOM   7898 C CB  . THR B 1 486 ? -2.655  26.299  -41.267 1.00 45.57  ? 486  THR B CB  1 
ATOM   7899 O OG1 . THR B 1 486 ? -2.822  25.454  -40.120 1.00 43.29  ? 486  THR B OG1 1 
ATOM   7900 C CG2 . THR B 1 486 ? -4.000  26.461  -42.005 1.00 39.90  ? 486  THR B CG2 1 
ATOM   7901 N N   . GLY B 1 487 ? 0.139   24.372  -41.079 1.00 40.07  ? 487  GLY B N   1 
ATOM   7902 C CA  . GLY B 1 487 ? 1.281   24.242  -40.195 1.00 34.74  ? 487  GLY B CA  1 
ATOM   7903 C C   . GLY B 1 487 ? 0.892   24.375  -38.728 1.00 43.27  ? 487  GLY B C   1 
ATOM   7904 O O   . GLY B 1 487 ? 1.755   24.493  -37.857 1.00 40.86  ? 487  GLY B O   1 
ATOM   7905 N N   . ASP B 1 488 ? -0.411  24.334  -38.456 1.00 42.08  ? 488  ASP B N   1 
ATOM   7906 C CA  . ASP B 1 488 ? -0.935  24.441  -37.093 1.00 36.04  ? 488  ASP B CA  1 
ATOM   7907 C C   . ASP B 1 488 ? -2.117  23.465  -36.966 1.00 37.29  ? 488  ASP B C   1 
ATOM   7908 O O   . ASP B 1 488 ? -3.074  23.588  -37.690 1.00 36.39  ? 488  ASP B O   1 
ATOM   7909 C CB  . ASP B 1 488 ? -1.411  25.873  -36.883 1.00 34.58  ? 488  ASP B CB  1 
ATOM   7910 C CG  . ASP B 1 488 ? -1.901  26.151  -35.454 1.00 44.26  ? 488  ASP B CG  1 
ATOM   7911 O OD1 . ASP B 1 488 ? -2.366  25.228  -34.754 1.00 43.70  ? 488  ASP B OD1 1 
ATOM   7912 O OD2 . ASP B 1 488 ? -1.829  27.327  -35.041 1.00 43.94  ? 488  ASP B OD2 1 
ATOM   7913 N N   . PRO B 1 489 ? -2.049  22.487  -36.049 1.00 38.87  ? 489  PRO B N   1 
ATOM   7914 C CA  . PRO B 1 489 ? -3.141  21.513  -35.988 1.00 35.79  ? 489  PRO B CA  1 
ATOM   7915 C C   . PRO B 1 489 ? -4.421  22.065  -35.334 1.00 38.21  ? 489  PRO B C   1 
ATOM   7916 O O   . PRO B 1 489 ? -5.456  21.404  -35.372 1.00 46.07  ? 489  PRO B O   1 
ATOM   7917 C CB  . PRO B 1 489 ? -2.537  20.399  -35.130 1.00 31.84  ? 489  PRO B CB  1 
ATOM   7918 C CG  . PRO B 1 489 ? -1.741  21.190  -34.130 1.00 37.46  ? 489  PRO B CG  1 
ATOM   7919 C CD  . PRO B 1 489 ? -1.019  22.190  -35.035 1.00 40.94  ? 489  PRO B CD  1 
ATOM   7920 N N   . ASN B 1 490 ? -4.363  23.251  -34.741 1.00 32.50  ? 490  ASN B N   1 
ATOM   7921 C CA  . ASN B 1 490 ? -5.564  23.842  -34.145 1.00 42.39  ? 490  ASN B CA  1 
ATOM   7922 C C   . ASN B 1 490 ? -6.565  24.320  -35.206 1.00 47.35  ? 490  ASN B C   1 
ATOM   7923 O O   . ASN B 1 490 ? -6.180  24.823  -36.269 1.00 46.75  ? 490  ASN B O   1 
ATOM   7924 C CB  . ASN B 1 490 ? -5.207  24.998  -33.195 1.00 43.51  ? 490  ASN B CB  1 
ATOM   7925 C CG  . ASN B 1 490 ? -4.403  24.536  -31.987 1.00 44.03  ? 490  ASN B CG  1 
ATOM   7926 O OD1 . ASN B 1 490 ? -4.937  23.896  -31.073 1.00 44.54  ? 490  ASN B OD1 1 
ATOM   7927 N ND2 . ASN B 1 490 ? -3.113  24.862  -31.976 1.00 32.99  ? 490  ASN B ND2 1 
ATOM   7928 N N   . ASP B 1 491 ? -7.845  24.147  -34.907 1.00 54.64  ? 491  ASP B N   1 
ATOM   7929 C CA  . ASP B 1 491 ? -8.928  24.535  -35.809 1.00 65.61  ? 491  ASP B CA  1 
ATOM   7930 C C   . ASP B 1 491 ? -8.983  26.061  -35.923 1.00 72.20  ? 491  ASP B C   1 
ATOM   7931 O O   . ASP B 1 491 ? -9.111  26.749  -34.914 1.00 72.16  ? 491  ASP B O   1 
ATOM   7932 C CB  . ASP B 1 491 ? -10.261 23.973  -35.292 1.00 75.81  ? 491  ASP B CB  1 
ATOM   7933 C CG  . ASP B 1 491 ? -11.163 23.458  -36.413 1.00 89.79  ? 491  ASP B CG  1 
ATOM   7934 O OD1 . ASP B 1 491 ? -11.356 24.179  -37.419 1.00 92.78  ? 491  ASP B OD1 1 
ATOM   7935 O OD2 . ASP B 1 491 ? -11.689 22.330  -36.282 1.00 93.24  ? 491  ASP B OD2 1 
ATOM   7936 N N   . PRO B 1 492 ? -8.884  26.589  -37.158 1.00 77.78  ? 492  PRO B N   1 
ATOM   7937 C CA  . PRO B 1 492 ? -8.763  28.027  -37.456 1.00 80.95  ? 492  PRO B CA  1 
ATOM   7938 C C   . PRO B 1 492 ? -9.954  28.825  -36.943 1.00 84.65  ? 492  PRO B C   1 
ATOM   7939 O O   . PRO B 1 492 ? -9.820  29.989  -36.558 1.00 78.36  ? 492  PRO B O   1 
ATOM   7940 C CB  . PRO B 1 492 ? -8.736  28.073  -38.988 1.00 82.89  ? 492  PRO B CB  1 
ATOM   7941 C CG  . PRO B 1 492 ? -8.368  26.694  -39.418 1.00 80.02  ? 492  PRO B CG  1 
ATOM   7942 C CD  . PRO B 1 492 ? -8.938  25.777  -38.385 1.00 78.32  ? 492  PRO B CD  1 
ATOM   7943 N N   . ARG B 1 493 ? -11.121 28.196  -36.972 1.00 92.20  ? 493  ARG B N   1 
ATOM   7944 C CA  . ARG B 1 493 ? -12.307 28.740  -36.340 1.00 102.46 ? 493  ARG B CA  1 
ATOM   7945 C C   . ARG B 1 493 ? -12.781 27.660  -35.389 1.00 107.78 ? 493  ARG B C   1 
ATOM   7946 O O   . ARG B 1 493 ? -12.530 26.482  -35.629 1.00 111.38 ? 493  ARG B O   1 
ATOM   7947 C CB  . ARG B 1 493 ? -13.378 29.065  -37.382 1.00 107.77 ? 493  ARG B CB  1 
ATOM   7948 N N   . ASP B 1 494 ? -13.464 28.066  -34.324 1.00 111.11 ? 494  ASP B N   1 
ATOM   7949 C CA  . ASP B 1 494 ? -13.784 27.197  -33.190 1.00 112.88 ? 494  ASP B CA  1 
ATOM   7950 C C   . ASP B 1 494 ? -12.987 27.664  -31.988 1.00 108.01 ? 494  ASP B C   1 
ATOM   7951 O O   . ASP B 1 494 ? -11.802 27.348  -31.850 1.00 100.76 ? 494  ASP B O   1 
ATOM   7952 C CB  . ASP B 1 494 ? -13.483 25.718  -33.473 1.00 116.15 ? 494  ASP B CB  1 
ATOM   7953 C CG  . ASP B 1 494 ? -13.257 24.905  -32.198 1.00 121.64 ? 494  ASP B CG  1 
ATOM   7954 O OD1 . ASP B 1 494 ? -14.114 24.949  -31.288 1.00 126.85 ? 494  ASP B OD1 1 
ATOM   7955 O OD2 . ASP B 1 494 ? -12.219 24.213  -32.110 1.00 119.93 ? 494  ASP B OD2 1 
ATOM   7956 N N   . SER B 1 495 ? -13.639 28.436  -31.127 1.00 110.75 ? 495  SER B N   1 
ATOM   7957 C CA  . SER B 1 495 ? -13.011 28.871  -29.896 1.00 112.23 ? 495  SER B CA  1 
ATOM   7958 C C   . SER B 1 495 ? -12.841 27.693  -28.944 1.00 120.23 ? 495  SER B C   1 
ATOM   7959 O O   . SER B 1 495 ? -11.885 26.925  -29.066 1.00 119.66 ? 495  SER B O   1 
ATOM   7960 C CB  . SER B 1 495 ? -13.830 29.971  -29.230 1.00 108.50 ? 495  SER B CB  1 
ATOM   7961 O OG  . SER B 1 495 ? -13.339 30.231  -27.928 1.00 105.28 ? 495  SER B OG  1 
ATOM   7962 N N   . LYS B 1 496 ? -13.794 27.538  -28.027 1.00 127.46 ? 496  LYS B N   1 
ATOM   7963 C CA  . LYS B 1 496 ? -13.663 26.605  -26.907 1.00 129.98 ? 496  LYS B CA  1 
ATOM   7964 C C   . LYS B 1 496 ? -12.444 25.687  -26.994 1.00 130.00 ? 496  LYS B C   1 
ATOM   7965 O O   . LYS B 1 496 ? -12.397 24.735  -27.783 1.00 127.81 ? 496  LYS B O   1 
ATOM   7966 C CB  . LYS B 1 496 ? -14.959 25.823  -26.648 1.00 130.15 ? 496  LYS B CB  1 
ATOM   7967 C CG  . LYS B 1 496 ? -14.990 25.117  -25.285 1.00 130.07 ? 496  LYS B CG  1 
ATOM   7968 C CD  . LYS B 1 496 ? -13.985 25.724  -24.281 1.00 126.59 ? 496  LYS B CD  1 
ATOM   7969 C CE  . LYS B 1 496 ? -14.430 27.062  -23.688 1.00 120.54 ? 496  LYS B CE  1 
ATOM   7970 N NZ  . LYS B 1 496 ? -15.144 26.890  -22.397 1.00 117.13 ? 496  LYS B NZ  1 
ATOM   7971 N N   . SER B 1 497 ? -11.464 26.026  -26.160 1.00 131.20 ? 497  SER B N   1 
ATOM   7972 C CA  . SER B 1 497 ? -10.178 25.346  -26.033 1.00 126.24 ? 497  SER B CA  1 
ATOM   7973 C C   . SER B 1 497 ? -10.299 23.824  -25.743 1.00 119.72 ? 497  SER B C   1 
ATOM   7974 O O   . SER B 1 497 ? -11.327 23.216  -26.060 1.00 130.00 ? 497  SER B O   1 
ATOM   7975 C CB  . SER B 1 497 ? -9.366  26.088  -24.960 1.00 118.22 ? 497  SER B CB  1 
ATOM   7976 O OG  . SER B 1 497 ? -10.201 26.583  -23.928 1.00 111.16 ? 497  SER B OG  1 
ATOM   7977 N N   . PRO B 1 498 ? -9.241  23.190  -25.190 1.00 100.02 ? 498  PRO B N   1 
ATOM   7978 C CA  . PRO B 1 498 ? -7.903  23.736  -24.948 1.00 85.25  ? 498  PRO B CA  1 
ATOM   7979 C C   . PRO B 1 498 ? -7.132  23.697  -26.261 1.00 65.40  ? 498  PRO B C   1 
ATOM   7980 O O   . PRO B 1 498 ? -7.355  22.797  -27.066 1.00 65.00  ? 498  PRO B O   1 
ATOM   7981 C CB  . PRO B 1 498 ? -7.298  22.769  -23.911 1.00 86.34  ? 498  PRO B CB  1 
ATOM   7982 C CG  . PRO B 1 498 ? -8.409  21.804  -23.546 1.00 87.51  ? 498  PRO B CG  1 
ATOM   7983 C CD  . PRO B 1 498 ? -9.332  21.798  -24.723 1.00 91.21  ? 498  PRO B CD  1 
ATOM   7984 N N   . GLN B 1 499 ? -6.272  24.683  -26.485 1.00 52.26  ? 499  GLN B N   1 
ATOM   7985 C CA  . GLN B 1 499 ? -5.481  24.741  -27.702 1.00 48.75  ? 499  GLN B CA  1 
ATOM   7986 C C   . GLN B 1 499 ? -4.256  23.816  -27.546 1.00 41.12  ? 499  GLN B C   1 
ATOM   7987 O O   . GLN B 1 499 ? -3.808  23.542  -26.443 1.00 35.11  ? 499  GLN B O   1 
ATOM   7988 C CB  . GLN B 1 499 ? -5.043  26.186  -27.995 1.00 48.59  ? 499  GLN B CB  1 
ATOM   7989 C CG  . GLN B 1 499 ? -6.186  27.207  -28.196 1.00 56.96  ? 499  GLN B CG  1 
ATOM   7990 C CD  . GLN B 1 499 ? -6.977  26.982  -29.484 1.00 57.60  ? 499  GLN B CD  1 
ATOM   7991 O OE1 . GLN B 1 499 ? -6.491  27.251  -30.583 1.00 50.50  ? 499  GLN B OE1 1 
ATOM   7992 N NE2 . GLN B 1 499 ? -8.210  26.504  -29.347 1.00 59.65  ? 499  GLN B NE2 1 
ATOM   7993 N N   . TRP B 1 500 ? -3.747  23.327  -28.662 1.00 38.07  ? 500  TRP B N   1 
ATOM   7994 C CA  . TRP B 1 500 ? -2.511  22.564  -28.689 1.00 37.44  ? 500  TRP B CA  1 
ATOM   7995 C C   . TRP B 1 500 ? -1.370  23.577  -28.823 1.00 34.58  ? 500  TRP B C   1 
ATOM   7996 O O   . TRP B 1 500 ? -1.236  24.194  -29.863 1.00 36.15  ? 500  TRP B O   1 
ATOM   7997 C CB  . TRP B 1 500 ? -2.542  21.659  -29.916 1.00 35.50  ? 500  TRP B CB  1 
ATOM   7998 C CG  . TRP B 1 500 ? -1.439  20.642  -30.030 1.00 31.91  ? 500  TRP B CG  1 
ATOM   7999 C CD1 . TRP B 1 500 ? -0.184  20.693  -29.475 1.00 34.50  ? 500  TRP B CD1 1 
ATOM   8000 C CD2 . TRP B 1 500 ? -1.497  19.429  -30.779 1.00 32.51  ? 500  TRP B CD2 1 
ATOM   8001 N NE1 . TRP B 1 500 ? 0.538   19.573  -29.835 1.00 30.75  ? 500  TRP B NE1 1 
ATOM   8002 C CE2 . TRP B 1 500 ? -0.247  18.786  -30.640 1.00 35.83  ? 500  TRP B CE2 1 
ATOM   8003 C CE3 . TRP B 1 500 ? -2.491  18.818  -31.558 1.00 38.48  ? 500  TRP B CE3 1 
ATOM   8004 C CZ2 . TRP B 1 500 ? 0.032   17.557  -31.252 1.00 35.82  ? 500  TRP B CZ2 1 
ATOM   8005 C CZ3 . TRP B 1 500 ? -2.207  17.598  -32.166 1.00 36.42  ? 500  TRP B CZ3 1 
ATOM   8006 C CH2 . TRP B 1 500 ? -0.961  16.983  -32.001 1.00 39.18  ? 500  TRP B CH2 1 
ATOM   8007 N N   . PRO B 1 501 ? -0.567  23.772  -27.763 1.00 34.97  ? 501  PRO B N   1 
ATOM   8008 C CA  . PRO B 1 501 ? 0.487   24.780  -27.883 1.00 33.11  ? 501  PRO B CA  1 
ATOM   8009 C C   . PRO B 1 501 ? 1.753   24.215  -28.556 1.00 35.67  ? 501  PRO B C   1 
ATOM   8010 O O   . PRO B 1 501 ? 1.992   23.006  -28.497 1.00 38.17  ? 501  PRO B O   1 
ATOM   8011 C CB  . PRO B 1 501 ? 0.744   25.165  -26.416 1.00 28.76  ? 501  PRO B CB  1 
ATOM   8012 C CG  . PRO B 1 501 ? 0.592   23.832  -25.695 1.00 29.35  ? 501  PRO B CG  1 
ATOM   8013 C CD  . PRO B 1 501 ? -0.692  23.288  -26.367 1.00 35.78  ? 501  PRO B CD  1 
ATOM   8014 N N   . PRO B 1 502 ? 2.542   25.086  -29.211 1.00 35.25  ? 502  PRO B N   1 
ATOM   8015 C CA  . PRO B 1 502 ? 3.829   24.653  -29.759 1.00 37.26  ? 502  PRO B CA  1 
ATOM   8016 C C   . PRO B 1 502 ? 4.727   24.080  -28.670 1.00 40.25  ? 502  PRO B C   1 
ATOM   8017 O O   . PRO B 1 502 ? 4.697   24.537  -27.526 1.00 41.54  ? 502  PRO B O   1 
ATOM   8018 C CB  . PRO B 1 502 ? 4.438   25.951  -30.299 1.00 35.07  ? 502  PRO B CB  1 
ATOM   8019 C CG  . PRO B 1 502 ? 3.247   26.827  -30.610 1.00 35.60  ? 502  PRO B CG  1 
ATOM   8020 C CD  . PRO B 1 502 ? 2.277   26.513  -29.483 1.00 35.35  ? 502  PRO B CD  1 
ATOM   8021 N N   . TYR B 1 503 ? 5.504   23.064  -29.033 1.00 34.65  ? 503  TYR B N   1 
ATOM   8022 C CA  . TYR B 1 503 ? 6.543   22.530  -28.180 1.00 35.52  ? 503  TYR B CA  1 
ATOM   8023 C C   . TYR B 1 503 ? 7.737   23.494  -28.235 1.00 37.98  ? 503  TYR B C   1 
ATOM   8024 O O   . TYR B 1 503 ? 8.165   23.876  -29.322 1.00 38.39  ? 503  TYR B O   1 
ATOM   8025 C CB  . TYR B 1 503 ? 6.965   21.138  -28.688 1.00 32.68  ? 503  TYR B CB  1 
ATOM   8026 C CG  . TYR B 1 503 ? 8.030   20.492  -27.829 1.00 37.92  ? 503  TYR B CG  1 
ATOM   8027 C CD1 . TYR B 1 503 ? 9.382   20.743  -28.053 1.00 35.18  ? 503  TYR B CD1 1 
ATOM   8028 C CD2 . TYR B 1 503 ? 7.678   19.656  -26.761 1.00 36.46  ? 503  TYR B CD2 1 
ATOM   8029 C CE1 . TYR B 1 503 ? 10.355  20.165  -27.255 1.00 35.12  ? 503  TYR B CE1 1 
ATOM   8030 C CE2 . TYR B 1 503 ? 8.635   19.080  -25.956 1.00 35.28  ? 503  TYR B CE2 1 
ATOM   8031 C CZ  . TYR B 1 503 ? 9.975   19.338  -26.204 1.00 39.20  ? 503  TYR B CZ  1 
ATOM   8032 O OH  . TYR B 1 503 ? 10.930  18.755  -25.407 1.00 43.61  ? 503  TYR B OH  1 
ATOM   8033 N N   . THR B 1 504 ? 8.264   23.882  -27.072 1.00 35.86  ? 504  THR B N   1 
ATOM   8034 C CA  . THR B 1 504 ? 9.416   24.786  -26.987 1.00 39.69  ? 504  THR B CA  1 
ATOM   8035 C C   . THR B 1 504 ? 10.455  24.209  -26.025 1.00 43.63  ? 504  THR B C   1 
ATOM   8036 O O   . THR B 1 504 ? 10.129  23.385  -25.174 1.00 39.26  ? 504  THR B O   1 
ATOM   8037 C CB  . THR B 1 504 ? 9.008   26.176  -26.434 1.00 42.20  ? 504  THR B CB  1 
ATOM   8038 O OG1 . THR B 1 504 ? 8.440   26.010  -25.126 1.00 43.59  ? 504  THR B OG1 1 
ATOM   8039 C CG2 . THR B 1 504 ? 7.982   26.864  -27.359 1.00 39.20  ? 504  THR B CG2 1 
ATOM   8040 N N   . THR B 1 505 ? 11.704  24.651  -26.121 1.00 42.49  ? 505  THR B N   1 
ATOM   8041 C CA  . THR B 1 505 ? 12.697  24.122  -25.184 1.00 42.59  ? 505  THR B CA  1 
ATOM   8042 C C   . THR B 1 505 ? 12.414  24.625  -23.762 1.00 43.15  ? 505  THR B C   1 
ATOM   8043 O O   . THR B 1 505 ? 12.622  23.899  -22.810 1.00 40.83  ? 505  THR B O   1 
ATOM   8044 C CB  . THR B 1 505 ? 14.179  24.428  -25.598 1.00 45.96  ? 505  THR B CB  1 
ATOM   8045 O OG1 . THR B 1 505 ? 14.388  25.840  -25.663 1.00 47.97  ? 505  THR B OG1 1 
ATOM   8046 C CG2 . THR B 1 505 ? 14.507  23.823  -26.953 1.00 41.81  ? 505  THR B CG2 1 
ATOM   8047 N N   . ALA B 1 506 ? 11.932  25.861  -23.633 1.00 39.23  ? 506  ALA B N   1 
ATOM   8048 C CA  . ALA B 1 506 ? 11.575  26.433  -22.325 1.00 48.12  ? 506  ALA B CA  1 
ATOM   8049 C C   . ALA B 1 506 ? 10.479  25.652  -21.562 1.00 58.89  ? 506  ALA B C   1 
ATOM   8050 O O   . ALA B 1 506 ? 10.709  25.177  -20.447 1.00 65.81  ? 506  ALA B O   1 
ATOM   8051 C CB  . ALA B 1 506 ? 11.166  27.908  -22.489 1.00 43.08  ? 506  ALA B CB  1 
ATOM   8052 N N   . ALA B 1 507 ? 9.300   25.506  -22.169 1.00 48.56  ? 507  ALA B N   1 
ATOM   8053 C CA  . ALA B 1 507 ? 8.146   24.935  -21.472 1.00 36.99  ? 507  ALA B CA  1 
ATOM   8054 C C   . ALA B 1 507 ? 7.893   23.462  -21.791 1.00 36.64  ? 507  ALA B C   1 
ATOM   8055 O O   . ALA B 1 507 ? 7.195   22.784  -21.050 1.00 39.44  ? 507  ALA B O   1 
ATOM   8056 C CB  . ALA B 1 507 ? 6.893   25.759  -21.756 1.00 39.97  ? 507  ALA B CB  1 
ATOM   8057 N N   . GLN B 1 508 ? 8.426   22.985  -22.913 1.00 37.19  ? 508  GLN B N   1 
ATOM   8058 C CA  . GLN B 1 508 ? 8.304   21.576  -23.289 1.00 37.36  ? 508  GLN B CA  1 
ATOM   8059 C C   . GLN B 1 508 ? 6.857   21.025  -23.287 1.00 38.51  ? 508  GLN B C   1 
ATOM   8060 O O   . GLN B 1 508 ? 6.600   19.880  -22.876 1.00 37.72  ? 508  GLN B O   1 
ATOM   8061 C CB  . GLN B 1 508 ? 9.240   20.731  -22.411 1.00 33.97  ? 508  GLN B CB  1 
ATOM   8062 C CG  . GLN B 1 508 ? 10.668  21.313  -22.325 1.00 42.97  ? 508  GLN B CG  1 
ATOM   8063 C CD  . GLN B 1 508 ? 11.575  20.543  -21.358 1.00 48.51  ? 508  GLN B CD  1 
ATOM   8064 O OE1 . GLN B 1 508 ? 11.622  19.309  -21.376 1.00 44.27  ? 508  GLN B OE1 1 
ATOM   8065 N NE2 . GLN B 1 508 ? 12.285  21.274  -20.504 1.00 44.63  ? 508  GLN B NE2 1 
ATOM   8066 N N   . GLN B 1 509 ? 5.913   21.823  -23.776 1.00 34.91  ? 509  GLN B N   1 
ATOM   8067 C CA  . GLN B 1 509 ? 4.510   21.390  -23.776 1.00 34.38  ? 509  GLN B CA  1 
ATOM   8068 C C   . GLN B 1 509 ? 4.169   20.427  -24.905 1.00 36.49  ? 509  GLN B C   1 
ATOM   8069 O O   . GLN B 1 509 ? 4.639   20.599  -26.029 1.00 36.41  ? 509  GLN B O   1 
ATOM   8070 C CB  . GLN B 1 509 ? 3.580   22.599  -23.837 1.00 32.13  ? 509  GLN B CB  1 
ATOM   8071 C CG  . GLN B 1 509 ? 3.665   23.483  -22.610 1.00 34.60  ? 509  GLN B CG  1 
ATOM   8072 C CD  . GLN B 1 509 ? 3.049   24.842  -22.854 1.00 42.05  ? 509  GLN B CD  1 
ATOM   8073 O OE1 . GLN B 1 509 ? 3.537   25.623  -23.682 1.00 39.09  ? 509  GLN B OE1 1 
ATOM   8074 N NE2 . GLN B 1 509 ? 1.977   25.136  -22.138 1.00 36.05  ? 509  GLN B NE2 1 
ATOM   8075 N N   . TYR B 1 510 ? 3.333   19.432  -24.586 1.00 31.38  ? 510  TYR B N   1 
ATOM   8076 C CA  . TYR B 1 510 ? 2.802   18.472  -25.551 1.00 29.98  ? 510  TYR B CA  1 
ATOM   8077 C C   . TYR B 1 510 ? 1.389   18.053  -25.120 1.00 35.25  ? 510  TYR B C   1 
ATOM   8078 O O   . TYR B 1 510 ? 0.945   18.372  -24.013 1.00 37.23  ? 510  TYR B O   1 
ATOM   8079 C CB  . TYR B 1 510 ? 3.726   17.243  -25.687 1.00 28.21  ? 510  TYR B CB  1 
ATOM   8080 C CG  . TYR B 1 510 ? 3.833   16.414  -24.430 1.00 34.12  ? 510  TYR B CG  1 
ATOM   8081 C CD1 . TYR B 1 510 ? 4.599   16.850  -23.340 1.00 32.29  ? 510  TYR B CD1 1 
ATOM   8082 C CD2 . TYR B 1 510 ? 3.170   15.185  -24.329 1.00 36.68  ? 510  TYR B CD2 1 
ATOM   8083 C CE1 . TYR B 1 510 ? 4.677   16.094  -22.162 1.00 35.63  ? 510  TYR B CE1 1 
ATOM   8084 C CE2 . TYR B 1 510 ? 3.252   14.411  -23.172 1.00 32.81  ? 510  TYR B CE2 1 
ATOM   8085 C CZ  . TYR B 1 510 ? 4.008   14.863  -22.106 1.00 34.00  ? 510  TYR B CZ  1 
ATOM   8086 O OH  . TYR B 1 510 ? 4.065   14.107  -20.980 1.00 36.98  ? 510  TYR B OH  1 
ATOM   8087 N N   . VAL B 1 511 ? 0.665   17.352  -25.981 1.00 30.31  ? 511  VAL B N   1 
ATOM   8088 C CA  . VAL B 1 511 ? -0.718  17.024  -25.632 1.00 26.79  ? 511  VAL B CA  1 
ATOM   8089 C C   . VAL B 1 511 ? -0.926  15.531  -25.659 1.00 38.88  ? 511  VAL B C   1 
ATOM   8090 O O   . VAL B 1 511 ? -0.224  14.825  -26.382 1.00 29.05  ? 511  VAL B O   1 
ATOM   8091 C CB  . VAL B 1 511 ? -1.738  17.677  -26.597 1.00 31.27  ? 511  VAL B CB  1 
ATOM   8092 C CG1 . VAL B 1 511 ? -1.604  19.210  -26.575 1.00 29.70  ? 511  VAL B CG1 1 
ATOM   8093 C CG2 . VAL B 1 511 ? -1.569  17.132  -28.022 1.00 32.34  ? 511  VAL B CG2 1 
ATOM   8094 N N   . SER B 1 512 ? -1.881  15.062  -24.858 1.00 37.11  ? 512  SER B N   1 
ATOM   8095 C CA  . SER B 1 512 ? -2.320  13.678  -24.892 1.00 37.91  ? 512  SER B CA  1 
ATOM   8096 C C   . SER B 1 512 ? -3.475  13.584  -25.879 1.00 40.73  ? 512  SER B C   1 
ATOM   8097 O O   . SER B 1 512 ? -4.430  14.370  -25.826 1.00 34.92  ? 512  SER B O   1 
ATOM   8098 C CB  . SER B 1 512 ? -2.767  13.206  -23.502 1.00 35.49  ? 512  SER B CB  1 
ATOM   8099 O OG  . SER B 1 512 ? -3.724  14.113  -22.950 1.00 45.66  ? 512  SER B OG  1 
ATOM   8100 N N   . LEU B 1 513 ? -3.358  12.645  -26.806 1.00 35.03  ? 513  LEU B N   1 
ATOM   8101 C CA  . LEU B 1 513 ? -4.436  12.319  -27.722 1.00 36.35  ? 513  LEU B CA  1 
ATOM   8102 C C   . LEU B 1 513 ? -5.136  11.056  -27.221 1.00 39.05  ? 513  LEU B C   1 
ATOM   8103 O O   . LEU B 1 513 ? -4.569  9.961   -27.251 1.00 38.07  ? 513  LEU B O   1 
ATOM   8104 C CB  . LEU B 1 513 ? -3.870  12.093  -29.125 1.00 35.42  ? 513  LEU B CB  1 
ATOM   8105 C CG  . LEU B 1 513 ? -3.186  13.323  -29.717 1.00 40.48  ? 513  LEU B CG  1 
ATOM   8106 C CD1 . LEU B 1 513 ? -2.619  13.027  -31.120 1.00 38.10  ? 513  LEU B CD1 1 
ATOM   8107 C CD2 . LEU B 1 513 ? -4.201  14.479  -29.761 1.00 35.44  ? 513  LEU B CD2 1 
ATOM   8108 N N   . ASN B 1 514 ? -6.355  11.221  -26.728 1.00 41.32  ? 514  ASN B N   1 
ATOM   8109 C CA  . ASN B 1 514 ? -7.182  10.091  -26.324 1.00 40.62  ? 514  ASN B CA  1 
ATOM   8110 C C   . ASN B 1 514 ? -8.653  10.485  -26.430 1.00 47.53  ? 514  ASN B C   1 
ATOM   8111 O O   . ASN B 1 514 ? -8.968  11.510  -27.047 1.00 45.57  ? 514  ASN B O   1 
ATOM   8112 C CB  . ASN B 1 514 ? -6.813  9.594   -24.913 1.00 42.20  ? 514  ASN B CB  1 
ATOM   8113 C CG  . ASN B 1 514 ? -6.886  10.688  -23.855 1.00 48.68  ? 514  ASN B CG  1 
ATOM   8114 O OD1 . ASN B 1 514 ? -7.802  11.511  -23.855 1.00 55.68  ? 514  ASN B OD1 1 
ATOM   8115 N ND2 . ASN B 1 514 ? -5.922  10.691  -22.938 1.00 48.52  ? 514  ASN B ND2 1 
ATOM   8116 N N   . LEU B 1 515 ? -9.550  9.694   -25.836 1.00 40.71  ? 515  LEU B N   1 
ATOM   8117 C CA  . LEU B 1 515 ? -10.979 9.952   -25.999 1.00 48.49  ? 515  LEU B CA  1 
ATOM   8118 C C   . LEU B 1 515 ? -11.407 11.250  -25.316 1.00 48.62  ? 515  LEU B C   1 
ATOM   8119 O O   . LEU B 1 515 ? -12.369 11.881  -25.732 1.00 56.51  ? 515  LEU B O   1 
ATOM   8120 C CB  . LEU B 1 515 ? -11.818 8.765   -25.515 1.00 49.25  ? 515  LEU B CB  1 
ATOM   8121 C CG  . LEU B 1 515 ? -11.548 7.471   -26.294 1.00 49.16  ? 515  LEU B CG  1 
ATOM   8122 C CD1 . LEU B 1 515 ? -12.384 6.322   -25.766 1.00 55.10  ? 515  LEU B CD1 1 
ATOM   8123 C CD2 . LEU B 1 515 ? -11.801 7.658   -27.795 1.00 45.04  ? 515  LEU B CD2 1 
ATOM   8124 N N   . LYS B 1 516 ? -10.669 11.660  -24.290 1.00 43.10  ? 516  LYS B N   1 
ATOM   8125 C CA  . LYS B 1 516 ? -10.958 12.913  -23.572 1.00 47.98  ? 516  LYS B CA  1 
ATOM   8126 C C   . LYS B 1 516 ? -10.379 14.137  -24.304 1.00 48.51  ? 516  LYS B C   1 
ATOM   8127 O O   . LYS B 1 516 ? -9.510  13.998  -25.159 1.00 45.94  ? 516  LYS B O   1 
ATOM   8128 C CB  . LYS B 1 516 ? -10.408 12.824  -22.149 1.00 52.71  ? 516  LYS B CB  1 
ATOM   8129 C CG  . LYS B 1 516 ? -10.798 11.530  -21.450 1.00 62.80  ? 516  LYS B CG  1 
ATOM   8130 C CD  . LYS B 1 516 ? -10.256 11.457  -20.033 1.00 77.17  ? 516  LYS B CD  1 
ATOM   8131 C CE  . LYS B 1 516 ? -8.830  10.943  -20.003 1.00 85.19  ? 516  LYS B CE  1 
ATOM   8132 N NZ  . LYS B 1 516 ? -8.344  10.787  -18.596 1.00 91.97  ? 516  LYS B NZ  1 
ATOM   8133 N N   . PRO B 1 517 ? -10.887 15.338  -24.003 1.00 54.52  ? 517  PRO B N   1 
ATOM   8134 C CA  . PRO B 1 517 ? -10.368 16.558  -24.645 1.00 51.59  ? 517  PRO B CA  1 
ATOM   8135 C C   . PRO B 1 517 ? -8.855  16.695  -24.472 1.00 48.20  ? 517  PRO B C   1 
ATOM   8136 O O   . PRO B 1 517 ? -8.324  16.155  -23.508 1.00 49.20  ? 517  PRO B O   1 
ATOM   8137 C CB  . PRO B 1 517 ? -11.066 17.675  -23.870 1.00 55.15  ? 517  PRO B CB  1 
ATOM   8138 C CG  . PRO B 1 517 ? -12.337 17.039  -23.353 1.00 55.22  ? 517  PRO B CG  1 
ATOM   8139 C CD  . PRO B 1 517 ? -11.988 15.617  -23.062 1.00 53.29  ? 517  PRO B CD  1 
ATOM   8140 N N   . LEU B 1 518 ? -8.181  17.406  -25.376 1.00 42.04  ? 518  LEU B N   1 
ATOM   8141 C CA  . LEU B 1 518 ? -6.738  17.591  -25.265 1.00 43.91  ? 518  LEU B CA  1 
ATOM   8142 C C   . LEU B 1 518 ? -6.369  18.016  -23.861 1.00 43.95  ? 518  LEU B C   1 
ATOM   8143 O O   . LEU B 1 518 ? -6.974  18.915  -23.297 1.00 39.63  ? 518  LEU B O   1 
ATOM   8144 C CB  . LEU B 1 518 ? -6.246  18.696  -26.198 1.00 41.18  ? 518  LEU B CB  1 
ATOM   8145 C CG  . LEU B 1 518 ? -6.149  18.482  -27.688 1.00 43.22  ? 518  LEU B CG  1 
ATOM   8146 C CD1 . LEU B 1 518 ? -5.613  19.748  -28.302 1.00 46.43  ? 518  LEU B CD1 1 
ATOM   8147 C CD2 . LEU B 1 518 ? -5.238  17.323  -27.983 1.00 41.78  ? 518  LEU B CD2 1 
ATOM   8148 N N   . GLU B 1 519 ? -5.333  17.408  -23.316 1.00 43.23  ? 519  GLU B N   1 
ATOM   8149 C CA  . GLU B 1 519 ? -4.752  17.908  -22.087 1.00 43.53  ? 519  GLU B CA  1 
ATOM   8150 C C   . GLU B 1 519 ? -3.286  18.254  -22.364 1.00 43.32  ? 519  GLU B C   1 
ATOM   8151 O O   . GLU B 1 519 ? -2.597  17.541  -23.097 1.00 41.69  ? 519  GLU B O   1 
ATOM   8152 C CB  . GLU B 1 519 ? -4.914  16.862  -20.985 1.00 44.04  ? 519  GLU B CB  1 
ATOM   8153 C CG  . GLU B 1 519 ? -3.861  16.849  -19.894 1.00 59.51  ? 519  GLU B CG  1 
ATOM   8154 C CD  . GLU B 1 519 ? -4.025  15.629  -18.983 1.00 70.61  ? 519  GLU B CD  1 
ATOM   8155 O OE1 . GLU B 1 519 ? -5.189  15.227  -18.740 1.00 78.66  ? 519  GLU B OE1 1 
ATOM   8156 O OE2 . GLU B 1 519 ? -3.005  15.075  -18.516 1.00 64.19  ? 519  GLU B OE2 1 
ATOM   8157 N N   . VAL B 1 520 ? -2.821  19.360  -21.799 1.00 36.40  ? 520  VAL B N   1 
ATOM   8158 C CA  . VAL B 1 520 ? -1.460  19.810  -22.032 1.00 38.91  ? 520  VAL B CA  1 
ATOM   8159 C C   . VAL B 1 520 ? -0.555  19.292  -20.926 1.00 35.83  ? 520  VAL B C   1 
ATOM   8160 O O   . VAL B 1 520 ? -0.896  19.373  -19.762 1.00 35.78  ? 520  VAL B O   1 
ATOM   8161 C CB  . VAL B 1 520 ? -1.383  21.347  -22.074 1.00 39.74  ? 520  VAL B CB  1 
ATOM   8162 C CG1 . VAL B 1 520 ? 0.076   21.803  -22.207 1.00 41.93  ? 520  VAL B CG1 1 
ATOM   8163 C CG2 . VAL B 1 520 ? -2.259  21.894  -23.227 1.00 36.95  ? 520  VAL B CG2 1 
ATOM   8164 N N   . ARG B 1 521 ? 0.596   18.745  -21.290 1.00 31.76  ? 521  ARG B N   1 
ATOM   8165 C CA  . ARG B 1 521 ? 1.557   18.282  -20.290 1.00 38.09  ? 521  ARG B CA  1 
ATOM   8166 C C   . ARG B 1 521 ? 2.887   18.909  -20.604 1.00 35.54  ? 521  ARG B C   1 
ATOM   8167 O O   . ARG B 1 521 ? 3.076   19.443  -21.703 1.00 34.00  ? 521  ARG B O   1 
ATOM   8168 C CB  . ARG B 1 521 ? 1.695   16.761  -20.337 1.00 38.62  ? 521  ARG B CB  1 
ATOM   8169 C CG  . ARG B 1 521 ? 0.400   16.051  -19.985 1.00 39.74  ? 521  ARG B CG  1 
ATOM   8170 C CD  . ARG B 1 521 ? 0.528   14.546  -20.065 1.00 41.45  ? 521  ARG B CD  1 
ATOM   8171 N NE  . ARG B 1 521 ? -0.792  13.921  -19.948 1.00 44.74  ? 521  ARG B NE  1 
ATOM   8172 C CZ  . ARG B 1 521 ? -1.063  12.674  -20.317 1.00 43.56  ? 521  ARG B CZ  1 
ATOM   8173 N NH1 . ARG B 1 521 ? -0.101  11.911  -20.835 1.00 35.54  ? 521  ARG B NH1 1 
ATOM   8174 N NH2 . ARG B 1 521 ? -2.292  12.195  -20.179 1.00 39.92  ? 521  ARG B NH2 1 
ATOM   8175 N N   . ARG B 1 522 ? 3.808   18.838  -19.650 1.00 32.71  ? 522  ARG B N   1 
ATOM   8176 C CA  . ARG B 1 522 ? 5.129   19.431  -19.814 1.00 37.21  ? 522  ARG B CA  1 
ATOM   8177 C C   . ARG B 1 522 ? 6.194   18.400  -19.532 1.00 37.44  ? 522  ARG B C   1 
ATOM   8178 O O   . ARG B 1 522 ? 6.162   17.731  -18.500 1.00 39.97  ? 522  ARG B O   1 
ATOM   8179 C CB  . ARG B 1 522 ? 5.301   20.665  -18.915 1.00 37.65  ? 522  ARG B CB  1 
ATOM   8180 C CG  . ARG B 1 522 ? 4.384   21.815  -19.343 1.00 44.12  ? 522  ARG B CG  1 
ATOM   8181 C CD  . ARG B 1 522 ? 4.441   23.043  -18.410 1.00 42.28  ? 522  ARG B CD  1 
ATOM   8182 N NE  . ARG B 1 522 ? 5.780   23.608  -18.301 1.00 44.29  ? 522  ARG B NE  1 
ATOM   8183 C CZ  . ARG B 1 522 ? 6.062   24.757  -17.685 1.00 50.74  ? 522  ARG B CZ  1 
ATOM   8184 N NH1 . ARG B 1 522 ? 5.087   25.485  -17.136 1.00 36.73  ? 522  ARG B NH1 1 
ATOM   8185 N NH2 . ARG B 1 522 ? 7.320   25.187  -17.630 1.00 46.91  ? 522  ARG B NH2 1 
ATOM   8186 N N   . GLY B 1 523 ? 7.128   18.266  -20.472 1.00 37.38  ? 523  GLY B N   1 
ATOM   8187 C CA  . GLY B 1 523 ? 8.266   17.394  -20.291 1.00 35.67  ? 523  GLY B CA  1 
ATOM   8188 C C   . GLY B 1 523 ? 7.922   16.005  -20.750 1.00 39.20  ? 523  GLY B C   1 
ATOM   8189 O O   . GLY B 1 523 ? 7.118   15.304  -20.133 1.00 44.15  ? 523  GLY B O   1 
ATOM   8190 N N   . LEU B 1 524 ? 8.510   15.629  -21.872 1.00 38.83  ? 524  LEU B N   1 
ATOM   8191 C CA  . LEU B 1 524 ? 8.299   14.315  -22.445 1.00 43.15  ? 524  LEU B CA  1 
ATOM   8192 C C   . LEU B 1 524 ? 9.339   13.386  -21.827 1.00 41.98  ? 524  LEU B C   1 
ATOM   8193 O O   . LEU B 1 524 ? 10.457  13.277  -22.336 1.00 45.27  ? 524  LEU B O   1 
ATOM   8194 C CB  . LEU B 1 524 ? 8.466   14.394  -23.963 1.00 47.88  ? 524  LEU B CB  1 
ATOM   8195 C CG  . LEU B 1 524 ? 7.988   13.235  -24.846 1.00 61.47  ? 524  LEU B CG  1 
ATOM   8196 C CD1 . LEU B 1 524 ? 6.632   12.696  -24.407 1.00 59.77  ? 524  LEU B CD1 1 
ATOM   8197 C CD2 . LEU B 1 524 ? 7.935   13.709  -26.293 1.00 65.14  ? 524  LEU B CD2 1 
ATOM   8198 N N   . ARG B 1 525 ? 8.978   12.753  -20.709 1.00 38.77  ? 525  ARG B N   1 
ATOM   8199 C CA  . ARG B 1 525 ? 9.903   11.880  -19.985 1.00 42.31  ? 525  ARG B CA  1 
ATOM   8200 C C   . ARG B 1 525 ? 11.223  12.600  -19.737 1.00 40.51  ? 525  ARG B C   1 
ATOM   8201 O O   . ARG B 1 525 ? 12.291  12.059  -20.015 1.00 37.09  ? 525  ARG B O   1 
ATOM   8202 C CB  . ARG B 1 525 ? 10.206  10.654  -20.824 1.00 42.80  ? 525  ARG B CB  1 
ATOM   8203 C CG  . ARG B 1 525 ? 9.029   9.789   -21.061 1.00 54.15  ? 525  ARG B CG  1 
ATOM   8204 C CD  . ARG B 1 525 ? 9.042   8.709   -20.058 1.00 63.09  ? 525  ARG B CD  1 
ATOM   8205 N NE  . ARG B 1 525 ? 8.760   7.426   -20.676 1.00 71.17  ? 525  ARG B NE  1 
ATOM   8206 C CZ  . ARG B 1 525 ? 7.615   7.133   -21.271 1.00 65.26  ? 525  ARG B CZ  1 
ATOM   8207 N NH1 . ARG B 1 525 ? 6.664   8.055   -21.342 1.00 62.00  ? 525  ARG B NH1 1 
ATOM   8208 N NH2 . ARG B 1 525 ? 7.431   5.923   -21.792 1.00 59.36  ? 525  ARG B NH2 1 
ATOM   8209 N N   . ALA B 1 526 ? 11.147  13.817  -19.231 1.00 38.14  ? 526  ALA B N   1 
ATOM   8210 C CA  . ALA B 1 526 ? 12.318  14.677  -19.185 1.00 40.69  ? 526  ALA B CA  1 
ATOM   8211 C C   . ALA B 1 526 ? 13.501  14.067  -18.424 1.00 37.57  ? 526  ALA B C   1 
ATOM   8212 O O   . ALA B 1 526 ? 14.616  14.127  -18.915 1.00 41.32  ? 526  ALA B O   1 
ATOM   8213 C CB  . ALA B 1 526 ? 11.956  16.053  -18.627 1.00 40.45  ? 526  ALA B CB  1 
ATOM   8214 N N   . GLN B 1 527 ? 13.259  13.488  -17.241 1.00 36.90  ? 527  GLN B N   1 
ATOM   8215 C CA  . GLN B 1 527 ? 14.348  12.975  -16.393 1.00 38.54  ? 527  GLN B CA  1 
ATOM   8216 C C   . GLN B 1 527 ? 15.006  11.791  -17.056 1.00 36.64  ? 527  GLN B C   1 
ATOM   8217 O O   . GLN B 1 527 ? 16.222  11.726  -17.177 1.00 37.82  ? 527  GLN B O   1 
ATOM   8218 C CB  . GLN B 1 527 ? 13.856  12.555  -14.991 1.00 35.85  ? 527  GLN B CB  1 
ATOM   8219 C CG  . GLN B 1 527 ? 13.455  13.709  -14.104 1.00 42.62  ? 527  GLN B CG  1 
ATOM   8220 C CD  . GLN B 1 527 ? 14.553  14.786  -13.996 1.00 48.15  ? 527  GLN B CD  1 
ATOM   8221 O OE1 . GLN B 1 527 ? 14.425  15.880  -14.565 1.00 48.97  ? 527  GLN B OE1 1 
ATOM   8222 N NE2 . GLN B 1 527 ? 15.632  14.476  -13.260 1.00 42.42  ? 527  GLN B NE2 1 
ATOM   8223 N N   . THR B 1 528 ? 14.181  10.847  -17.482 1.00 33.07  ? 528  THR B N   1 
ATOM   8224 C CA  . THR B 1 528 ? 14.659  9.624   -18.108 1.00 34.78  ? 528  THR B CA  1 
ATOM   8225 C C   . THR B 1 528 ? 15.324  9.930   -19.457 1.00 36.81  ? 528  THR B C   1 
ATOM   8226 O O   . THR B 1 528 ? 16.346  9.341   -19.791 1.00 43.28  ? 528  THR B O   1 
ATOM   8227 C CB  . THR B 1 528 ? 13.486  8.625   -18.269 1.00 41.80  ? 528  THR B CB  1 
ATOM   8228 O OG1 . THR B 1 528 ? 13.163  8.067   -16.985 1.00 45.87  ? 528  THR B OG1 1 
ATOM   8229 C CG2 . THR B 1 528 ? 13.822  7.504   -19.270 1.00 42.71  ? 528  THR B CG2 1 
ATOM   8230 N N   . CYS B 1 529 ? 14.786  10.879  -20.221 1.00 31.45  ? 529  CYS B N   1 
ATOM   8231 C CA  . CYS B 1 529 ? 15.408  11.153  -21.508 1.00 36.28  ? 529  CYS B CA  1 
ATOM   8232 C C   . CYS B 1 529 ? 16.737  11.874  -21.348 1.00 40.98  ? 529  CYS B C   1 
ATOM   8233 O O   . CYS B 1 529 ? 17.596  11.773  -22.234 1.00 31.34  ? 529  CYS B O   1 
ATOM   8234 C CB  . CYS B 1 529 ? 14.457  11.836  -22.510 1.00 30.87  ? 529  CYS B CB  1 
ATOM   8235 S SG  . CYS B 1 529 ? 13.186  10.640  -23.105 1.00 38.91  ? 529  CYS B SG  1 
ATOM   8236 N N   . ALA B 1 530 ? 16.906  12.582  -20.223 1.00 34.18  ? 530  ALA B N   1 
ATOM   8237 C CA  . ALA B 1 530 ? 18.202  13.191  -19.905 1.00 37.36  ? 530  ALA B CA  1 
ATOM   8238 C C   . ALA B 1 530 ? 19.284  12.109  -19.694 1.00 39.70  ? 530  ALA B C   1 
ATOM   8239 O O   . ALA B 1 530 ? 20.444  12.281  -20.082 1.00 38.38  ? 530  ALA B O   1 
ATOM   8240 C CB  . ALA B 1 530 ? 18.102  14.118  -18.669 1.00 32.22  ? 530  ALA B CB  1 
ATOM   8241 N N   . PHE B 1 531 ? 18.896  11.001  -19.073 1.00 37.17  ? 531  PHE B N   1 
ATOM   8242 C CA  . PHE B 1 531 ? 19.772  9.845   -18.960 1.00 39.31  ? 531  PHE B CA  1 
ATOM   8243 C C   . PHE B 1 531 ? 20.175  9.308   -20.348 1.00 39.82  ? 531  PHE B C   1 
ATOM   8244 O O   . PHE B 1 531 ? 21.369  9.161   -20.638 1.00 40.19  ? 531  PHE B O   1 
ATOM   8245 C CB  . PHE B 1 531 ? 19.106  8.743   -18.112 1.00 37.08  ? 531  PHE B CB  1 
ATOM   8246 C CG  . PHE B 1 531 ? 19.769  7.394   -18.241 1.00 41.04  ? 531  PHE B CG  1 
ATOM   8247 C CD1 . PHE B 1 531 ? 20.898  7.084   -17.492 1.00 44.95  ? 531  PHE B CD1 1 
ATOM   8248 C CD2 . PHE B 1 531 ? 19.272  6.439   -19.116 1.00 41.99  ? 531  PHE B CD2 1 
ATOM   8249 C CE1 . PHE B 1 531 ? 21.511  5.852   -17.601 1.00 45.41  ? 531  PHE B CE1 1 
ATOM   8250 C CE2 . PHE B 1 531 ? 19.890  5.212   -19.242 1.00 42.11  ? 531  PHE B CE2 1 
ATOM   8251 C CZ  . PHE B 1 531 ? 21.013  4.914   -18.471 1.00 45.08  ? 531  PHE B CZ  1 
ATOM   8252 N N   . TRP B 1 532 ? 19.192  9.013   -21.202 1.00 33.53  ? 532  TRP B N   1 
ATOM   8253 C CA  . TRP B 1 532 ? 19.498  8.540   -22.559 1.00 36.90  ? 532  TRP B CA  1 
ATOM   8254 C C   . TRP B 1 532 ? 20.258  9.556   -23.422 1.00 44.05  ? 532  TRP B C   1 
ATOM   8255 O O   . TRP B 1 532 ? 21.228  9.186   -24.094 1.00 40.11  ? 532  TRP B O   1 
ATOM   8256 C CB  . TRP B 1 532 ? 18.249  8.064   -23.307 1.00 36.98  ? 532  TRP B CB  1 
ATOM   8257 C CG  . TRP B 1 532 ? 17.632  6.828   -22.713 1.00 36.09  ? 532  TRP B CG  1 
ATOM   8258 C CD1 . TRP B 1 532 ? 16.521  6.767   -21.933 1.00 39.38  ? 532  TRP B CD1 1 
ATOM   8259 C CD2 . TRP B 1 532 ? 18.117  5.480   -22.826 1.00 31.38  ? 532  TRP B CD2 1 
ATOM   8260 N NE1 . TRP B 1 532 ? 16.262  5.462   -21.571 1.00 43.23  ? 532  TRP B NE1 1 
ATOM   8261 C CE2 . TRP B 1 532 ? 17.228  4.654   -22.105 1.00 32.43  ? 532  TRP B CE2 1 
ATOM   8262 C CE3 . TRP B 1 532 ? 19.207  4.892   -23.480 1.00 31.96  ? 532  TRP B CE3 1 
ATOM   8263 C CZ2 . TRP B 1 532 ? 17.392  3.270   -22.023 1.00 35.88  ? 532  TRP B CZ2 1 
ATOM   8264 C CZ3 . TRP B 1 532 ? 19.369  3.518   -23.403 1.00 31.51  ? 532  TRP B CZ3 1 
ATOM   8265 C CH2 . TRP B 1 532 ? 18.468  2.722   -22.678 1.00 39.85  ? 532  TRP B CH2 1 
ATOM   8266 N N   . ASN B 1 533 ? 19.840  10.824  -23.390 1.00 37.44  ? 533  ASN B N   1 
ATOM   8267 C CA  . ASN B 1 533 ? 20.342  11.796  -24.368 1.00 42.29  ? 533  ASN B CA  1 
ATOM   8268 C C   . ASN B 1 533 ? 21.621  12.496  -23.930 1.00 45.41  ? 533  ASN B C   1 
ATOM   8269 O O   . ASN B 1 533 ? 22.428  12.887  -24.764 1.00 46.71  ? 533  ASN B O   1 
ATOM   8270 C CB  . ASN B 1 533 ? 19.264  12.831  -24.771 1.00 41.27  ? 533  ASN B CB  1 
ATOM   8271 C CG  . ASN B 1 533 ? 18.029  12.181  -25.379 1.00 41.51  ? 533  ASN B CG  1 
ATOM   8272 O OD1 . ASN B 1 533 ? 18.080  11.043  -25.812 1.00 45.12  ? 533  ASN B OD1 1 
ATOM   8273 N ND2 . ASN B 1 533 ? 16.913  12.890  -25.378 1.00 35.54  ? 533  ASN B ND2 1 
ATOM   8274 N N   . ARG B 1 534 ? 21.810  12.631  -22.622 1.00 42.61  ? 534  ARG B N   1 
ATOM   8275 C CA  . ARG B 1 534 ? 22.957  13.357  -22.084 1.00 46.03  ? 534  ARG B CA  1 
ATOM   8276 C C   . ARG B 1 534 ? 23.977  12.460  -21.394 1.00 52.70  ? 534  ARG B C   1 
ATOM   8277 O O   . ARG B 1 534 ? 25.180  12.605  -21.606 1.00 57.90  ? 534  ARG B O   1 
ATOM   8278 C CB  . ARG B 1 534 ? 22.496  14.450  -21.115 1.00 45.17  ? 534  ARG B CB  1 
ATOM   8279 C CG  . ARG B 1 534 ? 21.632  15.524  -21.776 1.00 47.99  ? 534  ARG B CG  1 
ATOM   8280 C CD  . ARG B 1 534 ? 21.108  16.521  -20.754 1.00 52.21  ? 534  ARG B CD  1 
ATOM   8281 N NE  . ARG B 1 534 ? 20.044  17.329  -21.336 1.00 60.80  ? 534  ARG B NE  1 
ATOM   8282 C CZ  . ARG B 1 534 ? 20.178  18.600  -21.706 1.00 63.55  ? 534  ARG B CZ  1 
ATOM   8283 N NH1 . ARG B 1 534 ? 21.342  19.243  -21.538 1.00 54.26  ? 534  ARG B NH1 1 
ATOM   8284 N NH2 . ARG B 1 534 ? 19.133  19.229  -22.232 1.00 58.91  ? 534  ARG B NH2 1 
ATOM   8285 N N   . PHE B 1 535 ? 23.510  11.541  -20.561 1.00 43.85  ? 535  PHE B N   1 
ATOM   8286 C CA  . PHE B 1 535 ? 24.452  10.744  -19.808 1.00 42.19  ? 535  PHE B CA  1 
ATOM   8287 C C   . PHE B 1 535 ? 25.005  9.528   -20.553 1.00 35.73  ? 535  PHE B C   1 
ATOM   8288 O O   . PHE B 1 535 ? 26.205  9.312   -20.576 1.00 44.47  ? 535  PHE B O   1 
ATOM   8289 C CB  . PHE B 1 535 ? 23.893  10.311  -18.459 1.00 36.97  ? 535  PHE B CB  1 
ATOM   8290 C CG  . PHE B 1 535 ? 24.922  9.646   -17.593 1.00 38.32  ? 535  PHE B CG  1 
ATOM   8291 C CD1 . PHE B 1 535 ? 26.019  10.361  -17.136 1.00 36.28  ? 535  PHE B CD1 1 
ATOM   8292 C CD2 . PHE B 1 535 ? 24.822  8.310   -17.277 1.00 41.68  ? 535  PHE B CD2 1 
ATOM   8293 C CE1 . PHE B 1 535 ? 26.970  9.760   -16.339 1.00 39.97  ? 535  PHE B CE1 1 
ATOM   8294 C CE2 . PHE B 1 535 ? 25.766  7.710   -16.485 1.00 42.34  ? 535  PHE B CE2 1 
ATOM   8295 C CZ  . PHE B 1 535 ? 26.843  8.428   -16.024 1.00 40.55  ? 535  PHE B CZ  1 
ATOM   8296 N N   . LEU B 1 536 ? 24.124  8.732   -21.136 1.00 35.71  ? 536  LEU B N   1 
ATOM   8297 C CA  . LEU B 1 536 ? 24.532  7.518   -21.831 1.00 48.86  ? 536  LEU B CA  1 
ATOM   8298 C C   . LEU B 1 536 ? 25.717  7.750   -22.799 1.00 52.33  ? 536  LEU B C   1 
ATOM   8299 O O   . LEU B 1 536 ? 26.714  7.031   -22.743 1.00 50.14  ? 536  LEU B O   1 
ATOM   8300 C CB  . LEU B 1 536 ? 23.331  6.919   -22.556 1.00 57.88  ? 536  LEU B CB  1 
ATOM   8301 C CG  . LEU B 1 536 ? 23.135  5.409   -22.482 1.00 66.60  ? 536  LEU B CG  1 
ATOM   8302 C CD1 . LEU B 1 536 ? 23.650  4.755   -23.751 1.00 71.41  ? 536  LEU B CD1 1 
ATOM   8303 C CD2 . LEU B 1 536 ? 23.799  4.846   -21.241 1.00 71.57  ? 536  LEU B CD2 1 
ATOM   8304 N N   . PRO B 1 537 ? 25.619  8.758   -23.680 1.00 55.31  ? 537  PRO B N   1 
ATOM   8305 C CA  . PRO B 1 537 ? 26.747  9.009   -24.585 1.00 58.89  ? 537  PRO B CA  1 
ATOM   8306 C C   . PRO B 1 537 ? 28.094  9.140   -23.860 1.00 59.78  ? 537  PRO B C   1 
ATOM   8307 O O   . PRO B 1 537 ? 29.065  8.506   -24.284 1.00 58.39  ? 537  PRO B O   1 
ATOM   8308 C CB  . PRO B 1 537 ? 26.360  10.329  -25.264 1.00 55.90  ? 537  PRO B CB  1 
ATOM   8309 C CG  . PRO B 1 537 ? 24.893  10.305  -25.279 1.00 52.75  ? 537  PRO B CG  1 
ATOM   8310 C CD  . PRO B 1 537 ? 24.482  9.645   -23.977 1.00 53.89  ? 537  PRO B CD  1 
ATOM   8311 N N   . LYS B 1 538 ? 28.163  9.932   -22.791 1.00 57.10  ? 538  LYS B N   1 
ATOM   8312 C CA  . LYS B 1 538 ? 29.423  10.058  -22.052 1.00 56.31  ? 538  LYS B CA  1 
ATOM   8313 C C   . LYS B 1 538 ? 29.862  8.723   -21.453 1.00 54.43  ? 538  LYS B C   1 
ATOM   8314 O O   . LYS B 1 538 ? 31.023  8.337   -21.521 1.00 57.87  ? 538  LYS B O   1 
ATOM   8315 C CB  . LYS B 1 538 ? 29.308  11.104  -20.955 1.00 51.34  ? 538  LYS B CB  1 
ATOM   8316 C CG  . LYS B 1 538 ? 29.078  12.506  -21.468 1.00 54.92  ? 538  LYS B CG  1 
ATOM   8317 C CD  . LYS B 1 538 ? 28.736  13.420  -20.317 1.00 67.35  ? 538  LYS B CD  1 
ATOM   8318 C CE  . LYS B 1 538 ? 28.398  14.822  -20.787 1.00 74.31  ? 538  LYS B CE  1 
ATOM   8319 N NZ  . LYS B 1 538 ? 28.188  15.703  -19.597 1.00 81.19  ? 538  LYS B NZ  1 
ATOM   8320 N N   . LEU B 1 539 ? 28.920  8.011   -20.863 1.00 55.84  ? 539  LEU B N   1 
ATOM   8321 C CA  . LEU B 1 539 ? 29.256  6.758   -20.221 1.00 55.18  ? 539  LEU B CA  1 
ATOM   8322 C C   . LEU B 1 539 ? 29.827  5.787   -21.236 1.00 61.34  ? 539  LEU B C   1 
ATOM   8323 O O   . LEU B 1 539 ? 30.803  5.101   -20.943 1.00 61.86  ? 539  LEU B O   1 
ATOM   8324 C CB  . LEU B 1 539 ? 28.032  6.157   -19.553 1.00 48.53  ? 539  LEU B CB  1 
ATOM   8325 C CG  . LEU B 1 539 ? 28.299  4.866   -18.803 1.00 56.47  ? 539  LEU B CG  1 
ATOM   8326 C CD1 . LEU B 1 539 ? 29.267  5.146   -17.672 1.00 58.07  ? 539  LEU B CD1 1 
ATOM   8327 C CD2 . LEU B 1 539 ? 26.992  4.277   -18.283 1.00 60.60  ? 539  LEU B CD2 1 
ATOM   8328 N N   . LEU B 1 540 ? 29.216  5.727   -22.423 1.00 60.29  ? 540  LEU B N   1 
ATOM   8329 C CA  . LEU B 1 540 ? 29.688  4.834   -23.488 1.00 60.67  ? 540  LEU B CA  1 
ATOM   8330 C C   . LEU B 1 540 ? 31.080  5.218   -23.991 1.00 61.97  ? 540  LEU B C   1 
ATOM   8331 O O   . LEU B 1 540 ? 31.931  4.348   -24.158 1.00 54.70  ? 540  LEU B O   1 
ATOM   8332 C CB  . LEU B 1 540 ? 28.702  4.766   -24.659 1.00 60.97  ? 540  LEU B CB  1 
ATOM   8333 C CG  . LEU B 1 540 ? 27.474  3.862   -24.466 1.00 63.15  ? 540  LEU B CG  1 
ATOM   8334 C CD1 . LEU B 1 540 ? 26.427  4.059   -25.581 1.00 52.92  ? 540  LEU B CD1 1 
ATOM   8335 C CD2 . LEU B 1 540 ? 27.889  2.389   -24.344 1.00 60.44  ? 540  LEU B CD2 1 
ATOM   8336 N N   . SER B 1 541 ? 31.325  6.506   -24.225 1.00 59.50  ? 541  SER B N   1 
ATOM   8337 C CA  . SER B 1 541 ? 32.663  6.917   -24.643 1.00 62.28  ? 541  SER B CA  1 
ATOM   8338 C C   . SER B 1 541 ? 33.718  6.535   -23.591 1.00 71.88  ? 541  SER B C   1 
ATOM   8339 O O   . SER B 1 541 ? 34.735  5.918   -23.920 1.00 76.32  ? 541  SER B O   1 
ATOM   8340 C CB  . SER B 1 541 ? 32.712  8.405   -25.015 1.00 67.46  ? 541  SER B CB  1 
ATOM   8341 O OG  . SER B 1 541 ? 32.689  9.244   -23.880 1.00 78.03  ? 541  SER B OG  1 
ATOM   8342 N N   . ALA B 1 542 ? 33.462  6.868   -22.326 1.00 76.33  ? 542  ALA B N   1 
ATOM   8343 C CA  . ALA B 1 542 ? 34.324  6.433   -21.221 1.00 78.06  ? 542  ALA B CA  1 
ATOM   8344 C C   . ALA B 1 542 ? 34.356  4.905   -21.112 1.00 79.67  ? 542  ALA B C   1 
ATOM   8345 O O   . ALA B 1 542 ? 35.166  4.340   -20.379 1.00 75.46  ? 542  ALA B O   1 
ATOM   8346 C CB  . ALA B 1 542 ? 33.850  7.047   -19.904 1.00 77.20  ? 542  ALA B CB  1 
ATOM   8347 N N   . THR B 1 543 ? 33.459  4.262   -21.858 1.00 87.51  ? 543  THR B N   1 
ATOM   8348 C CA  . THR B 1 543 ? 33.267  2.807   -21.882 1.00 94.95  ? 543  THR B CA  1 
ATOM   8349 C C   . THR B 1 543 ? 32.800  2.247   -20.538 1.00 100.60 ? 543  THR B C   1 
ATOM   8350 O O   . THR B 1 543 ? 31.737  1.628   -20.454 1.00 99.46  ? 543  THR B O   1 
ATOM   8351 C CB  . THR B 1 543 ? 34.505  2.037   -22.431 1.00 78.85  ? 543  THR B CB  1 
ATOM   8352 O OG1 . THR B 1 543 ? 34.732  2.398   -23.801 1.00 76.53  ? 543  THR B OG1 1 
ATOM   8353 C CG2 . THR B 1 543 ? 34.279  0.536   -22.360 1.00 77.17  ? 543  THR B CG2 1 
ATOM   8354 N N   . ALA B 1 544 ? 33.451  2.416   -19.507 1.00 105.81 ? 544  ALA B N   1 
HETATM 8355 C C1  . NAG C 2 .   ? 23.951  35.518  -0.201  0.70 61.64  ? 601  NAG A C1  1 
HETATM 8356 C C2  . NAG C 2 .   ? 24.136  35.870  -1.680  0.70 63.12  ? 601  NAG A C2  1 
HETATM 8357 C C3  . NAG C 2 .   ? 25.440  35.324  -2.257  0.70 68.67  ? 601  NAG A C3  1 
HETATM 8358 C C4  . NAG C 2 .   ? 26.609  35.765  -1.401  0.70 71.77  ? 601  NAG A C4  1 
HETATM 8359 C C5  . NAG C 2 .   ? 26.377  35.375  0.051   0.70 67.78  ? 601  NAG A C5  1 
HETATM 8360 C C6  . NAG C 2 .   ? 27.494  35.933  0.931   0.70 69.14  ? 601  NAG A C6  1 
HETATM 8361 C C7  . NAG C 2 .   ? 22.230  36.330  -3.066  0.70 67.47  ? 601  NAG A C7  1 
HETATM 8362 C C8  . NAG C 2 .   ? 21.539  35.909  -4.336  0.70 69.20  ? 601  NAG A C8  1 
HETATM 8363 N N2  . NAG C 2 .   ? 22.994  35.430  -2.461  0.70 60.28  ? 601  NAG A N2  1 
HETATM 8364 O O3  . NAG C 2 .   ? 25.667  35.830  -3.553  0.70 68.87  ? 601  NAG A O3  1 
HETATM 8365 O O4  . NAG C 2 .   ? 27.788  35.178  -1.906  0.70 75.44  ? 601  NAG A O4  1 
HETATM 8366 O O5  . NAG C 2 .   ? 25.127  35.865  0.518   0.70 65.48  ? 601  NAG A O5  1 
HETATM 8367 O O6  . NAG C 2 .   ? 27.236  37.280  1.278   0.70 72.81  ? 601  NAG A O6  1 
HETATM 8368 O O7  . NAG C 2 .   ? 22.096  37.471  -2.619  0.70 71.71  ? 601  NAG A O7  1 
HETATM 8369 C C1  . NAG D 2 .   ? 11.753  33.606  25.931  0.50 76.80  ? 701  NAG A C1  1 
HETATM 8370 C C2  . NAG D 2 .   ? 13.112  34.208  25.571  0.50 74.43  ? 701  NAG A C2  1 
HETATM 8371 C C3  . NAG D 2 .   ? 13.410  35.481  26.358  0.50 76.88  ? 701  NAG A C3  1 
HETATM 8372 C C4  . NAG D 2 .   ? 12.229  36.437  26.277  0.50 77.86  ? 701  NAG A C4  1 
HETATM 8373 C C5  . NAG D 2 .   ? 10.949  35.728  26.693  0.50 79.78  ? 701  NAG A C5  1 
HETATM 8374 C C6  . NAG D 2 .   ? 9.755   36.676  26.594  0.50 80.72  ? 701  NAG A C6  1 
HETATM 8375 C C7  . NAG D 2 .   ? 14.870  32.775  24.723  0.50 66.88  ? 701  NAG A C7  1 
HETATM 8376 C C8  . NAG D 2 .   ? 15.839  31.660  24.984  0.50 63.43  ? 701  NAG A C8  1 
HETATM 8377 N N2  . NAG D 2 .   ? 14.172  33.231  25.761  0.50 67.96  ? 701  NAG A N2  1 
HETATM 8378 O O3  . NAG D 2 .   ? 14.556  36.112  25.829  0.50 75.79  ? 701  NAG A O3  1 
HETATM 8379 O O4  . NAG D 2 .   ? 12.440  37.548  27.121  0.50 77.96  ? 701  NAG A O4  1 
HETATM 8380 O O5  . NAG D 2 .   ? 10.725  34.578  25.899  0.50 78.04  ? 701  NAG A O5  1 
HETATM 8381 O O6  . NAG D 2 .   ? 9.835   37.424  25.401  0.50 80.47  ? 701  NAG A O6  1 
HETATM 8382 O O7  . NAG D 2 .   ? 14.744  33.226  23.587  0.50 69.69  ? 701  NAG A O7  1 
HETATM 8383 C C8  . HI6 E 3 .   ? 29.725  23.064  12.749  0.80 62.65  ? 1543 HI6 A C8  1 
HETATM 8384 O O2  . HI6 E 3 .   ? 29.489  22.096  13.786  0.80 67.64  ? 1543 HI6 A O2  1 
HETATM 8385 C C7  . HI6 E 3 .   ? 28.277  22.281  14.541  0.80 56.12  ? 1543 HI6 A C7  1 
HETATM 8386 N N2  . HI6 E 3 .   ? 27.726  20.977  14.965  0.80 47.84  ? 1543 HI6 A N2  1 
HETATM 8387 C C2  . HI6 E 3 .   ? 26.450  20.702  14.703  0.80 49.35  ? 1543 HI6 A C2  1 
HETATM 8388 C C1  . HI6 E 3 .   ? 25.658  21.723  14.001  0.80 51.71  ? 1543 HI6 A C1  1 
HETATM 8389 N N1  . HI6 E 3 .   ? 24.459  21.486  13.733  0.80 58.46  ? 1543 HI6 A N1  1 
HETATM 8390 O O1  . HI6 E 3 .   ? 23.749  22.482  13.073  0.80 71.17  ? 1543 HI6 A O1  1 
HETATM 8391 C C3  . HI6 E 3 .   ? 25.865  19.488  15.060  0.80 51.31  ? 1543 HI6 A C3  1 
HETATM 8392 C C4  . HI6 E 3 .   ? 26.621  18.528  15.719  0.80 55.90  ? 1543 HI6 A C4  1 
HETATM 8393 C C5  . HI6 E 3 .   ? 27.950  18.835  15.998  0.80 50.91  ? 1543 HI6 A C5  1 
HETATM 8394 C C6  . HI6 E 3 .   ? 28.473  20.065  15.604  0.80 48.60  ? 1543 HI6 A C6  1 
HETATM 8395 O O1  . P6G F 4 .   ? 16.418  11.458  -12.082 1.00 82.86  ? 1544 P6G A O1  1 
HETATM 8396 C C2  . P6G F 4 .   ? 17.333  10.860  -12.853 1.00 87.74  ? 1544 P6G A C2  1 
HETATM 8397 C C3  . P6G F 4 .   ? 17.931  11.520  -13.852 1.00 90.82  ? 1544 P6G A C3  1 
HETATM 8398 O O4  . P6G F 4 .   ? 18.934  10.841  -14.667 1.00 94.42  ? 1544 P6G A O4  1 
HETATM 8399 C C5  . P6G F 4 .   ? 20.019  11.551  -15.347 1.00 87.56  ? 1544 P6G A C5  1 
HETATM 8400 C C6  . P6G F 4 .   ? 21.285  11.119  -15.281 1.00 81.93  ? 1544 P6G A C6  1 
HETATM 8401 O O7  . P6G F 4 .   ? 21.642  9.933   -14.504 1.00 82.38  ? 1544 P6G A O7  1 
HETATM 8402 C C8  . P6G F 4 .   ? 22.996  9.404   -14.548 1.00 74.66  ? 1544 P6G A C8  1 
HETATM 8403 C C9  . P6G F 4 .   ? 23.346  8.201   -14.083 1.00 65.77  ? 1544 P6G A C9  1 
HETATM 8404 O O10 . P6G F 4 .   ? 22.411  7.300   -13.443 1.00 61.35  ? 1544 P6G A O10 1 
HETATM 8405 C C11 . P6G F 4 .   ? 22.532  5.901   -13.658 1.00 56.68  ? 1544 P6G A C11 1 
HETATM 8406 C C12 . P6G F 4 .   ? 22.248  5.110   -12.391 1.00 63.50  ? 1544 P6G A C12 1 
HETATM 8407 O O13 . P6G F 4 .   ? 20.988  5.455   -11.825 1.00 76.07  ? 1544 P6G A O13 1 
HETATM 8408 C C14 . P6G F 4 .   ? 20.384  4.568   -10.832 1.00 77.53  ? 1544 P6G A C14 1 
HETATM 8409 C C15 . P6G F 4 .   ? 19.338  4.941   -10.080 1.00 78.78  ? 1544 P6G A C15 1 
HETATM 8410 O O16 . P6G F 4 .   ? 18.728  6.268   -10.167 1.00 79.46  ? 1544 P6G A O16 1 
HETATM 8411 C C17 . P6G F 4 .   ? 17.625  6.532   -11.085 1.00 79.97  ? 1544 P6G A C17 1 
HETATM 8412 C C18 . P6G F 4 .   ? 16.369  6.238   -10.741 1.00 79.06  ? 1544 P6G A C18 1 
HETATM 8413 O O19 . P6G F 4 .   ? 15.347  6.471   -11.566 1.00 74.57  ? 1544 P6G A O19 1 
HETATM 8414 C C1  . PGE G 5 .   ? 16.298  13.459  -7.315  1.00 79.48  ? 1545 PGE A C1  1 
HETATM 8415 O O1  . PGE G 5 .   ? 16.080  13.631  -5.904  1.00 80.82  ? 1545 PGE A O1  1 
HETATM 8416 C C2  . PGE G 5 .   ? 15.048  13.926  -8.051  1.00 81.07  ? 1545 PGE A C2  1 
HETATM 8417 O O2  . PGE G 5 .   ? 15.402  14.753  -9.160  1.00 81.67  ? 1545 PGE A O2  1 
HETATM 8418 C C3  . PGE G 5 .   ? 16.168  15.882  -8.730  1.00 85.27  ? 1545 PGE A C3  1 
HETATM 8419 C C4  . PGE G 5 .   ? 15.421  16.676  -7.666  1.00 83.04  ? 1545 PGE A C4  1 
HETATM 8420 O O4  . PGE G 5 .   ? 15.220  18.994  -4.993  1.00 79.48  ? 1545 PGE A O4  1 
HETATM 8421 C C6  . PGE G 5 .   ? 15.814  17.842  -4.375  1.00 75.71  ? 1545 PGE A C6  1 
HETATM 8422 C C5  . PGE G 5 .   ? 15.765  16.656  -5.330  1.00 75.38  ? 1545 PGE A C5  1 
HETATM 8423 O O3  . PGE G 5 .   ? 16.315  17.015  -6.604  1.00 77.91  ? 1545 PGE A O3  1 
HETATM 8424 C C1  . NAG H 2 .   ? 5.155   -17.030 -21.783 0.70 90.60  ? 601  NAG B C1  1 
HETATM 8425 C C2  . NAG H 2 .   ? 5.838   -17.665 -20.567 0.70 96.29  ? 601  NAG B C2  1 
HETATM 8426 C C3  . NAG H 2 .   ? 7.324   -17.937 -20.785 0.70 95.43  ? 601  NAG B C3  1 
HETATM 8427 C C4  . NAG H 2 .   ? 7.578   -18.602 -22.122 0.70 95.44  ? 601  NAG B C4  1 
HETATM 8428 C C5  . NAG H 2 .   ? 6.948   -17.771 -23.229 0.70 93.80  ? 601  NAG B C5  1 
HETATM 8429 C C6  . NAG H 2 .   ? 7.189   -18.382 -24.612 0.70 94.41  ? 601  NAG B C6  1 
HETATM 8430 C C7  . NAG H 2 .   ? 6.601   -16.564 -18.504 0.70 101.42 ? 601  NAG B C7  1 
HETATM 8431 C C8  . NAG H 2 .   ? 7.234   -15.199 -18.539 0.70 90.15  ? 601  NAG B C8  1 
HETATM 8432 N N2  . NAG H 2 .   ? 5.645   -16.815 -19.401 0.70 100.11 ? 601  NAG B N2  1 
HETATM 8433 O O3  . NAG H 2 .   ? 7.811   -18.794 -19.782 0.70 97.39  ? 601  NAG B O3  1 
HETATM 8434 O O4  . NAG H 2 .   ? 8.972   -18.713 -22.308 0.70 95.81  ? 601  NAG B O4  1 
HETATM 8435 O O5  . NAG H 2 .   ? 5.558   -17.635 -23.002 0.70 93.70  ? 601  NAG B O5  1 
HETATM 8436 O O6  . NAG H 2 .   ? 6.822   -19.746 -24.647 0.70 94.77  ? 601  NAG B O6  1 
HETATM 8437 O O7  . NAG H 2 .   ? 6.960   -17.394 -17.666 0.70 107.64 ? 601  NAG B O7  1 
HETATM 8438 C C8  . HI6 I 3 .   ? 8.196   -6.807  -36.391 0.80 40.29  ? 1545 HI6 B C8  1 
HETATM 8439 O O2  . HI6 I 3 .   ? 7.361   -6.290  -37.437 0.80 60.42  ? 1545 HI6 B O2  1 
HETATM 8440 C C7  . HI6 I 3 .   ? 6.047   -5.801  -37.069 0.80 60.46  ? 1545 HI6 B C7  1 
HETATM 8441 N N2  . HI6 I 3 .   ? 5.741   -4.526  -37.768 0.80 57.38  ? 1545 HI6 B N2  1 
HETATM 8442 C C2  . HI6 I 3 .   ? 4.863   -3.622  -37.295 0.80 56.70  ? 1545 HI6 B C2  1 
HETATM 8443 C C1  . HI6 I 3 .   ? 4.117   -3.840  -36.051 0.80 65.46  ? 1545 HI6 B C1  1 
HETATM 8444 N N1  . HI6 I 3 .   ? 3.328   -2.923  -35.702 0.80 68.23  ? 1545 HI6 B N1  1 
HETATM 8445 O O1  . HI6 I 3 .   ? 2.585   -3.059  -34.533 0.80 69.90  ? 1545 HI6 B O1  1 
HETATM 8446 C C3  . HI6 I 3 .   ? 4.595   -2.420  -37.933 0.80 45.57  ? 1545 HI6 B C3  1 
HETATM 8447 C C4  . HI6 I 3 .   ? 5.232   -2.112  -39.109 0.80 43.17  ? 1545 HI6 B C4  1 
HETATM 8448 C C5  . HI6 I 3 .   ? 6.133   -3.046  -39.581 0.80 59.12  ? 1545 HI6 B C5  1 
HETATM 8449 C C6  . HI6 I 3 .   ? 6.375   -4.240  -38.901 0.80 58.92  ? 1545 HI6 B C6  1 
HETATM 8450 C C1  . PEG J 6 .   ? 2.345   -0.178  -18.477 1.00 97.71  ? 1546 PEG B C1  1 
HETATM 8451 O O1  . PEG J 6 .   ? 2.432   0.980   -17.646 1.00 97.91  ? 1546 PEG B O1  1 
HETATM 8452 C C2  . PEG J 6 .   ? 1.007   -0.178  -19.211 1.00 96.23  ? 1546 PEG B C2  1 
HETATM 8453 O O2  . PEG J 6 .   ? 0.561   -1.519  -19.403 1.00 91.16  ? 1546 PEG B O2  1 
HETATM 8454 C C3  . PEG J 6 .   ? -0.857  -1.585  -19.299 1.00 89.03  ? 1546 PEG B C3  1 
HETATM 8455 C C4  . PEG J 6 .   ? -1.221  -2.758  -18.399 1.00 89.97  ? 1546 PEG B C4  1 
HETATM 8456 O O4  . PEG J 6 .   ? -2.537  -2.569  -17.870 1.00 90.11  ? 1546 PEG B O4  1 
HETATM 8457 C C1  . PGE K 5 .   ? 9.480   4.008   -9.898  1.00 72.71  ? 1547 PGE B C1  1 
HETATM 8458 O O1  . PGE K 5 .   ? 8.905   5.277   -9.543  1.00 72.35  ? 1547 PGE B O1  1 
HETATM 8459 C C2  . PGE K 5 .   ? 10.886  4.224   -10.445 1.00 72.19  ? 1547 PGE B C2  1 
HETATM 8460 O O2  . PGE K 5 .   ? 11.088  3.466   -11.638 1.00 75.36  ? 1547 PGE B O2  1 
HETATM 8461 C C3  . PGE K 5 .   ? 12.108  4.039   -12.461 1.00 78.64  ? 1547 PGE B C3  1 
HETATM 8462 C C4  . PGE K 5 .   ? 11.565  4.454   -13.830 1.00 86.29  ? 1547 PGE B C4  1 
HETATM 8463 O O4  . PGE K 5 .   ? 8.820   1.855   -15.928 1.00 71.32  ? 1547 PGE B O4  1 
HETATM 8464 C C6  . PGE K 5 .   ? 9.045   3.252   -16.168 1.00 81.24  ? 1547 PGE B C6  1 
HETATM 8465 C C5  . PGE K 5 .   ? 10.463  3.694   -15.792 1.00 89.56  ? 1547 PGE B C5  1 
HETATM 8466 O O3  . PGE K 5 .   ? 10.796  3.397   -14.427 1.00 92.67  ? 1547 PGE B O3  1 
HETATM 8467 C C1  . PGE L 5 .   ? 33.006  10.934  -47.295 1.00 94.32  ? 1548 PGE B C1  1 
HETATM 8468 O O1  . PGE L 5 .   ? 32.617  12.070  -48.081 1.00 93.82  ? 1548 PGE B O1  1 
HETATM 8469 C C2  . PGE L 5 .   ? 31.760  10.251  -46.736 1.00 93.15  ? 1548 PGE B C2  1 
HETATM 8470 O O2  . PGE L 5 .   ? 32.022  9.751   -45.428 1.00 89.54  ? 1548 PGE B O2  1 
HETATM 8471 C C3  . PGE L 5 .   ? 30.947  10.053  -44.544 1.00 87.10  ? 1548 PGE B C3  1 
HETATM 8472 C C4  . PGE L 5 .   ? 30.825  11.570  -44.488 1.00 86.71  ? 1548 PGE B C4  1 
HETATM 8473 O O4  . PGE L 5 .   ? 32.333  15.063  -41.796 1.00 93.13  ? 1548 PGE B O4  1 
HETATM 8474 C C6  . PGE L 5 .   ? 31.898  13.698  -41.795 1.00 93.96  ? 1548 PGE B C6  1 
HETATM 8475 C C5  . PGE L 5 .   ? 31.161  13.407  -43.096 1.00 89.70  ? 1548 PGE B C5  1 
HETATM 8476 O O3  . PGE L 5 .   ? 30.782  12.031  -43.141 1.00 86.08  ? 1548 PGE B O3  1 
HETATM 8477 C C1  . PGE M 5 .   ? 33.110  -0.012  -32.867 1.00 85.80  ? 1549 PGE B C1  1 
HETATM 8478 O O1  . PGE M 5 .   ? 34.242  0.848   -33.042 1.00 80.50  ? 1549 PGE B O1  1 
HETATM 8479 C C2  . PGE M 5 .   ? 33.175  -1.179  -33.850 1.00 92.05  ? 1549 PGE B C2  1 
HETATM 8480 O O2  . PGE M 5 .   ? 31.840  -1.647  -34.026 1.00 98.98  ? 1549 PGE B O2  1 
HETATM 8481 C C3  . PGE M 5 .   ? 31.727  -3.064  -33.975 1.00 98.45  ? 1549 PGE B C3  1 
HETATM 8482 C C4  . PGE M 5 .   ? 30.748  -3.400  -32.859 1.00 98.05  ? 1549 PGE B C4  1 
HETATM 8483 O O4  . PGE M 5 .   ? 30.564  -3.506  -28.067 1.00 84.81  ? 1549 PGE B O4  1 
HETATM 8484 C C6  . PGE M 5 .   ? 31.428  -3.356  -29.202 1.00 90.96  ? 1549 PGE B C6  1 
HETATM 8485 C C5  . PGE M 5 .   ? 30.617  -3.517  -30.487 1.00 95.54  ? 1549 PGE B C5  1 
HETATM 8486 O O3  . PGE M 5 .   ? 31.347  -3.028  -31.615 1.00 98.51  ? 1549 PGE B O3  1 
HETATM 8487 O O   . HOH N 7 .   ? 31.215  11.561  51.475  1.00 55.85  ? 2001 HOH A O   1 
HETATM 8488 O O   . HOH N 7 .   ? 28.561  8.666   52.511  1.00 62.02  ? 2002 HOH A O   1 
HETATM 8489 O O   . HOH N 7 .   ? 29.269  18.039  56.031  1.00 62.28  ? 2003 HOH A O   1 
HETATM 8490 O O   . HOH N 7 .   ? 26.160  17.490  49.116  1.00 61.62  ? 2004 HOH A O   1 
HETATM 8491 O O   . HOH N 7 .   ? 41.611  1.122   39.476  1.00 50.59  ? 2005 HOH A O   1 
HETATM 8492 O O   . HOH N 7 .   ? 21.251  19.141  48.005  1.00 50.34  ? 2006 HOH A O   1 
HETATM 8493 O O   . HOH N 7 .   ? 24.220  19.262  50.279  1.00 66.79  ? 2007 HOH A O   1 
HETATM 8494 O O   . HOH N 7 .   ? 26.920  21.958  45.430  1.00 72.62  ? 2008 HOH A O   1 
HETATM 8495 O O   . HOH N 7 .   ? 25.294  9.178   52.541  1.00 46.83  ? 2009 HOH A O   1 
HETATM 8496 O O   . HOH N 7 .   ? 8.339   17.836  33.046  1.00 57.35  ? 2010 HOH A O   1 
HETATM 8497 O O   . HOH N 7 .   ? 24.049  8.483   48.257  1.00 39.79  ? 2011 HOH A O   1 
HETATM 8498 O O   . HOH N 7 .   ? 29.584  2.173   45.893  1.00 35.76  ? 2012 HOH A O   1 
HETATM 8499 O O   . HOH N 7 .   ? 39.167  5.042   49.001  1.00 56.52  ? 2013 HOH A O   1 
HETATM 8500 O O   . HOH N 7 .   ? 28.082  4.105   46.919  1.00 35.77  ? 2014 HOH A O   1 
HETATM 8501 O O   . HOH N 7 .   ? 36.584  2.759   45.745  1.00 42.13  ? 2015 HOH A O   1 
HETATM 8502 O O   . HOH N 7 .   ? 43.787  0.363   41.190  1.00 47.71  ? 2016 HOH A O   1 
HETATM 8503 O O   . HOH N 7 .   ? 33.165  0.988   44.155  1.00 43.60  ? 2017 HOH A O   1 
HETATM 8504 O O   . HOH N 7 .   ? 42.480  0.525   44.808  1.00 37.18  ? 2018 HOH A O   1 
HETATM 8505 O O   . HOH N 7 .   ? 39.400  3.463   45.192  1.00 38.07  ? 2019 HOH A O   1 
HETATM 8506 O O   . HOH N 7 .   ? 53.312  15.284  31.696  1.00 71.72  ? 2020 HOH A O   1 
HETATM 8507 O O   . HOH N 7 .   ? 37.895  7.737   50.150  1.00 66.93  ? 2021 HOH A O   1 
HETATM 8508 O O   . HOH N 7 .   ? 44.579  7.683   -4.548  1.00 67.76  ? 2022 HOH A O   1 
HETATM 8509 O O   . HOH N 7 .   ? 31.161  10.300  48.892  1.00 51.48  ? 2023 HOH A O   1 
HETATM 8510 O O   . HOH N 7 .   ? 47.637  5.741   46.851  1.00 69.34  ? 2024 HOH A O   1 
HETATM 8511 O O   . HOH N 7 .   ? 26.303  19.508  46.477  1.00 70.16  ? 2025 HOH A O   1 
HETATM 8512 O O   . HOH N 7 .   ? 48.402  0.417   20.309  1.00 65.29  ? 2026 HOH A O   1 
HETATM 8513 O O   . HOH N 7 .   ? 13.220  21.208  43.271  1.00 69.52  ? 2027 HOH A O   1 
HETATM 8514 O O   . HOH N 7 .   ? 23.213  19.810  45.864  1.00 41.73  ? 2028 HOH A O   1 
HETATM 8515 O O   . HOH N 7 .   ? 39.344  15.448  38.863  1.00 55.83  ? 2029 HOH A O   1 
HETATM 8516 O O   . HOH N 7 .   ? 37.972  22.561  36.519  1.00 78.74  ? 2030 HOH A O   1 
HETATM 8517 O O   . HOH N 7 .   ? 19.514  23.526  38.899  1.00 45.47  ? 2031 HOH A O   1 
HETATM 8518 O O   . HOH N 7 .   ? 10.835  17.412  34.521  1.00 46.05  ? 2032 HOH A O   1 
HETATM 8519 O O   . HOH N 7 .   ? 21.422  25.234  23.346  1.00 53.13  ? 2033 HOH A O   1 
HETATM 8520 O O   . HOH N 7 .   ? 38.253  4.116   34.313  1.00 48.76  ? 2034 HOH A O   1 
HETATM 8521 O O   . HOH N 7 .   ? 40.686  12.568  33.390  1.00 34.73  ? 2035 HOH A O   1 
HETATM 8522 O O   . HOH N 7 .   ? 45.707  10.876  37.825  1.00 70.90  ? 2036 HOH A O   1 
HETATM 8523 O O   . HOH N 7 .   ? 48.747  11.845  32.723  1.00 53.99  ? 2037 HOH A O   1 
HETATM 8524 O O   . HOH N 7 .   ? 51.146  12.569  31.273  1.00 56.91  ? 2038 HOH A O   1 
HETATM 8525 O O   . HOH N 7 .   ? 50.411  17.582  25.860  1.00 54.94  ? 2039 HOH A O   1 
HETATM 8526 O O   . HOH N 7 .   ? 54.663  13.467  29.983  1.00 64.05  ? 2040 HOH A O   1 
HETATM 8527 O O   . HOH N 7 .   ? 53.673  8.004   28.299  1.00 62.50  ? 2041 HOH A O   1 
HETATM 8528 O O   . HOH N 7 .   ? 52.751  9.485   21.466  1.00 38.53  ? 2042 HOH A O   1 
HETATM 8529 O O   . HOH N 7 .   ? 33.465  28.532  -7.576  1.00 49.81  ? 2043 HOH A O   1 
HETATM 8530 O O   . HOH N 7 .   ? 46.949  7.663   17.685  1.00 36.60  ? 2044 HOH A O   1 
HETATM 8531 O O   . HOH N 7 .   ? 23.894  20.294  30.904  1.00 46.49  ? 2045 HOH A O   1 
HETATM 8532 O O   . HOH N 7 .   ? 19.241  25.450  24.698  1.00 60.08  ? 2046 HOH A O   1 
HETATM 8533 O O   . HOH N 7 .   ? 34.087  27.598  -9.979  1.00 56.27  ? 2047 HOH A O   1 
HETATM 8534 O O   . HOH N 7 .   ? 33.684  31.909  -10.141 1.00 72.98  ? 2048 HOH A O   1 
HETATM 8535 O O   . HOH N 7 .   ? 32.938  35.460  -7.701  1.00 75.27  ? 2049 HOH A O   1 
HETATM 8536 O O   . HOH N 7 .   ? 46.936  8.520   26.914  1.00 49.32  ? 2050 HOH A O   1 
HETATM 8537 O O   . HOH N 7 .   ? 48.869  4.550   26.791  1.00 54.61  ? 2051 HOH A O   1 
HETATM 8538 O O   . HOH N 7 .   ? 40.750  12.083  -6.914  1.00 63.63  ? 2052 HOH A O   1 
HETATM 8539 O O   . HOH N 7 .   ? 43.334  10.439  -4.079  1.00 59.70  ? 2053 HOH A O   1 
HETATM 8540 O O   . HOH N 7 .   ? 45.431  8.154   29.449  1.00 39.15  ? 2054 HOH A O   1 
HETATM 8541 O O   . HOH N 7 .   ? 41.973  13.286  35.929  1.00 46.30  ? 2055 HOH A O   1 
HETATM 8542 O O   . HOH N 7 .   ? 42.802  13.071  40.710  1.00 68.54  ? 2056 HOH A O   1 
HETATM 8543 O O   . HOH N 7 .   ? 44.829  9.707   41.025  1.00 63.42  ? 2057 HOH A O   1 
HETATM 8544 O O   . HOH N 7 .   ? 46.240  5.991   43.002  1.00 52.78  ? 2058 HOH A O   1 
HETATM 8545 O O   . HOH N 7 .   ? 45.398  7.557   46.422  1.00 64.64  ? 2059 HOH A O   1 
HETATM 8546 O O   . HOH N 7 .   ? 40.097  5.737   46.428  1.00 43.53  ? 2060 HOH A O   1 
HETATM 8547 O O   . HOH N 7 .   ? 39.949  14.341  45.442  1.00 55.53  ? 2061 HOH A O   1 
HETATM 8548 O O   . HOH N 7 .   ? 38.382  8.556   47.596  1.00 50.13  ? 2062 HOH A O   1 
HETATM 8549 O O   . HOH N 7 .   ? 39.744  16.301  46.759  1.00 55.68  ? 2063 HOH A O   1 
HETATM 8550 O O   . HOH N 7 .   ? 37.539  14.967  50.941  1.00 63.50  ? 2064 HOH A O   1 
HETATM 8551 O O   . HOH N 7 .   ? 36.655  17.911  40.691  1.00 52.82  ? 2065 HOH A O   1 
HETATM 8552 O O   . HOH N 7 .   ? 61.735  5.128   22.312  1.00 67.82  ? 2066 HOH A O   1 
HETATM 8553 O O   . HOH N 7 .   ? 45.829  0.811   20.241  1.00 52.59  ? 2067 HOH A O   1 
HETATM 8554 O O   . HOH N 7 .   ? 26.105  23.107  38.354  1.00 63.77  ? 2068 HOH A O   1 
HETATM 8555 O O   . HOH N 7 .   ? 32.482  16.933  32.562  1.00 32.35  ? 2069 HOH A O   1 
HETATM 8556 O O   . HOH N 7 .   ? 36.888  16.606  38.254  1.00 42.30  ? 2070 HOH A O   1 
HETATM 8557 O O   . HOH N 7 .   ? 32.901  19.141  29.166  1.00 38.21  ? 2071 HOH A O   1 
HETATM 8558 O O   . HOH N 7 .   ? 33.468  -4.843  35.171  1.00 54.63  ? 2072 HOH A O   1 
HETATM 8559 O O   . HOH N 7 .   ? 36.346  23.336  33.748  1.00 67.82  ? 2073 HOH A O   1 
HETATM 8560 O O   . HOH N 7 .   ? 27.145  -6.977  35.201  1.00 48.66  ? 2074 HOH A O   1 
HETATM 8561 O O   . HOH N 7 .   ? 45.651  27.881  24.084  1.00 61.62  ? 2075 HOH A O   1 
HETATM 8562 O O   . HOH N 7 .   ? 40.895  17.018  21.522  1.00 35.41  ? 2076 HOH A O   1 
HETATM 8563 O O   . HOH N 7 .   ? 42.326  17.476  23.709  1.00 38.44  ? 2077 HOH A O   1 
HETATM 8564 O O   . HOH N 7 .   ? 41.502  19.264  17.928  1.00 32.89  ? 2078 HOH A O   1 
HETATM 8565 O O   . HOH N 7 .   ? 24.763  -6.942  37.091  1.00 48.04  ? 2079 HOH A O   1 
HETATM 8566 O O   . HOH N 7 .   ? 14.892  -3.119  32.487  1.00 67.48  ? 2080 HOH A O   1 
HETATM 8567 O O   . HOH N 7 .   ? 17.303  -5.908  30.078  1.00 61.95  ? 2081 HOH A O   1 
HETATM 8568 O O   . HOH N 7 .   ? 40.710  26.506  19.268  1.00 45.96  ? 2082 HOH A O   1 
HETATM 8569 O O   . HOH N 7 .   ? 34.076  23.634  18.601  1.00 38.29  ? 2083 HOH A O   1 
HETATM 8570 O O   . HOH N 7 .   ? 40.042  27.680  17.024  1.00 42.75  ? 2084 HOH A O   1 
HETATM 8571 O O   . HOH N 7 .   ? 33.592  26.233  11.225  1.00 64.10  ? 2085 HOH A O   1 
HETATM 8572 O O   . HOH N 7 .   ? 29.381  25.793  15.602  1.00 46.99  ? 2086 HOH A O   1 
HETATM 8573 O O   . HOH N 7 .   ? 21.537  34.498  17.620  1.00 57.04  ? 2087 HOH A O   1 
HETATM 8574 O O   . HOH N 7 .   ? 24.026  23.717  23.599  1.00 40.04  ? 2088 HOH A O   1 
HETATM 8575 O O   . HOH N 7 .   ? 38.854  9.190   2.329   1.00 47.53  ? 2089 HOH A O   1 
HETATM 8576 O O   . HOH N 7 .   ? 37.331  8.090   0.460   1.00 65.48  ? 2090 HOH A O   1 
HETATM 8577 O O   . HOH N 7 .   ? 31.952  21.868  21.626  1.00 36.23  ? 2091 HOH A O   1 
HETATM 8578 O O   . HOH N 7 .   ? 29.432  20.712  19.038  1.00 32.94  ? 2092 HOH A O   1 
HETATM 8579 O O   . HOH N 7 .   ? 31.621  24.000  16.776  1.00 48.29  ? 2093 HOH A O   1 
HETATM 8580 O O   . HOH N 7 .   ? 27.855  25.996  23.958  1.00 54.07  ? 2094 HOH A O   1 
HETATM 8581 O O   . HOH N 7 .   ? 42.307  7.171   -0.132  1.00 50.15  ? 2095 HOH A O   1 
HETATM 8582 O O   . HOH N 7 .   ? 53.279  5.683   -0.605  1.00 76.65  ? 2096 HOH A O   1 
HETATM 8583 O O   . HOH N 7 .   ? 53.165  11.454  2.279   1.00 45.16  ? 2097 HOH A O   1 
HETATM 8584 O O   . HOH N 7 .   ? 29.324  23.112  35.252  1.00 49.72  ? 2098 HOH A O   1 
HETATM 8585 O O   . HOH N 7 .   ? 35.969  27.362  25.890  1.00 44.95  ? 2099 HOH A O   1 
HETATM 8586 O O   . HOH N 7 .   ? 50.361  22.000  1.321   1.00 70.22  ? 2100 HOH A O   1 
HETATM 8587 O O   . HOH N 7 .   ? 35.945  25.597  32.853  1.00 48.60  ? 2101 HOH A O   1 
HETATM 8588 O O   . HOH N 7 .   ? 42.109  23.375  33.398  1.00 64.88  ? 2102 HOH A O   1 
HETATM 8589 O O   . HOH N 7 .   ? 60.559  15.727  12.603  1.00 67.04  ? 2103 HOH A O   1 
HETATM 8590 O O   . HOH N 7 .   ? 39.224  28.011  26.875  1.00 44.66  ? 2104 HOH A O   1 
HETATM 8591 O O   . HOH N 7 .   ? 44.407  22.412  31.949  1.00 80.29  ? 2105 HOH A O   1 
HETATM 8592 O O   . HOH N 7 .   ? 46.013  14.934  24.188  1.00 31.04  ? 2106 HOH A O   1 
HETATM 8593 O O   . HOH N 7 .   ? 43.332  15.439  24.880  1.00 37.33  ? 2107 HOH A O   1 
HETATM 8594 O O   . HOH N 7 .   ? 43.418  20.313  34.185  1.00 74.82  ? 2108 HOH A O   1 
HETATM 8595 O O   . HOH N 7 .   ? 41.880  13.861  31.438  1.00 29.95  ? 2109 HOH A O   1 
HETATM 8596 O O   . HOH N 7 .   ? 47.157  17.380  33.494  1.00 62.74  ? 2110 HOH A O   1 
HETATM 8597 O O   . HOH N 7 .   ? 49.271  25.179  4.355   1.00 56.62  ? 2111 HOH A O   1 
HETATM 8598 O O   . HOH N 7 .   ? 40.458  24.769  0.149   1.00 71.05  ? 2112 HOH A O   1 
HETATM 8599 O O   . HOH N 7 .   ? 17.540  12.428  49.888  1.00 56.30  ? 2113 HOH A O   1 
HETATM 8600 O O   . HOH N 7 .   ? 12.992  9.079   42.140  1.00 63.59  ? 2114 HOH A O   1 
HETATM 8601 O O   . HOH N 7 .   ? 23.163  3.624   47.273  1.00 50.44  ? 2115 HOH A O   1 
HETATM 8602 O O   . HOH N 7 .   ? 41.340  0.520   4.277   1.00 48.47  ? 2116 HOH A O   1 
HETATM 8603 O O   . HOH N 7 .   ? 13.858  2.082   37.928  1.00 66.99  ? 2117 HOH A O   1 
HETATM 8604 O O   . HOH N 7 .   ? 29.237  12.417  24.688  1.00 28.50  ? 2118 HOH A O   1 
HETATM 8605 O O   . HOH N 7 .   ? 35.188  17.313  24.383  1.00 31.29  ? 2119 HOH A O   1 
HETATM 8606 O O   . HOH N 7 .   ? 25.978  15.479  18.457  1.00 26.34  ? 2120 HOH A O   1 
HETATM 8607 O O   . HOH N 7 .   ? 12.537  24.167  2.329   1.00 56.46  ? 2121 HOH A O   1 
HETATM 8608 O O   . HOH N 7 .   ? 33.322  24.157  13.052  1.00 55.73  ? 2122 HOH A O   1 
HETATM 8609 O O   . HOH N 7 .   ? 30.866  21.216  16.650  1.00 45.90  ? 2123 HOH A O   1 
HETATM 8610 O O   . HOH N 7 .   ? 32.955  14.777  17.160  1.00 26.30  ? 2124 HOH A O   1 
HETATM 8611 O O   . HOH N 7 .   ? 30.803  29.014  -7.379  1.00 47.36  ? 2125 HOH A O   1 
HETATM 8612 O O   . HOH N 7 .   ? 25.009  18.636  28.880  1.00 35.90  ? 2126 HOH A O   1 
HETATM 8613 O O   . HOH N 7 .   ? 29.441  31.715  -11.042 1.00 52.25  ? 2127 HOH A O   1 
HETATM 8614 O O   . HOH N 7 .   ? 25.161  22.730  30.064  1.00 43.70  ? 2128 HOH A O   1 
HETATM 8615 O O   . HOH N 7 .   ? 19.334  25.772  27.212  1.00 66.27  ? 2129 HOH A O   1 
HETATM 8616 O O   . HOH N 7 .   ? 32.098  27.917  -11.611 1.00 47.12  ? 2130 HOH A O   1 
HETATM 8617 O O   . HOH N 7 .   ? 29.879  25.921  -15.114 1.00 47.82  ? 2131 HOH A O   1 
HETATM 8618 O O   . HOH N 7 .   ? 29.935  33.318  -9.190  1.00 72.55  ? 2132 HOH A O   1 
HETATM 8619 O O   . HOH N 7 .   ? 34.165  24.382  -9.857  1.00 54.11  ? 2133 HOH A O   1 
HETATM 8620 O O   . HOH N 7 .   ? 28.799  18.217  19.990  1.00 29.40  ? 2134 HOH A O   1 
HETATM 8621 O O   . HOH N 7 .   ? 19.710  22.140  29.021  1.00 54.31  ? 2135 HOH A O   1 
HETATM 8622 O O   . HOH N 7 .   ? 22.512  19.165  33.800  1.00 54.58  ? 2136 HOH A O   1 
HETATM 8623 O O   . HOH N 7 .   ? 17.573  14.899  29.158  1.00 30.95  ? 2137 HOH A O   1 
HETATM 8624 O O   . HOH N 7 .   ? 36.393  7.218   -4.019  1.00 60.46  ? 2138 HOH A O   1 
HETATM 8625 O O   . HOH N 7 .   ? 40.799  10.377  -3.760  1.00 54.54  ? 2139 HOH A O   1 
HETATM 8626 O O   . HOH N 7 .   ? 21.693  23.742  36.445  1.00 58.89  ? 2140 HOH A O   1 
HETATM 8627 O O   . HOH N 7 .   ? 18.079  24.942  34.582  1.00 81.16  ? 2141 HOH A O   1 
HETATM 8628 O O   . HOH N 7 .   ? 12.392  10.223  38.052  1.00 53.19  ? 2142 HOH A O   1 
HETATM 8629 O O   . HOH N 7 .   ? 8.136   11.427  28.024  1.00 51.58  ? 2143 HOH A O   1 
HETATM 8630 O O   . HOH N 7 .   ? 14.008  4.704   37.262  1.00 51.43  ? 2144 HOH A O   1 
HETATM 8631 O O   . HOH N 7 .   ? 25.581  15.045  28.104  1.00 35.59  ? 2145 HOH A O   1 
HETATM 8632 O O   . HOH N 7 .   ? 31.741  16.832  29.710  1.00 26.53  ? 2146 HOH A O   1 
HETATM 8633 O O   . HOH N 7 .   ? 23.721  -1.663  -0.661  1.00 74.40  ? 2147 HOH A O   1 
HETATM 8634 O O   . HOH N 7 .   ? 14.488  -11.867 6.857   1.00 72.27  ? 2148 HOH A O   1 
HETATM 8635 O O   . HOH N 7 .   ? 43.609  18.823  16.269  1.00 34.45  ? 2149 HOH A O   1 
HETATM 8636 O O   . HOH N 7 .   ? 45.988  12.743  22.435  1.00 34.05  ? 2150 HOH A O   1 
HETATM 8637 O O   . HOH N 7 .   ? 42.457  7.593   13.782  1.00 29.27  ? 2151 HOH A O   1 
HETATM 8638 O O   . HOH N 7 .   ? 49.664  0.270   15.873  1.00 60.86  ? 2152 HOH A O   1 
HETATM 8639 O O   . HOH N 7 .   ? 56.846  3.304   15.704  1.00 55.88  ? 2153 HOH A O   1 
HETATM 8640 O O   . HOH N 7 .   ? 58.952  4.967   21.646  1.00 65.79  ? 2154 HOH A O   1 
HETATM 8641 O O   . HOH N 7 .   ? 44.011  1.864   18.224  1.00 46.30  ? 2155 HOH A O   1 
HETATM 8642 O O   . HOH N 7 .   ? 40.021  1.805   25.665  1.00 45.74  ? 2156 HOH A O   1 
HETATM 8643 O O   . HOH N 7 .   ? 40.234  -1.964  23.512  1.00 53.69  ? 2157 HOH A O   1 
HETATM 8644 O O   . HOH N 7 .   ? 9.602   -5.617  28.623  1.00 80.24  ? 2158 HOH A O   1 
HETATM 8645 O O   . HOH N 7 .   ? 10.670  -3.842  30.571  1.00 72.45  ? 2159 HOH A O   1 
HETATM 8646 O O   . HOH N 7 .   ? 34.593  -2.761  33.106  1.00 46.17  ? 2160 HOH A O   1 
HETATM 8647 O O   . HOH N 7 .   ? 36.205  5.112   38.885  1.00 48.19  ? 2161 HOH A O   1 
HETATM 8648 O O   . HOH N 7 .   ? 36.793  1.638   34.179  1.00 50.68  ? 2162 HOH A O   1 
HETATM 8649 O O   . HOH N 7 .   ? 27.817  -1.525  37.344  1.00 34.22  ? 2163 HOH A O   1 
HETATM 8650 O O   . HOH N 7 .   ? 26.931  -6.506  32.344  1.00 52.59  ? 2164 HOH A O   1 
HETATM 8651 O O   . HOH N 7 .   ? 34.061  -1.509  41.653  1.00 42.26  ? 2165 HOH A O   1 
HETATM 8652 O O   . HOH N 7 .   ? 36.619  1.775   37.033  1.00 45.80  ? 2166 HOH A O   1 
HETATM 8653 O O   . HOH N 7 .   ? 10.244  -8.955  5.843   1.00 62.33  ? 2167 HOH A O   1 
HETATM 8654 O O   . HOH N 7 .   ? 5.397   18.557  9.018   1.00 76.29  ? 2168 HOH A O   1 
HETATM 8655 O O   . HOH N 7 .   ? 18.882  -6.534  32.805  1.00 70.76  ? 2169 HOH A O   1 
HETATM 8656 O O   . HOH N 7 .   ? 22.293  -6.226  36.531  1.00 66.80  ? 2170 HOH A O   1 
HETATM 8657 O O   . HOH N 7 .   ? 17.022  -2.741  34.291  1.00 51.62  ? 2171 HOH A O   1 
HETATM 8658 O O   . HOH N 7 .   ? 19.351  -5.716  28.046  1.00 47.38  ? 2172 HOH A O   1 
HETATM 8659 O O   . HOH N 7 .   ? 16.277  -3.365  29.854  1.00 42.55  ? 2173 HOH A O   1 
HETATM 8660 O O   . HOH N 7 .   ? 18.746  -7.200  0.167   1.00 72.09  ? 2174 HOH A O   1 
HETATM 8661 O O   . HOH N 7 .   ? 19.437  0.643   28.073  1.00 35.01  ? 2175 HOH A O   1 
HETATM 8662 O O   . HOH N 7 .   ? 36.481  -4.596  13.796  1.00 37.85  ? 2176 HOH A O   1 
HETATM 8663 O O   . HOH N 7 .   ? 32.773  -6.980  13.542  1.00 56.71  ? 2177 HOH A O   1 
HETATM 8664 O O   . HOH N 7 .   ? 36.738  -6.297  15.891  1.00 47.87  ? 2178 HOH A O   1 
HETATM 8665 O O   . HOH N 7 .   ? 26.302  -5.943  21.571  1.00 53.38  ? 2179 HOH A O   1 
HETATM 8666 O O   . HOH N 7 .   ? 26.362  -7.688  25.254  1.00 69.12  ? 2180 HOH A O   1 
HETATM 8667 O O   . HOH N 7 .   ? 28.658  -0.221  29.462  1.00 36.67  ? 2181 HOH A O   1 
HETATM 8668 O O   . HOH N 7 .   ? 19.782  -7.528  25.698  1.00 74.83  ? 2182 HOH A O   1 
HETATM 8669 O O   . HOH N 7 .   ? 20.868  15.205  13.164  1.00 39.96  ? 2183 HOH A O   1 
HETATM 8670 O O   . HOH N 7 .   ? 30.540  8.330   6.554   1.00 32.56  ? 2184 HOH A O   1 
HETATM 8671 O O   . HOH N 7 .   ? 31.348  2.748   3.304   1.00 45.23  ? 2185 HOH A O   1 
HETATM 8672 O O   . HOH N 7 .   ? 31.216  6.128   0.651   1.00 53.90  ? 2186 HOH A O   1 
HETATM 8673 O O   . HOH N 7 .   ? 35.220  9.952   0.512   1.00 50.06  ? 2187 HOH A O   1 
HETATM 8674 O O   . HOH N 7 .   ? 36.891  9.827   4.264   1.00 37.49  ? 2188 HOH A O   1 
HETATM 8675 O O   . HOH N 7 .   ? 36.264  12.947  6.649   1.00 33.30  ? 2189 HOH A O   1 
HETATM 8676 O O   . HOH N 7 .   ? 33.450  5.132   6.325   1.00 33.12  ? 2190 HOH A O   1 
HETATM 8677 O O   . HOH N 7 .   ? 43.671  5.373   0.313   1.00 57.21  ? 2191 HOH A O   1 
HETATM 8678 O O   . HOH N 7 .   ? 40.713  7.331   2.757   1.00 40.97  ? 2192 HOH A O   1 
HETATM 8679 O O   . HOH N 7 .   ? 45.756  2.165   2.861   1.00 46.46  ? 2193 HOH A O   1 
HETATM 8680 O O   . HOH N 7 .   ? 50.513  7.496   2.518   1.00 45.55  ? 2194 HOH A O   1 
HETATM 8681 O O   . HOH N 7 .   ? 47.000  9.455   -1.089  1.00 56.18  ? 2195 HOH A O   1 
HETATM 8682 O O   . HOH N 7 .   ? 46.285  10.795  10.641  1.00 35.13  ? 2196 HOH A O   1 
HETATM 8683 O O   . HOH N 7 .   ? 56.290  3.024   8.626   1.00 68.13  ? 2197 HOH A O   1 
HETATM 8684 O O   . HOH N 7 .   ? 50.352  3.305   7.062   1.00 48.42  ? 2198 HOH A O   1 
HETATM 8685 O O   . HOH N 7 .   ? 50.487  15.026  1.144   1.00 48.21  ? 2199 HOH A O   1 
HETATM 8686 O O   . HOH N 7 .   ? 51.935  13.793  3.282   1.00 38.59  ? 2200 HOH A O   1 
HETATM 8687 O O   . HOH N 7 .   ? 46.509  18.148  1.076   1.00 44.32  ? 2201 HOH A O   1 
HETATM 8688 O O   . HOH N 7 .   ? 52.173  9.245   3.338   1.00 52.45  ? 2202 HOH A O   1 
HETATM 8689 O O   . HOH N 7 .   ? 40.170  11.454  1.169   1.00 40.24  ? 2203 HOH A O   1 
HETATM 8690 O O   . HOH N 7 .   ? 38.165  13.761  1.933   1.00 43.91  ? 2204 HOH A O   1 
HETATM 8691 O O   . HOH N 7 .   ? 37.965  12.286  4.533   1.00 30.42  ? 2205 HOH A O   1 
HETATM 8692 O O   . HOH N 7 .   ? 53.046  22.511  2.262   1.00 69.74  ? 2206 HOH A O   1 
HETATM 8693 O O   . HOH N 7 .   ? 53.140  26.096  8.396   1.00 45.82  ? 2207 HOH A O   1 
HETATM 8694 O O   . HOH N 7 .   ? 60.359  15.812  10.098  1.00 60.17  ? 2208 HOH A O   1 
HETATM 8695 O O   . HOH N 7 .   ? 60.631  18.525  9.483   1.00 68.07  ? 2209 HOH A O   1 
HETATM 8696 O O   . HOH N 7 .   ? 59.941  4.154   14.262  1.00 73.73  ? 2210 HOH A O   1 
HETATM 8697 O O   . HOH N 7 .   ? 63.698  4.685   15.812  1.00 77.38  ? 2211 HOH A O   1 
HETATM 8698 O O   . HOH N 7 .   ? 56.216  2.526   13.054  1.00 60.06  ? 2212 HOH A O   1 
HETATM 8699 O O   . HOH N 7 .   ? 59.844  4.045   11.274  1.00 82.32  ? 2213 HOH A O   1 
HETATM 8700 O O   . HOH N 7 .   ? 58.192  4.872   9.131   1.00 76.39  ? 2214 HOH A O   1 
HETATM 8701 O O   . HOH N 7 .   ? 57.557  8.796   19.863  1.00 48.28  ? 2215 HOH A O   1 
HETATM 8702 O O   . HOH N 7 .   ? 61.853  2.680   16.189  1.00 75.22  ? 2216 HOH A O   1 
HETATM 8703 O O   . HOH N 7 .   ? 58.469  14.450  22.741  1.00 58.23  ? 2217 HOH A O   1 
HETATM 8704 O O   . HOH N 7 .   ? 56.627  14.214  25.373  1.00 53.72  ? 2218 HOH A O   1 
HETATM 8705 O O   . HOH N 7 .   ? 52.318  16.448  24.244  1.00 37.95  ? 2219 HOH A O   1 
HETATM 8706 O O   . HOH N 7 .   ? 53.453  20.982  24.689  1.00 61.65  ? 2220 HOH A O   1 
HETATM 8707 O O   . HOH N 7 .   ? 49.839  23.171  24.716  1.00 41.23  ? 2221 HOH A O   1 
HETATM 8708 O O   . HOH N 7 .   ? 48.080  25.630  22.987  1.00 42.41  ? 2222 HOH A O   1 
HETATM 8709 O O   . HOH N 7 .   ? 53.380  28.320  14.985  1.00 52.72  ? 2223 HOH A O   1 
HETATM 8710 O O   . HOH N 7 .   ? 42.191  27.708  14.981  1.00 52.24  ? 2224 HOH A O   1 
HETATM 8711 O O   . HOH N 7 .   ? 40.215  17.074  12.422  1.00 42.92  ? 2225 HOH A O   1 
HETATM 8712 O O   . HOH N 7 .   ? 39.613  20.406  16.386  1.00 29.87  ? 2226 HOH A O   1 
HETATM 8713 O O   . HOH N 7 .   ? 48.473  22.811  3.141   1.00 59.40  ? 2227 HOH A O   1 
HETATM 8714 O O   . HOH N 7 .   ? 43.371  21.400  -0.837  1.00 62.63  ? 2228 HOH A O   1 
HETATM 8715 O O   . HOH N 7 .   ? 38.532  16.082  0.809   1.00 32.39  ? 2229 HOH A O   1 
HETATM 8716 O O   . HOH N 7 .   ? 40.176  20.993  -4.726  1.00 50.31  ? 2230 HOH A O   1 
HETATM 8717 O O   . HOH N 7 .   ? 36.452  19.776  -4.755  1.00 47.24  ? 2231 HOH A O   1 
HETATM 8718 O O   . HOH N 7 .   ? 38.121  22.220  2.375   1.00 62.71  ? 2232 HOH A O   1 
HETATM 8719 O O   . HOH N 7 .   ? 36.161  12.319  -0.206  1.00 43.76  ? 2233 HOH A O   1 
HETATM 8720 O O   . HOH N 7 .   ? 35.096  19.848  4.986   1.00 45.56  ? 2234 HOH A O   1 
HETATM 8721 O O   . HOH N 7 .   ? 43.945  11.504  9.110   1.00 33.60  ? 2235 HOH A O   1 
HETATM 8722 O O   . HOH N 7 .   ? 38.024  15.455  12.533  1.00 32.70  ? 2236 HOH A O   1 
HETATM 8723 O O   . HOH N 7 .   ? 42.845  9.769   10.975  1.00 31.61  ? 2237 HOH A O   1 
HETATM 8724 O O   . HOH N 7 .   ? 43.339  0.803   5.840   1.00 42.96  ? 2238 HOH A O   1 
HETATM 8725 O O   . HOH N 7 .   ? 44.701  -2.703  7.606   1.00 53.38  ? 2239 HOH A O   1 
HETATM 8726 O O   . HOH N 7 .   ? 44.973  1.427   15.991  1.00 57.96  ? 2240 HOH A O   1 
HETATM 8727 O O   . HOH N 7 .   ? 42.579  -0.478  18.966  1.00 55.38  ? 2241 HOH A O   1 
HETATM 8728 O O   . HOH N 7 .   ? 48.185  -4.792  16.847  1.00 75.99  ? 2242 HOH A O   1 
HETATM 8729 O O   . HOH N 7 .   ? 42.854  -3.885  6.721   1.00 56.66  ? 2243 HOH A O   1 
HETATM 8730 O O   . HOH N 7 .   ? 37.706  -7.273  2.110   1.00 71.58  ? 2244 HOH A O   1 
HETATM 8731 O O   . HOH N 7 .   ? 35.746  -2.200  1.328   1.00 70.65  ? 2245 HOH A O   1 
HETATM 8732 O O   . HOH N 7 .   ? 35.237  0.736   1.236   1.00 80.02  ? 2246 HOH A O   1 
HETATM 8733 O O   . HOH N 7 .   ? 32.428  1.234   -2.105  1.00 78.89  ? 2247 HOH A O   1 
HETATM 8734 O O   . HOH N 7 .   ? 33.161  -3.882  0.525   1.00 70.05  ? 2248 HOH A O   1 
HETATM 8735 O O   . HOH N 7 .   ? 33.332  1.953   4.205   1.00 55.86  ? 2249 HOH A O   1 
HETATM 8736 O O   . HOH N 7 .   ? 32.763  -6.436  1.267   1.00 80.35  ? 2250 HOH A O   1 
HETATM 8737 O O   . HOH N 7 .   ? 32.714  -9.731  9.917   1.00 62.65  ? 2251 HOH A O   1 
HETATM 8738 O O   . HOH N 7 .   ? 22.110  -13.881 9.283   1.00 72.82  ? 2252 HOH A O   1 
HETATM 8739 O O   . HOH N 7 .   ? 17.749  -8.950  17.293  1.00 67.33  ? 2253 HOH A O   1 
HETATM 8740 O O   . HOH N 7 .   ? 17.932  14.991  4.345   1.00 36.92  ? 2254 HOH A O   1 
HETATM 8741 O O   . HOH N 7 .   ? 10.930  22.706  6.943   1.00 55.23  ? 2255 HOH A O   1 
HETATM 8742 O O   . HOH N 7 .   ? 13.384  16.742  1.837   1.00 61.31  ? 2256 HOH A O   1 
HETATM 8743 O O   . HOH N 7 .   ? 13.334  22.161  1.150   1.00 68.33  ? 2257 HOH A O   1 
HETATM 8744 O O   . HOH N 7 .   ? 13.024  19.572  2.043   1.00 61.90  ? 2258 HOH A O   1 
HETATM 8745 O O   . HOH N 7 .   ? 21.429  20.575  7.573   1.00 34.24  ? 2259 HOH A O   1 
HETATM 8746 O O   . HOH N 7 .   ? 19.538  17.934  2.733   1.00 35.28  ? 2260 HOH A O   1 
HETATM 8747 O O   . HOH N 7 .   ? 28.581  19.294  12.143  0.70 40.29  ? 2261 HOH A O   1 
HETATM 8748 O O   . HOH N 7 .   ? 34.167  28.883  7.366   1.00 70.66  ? 2262 HOH A O   1 
HETATM 8749 O O   . HOH N 7 .   ? 29.447  29.481  1.866   1.00 58.76  ? 2263 HOH A O   1 
HETATM 8750 O O   . HOH N 7 .   ? 29.026  27.552  -5.889  1.00 35.51  ? 2264 HOH A O   1 
HETATM 8751 O O   . HOH N 7 .   ? 14.950  31.542  4.099   1.00 58.30  ? 2265 HOH A O   1 
HETATM 8752 O O   . HOH N 7 .   ? 18.597  35.057  -2.761  1.00 65.63  ? 2266 HOH A O   1 
HETATM 8753 O O   . HOH N 7 .   ? 26.864  32.421  -11.302 1.00 47.33  ? 2267 HOH A O   1 
HETATM 8754 O O   . HOH N 7 .   ? 25.070  29.535  -14.440 1.00 47.09  ? 2268 HOH A O   1 
HETATM 8755 O O   . HOH N 7 .   ? 30.234  29.317  -10.166 1.00 49.45  ? 2269 HOH A O   1 
HETATM 8756 O O   . HOH N 7 .   ? 30.677  25.769  -12.494 1.00 42.26  ? 2270 HOH A O   1 
HETATM 8757 O O   . HOH N 7 .   ? 29.730  32.006  -6.888  1.00 46.19  ? 2271 HOH A O   1 
HETATM 8758 O O   . HOH N 7 .   ? 30.217  19.973  -11.618 1.00 50.87  ? 2272 HOH A O   1 
HETATM 8759 O O   . HOH N 7 .   ? 32.408  23.572  -11.644 1.00 43.60  ? 2273 HOH A O   1 
HETATM 8760 O O   . HOH N 7 .   ? 33.880  23.915  -7.281  1.00 40.70  ? 2274 HOH A O   1 
HETATM 8761 O O   . HOH N 7 .   ? 34.942  16.433  -7.457  1.00 47.94  ? 2275 HOH A O   1 
HETATM 8762 O O   . HOH N 7 .   ? 29.859  16.560  1.076   1.00 36.22  ? 2276 HOH A O   1 
HETATM 8763 O O   . HOH N 7 .   ? 37.237  17.598  -6.220  1.00 60.91  ? 2277 HOH A O   1 
HETATM 8764 O O   . HOH N 7 .   ? 38.355  9.104   -5.457  1.00 67.69  ? 2278 HOH A O   1 
HETATM 8765 O O   . HOH N 7 .   ? 38.386  13.073  -13.743 1.00 58.00  ? 2279 HOH A O   1 
HETATM 8766 O O   . HOH N 7 .   ? 31.624  14.745  -17.950 1.00 71.08  ? 2280 HOH A O   1 
HETATM 8767 O O   . HOH N 7 .   ? 35.685  11.231  -15.555 1.00 51.72  ? 2281 HOH A O   1 
HETATM 8768 O O   . HOH N 7 .   ? 11.979  23.370  -9.781  1.00 57.47  ? 2282 HOH A O   1 
HETATM 8769 O O   . HOH N 7 .   ? 17.376  22.300  -11.966 1.00 42.38  ? 2283 HOH A O   1 
HETATM 8770 O O   . HOH N 7 .   ? 15.097  26.458  -16.063 1.00 53.53  ? 2284 HOH A O   1 
HETATM 8771 O O   . HOH N 7 .   ? 12.117  30.516  -3.804  1.00 49.85  ? 2285 HOH A O   1 
HETATM 8772 O O   . HOH N 7 .   ? 12.867  22.969  -5.064  1.00 62.04  ? 2286 HOH A O   1 
HETATM 8773 O O   . HOH N 7 .   ? 16.599  19.635  -0.434  1.00 40.49  ? 2287 HOH A O   1 
HETATM 8774 O O   . HOH N 7 .   ? 17.210  21.201  1.987   1.00 45.93  ? 2288 HOH A O   1 
HETATM 8775 O O   . HOH N 7 .   ? 16.880  13.604  -2.880  1.00 50.68  ? 2289 HOH A O   1 
HETATM 8776 O O   . HOH N 7 .   ? 19.247  15.091  2.048   1.00 41.03  ? 2290 HOH A O   1 
HETATM 8777 O O   . HOH N 7 .   ? 29.612  7.462   -1.431  1.00 60.53  ? 2291 HOH A O   1 
HETATM 8778 O O   . HOH N 7 .   ? 26.789  8.160   -0.295  1.00 35.49  ? 2292 HOH A O   1 
HETATM 8779 O O   . HOH N 7 .   ? 26.552  9.014   7.685   1.00 38.58  ? 2293 HOH A O   1 
HETATM 8780 O O   . HOH N 7 .   ? 27.757  3.859   2.297   1.00 49.25  ? 2294 HOH A O   1 
HETATM 8781 O O   . HOH N 7 .   ? 27.927  1.397   -1.405  1.00 63.29  ? 2295 HOH A O   1 
HETATM 8782 O O   . HOH N 7 .   ? 21.311  -2.078  1.996   1.00 53.17  ? 2296 HOH A O   1 
HETATM 8783 O O   . HOH N 7 .   ? 17.031  -11.926 7.845   1.00 71.06  ? 2297 HOH A O   1 
HETATM 8784 O O   . HOH N 7 .   ? 16.382  -8.522  10.540  1.00 58.46  ? 2298 HOH A O   1 
HETATM 8785 O O   . HOH N 7 .   ? 9.307   -6.935  17.699  1.00 75.73  ? 2299 HOH A O   1 
HETATM 8786 O O   . HOH N 7 .   ? 11.192  14.232  3.711   0.50 59.01  ? 2300 HOH A O   1 
HETATM 8787 O O   . HOH N 7 .   ? 14.099  20.977  14.570  1.00 48.53  ? 2301 HOH A O   1 
HETATM 8788 O O   . HOH N 7 .   ? 7.953   25.030  13.368  1.00 56.58  ? 2302 HOH A O   1 
HETATM 8789 O O   . HOH N 7 .   ? 8.144   21.775  10.711  1.00 48.77  ? 2303 HOH A O   1 
HETATM 8790 O O   . HOH N 7 .   ? 11.124  27.823  12.908  1.00 52.31  ? 2304 HOH A O   1 
HETATM 8791 O O   . HOH N 7 .   ? 8.430   29.323  19.994  1.00 55.92  ? 2305 HOH A O   1 
HETATM 8792 O O   . HOH N 7 .   ? 5.184   28.035  16.070  1.00 70.45  ? 2306 HOH A O   1 
HETATM 8793 O O   . HOH N 7 .   ? 15.521  31.610  19.490  1.00 62.25  ? 2307 HOH A O   1 
HETATM 8794 O O   . HOH N 7 .   ? 19.437  27.905  16.867  1.00 52.93  ? 2308 HOH A O   1 
HETATM 8795 O O   . HOH N 7 .   ? 19.830  33.128  10.496  1.00 53.95  ? 2309 HOH A O   1 
HETATM 8796 O O   . HOH N 7 .   ? 14.558  32.882  10.674  1.00 74.79  ? 2310 HOH A O   1 
HETATM 8797 O O   . HOH N 7 .   ? 11.484  25.694  6.589   1.00 69.47  ? 2311 HOH A O   1 
HETATM 8798 O O   . HOH N 7 .   ? 14.148  32.917  6.964   1.00 69.32  ? 2312 HOH A O   1 
HETATM 8799 O O   . HOH N 7 .   ? 17.032  23.669  1.261   1.00 45.10  ? 2313 HOH A O   1 
HETATM 8800 O O   . HOH N 7 .   ? 18.528  12.176  13.408  1.00 30.36  ? 2314 HOH A O   1 
HETATM 8801 O O   . HOH N 7 .   ? 18.991  20.199  18.814  1.00 33.72  ? 2315 HOH A O   1 
HETATM 8802 O O   . HOH N 7 .   ? 15.848  25.491  18.158  1.00 50.82  ? 2316 HOH A O   1 
HETATM 8803 O O   . HOH N 7 .   ? 6.300   24.461  27.023  1.00 70.25  ? 2317 HOH A O   1 
HETATM 8804 O O   . HOH N 7 .   ? 7.139   20.614  32.031  1.00 62.57  ? 2318 HOH A O   1 
HETATM 8805 O O   . HOH N 7 .   ? 16.135  23.292  33.418  0.50 37.66  ? 2319 HOH A O   1 
HETATM 8806 O O   . HOH N 7 .   ? 9.919   25.373  26.377  1.00 46.53  ? 2320 HOH A O   1 
HETATM 8807 O O   . HOH N 7 .   ? 14.717  29.084  23.206  1.00 60.74  ? 2321 HOH A O   1 
HETATM 8808 O O   . HOH N 7 .   ? 8.742   31.767  28.854  1.00 77.26  ? 2322 HOH A O   1 
HETATM 8809 O O   . HOH N 7 .   ? 17.049  24.861  22.913  1.00 52.75  ? 2323 HOH A O   1 
HETATM 8810 O O   . HOH N 7 .   ? 2.479   17.500  19.733  1.00 49.03  ? 2324 HOH A O   1 
HETATM 8811 O O   . HOH N 7 .   ? -1.279  19.884  26.809  1.00 75.74  ? 2325 HOH A O   1 
HETATM 8812 O O   . HOH N 7 .   ? 3.352   12.941  24.866  1.00 57.45  ? 2326 HOH A O   1 
HETATM 8813 O O   . HOH N 7 .   ? 2.888   6.604   18.622  1.00 47.53  ? 2327 HOH A O   1 
HETATM 8814 O O   . HOH N 7 .   ? 9.541   3.297   33.458  1.00 69.06  ? 2328 HOH A O   1 
HETATM 8815 O O   . HOH N 7 .   ? 12.544  -5.591  29.357  1.00 74.49  ? 2329 HOH A O   1 
HETATM 8816 O O   . HOH N 7 .   ? 15.371  -7.457  24.059  1.00 62.38  ? 2330 HOH A O   1 
HETATM 8817 O O   . HOH N 7 .   ? 11.139  1.322   10.943  1.00 37.14  ? 2331 HOH A O   1 
HETATM 8818 O O   . HOH N 7 .   ? 14.445  -5.327  11.282  1.00 49.30  ? 2332 HOH A O   1 
HETATM 8819 O O   . HOH N 7 .   ? 9.737   -2.994  6.809   1.00 45.43  ? 2333 HOH A O   1 
HETATM 8820 O O   . HOH N 7 .   ? 15.097  -7.677  6.190   1.00 57.94  ? 2334 HOH A O   1 
HETATM 8821 O O   . HOH N 7 .   ? 13.781  -5.810  -1.653  1.00 58.63  ? 2335 HOH A O   1 
HETATM 8822 O O   . HOH N 7 .   ? 12.676  -8.562  4.578   1.00 54.07  ? 2336 HOH A O   1 
HETATM 8823 O O   . HOH N 7 .   ? 14.808  2.108   1.739   1.00 41.36  ? 2337 HOH A O   1 
HETATM 8824 O O   . HOH N 7 .   ? 3.487   0.219   5.065   1.00 51.94  ? 2338 HOH A O   1 
HETATM 8825 O O   . HOH N 7 .   ? 9.679   10.692  3.589   1.00 52.35  ? 2339 HOH A O   1 
HETATM 8826 O O   . HOH N 7 .   ? 3.651   11.849  11.392  1.00 47.20  ? 2340 HOH A O   1 
HETATM 8827 O O   . HOH N 7 .   ? 4.783   18.775  12.110  1.00 61.01  ? 2341 HOH A O   1 
HETATM 8828 O O   . HOH N 7 .   ? 2.731   15.160  18.815  1.00 51.66  ? 2342 HOH A O   1 
HETATM 8829 O O   . HOH N 7 .   ? 0.207   17.414  6.999   1.00 78.12  ? 2343 HOH A O   1 
HETATM 8830 O O   . HOH N 7 .   ? 5.135   11.581  14.362  1.00 42.28  ? 2344 HOH A O   1 
HETATM 8831 O O   . HOH N 7 .   ? -0.254  11.256  10.793  1.00 66.98  ? 2345 HOH A O   1 
HETATM 8832 O O   . HOH N 7 .   ? 1.753   8.291   17.064  1.00 55.32  ? 2346 HOH A O   1 
HETATM 8833 O O   . HOH N 7 .   ? 5.643   5.909   1.337   1.00 49.48  ? 2347 HOH A O   1 
HETATM 8834 O O   . HOH N 7 .   ? 16.840  3.174   0.278   1.00 42.71  ? 2348 HOH A O   1 
HETATM 8835 O O   . HOH N 7 .   ? 11.793  8.837   0.427   1.00 53.59  ? 2349 HOH A O   1 
HETATM 8836 O O   . HOH N 7 .   ? 16.477  17.056  1.142   1.00 70.32  ? 2350 HOH A O   1 
HETATM 8837 O O   . HOH N 7 .   ? 14.031  14.617  2.923   0.50 37.68  ? 2351 HOH A O   1 
HETATM 8838 O O   . HOH N 7 .   ? 12.041  12.146  2.232   1.00 54.28  ? 2352 HOH A O   1 
HETATM 8839 O O   . HOH N 7 .   ? 14.446  8.539   -4.181  1.00 44.65  ? 2353 HOH A O   1 
HETATM 8840 O O   . HOH N 7 .   ? 26.170  5.680   0.797   1.00 50.72  ? 2354 HOH A O   1 
HETATM 8841 O O   . HOH N 7 .   ? 19.563  -6.150  -2.521  1.00 69.27  ? 2355 HOH A O   1 
HETATM 8842 O O   . HOH N 7 .   ? 22.986  -3.530  -7.540  1.00 64.91  ? 2356 HOH A O   1 
HETATM 8843 O O   . HOH N 7 .   ? 19.516  -6.764  -6.559  1.00 64.97  ? 2357 HOH A O   1 
HETATM 8844 O O   . HOH N 7 .   ? 31.186  5.444   -4.192  1.00 63.50  ? 2358 HOH A O   1 
HETATM 8845 O O   . HOH N 7 .   ? 38.627  6.566   -12.920 1.00 63.46  ? 2359 HOH A O   1 
HETATM 8846 O O   . HOH N 7 .   ? 35.361  7.473   -13.805 1.00 59.90  ? 2360 HOH A O   1 
HETATM 8847 O O   . HOH N 7 .   ? 23.234  33.192  -3.884  1.00 48.60  ? 2361 HOH A O   1 
HETATM 8848 O O   . HOH N 7 .   ? 25.297  34.058  -5.497  1.00 54.08  ? 2362 HOH A O   1 
HETATM 8849 O O   . HOH N 7 .   ? 19.811  8.074   -12.953 1.00 73.30  ? 2363 HOH A O   1 
HETATM 8850 O O   . HOH N 7 .   ? 13.841  16.475  -10.109 1.00 51.09  ? 2364 HOH A O   1 
HETATM 8851 O O   . HOH O 7 .   ? -13.842 3.939   -65.974 1.00 57.71  ? 2001 HOH B O   1 
HETATM 8852 O O   . HOH O 7 .   ? -12.671 -0.617  -62.751 1.00 69.97  ? 2002 HOH B O   1 
HETATM 8853 O O   . HOH O 7 .   ? -0.036  9.954   -74.627 1.00 71.81  ? 2003 HOH B O   1 
HETATM 8854 O O   . HOH O 7 .   ? 0.776   13.271  -71.407 1.00 55.08  ? 2004 HOH B O   1 
HETATM 8855 O O   . HOH O 7 .   ? 4.401   20.001  -64.650 1.00 68.05  ? 2005 HOH B O   1 
HETATM 8856 O O   . HOH O 7 .   ? 8.228   -0.536  -66.922 1.00 38.33  ? 2006 HOH B O   1 
HETATM 8857 O O   . HOH O 7 .   ? 4.365   11.027  -65.278 1.00 46.54  ? 2007 HOH B O   1 
HETATM 8858 O O   . HOH O 7 .   ? 10.325  12.454  -65.862 1.00 74.08  ? 2008 HOH B O   1 
HETATM 8859 O O   . HOH O 7 .   ? 14.319  5.187   -74.571 0.50 29.41  ? 2009 HOH B O   1 
HETATM 8860 O O   . HOH O 7 .   ? -12.663 2.530   -63.231 1.00 62.93  ? 2010 HOH B O   1 
HETATM 8861 O O   . HOH O 7 .   ? -14.861 3.167   -61.469 1.00 50.18  ? 2011 HOH B O   1 
HETATM 8862 O O   . HOH O 7 .   ? 7.466   -14.827 -49.408 1.00 75.85  ? 2012 HOH B O   1 
HETATM 8863 O O   . HOH O 7 .   ? 5.111   8.480   -64.352 1.00 42.09  ? 2013 HOH B O   1 
HETATM 8864 O O   . HOH O 7 .   ? 8.923   9.557   -62.657 1.00 50.25  ? 2014 HOH B O   1 
HETATM 8865 O O   . HOH O 7 .   ? 7.681   1.308   -61.951 1.00 38.31  ? 2015 HOH B O   1 
HETATM 8866 O O   . HOH O 7 .   ? 15.072  2.847   -61.933 1.00 38.11  ? 2016 HOH B O   1 
HETATM 8867 O O   . HOH O 7 .   ? 12.434  -0.631  -68.182 1.00 44.90  ? 2017 HOH B O   1 
HETATM 8868 O O   . HOH O 7 .   ? 9.207   1.556   -68.487 1.00 38.43  ? 2018 HOH B O   1 
HETATM 8869 O O   . HOH O 7 .   ? 16.717  -7.665  -60.081 1.00 44.00  ? 2019 HOH B O   1 
HETATM 8870 O O   . HOH O 7 .   ? 22.079  -0.504  -65.340 1.00 63.56  ? 2020 HOH B O   1 
HETATM 8871 O O   . HOH O 7 .   ? 14.153  -3.910  -67.349 1.00 34.48  ? 2021 HOH B O   1 
HETATM 8872 O O   . HOH O 7 .   ? 17.583  -2.488  -55.867 1.00 39.57  ? 2022 HOH B O   1 
HETATM 8873 O O   . HOH O 7 .   ? 19.119  -14.902 -21.900 1.00 72.50  ? 2023 HOH B O   1 
HETATM 8874 O O   . HOH O 7 .   ? 17.366  1.580   -60.446 1.00 52.04  ? 2024 HOH B O   1 
HETATM 8875 O O   . HOH O 7 .   ? 20.590  4.669   -61.835 1.00 55.28  ? 2025 HOH B O   1 
HETATM 8876 O O   . HOH O 7 .   ? 20.040  2.468   -63.305 1.00 61.83  ? 2026 HOH B O   1 
HETATM 8877 O O   . HOH O 7 .   ? 14.493  7.375   -67.432 1.00 61.23  ? 2027 HOH B O   1 
HETATM 8878 O O   . HOH O 7 .   ? 10.749  10.314  -68.023 1.00 67.09  ? 2028 HOH B O   1 
HETATM 8879 O O   . HOH O 7 .   ? 7.518   9.626   -65.024 1.00 54.60  ? 2029 HOH B O   1 
HETATM 8880 O O   . HOH O 7 .   ? 4.694   1.327   -69.300 1.00 35.94  ? 2030 HOH B O   1 
HETATM 8881 O O   . HOH O 7 .   ? 7.673   -0.501  -71.875 1.00 38.22  ? 2031 HOH B O   1 
HETATM 8882 O O   . HOH O 7 .   ? 12.093  3.952   -74.562 1.00 46.16  ? 2032 HOH B O   1 
HETATM 8883 O O   . HOH O 7 .   ? 5.478   5.488   -75.557 1.00 60.13  ? 2033 HOH B O   1 
HETATM 8884 O O   . HOH O 7 .   ? 2.845   9.446   -73.409 1.00 51.34  ? 2034 HOH B O   1 
HETATM 8885 O O   . HOH O 7 .   ? -0.797  6.983   -76.971 1.00 61.65  ? 2035 HOH B O   1 
HETATM 8886 O O   . HOH O 7 .   ? -0.526  7.626   -72.777 1.00 43.22  ? 2036 HOH B O   1 
HETATM 8887 O O   . HOH O 7 .   ? -4.966  1.742   -73.777 1.00 52.99  ? 2037 HOH B O   1 
HETATM 8888 O O   . HOH O 7 .   ? -1.479  -1.272  -64.682 1.00 51.46  ? 2038 HOH B O   1 
HETATM 8889 O O   . HOH O 7 .   ? -2.403  -0.435  -61.424 1.00 52.16  ? 2039 HOH B O   1 
HETATM 8890 O O   . HOH O 7 .   ? -1.495  -3.166  -60.591 1.00 58.09  ? 2040 HOH B O   1 
HETATM 8891 O O   . HOH O 7 .   ? 21.400  11.797  -55.263 1.00 67.65  ? 2041 HOH B O   1 
HETATM 8892 O O   . HOH O 7 .   ? 18.502  16.088  -56.745 1.00 66.38  ? 2042 HOH B O   1 
HETATM 8893 O O   . HOH O 7 .   ? 0.670   -0.383  -63.213 1.00 63.69  ? 2043 HOH B O   1 
HETATM 8894 O O   . HOH O 7 .   ? 1.843   21.784  -61.667 1.00 53.98  ? 2044 HOH B O   1 
HETATM 8895 O O   . HOH O 7 .   ? 1.017   17.321  -67.922 1.00 64.66  ? 2045 HOH B O   1 
HETATM 8896 O O   . HOH O 7 .   ? 0.147   19.782  -64.422 1.00 78.60  ? 2046 HOH B O   1 
HETATM 8897 O O   . HOH O 7 .   ? 12.771  -4.230  -51.668 1.00 34.79  ? 2047 HOH B O   1 
HETATM 8898 O O   . HOH O 7 .   ? 14.097  -7.118  -48.599 1.00 40.48  ? 2048 HOH B O   1 
HETATM 8899 O O   . HOH O 7 .   ? 12.687  -4.976  -54.213 1.00 47.19  ? 2049 HOH B O   1 
HETATM 8900 O O   . HOH O 7 .   ? 4.425   -5.169  -46.112 1.00 45.46  ? 2050 HOH B O   1 
HETATM 8901 O O   . HOH O 7 .   ? 6.525   -8.018  -44.589 1.00 45.79  ? 2051 HOH B O   1 
HETATM 8902 O O   . HOH O 7 .   ? 10.040  -13.194 -48.415 1.00 47.13  ? 2052 HOH B O   1 
HETATM 8903 O O   . HOH O 7 .   ? -0.086  26.903  -48.616 1.00 54.07  ? 2053 HOH B O   1 
HETATM 8904 O O   . HOH O 7 .   ? 10.558  -14.129 -45.865 1.00 56.04  ? 2054 HOH B O   1 
HETATM 8905 O O   . HOH O 7 .   ? 4.261   -8.323  -39.191 1.00 49.10  ? 2055 HOH B O   1 
HETATM 8906 O O   . HOH O 7 .   ? -0.929  -11.952 -45.321 1.00 75.23  ? 2056 HOH B O   1 
HETATM 8907 O O   . HOH O 7 .   ? -3.364  -3.232  -42.658 1.00 52.98  ? 2057 HOH B O   1 
HETATM 8908 O O   . HOH O 7 .   ? 25.005  1.338   -35.846 1.00 47.95  ? 2058 HOH B O   1 
HETATM 8909 O O   . HOH O 7 .   ? 4.538   -3.371  -42.662 1.00 40.56  ? 2059 HOH B O   1 
HETATM 8910 O O   . HOH O 7 .   ? -1.652  -7.116  -44.787 1.00 50.65  ? 2060 HOH B O   1 
HETATM 8911 O O   . HOH O 7 .   ? 6.015   -7.555  -41.601 1.00 58.76  ? 2061 HOH B O   1 
HETATM 8912 O O   . HOH O 7 .   ? 29.621  1.369   -36.050 1.00 50.67  ? 2062 HOH B O   1 
HETATM 8913 O O   . HOH O 7 .   ? 32.571  7.538   -42.406 1.00 59.91  ? 2063 HOH B O   1 
HETATM 8914 O O   . HOH O 7 .   ? 35.520  0.183   -43.727 1.00 62.09  ? 2064 HOH B O   1 
HETATM 8915 O O   . HOH O 7 .   ? -2.068  -9.758  -45.633 1.00 68.35  ? 2065 HOH B O   1 
HETATM 8916 O O   . HOH O 7 .   ? 33.612  5.104   -47.506 1.00 63.40  ? 2066 HOH B O   1 
HETATM 8917 O O   . HOH O 7 .   ? 2.801   -11.471 -51.077 1.00 56.02  ? 2067 HOH B O   1 
HETATM 8918 O O   . HOH O 7 .   ? -6.234  -3.192  -55.646 1.00 53.42  ? 2068 HOH B O   1 
HETATM 8919 O O   . HOH O 7 .   ? -3.807  -5.480  -56.705 1.00 59.93  ? 2069 HOH B O   1 
HETATM 8920 O O   . HOH O 7 .   ? 4.685   -12.987 -53.415 1.00 56.11  ? 2070 HOH B O   1 
HETATM 8921 O O   . HOH O 7 .   ? 13.692  -10.637 -58.907 1.00 52.42  ? 2071 HOH B O   1 
HETATM 8922 O O   . HOH O 7 .   ? 15.648  -4.300  -56.904 1.00 38.21  ? 2072 HOH B O   1 
HETATM 8923 O O   . HOH O 7 .   ? 13.272  -3.494  -56.019 1.00 41.36  ? 2073 HOH B O   1 
HETATM 8924 O O   . HOH O 7 .   ? 37.648  -11.778 -51.012 1.00 80.81  ? 2074 HOH B O   1 
HETATM 8925 O O   . HOH O 7 .   ? 10.394  -5.754  -64.296 1.00 42.01  ? 2075 HOH B O   1 
HETATM 8926 O O   . HOH O 7 .   ? 9.008   -0.645  -60.799 1.00 31.33  ? 2076 HOH B O   1 
HETATM 8927 O O   . HOH O 7 .   ? 6.675   0.091   -64.566 1.00 45.20  ? 2077 HOH B O   1 
HETATM 8928 O O   . HOH O 7 .   ? 0.456   0.467   -55.939 1.00 41.70  ? 2078 HOH B O   1 
HETATM 8929 O O   . HOH O 7 .   ? -8.289  2.680   -51.199 1.00 64.87  ? 2079 HOH B O   1 
HETATM 8930 O O   . HOH O 7 .   ? -9.776  22.400  -52.184 1.00 73.08  ? 2080 HOH B O   1 
HETATM 8931 O O   . HOH O 7 .   ? 4.316   4.982   -48.344 1.00 32.36  ? 2081 HOH B O   1 
HETATM 8932 O O   . HOH O 7 .   ? 4.134   2.747   -40.973 1.00 36.25  ? 2082 HOH B O   1 
HETATM 8933 O O   . HOH O 7 .   ? 8.944   -8.858  -39.322 1.00 66.78  ? 2083 HOH B O   1 
HETATM 8934 O O   . HOH O 7 .   ? 6.368   -4.731  -41.493 1.00 41.99  ? 2084 HOH B O   1 
HETATM 8935 O O   . HOH O 7 .   ? 10.265  0.359   -43.954 1.00 29.70  ? 2085 HOH B O   1 
HETATM 8936 O O   . HOH O 7 .   ? 6.655   -2.141  -50.696 1.00 36.41  ? 2086 HOH B O   1 
HETATM 8937 O O   . HOH O 7 .   ? -5.655  -2.198  -48.958 1.00 45.16  ? 2087 HOH B O   1 
HETATM 8938 O O   . HOH O 7 .   ? 1.576   -2.447  -52.979 1.00 44.14  ? 2088 HOH B O   1 
HETATM 8939 O O   . HOH O 7 .   ? -3.593  1.457   -48.555 1.00 37.28  ? 2089 HOH B O   1 
HETATM 8940 O O   . HOH O 7 .   ? -3.442  -5.029  -45.055 1.00 53.34  ? 2090 HOH B O   1 
HETATM 8941 O O   . HOH O 7 .   ? -5.613  -6.345  -47.180 1.00 62.57  ? 2091 HOH B O   1 
HETATM 8942 O O   . HOH O 7 .   ? 16.826  -14.794 -20.506 1.00 56.63  ? 2092 HOH B O   1 
HETATM 8943 O O   . HOH O 7 .   ? -8.845  -3.090  -41.484 1.00 75.96  ? 2093 HOH B O   1 
HETATM 8944 O O   . HOH O 7 .   ? 22.543  -12.208 -20.913 1.00 62.31  ? 2094 HOH B O   1 
HETATM 8945 O O   . HOH O 7 .   ? 4.317   -0.682  -43.470 1.00 35.71  ? 2095 HOH B O   1 
HETATM 8946 O O   . HOH O 7 .   ? -8.979  0.200   -45.462 1.00 57.33  ? 2096 HOH B O   1 
HETATM 8947 O O   . HOH O 7 .   ? -6.221  0.897   -49.369 1.00 53.58  ? 2097 HOH B O   1 
HETATM 8948 O O   . HOH O 7 .   ? -15.240 0.631   -52.917 1.00 56.63  ? 2098 HOH B O   1 
HETATM 8949 O O   . HOH O 7 .   ? -18.029 13.352  -45.041 1.00 61.34  ? 2099 HOH B O   1 
HETATM 8950 O O   . HOH O 7 .   ? -12.362 14.807  -39.676 1.00 54.39  ? 2100 HOH B O   1 
HETATM 8951 O O   . HOH O 7 .   ? -1.338  4.231   -48.790 1.00 39.14  ? 2101 HOH B O   1 
HETATM 8952 O O   . HOH O 7 .   ? 1.503   0.371   -53.160 1.00 39.75  ? 2102 HOH B O   1 
HETATM 8953 O O   . HOH O 7 .   ? 17.786  21.320  -27.116 1.00 63.80  ? 2103 HOH B O   1 
HETATM 8954 O O   . HOH O 7 .   ? 21.905  2.644   -47.478 1.00 40.95  ? 2104 HOH B O   1 
HETATM 8955 O O   . HOH O 7 .   ? 22.962  0.992   -53.060 1.00 43.94  ? 2105 HOH B O   1 
HETATM 8956 O O   . HOH O 7 .   ? 25.139  -2.260  -46.543 1.00 41.18  ? 2106 HOH B O   1 
HETATM 8957 O O   . HOH O 7 .   ? 23.608  4.457   -64.452 1.00 77.23  ? 2107 HOH B O   1 
HETATM 8958 O O   . HOH O 7 .   ? 32.754  1.410   -57.953 1.00 62.67  ? 2108 HOH B O   1 
HETATM 8959 O O   . HOH O 7 .   ? 28.251  6.030   -51.385 1.00 46.51  ? 2109 HOH B O   1 
HETATM 8960 O O   . HOH O 7 .   ? 22.665  7.602   -52.825 1.00 55.93  ? 2110 HOH B O   1 
HETATM 8961 O O   . HOH O 7 .   ? -13.889 -6.690  -39.377 0.50 52.23  ? 2111 HOH B O   1 
HETATM 8962 O O   . HOH O 7 .   ? -12.927 -8.153  -37.607 0.50 39.23  ? 2112 HOH B O   1 
HETATM 8963 O O   . HOH O 7 .   ? 15.815  10.263  -56.594 1.00 43.19  ? 2113 HOH B O   1 
HETATM 8964 O O   . HOH O 7 .   ? 21.187  13.690  -51.880 1.00 54.48  ? 2114 HOH B O   1 
HETATM 8965 O O   . HOH O 7 .   ? 18.831  13.343  -55.608 1.00 59.19  ? 2115 HOH B O   1 
HETATM 8966 O O   . HOH O 7 .   ? 15.887  17.095  -55.963 1.00 58.39  ? 2116 HOH B O   1 
HETATM 8967 O O   . HOH O 7 .   ? 1.768   19.555  -60.169 1.00 39.89  ? 2117 HOH B O   1 
HETATM 8968 O O   . HOH O 7 .   ? 9.118   21.826  -57.393 1.00 64.73  ? 2118 HOH B O   1 
HETATM 8969 O O   . HOH O 7 .   ? 8.953   12.583  -61.740 1.00 74.21  ? 2119 HOH B O   1 
HETATM 8970 O O   . HOH O 7 .   ? 1.028   17.485  -65.473 1.00 65.20  ? 2120 HOH B O   1 
HETATM 8971 O O   . HOH O 7 .   ? 6.804   13.012  -64.309 1.00 60.90  ? 2121 HOH B O   1 
HETATM 8972 O O   . HOH O 7 .   ? 13.257  30.897  -29.270 1.00 74.11  ? 2122 HOH B O   1 
HETATM 8973 O O   . HOH O 7 .   ? -1.484  24.780  -19.936 1.00 72.84  ? 2123 HOH B O   1 
HETATM 8974 O O   . HOH O 7 .   ? 1.962   12.449  -17.575 1.00 64.20  ? 2124 HOH B O   1 
HETATM 8975 O O   . HOH O 7 .   ? -11.618 7.643   -21.644 1.00 76.89  ? 2125 HOH B O   1 
HETATM 8976 O O   . HOH O 7 .   ? -1.970  23.769  -58.943 1.00 63.48  ? 2126 HOH B O   1 
HETATM 8977 O O   . HOH O 7 .   ? -3.939  24.633  -51.296 1.00 52.35  ? 2127 HOH B O   1 
HETATM 8978 O O   . HOH O 7 .   ? 2.239   25.856  -48.184 1.00 51.40  ? 2128 HOH B O   1 
HETATM 8979 O O   . HOH O 7 .   ? -0.074  20.089  -47.331 1.00 41.16  ? 2129 HOH B O   1 
HETATM 8980 O O   . HOH O 7 .   ? 22.340  16.138  -45.787 1.00 45.33  ? 2130 HOH B O   1 
HETATM 8981 O O   . HOH O 7 .   ? 22.278  17.854  -47.990 1.00 52.49  ? 2131 HOH B O   1 
HETATM 8982 O O   . HOH O 7 .   ? 11.277  22.192  -46.948 1.00 48.02  ? 2132 HOH B O   1 
HETATM 8983 O O   . HOH O 7 .   ? 9.787   24.286  -50.227 1.00 53.70  ? 2133 HOH B O   1 
HETATM 8984 O O   . HOH O 7 .   ? 11.029  24.076  -45.345 1.00 70.92  ? 2134 HOH B O   1 
HETATM 8985 O O   . HOH O 7 .   ? 11.769  21.719  -57.036 1.00 63.15  ? 2135 HOH B O   1 
HETATM 8986 O O   . HOH O 7 .   ? 6.152   17.087  -53.707 1.00 36.92  ? 2136 HOH B O   1 
HETATM 8987 O O   . HOH O 7 .   ? 3.455   4.298   -33.890 1.00 37.38  ? 2137 HOH B O   1 
HETATM 8988 O O   . HOH O 7 .   ? 13.238  6.983   -33.408 1.00 37.51  ? 2138 HOH B O   1 
HETATM 8989 O O   . HOH O 7 .   ? 16.993  5.958   -34.780 1.00 36.75  ? 2139 HOH B O   1 
HETATM 8990 O O   . HOH O 7 .   ? 21.617  7.033   -30.554 1.00 52.46  ? 2140 HOH B O   1 
HETATM 8991 O O   . HOH O 7 .   ? 22.397  1.690   -36.152 1.00 36.24  ? 2141 HOH B O   1 
HETATM 8992 O O   . HOH O 7 .   ? 23.230  1.981   -32.263 1.00 51.80  ? 2142 HOH B O   1 
HETATM 8993 O O   . HOH O 7 .   ? 20.415  7.648   -36.622 1.00 41.29  ? 2143 HOH B O   1 
HETATM 8994 O O   . HOH O 7 .   ? 26.983  2.174   -37.417 1.00 43.12  ? 2144 HOH B O   1 
HETATM 8995 O O   . HOH O 7 .   ? 31.639  2.216   -36.921 1.00 72.36  ? 2145 HOH B O   1 
HETATM 8996 O O   . HOH O 7 .   ? 34.117  -1.972  -42.700 1.00 61.49  ? 2146 HOH B O   1 
HETATM 8997 O O   . HOH O 7 .   ? 32.603  4.986   -41.279 1.00 53.72  ? 2147 HOH B O   1 
HETATM 8998 O O   . HOH O 7 .   ? 33.206  2.532   -46.889 1.00 58.45  ? 2148 HOH B O   1 
HETATM 8999 O O   . HOH O 7 .   ? 32.201  -8.267  -43.010 1.00 53.64  ? 2149 HOH B O   1 
HETATM 9000 O O   . HOH O 7 .   ? 27.686  -10.218 -37.737 1.00 54.01  ? 2150 HOH B O   1 
HETATM 9001 O O   . HOH O 7 .   ? 31.760  -12.036 -39.330 1.00 69.25  ? 2151 HOH B O   1 
HETATM 9002 O O   . HOH O 7 .   ? 22.064  -0.999  -36.685 1.00 41.38  ? 2152 HOH B O   1 
HETATM 9003 O O   . HOH O 7 .   ? 25.940  -1.359  -35.428 1.00 59.42  ? 2153 HOH B O   1 
HETATM 9004 O O   . HOH O 7 .   ? 34.444  -6.676  -43.292 1.00 63.21  ? 2154 HOH B O   1 
HETATM 9005 O O   . HOH O 7 .   ? 30.028  -16.868 -41.644 1.00 79.15  ? 2155 HOH B O   1 
HETATM 9006 O O   . HOH O 7 .   ? 32.570  -15.545 -56.240 1.00 77.36  ? 2156 HOH B O   1 
HETATM 9007 O O   . HOH O 7 .   ? 38.064  -9.166  -52.809 1.00 75.08  ? 2157 HOH B O   1 
HETATM 9008 O O   . HOH O 7 .   ? 25.770  -9.166  -63.002 1.00 60.80  ? 2158 HOH B O   1 
HETATM 9009 O O   . HOH O 7 .   ? 24.306  -2.379  -58.956 1.00 51.22  ? 2159 HOH B O   1 
HETATM 9010 O O   . HOH O 7 .   ? 25.376  -6.132  -65.242 1.00 67.77  ? 2160 HOH B O   1 
HETATM 9011 O O   . HOH O 7 .   ? 21.524  -10.135 -62.881 1.00 67.33  ? 2161 HOH B O   1 
HETATM 9012 O O   . HOH O 7 .   ? 23.575  -6.944  -64.062 1.00 49.70  ? 2162 HOH B O   1 
HETATM 9013 O O   . HOH O 7 .   ? 14.589  -13.107 -57.983 1.00 48.84  ? 2163 HOH B O   1 
HETATM 9014 O O   . HOH O 7 .   ? 19.476  -19.039 -49.360 1.00 62.87  ? 2164 HOH B O   1 
HETATM 9015 O O   . HOH O 7 .   ? 19.648  -19.515 -44.735 1.00 79.63  ? 2165 HOH B O   1 
HETATM 9016 O O   . HOH O 7 .   ? 16.831  -7.813  -48.308 1.00 45.18  ? 2166 HOH B O   1 
HETATM 9017 O O   . HOH O 7 .   ? 13.383  -7.532  -46.144 1.00 36.62  ? 2167 HOH B O   1 
HETATM 9018 O O   . HOH O 7 .   ? 22.867  -5.055  -33.354 1.00 44.23  ? 2168 HOH B O   1 
HETATM 9019 O O   . HOH O 7 .   ? 19.155  -10.292 -33.488 1.00 69.78  ? 2169 HOH B O   1 
HETATM 9020 O O   . HOH O 7 .   ? 16.804  -6.462  -34.250 1.00 56.14  ? 2170 HOH B O   1 
HETATM 9021 O O   . HOH O 7 .   ? 19.262  -0.623  -37.337 1.00 47.10  ? 2171 HOH B O   1 
HETATM 9022 O O   . HOH O 7 .   ? 24.216  -1.946  -43.824 1.00 38.16  ? 2172 HOH B O   1 
HETATM 9023 O O   . HOH O 7 .   ? 17.695  -5.017  -43.497 1.00 51.23  ? 2173 HOH B O   1 
HETATM 9024 O O   . HOH O 7 .   ? 16.368  -2.811  -42.801 1.00 37.55  ? 2174 HOH B O   1 
HETATM 9025 O O   . HOH O 7 .   ? 22.886  0.162   -44.976 1.00 39.05  ? 2175 HOH B O   1 
HETATM 9026 O O   . HOH O 7 .   ? 29.816  7.475   -42.095 1.00 51.82  ? 2176 HOH B O   1 
HETATM 9027 O O   . HOH O 7 .   ? 22.327  10.448  -52.825 1.00 55.24  ? 2177 HOH B O   1 
HETATM 9028 O O   . HOH O 7 .   ? 22.386  15.944  -50.135 1.00 62.77  ? 2178 HOH B O   1 
HETATM 9029 O O   . HOH O 7 .   ? 24.605  12.351  -55.991 1.00 73.37  ? 2179 HOH B O   1 
HETATM 9030 O O   . HOH O 7 .   ? 26.195  8.787   -53.007 1.00 69.19  ? 2180 HOH B O   1 
HETATM 9031 O O   . HOH O 7 .   ? 22.806  15.596  -54.589 1.00 65.70  ? 2181 HOH B O   1 
HETATM 9032 O O   . HOH O 7 .   ? 25.785  10.854  -29.533 1.00 72.31  ? 2182 HOH B O   1 
HETATM 9033 O O   . HOH O 7 .   ? 8.520   28.056  -39.078 1.00 64.11  ? 2183 HOH B O   1 
HETATM 9034 O O   . HOH O 7 .   ? 17.742  30.000  -35.762 1.00 77.23  ? 2184 HOH B O   1 
HETATM 9035 O O   . HOH O 7 .   ? 13.556  26.287  -42.761 1.00 67.82  ? 2185 HOH B O   1 
HETATM 9036 O O   . HOH O 7 .   ? 6.291   4.677   -25.038 1.00 38.50  ? 2186 HOH B O   1 
HETATM 9037 O O   . HOH O 7 .   ? -3.208  0.892   -22.128 1.00 67.35  ? 2187 HOH B O   1 
HETATM 9038 O O   . HOH O 7 .   ? 4.053   4.447   -20.083 1.00 64.82  ? 2188 HOH B O   1 
HETATM 9039 O O   . HOH O 7 .   ? 4.624   -0.856  -21.869 1.00 43.12  ? 2189 HOH B O   1 
HETATM 9040 O O   . HOH O 7 .   ? 2.419   2.568   -20.216 1.00 56.80  ? 2190 HOH B O   1 
HETATM 9041 O O   . HOH O 7 .   ? 4.845   -1.537  -29.044 1.00 41.12  ? 2191 HOH B O   1 
HETATM 9042 O O   . HOH O 7 .   ? 7.225   1.168   -24.185 1.00 41.57  ? 2192 HOH B O   1 
HETATM 9043 O O   . HOH O 7 .   ? 8.505   -2.847  -36.811 1.00 62.55  ? 2193 HOH B O   1 
HETATM 9044 O O   . HOH O 7 .   ? 8.621   -14.885 -28.855 1.00 70.39  ? 2194 HOH B O   1 
HETATM 9045 O O   . HOH O 7 .   ? 10.870  -13.249 -27.465 1.00 67.16  ? 2195 HOH B O   1 
HETATM 9046 O O   . HOH O 7 .   ? 14.825  -16.626 -14.819 1.00 69.06  ? 2196 HOH B O   1 
HETATM 9047 O O   . HOH O 7 .   ? 20.773  -5.572  -10.689 1.00 57.27  ? 2197 HOH B O   1 
HETATM 9048 O O   . HOH O 7 .   ? 20.523  -12.245 -16.540 1.00 56.67  ? 2198 HOH B O   1 
HETATM 9049 O O   . HOH O 7 .   ? 18.567  -14.737 -17.896 1.00 63.16  ? 2199 HOH B O   1 
HETATM 9050 O O   . HOH O 7 .   ? 15.555  -12.285 -20.968 1.00 54.20  ? 2200 HOH B O   1 
HETATM 9051 O O   . HOH O 7 .   ? 22.372  -6.401  -17.542 1.00 63.54  ? 2201 HOH B O   1 
HETATM 9052 O O   . HOH O 7 .   ? 22.316  -11.025 -18.143 1.00 58.08  ? 2202 HOH B O   1 
HETATM 9053 O O   . HOH O 7 .   ? 24.470  -5.051  -24.217 1.00 58.53  ? 2203 HOH B O   1 
HETATM 9054 O O   . HOH O 7 .   ? 23.026  -8.273  -27.046 1.00 50.53  ? 2204 HOH B O   1 
HETATM 9055 O O   . HOH O 7 .   ? 24.208  -9.022  -18.436 1.00 62.58  ? 2205 HOH B O   1 
HETATM 9056 O O   . HOH O 7 .   ? 16.435  -1.857  -28.815 1.00 43.79  ? 2206 HOH B O   1 
HETATM 9057 O O   . HOH O 7 .   ? 23.174  -2.636  -34.357 1.00 38.79  ? 2207 HOH B O   1 
HETATM 9058 O O   . HOH O 7 .   ? 22.815  0.648   -28.078 1.00 41.15  ? 2208 HOH B O   1 
HETATM 9059 O O   . HOH O 7 .   ? 31.784  -4.103  -21.472 1.00 67.75  ? 2209 HOH B O   1 
HETATM 9060 O O   . HOH O 7 .   ? 31.640  -1.705  -18.826 1.00 52.24  ? 2210 HOH B O   1 
HETATM 9061 O O   . HOH O 7 .   ? 11.672  -3.388  -10.541 1.00 53.51  ? 2211 HOH B O   1 
HETATM 9062 O O   . HOH O 7 .   ? 6.779   2.370   -6.425  1.00 67.96  ? 2212 HOH B O   1 
HETATM 9063 O O   . HOH O 7 .   ? 10.188  -7.075  -5.088  1.00 53.96  ? 2213 HOH B O   1 
HETATM 9064 O O   . HOH O 7 .   ? 9.353   -0.791  -12.516 1.00 65.75  ? 2214 HOH B O   1 
HETATM 9065 O O   . HOH O 7 .   ? -0.569  -9.029  -16.225 1.00 68.05  ? 2215 HOH B O   1 
HETATM 9066 O O   . HOH O 7 .   ? 6.054   0.437   -19.738 1.00 43.95  ? 2216 HOH B O   1 
HETATM 9067 O O   . HOH O 7 .   ? 8.637   3.863   -24.224 1.00 44.47  ? 2217 HOH B O   1 
HETATM 9068 O O   . HOH O 7 .   ? 10.145  5.554   -18.766 1.00 54.67  ? 2218 HOH B O   1 
HETATM 9069 O O   . HOH O 7 .   ? 18.179  6.784   -27.031 1.00 36.88  ? 2219 HOH B O   1 
HETATM 9070 O O   . HOH O 7 .   ? 19.114  10.508  -30.274 1.00 46.55  ? 2220 HOH B O   1 
HETATM 9071 O O   . HOH O 7 .   ? 19.518  16.058  -26.757 1.00 78.77  ? 2221 HOH B O   1 
HETATM 9072 O O   . HOH O 7 .   ? 17.016  18.482  -27.604 1.00 56.14  ? 2222 HOH B O   1 
HETATM 9073 O O   . HOH O 7 .   ? 14.098  29.940  -31.535 1.00 73.31  ? 2223 HOH B O   1 
HETATM 9074 O O   . HOH O 7 .   ? -0.520  27.309  -32.341 1.00 35.66  ? 2224 HOH B O   1 
HETATM 9075 O O   . HOH O 7 .   ? 3.013   8.154   -33.186 1.00 35.09  ? 2225 HOH B O   1 
HETATM 9076 O O   . HOH O 7 .   ? -6.681  6.686   -21.989 1.00 72.49  ? 2226 HOH B O   1 
HETATM 9077 O O   . HOH O 7 .   ? -4.269  4.041   -21.985 1.00 70.37  ? 2227 HOH B O   1 
HETATM 9078 O O   . HOH O 7 .   ? 1.595   7.922   -20.911 1.00 76.38  ? 2228 HOH B O   1 
HETATM 9079 O O   . HOH O 7 .   ? -8.738  5.292   -24.056 1.00 58.41  ? 2229 HOH B O   1 
HETATM 9080 O O   . HOH O 7 .   ? -6.884  3.302   -23.829 1.00 51.53  ? 2230 HOH B O   1 
HETATM 9081 O O   . HOH O 7 .   ? -9.518  0.577   -25.048 1.00 72.94  ? 2231 HOH B O   1 
HETATM 9082 O O   . HOH O 7 .   ? -8.389  -3.360  -26.662 1.00 61.47  ? 2232 HOH B O   1 
HETATM 9083 O O   . HOH O 7 .   ? -2.649  -12.067 -28.917 1.00 68.19  ? 2233 HOH B O   1 
HETATM 9084 O O   . HOH O 7 .   ? -4.738  -10.031 -22.635 1.00 60.85  ? 2234 HOH B O   1 
HETATM 9085 O O   . HOH O 7 .   ? 3.903   -3.184  -20.780 1.00 45.16  ? 2235 HOH B O   1 
HETATM 9086 O O   . HOH O 7 .   ? -3.015  1.408   -36.917 1.00 39.52  ? 2236 HOH B O   1 
HETATM 9087 O O   . HOH O 7 .   ? -6.994  -2.514  -33.881 1.00 55.10  ? 2237 HOH B O   1 
HETATM 9088 O O   . HOH O 7 .   ? -7.876  8.030   -45.247 1.00 38.74  ? 2238 HOH B O   1 
HETATM 9089 O O   . HOH O 7 .   ? -16.000 1.134   -37.171 1.00 55.98  ? 2239 HOH B O   1 
HETATM 9090 O O   . HOH O 7 .   ? -15.604 -7.797  -38.307 0.50 49.96  ? 2240 HOH B O   1 
HETATM 9091 O O   . HOH O 7 .   ? -20.397 2.489   -29.948 1.00 72.64  ? 2241 HOH B O   1 
HETATM 9092 O O   . HOH O 7 .   ? -19.998 6.769   -23.538 0.50 52.73  ? 2242 HOH B O   1 
HETATM 9093 O O   . HOH O 7 .   ? -9.509  18.205  -34.130 1.00 51.87  ? 2243 HOH B O   1 
HETATM 9094 O O   . HOH O 7 .   ? -8.856  20.232  -29.558 1.00 49.06  ? 2244 HOH B O   1 
HETATM 9095 O O   . HOH O 7 .   ? -1.831  25.200  -47.622 1.00 43.06  ? 2245 HOH B O   1 
HETATM 9096 O O   . HOH O 7 .   ? -8.640  20.419  -47.527 1.00 69.59  ? 2246 HOH B O   1 
HETATM 9097 O O   . HOH O 7 .   ? -13.994 31.322  -25.530 1.00 43.35  ? 2247 HOH B O   1 
HETATM 9098 O O   . HOH O 7 .   ? -13.452 31.790  -31.908 1.00 71.31  ? 2248 HOH B O   1 
HETATM 9099 O O   . HOH O 7 .   ? -4.063  27.915  -30.973 1.00 51.18  ? 2249 HOH B O   1 
HETATM 9100 O O   . HOH O 7 .   ? -1.745  27.082  -29.806 1.00 42.47  ? 2250 HOH B O   1 
HETATM 9101 O O   . HOH O 7 .   ? 3.235   20.626  -28.531 1.00 34.03  ? 2251 HOH B O   1 
HETATM 9102 O O   . HOH O 7 .   ? 4.360   27.399  -26.873 1.00 39.86  ? 2252 HOH B O   1 
HETATM 9103 O O   . HOH O 7 .   ? 5.954   24.487  -24.963 1.00 33.69  ? 2253 HOH B O   1 
HETATM 9104 O O   . HOH O 7 .   ? 13.669  18.433  -25.839 1.00 60.64  ? 2254 HOH B O   1 
HETATM 9105 O O   . HOH O 7 .   ? 7.861   25.330  -31.604 1.00 37.79  ? 2255 HOH B O   1 
HETATM 9106 O O   . HOH O 7 .   ? 8.304   28.359  -23.950 1.00 56.85  ? 2256 HOH B O   1 
HETATM 9107 O O   . HOH O 7 .   ? 12.070  26.809  -28.356 1.00 40.62  ? 2257 HOH B O   1 
HETATM 9108 O O   . HOH O 7 .   ? 12.001  28.027  -25.674 1.00 53.30  ? 2258 HOH B O   1 
HETATM 9109 O O   . HOH O 7 .   ? 10.687  17.340  -22.999 1.00 33.78  ? 2259 HOH B O   1 
HETATM 9110 O O   . HOH O 7 .   ? 14.305  18.086  -21.054 1.00 50.83  ? 2260 HOH B O   1 
HETATM 9111 O O   . HOH O 7 .   ? 1.244   23.960  -19.684 1.00 50.59  ? 2261 HOH B O   1 
HETATM 9112 O O   . HOH O 7 .   ? 1.174   27.691  -23.644 1.00 61.03  ? 2262 HOH B O   1 
HETATM 9113 O O   . HOH O 7 .   ? 4.838   15.041  -18.507 1.00 45.95  ? 2263 HOH B O   1 
HETATM 9114 O O   . HOH O 7 .   ? 2.729   11.885  -20.390 1.00 41.39  ? 2264 HOH B O   1 
HETATM 9115 O O   . HOH O 7 .   ? -8.998  7.823   -23.530 1.00 65.93  ? 2265 HOH B O   1 
HETATM 9116 O O   . HOH O 7 .   ? -7.206  14.124  -26.624 1.00 35.20  ? 2266 HOH B O   1 
HETATM 9117 O O   . HOH O 7 .   ? -6.503  14.279  -23.277 1.00 52.14  ? 2267 HOH B O   1 
HETATM 9118 O O   . HOH O 7 .   ? -9.881  18.608  -27.456 1.00 55.14  ? 2268 HOH B O   1 
HETATM 9119 O O   . HOH O 7 .   ? -2.440  12.777  -17.095 1.00 75.80  ? 2269 HOH B O   1 
HETATM 9120 O O   . HOH O 7 .   ? -4.499  21.286  -20.382 1.00 45.71  ? 2270 HOH B O   1 
HETATM 9121 O O   . HOH O 7 .   ? 0.881   21.659  -18.385 1.00 53.74  ? 2271 HOH B O   1 
HETATM 9122 O O   . HOH O 7 .   ? 2.783   17.487  -16.923 1.00 50.52  ? 2272 HOH B O   1 
HETATM 9123 O O   . HOH O 7 .   ? 5.315   18.024  -15.714 1.00 54.96  ? 2273 HOH B O   1 
HETATM 9124 O O   . HOH O 7 .   ? 12.391  15.355  -22.701 1.00 36.97  ? 2274 HOH B O   1 
HETATM 9125 O O   . HOH O 7 .   ? 6.363   12.411  -19.076 1.00 64.15  ? 2275 HOH B O   1 
HETATM 9126 O O   . HOH O 7 .   ? 4.620   9.593   -20.537 1.00 48.02  ? 2276 HOH B O   1 
HETATM 9127 O O   . HOH O 7 .   ? 4.710   6.305   -21.556 1.00 60.83  ? 2277 HOH B O   1 
HETATM 9128 O O   . HOH O 7 .   ? 8.836   14.463  -17.799 1.00 42.74  ? 2278 HOH B O   1 
HETATM 9129 O O   . HOH O 7 .   ? 15.424  15.738  -20.880 1.00 41.04  ? 2279 HOH B O   1 
HETATM 9130 O O   . HOH O 7 .   ? 10.439  13.122  -16.026 1.00 48.67  ? 2280 HOH B O   1 
HETATM 9131 O O   . HOH O 7 .   ? 11.139  10.821  -16.846 1.00 35.70  ? 2281 HOH B O   1 
HETATM 9132 O O   . HOH O 7 .   ? 18.159  9.253   -27.905 1.00 41.29  ? 2282 HOH B O   1 
HETATM 9133 O O   . HOH O 7 .   ? 17.260  15.966  -25.083 1.00 48.59  ? 2283 HOH B O   1 
HETATM 9134 O O   . HOH O 7 .   ? 17.735  15.804  -22.165 1.00 58.26  ? 2284 HOH B O   1 
HETATM 9135 O O   . HOH O 7 .   ? 35.543  3.494   -25.962 1.00 74.17  ? 2285 HOH B O   1 
HETATM 9136 O O   . HOH O 7 .   ? 4.408   -19.876 -25.112 1.00 66.83  ? 2286 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.3032 1.2371 1.0407 0.0833  -0.0346 -0.0001 1    GLU A N   
2    C CA  . GLU A 1   ? 1.2743 1.2092 1.0111 0.0853  -0.0250 0.0009  1    GLU A CA  
3    C C   . GLU A 1   ? 1.2628 1.1980 0.9797 0.0917  -0.0222 -0.0003 1    GLU A C   
4    O O   . GLU A 1   ? 1.3081 1.2428 1.0124 0.0940  -0.0269 0.0000  1    GLU A O   
5    C CB  . GLU A 1   ? 1.2048 1.1441 0.9525 0.0825  -0.0178 0.0099  1    GLU A CB  
6    C CG  . GLU A 1   ? 1.0881 1.0294 0.8267 0.0844  -0.0153 0.0180  1    GLU A CG  
7    C CD  . GLU A 1   ? 1.0530 0.9950 0.8027 0.0804  -0.0104 0.0263  1    GLU A CD  
8    O OE1 . GLU A 1   ? 0.9474 0.8918 0.6949 0.0798  -0.0021 0.0317  1    GLU A OE1 
9    O OE2 . GLU A 1   ? 1.0626 1.0028 0.8226 0.0776  -0.0149 0.0275  1    GLU A OE2 
10   N N   . GLY A 2   ? 1.1716 1.1086 0.8856 0.0948  -0.0144 -0.0014 2    GLY A N   
11   C CA  . GLY A 2   ? 1.0342 0.9726 0.7293 0.1016  -0.0108 -0.0030 2    GLY A CA  
12   C C   . GLY A 2   ? 0.9819 0.9230 0.6775 0.1053  -0.0031 -0.0058 2    GLY A C   
13   O O   . GLY A 2   ? 0.8863 0.8356 0.5788 0.1077  0.0058  -0.0004 2    GLY A O   
14   N N   . ARG A 3   ? 1.0649 0.9994 0.7645 0.1056  -0.0065 -0.0137 3    ARG A N   
15   C CA  . ARG A 3   ? 1.0518 0.9883 0.7525 0.1101  0.0001  -0.0170 3    ARG A CA  
16   C C   . ARG A 3   ? 1.0725 1.0119 0.7942 0.1050  0.0027  -0.0147 3    ARG A C   
17   O O   . ARG A 3   ? 1.1802 1.1232 0.9055 0.1084  0.0083  -0.0162 3    ARG A O   
18   C CB  . ARG A 3   ? 1.0025 0.9276 0.6890 0.1161  -0.0046 -0.0279 3    ARG A CB  
19   C CG  . ARG A 3   ? 1.1795 1.1055 0.8439 0.1256  -0.0007 -0.0308 3    ARG A CG  
20   C CD  . ARG A 3   ? 1.1573 1.0853 0.8094 0.1253  -0.0034 -0.0273 3    ARG A CD  
21   N NE  . ARG A 3   ? 1.1571 1.0801 0.7850 0.1334  -0.0047 -0.0335 3    ARG A NE  
22   C CZ  . ARG A 3   ? 1.1630 1.0938 0.7781 0.1411  0.0037  -0.0315 3    ARG A CZ  
23   N NH1 . ARG A 3   ? 1.1190 1.0639 0.7439 0.1412  0.0141  -0.0232 3    ARG A NH1 
24   N NH2 . ARG A 3   ? 1.2053 1.1303 0.7973 0.1485  0.0017  -0.0378 3    ARG A NH2 
25   N N   . GLU A 4   ? 0.9922 0.9307 0.7274 0.0974  -0.0015 -0.0111 4    GLU A N   
26   C CA  . GLU A 4   ? 0.9464 0.8877 0.7009 0.0922  0.0007  -0.0086 4    GLU A CA  
27   C C   . GLU A 4   ? 0.8759 0.8291 0.6365 0.0919  0.0107  -0.0015 4    GLU A C   
28   O O   . GLU A 4   ? 0.8876 0.8467 0.6397 0.0937  0.0154  0.0035  4    GLU A O   
29   C CB  . GLU A 4   ? 1.0652 1.0045 0.8311 0.0849  -0.0049 -0.0051 4    GLU A CB  
30   C CG  . GLU A 4   ? 1.1959 1.1265 0.9590 0.0832  -0.0152 -0.0109 4    GLU A CG  
31   C CD  . GLU A 4   ? 1.3046 1.2361 1.0820 0.0766  -0.0194 -0.0070 4    GLU A CD  
32   O OE1 . GLU A 4   ? 1.3431 1.2738 1.1168 0.0755  -0.0256 -0.0063 4    GLU A OE1 
33   O OE2 . GLU A 4   ? 1.3575 1.2915 1.1496 0.0730  -0.0162 -0.0045 4    GLU A OE2 
34   N N   . ASP A 5   ? 0.8033 0.7602 0.5787 0.0891  0.0137  -0.0007 5    ASP A N   
35   C CA  . ASP A 5   ? 0.7378 0.7068 0.5221 0.0867  0.0223  0.0063  5    ASP A CA  
36   C C   . ASP A 5   ? 0.7745 0.7443 0.5644 0.0795  0.0225  0.0142  5    ASP A C   
37   O O   . ASP A 5   ? 0.7161 0.6802 0.5155 0.0744  0.0176  0.0145  5    ASP A O   
38   C CB  . ASP A 5   ? 0.6505 0.6224 0.4495 0.0852  0.0238  0.0045  5    ASP A CB  
39   C CG  . ASP A 5   ? 0.7045 0.6904 0.5135 0.0819  0.0321  0.0115  5    ASP A CG  
40   O OD1 . ASP A 5   ? 0.7361 0.7273 0.5434 0.0783  0.0359  0.0185  5    ASP A OD1 
41   O OD2 . ASP A 5   ? 0.7138 0.7055 0.5323 0.0827  0.0346  0.0103  5    ASP A OD2 
42   N N   . PRO A 6   ? 0.8367 0.8132 0.6200 0.0793  0.0284  0.0209  6    PRO A N   
43   C CA  . PRO A 6   ? 0.8202 0.7955 0.6055 0.0731  0.0293  0.0290  6    PRO A CA  
44   C C   . PRO A 6   ? 0.7264 0.7035 0.5281 0.0653  0.0312  0.0331  6    PRO A C   
45   O O   . PRO A 6   ? 0.6980 0.6696 0.5020 0.0603  0.0299  0.0382  6    PRO A O   
46   C CB  . PRO A 6   ? 0.8801 0.8637 0.6543 0.0750  0.0366  0.0349  6    PRO A CB  
47   C CG  . PRO A 6   ? 0.8191 0.8125 0.5918 0.0809  0.0414  0.0305  6    PRO A CG  
48   C CD  . PRO A 6   ? 0.7831 0.7674 0.5535 0.0859  0.0342  0.0209  6    PRO A CD  
49   N N   . GLN A 7   ? 0.7124 0.6964 0.5244 0.0646  0.0342  0.0310  7    GLN A N   
50   C CA  . GLN A 7   ? 0.6995 0.6853 0.5266 0.0571  0.0355  0.0342  7    GLN A CA  
51   C C   . GLN A 7   ? 0.7050 0.6815 0.5410 0.0551  0.0285  0.0301  7    GLN A C   
52   O O   . GLN A 7   ? 0.7686 0.7444 0.6155 0.0490  0.0287  0.0327  7    GLN A O   
53   C CB  . GLN A 7   ? 0.8919 0.8907 0.7271 0.0572  0.0413  0.0341  7    GLN A CB  
54   C CG  . GLN A 7   ? 0.9418 0.9529 0.7770 0.0531  0.0493  0.0419  7    GLN A CG  
55   C CD  . GLN A 7   ? 0.9193 0.9267 0.7611 0.0429  0.0499  0.0486  7    GLN A CD  
56   O OE1 . GLN A 7   ? 0.8017 0.8030 0.6535 0.0387  0.0463  0.0471  7    GLN A OE1 
57   N NE2 . GLN A 7   ? 0.9305 0.9407 0.7657 0.0389  0.0546  0.0560  7    GLN A NE2 
58   N N   . LEU A 8   ? 0.6478 0.6173 0.4787 0.0597  0.0223  0.0239  8    LEU A N   
59   C CA  . LEU A 8   ? 0.5895 0.5521 0.4295 0.0576  0.0158  0.0200  8    LEU A CA  
60   C C   . LEU A 8   ? 0.5825 0.5373 0.4199 0.0564  0.0098  0.0210  8    LEU A C   
61   O O   . LEU A 8   ? 0.6280 0.5785 0.4718 0.0551  0.0040  0.0178  8    LEU A O   
62   C CB  . LEU A 8   ? 0.5566 0.5170 0.3953 0.0622  0.0125  0.0121  8    LEU A CB  
63   C CG  . LEU A 8   ? 0.5775 0.5458 0.4204 0.0646  0.0180  0.0109  8    LEU A CG  
64   C CD1 . LEU A 8   ? 0.5135 0.4764 0.3515 0.0706  0.0147  0.0030  8    LEU A CD1 
65   C CD2 . LEU A 8   ? 0.5457 0.5187 0.4043 0.0587  0.0202  0.0139  8    LEU A CD2 
66   N N   . LEU A 9   ? 0.6115 0.5654 0.4394 0.0571  0.0111  0.0259  9    LEU A N   
67   C CA  . LEU A 9   ? 0.5761 0.5238 0.4008 0.0572  0.0055  0.0274  9    LEU A CA  
68   C C   . LEU A 9   ? 0.6645 0.6094 0.4933 0.0529  0.0082  0.0346  9    LEU A C   
69   O O   . LEU A 9   ? 0.6086 0.5548 0.4324 0.0513  0.0140  0.0402  9    LEU A O   
70   C CB  . LEU A 9   ? 0.6203 0.5671 0.4291 0.0623  0.0037  0.0273  9    LEU A CB  
71   C CG  . LEU A 9   ? 0.7691 0.7167 0.5701 0.0671  0.0014  0.0199  9    LEU A CG  
72   C CD1 . LEU A 9   ? 0.7816 0.7288 0.5650 0.0722  0.0007  0.0203  9    LEU A CD1 
73   C CD2 . LEU A 9   ? 0.7868 0.7303 0.5939 0.0664  -0.0064 0.0132  9    LEU A CD2 
74   N N   . VAL A 10  ? 0.5552 0.4960 0.3925 0.0509  0.0040  0.0344  10   VAL A N   
75   C CA  . VAL A 10  ? 0.5613 0.4973 0.4025 0.0473  0.0061  0.0402  10   VAL A CA  
76   C C   . VAL A 10  ? 0.6278 0.5588 0.4695 0.0496  0.0002  0.0409  10   VAL A C   
77   O O   . VAL A 10  ? 0.6851 0.6184 0.5314 0.0513  -0.0056 0.0362  10   VAL A O   
78   C CB  . VAL A 10  ? 0.6558 0.5937 0.5100 0.0419  0.0091  0.0393  10   VAL A CB  
79   C CG1 . VAL A 10  ? 0.6548 0.5855 0.5125 0.0384  0.0100  0.0439  10   VAL A CG1 
80   C CG2 . VAL A 10  ? 0.6577 0.6025 0.5117 0.0397  0.0155  0.0401  10   VAL A CG2 
81   N N   . ARG A 11  ? 0.5432 0.4673 0.3798 0.0497  0.0015  0.0470  11   ARG A N   
82   C CA  . ARG A 11  ? 0.5540 0.4743 0.3916 0.0529  -0.0035 0.0483  11   ARG A CA  
83   C C   . ARG A 11  ? 0.5957 0.5104 0.4418 0.0498  -0.0017 0.0501  11   ARG A C   
84   O O   . ARG A 11  ? 0.5818 0.4909 0.4264 0.0456  0.0036  0.0537  11   ARG A O   
85   C CB  . ARG A 11  ? 0.5359 0.4511 0.3598 0.0574  -0.0042 0.0538  11   ARG A CB  
86   C CG  . ARG A 11  ? 0.5719 0.4829 0.3964 0.0618  -0.0085 0.0564  11   ARG A CG  
87   C CD  . ARG A 11  ? 0.5618 0.4687 0.3719 0.0675  -0.0101 0.0619  11   ARG A CD  
88   N NE  . ARG A 11  ? 0.5566 0.4717 0.3607 0.0709  -0.0145 0.0587  11   ARG A NE  
89   C CZ  . ARG A 11  ? 0.6372 0.5592 0.4439 0.0747  -0.0219 0.0558  11   ARG A CZ  
90   N NH1 . ARG A 11  ? 0.6558 0.5840 0.4553 0.0769  -0.0260 0.0528  11   ARG A NH1 
91   N NH2 . ARG A 11  ? 0.6370 0.5603 0.4531 0.0763  -0.0251 0.0560  11   ARG A NH2 
92   N N   . VAL A 12  ? 0.5380 0.4547 0.3928 0.0514  -0.0062 0.0475  12   VAL A N   
93   C CA  . VAL A 12  ? 0.4557 0.3668 0.3168 0.0503  -0.0053 0.0492  12   VAL A CA  
94   C C   . VAL A 12  ? 0.5835 0.4925 0.4420 0.0568  -0.0095 0.0517  12   VAL A C   
95   O O   . VAL A 12  ? 0.6034 0.5167 0.4562 0.0613  -0.0135 0.0520  12   VAL A O   
96   C CB  . VAL A 12  ? 0.4568 0.3736 0.3318 0.0464  -0.0057 0.0442  12   VAL A CB  
97   C CG1 . VAL A 12  ? 0.4630 0.3815 0.3400 0.0407  -0.0009 0.0429  12   VAL A CG1 
98   C CG2 . VAL A 12  ? 0.4476 0.3741 0.3290 0.0484  -0.0116 0.0394  12   VAL A CG2 
99   N N   . ARG A 13  ? 0.5855 0.4880 0.4472 0.0577  -0.0086 0.0535  13   ARG A N   
100  C CA  . ARG A 13  ? 0.6132 0.5132 0.4720 0.0652  -0.0117 0.0566  13   ARG A CA  
101  C C   . ARG A 13  ? 0.6016 0.5158 0.4661 0.0693  -0.0184 0.0538  13   ARG A C   
102  O O   . ARG A 13  ? 0.6283 0.5442 0.4870 0.0757  -0.0218 0.0567  13   ARG A O   
103  C CB  . ARG A 13  ? 0.5187 0.4115 0.3822 0.0654  -0.0097 0.0571  13   ARG A CB  
104  C CG  . ARG A 13  ? 0.5887 0.4795 0.4506 0.0743  -0.0124 0.0598  13   ARG A CG  
105  C CD  . ARG A 13  ? 0.6968 0.5760 0.5436 0.0808  -0.0121 0.0661  13   ARG A CD  
106  N NE  . ARG A 13  ? 0.8181 0.7103 0.6653 0.0870  -0.0178 0.0664  13   ARG A NE  
107  C CZ  . ARG A 13  ? 0.7281 0.6232 0.5741 0.0962  -0.0212 0.0691  13   ARG A CZ  
108  N NH1 . ARG A 13  ? 0.6199 0.5036 0.4622 0.1018  -0.0191 0.0721  13   ARG A NH1 
109  N NH2 . ARG A 13  ? 0.8607 0.7701 0.7082 0.1002  -0.0268 0.0690  13   ARG A NH2 
110  N N   . GLY A 14  ? 0.5297 0.4540 0.4050 0.0651  -0.0204 0.0484  14   GLY A N   
111  C CA  . GLY A 14  ? 0.5398 0.4772 0.4209 0.0669  -0.0269 0.0456  14   GLY A CA  
112  C C   . GLY A 14  ? 0.6269 0.5690 0.5014 0.0664  -0.0303 0.0434  14   GLY A C   
113  O O   . GLY A 14  ? 0.6028 0.5549 0.4800 0.0677  -0.0366 0.0414  14   GLY A O   
114  N N   . GLY A 15  ? 0.5912 0.5268 0.4570 0.0643  -0.0263 0.0437  15   GLY A N   
115  C CA  . GLY A 15  ? 0.6206 0.5596 0.4783 0.0647  -0.0291 0.0414  15   GLY A CA  
116  C C   . GLY A 15  ? 0.6489 0.5850 0.5033 0.0606  -0.0245 0.0388  15   GLY A C   
117  O O   . GLY A 15  ? 0.6293 0.5604 0.4859 0.0574  -0.0186 0.0402  15   GLY A O   
118  N N   . GLN A 16  ? 0.5929 0.5328 0.4417 0.0609  -0.0275 0.0348  16   GLN A N   
119  C CA  . GLN A 16  ? 0.6490 0.5872 0.4927 0.0590  -0.0233 0.0323  16   GLN A CA  
120  C C   . GLN A 16  ? 0.5948 0.5356 0.4481 0.0552  -0.0241 0.0263  16   GLN A C   
121  O O   . GLN A 16  ? 0.5881 0.5327 0.4478 0.0542  -0.0299 0.0227  16   GLN A O   
122  C CB  . GLN A 16  ? 0.6287 0.5680 0.4585 0.0625  -0.0259 0.0309  16   GLN A CB  
123  C CG  . GLN A 16  ? 0.7208 0.6565 0.5381 0.0661  -0.0231 0.0373  16   GLN A CG  
124  C CD  . GLN A 16  ? 0.8186 0.7564 0.6221 0.0699  -0.0266 0.0356  16   GLN A CD  
125  O OE1 . GLN A 16  ? 0.8590 0.8006 0.6608 0.0721  -0.0340 0.0337  16   GLN A OE1 
126  N NE2 . GLN A 16  ? 0.7232 0.6596 0.5165 0.0706  -0.0214 0.0362  16   GLN A NE2 
127  N N   . LEU A 17  ? 0.5386 0.4780 0.3926 0.0531  -0.0182 0.0255  17   LEU A N   
128  C CA  . LEU A 17  ? 0.5342 0.4752 0.3964 0.0502  -0.0181 0.0204  17   LEU A CA  
129  C C   . LEU A 17  ? 0.5752 0.5163 0.4292 0.0519  -0.0151 0.0174  17   LEU A C   
130  O O   . LEU A 17  ? 0.5703 0.5115 0.4159 0.0536  -0.0103 0.0208  17   LEU A O   
131  C CB  . LEU A 17  ? 0.5570 0.4977 0.4300 0.0464  -0.0133 0.0226  17   LEU A CB  
132  C CG  . LEU A 17  ? 0.6202 0.5600 0.5015 0.0450  -0.0146 0.0255  17   LEU A CG  
133  C CD1 . LEU A 17  ? 0.5909 0.5290 0.4788 0.0414  -0.0090 0.0277  17   LEU A CD1 
134  C CD2 . LEU A 17  ? 0.6542 0.5976 0.5441 0.0441  -0.0207 0.0217  17   LEU A CD2 
135  N N   . ARG A 18  ? 0.5233 0.4642 0.3792 0.0517  -0.0178 0.0114  18   ARG A N   
136  C CA  . ARG A 18  ? 0.5133 0.4540 0.3627 0.0542  -0.0143 0.0081  18   ARG A CA  
137  C C   . ARG A 18  ? 0.5367 0.4782 0.3971 0.0518  -0.0120 0.0060  18   ARG A C   
138  O O   . ARG A 18  ? 0.5512 0.4903 0.4184 0.0496  -0.0166 0.0026  18   ARG A O   
139  C CB  . ARG A 18  ? 0.5396 0.4767 0.3781 0.0573  -0.0198 0.0021  18   ARG A CB  
140  C CG  . ARG A 18  ? 0.6329 0.5685 0.4644 0.0611  -0.0163 -0.0023 18   ARG A CG  
141  C CD  . ARG A 18  ? 0.7643 0.6939 0.5817 0.0647  -0.0218 -0.0086 18   ARG A CD  
142  N NE  . ARG A 18  ? 0.8883 0.8139 0.7094 0.0609  -0.0305 -0.0119 18   ARG A NE  
143  C CZ  . ARG A 18  ? 0.9097 0.8357 0.7257 0.0602  -0.0367 -0.0117 18   ARG A CZ  
144  N NH1 . ARG A 18  ? 0.8142 0.7428 0.6196 0.0637  -0.0353 -0.0087 18   ARG A NH1 
145  N NH2 . ARG A 18  ? 0.9531 0.8776 0.7744 0.0557  -0.0444 -0.0143 18   ARG A NH2 
146  N N   . GLY A 19  ? 0.4822 0.4277 0.3441 0.0519  -0.0050 0.0085  19   GLY A N   
147  C CA  . GLY A 19  ? 0.4466 0.3945 0.3186 0.0502  -0.0024 0.0073  19   GLY A CA  
148  C C   . GLY A 19  ? 0.5454 0.4931 0.4114 0.0550  -0.0011 0.0024  19   GLY A C   
149  O O   . GLY A 19  ? 0.5640 0.5080 0.4179 0.0593  -0.0033 -0.0010 19   GLY A O   
150  N N   . ILE A 20  ? 0.5040 0.4555 0.3776 0.0549  0.0024  0.0020  20   ILE A N   
151  C CA  . ILE A 20  ? 0.5223 0.4733 0.3907 0.0607  0.0039  -0.0025 20   ILE A CA  
152  C C   . ILE A 20  ? 0.5355 0.4978 0.4089 0.0620  0.0115  0.0007  20   ILE A C   
153  O O   . ILE A 20  ? 0.5667 0.5351 0.4510 0.0568  0.0140  0.0051  20   ILE A O   
154  C CB  . ILE A 20  ? 0.5316 0.4744 0.4039 0.0604  -0.0014 -0.0075 20   ILE A CB  
155  C CG1 . ILE A 20  ? 0.5902 0.5295 0.4547 0.0677  -0.0001 -0.0126 20   ILE A CG1 
156  C CG2 . ILE A 20  ? 0.4991 0.4455 0.3864 0.0552  -0.0006 -0.0047 20   ILE A CG2 
157  C CD1 . ILE A 20  ? 0.5663 0.4960 0.4341 0.0672  -0.0047 -0.0168 20   ILE A CD1 
158  N N   . ARG A 21  ? 0.5281 0.4936 0.3931 0.0691  0.0150  -0.0015 21   ARG A N   
159  C CA  . ARG A 21  ? 0.5304 0.5093 0.4000 0.0711  0.0223  0.0016  21   ARG A CA  
160  C C   . ARG A 21  ? 0.5653 0.5436 0.4416 0.0739  0.0216  -0.0016 21   ARG A C   
161  O O   . ARG A 21  ? 0.6051 0.5742 0.4737 0.0801  0.0187  -0.0074 21   ARG A O   
162  C CB  . ARG A 21  ? 0.5748 0.5590 0.4316 0.0786  0.0268  0.0010  21   ARG A CB  
163  C CG  . ARG A 21  ? 0.5502 0.5519 0.4113 0.0810  0.0350  0.0050  21   ARG A CG  
164  C CD  . ARG A 21  ? 0.5427 0.5492 0.3897 0.0905  0.0393  0.0032  21   ARG A CD  
165  N NE  . ARG A 21  ? 0.8706 0.8859 0.7199 0.0982  0.0433  0.0014  21   ARG A NE  
166  C CZ  . ARG A 21  ? 0.9892 1.0225 0.8385 0.1027  0.0511  0.0048  21   ARG A CZ  
167  N NH1 . ARG A 21  ? 1.0373 1.0810 0.8834 0.0996  0.0558  0.0105  21   ARG A NH1 
168  N NH2 . ARG A 21  ? 0.9921 1.0334 0.8444 0.1105  0.0541  0.0030  21   ARG A NH2 
169  N N   . LEU A 22  ? 0.5385 0.5252 0.4280 0.0694  0.0238  0.0021  22   LEU A N   
170  C CA  . LEU A 22  ? 0.5421 0.5290 0.4384 0.0720  0.0231  -0.0002 22   LEU A CA  
171  C C   . LEU A 22  ? 0.5960 0.5990 0.4957 0.0768  0.0298  0.0021  22   LEU A C   
172  O O   . LEU A 22  ? 0.6132 0.6297 0.5150 0.0744  0.0349  0.0070  22   LEU A O   
173  C CB  . LEU A 22  ? 0.5553 0.5406 0.4644 0.0638  0.0202  0.0019  22   LEU A CB  
174  C CG  . LEU A 22  ? 0.5282 0.4996 0.4360 0.0595  0.0135  -0.0003 22   LEU A CG  
175  C CD1 . LEU A 22  ? 0.5453 0.5172 0.4655 0.0526  0.0117  0.0020  22   LEU A CD1 
176  C CD2 . LEU A 22  ? 0.5475 0.5057 0.4465 0.0648  0.0087  -0.0065 22   LEU A CD2 
177  N N   . LYS A 23  ? 0.6193 0.6214 0.5198 0.0835  0.0295  -0.0010 23   LYS A N   
178  C CA  . LYS A 23  ? 0.6216 0.6405 0.5264 0.0892  0.0355  0.0012  23   LYS A CA  
179  C C   . LYS A 23  ? 0.6197 0.6481 0.5398 0.0832  0.0357  0.0051  23   LYS A C   
180  O O   . LYS A 23  ? 0.5807 0.5993 0.5050 0.0817  0.0312  0.0031  23   LYS A O   
181  C CB  . LYS A 23  ? 0.8305 0.8419 0.7258 0.1016  0.0350  -0.0044 23   LYS A CB  
182  C CG  . LYS A 23  ? 1.0517 1.0789 0.9427 0.1117  0.0420  -0.0036 23   LYS A CG  
183  C CD  . LYS A 23  ? 1.1772 1.2231 1.0812 0.1134  0.0459  0.0004  23   LYS A CD  
184  C CE  . LYS A 23  ? 1.2369 1.2983 1.1362 0.1259  0.0525  0.0006  23   LYS A CE  
185  N NZ  . LYS A 23  ? 1.2397 1.3185 1.1514 0.1290  0.0551  0.0038  23   LYS A NZ  
186  N N   . ALA A 24  ? 0.5748 0.6224 0.5031 0.0790  0.0407  0.0107  24   ALA A N   
187  C CA  . ALA A 24  ? 0.5248 0.5843 0.4667 0.0747  0.0414  0.0141  24   ALA A CA  
188  C C   . ALA A 24  ? 0.5981 0.6777 0.5425 0.0827  0.0470  0.0159  24   ALA A C   
189  O O   . ALA A 24  ? 0.5847 0.6707 0.5214 0.0891  0.0512  0.0158  24   ALA A O   
190  C CB  . ALA A 24  ? 0.4847 0.5501 0.4345 0.0620  0.0419  0.0192  24   ALA A CB  
191  N N   . PRO A 25  ? 0.6282 0.7187 0.5832 0.0831  0.0471  0.0176  25   PRO A N   
192  C CA  . PRO A 25  ? 0.5879 0.6981 0.5456 0.0928  0.0520  0.0191  25   PRO A CA  
193  C C   . PRO A 25  ? 0.5805 0.7115 0.5385 0.0920  0.0587  0.0236  25   PRO A C   
194  O O   . PRO A 25  ? 0.5865 0.7258 0.5382 0.1031  0.0629  0.0226  25   PRO A O   
195  C CB  . PRO A 25  ? 0.6042 0.7259 0.5757 0.0883  0.0507  0.0222  25   PRO A CB  
196  C CG  . PRO A 25  ? 0.5957 0.6959 0.5675 0.0819  0.0442  0.0195  25   PRO A CG  
197  C CD  . PRO A 25  ? 0.5434 0.6299 0.5082 0.0750  0.0429  0.0186  25   PRO A CD  
198  N N   . GLY A 26  ? 0.5768 0.7151 0.5408 0.0790  0.0596  0.0285  26   GLY A N   
199  C CA  . GLY A 26  ? 0.5422 0.7006 0.5072 0.0760  0.0659  0.0338  26   GLY A CA  
200  C C   . GLY A 26  ? 0.6416 0.7904 0.5941 0.0757  0.0676  0.0334  26   GLY A C   
201  O O   . GLY A 26  ? 0.5769 0.7416 0.5293 0.0724  0.0730  0.0385  26   GLY A O   
202  N N   . GLY A 27  ? 0.6148 0.7388 0.5567 0.0786  0.0630  0.0279  27   GLY A N   
203  C CA  . GLY A 27  ? 0.5727 0.6869 0.5020 0.0786  0.0637  0.0274  27   GLY A CA  
204  C C   . GLY A 27  ? 0.6210 0.7098 0.5446 0.0741  0.0570  0.0237  27   GLY A C   
205  O O   . GLY A 27  ? 0.6255 0.7041 0.5551 0.0705  0.0520  0.0217  27   GLY A O   
206  N N   . PRO A 28  ? 0.5968 0.6764 0.5087 0.0744  0.0569  0.0231  28   PRO A N   
207  C CA  . PRO A 28  ? 0.5026 0.5595 0.4083 0.0720  0.0503  0.0192  28   PRO A CA  
208  C C   . PRO A 28  ? 0.5370 0.5888 0.4499 0.0596  0.0477  0.0231  28   PRO A C   
209  O O   . PRO A 28  ? 0.4786 0.5422 0.3973 0.0524  0.0515  0.0291  28   PRO A O   
210  C CB  . PRO A 28  ? 0.5294 0.5819 0.4202 0.0768  0.0517  0.0182  28   PRO A CB  
211  C CG  . PRO A 28  ? 0.5381 0.6116 0.4303 0.0752  0.0596  0.0249  28   PRO A CG  
212  C CD  . PRO A 28  ? 0.5811 0.6710 0.4839 0.0786  0.0628  0.0255  28   PRO A CD  
213  N N   . VAL A 29  ? 0.4711 0.5056 0.3832 0.0573  0.0413  0.0198  29   VAL A N   
214  C CA  . VAL A 29  ? 0.4367 0.4643 0.3528 0.0475  0.0389  0.0230  29   VAL A CA  
215  C C   . VAL A 29  ? 0.5283 0.5395 0.4353 0.0488  0.0338  0.0199  29   VAL A C   
216  O O   . VAL A 29  ? 0.5683 0.5723 0.4682 0.0556  0.0310  0.0147  29   VAL A O   
217  C CB  . VAL A 29  ? 0.5378 0.5645 0.4663 0.0420  0.0361  0.0229  29   VAL A CB  
218  C CG1 . VAL A 29  ? 0.4826 0.5269 0.4207 0.0397  0.0405  0.0263  29   VAL A CG1 
219  C CG2 . VAL A 29  ? 0.5355 0.5518 0.4644 0.0468  0.0310  0.0172  29   VAL A CG2 
220  N N   . SER A 30  ? 0.4785 0.4834 0.3853 0.0422  0.0323  0.0231  30   SER A N   
221  C CA  . SER A 30  ? 0.5032 0.4946 0.4031 0.0431  0.0271  0.0209  30   SER A CA  
222  C C   . SER A 30  ? 0.5145 0.4980 0.4227 0.0395  0.0220  0.0191  30   SER A C   
223  O O   . SER A 30  ? 0.5028 0.4885 0.4194 0.0337  0.0229  0.0219  30   SER A O   
224  C CB  . SER A 30  ? 0.4976 0.4866 0.3912 0.0394  0.0287  0.0261  30   SER A CB  
225  O OG  . SER A 30  ? 0.6671 0.6643 0.5529 0.0420  0.0340  0.0287  30   SER A OG  
226  N N   . ALA A 31  ? 0.5244 0.4991 0.4297 0.0427  0.0165  0.0144  31   ALA A N   
227  C CA  . ALA A 31  ? 0.5397 0.5079 0.4523 0.0392  0.0116  0.0131  31   ALA A CA  
228  C C   . ALA A 31  ? 0.5597 0.5195 0.4666 0.0395  0.0065  0.0120  31   ALA A C   
229  O O   . ALA A 31  ? 0.5877 0.5443 0.4852 0.0438  0.0043  0.0092  31   ALA A O   
230  C CB  . ALA A 31  ? 0.4254 0.3927 0.3428 0.0414  0.0095  0.0089  31   ALA A CB  
231  N N   . PHE A 32  ? 0.5020 0.4591 0.4144 0.0354  0.0045  0.0143  32   PHE A N   
232  C CA  . PHE A 32  ? 0.4786 0.4300 0.3881 0.0358  -0.0007 0.0138  32   PHE A CA  
233  C C   . PHE A 32  ? 0.4543 0.4044 0.3738 0.0330  -0.0043 0.0124  32   PHE A C   
234  O O   . PHE A 32  ? 0.4764 0.4273 0.4027 0.0297  -0.0029 0.0151  32   PHE A O   
235  C CB  . PHE A 32  ? 0.4581 0.4079 0.3632 0.0348  0.0009  0.0188  32   PHE A CB  
236  C CG  . PHE A 32  ? 0.5089 0.4604 0.4039 0.0369  0.0050  0.0211  32   PHE A CG  
237  C CD1 . PHE A 32  ? 0.4027 0.3593 0.2990 0.0345  0.0111  0.0242  32   PHE A CD1 
238  C CD2 . PHE A 32  ? 0.4901 0.4393 0.3743 0.0409  0.0026  0.0204  32   PHE A CD2 
239  C CE1 . PHE A 32  ? 0.4592 0.4190 0.3463 0.0361  0.0153  0.0269  32   PHE A CE1 
240  C CE2 . PHE A 32  ? 0.5359 0.4873 0.4101 0.0430  0.0066  0.0228  32   PHE A CE2 
241  C CZ  . PHE A 32  ? 0.4968 0.4537 0.3726 0.0406  0.0132  0.0262  32   PHE A CZ  
242  N N   . LEU A 33  ? 0.4701 0.4179 0.3898 0.0341  -0.0089 0.0081  33   LEU A N   
243  C CA  . LEU A 33  ? 0.4693 0.4166 0.3984 0.0312  -0.0119 0.0068  33   LEU A CA  
244  C C   . LEU A 33  ? 0.4554 0.4013 0.3851 0.0302  -0.0179 0.0062  33   LEU A C   
245  O O   . LEU A 33  ? 0.4707 0.4146 0.3925 0.0321  -0.0212 0.0044  33   LEU A O   
246  C CB  . LEU A 33  ? 0.4826 0.4278 0.4117 0.0325  -0.0125 0.0029  33   LEU A CB  
247  C CG  . LEU A 33  ? 0.5736 0.5223 0.5013 0.0350  -0.0068 0.0033  33   LEU A CG  
248  C CD1 . LEU A 33  ? 0.4954 0.4401 0.4205 0.0384  -0.0081 -0.0011 33   LEU A CD1 
249  C CD2 . LEU A 33  ? 0.4604 0.4151 0.3973 0.0317  -0.0027 0.0069  33   LEU A CD2 
250  N N   . GLY A 34  ? 0.3962 0.3443 0.3351 0.0271  -0.0194 0.0076  34   GLY A N   
251  C CA  . GLY A 34  ? 0.4239 0.3737 0.3651 0.0260  -0.0249 0.0075  34   GLY A CA  
252  C C   . GLY A 34  ? 0.4893 0.4411 0.4266 0.0284  -0.0255 0.0105  34   GLY A C   
253  O O   . GLY A 34  ? 0.4891 0.4429 0.4242 0.0289  -0.0305 0.0099  34   GLY A O   
254  N N   . ILE A 35  ? 0.4835 0.4345 0.4196 0.0296  -0.0207 0.0140  35   ILE A N   
255  C CA  . ILE A 35  ? 0.4878 0.4387 0.4196 0.0324  -0.0210 0.0175  35   ILE A CA  
256  C C   . ILE A 35  ? 0.4908 0.4457 0.4305 0.0324  -0.0229 0.0194  35   ILE A C   
257  O O   . ILE A 35  ? 0.4583 0.4129 0.4041 0.0308  -0.0199 0.0205  35   ILE A O   
258  C CB  . ILE A 35  ? 0.4580 0.4045 0.3847 0.0331  -0.0152 0.0209  35   ILE A CB  
259  C CG1 . ILE A 35  ? 0.4257 0.3707 0.3453 0.0333  -0.0122 0.0198  35   ILE A CG1 
260  C CG2 . ILE A 35  ? 0.4330 0.3772 0.3538 0.0366  -0.0158 0.0248  35   ILE A CG2 
261  C CD1 . ILE A 35  ? 0.4666 0.4086 0.3824 0.0322  -0.0062 0.0238  35   ILE A CD1 
262  N N   . PRO A 36  ? 0.4949 0.4544 0.4342 0.0345  -0.0278 0.0200  36   PRO A N   
263  C CA  . PRO A 36  ? 0.4414 0.4069 0.3890 0.0352  -0.0291 0.0221  36   PRO A CA  
264  C C   . PRO A 36  ? 0.5527 0.5134 0.4974 0.0388  -0.0248 0.0259  36   PRO A C   
265  O O   . PRO A 36  ? 0.5535 0.5090 0.4888 0.0419  -0.0236 0.0279  36   PRO A O   
266  C CB  . PRO A 36  ? 0.4033 0.3763 0.3500 0.0372  -0.0354 0.0223  36   PRO A CB  
267  C CG  . PRO A 36  ? 0.4712 0.4389 0.4055 0.0394  -0.0359 0.0217  36   PRO A CG  
268  C CD  . PRO A 36  ? 0.3794 0.3403 0.3112 0.0363  -0.0324 0.0187  36   PRO A CD  
269  N N   . PHE A 37  ? 0.4992 0.4607 0.4505 0.0386  -0.0225 0.0269  37   PHE A N   
270  C CA  . PHE A 37  ? 0.4965 0.4512 0.4432 0.0425  -0.0190 0.0303  37   PHE A CA  
271  C C   . PHE A 37  ? 0.4730 0.4341 0.4246 0.0472  -0.0206 0.0322  37   PHE A C   
272  O O   . PHE A 37  ? 0.5361 0.4907 0.4830 0.0518  -0.0181 0.0349  37   PHE A O   
273  C CB  . PHE A 37  ? 0.5140 0.4604 0.4602 0.0390  -0.0137 0.0300  37   PHE A CB  
274  C CG  . PHE A 37  ? 0.4837 0.4348 0.4397 0.0357  -0.0131 0.0281  37   PHE A CG  
275  C CD1 . PHE A 37  ? 0.3753 0.3271 0.3346 0.0382  -0.0121 0.0292  37   PHE A CD1 
276  C CD2 . PHE A 37  ? 0.4746 0.4291 0.4355 0.0308  -0.0136 0.0252  37   PHE A CD2 
277  C CE1 . PHE A 37  ? 0.4343 0.3912 0.4021 0.0352  -0.0114 0.0277  37   PHE A CE1 
278  C CE2 . PHE A 37  ? 0.4361 0.3947 0.4054 0.0279  -0.0132 0.0239  37   PHE A CE2 
279  C CZ  . PHE A 37  ? 0.4717 0.4319 0.4446 0.0298  -0.0121 0.0253  37   PHE A CZ  
280  N N   . ALA A 38  ? 0.4757 0.4493 0.4362 0.0461  -0.0247 0.0311  38   ALA A N   
281  C CA  . ALA A 38  ? 0.4494 0.4333 0.4164 0.0504  -0.0263 0.0332  38   ALA A CA  
282  C C   . ALA A 38  ? 0.4696 0.4676 0.4422 0.0494  -0.0326 0.0329  38   ALA A C   
283  O O   . ALA A 38  ? 0.4572 0.4559 0.4302 0.0438  -0.0354 0.0302  38   ALA A O   
284  C CB  . ALA A 38  ? 0.4157 0.4025 0.3911 0.0481  -0.0236 0.0324  38   ALA A CB  
285  N N   . GLU A 39  ? 0.4106 0.4199 0.3871 0.0549  -0.0348 0.0358  39   GLU A N   
286  C CA  . GLU A 39  ? 0.4678 0.4940 0.4526 0.0525  -0.0409 0.0358  39   GLU A CA  
287  C C   . GLU A 39  ? 0.4577 0.4902 0.4531 0.0448  -0.0411 0.0339  39   GLU A C   
288  O O   . GLU A 39  ? 0.4754 0.5064 0.4748 0.0451  -0.0367 0.0342  39   GLU A O   
289  C CB  . GLU A 39  ? 0.4494 0.4893 0.4379 0.0605  -0.0425 0.0398  39   GLU A CB  
290  C CG  . GLU A 39  ? 0.5449 0.5812 0.5232 0.0679  -0.0441 0.0422  39   GLU A CG  
291  C CD  . GLU A 39  ? 0.6290 0.6688 0.6039 0.0639  -0.0502 0.0406  39   GLU A CD  
292  O OE1 . GLU A 39  ? 0.7246 0.7804 0.7078 0.0598  -0.0559 0.0402  39   GLU A OE1 
293  O OE2 . GLU A 39  ? 0.5673 0.5941 0.5308 0.0644  -0.0494 0.0398  39   GLU A OE2 
294  N N   . PRO A 40  ? 0.4915 0.5299 0.4904 0.0378  -0.0463 0.0318  40   PRO A N   
295  C CA  . PRO A 40  ? 0.4552 0.4982 0.4633 0.0301  -0.0468 0.0305  40   PRO A CA  
296  C C   . PRO A 40  ? 0.4754 0.5326 0.4942 0.0322  -0.0451 0.0338  40   PRO A C   
297  O O   . PRO A 40  ? 0.4448 0.5174 0.4686 0.0356  -0.0479 0.0367  40   PRO A O   
298  C CB  . PRO A 40  ? 0.4548 0.5040 0.4643 0.0235  -0.0542 0.0288  40   PRO A CB  
299  C CG  . PRO A 40  ? 0.4793 0.5202 0.4769 0.0270  -0.0561 0.0273  40   PRO A CG  
300  C CD  . PRO A 40  ? 0.4897 0.5314 0.4841 0.0367  -0.0525 0.0309  40   PRO A CD  
301  N N   . PRO A 41  ? 0.4441 0.4970 0.4659 0.0308  -0.0402 0.0335  41   PRO A N   
302  C CA  . PRO A 41  ? 0.4082 0.4736 0.4384 0.0340  -0.0376 0.0366  41   PRO A CA  
303  C C   . PRO A 41  ? 0.4456 0.5281 0.4878 0.0268  -0.0412 0.0380  41   PRO A C   
304  O O   . PRO A 41  ? 0.4142 0.4994 0.4622 0.0237  -0.0384 0.0387  41   PRO A O   
305  C CB  . PRO A 41  ? 0.4500 0.5025 0.4771 0.0344  -0.0315 0.0352  41   PRO A CB  
306  C CG  . PRO A 41  ? 0.4354 0.4768 0.4597 0.0263  -0.0328 0.0318  41   PRO A CG  
307  C CD  . PRO A 41  ? 0.3825 0.4194 0.3995 0.0273  -0.0366 0.0306  41   PRO A CD  
308  N N   . VAL A 42  ? 0.4826 0.5768 0.5282 0.0240  -0.0475 0.0389  42   VAL A N   
309  C CA  . VAL A 42  ? 0.4767 0.5853 0.5326 0.0147  -0.0520 0.0401  42   VAL A CA  
310  C C   . VAL A 42  ? 0.4829 0.6170 0.5490 0.0179  -0.0541 0.0448  42   VAL A C   
311  O O   . VAL A 42  ? 0.3905 0.5296 0.4543 0.0278  -0.0530 0.0465  42   VAL A O   
312  C CB  . VAL A 42  ? 0.4954 0.5972 0.5468 0.0065  -0.0587 0.0369  42   VAL A CB  
313  C CG1 . VAL A 42  ? 0.4552 0.5334 0.4962 0.0049  -0.0564 0.0324  42   VAL A CG1 
314  C CG2 . VAL A 42  ? 0.4679 0.5764 0.5155 0.0106  -0.0637 0.0372  42   VAL A CG2 
315  N N   . GLY A 43  ? 0.4291 0.5794 0.5064 0.0095  -0.0570 0.0471  43   GLY A N   
316  C CA  . GLY A 43  ? 0.3746 0.5525 0.4630 0.0115  -0.0592 0.0519  43   GLY A CA  
317  C C   . GLY A 43  ? 0.4216 0.6076 0.5123 0.0237  -0.0525 0.0549  43   GLY A C   
318  O O   . GLY A 43  ? 0.4447 0.6257 0.5361 0.0249  -0.0466 0.0550  43   GLY A O   
319  N N   . SER A 44  ? 0.3980 0.5956 0.4886 0.0337  -0.0535 0.0572  44   SER A N   
320  C CA  . SER A 44  ? 0.4733 0.6795 0.5655 0.0466  -0.0475 0.0603  44   SER A CA  
321  C C   . SER A 44  ? 0.4900 0.6700 0.5693 0.0542  -0.0410 0.0571  44   SER A C   
322  O O   . SER A 44  ? 0.4378 0.6189 0.5158 0.0642  -0.0354 0.0586  44   SER A O   
323  C CB  . SER A 44  ? 0.5012 0.7251 0.5954 0.0563  -0.0506 0.0637  44   SER A CB  
324  O OG  . SER A 44  ? 0.5474 0.7529 0.6286 0.0610  -0.0524 0.0612  44   SER A OG  
325  N N   . ARG A 45  ? 0.4403 0.5969 0.5096 0.0493  -0.0419 0.0529  45   ARG A N   
326  C CA  . ARG A 45  ? 0.4293 0.5619 0.4868 0.0547  -0.0362 0.0501  45   ARG A CA  
327  C C   . ARG A 45  ? 0.4342 0.5567 0.4923 0.0484  -0.0320 0.0480  45   ARG A C   
328  O O   . ARG A 45  ? 0.4427 0.5472 0.4921 0.0519  -0.0272 0.0459  45   ARG A O   
329  C CB  . ARG A 45  ? 0.5195 0.6333 0.5652 0.0544  -0.0385 0.0473  45   ARG A CB  
330  C CG  . ARG A 45  ? 0.4895 0.6087 0.5311 0.0622  -0.0419 0.0493  45   ARG A CG  
331  C CD  . ARG A 45  ? 0.6856 0.7869 0.7162 0.0590  -0.0443 0.0462  45   ARG A CD  
332  N NE  . ARG A 45  ? 0.9375 1.0450 0.9644 0.0634  -0.0493 0.0479  45   ARG A NE  
333  C CZ  . ARG A 45  ? 1.0118 1.1083 1.0276 0.0724  -0.0477 0.0489  45   ARG A CZ  
334  N NH1 . ARG A 45  ? 1.0454 1.1236 1.0529 0.0772  -0.0415 0.0484  45   ARG A NH1 
335  N NH2 . ARG A 45  ? 0.9598 1.0631 0.9722 0.0763  -0.0527 0.0507  45   ARG A NH2 
336  N N   . ARG A 46  ? 0.3877 0.5214 0.4557 0.0389  -0.0340 0.0488  46   ARG A N   
337  C CA  . ARG A 46  ? 0.4105 0.5367 0.4794 0.0338  -0.0300 0.0476  46   ARG A CA  
338  C C   . ARG A 46  ? 0.4023 0.5294 0.4698 0.0428  -0.0233 0.0487  46   ARG A C   
339  O O   . ARG A 46  ? 0.4057 0.5499 0.4783 0.0501  -0.0222 0.0520  46   ARG A O   
340  C CB  . ARG A 46  ? 0.4195 0.5598 0.4995 0.0229  -0.0329 0.0497  46   ARG A CB  
341  C CG  . ARG A 46  ? 0.3432 0.4740 0.4232 0.0168  -0.0296 0.0486  46   ARG A CG  
342  C CD  . ARG A 46  ? 0.3561 0.5028 0.4473 0.0067  -0.0321 0.0519  46   ARG A CD  
343  N NE  . ARG A 46  ? 0.3143 0.4556 0.4054 -0.0037 -0.0386 0.0505  46   ARG A NE  
344  C CZ  . ARG A 46  ? 0.3756 0.5271 0.4746 -0.0143 -0.0424 0.0530  46   ARG A CZ  
345  N NH1 . ARG A 46  ? 0.3078 0.4782 0.4169 -0.0162 -0.0401 0.0578  46   ARG A NH1 
346  N NH2 . ARG A 46  ? 0.3293 0.4715 0.4255 -0.0231 -0.0484 0.0508  46   ARG A NH2 
347  N N   . PHE A 47  ? 0.3367 0.4460 0.3971 0.0425  -0.0191 0.0459  47   PHE A N   
348  C CA  . PHE A 47  ? 0.3117 0.4172 0.3680 0.0501  -0.0129 0.0458  47   PHE A CA  
349  C C   . PHE A 47  ? 0.3522 0.4468 0.3980 0.0615  -0.0107 0.0450  47   PHE A C   
350  O O   . PHE A 47  ? 0.4390 0.5257 0.4785 0.0680  -0.0058 0.0441  47   PHE A O   
351  C CB  . PHE A 47  ? 0.3354 0.4631 0.4017 0.0523  -0.0107 0.0496  47   PHE A CB  
352  C CG  . PHE A 47  ? 0.3936 0.5335 0.4706 0.0408  -0.0129 0.0515  47   PHE A CG  
353  C CD1 . PHE A 47  ? 0.3717 0.4989 0.4465 0.0328  -0.0122 0.0495  47   PHE A CD1 
354  C CD2 . PHE A 47  ? 0.3786 0.5430 0.4675 0.0380  -0.0159 0.0558  47   PHE A CD2 
355  C CE1 . PHE A 47  ? 0.3177 0.4540 0.4010 0.0224  -0.0142 0.0517  47   PHE A CE1 
356  C CE2 . PHE A 47  ? 0.3326 0.5066 0.4304 0.0265  -0.0181 0.0580  47   PHE A CE2 
357  C CZ  . PHE A 47  ? 0.3475 0.5060 0.4419 0.0188  -0.0172 0.0559  47   PHE A CZ  
358  N N   . MET A 48  ? 0.3677 0.4608 0.4106 0.0638  -0.0144 0.0454  48   MET A N   
359  C CA  . MET A 48  ? 0.4246 0.5071 0.4569 0.0750  -0.0126 0.0455  48   MET A CA  
360  C C   . MET A 48  ? 0.4071 0.4640 0.4268 0.0731  -0.0116 0.0422  48   MET A C   
361  O O   . MET A 48  ? 0.4312 0.4820 0.4512 0.0640  -0.0137 0.0403  48   MET A O   
362  C CB  . MET A 48  ? 0.3759 0.4719 0.4111 0.0799  -0.0169 0.0484  48   MET A CB  
363  C CG  . MET A 48  ? 0.5573 0.6819 0.6061 0.0817  -0.0182 0.0523  48   MET A CG  
364  S SD  . MET A 48  ? 0.5902 0.7289 0.6387 0.0950  -0.0204 0.0563  48   MET A SD  
365  C CE  . MET A 48  ? 0.6167 0.7415 0.6540 0.1094  -0.0128 0.0558  48   MET A CE  
366  N N   . PRO A 49  ? 0.4124 0.4542 0.4205 0.0818  -0.0082 0.0418  49   PRO A N   
367  C CA  . PRO A 49  ? 0.4529 0.4714 0.4486 0.0802  -0.0073 0.0397  49   PRO A CA  
368  C C   . PRO A 49  ? 0.4978 0.5175 0.4938 0.0761  -0.0120 0.0402  49   PRO A C   
369  O O   . PRO A 49  ? 0.4330 0.4680 0.4346 0.0790  -0.0157 0.0426  49   PRO A O   
370  C CB  . PRO A 49  ? 0.4798 0.4872 0.4643 0.0921  -0.0046 0.0409  49   PRO A CB  
371  C CG  . PRO A 49  ? 0.4854 0.5052 0.4748 0.0989  -0.0018 0.0419  49   PRO A CG  
372  C CD  . PRO A 49  ? 0.3853 0.4315 0.3909 0.0940  -0.0051 0.0437  49   PRO A CD  
373  N N   . PRO A 50  ? 0.4256 0.4307 0.4158 0.0693  -0.0120 0.0379  50   PRO A N   
374  C CA  . PRO A 50  ? 0.4353 0.4404 0.4241 0.0659  -0.0161 0.0379  50   PRO A CA  
375  C C   . PRO A 50  ? 0.5014 0.5009 0.4810 0.0744  -0.0168 0.0404  50   PRO A C   
376  O O   . PRO A 50  ? 0.5363 0.5227 0.5067 0.0807  -0.0133 0.0412  50   PRO A O   
377  C CB  . PRO A 50  ? 0.3635 0.3535 0.3468 0.0586  -0.0143 0.0351  50   PRO A CB  
378  C CG  . PRO A 50  ? 0.4483 0.4247 0.4248 0.0611  -0.0092 0.0346  50   PRO A CG  
379  C CD  . PRO A 50  ? 0.4376 0.4251 0.4204 0.0662  -0.0080 0.0355  50   PRO A CD  
380  N N   . GLU A 51  ? 0.5731 0.5817 0.5544 0.0746  -0.0215 0.0416  51   GLU A N   
381  C CA  . GLU A 51  ? 0.6042 0.6067 0.5757 0.0817  -0.0228 0.0441  51   GLU A CA  
382  C C   . GLU A 51  ? 0.5751 0.5659 0.5390 0.0759  -0.0236 0.0426  51   GLU A C   
383  O O   . GLU A 51  ? 0.5186 0.5145 0.4874 0.0681  -0.0262 0.0402  51   GLU A O   
384  C CB  . GLU A 51  ? 0.7077 0.7301 0.6857 0.0864  -0.0278 0.0468  51   GLU A CB  
385  C CG  . GLU A 51  ? 0.9966 1.0335 0.9822 0.0938  -0.0267 0.0491  51   GLU A CG  
386  C CD  . GLU A 51  ? 1.2325 1.2929 1.2263 0.0976  -0.0321 0.0521  51   GLU A CD  
387  O OE1 . GLU A 51  ? 1.2921 1.3526 1.2807 0.0994  -0.0361 0.0534  51   GLU A OE1 
388  O OE2 . GLU A 51  ? 1.2902 1.3701 1.2958 0.0985  -0.0325 0.0534  51   GLU A OE2 
389  N N   . PRO A 52  ? 0.5904 0.5650 0.5415 0.0800  -0.0214 0.0443  52   PRO A N   
390  C CA  . PRO A 52  ? 0.5648 0.5285 0.5073 0.0756  -0.0214 0.0437  52   PRO A CA  
391  C C   . PRO A 52  ? 0.5256 0.5013 0.4707 0.0737  -0.0270 0.0433  52   PRO A C   
392  O O   . PRO A 52  ? 0.5149 0.5031 0.4632 0.0789  -0.0310 0.0453  52   PRO A O   
393  C CB  . PRO A 52  ? 0.6340 0.5826 0.5630 0.0830  -0.0191 0.0473  52   PRO A CB  
394  C CG  . PRO A 52  ? 0.6769 0.6218 0.6062 0.0892  -0.0161 0.0482  52   PRO A CG  
395  C CD  . PRO A 52  ? 0.5938 0.5600 0.5372 0.0901  -0.0188 0.0473  52   PRO A CD  
396  N N   . LYS A 53  ? 0.4589 0.4316 0.4028 0.0664  -0.0276 0.0405  53   LYS A N   
397  C CA  . LYS A 53  ? 0.4785 0.4597 0.4228 0.0639  -0.0329 0.0391  53   LYS A CA  
398  C C   . LYS A 53  ? 0.5687 0.5483 0.5029 0.0706  -0.0351 0.0424  53   LYS A C   
399  O O   . LYS A 53  ? 0.5859 0.5519 0.5095 0.0740  -0.0314 0.0450  53   LYS A O   
400  C CB  . LYS A 53  ? 0.4837 0.4581 0.4254 0.0565  -0.0318 0.0355  53   LYS A CB  
401  C CG  . LYS A 53  ? 0.4489 0.4271 0.3862 0.0548  -0.0366 0.0336  53   LYS A CG  
402  C CD  . LYS A 53  ? 0.5759 0.5687 0.5230 0.0516  -0.0428 0.0316  53   LYS A CD  
403  C CE  . LYS A 53  ? 0.5722 0.5659 0.5144 0.0480  -0.0477 0.0282  53   LYS A CE  
404  N NZ  . LYS A 53  ? 0.5931 0.5985 0.5446 0.0428  -0.0536 0.0260  53   LYS A NZ  
405  N N   . ARG A 54  ? 0.5479 0.5412 0.4851 0.0721  -0.0412 0.0427  54   ARG A N   
406  C CA  . ARG A 54  ? 0.6140 0.6074 0.5416 0.0788  -0.0439 0.0460  54   ARG A CA  
407  C C   . ARG A 54  ? 0.5824 0.5702 0.5011 0.0746  -0.0454 0.0438  54   ARG A C   
408  O O   . ARG A 54  ? 0.5044 0.4950 0.4271 0.0674  -0.0472 0.0393  54   ARG A O   
409  C CB  . ARG A 54  ? 0.6997 0.7124 0.6346 0.0829  -0.0501 0.0478  54   ARG A CB  
410  C CG  . ARG A 54  ? 0.7922 0.8119 0.7351 0.0889  -0.0481 0.0506  54   ARG A CG  
411  C CD  . ARG A 54  ? 0.9270 0.9678 0.8765 0.0942  -0.0541 0.0533  54   ARG A CD  
412  N NE  . ARG A 54  ? 1.0070 1.0628 0.9649 0.0856  -0.0604 0.0502  54   ARG A NE  
413  C CZ  . ARG A 54  ? 1.0609 1.1335 1.0330 0.0812  -0.0627 0.0494  54   ARG A CZ  
414  N NH1 . ARG A 54  ? 1.0013 1.0797 0.9813 0.0855  -0.0589 0.0516  54   ARG A NH1 
415  N NH2 . ARG A 54  ? 1.0718 1.1548 1.0492 0.0723  -0.0689 0.0466  54   ARG A NH2 
416  N N   . PRO A 55  ? 0.5406 0.5194 0.4461 0.0795  -0.0444 0.0470  55   PRO A N   
417  C CA  . PRO A 55  ? 0.5660 0.5389 0.4612 0.0766  -0.0448 0.0453  55   PRO A CA  
418  C C   . PRO A 55  ? 0.5743 0.5589 0.4723 0.0726  -0.0517 0.0411  55   PRO A C   
419  O O   . PRO A 55  ? 0.5629 0.5613 0.4673 0.0742  -0.0575 0.0415  55   PRO A O   
420  C CB  . PRO A 55  ? 0.5908 0.5577 0.4728 0.0844  -0.0446 0.0508  55   PRO A CB  
421  C CG  . PRO A 55  ? 0.6456 0.6064 0.5287 0.0900  -0.0409 0.0549  55   PRO A CG  
422  C CD  . PRO A 55  ? 0.5662 0.5389 0.4649 0.0885  -0.0423 0.0526  55   PRO A CD  
423  N N   . TRP A 56  ? 0.5628 0.5419 0.4558 0.0675  -0.0510 0.0371  56   TRP A N   
424  C CA  . TRP A 56  ? 0.6160 0.6021 0.5083 0.0636  -0.0575 0.0325  56   TRP A CA  
425  C C   . TRP A 56  ? 0.6738 0.6553 0.5506 0.0666  -0.0586 0.0328  56   TRP A C   
426  O O   . TRP A 56  ? 0.6897 0.6618 0.5572 0.0702  -0.0533 0.0364  56   TRP A O   
427  C CB  . TRP A 56  ? 0.6033 0.5856 0.5005 0.0563  -0.0559 0.0269  56   TRP A CB  
428  C CG  . TRP A 56  ? 0.6236 0.5935 0.5141 0.0558  -0.0487 0.0267  56   TRP A CG  
429  C CD1 . TRP A 56  ? 0.6396 0.6032 0.5180 0.0562  -0.0473 0.0249  56   TRP A CD1 
430  C CD2 . TRP A 56  ? 0.5954 0.5591 0.4909 0.0548  -0.0418 0.0284  56   TRP A CD2 
431  N NE1 . TRP A 56  ? 0.6438 0.5993 0.5206 0.0553  -0.0398 0.0259  56   TRP A NE1 
432  C CE2 . TRP A 56  ? 0.6015 0.5566 0.4886 0.0540  -0.0367 0.0279  56   TRP A CE2 
433  C CE3 . TRP A 56  ? 0.5727 0.5378 0.4785 0.0544  -0.0395 0.0303  56   TRP A CE3 
434  C CZ2 . TRP A 56  ? 0.5481 0.4967 0.4375 0.0520  -0.0299 0.0294  56   TRP A CZ2 
435  C CZ3 . TRP A 56  ? 0.6316 0.5885 0.5385 0.0527  -0.0329 0.0312  56   TRP A CZ3 
436  C CH2 . TRP A 56  ? 0.5910 0.5401 0.4901 0.0511  -0.0284 0.0308  56   TRP A CH2 
437  N N   . SER A 57  ? 0.7185 0.7059 0.5916 0.0646  -0.0654 0.0291  57   SER A N   
438  C CA  . SER A 57  ? 0.7774 0.7607 0.6347 0.0675  -0.0667 0.0289  57   SER A CA  
439  C C   . SER A 57  ? 0.7025 0.6788 0.5541 0.0628  -0.0658 0.0225  57   SER A C   
440  O O   . SER A 57  ? 0.7414 0.7184 0.6010 0.0572  -0.0675 0.0177  57   SER A O   
441  C CB  . SER A 57  ? 0.8477 0.8425 0.7018 0.0700  -0.0755 0.0295  57   SER A CB  
442  O OG  . SER A 57  ? 0.8907 0.8922 0.7499 0.0634  -0.0824 0.0235  57   SER A OG  
443  N N   . GLY A 58  ? 0.7019 0.6713 0.5390 0.0658  -0.0630 0.0227  58   GLY A N   
444  C CA  . GLY A 58  ? 0.7136 0.6765 0.5434 0.0632  -0.0616 0.0169  58   GLY A CA  
445  C C   . GLY A 58  ? 0.7312 0.6873 0.5665 0.0611  -0.0533 0.0168  58   GLY A C   
446  O O   . GLY A 58  ? 0.7015 0.6567 0.5440 0.0614  -0.0483 0.0215  58   GLY A O   
447  N N   . VAL A 59  ? 0.6638 0.6151 0.4949 0.0592  -0.0520 0.0112  59   VAL A N   
448  C CA  . VAL A 59  ? 0.6590 0.6056 0.4945 0.0577  -0.0443 0.0110  59   VAL A CA  
449  C C   . VAL A 59  ? 0.6418 0.5890 0.4904 0.0527  -0.0464 0.0072  59   VAL A C   
450  O O   . VAL A 59  ? 0.7113 0.6569 0.5583 0.0504  -0.0515 0.0014  59   VAL A O   
451  C CB  . VAL A 59  ? 0.6721 0.6139 0.4948 0.0601  -0.0406 0.0078  59   VAL A CB  
452  C CG1 . VAL A 59  ? 0.5971 0.5369 0.4258 0.0587  -0.0328 0.0080  59   VAL A CG1 
453  C CG2 . VAL A 59  ? 0.5945 0.5365 0.4030 0.0649  -0.0387 0.0120  59   VAL A CG2 
454  N N   . LEU A 60  ? 0.5728 0.5213 0.4334 0.0508  -0.0425 0.0105  60   LEU A N   
455  C CA  . LEU A 60  ? 0.5914 0.5406 0.4646 0.0462  -0.0435 0.0078  60   LEU A CA  
456  C C   . LEU A 60  ? 0.6243 0.5679 0.4958 0.0454  -0.0391 0.0042  60   LEU A C   
457  O O   . LEU A 60  ? 0.6422 0.5842 0.5109 0.0472  -0.0323 0.0065  60   LEU A O   
458  C CB  . LEU A 60  ? 0.5526 0.5051 0.4378 0.0451  -0.0406 0.0125  60   LEU A CB  
459  C CG  . LEU A 60  ? 0.6343 0.5887 0.5328 0.0404  -0.0414 0.0105  60   LEU A CG  
460  C CD1 . LEU A 60  ? 0.6302 0.5917 0.5388 0.0401  -0.0435 0.0140  60   LEU A CD1 
461  C CD2 . LEU A 60  ? 0.5503 0.5005 0.4526 0.0391  -0.0346 0.0106  60   LEU A CD2 
462  N N   . ASP A 61  ? 0.5546 0.4954 0.4272 0.0428  -0.0431 -0.0013 61   ASP A N   
463  C CA  . ASP A 61  ? 0.5984 0.5337 0.4700 0.0430  -0.0394 -0.0047 61   ASP A CA  
464  C C   . ASP A 61  ? 0.6304 0.5677 0.5154 0.0403  -0.0348 -0.0022 61   ASP A C   
465  O O   . ASP A 61  ? 0.5876 0.5270 0.4829 0.0364  -0.0378 -0.0020 61   ASP A O   
466  C CB  . ASP A 61  ? 0.6820 0.6108 0.5491 0.0412  -0.0454 -0.0113 61   ASP A CB  
467  C CG  . ASP A 61  ? 0.8483 0.7702 0.7107 0.0437  -0.0414 -0.0152 61   ASP A CG  
468  O OD1 . ASP A 61  ? 0.8397 0.7610 0.7116 0.0418  -0.0389 -0.0148 61   ASP A OD1 
469  O OD2 . ASP A 61  ? 0.9743 0.8918 0.8231 0.0484  -0.0405 -0.0182 61   ASP A OD2 
470  N N   . ALA A 62  ? 0.5322 0.4699 0.4167 0.0423  -0.0276 -0.0002 62   ALA A N   
471  C CA  . ALA A 62  ? 0.5096 0.4496 0.4054 0.0398  -0.0231 0.0022  62   ALA A CA  
472  C C   . ALA A 62  ? 0.5060 0.4441 0.4010 0.0412  -0.0195 -0.0006 62   ALA A C   
473  O O   . ALA A 62  ? 0.5333 0.4750 0.4312 0.0415  -0.0135 0.0021  62   ALA A O   
474  C CB  . ALA A 62  ? 0.5204 0.4634 0.4170 0.0400  -0.0179 0.0080  62   ALA A CB  
475  N N   . THR A 63  ? 0.5043 0.4368 0.3948 0.0422  -0.0234 -0.0059 63   THR A N   
476  C CA  . THR A 63  ? 0.5479 0.4775 0.4352 0.0455  -0.0202 -0.0090 63   THR A CA  
477  C C   . THR A 63  ? 0.5987 0.5249 0.4945 0.0430  -0.0218 -0.0108 63   THR A C   
478  O O   . THR A 63  ? 0.5650 0.4891 0.4594 0.0462  -0.0192 -0.0128 63   THR A O   
479  C CB  . THR A 63  ? 0.5788 0.5016 0.4511 0.0504  -0.0224 -0.0142 63   THR A CB  
480  O OG1 . THR A 63  ? 0.5755 0.4904 0.4452 0.0476  -0.0303 -0.0184 63   THR A OG1 
481  C CG2 . THR A 63  ? 0.6011 0.5274 0.4635 0.0534  -0.0207 -0.0122 63   THR A CG2 
482  N N   . THR A 64  ? 0.5587 0.4851 0.4630 0.0376  -0.0261 -0.0097 64   THR A N   
483  C CA  . THR A 64  ? 0.5342 0.4576 0.4464 0.0345  -0.0277 -0.0107 64   THR A CA  
484  C C   . THR A 64  ? 0.4959 0.4259 0.4212 0.0296  -0.0277 -0.0066 64   THR A C   
485  O O   . THR A 64  ? 0.5155 0.4504 0.4430 0.0281  -0.0286 -0.0039 64   THR A O   
486  C CB  . THR A 64  ? 0.5876 0.5013 0.4944 0.0325  -0.0348 -0.0154 64   THR A CB  
487  O OG1 . THR A 64  ? 0.5916 0.5086 0.5007 0.0281  -0.0400 -0.0143 64   THR A OG1 
488  C CG2 . THR A 64  ? 0.5476 0.4526 0.4392 0.0379  -0.0355 -0.0204 64   THR A CG2 
489  N N   . PHE A 65  ? 0.4813 0.4113 0.4144 0.0277  -0.0264 -0.0059 65   PHE A N   
490  C CA  . PHE A 65  ? 0.5057 0.4416 0.4502 0.0234  -0.0261 -0.0024 65   PHE A CA  
491  C C   . PHE A 65  ? 0.4816 0.4181 0.4290 0.0193  -0.0320 -0.0024 65   PHE A C   
492  O O   . PHE A 65  ? 0.4583 0.3887 0.4010 0.0178  -0.0370 -0.0056 65   PHE A O   
493  C CB  . PHE A 65  ? 0.4693 0.4047 0.4204 0.0224  -0.0241 -0.0020 65   PHE A CB  
494  C CG  . PHE A 65  ? 0.4573 0.3968 0.4090 0.0255  -0.0180 -0.0005 65   PHE A CG  
495  C CD1 . PHE A 65  ? 0.4311 0.3775 0.3866 0.0245  -0.0142 0.0029  65   PHE A CD1 
496  C CD2 . PHE A 65  ? 0.4837 0.4201 0.4321 0.0292  -0.0162 -0.0025 65   PHE A CD2 
497  C CE1 . PHE A 65  ? 0.5065 0.4579 0.4632 0.0259  -0.0089 0.0046  65   PHE A CE1 
498  C CE2 . PHE A 65  ? 0.4976 0.4408 0.4479 0.0318  -0.0107 -0.0008 65   PHE A CE2 
499  C CZ  . PHE A 65  ? 0.4403 0.3916 0.3951 0.0294  -0.0072 0.0029  65   PHE A CZ  
500  N N   . GLN A 66  ? 0.4629 0.4068 0.4177 0.0174  -0.0316 0.0011  66   GLN A N   
501  C CA  . GLN A 66  ? 0.4601 0.4081 0.4198 0.0136  -0.0368 0.0019  66   GLN A CA  
502  C C   . GLN A 66  ? 0.4464 0.3961 0.4154 0.0090  -0.0378 0.0030  66   GLN A C   
503  O O   . GLN A 66  ? 0.4300 0.3767 0.4012 0.0091  -0.0346 0.0030  66   GLN A O   
504  C CB  . GLN A 66  ? 0.4375 0.3932 0.3994 0.0153  -0.0359 0.0053  66   GLN A CB  
505  C CG  . GLN A 66  ? 0.4676 0.4230 0.4209 0.0175  -0.0394 0.0043  66   GLN A CG  
506  C CD  . GLN A 66  ? 0.5977 0.5559 0.5521 0.0136  -0.0468 0.0027  66   GLN A CD  
507  O OE1 . GLN A 66  ? 0.5429 0.5025 0.5044 0.0087  -0.0493 0.0026  66   GLN A OE1 
508  N NE2 . GLN A 66  ? 0.5842 0.5438 0.5317 0.0154  -0.0505 0.0020  66   GLN A NE2 
509  N N   . ASN A 67  ? 0.4821 0.4378 0.4566 0.0050  -0.0422 0.0042  67   ASN A N   
510  C CA  . ASN A 67  ? 0.4147 0.3738 0.3984 0.0001  -0.0432 0.0060  67   ASN A CA  
511  C C   . ASN A 67  ? 0.4213 0.3844 0.4116 0.0015  -0.0374 0.0089  67   ASN A C   
512  O O   . ASN A 67  ? 0.4070 0.3737 0.3974 0.0052  -0.0337 0.0105  67   ASN A O   
513  C CB  . ASN A 67  ? 0.4866 0.4562 0.4766 -0.0037 -0.0477 0.0081  67   ASN A CB  
514  C CG  . ASN A 67  ? 0.4837 0.4504 0.4677 -0.0067 -0.0546 0.0053  67   ASN A CG  
515  O OD1 . ASN A 67  ? 0.4616 0.4165 0.4381 -0.0084 -0.0569 0.0017  67   ASN A OD1 
516  N ND2 . ASN A 67  ? 0.4657 0.4432 0.4523 -0.0071 -0.0579 0.0070  67   ASN A ND2 
517  N N   . VAL A 68  ? 0.3502 0.3119 0.3452 -0.0018 -0.0371 0.0096  68   VAL A N   
518  C CA  . VAL A 68  ? 0.3504 0.3171 0.3522 -0.0016 -0.0328 0.0124  68   VAL A CA  
519  C C   . VAL A 68  ? 0.4031 0.3811 0.4135 -0.0042 -0.0338 0.0157  68   VAL A C   
520  O O   . VAL A 68  ? 0.3803 0.3621 0.3937 -0.0086 -0.0384 0.0163  68   VAL A O   
521  C CB  . VAL A 68  ? 0.4802 0.4404 0.4825 -0.0036 -0.0322 0.0120  68   VAL A CB  
522  C CG1 . VAL A 68  ? 0.4439 0.4100 0.4533 -0.0045 -0.0288 0.0150  68   VAL A CG1 
523  C CG2 . VAL A 68  ? 0.4167 0.3680 0.4111 0.0005  -0.0303 0.0091  68   VAL A CG2 
524  N N   . CYS A 69  ? 0.3641 0.3479 0.3781 -0.0015 -0.0296 0.0179  69   CYS A N   
525  C CA  . CYS A 69  ? 0.4115 0.4070 0.4331 -0.0023 -0.0298 0.0210  69   CYS A CA  
526  C C   . CYS A 69  ? 0.4503 0.4488 0.4780 -0.0078 -0.0311 0.0227  69   CYS A C   
527  O O   . CYS A 69  ? 0.3396 0.3319 0.3666 -0.0091 -0.0293 0.0224  69   CYS A O   
528  C CB  . CYS A 69  ? 0.3495 0.3479 0.3716 0.0023  -0.0249 0.0224  69   CYS A CB  
529  S SG  . CYS A 69  ? 0.4197 0.4139 0.4340 0.0084  -0.0235 0.0215  69   CYS A SG  
530  N N   . TYR A 70  ? 0.3629 0.3721 0.3969 -0.0111 -0.0341 0.0250  70   TYR A N   
531  C CA  . TYR A 70  ? 0.4406 0.4538 0.4806 -0.0176 -0.0357 0.0274  70   TYR A CA  
532  C C   . TYR A 70  ? 0.4392 0.4529 0.4819 -0.0169 -0.0310 0.0293  70   TYR A C   
533  O O   . TYR A 70  ? 0.3483 0.3677 0.3925 -0.0123 -0.0269 0.0303  70   TYR A O   
534  C CB  . TYR A 70  ? 0.4459 0.4748 0.4937 -0.0207 -0.0388 0.0305  70   TYR A CB  
535  C CG  . TYR A 70  ? 0.4536 0.4816 0.5036 -0.0298 -0.0439 0.0314  70   TYR A CG  
536  C CD1 . TYR A 70  ? 0.5316 0.5569 0.5784 -0.0337 -0.0500 0.0293  70   TYR A CD1 
537  C CD2 . TYR A 70  ? 0.5048 0.5328 0.5586 -0.0350 -0.0429 0.0341  70   TYR A CD2 
538  C CE1 . TYR A 70  ? 0.5123 0.5343 0.5599 -0.0432 -0.0552 0.0299  70   TYR A CE1 
539  C CE2 . TYR A 70  ? 0.5264 0.5512 0.5811 -0.0440 -0.0476 0.0352  70   TYR A CE2 
540  C CZ  . TYR A 70  ? 0.6025 0.6238 0.6540 -0.0484 -0.0538 0.0330  70   TYR A CZ  
541  O OH  . TYR A 70  ? 0.8129 0.8291 0.8645 -0.0584 -0.0587 0.0341  70   TYR A OH  
542  N N   . GLN A 71  ? 0.3670 0.3734 0.4090 -0.0213 -0.0317 0.0297  71   GLN A N   
543  C CA  . GLN A 71  ? 0.3909 0.3965 0.4339 -0.0203 -0.0276 0.0312  71   GLN A CA  
544  C C   . GLN A 71  ? 0.3852 0.3855 0.4288 -0.0260 -0.0292 0.0331  71   GLN A C   
545  O O   . GLN A 71  ? 0.4424 0.4339 0.4829 -0.0300 -0.0334 0.0320  71   GLN A O   
546  C CB  . GLN A 71  ? 0.3484 0.3453 0.3852 -0.0148 -0.0243 0.0282  71   GLN A CB  
547  C CG  . GLN A 71  ? 0.3106 0.2942 0.3407 -0.0148 -0.0264 0.0251  71   GLN A CG  
548  C CD  . GLN A 71  ? 0.4458 0.4246 0.4706 -0.0093 -0.0233 0.0225  71   GLN A CD  
549  O OE1 . GLN A 71  ? 0.3769 0.3513 0.3998 -0.0080 -0.0214 0.0221  71   GLN A OE1 
550  N NE2 . GLN A 71  ? 0.4013 0.3820 0.4238 -0.0062 -0.0227 0.0211  71   GLN A NE2 
551  N N   . TYR A 72  ? 0.4349 0.4393 0.4815 -0.0260 -0.0258 0.0359  72   TYR A N   
552  C CA  . TYR A 72  ? 0.4676 0.4656 0.5134 -0.0302 -0.0265 0.0382  72   TYR A CA  
553  C C   . TYR A 72  ? 0.5433 0.5257 0.5814 -0.0275 -0.0271 0.0351  72   TYR A C   
554  O O   . TYR A 72  ? 0.4398 0.4201 0.4747 -0.0218 -0.0246 0.0323  72   TYR A O   
555  C CB  . TYR A 72  ? 0.5279 0.5344 0.5773 -0.0293 -0.0222 0.0416  72   TYR A CB  
556  C CG  . TYR A 72  ? 0.6254 0.6260 0.6737 -0.0330 -0.0225 0.0447  72   TYR A CG  
557  C CD1 . TYR A 72  ? 0.6644 0.6567 0.7078 -0.0293 -0.0208 0.0437  72   TYR A CD1 
558  C CD2 . TYR A 72  ? 0.6745 0.6784 0.7266 -0.0403 -0.0246 0.0491  72   TYR A CD2 
559  C CE1 . TYR A 72  ? 0.6787 0.6652 0.7204 -0.0319 -0.0211 0.0470  72   TYR A CE1 
560  C CE2 . TYR A 72  ? 0.7002 0.6975 0.7504 -0.0437 -0.0249 0.0526  72   TYR A CE2 
561  C CZ  . TYR A 72  ? 0.7839 0.7720 0.8286 -0.0390 -0.0231 0.0515  72   TYR A CZ  
562  O OH  . TYR A 72  ? 0.8276 0.8085 0.8697 -0.0418 -0.0235 0.0553  72   TYR A OH  
563  N N   . VAL A 73  ? 0.5429 0.5145 0.5778 -0.0317 -0.0304 0.0358  73   VAL A N   
564  C CA  . VAL A 73  ? 0.5357 0.4922 0.5627 -0.0285 -0.0312 0.0330  73   VAL A CA  
565  C C   . VAL A 73  ? 0.6271 0.5785 0.6529 -0.0287 -0.0299 0.0362  73   VAL A C   
566  O O   . VAL A 73  ? 0.5836 0.5350 0.6117 -0.0346 -0.0313 0.0403  73   VAL A O   
567  C CB  . VAL A 73  ? 0.5369 0.4811 0.5582 -0.0316 -0.0364 0.0304  73   VAL A CB  
568  C CG1 . VAL A 73  ? 0.5853 0.5128 0.5973 -0.0271 -0.0370 0.0277  73   VAL A CG1 
569  C CG2 . VAL A 73  ? 0.5092 0.4587 0.5306 -0.0302 -0.0376 0.0271  73   VAL A CG2 
570  N N   . ASP A 74  ? 0.6499 0.5981 0.6723 -0.0224 -0.0273 0.0347  74   ASP A N   
571  C CA  . ASP A 74  ? 0.6963 0.6422 0.7177 -0.0210 -0.0257 0.0377  74   ASP A CA  
572  C C   . ASP A 74  ? 0.6136 0.5430 0.6285 -0.0223 -0.0290 0.0386  74   ASP A C   
573  O O   . ASP A 74  ? 0.7053 0.6232 0.7135 -0.0186 -0.0307 0.0350  74   ASP A O   
574  C CB  . ASP A 74  ? 0.7946 0.7437 0.8147 -0.0138 -0.0224 0.0356  74   ASP A CB  
575  C CG  . ASP A 74  ? 0.8836 0.8327 0.9028 -0.0116 -0.0209 0.0387  74   ASP A CG  
576  O OD1 . ASP A 74  ? 0.7721 0.7147 0.7898 -0.0145 -0.0225 0.0423  74   ASP A OD1 
577  O OD2 . ASP A 74  ? 0.8609 0.8166 0.8807 -0.0072 -0.0182 0.0376  74   ASP A OD2 
578  N N   . THR A 75  ? 0.6249 0.5523 0.6407 -0.0274 -0.0299 0.0435  75   THR A N   
579  C CA  . THR A 75  ? 0.8290 0.7383 0.8375 -0.0294 -0.0333 0.0450  75   THR A CA  
580  C C   . THR A 75  ? 0.8252 0.7307 0.8313 -0.0272 -0.0318 0.0496  75   THR A C   
581  O O   . THR A 75  ? 0.8473 0.7382 0.8477 -0.0302 -0.0344 0.0525  75   THR A O   
582  C CB  . THR A 75  ? 0.8811 0.7867 0.8907 -0.0397 -0.0371 0.0475  75   THR A CB  
583  O OG1 . THR A 75  ? 0.8939 0.8159 0.9123 -0.0448 -0.0349 0.0525  75   THR A OG1 
584  C CG2 . THR A 75  ? 0.8454 0.7510 0.8550 -0.0418 -0.0400 0.0429  75   THR A CG2 
585  N N   . LEU A 76  ? 0.7899 0.7075 0.7995 -0.0221 -0.0279 0.0502  76   LEU A N   
586  C CA  . LEU A 76  ? 0.8048 0.7213 0.8124 -0.0197 -0.0266 0.0547  76   LEU A CA  
587  C C   . LEU A 76  ? 0.8616 0.7605 0.8600 -0.0138 -0.0285 0.0543  76   LEU A C   
588  O O   . LEU A 76  ? 0.8779 0.7664 0.8717 -0.0151 -0.0299 0.0589  76   LEU A O   
589  C CB  . LEU A 76  ? 0.8308 0.7636 0.8430 -0.0152 -0.0227 0.0545  76   LEU A CB  
590  C CG  . LEU A 76  ? 0.8901 0.8249 0.9008 -0.0132 -0.0215 0.0594  76   LEU A CG  
591  C CD1 . LEU A 76  ? 0.9185 0.8550 0.9310 -0.0207 -0.0215 0.0653  76   LEU A CD1 
592  C CD2 . LEU A 76  ? 0.8855 0.8352 0.8993 -0.0088 -0.0183 0.0581  76   LEU A CD2 
593  N N   . TYR A 77  ? 0.8308 0.7266 0.8261 -0.0070 -0.0285 0.0491  77   TYR A N   
594  C CA  . TYR A 77  ? 0.7972 0.6770 0.7833 0.0004  -0.0299 0.0480  77   TYR A CA  
595  C C   . TYR A 77  ? 0.8408 0.7080 0.8208 0.0019  -0.0323 0.0424  77   TYR A C   
596  O O   . TYR A 77  ? 0.8520 0.7245 0.8321 0.0080  -0.0307 0.0380  77   TYR A O   
597  C CB  . TYR A 77  ? 0.6897 0.5797 0.6770 0.0098  -0.0270 0.0474  77   TYR A CB  
598  C CG  . TYR A 77  ? 0.7453 0.6475 0.7371 0.0094  -0.0250 0.0524  77   TYR A CG  
599  C CD1 . TYR A 77  ? 0.6837 0.5770 0.6712 0.0088  -0.0262 0.0580  77   TYR A CD1 
600  C CD2 . TYR A 77  ? 0.7110 0.6326 0.7100 0.0099  -0.0220 0.0514  77   TYR A CD2 
601  C CE1 . TYR A 77  ? 0.6602 0.5649 0.6509 0.0089  -0.0245 0.0625  77   TYR A CE1 
602  C CE2 . TYR A 77  ? 0.6558 0.5882 0.6577 0.0098  -0.0205 0.0554  77   TYR A CE2 
603  C CZ  . TYR A 77  ? 0.7015 0.6261 0.6993 0.0094  -0.0217 0.0609  77   TYR A CZ  
604  O OH  . TYR A 77  ? 0.7479 0.6833 0.7476 0.0095  -0.0203 0.0650  77   TYR A OH  
605  N N   . PRO A 78  ? 0.9828 0.8332 0.9570 -0.0042 -0.0362 0.0428  78   PRO A N   
606  C CA  . PRO A 78  ? 0.9849 0.8205 0.9514 -0.0043 -0.0395 0.0374  78   PRO A CA  
607  C C   . PRO A 78  ? 0.9520 0.7769 0.9091 0.0074  -0.0390 0.0330  78   PRO A C   
608  O O   . PRO A 78  ? 0.9632 0.7750 0.9127 0.0133  -0.0394 0.0349  78   PRO A O   
609  C CB  . PRO A 78  ? 1.0175 0.8342 0.9777 -0.0127 -0.0439 0.0404  78   PRO A CB  
610  C CG  . PRO A 78  ? 1.0567 0.8872 1.0264 -0.0207 -0.0426 0.0469  78   PRO A CG  
611  C CD  . PRO A 78  ? 1.0295 0.8765 1.0051 -0.0133 -0.0378 0.0487  78   PRO A CD  
612  N N   . GLY A 79  ? 0.9571 0.7874 0.9142 0.0110  -0.0381 0.0276  79   GLY A N   
613  C CA  . GLY A 79  ? 0.9168 0.7379 0.8647 0.0220  -0.0374 0.0231  79   GLY A CA  
614  C C   . GLY A 79  ? 0.8884 0.7248 0.8407 0.0319  -0.0328 0.0239  79   GLY A C   
615  O O   . GLY A 79  ? 0.8997 0.7336 0.8462 0.0418  -0.0313 0.0207  79   GLY A O   
616  N N   . PHE A 80  ? 0.8063 0.6593 0.7687 0.0290  -0.0305 0.0284  80   PHE A N   
617  C CA  . PHE A 80  ? 0.7233 0.5927 0.6909 0.0362  -0.0267 0.0297  80   PHE A CA  
618  C C   . PHE A 80  ? 0.6785 0.5654 0.6527 0.0364  -0.0238 0.0264  80   PHE A C   
619  O O   . PHE A 80  ? 0.6739 0.5690 0.6543 0.0287  -0.0236 0.0262  80   PHE A O   
620  C CB  . PHE A 80  ? 0.6853 0.5635 0.6593 0.0320  -0.0261 0.0356  80   PHE A CB  
621  C CG  . PHE A 80  ? 0.6507 0.5490 0.6318 0.0364  -0.0227 0.0371  80   PHE A CG  
622  C CD1 . PHE A 80  ? 0.6409 0.5411 0.6191 0.0468  -0.0215 0.0375  80   PHE A CD1 
623  C CD2 . PHE A 80  ? 0.6240 0.5392 0.6143 0.0302  -0.0209 0.0381  80   PHE A CD2 
624  C CE1 . PHE A 80  ? 0.5949 0.5152 0.5801 0.0497  -0.0189 0.0391  80   PHE A CE1 
625  C CE2 . PHE A 80  ? 0.6291 0.5618 0.6251 0.0330  -0.0183 0.0393  80   PHE A CE2 
626  C CZ  . PHE A 80  ? 0.5937 0.5296 0.5875 0.0422  -0.0175 0.0399  80   PHE A CZ  
627  N N   . GLU A 81  ? 0.6169 0.5094 0.5892 0.0453  -0.0214 0.0242  81   GLU A N   
628  C CA  . GLU A 81  ? 0.7135 0.6209 0.6906 0.0455  -0.0185 0.0213  81   GLU A CA  
629  C C   . GLU A 81  ? 0.6424 0.5682 0.6303 0.0391  -0.0165 0.0236  81   GLU A C   
630  O O   . GLU A 81  ? 0.5667 0.5003 0.5582 0.0351  -0.0153 0.0217  81   GLU A O   
631  C CB  . GLU A 81  ? 0.8345 0.7480 0.8090 0.0563  -0.0157 0.0198  81   GLU A CB  
632  C CG  . GLU A 81  ? 0.9702 0.8997 0.9494 0.0562  -0.0125 0.0177  81   GLU A CG  
633  C CD  . GLU A 81  ? 1.1370 1.0573 1.1095 0.0560  -0.0132 0.0131  81   GLU A CD  
634  O OE1 . GLU A 81  ? 1.2444 1.1485 1.2068 0.0616  -0.0149 0.0105  81   GLU A OE1 
635  O OE2 . GLU A 81  ? 1.1087 1.0372 1.0853 0.0507  -0.0121 0.0120  81   GLU A OE2 
636  N N   . GLY A 82  ? 0.5684 0.5001 0.5602 0.0384  -0.0163 0.0277  82   GLY A N   
637  C CA  . GLY A 82  ? 0.6011 0.5498 0.6015 0.0337  -0.0143 0.0295  82   GLY A CA  
638  C C   . GLY A 82  ? 0.6202 0.5690 0.6239 0.0249  -0.0149 0.0293  82   GLY A C   
639  O O   . GLY A 82  ? 0.6334 0.5937 0.6422 0.0215  -0.0130 0.0288  82   GLY A O   
640  N N   . THR A 83  ? 0.5568 0.4926 0.5574 0.0212  -0.0177 0.0298  83   THR A N   
641  C CA  . THR A 83  ? 0.5678 0.5043 0.5716 0.0135  -0.0186 0.0297  83   THR A CA  
642  C C   . THR A 83  ? 0.6384 0.5685 0.6389 0.0128  -0.0199 0.0256  83   THR A C   
643  O O   . THR A 83  ? 0.6250 0.5615 0.6292 0.0088  -0.0194 0.0246  83   THR A O   
644  C CB  . THR A 83  ? 0.5588 0.4881 0.5624 0.0083  -0.0209 0.0334  83   THR A CB  
645  O OG1 . THR A 83  ? 0.6003 0.5127 0.5962 0.0108  -0.0236 0.0334  83   THR A OG1 
646  C CG2 . THR A 83  ? 0.5082 0.4462 0.5154 0.0080  -0.0193 0.0377  83   THR A CG2 
647  N N   . GLU A 84  ? 0.6346 0.5520 0.6275 0.0172  -0.0216 0.0232  84   GLU A N   
648  C CA  . GLU A 84  ? 0.6632 0.5732 0.6515 0.0162  -0.0236 0.0193  84   GLU A CA  
649  C C   . GLU A 84  ? 0.6437 0.5640 0.6337 0.0184  -0.0209 0.0166  84   GLU A C   
650  O O   . GLU A 84  ? 0.6714 0.5920 0.6614 0.0150  -0.0220 0.0147  84   GLU A O   
651  C CB  . GLU A 84  ? 0.7817 0.6739 0.7594 0.0210  -0.0261 0.0168  84   GLU A CB  
652  C CG  . GLU A 84  ? 0.9232 0.8003 0.8969 0.0174  -0.0296 0.0193  84   GLU A CG  
653  C CD  . GLU A 84  ? 1.0687 0.9438 1.0452 0.0071  -0.0329 0.0204  84   GLU A CD  
654  O OE1 . GLU A 84  ? 1.1083 0.9917 1.0885 0.0038  -0.0329 0.0184  84   GLU A OE1 
655  O OE2 . GLU A 84  ? 1.1317 0.9975 1.1067 0.0022  -0.0354 0.0235  84   GLU A OE2 
656  N N   . MET A 85  ? 0.5604 0.4898 0.5519 0.0238  -0.0175 0.0167  85   MET A N   
657  C CA  . MET A 85  ? 0.5793 0.5182 0.5720 0.0254  -0.0147 0.0148  85   MET A CA  
658  C C   . MET A 85  ? 0.5211 0.4683 0.5196 0.0190  -0.0140 0.0156  85   MET A C   
659  O O   . MET A 85  ? 0.5354 0.4869 0.5333 0.0191  -0.0125 0.0140  85   MET A O   
660  C CB  . MET A 85  ? 0.5576 0.5074 0.5524 0.0308  -0.0113 0.0158  85   MET A CB  
661  C CG  . MET A 85  ? 0.5977 0.5586 0.5997 0.0278  -0.0099 0.0192  85   MET A CG  
662  S SD  . MET A 85  ? 0.7496 0.7268 0.7549 0.0324  -0.0062 0.0202  85   MET A SD  
663  C CE  . MET A 85  ? 0.8009 0.7867 0.8094 0.0264  -0.0040 0.0192  85   MET A CE  
664  N N   . TRP A 86  ? 0.4185 0.3679 0.4219 0.0141  -0.0148 0.0182  86   TRP A N   
665  C CA  . TRP A 86  ? 0.4361 0.3925 0.4440 0.0093  -0.0141 0.0189  86   TRP A CA  
666  C C   . TRP A 86  ? 0.4969 0.4480 0.5044 0.0053  -0.0172 0.0183  86   TRP A C   
667  O O   . TRP A 86  ? 0.4051 0.3617 0.4155 0.0027  -0.0167 0.0186  86   TRP A O   
668  C CB  . TRP A 86  ? 0.4230 0.3871 0.4363 0.0068  -0.0126 0.0219  86   TRP A CB  
669  C CG  . TRP A 86  ? 0.4826 0.4530 0.4966 0.0099  -0.0104 0.0226  86   TRP A CG  
670  C CD1 . TRP A 86  ? 0.4136 0.3833 0.4274 0.0125  -0.0108 0.0245  86   TRP A CD1 
671  C CD2 . TRP A 86  ? 0.4167 0.3957 0.4318 0.0105  -0.0076 0.0218  86   TRP A CD2 
672  N NE1 . TRP A 86  ? 0.4461 0.4252 0.4615 0.0149  -0.0086 0.0248  86   TRP A NE1 
673  C CE2 . TRP A 86  ? 0.4284 0.4133 0.4447 0.0131  -0.0067 0.0232  86   TRP A CE2 
674  C CE3 . TRP A 86  ? 0.4264 0.4083 0.4412 0.0088  -0.0060 0.0203  86   TRP A CE3 
675  C CZ2 . TRP A 86  ? 0.4502 0.4454 0.4682 0.0132  -0.0044 0.0231  86   TRP A CZ2 
676  C CZ3 . TRP A 86  ? 0.4691 0.4589 0.4847 0.0088  -0.0035 0.0204  86   TRP A CZ3 
677  C CH2 . TRP A 86  ? 0.4386 0.4356 0.4561 0.0105  -0.0028 0.0217  86   TRP A CH2 
678  N N   . ASN A 87  ? 0.3959 0.3364 0.3994 0.0049  -0.0205 0.0178  87   ASN A N   
679  C CA  . ASN A 87  ? 0.5164 0.4528 0.5199 -0.0002 -0.0241 0.0177  87   ASN A CA  
680  C C   . ASN A 87  ? 0.5452 0.4804 0.5451 0.0005  -0.0254 0.0144  87   ASN A C   
681  O O   . ASN A 87  ? 0.5525 0.4851 0.5473 0.0054  -0.0241 0.0117  87   ASN A O   
682  C CB  . ASN A 87  ? 0.4952 0.4190 0.4947 -0.0023 -0.0278 0.0183  87   ASN A CB  
683  C CG  . ASN A 87  ? 0.5677 0.4941 0.5722 -0.0064 -0.0276 0.0228  87   ASN A CG  
684  O OD1 . ASN A 87  ? 0.6348 0.5730 0.6461 -0.0086 -0.0255 0.0252  87   ASN A OD1 
685  N ND2 . ASN A 87  ? 0.6018 0.5164 0.6019 -0.0070 -0.0298 0.0241  87   ASN A ND2 
686  N N   . PRO A 88  ? 0.5935 0.5316 0.5960 -0.0041 -0.0279 0.0148  88   PRO A N   
687  C CA  . PRO A 88  ? 0.5849 0.5219 0.5833 -0.0033 -0.0297 0.0119  88   PRO A CA  
688  C C   . PRO A 88  ? 0.5377 0.4618 0.5263 -0.0004 -0.0320 0.0081  88   PRO A C   
689  O O   . PRO A 88  ? 0.4862 0.3999 0.4713 -0.0021 -0.0348 0.0077  88   PRO A O   
690  C CB  . PRO A 88  ? 0.5212 0.4621 0.5239 -0.0095 -0.0335 0.0134  88   PRO A CB  
691  C CG  . PRO A 88  ? 0.4958 0.4460 0.5069 -0.0119 -0.0311 0.0175  88   PRO A CG  
692  C CD  . PRO A 88  ? 0.4999 0.4443 0.5094 -0.0099 -0.0291 0.0183  88   PRO A CD  
693  N N   . ASN A 89  ? 0.5058 0.4298 0.4891 0.0041  -0.0308 0.0053  89   ASN A N   
694  C CA  . ASN A 89  ? 0.4870 0.3992 0.4599 0.0079  -0.0325 0.0013  89   ASN A CA  
695  C C   . ASN A 89  ? 0.5374 0.4476 0.5048 0.0068  -0.0360 -0.0014 89   ASN A C   
696  O O   . ASN A 89  ? 0.5439 0.4458 0.5014 0.0108  -0.0368 -0.0052 89   ASN A O   
697  C CB  . ASN A 89  ? 0.4650 0.3789 0.4348 0.0153  -0.0277 0.0004  89   ASN A CB  
698  C CG  . ASN A 89  ? 0.5196 0.4440 0.4910 0.0171  -0.0242 0.0009  89   ASN A CG  
699  O OD1 . ASN A 89  ? 0.4125 0.3443 0.3894 0.0135  -0.0242 0.0029  89   ASN A OD1 
700  N ND2 . ASN A 89  ? 0.4859 0.4111 0.4521 0.0230  -0.0209 -0.0006 89   ASN A ND2 
701  N N   . ARG A 90  ? 0.4905 0.4090 0.4639 0.0020  -0.0378 0.0005  90   ARG A N   
702  C CA  . ARG A 90  ? 0.4731 0.3911 0.4424 -0.0001 -0.0422 -0.0015 90   ARG A CA  
703  C C   . ARG A 90  ? 0.4842 0.4081 0.4614 -0.0076 -0.0460 0.0012  90   ARG A C   
704  O O   . ARG A 90  ? 0.5013 0.4301 0.4866 -0.0102 -0.0442 0.0046  90   ARG A O   
705  C CB  . ARG A 90  ? 0.4511 0.3778 0.4200 0.0036  -0.0395 -0.0012 90   ARG A CB  
706  C CG  . ARG A 90  ? 0.5747 0.4969 0.5349 0.0104  -0.0361 -0.0038 90   ARG A CG  
707  C CD  . ARG A 90  ? 0.6820 0.5930 0.6304 0.0117  -0.0404 -0.0085 90   ARG A CD  
708  N NE  . ARG A 90  ? 0.9488 0.8561 0.8885 0.0189  -0.0366 -0.0109 90   ARG A NE  
709  C CZ  . ARG A 90  ? 1.0557 0.9573 0.9924 0.0232  -0.0340 -0.0121 90   ARG A CZ  
710  N NH1 . ARG A 90  ? 1.0575 0.9545 0.9985 0.0209  -0.0349 -0.0111 90   ARG A NH1 
711  N NH2 . ARG A 90  ? 0.9911 0.8922 0.9205 0.0302  -0.0302 -0.0139 90   ARG A NH2 
712  N N   . GLU A 91  ? 0.4900 0.4145 0.4649 -0.0112 -0.0512 -0.0002 91   GLU A N   
713  C CA  . GLU A 91  ? 0.4796 0.4111 0.4620 -0.0190 -0.0555 0.0025  91   GLU A CA  
714  C C   . GLU A 91  ? 0.4823 0.4305 0.4765 -0.0189 -0.0520 0.0072  91   GLU A C   
715  O O   . GLU A 91  ? 0.4250 0.3799 0.4198 -0.0134 -0.0484 0.0077  91   GLU A O   
716  C CB  . GLU A 91  ? 0.4992 0.4308 0.4767 -0.0222 -0.0618 0.0001  91   GLU A CB  
717  C CG  . GLU A 91  ? 0.5847 0.5277 0.5711 -0.0305 -0.0666 0.0032  91   GLU A CG  
718  C CD  . GLU A 91  ? 0.6958 0.6421 0.6780 -0.0330 -0.0729 0.0010  91   GLU A CD  
719  O OE1 . GLU A 91  ? 0.5725 0.5057 0.5424 -0.0312 -0.0755 -0.0039 91   GLU A OE1 
720  O OE2 . GLU A 91  ? 0.8060 0.7686 0.7969 -0.0362 -0.0751 0.0043  91   GLU A OE2 
721  N N   . LEU A 92  ? 0.3702 0.3241 0.3727 -0.0246 -0.0528 0.0107  92   LEU A N   
722  C CA  . LEU A 92  ? 0.4354 0.4056 0.4485 -0.0243 -0.0497 0.0151  92   LEU A CA  
723  C C   . LEU A 92  ? 0.4949 0.4774 0.5115 -0.0258 -0.0533 0.0160  92   LEU A C   
724  O O   . LEU A 92  ? 0.5159 0.4982 0.5319 -0.0319 -0.0592 0.0154  92   LEU A O   
725  C CB  . LEU A 92  ? 0.3582 0.3322 0.3789 -0.0297 -0.0491 0.0189  92   LEU A CB  
726  C CG  . LEU A 92  ? 0.5334 0.4972 0.5517 -0.0285 -0.0458 0.0190  92   LEU A CG  
727  C CD1 . LEU A 92  ? 0.4924 0.4632 0.5188 -0.0337 -0.0450 0.0238  92   LEU A CD1 
728  C CD2 . LEU A 92  ? 0.4364 0.4004 0.4529 -0.0207 -0.0402 0.0180  92   LEU A CD2 
729  N N   . SER A 93  ? 0.4649 0.4577 0.4848 -0.0203 -0.0500 0.0177  93   SER A N   
730  C CA  . SER A 93  ? 0.3904 0.3965 0.4141 -0.0202 -0.0530 0.0193  93   SER A CA  
731  C C   . SER A 93  ? 0.4345 0.4512 0.4630 -0.0136 -0.0479 0.0222  93   SER A C   
732  O O   . SER A 93  ? 0.4115 0.4218 0.4366 -0.0085 -0.0428 0.0215  93   SER A O   
733  C CB  . SER A 93  ? 0.4209 0.4208 0.4353 -0.0182 -0.0567 0.0157  93   SER A CB  
734  O OG  . SER A 93  ? 0.4023 0.4155 0.4196 -0.0160 -0.0590 0.0175  93   SER A OG  
735  N N   . GLU A 94  ? 0.4172 0.4501 0.4531 -0.0135 -0.0495 0.0254  94   GLU A N   
736  C CA  . GLU A 94  ? 0.4153 0.4565 0.4533 -0.0056 -0.0452 0.0277  94   GLU A CA  
737  C C   . GLU A 94  ? 0.4345 0.4693 0.4636 0.0008  -0.0452 0.0258  94   GLU A C   
738  O O   . GLU A 94  ? 0.4173 0.4507 0.4437 0.0078  -0.0408 0.0266  94   GLU A O   
739  C CB  . GLU A 94  ? 0.4263 0.4876 0.4744 -0.0061 -0.0468 0.0318  94   GLU A CB  
740  C CG  . GLU A 94  ? 0.4691 0.5384 0.5262 -0.0114 -0.0453 0.0346  94   GLU A CG  
741  C CD  . GLU A 94  ? 0.4850 0.5770 0.5526 -0.0108 -0.0459 0.0392  94   GLU A CD  
742  O OE1 . GLU A 94  ? 0.3794 0.4783 0.4485 -0.0026 -0.0413 0.0410  94   GLU A OE1 
743  O OE2 . GLU A 94  ? 0.4556 0.5585 0.5296 -0.0186 -0.0510 0.0410  94   GLU A OE2 
744  N N   . ASP A 95  ? 0.3835 0.4136 0.4070 -0.0018 -0.0501 0.0232  95   ASP A N   
745  C CA  . ASP A 95  ? 0.4655 0.4885 0.4792 0.0039  -0.0500 0.0214  95   ASP A CA  
746  C C   . ASP A 95  ? 0.4551 0.4620 0.4612 0.0050  -0.0459 0.0185  95   ASP A C   
747  O O   . ASP A 95  ? 0.4272 0.4248 0.4277 0.0018  -0.0483 0.0152  95   ASP A O   
748  C CB  . ASP A 95  ? 0.4974 0.5223 0.5074 0.0009  -0.0570 0.0197  95   ASP A CB  
749  C CG  . ASP A 95  ? 0.4795 0.4967 0.4782 0.0064  -0.0570 0.0178  95   ASP A CG  
750  O OD1 . ASP A 95  ? 0.4596 0.4707 0.4539 0.0124  -0.0516 0.0185  95   ASP A OD1 
751  O OD2 . ASP A 95  ? 0.6164 0.6337 0.6101 0.0043  -0.0627 0.0159  95   ASP A OD2 
752  N N   . CYS A 96  ? 0.3624 0.3663 0.3681 0.0094  -0.0399 0.0198  96   CYS A N   
753  C CA  . CYS A 96  ? 0.4205 0.4129 0.4218 0.0095  -0.0357 0.0179  96   CYS A CA  
754  C C   . CYS A 96  ? 0.4088 0.3961 0.4047 0.0149  -0.0306 0.0187  96   CYS A C   
755  O O   . CYS A 96  ? 0.3846 0.3648 0.3778 0.0147  -0.0269 0.0177  96   CYS A O   
756  C CB  . CYS A 96  ? 0.3712 0.3649 0.3797 0.0058  -0.0337 0.0187  96   CYS A CB  
757  S SG  . CYS A 96  ? 0.4235 0.4269 0.4393 0.0086  -0.0297 0.0223  96   CYS A SG  
758  N N   . LEU A 97  ? 0.3344 0.3254 0.3285 0.0195  -0.0306 0.0208  97   LEU A N   
759  C CA  . LEU A 97  ? 0.4254 0.4101 0.4140 0.0240  -0.0258 0.0221  97   LEU A CA  
760  C C   . LEU A 97  ? 0.4233 0.3994 0.4018 0.0254  -0.0253 0.0210  97   LEU A C   
761  O O   . LEU A 97  ? 0.4212 0.3970 0.3939 0.0292  -0.0265 0.0223  97   LEU A O   
762  C CB  . LEU A 97  ? 0.3991 0.3895 0.3892 0.0292  -0.0254 0.0252  97   LEU A CB  
763  C CG  . LEU A 97  ? 0.4048 0.4027 0.4036 0.0287  -0.0239 0.0264  97   LEU A CG  
764  C CD1 . LEU A 97  ? 0.3794 0.3818 0.3782 0.0356  -0.0226 0.0292  97   LEU A CD1 
765  C CD2 . LEU A 97  ? 0.4247 0.4153 0.4236 0.0260  -0.0195 0.0252  97   LEU A CD2 
766  N N   . TYR A 98  ? 0.4044 0.3747 0.3808 0.0227  -0.0233 0.0188  98   TYR A N   
767  C CA  . TYR A 98  ? 0.3991 0.3629 0.3665 0.0237  -0.0222 0.0177  98   TYR A CA  
768  C C   . TYR A 98  ? 0.4617 0.4206 0.4279 0.0227  -0.0169 0.0179  98   TYR A C   
769  O O   . TYR A 98  ? 0.4181 0.3782 0.3904 0.0203  -0.0151 0.0178  98   TYR A O   
770  C CB  . TYR A 98  ? 0.4390 0.4022 0.4048 0.0217  -0.0260 0.0143  98   TYR A CB  
771  C CG  . TYR A 98  ? 0.4685 0.4369 0.4351 0.0213  -0.0320 0.0138  98   TYR A CG  
772  C CD1 . TYR A 98  ? 0.4874 0.4558 0.4464 0.0243  -0.0345 0.0139  98   TYR A CD1 
773  C CD2 . TYR A 98  ? 0.4658 0.4402 0.4410 0.0175  -0.0354 0.0137  98   TYR A CD2 
774  C CE1 . TYR A 98  ? 0.5032 0.4779 0.4632 0.0235  -0.0407 0.0136  98   TYR A CE1 
775  C CE2 . TYR A 98  ? 0.5043 0.4853 0.4810 0.0161  -0.0414 0.0136  98   TYR A CE2 
776  C CZ  . TYR A 98  ? 0.5390 0.5204 0.5083 0.0191  -0.0441 0.0134  98   TYR A CZ  
777  O OH  . TYR A 98  ? 0.4662 0.4557 0.4374 0.0173  -0.0504 0.0134  98   TYR A OH  
778  N N   . LEU A 99  ? 0.4222 0.3766 0.3806 0.0241  -0.0144 0.0185  99   LEU A N   
779  C CA  . LEU A 99  ? 0.4311 0.3827 0.3884 0.0222  -0.0095 0.0191  99   LEU A CA  
780  C C   . LEU A 99  ? 0.4697 0.4203 0.4207 0.0228  -0.0082 0.0179  99   LEU A C   
781  O O   . LEU A 99  ? 0.4666 0.4168 0.4122 0.0252  -0.0108 0.0167  99   LEU A O   
782  C CB  . LEU A 99  ? 0.4012 0.3481 0.3552 0.0226  -0.0063 0.0223  99   LEU A CB  
783  C CG  . LEU A 99  ? 0.4302 0.3724 0.3750 0.0258  -0.0061 0.0249  99   LEU A CG  
784  C CD1 . LEU A 99  ? 0.4009 0.3414 0.3387 0.0250  -0.0034 0.0255  99   LEU A CD1 
785  C CD2 . LEU A 99  ? 0.4400 0.3758 0.3824 0.0265  -0.0039 0.0278  99   LEU A CD2 
786  N N   . ASN A 100 ? 0.4376 0.3888 0.3895 0.0209  -0.0042 0.0182  100  ASN A N   
787  C CA  . ASN A 100 ? 0.4417 0.3946 0.3895 0.0219  -0.0023 0.0169  100  ASN A CA  
788  C C   . ASN A 100 ? 0.4653 0.4188 0.4098 0.0201  0.0028  0.0200  100  ASN A C   
789  O O   . ASN A 100 ? 0.4347 0.3878 0.3829 0.0167  0.0048  0.0220  100  ASN A O   
790  C CB  . ASN A 100 ? 0.3748 0.3307 0.3285 0.0213  -0.0026 0.0143  100  ASN A CB  
791  C CG  . ASN A 100 ? 0.4467 0.4013 0.4046 0.0212  -0.0075 0.0119  100  ASN A CG  
792  O OD1 . ASN A 100 ? 0.4304 0.3826 0.3841 0.0229  -0.0112 0.0100  100  ASN A OD1 
793  N ND2 . ASN A 100 ? 0.4213 0.3776 0.3871 0.0187  -0.0076 0.0121  100  ASN A ND2 
794  N N   . VAL A 101 ? 0.4970 0.4517 0.4344 0.0221  0.0047  0.0205  101  VAL A N   
795  C CA  . VAL A 101 ? 0.4525 0.4093 0.3866 0.0197  0.0097  0.0240  101  VAL A CA  
796  C C   . VAL A 101 ? 0.4778 0.4421 0.4104 0.0216  0.0126  0.0230  101  VAL A C   
797  O O   . VAL A 101 ? 0.5432 0.5073 0.4700 0.0262  0.0114  0.0207  101  VAL A O   
798  C CB  . VAL A 101 ? 0.4618 0.4132 0.3865 0.0207  0.0102  0.0272  101  VAL A CB  
799  C CG1 . VAL A 101 ? 0.4259 0.3792 0.3467 0.0170  0.0156  0.0315  101  VAL A CG1 
800  C CG2 . VAL A 101 ? 0.4154 0.3593 0.3404 0.0206  0.0075  0.0284  101  VAL A CG2 
801  N N   . TRP A 102 ? 0.4582 0.4296 0.3956 0.0183  0.0164  0.0247  102  TRP A N   
802  C CA  . TRP A 102 ? 0.4651 0.4462 0.4012 0.0204  0.0202  0.0249  102  TRP A CA  
803  C C   . TRP A 102 ? 0.4830 0.4683 0.4162 0.0158  0.0250  0.0301  102  TRP A C   
804  O O   . TRP A 102 ? 0.4649 0.4480 0.4012 0.0095  0.0257  0.0328  102  TRP A O   
805  C CB  . TRP A 102 ? 0.4403 0.4295 0.3851 0.0205  0.0209  0.0233  102  TRP A CB  
806  C CG  . TRP A 102 ? 0.4446 0.4301 0.3919 0.0249  0.0169  0.0187  102  TRP A CG  
807  C CD1 . TRP A 102 ? 0.4320 0.4187 0.3761 0.0313  0.0165  0.0153  102  TRP A CD1 
808  C CD2 . TRP A 102 ? 0.3963 0.3758 0.3491 0.0229  0.0129  0.0171  102  TRP A CD2 
809  N NE1 . TRP A 102 ? 0.4121 0.3924 0.3591 0.0327  0.0122  0.0119  102  TRP A NE1 
810  C CE2 . TRP A 102 ? 0.4709 0.4479 0.4239 0.0275  0.0101  0.0132  102  TRP A CE2 
811  C CE3 . TRP A 102 ? 0.4418 0.4174 0.3987 0.0180  0.0116  0.0187  102  TRP A CE3 
812  C CZ2 . TRP A 102 ? 0.4765 0.4483 0.4344 0.0263  0.0060  0.0114  102  TRP A CZ2 
813  C CZ3 . TRP A 102 ? 0.5066 0.4785 0.4687 0.0178  0.0079  0.0167  102  TRP A CZ3 
814  C CH2 . TRP A 102 ? 0.4878 0.4583 0.4507 0.0215  0.0052  0.0133  102  TRP A CH2 
815  N N   . THR A 103 ? 0.4728 0.4636 0.3995 0.0186  0.0282  0.0314  103  THR A N   
816  C CA  . THR A 103 ? 0.4928 0.4890 0.4165 0.0137  0.0331  0.0369  103  THR A CA  
817  C C   . THR A 103 ? 0.5506 0.5613 0.4736 0.0175  0.0375  0.0373  103  THR A C   
818  O O   . THR A 103 ? 0.5277 0.5399 0.4489 0.0252  0.0363  0.0329  103  THR A O   
819  C CB  . THR A 103 ? 0.5507 0.5370 0.4634 0.0134  0.0330  0.0400  103  THR A CB  
820  O OG1 . THR A 103 ? 0.5750 0.5624 0.4794 0.0207  0.0329  0.0381  103  THR A OG1 
821  C CG2 . THR A 103 ? 0.5383 0.5106 0.4504 0.0127  0.0283  0.0391  103  THR A CG2 
822  N N   . PRO A 104 ? 0.5329 0.5541 0.4570 0.0121  0.0425  0.0425  104  PRO A N   
823  C CA  . PRO A 104 ? 0.5434 0.5803 0.4659 0.0159  0.0476  0.0440  104  PRO A CA  
824  C C   . PRO A 104 ? 0.5535 0.5858 0.4636 0.0235  0.0479  0.0425  104  PRO A C   
825  O O   . PRO A 104 ? 0.6252 0.6437 0.5280 0.0237  0.0448  0.0422  104  PRO A O   
826  C CB  . PRO A 104 ? 0.5272 0.5723 0.4510 0.0062  0.0523  0.0511  104  PRO A CB  
827  C CG  . PRO A 104 ? 0.5273 0.5650 0.4580 -0.0023 0.0493  0.0516  104  PRO A CG  
828  C CD  . PRO A 104 ? 0.5446 0.5638 0.4715 0.0016  0.0437  0.0473  104  PRO A CD  
829  N N   . TYR A 105 ? 0.5443 0.5889 0.4520 0.0304  0.0515  0.0415  105  TYR A N   
830  C CA  . TYR A 105 ? 0.5725 0.6140 0.4673 0.0381  0.0522  0.0398  105  TYR A CA  
831  C C   . TYR A 105 ? 0.6416 0.7005 0.5338 0.0390  0.0596  0.0444  105  TYR A C   
832  O O   . TYR A 105 ? 0.6410 0.7156 0.5399 0.0419  0.0630  0.0442  105  TYR A O   
833  C CB  . TYR A 105 ? 0.4748 0.5121 0.3672 0.0481  0.0489  0.0321  105  TYR A CB  
834  C CG  . TYR A 105 ? 0.5234 0.5565 0.4013 0.0565  0.0489  0.0292  105  TYR A CG  
835  C CD1 . TYR A 105 ? 0.5242 0.5411 0.3942 0.0587  0.0428  0.0250  105  TYR A CD1 
836  C CD2 . TYR A 105 ? 0.5005 0.5470 0.3724 0.0625  0.0551  0.0304  105  TYR A CD2 
837  C CE1 . TYR A 105 ? 0.5095 0.5221 0.3651 0.0661  0.0422  0.0219  105  TYR A CE1 
838  C CE2 . TYR A 105 ? 0.4699 0.5118 0.3270 0.0707  0.0551  0.0272  105  TYR A CE2 
839  C CZ  . TYR A 105 ? 0.5861 0.6105 0.4349 0.0722  0.0483  0.0227  105  TYR A CZ  
840  O OH  . TYR A 105 ? 0.6553 0.6748 0.4886 0.0799  0.0477  0.0192  105  TYR A OH  
841  N N   . PRO A 106 ? 0.6726 0.7300 0.5552 0.0368  0.0622  0.0491  106  PRO A N   
842  C CA  . PRO A 106 ? 0.5989 0.6385 0.4729 0.0342  0.0582  0.0501  106  PRO A CA  
843  C C   . PRO A 106 ? 0.5910 0.6229 0.4724 0.0237  0.0562  0.0536  106  PRO A C   
844  O O   . PRO A 106 ? 0.6030 0.6444 0.4947 0.0174  0.0585  0.0560  106  PRO A O   
845  C CB  . PRO A 106 ? 0.6648 0.7102 0.5278 0.0341  0.0636  0.0560  106  PRO A CB  
846  C CG  . PRO A 106 ? 0.7114 0.7778 0.5823 0.0300  0.0705  0.0608  106  PRO A CG  
847  C CD  . PRO A 106 ? 0.6542 0.7289 0.5329 0.0373  0.0697  0.0544  106  PRO A CD  
848  N N   . ARG A 107 ? 0.6327 0.6478 0.5084 0.0222  0.0520  0.0539  107  ARG A N   
849  C CA  . ARG A 107 ? 0.6591 0.6644 0.5404 0.0138  0.0497  0.0562  107  ARG A CA  
850  C C   . ARG A 107 ? 0.6388 0.6492 0.5208 0.0039  0.0547  0.0639  107  ARG A C   
851  O O   . ARG A 107 ? 0.7005 0.7181 0.5756 0.0034  0.0595  0.0687  107  ARG A O   
852  C CB  . ARG A 107 ? 0.6594 0.6466 0.5339 0.0157  0.0443  0.0552  107  ARG A CB  
853  C CG  . ARG A 107 ? 0.7497 0.7323 0.6261 0.0231  0.0384  0.0476  107  ARG A CG  
854  C CD  . ARG A 107 ? 0.8408 0.8086 0.7130 0.0242  0.0330  0.0471  107  ARG A CD  
855  N NE  . ARG A 107 ? 0.7869 0.7487 0.6465 0.0251  0.0340  0.0519  107  ARG A NE  
856  C CZ  . ARG A 107 ? 0.7691 0.7310 0.6187 0.0317  0.0326  0.0504  107  ARG A CZ  
857  N NH1 . ARG A 107 ? 0.6507 0.6171 0.5014 0.0375  0.0302  0.0439  107  ARG A NH1 
858  N NH2 . ARG A 107 ? 0.8378 0.7944 0.6756 0.0326  0.0334  0.0552  107  ARG A NH2 
859  N N   . PRO A 108 ? 0.6724 0.6790 0.5622 -0.0044 0.0537  0.0652  108  PRO A N   
860  C CA  . PRO A 108 ? 0.7431 0.7528 0.6336 -0.0157 0.0576  0.0722  108  PRO A CA  
861  C C   . PRO A 108 ? 0.8011 0.7985 0.6783 -0.0185 0.0591  0.0783  108  PRO A C   
862  O O   . PRO A 108 ? 0.7948 0.7749 0.6646 -0.0146 0.0552  0.0771  108  PRO A O   
863  C CB  . PRO A 108 ? 0.6628 0.6629 0.5606 -0.0221 0.0539  0.0705  108  PRO A CB  
864  C CG  . PRO A 108 ? 0.7085 0.7087 0.6131 -0.0143 0.0496  0.0630  108  PRO A CG  
865  C CD  . PRO A 108 ? 0.7131 0.7107 0.6101 -0.0039 0.0483  0.0601  108  PRO A CD  
866  N N   . ALA A 109 ? 0.8177 0.8241 0.6919 -0.0252 0.0646  0.0853  109  ALA A N   
867  C CA  . ALA A 109 ? 0.9243 0.9185 0.7849 -0.0283 0.0663  0.0919  109  ALA A CA  
868  C C   . ALA A 109 ? 0.9452 0.9200 0.8029 -0.0383 0.0644  0.0956  109  ALA A C   
869  O O   . ALA A 109 ? 0.9601 0.9166 0.8058 -0.0379 0.0633  0.0990  109  ALA A O   
870  C CB  . ALA A 109 ? 0.9236 0.9346 0.7808 -0.0315 0.0732  0.0985  109  ALA A CB  
871  N N   . SER A 110 ? 0.9047 0.8829 0.7726 -0.0466 0.0639  0.0947  110  SER A N   
872  C CA  . SER A 110 ? 0.8793 0.8374 0.7441 -0.0554 0.0614  0.0965  110  SER A CA  
873  C C   . SER A 110 ? 0.7826 0.7334 0.6551 -0.0519 0.0560  0.0890  110  SER A C   
874  O O   . SER A 110 ? 0.7139 0.6790 0.5972 -0.0468 0.0549  0.0835  110  SER A O   
875  C CB  . SER A 110 ? 0.8776 0.8428 0.7454 -0.0703 0.0649  0.1025  110  SER A CB  
876  O OG  . SER A 110 ? 0.9459 0.9359 0.8282 -0.0719 0.0664  0.1001  110  SER A OG  
877  N N   . PRO A 111 ? 0.7143 0.6422 0.5805 -0.0543 0.0527  0.0891  111  PRO A N   
878  C CA  . PRO A 111 ? 0.6786 0.5981 0.5504 -0.0503 0.0478  0.0825  111  PRO A CA  
879  C C   . PRO A 111 ? 0.7078 0.6420 0.5935 -0.0553 0.0474  0.0788  111  PRO A C   
880  O O   . PRO A 111 ? 0.6963 0.6336 0.5840 -0.0667 0.0492  0.0819  111  PRO A O   
881  C CB  . PRO A 111 ? 0.5743 0.4674 0.4350 -0.0547 0.0461  0.0851  111  PRO A CB  
882  C CG  . PRO A 111 ? 0.6931 0.5782 0.5403 -0.0562 0.0491  0.0924  111  PRO A CG  
883  C CD  . PRO A 111 ? 0.7598 0.6679 0.6122 -0.0609 0.0539  0.0958  111  PRO A CD  
884  N N   . THR A 112 ? 0.6343 0.5773 0.5289 -0.0470 0.0449  0.0724  112  THR A N   
885  C CA  . THR A 112 ? 0.6109 0.5689 0.5186 -0.0493 0.0443  0.0688  112  THR A CA  
886  C C   . THR A 112 ? 0.5737 0.5203 0.4847 -0.0485 0.0398  0.0638  112  THR A C   
887  O O   . THR A 112 ? 0.5429 0.4779 0.4505 -0.0407 0.0369  0.0609  112  THR A O   
888  C CB  . THR A 112 ? 0.6383 0.6138 0.5530 -0.0398 0.0447  0.0652  112  THR A CB  
889  O OG1 . THR A 112 ? 0.6944 0.6780 0.6035 -0.0379 0.0487  0.0691  112  THR A OG1 
890  C CG2 . THR A 112 ? 0.6088 0.6026 0.5363 -0.0420 0.0451  0.0629  112  THR A CG2 
891  N N   . PRO A 113 ? 0.5735 0.5249 0.4912 -0.0565 0.0393  0.0630  113  PRO A N   
892  C CA  . PRO A 113 ? 0.5687 0.5112 0.4896 -0.0554 0.0354  0.0582  113  PRO A CA  
893  C C   . PRO A 113 ? 0.5347 0.4821 0.4617 -0.0441 0.0329  0.0529  113  PRO A C   
894  O O   . PRO A 113 ? 0.5167 0.4795 0.4497 -0.0391 0.0339  0.0518  113  PRO A O   
895  C CB  . PRO A 113 ? 0.5325 0.4875 0.4617 -0.0649 0.0357  0.0582  113  PRO A CB  
896  C CG  . PRO A 113 ? 0.6008 0.5593 0.5255 -0.0752 0.0394  0.0647  113  PRO A CG  
897  C CD  . PRO A 113 ? 0.6383 0.6016 0.5592 -0.0681 0.0423  0.0673  113  PRO A CD  
898  N N   . VAL A 114 ? 0.5438 0.4775 0.4687 -0.0401 0.0297  0.0498  114  VAL A N   
899  C CA  . VAL A 114 ? 0.5203 0.4567 0.4499 -0.0303 0.0271  0.0454  114  VAL A CA  
900  C C   . VAL A 114 ? 0.5248 0.4650 0.4629 -0.0311 0.0248  0.0415  114  VAL A C   
901  O O   . VAL A 114 ? 0.4576 0.3890 0.3936 -0.0364 0.0241  0.0412  114  VAL A O   
902  C CB  . VAL A 114 ? 0.5179 0.4382 0.4390 -0.0241 0.0252  0.0454  114  VAL A CB  
903  C CG1 . VAL A 114 ? 0.4824 0.4066 0.4090 -0.0153 0.0220  0.0412  114  VAL A CG1 
904  C CG2 . VAL A 114 ? 0.4007 0.3168 0.3123 -0.0233 0.0273  0.0498  114  VAL A CG2 
905  N N   . LEU A 115 ? 0.4209 0.3734 0.3675 -0.0259 0.0237  0.0385  115  LEU A N   
906  C CA  . LEU A 115 ? 0.4219 0.3775 0.3759 -0.0253 0.0214  0.0350  115  LEU A CA  
907  C C   . LEU A 115 ? 0.4203 0.3714 0.3751 -0.0171 0.0186  0.0321  115  LEU A C   
908  O O   . LEU A 115 ? 0.4969 0.4511 0.4514 -0.0115 0.0182  0.0316  115  LEU A O   
909  C CB  . LEU A 115 ? 0.4883 0.4615 0.4515 -0.0259 0.0222  0.0343  115  LEU A CB  
910  C CG  . LEU A 115 ? 0.5812 0.5642 0.5472 -0.0347 0.0243  0.0369  115  LEU A CG  
911  C CD1 . LEU A 115 ? 0.5994 0.6014 0.5743 -0.0323 0.0252  0.0365  115  LEU A CD1 
912  C CD2 . LEU A 115 ? 0.7222 0.6985 0.6881 -0.0409 0.0226  0.0359  115  LEU A CD2 
913  N N   . ILE A 116 ? 0.4408 0.3849 0.3964 -0.0165 0.0165  0.0302  116  ILE A N   
914  C CA  . ILE A 116 ? 0.4400 0.3819 0.3974 -0.0096 0.0139  0.0280  116  ILE A CA  
915  C C   . ILE A 116 ? 0.4044 0.3529 0.3700 -0.0095 0.0123  0.0254  116  ILE A C   
916  O O   . ILE A 116 ? 0.4484 0.3944 0.4145 -0.0131 0.0123  0.0249  116  ILE A O   
917  C CB  . ILE A 116 ? 0.4495 0.3779 0.4000 -0.0072 0.0130  0.0285  116  ILE A CB  
918  C CG1 . ILE A 116 ? 0.4489 0.3688 0.3899 -0.0073 0.0145  0.0317  116  ILE A CG1 
919  C CG2 . ILE A 116 ? 0.3732 0.3031 0.3271 -0.0004 0.0102  0.0268  116  ILE A CG2 
920  C CD1 . ILE A 116 ? 0.4295 0.3363 0.3634 -0.0029 0.0134  0.0324  116  ILE A CD1 
921  N N   . TRP A 117 ? 0.3744 0.3302 0.3455 -0.0054 0.0108  0.0239  117  TRP A N   
922  C CA  . TRP A 117 ? 0.4042 0.3661 0.3826 -0.0051 0.0093  0.0220  117  TRP A CA  
923  C C   . TRP A 117 ? 0.4805 0.4386 0.4605 -0.0018 0.0069  0.0208  117  TRP A C   
924  O O   . TRP A 117 ? 0.4457 0.4017 0.4242 0.0020  0.0054  0.0207  117  TRP A O   
925  C CB  . TRP A 117 ? 0.3919 0.3625 0.3746 -0.0026 0.0090  0.0212  117  TRP A CB  
926  C CG  . TRP A 117 ? 0.4132 0.3885 0.4026 -0.0018 0.0072  0.0198  117  TRP A CG  
927  C CD1 . TRP A 117 ? 0.4374 0.4120 0.4293 0.0018  0.0047  0.0184  117  TRP A CD1 
928  C CD2 . TRP A 117 ? 0.4278 0.4091 0.4216 -0.0049 0.0078  0.0200  117  TRP A CD2 
929  N NE1 . TRP A 117 ? 0.4414 0.4204 0.4387 0.0012  0.0039  0.0181  117  TRP A NE1 
930  C CE2 . TRP A 117 ? 0.4125 0.3959 0.4110 -0.0025 0.0057  0.0190  117  TRP A CE2 
931  C CE3 . TRP A 117 ? 0.3531 0.3380 0.3469 -0.0102 0.0095  0.0211  117  TRP A CE3 
932  C CZ2 . TRP A 117 ? 0.3851 0.3744 0.3880 -0.0042 0.0055  0.0192  117  TRP A CZ2 
933  C CZ3 . TRP A 117 ? 0.4098 0.4014 0.4084 -0.0122 0.0089  0.0210  117  TRP A CZ3 
934  C CH2 . TRP A 117 ? 0.4007 0.3946 0.4037 -0.0087 0.0070  0.0201  117  TRP A CH2 
935  N N   . ILE A 118 ? 0.4145 0.3728 0.3973 -0.0033 0.0066  0.0202  118  ILE A N   
936  C CA  . ILE A 118 ? 0.3712 0.3293 0.3570 -0.0003 0.0047  0.0194  118  ILE A CA  
937  C C   . ILE A 118 ? 0.3814 0.3469 0.3742 -0.0011 0.0037  0.0187  118  ILE A C   
938  O O   . ILE A 118 ? 0.4514 0.4189 0.4454 -0.0040 0.0045  0.0185  118  ILE A O   
939  C CB  . ILE A 118 ? 0.3990 0.3501 0.3807 -0.0004 0.0055  0.0195  118  ILE A CB  
940  C CG1 . ILE A 118 ? 0.3748 0.3164 0.3480 0.0003  0.0066  0.0206  118  ILE A CG1 
941  C CG2 . ILE A 118 ? 0.3990 0.3524 0.3843 0.0034  0.0040  0.0191  118  ILE A CG2 
942  C CD1 . ILE A 118 ? 0.3756 0.3074 0.3426 0.0012  0.0075  0.0205  118  ILE A CD1 
943  N N   . TYR A 119 ? 0.3668 0.3354 0.3633 0.0013  0.0016  0.0183  119  TYR A N   
944  C CA  . TYR A 119 ? 0.3617 0.3355 0.3637 0.0009  0.0005  0.0181  119  TYR A CA  
945  C C   . TYR A 119 ? 0.4191 0.3944 0.4240 0.0000  0.0003  0.0185  119  TYR A C   
946  O O   . TYR A 119 ? 0.3744 0.3471 0.3777 0.0010  0.0005  0.0187  119  TYR A O   
947  C CB  . TYR A 119 ? 0.3562 0.3302 0.3599 0.0031  -0.0020 0.0175  119  TYR A CB  
948  C CG  . TYR A 119 ? 0.4003 0.3725 0.4042 0.0044  -0.0041 0.0176  119  TYR A CG  
949  C CD1 . TYR A 119 ? 0.3356 0.3105 0.3438 0.0038  -0.0052 0.0186  119  TYR A CD1 
950  C CD2 . TYR A 119 ? 0.3558 0.3251 0.3558 0.0063  -0.0052 0.0171  119  TYR A CD2 
951  C CE1 . TYR A 119 ? 0.3818 0.3579 0.3913 0.0048  -0.0073 0.0191  119  TYR A CE1 
952  C CE2 . TYR A 119 ? 0.3104 0.2800 0.3110 0.0075  -0.0076 0.0174  119  TYR A CE2 
953  C CZ  . TYR A 119 ? 0.4153 0.3890 0.4211 0.0066  -0.0087 0.0184  119  TYR A CZ  
954  O OH  . TYR A 119 ? 0.3528 0.3292 0.3600 0.0077  -0.0112 0.0191  119  TYR A OH  
955  N N   . GLY A 120 ? 0.2965 0.2761 0.3050 -0.0012 0.0000  0.0188  120  GLY A N   
956  C CA  . GLY A 120 ? 0.3255 0.3076 0.3367 -0.0018 -0.0003 0.0196  120  GLY A CA  
957  C C   . GLY A 120 ? 0.3750 0.3589 0.3904 -0.0009 -0.0025 0.0206  120  GLY A C   
958  O O   . GLY A 120 ? 0.3277 0.3095 0.3432 0.0001  -0.0042 0.0202  120  GLY A O   
959  N N   . GLY A 121 ? 0.3641 0.3514 0.3823 -0.0019 -0.0026 0.0219  121  GLY A N   
960  C CA  . GLY A 121 ? 0.3422 0.3309 0.3642 -0.0023 -0.0046 0.0236  121  GLY A CA  
961  C C   . GLY A 121 ? 0.3873 0.3805 0.4114 -0.0027 -0.0038 0.0251  121  GLY A C   
962  O O   . GLY A 121 ? 0.3675 0.3632 0.3950 -0.0033 -0.0053 0.0266  121  GLY A O   
963  N N   . GLY A 122 ? 0.3713 0.3659 0.3932 -0.0023 -0.0015 0.0247  122  GLY A N   
964  C CA  . GLY A 122 ? 0.3510 0.3505 0.3740 -0.0019 -0.0002 0.0261  122  GLY A CA  
965  C C   . GLY A 122 ? 0.4255 0.4269 0.4490 0.0006  0.0003  0.0263  122  GLY A C   
966  O O   . GLY A 122 ? 0.4505 0.4583 0.4762 0.0016  0.0014  0.0280  122  GLY A O   
967  N N   . PHE A 123 ? 0.3608 0.3577 0.3822 0.0021  -0.0004 0.0248  123  PHE A N   
968  C CA  . PHE A 123 ? 0.3318 0.3311 0.3538 0.0052  -0.0005 0.0253  123  PHE A CA  
969  C C   . PHE A 123 ? 0.3341 0.3411 0.3630 0.0036  -0.0029 0.0277  123  PHE A C   
970  O O   . PHE A 123 ? 0.3524 0.3649 0.3834 0.0059  -0.0033 0.0287  123  PHE A O   
971  C CB  . PHE A 123 ? 0.3161 0.3168 0.3350 0.0089  0.0024  0.0251  123  PHE A CB  
972  C CG  . PHE A 123 ? 0.3671 0.3578 0.3774 0.0103  0.0043  0.0225  123  PHE A CG  
973  C CD1 . PHE A 123 ? 0.3738 0.3572 0.3797 0.0119  0.0040  0.0214  123  PHE A CD1 
974  C CD2 . PHE A 123 ? 0.2865 0.2747 0.2926 0.0094  0.0061  0.0213  123  PHE A CD2 
975  C CE1 . PHE A 123 ? 0.3747 0.3477 0.3722 0.0121  0.0056  0.0195  123  PHE A CE1 
976  C CE2 . PHE A 123 ? 0.3688 0.3468 0.3664 0.0093  0.0074  0.0188  123  PHE A CE2 
977  C CZ  . PHE A 123 ? 0.3726 0.3426 0.3659 0.0105  0.0072  0.0180  123  PHE A CZ  
978  N N   . TYR A 124 ? 0.3376 0.3450 0.3697 -0.0003 -0.0048 0.0287  124  TYR A N   
979  C CA  . TYR A 124 ? 0.3756 0.3882 0.4133 -0.0034 -0.0076 0.0311  124  TYR A CA  
980  C C   . TYR A 124 ? 0.3967 0.4021 0.4333 -0.0059 -0.0111 0.0298  124  TYR A C   
981  O O   . TYR A 124 ? 0.3975 0.4045 0.4372 -0.0093 -0.0142 0.0311  124  TYR A O   
982  C CB  . TYR A 124 ? 0.3974 0.4163 0.4392 -0.0063 -0.0069 0.0343  124  TYR A CB  
983  C CG  . TYR A 124 ? 0.3960 0.4082 0.4359 -0.0088 -0.0075 0.0344  124  TYR A CG  
984  C CD1 . TYR A 124 ? 0.3879 0.3946 0.4284 -0.0122 -0.0108 0.0349  124  TYR A CD1 
985  C CD2 . TYR A 124 ? 0.3808 0.3918 0.4176 -0.0074 -0.0050 0.0338  124  TYR A CD2 
986  C CE1 . TYR A 124 ? 0.3487 0.3489 0.3868 -0.0130 -0.0112 0.0352  124  TYR A CE1 
987  C CE2 . TYR A 124 ? 0.3558 0.3623 0.3911 -0.0088 -0.0056 0.0342  124  TYR A CE2 
988  C CZ  . TYR A 124 ? 0.4485 0.4497 0.4846 -0.0111 -0.0086 0.0351  124  TYR A CZ  
989  O OH  . TYR A 124 ? 0.4354 0.4319 0.4694 -0.0111 -0.0091 0.0358  124  TYR A OH  
990  N N   . SER A 125 ? 0.3765 0.3740 0.4082 -0.0043 -0.0105 0.0272  125  SER A N   
991  C CA  . SER A 125 ? 0.3482 0.3384 0.3773 -0.0053 -0.0132 0.0257  125  SER A CA  
992  C C   . SER A 125 ? 0.3587 0.3436 0.3826 -0.0023 -0.0117 0.0230  125  SER A C   
993  O O   . SER A 125 ? 0.3443 0.3302 0.3663 -0.0005 -0.0089 0.0226  125  SER A O   
994  C CB  . SER A 125 ? 0.4143 0.4011 0.4439 -0.0075 -0.0139 0.0267  125  SER A CB  
995  O OG  . SER A 125 ? 0.3686 0.3562 0.3972 -0.0060 -0.0110 0.0268  125  SER A OG  
996  N N   . GLY A 126 ? 0.3606 0.3395 0.3813 -0.0020 -0.0135 0.0213  126  GLY A N   
997  C CA  . GLY A 126 ? 0.3742 0.3495 0.3900 0.0007  -0.0119 0.0192  126  GLY A CA  
998  C C   . GLY A 126 ? 0.4608 0.4331 0.4728 0.0021  -0.0137 0.0176  126  GLY A C   
999  O O   . GLY A 126 ? 0.3884 0.3623 0.4018 0.0011  -0.0163 0.0180  126  GLY A O   
1000 N N   . ALA A 127 ? 0.4248 0.3939 0.4320 0.0044  -0.0124 0.0160  127  ALA A N   
1001 C CA  . ALA A 127 ? 0.4143 0.3801 0.4164 0.0062  -0.0138 0.0144  127  ALA A CA  
1002 C C   . ALA A 127 ? 0.4628 0.4275 0.4603 0.0085  -0.0107 0.0136  127  ALA A C   
1003 O O   . ALA A 127 ? 0.3525 0.3184 0.3507 0.0089  -0.0088 0.0136  127  ALA A O   
1004 C CB  . ALA A 127 ? 0.3284 0.2891 0.3285 0.0057  -0.0176 0.0127  127  ALA A CB  
1005 N N   . ALA A 128 ? 0.4129 0.3764 0.4057 0.0100  -0.0103 0.0133  128  ALA A N   
1006 C CA  . ALA A 128 ? 0.4151 0.3785 0.4034 0.0116  -0.0072 0.0132  128  ALA A CA  
1007 C C   . ALA A 128 ? 0.4677 0.4289 0.4516 0.0143  -0.0077 0.0111  128  ALA A C   
1008 O O   . ALA A 128 ? 0.4462 0.4094 0.4269 0.0160  -0.0048 0.0111  128  ALA A O   
1009 C CB  . ALA A 128 ? 0.3132 0.2751 0.2969 0.0123  -0.0064 0.0143  128  ALA A CB  
1010 N N   . SER A 129 ? 0.4246 0.3818 0.4080 0.0147  -0.0114 0.0093  129  SER A N   
1011 C CA  . SER A 129 ? 0.4356 0.3881 0.4127 0.0182  -0.0123 0.0066  129  SER A CA  
1012 C C   . SER A 129 ? 0.4377 0.3893 0.4160 0.0201  -0.0114 0.0059  129  SER A C   
1013 O O   . SER A 129 ? 0.4919 0.4384 0.4641 0.0240  -0.0120 0.0035  129  SER A O   
1014 C CB  . SER A 129 ? 0.4604 0.4065 0.4335 0.0176  -0.0174 0.0043  129  SER A CB  
1015 O OG  . SER A 129 ? 0.4629 0.4080 0.4416 0.0137  -0.0206 0.0050  129  SER A OG  
1016 N N   . LEU A 130 ? 0.3288 0.2847 0.3138 0.0180  -0.0101 0.0081  130  LEU A N   
1017 C CA  . LEU A 130 ? 0.4189 0.3742 0.4050 0.0204  -0.0096 0.0080  130  LEU A CA  
1018 C C   . LEU A 130 ? 0.4059 0.3665 0.3893 0.0250  -0.0058 0.0077  130  LEU A C   
1019 O O   . LEU A 130 ? 0.3986 0.3658 0.3823 0.0241  -0.0028 0.0088  130  LEU A O   
1020 C CB  . LEU A 130 ? 0.4433 0.4034 0.4369 0.0172  -0.0089 0.0106  130  LEU A CB  
1021 C CG  . LEU A 130 ? 0.5250 0.4835 0.5225 0.0125  -0.0116 0.0118  130  LEU A CG  
1022 C CD1 . LEU A 130 ? 0.4526 0.4165 0.4560 0.0105  -0.0102 0.0142  130  LEU A CD1 
1023 C CD2 . LEU A 130 ? 0.5244 0.4737 0.5192 0.0119  -0.0159 0.0105  130  LEU A CD2 
1024 N N   . ASP A 131 ? 0.4673 0.4249 0.4478 0.0299  -0.0059 0.0064  131  ASP A N   
1025 C CA  . ASP A 131 ? 0.4468 0.4114 0.4254 0.0354  -0.0022 0.0064  131  ASP A CA  
1026 C C   . ASP A 131 ? 0.4799 0.4583 0.4657 0.0328  0.0014  0.0096  131  ASP A C   
1027 O O   . ASP A 131 ? 0.5358 0.5226 0.5207 0.0342  0.0048  0.0103  131  ASP A O   
1028 C CB  . ASP A 131 ? 0.5243 0.4836 0.4995 0.0420  -0.0029 0.0050  131  ASP A CB  
1029 C CG  . ASP A 131 ? 0.6168 0.5613 0.5819 0.0455  -0.0061 0.0011  131  ASP A CG  
1030 O OD1 . ASP A 131 ? 0.6375 0.5781 0.5985 0.0433  -0.0075 -0.0006 131  ASP A OD1 
1031 O OD2 . ASP A 131 ? 0.8338 0.7696 0.7943 0.0506  -0.0074 -0.0003 131  ASP A OD2 
1032 N N   . VAL A 132 ? 0.3954 0.3765 0.3877 0.0286  0.0006  0.0116  132  VAL A N   
1033 C CA  . VAL A 132 ? 0.4732 0.4668 0.4714 0.0256  0.0035  0.0143  132  VAL A CA  
1034 C C   . VAL A 132 ? 0.4463 0.4428 0.4445 0.0204  0.0052  0.0152  132  VAL A C   
1035 O O   . VAL A 132 ? 0.4478 0.4535 0.4493 0.0171  0.0075  0.0172  132  VAL A O   
1036 C CB  . VAL A 132 ? 0.5357 0.5316 0.5399 0.0225  0.0021  0.0160  132  VAL A CB  
1037 C CG1 . VAL A 132 ? 0.6150 0.6135 0.6202 0.0278  0.0019  0.0166  132  VAL A CG1 
1038 C CG2 . VAL A 132 ? 0.4565 0.4429 0.4607 0.0189  -0.0008 0.0156  132  VAL A CG2 
1039 N N   . TYR A 133 ? 0.4114 0.3996 0.4052 0.0196  0.0039  0.0139  133  TYR A N   
1040 C CA  . TYR A 133 ? 0.4211 0.4098 0.4134 0.0156  0.0054  0.0151  133  TYR A CA  
1041 C C   . TYR A 133 ? 0.4006 0.3891 0.3865 0.0183  0.0072  0.0146  133  TYR A C   
1042 O O   . TYR A 133 ? 0.4101 0.3961 0.3928 0.0160  0.0079  0.0155  133  TYR A O   
1043 C CB  . TYR A 133 ? 0.3352 0.3162 0.3275 0.0127  0.0028  0.0148  133  TYR A CB  
1044 C CG  . TYR A 133 ? 0.3871 0.3679 0.3848 0.0103  0.0012  0.0153  133  TYR A CG  
1045 C CD1 . TYR A 133 ? 0.3776 0.3651 0.3796 0.0085  0.0025  0.0166  133  TYR A CD1 
1046 C CD2 . TYR A 133 ? 0.3706 0.3457 0.3690 0.0098  -0.0018 0.0148  133  TYR A CD2 
1047 C CE1 . TYR A 133 ? 0.3597 0.3472 0.3657 0.0066  0.0011  0.0172  133  TYR A CE1 
1048 C CE2 . TYR A 133 ? 0.3278 0.3039 0.3310 0.0077  -0.0029 0.0157  133  TYR A CE2 
1049 C CZ  . TYR A 133 ? 0.3647 0.3464 0.3711 0.0063  -0.0013 0.0168  133  TYR A CZ  
1050 O OH  . TYR A 133 ? 0.3763 0.3591 0.3864 0.0045  -0.0022 0.0178  133  TYR A OH  
1051 N N   . ASP A 134 ? 0.4451 0.4359 0.4285 0.0240  0.0080  0.0132  134  ASP A N   
1052 C CA  . ASP A 134 ? 0.4809 0.4725 0.4574 0.0278  0.0100  0.0125  134  ASP A CA  
1053 C C   . ASP A 134 ? 0.4902 0.4916 0.4673 0.0244  0.0143  0.0158  134  ASP A C   
1054 O O   . ASP A 134 ? 0.3869 0.3999 0.3687 0.0239  0.0170  0.0177  134  ASP A O   
1055 C CB  . ASP A 134 ? 0.4407 0.4336 0.4146 0.0353  0.0104  0.0105  134  ASP A CB  
1056 C CG  . ASP A 134 ? 0.5398 0.5320 0.5047 0.0408  0.0122  0.0088  134  ASP A CG  
1057 O OD1 . ASP A 134 ? 0.5146 0.5080 0.4760 0.0384  0.0138  0.0102  134  ASP A OD1 
1058 O OD2 . ASP A 134 ? 0.5174 0.5070 0.4777 0.0479  0.0121  0.0062  134  ASP A OD2 
1059 N N   . GLY A 135 ? 0.4759 0.4731 0.4481 0.0220  0.0148  0.0168  135  GLY A N   
1060 C CA  . GLY A 135 ? 0.4572 0.4611 0.4288 0.0176  0.0186  0.0203  135  GLY A CA  
1061 C C   . GLY A 135 ? 0.4394 0.4528 0.4073 0.0209  0.0228  0.0216  135  GLY A C   
1062 O O   . GLY A 135 ? 0.4299 0.4496 0.3972 0.0164  0.0261  0.0252  135  GLY A O   
1063 N N   . ARG A 136 ? 0.4330 0.4473 0.3977 0.0287  0.0227  0.0188  136  ARG A N   
1064 C CA  . ARG A 136 ? 0.5269 0.5501 0.4865 0.0333  0.0269  0.0196  136  ARG A CA  
1065 C C   . ARG A 136 ? 0.5749 0.6163 0.5412 0.0312  0.0315  0.0234  136  ARG A C   
1066 O O   . ARG A 136 ? 0.5260 0.5767 0.4894 0.0310  0.0358  0.0263  136  ARG A O   
1067 C CB  . ARG A 136 ? 0.4535 0.4720 0.4065 0.0431  0.0258  0.0152  136  ARG A CB  
1068 C CG  . ARG A 136 ? 0.4120 0.4356 0.3696 0.0486  0.0258  0.0136  136  ARG A CG  
1069 C CD  . ARG A 136 ? 0.4916 0.5061 0.4401 0.0585  0.0242  0.0087  136  ARG A CD  
1070 N NE  . ARG A 136 ? 0.5769 0.5735 0.5213 0.0573  0.0184  0.0051  136  ARG A NE  
1071 C CZ  . ARG A 136 ? 0.6069 0.5910 0.5412 0.0631  0.0156  0.0005  136  ARG A CZ  
1072 N NH1 . ARG A 136 ? 0.6054 0.5755 0.5377 0.0601  0.0100  -0.0021 136  ARG A NH1 
1073 N NH2 . ARG A 136 ? 0.5581 0.5441 0.4841 0.0718  0.0183  -0.0017 136  ARG A NH2 
1074 N N   . PHE A 137 ? 0.5033 0.5508 0.4784 0.0296  0.0306  0.0238  137  PHE A N   
1075 C CA  . PHE A 137 ? 0.4645 0.5316 0.4469 0.0278  0.0343  0.0273  137  PHE A CA  
1076 C C   . PHE A 137 ? 0.4248 0.4968 0.4099 0.0167  0.0361  0.0317  137  PHE A C   
1077 O O   . PHE A 137 ? 0.4625 0.5489 0.4486 0.0144  0.0404  0.0354  137  PHE A O   
1078 C CB  . PHE A 137 ? 0.4540 0.5261 0.4444 0.0299  0.0323  0.0264  137  PHE A CB  
1079 C CG  . PHE A 137 ? 0.4551 0.5184 0.4416 0.0399  0.0300  0.0221  137  PHE A CG  
1080 C CD1 . PHE A 137 ? 0.4599 0.5301 0.4428 0.0499  0.0327  0.0211  137  PHE A CD1 
1081 C CD2 . PHE A 137 ? 0.4746 0.5216 0.4601 0.0394  0.0252  0.0192  137  PHE A CD2 
1082 C CE1 . PHE A 137 ? 0.5112 0.5701 0.4886 0.0591  0.0304  0.0169  137  PHE A CE1 
1083 C CE2 . PHE A 137 ? 0.4439 0.4808 0.4248 0.0475  0.0228  0.0156  137  PHE A CE2 
1084 C CZ  . PHE A 137 ? 0.5004 0.5419 0.4767 0.0573  0.0252  0.0142  137  PHE A CZ  
1085 N N   . LEU A 138 ? 0.3946 0.4545 0.3803 0.0099  0.0329  0.0315  138  LEU A N   
1086 C CA  . LEU A 138 ? 0.4407 0.4997 0.4260 -0.0005 0.0340  0.0351  138  LEU A CA  
1087 C C   . LEU A 138 ? 0.5067 0.5629 0.4836 -0.0014 0.0370  0.0376  138  LEU A C   
1088 O O   . LEU A 138 ? 0.4769 0.5414 0.4540 -0.0084 0.0402  0.0420  138  LEU A O   
1089 C CB  . LEU A 138 ? 0.4017 0.4451 0.3867 -0.0051 0.0300  0.0335  138  LEU A CB  
1090 C CG  . LEU A 138 ? 0.4713 0.5196 0.4644 -0.0075 0.0277  0.0326  138  LEU A CG  
1091 C CD1 . LEU A 138 ? 0.4509 0.4836 0.4428 -0.0094 0.0240  0.0303  138  LEU A CD1 
1092 C CD2 . LEU A 138 ? 0.4936 0.5552 0.4915 -0.0163 0.0298  0.0363  138  LEU A CD2 
1093 N N   . ALA A 139 ? 0.4312 0.4759 0.4005 0.0050  0.0357  0.0350  139  ALA A N   
1094 C CA  . ALA A 139 ? 0.4676 0.5095 0.4279 0.0056  0.0382  0.0371  139  ALA A CA  
1095 C C   . ALA A 139 ? 0.5554 0.6154 0.5159 0.0083  0.0435  0.0397  139  ALA A C   
1096 O O   . ALA A 139 ? 0.5154 0.5813 0.4735 0.0027  0.0472  0.0445  139  ALA A O   
1097 C CB  . ALA A 139 ? 0.4816 0.5100 0.4341 0.0127  0.0352  0.0333  139  ALA A CB  
1098 N N   . GLN A 140 ? 0.5412 0.6098 0.5042 0.0169  0.0440  0.0368  140  GLN A N   
1099 C CA  . GLN A 140 ? 0.5458 0.6323 0.5083 0.0218  0.0493  0.0389  140  GLN A CA  
1100 C C   . GLN A 140 ? 0.5971 0.7041 0.5692 0.0146  0.0528  0.0440  140  GLN A C   
1101 O O   . GLN A 140 ? 0.5651 0.6843 0.5358 0.0113  0.0575  0.0487  140  GLN A O   
1102 C CB  . GLN A 140 ? 0.4297 0.5183 0.3911 0.0342  0.0488  0.0341  140  GLN A CB  
1103 C CG  . GLN A 140 ? 0.4891 0.5887 0.4439 0.0425  0.0538  0.0346  140  GLN A CG  
1104 C CD  . GLN A 140 ? 0.5876 0.7137 0.5505 0.0412  0.0596  0.0397  140  GLN A CD  
1105 O OE1 . GLN A 140 ? 0.5853 0.7221 0.5589 0.0392  0.0589  0.0406  140  GLN A OE1 
1106 N NE2 . GLN A 140 ? 0.5310 0.6687 0.4890 0.0420  0.0651  0.0433  140  GLN A NE2 
1107 N N   . VAL A 141 ? 0.5442 0.6559 0.5258 0.0117  0.0505  0.0435  141  VAL A N   
1108 C CA  . VAL A 141 ? 0.4413 0.5751 0.4327 0.0054  0.0532  0.0480  141  VAL A CA  
1109 C C   . VAL A 141 ? 0.4810 0.6125 0.4729 -0.0091 0.0534  0.0525  141  VAL A C   
1110 O O   . VAL A 141 ? 0.4469 0.5948 0.4415 -0.0155 0.0574  0.0578  141  VAL A O   
1111 C CB  . VAL A 141 ? 0.4878 0.6289 0.4887 0.0078  0.0505  0.0460  141  VAL A CB  
1112 C CG1 . VAL A 141 ? 0.5245 0.6889 0.5358 -0.0003 0.0525  0.0509  141  VAL A CG1 
1113 C CG2 . VAL A 141 ? 0.4167 0.5607 0.4162 0.0224  0.0509  0.0423  141  VAL A CG2 
1114 N N   . GLU A 142 ? 0.5174 0.6282 0.5061 -0.0143 0.0492  0.0506  142  GLU A N   
1115 C CA  . GLU A 142 ? 0.4331 0.5377 0.4206 -0.0276 0.0488  0.0542  142  GLU A CA  
1116 C C   . GLU A 142 ? 0.4497 0.5384 0.4258 -0.0301 0.0499  0.0562  142  GLU A C   
1117 O O   . GLU A 142 ? 0.5314 0.6126 0.5043 -0.0407 0.0500  0.0596  142  GLU A O   
1118 C CB  . GLU A 142 ? 0.4067 0.4997 0.3973 -0.0322 0.0439  0.0514  142  GLU A CB  
1119 C CG  . GLU A 142 ? 0.5195 0.6294 0.5212 -0.0321 0.0427  0.0507  142  GLU A CG  
1120 C CD  . GLU A 142 ? 0.6908 0.8232 0.6991 -0.0410 0.0458  0.0560  142  GLU A CD  
1121 O OE1 . GLU A 142 ? 0.6217 0.7511 0.6260 -0.0515 0.0473  0.0600  142  GLU A OE1 
1122 O OE2 . GLU A 142 ? 0.7550 0.9082 0.7723 -0.0375 0.0464  0.0565  142  GLU A OE2 
1123 N N   . GLY A 143 ? 0.4503 0.5334 0.4194 -0.0205 0.0507  0.0543  143  GLY A N   
1124 C CA  . GLY A 143 ? 0.5018 0.5703 0.4597 -0.0218 0.0514  0.0563  143  GLY A CA  
1125 C C   . GLY A 143 ? 0.5317 0.5767 0.4847 -0.0242 0.0468  0.0542  143  GLY A C   
1126 O O   . GLY A 143 ? 0.5770 0.6089 0.5209 -0.0270 0.0471  0.0567  143  GLY A O   
1127 N N   . ALA A 144 ? 0.5083 0.5484 0.4670 -0.0225 0.0428  0.0498  144  ALA A N   
1128 C CA  . ALA A 144 ? 0.5763 0.5963 0.5312 -0.0241 0.0387  0.0478  144  ALA A CA  
1129 C C   . ALA A 144 ? 0.5286 0.5352 0.4758 -0.0160 0.0365  0.0453  144  ALA A C   
1130 O O   . ALA A 144 ? 0.5325 0.5440 0.4788 -0.0079 0.0366  0.0429  144  ALA A O   
1131 C CB  . ALA A 144 ? 0.5074 0.5278 0.4706 -0.0244 0.0353  0.0442  144  ALA A CB  
1132 N N   . VAL A 145 ? 0.5099 0.4997 0.4514 -0.0180 0.0343  0.0456  145  VAL A N   
1133 C CA  . VAL A 145 ? 0.4897 0.4680 0.4265 -0.0107 0.0309  0.0427  145  VAL A CA  
1134 C C   . VAL A 145 ? 0.5121 0.4859 0.4554 -0.0097 0.0269  0.0387  145  VAL A C   
1135 O O   . VAL A 145 ? 0.4979 0.4657 0.4425 -0.0152 0.0263  0.0393  145  VAL A O   
1136 C CB  . VAL A 145 ? 0.5096 0.4733 0.4356 -0.0118 0.0309  0.0460  145  VAL A CB  
1137 C CG1 . VAL A 145 ? 0.4439 0.3965 0.3669 -0.0049 0.0265  0.0430  145  VAL A CG1 
1138 C CG2 . VAL A 145 ? 0.4637 0.4323 0.3823 -0.0112 0.0346  0.0499  145  VAL A CG2 
1139 N N   . LEU A 146 ? 0.4938 0.4701 0.4406 -0.0030 0.0244  0.0346  146  LEU A N   
1140 C CA  . LEU A 146 ? 0.4519 0.4258 0.4053 -0.0025 0.0211  0.0314  146  LEU A CA  
1141 C C   . LEU A 146 ? 0.5101 0.4751 0.4612 0.0028  0.0172  0.0290  146  LEU A C   
1142 O O   . LEU A 146 ? 0.4554 0.4209 0.4034 0.0081  0.0159  0.0274  146  LEU A O   
1143 C CB  . LEU A 146 ? 0.4586 0.4444 0.4202 -0.0008 0.0212  0.0293  146  LEU A CB  
1144 C CG  . LEU A 146 ? 0.5992 0.5838 0.5677 -0.0024 0.0186  0.0273  146  LEU A CG  
1145 C CD1 . LEU A 146 ? 0.5360 0.5323 0.5115 -0.0058 0.0201  0.0280  146  LEU A CD1 
1146 C CD2 . LEU A 146 ? 0.6519 0.6330 0.6223 0.0035  0.0150  0.0237  146  LEU A CD2 
1147 N N   . VAL A 147 ? 0.4470 0.4046 0.3995 0.0013  0.0152  0.0286  147  VAL A N   
1148 C CA  . VAL A 147 ? 0.4982 0.4500 0.4501 0.0058  0.0115  0.0268  147  VAL A CA  
1149 C C   . VAL A 147 ? 0.4456 0.3997 0.4057 0.0058  0.0092  0.0243  147  VAL A C   
1150 O O   . VAL A 147 ? 0.4258 0.3806 0.3894 0.0019  0.0103  0.0246  147  VAL A O   
1151 C CB  . VAL A 147 ? 0.5244 0.4654 0.4698 0.0058  0.0113  0.0292  147  VAL A CB  
1152 C CG1 . VAL A 147 ? 0.3775 0.3158 0.3233 0.0111  0.0073  0.0277  147  VAL A CG1 
1153 C CG2 . VAL A 147 ? 0.4818 0.4192 0.4181 0.0051  0.0138  0.0326  147  VAL A CG2 
1154 N N   . SER A 148 ? 0.3896 0.3446 0.3520 0.0096  0.0059  0.0220  148  SER A N   
1155 C CA  . SER A 148 ? 0.4360 0.3920 0.4053 0.0094  0.0036  0.0204  148  SER A CA  
1156 C C   . SER A 148 ? 0.4533 0.4071 0.4224 0.0127  0.0000  0.0198  148  SER A C   
1157 O O   . SER A 148 ? 0.4781 0.4314 0.4434 0.0153  -0.0019 0.0192  148  SER A O   
1158 C CB  . SER A 148 ? 0.4160 0.3780 0.3907 0.0095  0.0030  0.0185  148  SER A CB  
1159 O OG  . SER A 148 ? 0.4206 0.3829 0.3925 0.0130  0.0014  0.0167  148  SER A OG  
1160 N N   . MET A 149 ? 0.3987 0.3520 0.3716 0.0125  -0.0011 0.0200  149  MET A N   
1161 C CA  . MET A 149 ? 0.4104 0.3646 0.3845 0.0154  -0.0045 0.0199  149  MET A CA  
1162 C C   . MET A 149 ? 0.3823 0.3416 0.3644 0.0143  -0.0067 0.0188  149  MET A C   
1163 O O   . MET A 149 ? 0.4196 0.3803 0.4057 0.0121  -0.0051 0.0187  149  MET A O   
1164 C CB  . MET A 149 ? 0.3620 0.3117 0.3325 0.0176  -0.0037 0.0220  149  MET A CB  
1165 C CG  . MET A 149 ? 0.4435 0.3937 0.4184 0.0169  -0.0026 0.0221  149  MET A CG  
1166 S SD  . MET A 149 ? 0.4370 0.3838 0.4113 0.0120  0.0011  0.0217  149  MET A SD  
1167 C CE  . MET A 149 ? 0.3397 0.2751 0.3034 0.0119  0.0037  0.0238  149  MET A CE  
1168 N N   . ASN A 150 ? 0.4170 0.3795 0.4011 0.0155  -0.0105 0.0183  150  ASN A N   
1169 C CA  . ASN A 150 ? 0.4336 0.4015 0.4252 0.0141  -0.0126 0.0183  150  ASN A CA  
1170 C C   . ASN A 150 ? 0.3926 0.3630 0.3859 0.0163  -0.0117 0.0203  150  ASN A C   
1171 O O   . ASN A 150 ? 0.3723 0.3405 0.3608 0.0197  -0.0115 0.0214  150  ASN A O   
1172 C CB  . ASN A 150 ? 0.3625 0.3332 0.3556 0.0133  -0.0173 0.0172  150  ASN A CB  
1173 C CG  . ASN A 150 ? 0.5266 0.4936 0.5181 0.0115  -0.0183 0.0148  150  ASN A CG  
1174 O OD1 . ASN A 150 ? 0.4328 0.3973 0.4235 0.0112  -0.0153 0.0143  150  ASN A OD1 
1175 N ND2 . ASN A 150 ? 0.4716 0.4381 0.4622 0.0104  -0.0227 0.0133  150  ASN A ND2 
1176 N N   . TYR A 151 ? 0.3781 0.3528 0.3773 0.0150  -0.0110 0.0208  151  TYR A N   
1177 C CA  . TYR A 151 ? 0.3159 0.2945 0.3169 0.0181  -0.0102 0.0225  151  TYR A CA  
1178 C C   . TYR A 151 ? 0.3680 0.3562 0.3776 0.0160  -0.0120 0.0233  151  TYR A C   
1179 O O   . TYR A 151 ? 0.3816 0.3702 0.3945 0.0119  -0.0126 0.0226  151  TYR A O   
1180 C CB  . TYR A 151 ? 0.3467 0.3192 0.3438 0.0192  -0.0061 0.0226  151  TYR A CB  
1181 C CG  . TYR A 151 ? 0.3751 0.3475 0.3749 0.0152  -0.0044 0.0216  151  TYR A CG  
1182 C CD1 . TYR A 151 ? 0.4272 0.3951 0.4245 0.0121  -0.0034 0.0205  151  TYR A CD1 
1183 C CD2 . TYR A 151 ? 0.3543 0.3324 0.3590 0.0149  -0.0037 0.0222  151  TYR A CD2 
1184 C CE1 . TYR A 151 ? 0.4235 0.3928 0.4235 0.0088  -0.0022 0.0199  151  TYR A CE1 
1185 C CE2 . TYR A 151 ? 0.3189 0.2971 0.3254 0.0114  -0.0024 0.0215  151  TYR A CE2 
1186 C CZ  . TYR A 151 ? 0.3994 0.3732 0.4036 0.0085  -0.0019 0.0204  151  TYR A CZ  
1187 O OH  . TYR A 151 ? 0.3407 0.3161 0.3469 0.0056  -0.0010 0.0200  151  TYR A OH  
1188 N N   . ARG A 152 ? 0.3783 0.3745 0.3913 0.0190  -0.0128 0.0252  152  ARG A N   
1189 C CA  . ARG A 152 ? 0.3861 0.3935 0.4079 0.0164  -0.0143 0.0267  152  ARG A CA  
1190 C C   . ARG A 152 ? 0.3375 0.3452 0.3617 0.0144  -0.0113 0.0269  152  ARG A C   
1191 O O   . ARG A 152 ? 0.3820 0.3851 0.4021 0.0173  -0.0077 0.0264  152  ARG A O   
1192 C CB  . ARG A 152 ? 0.3285 0.3472 0.3540 0.0206  -0.0153 0.0291  152  ARG A CB  
1193 C CG  . ARG A 152 ? 0.2925 0.3151 0.3180 0.0208  -0.0200 0.0294  152  ARG A CG  
1194 C CD  . ARG A 152 ? 0.3815 0.4169 0.4108 0.0264  -0.0206 0.0322  152  ARG A CD  
1195 N NE  . ARG A 152 ? 0.3361 0.3634 0.3573 0.0341  -0.0175 0.0322  152  ARG A NE  
1196 C CZ  . ARG A 152 ? 0.4249 0.4587 0.4459 0.0416  -0.0167 0.0344  152  ARG A CZ  
1197 N NH1 . ARG A 152 ? 0.3317 0.3835 0.3617 0.0427  -0.0187 0.0370  152  ARG A NH1 
1198 N NH2 . ARG A 152 ? 0.3793 0.4013 0.3908 0.0481  -0.0139 0.0342  152  ARG A NH2 
1199 N N   . VAL A 153 ? 0.3216 0.3336 0.3515 0.0093  -0.0130 0.0275  153  VAL A N   
1200 C CA  . VAL A 153 ? 0.3303 0.3433 0.3623 0.0073  -0.0105 0.0282  153  VAL A CA  
1201 C C   . VAL A 153 ? 0.4299 0.4559 0.4699 0.0055  -0.0111 0.0313  153  VAL A C   
1202 O O   . VAL A 153 ? 0.3597 0.3942 0.4041 0.0050  -0.0139 0.0328  153  VAL A O   
1203 C CB  . VAL A 153 ? 0.3886 0.3940 0.4192 0.0031  -0.0111 0.0268  153  VAL A CB  
1204 C CG1 . VAL A 153 ? 0.3662 0.3619 0.3899 0.0049  -0.0095 0.0243  153  VAL A CG1 
1205 C CG2 . VAL A 153 ? 0.2773 0.2826 0.3105 -0.0012 -0.0155 0.0269  153  VAL A CG2 
1206 N N   . GLY A 154 ? 0.3597 0.3884 0.4015 0.0044  -0.0085 0.0325  154  GLY A N   
1207 C CA  . GLY A 154 ? 0.3955 0.4371 0.4447 0.0020  -0.0086 0.0360  154  GLY A CA  
1208 C C   . GLY A 154 ? 0.3551 0.4092 0.4076 0.0070  -0.0074 0.0379  154  GLY A C   
1209 O O   . GLY A 154 ? 0.3668 0.4175 0.4142 0.0137  -0.0051 0.0363  154  GLY A O   
1210 N N   . THR A 155 ? 0.3400 0.4085 0.4008 0.0038  -0.0090 0.0415  155  THR A N   
1211 C CA  . THR A 155 ? 0.3009 0.3845 0.3663 0.0088  -0.0082 0.0438  155  THR A CA  
1212 C C   . THR A 155 ? 0.4047 0.4844 0.4662 0.0140  -0.0101 0.0419  155  THR A C   
1213 O O   . THR A 155 ? 0.3644 0.4467 0.4232 0.0222  -0.0076 0.0418  155  THR A O   
1214 C CB  . THR A 155 ? 0.3209 0.4228 0.3971 0.0029  -0.0107 0.0484  155  THR A CB  
1215 O OG1 . THR A 155 ? 0.3263 0.4246 0.4042 -0.0043 -0.0164 0.0480  155  THR A OG1 
1216 C CG2 . THR A 155 ? 0.2830 0.3900 0.3627 -0.0016 -0.0082 0.0514  155  THR A CG2 
1217 N N   . PHE A 156 ? 0.3343 0.4070 0.3945 0.0096  -0.0145 0.0403  156  PHE A N   
1218 C CA  . PHE A 156 ? 0.3904 0.4603 0.4468 0.0140  -0.0167 0.0389  156  PHE A CA  
1219 C C   . PHE A 156 ? 0.4228 0.4807 0.4698 0.0217  -0.0131 0.0366  156  PHE A C   
1220 O O   . PHE A 156 ? 0.3246 0.3839 0.3688 0.0282  -0.0133 0.0369  156  PHE A O   
1221 C CB  . PHE A 156 ? 0.3281 0.3895 0.3823 0.0079  -0.0216 0.0368  156  PHE A CB  
1222 C CG  . PHE A 156 ? 0.3751 0.4439 0.4366 -0.0009 -0.0254 0.0387  156  PHE A CG  
1223 C CD1 . PHE A 156 ? 0.3449 0.4288 0.4134 -0.0035 -0.0294 0.0412  156  PHE A CD1 
1224 C CD2 . PHE A 156 ? 0.3453 0.4065 0.4065 -0.0067 -0.0250 0.0383  156  PHE A CD2 
1225 C CE1 . PHE A 156 ? 0.4078 0.4979 0.4825 -0.0128 -0.0331 0.0433  156  PHE A CE1 
1226 C CE2 . PHE A 156 ? 0.3484 0.4144 0.4152 -0.0152 -0.0284 0.0405  156  PHE A CE2 
1227 C CZ  . PHE A 156 ? 0.3844 0.4644 0.4578 -0.0188 -0.0325 0.0429  156  PHE A CZ  
1228 N N   . GLY A 157 ? 0.3448 0.3906 0.3866 0.0208  -0.0101 0.0345  157  GLY A N   
1229 C CA  . GLY A 157 ? 0.3136 0.3467 0.3459 0.0263  -0.0069 0.0323  157  GLY A CA  
1230 C C   . GLY A 157 ? 0.3308 0.3646 0.3605 0.0316  -0.0024 0.0326  157  GLY A C   
1231 O O   . GLY A 157 ? 0.3594 0.3831 0.3806 0.0373  -0.0001 0.0311  157  GLY A O   
1232 N N   . PHE A 158 ? 0.2853 0.3299 0.3212 0.0299  -0.0011 0.0344  158  PHE A N   
1233 C CA  . PHE A 158 ? 0.3156 0.3587 0.3473 0.0342  0.0034  0.0338  158  PHE A CA  
1234 C C   . PHE A 158 ? 0.3511 0.4112 0.3889 0.0379  0.0056  0.0368  158  PHE A C   
1235 O O   . PHE A 158 ? 0.4042 0.4628 0.4369 0.0432  0.0096  0.0360  158  PHE A O   
1236 C CB  . PHE A 158 ? 0.3127 0.3450 0.3403 0.0289  0.0045  0.0316  158  PHE A CB  
1237 C CG  . PHE A 158 ? 0.3776 0.3938 0.3976 0.0276  0.0037  0.0286  158  PHE A CG  
1238 C CD1 . PHE A 158 ? 0.3587 0.3631 0.3689 0.0325  0.0059  0.0265  158  PHE A CD1 
1239 C CD2 . PHE A 158 ? 0.3822 0.3950 0.4043 0.0217  0.0008  0.0281  158  PHE A CD2 
1240 C CE1 . PHE A 158 ? 0.3541 0.3449 0.3576 0.0304  0.0053  0.0245  158  PHE A CE1 
1241 C CE2 . PHE A 158 ? 0.3865 0.3868 0.4020 0.0207  0.0005  0.0258  158  PHE A CE2 
1242 C CZ  . PHE A 158 ? 0.3033 0.2933 0.3100 0.0246  0.0027  0.0243  158  PHE A CZ  
1243 N N   . LEU A 159 ? 0.3424 0.4189 0.3905 0.0350  0.0031  0.0402  159  LEU A N   
1244 C CA  . LEU A 159 ? 0.3887 0.4846 0.4436 0.0387  0.0053  0.0438  159  LEU A CA  
1245 C C   . LEU A 159 ? 0.3753 0.4723 0.4251 0.0506  0.0079  0.0435  159  LEU A C   
1246 O O   . LEU A 159 ? 0.4349 0.5278 0.4823 0.0541  0.0057  0.0429  159  LEU A O   
1247 C CB  . LEU A 159 ? 0.3033 0.4173 0.3706 0.0324  0.0015  0.0479  159  LEU A CB  
1248 C CG  . LEU A 159 ? 0.4384 0.5763 0.5145 0.0352  0.0039  0.0526  159  LEU A CG  
1249 C CD1 . LEU A 159 ? 0.3104 0.4623 0.3977 0.0239  0.0011  0.0568  159  LEU A CD1 
1250 C CD2 . LEU A 159 ? 0.3544 0.5047 0.4329 0.0443  0.0036  0.0541  159  LEU A CD2 
1251 N N   . ALA A 160 ? 0.3853 0.4871 0.4325 0.0572  0.0126  0.0438  160  ALA A N   
1252 C CA  . ALA A 160 ? 0.4027 0.5017 0.4422 0.0698  0.0158  0.0428  160  ALA A CA  
1253 C C   . ALA A 160 ? 0.4384 0.5580 0.4829 0.0768  0.0198  0.0460  160  ALA A C   
1254 O O   . ALA A 160 ? 0.3890 0.5164 0.4367 0.0731  0.0221  0.0472  160  ALA A O   
1255 C CB  . ALA A 160 ? 0.4139 0.4885 0.4386 0.0725  0.0183  0.0380  160  ALA A CB  
1256 N N   . LEU A 161 ? 0.3733 0.5024 0.4183 0.0874  0.0206  0.0477  161  LEU A N   
1257 C CA  . LEU A 161 ? 0.4522 0.5975 0.4983 0.0980  0.0254  0.0498  161  LEU A CA  
1258 C C   . LEU A 161 ? 0.4229 0.5486 0.4534 0.1108  0.0279  0.0461  161  LEU A C   
1259 O O   . LEU A 161 ? 0.4692 0.5960 0.4986 0.1187  0.0266  0.0472  161  LEU A O   
1260 C CB  . LEU A 161 ? 0.4383 0.6135 0.4994 0.0993  0.0236  0.0556  161  LEU A CB  
1261 C CG  . LEU A 161 ? 0.5107 0.7011 0.5851 0.0849  0.0213  0.0590  161  LEU A CG  
1262 C CD1 . LEU A 161 ? 0.5818 0.7907 0.6694 0.0787  0.0158  0.0631  161  LEU A CD1 
1263 C CD2 . LEU A 161 ? 0.4437 0.6515 0.5224 0.0860  0.0264  0.0619  161  LEU A CD2 
1264 N N   . PRO A 162 ? 0.4947 0.5998 0.5120 0.1118  0.0310  0.0416  162  PRO A N   
1265 C CA  . PRO A 162 ? 0.5248 0.6042 0.5246 0.1210  0.0326  0.0372  162  PRO A CA  
1266 C C   . PRO A 162 ? 0.5455 0.6333 0.5423 0.1372  0.0354  0.0390  162  PRO A C   
1267 O O   . PRO A 162 ? 0.4843 0.5922 0.4861 0.1438  0.0391  0.0413  162  PRO A O   
1268 C CB  . PRO A 162 ? 0.5266 0.5922 0.5158 0.1194  0.0360  0.0331  162  PRO A CB  
1269 C CG  . PRO A 162 ? 0.4923 0.5671 0.4924 0.1051  0.0339  0.0345  162  PRO A CG  
1270 C CD  . PRO A 162 ? 0.4018 0.5054 0.4195 0.1030  0.0324  0.0404  162  PRO A CD  
1271 N N   . GLY A 163 ? 0.5951 0.6689 0.5842 0.1436  0.0337  0.0383  163  GLY A N   
1272 C CA  . GLY A 163 ? 0.5828 0.6633 0.5683 0.1602  0.0359  0.0403  163  GLY A CA  
1273 C C   . GLY A 163 ? 0.6560 0.7605 0.6557 0.1619  0.0323  0.0457  163  GLY A C   
1274 O O   . GLY A 163 ? 0.6598 0.7654 0.6551 0.1752  0.0327  0.0473  163  GLY A O   
1275 N N   . SER A 164 ? 0.5752 0.6986 0.5912 0.1489  0.0286  0.0485  164  SER A N   
1276 C CA  . SER A 164 ? 0.5675 0.7135 0.5968 0.1484  0.0242  0.0534  164  SER A CA  
1277 C C   . SER A 164 ? 0.5724 0.6988 0.5943 0.1474  0.0198  0.0521  164  SER A C   
1278 O O   . SER A 164 ? 0.6519 0.7501 0.6615 0.1431  0.0197  0.0479  164  SER A O   
1279 C CB  . SER A 164 ? 0.5512 0.7189 0.5979 0.1333  0.0210  0.0562  164  SER A CB  
1280 O OG  . SER A 164 ? 0.5258 0.6748 0.5702 0.1193  0.0176  0.0532  164  SER A OG  
1281 N N   . ARG A 165 ? 0.5630 0.7054 0.5923 0.1509  0.0160  0.0559  165  ARG A N   
1282 C CA  . ARG A 165 ? 0.5761 0.7027 0.5992 0.1492  0.0115  0.0553  165  ARG A CA  
1283 C C   . ARG A 165 ? 0.5311 0.6627 0.5642 0.1325  0.0061  0.0553  165  ARG A C   
1284 O O   . ARG A 165 ? 0.5636 0.6763 0.5900 0.1267  0.0031  0.0532  165  ARG A O   
1285 C CB  . ARG A 165 ? 0.5721 0.7124 0.5965 0.1623  0.0098  0.0594  165  ARG A CB  
1286 N N   . GLU A 166 ? 0.4963 0.6532 0.5449 0.1249  0.0049  0.0579  166  GLU A N   
1287 C CA  . GLU A 166 ? 0.4815 0.6461 0.5400 0.1105  -0.0009 0.0586  166  GLU A CA  
1288 C C   . GLU A 166 ? 0.4757 0.6239 0.5321 0.0974  -0.0007 0.0550  166  GLU A C   
1289 O O   . GLU A 166 ? 0.5694 0.7140 0.6288 0.0864  -0.0053 0.0541  166  GLU A O   
1290 C CB  . GLU A 166 ? 0.5204 0.7199 0.5963 0.1076  -0.0032 0.0636  166  GLU A CB  
1291 C CG  . GLU A 166 ? 0.5771 0.7975 0.6571 0.1206  -0.0040 0.0678  166  GLU A CG  
1292 C CD  . GLU A 166 ? 0.7311 0.9650 0.8119 0.1339  0.0025  0.0699  166  GLU A CD  
1293 O OE1 . GLU A 166 ? 0.7448 0.9645 0.8180 0.1357  0.0081  0.0670  166  GLU A OE1 
1294 O OE2 . GLU A 166 ? 0.7480 1.0079 0.8369 0.1429  0.0021  0.0745  166  GLU A OE2 
1295 N N   . ALA A 167 ? 0.3948 0.5333 0.4456 0.0991  0.0046  0.0528  167  ALA A N   
1296 C CA  . ALA A 167 ? 0.4340 0.5577 0.4822 0.0882  0.0052  0.0496  167  ALA A CA  
1297 C C   . ALA A 167 ? 0.4395 0.5428 0.4742 0.0941  0.0104  0.0460  167  ALA A C   
1298 O O   . ALA A 167 ? 0.3759 0.4830 0.4114 0.0936  0.0141  0.0457  167  ALA A O   
1299 C CB  . ALA A 167 ? 0.4038 0.5472 0.4652 0.0789  0.0049  0.0522  167  ALA A CB  
1300 N N   . PRO A 168 ? 0.4404 0.5216 0.4620 0.0993  0.0106  0.0434  168  PRO A N   
1301 C CA  . PRO A 168 ? 0.4672 0.5265 0.4738 0.1053  0.0150  0.0399  168  PRO A CA  
1302 C C   . PRO A 168 ? 0.5277 0.5722 0.5303 0.0952  0.0158  0.0363  168  PRO A C   
1303 O O   . PRO A 168 ? 0.5451 0.5747 0.5366 0.0987  0.0193  0.0333  168  PRO A O   
1304 C CB  . PRO A 168 ? 0.4346 0.4751 0.4296 0.1112  0.0137  0.0391  168  PRO A CB  
1305 C CG  . PRO A 168 ? 0.4518 0.4989 0.4546 0.1035  0.0083  0.0408  168  PRO A CG  
1306 C CD  . PRO A 168 ? 0.3843 0.4596 0.4039 0.0988  0.0063  0.0440  168  PRO A CD  
1307 N N   . GLY A 169 ? 0.4764 0.5245 0.4870 0.0832  0.0125  0.0365  169  GLY A N   
1308 C CA  . GLY A 169 ? 0.4173 0.4522 0.4242 0.0743  0.0130  0.0334  169  GLY A CA  
1309 C C   . GLY A 169 ? 0.4812 0.4953 0.4795 0.0701  0.0112  0.0309  169  GLY A C   
1310 O O   . GLY A 169 ? 0.3921 0.3980 0.3842 0.0753  0.0104  0.0311  169  GLY A O   
1311 N N   . ASN A 170 ? 0.4050 0.4120 0.4033 0.0607  0.0106  0.0289  170  ASN A N   
1312 C CA  . ASN A 170 ? 0.3974 0.3862 0.3876 0.0565  0.0096  0.0266  170  ASN A CA  
1313 C C   . ASN A 170 ? 0.4593 0.4467 0.4505 0.0552  0.0063  0.0278  170  ASN A C   
1314 O O   . ASN A 170 ? 0.4796 0.4516 0.4623 0.0538  0.0063  0.0265  170  ASN A O   
1315 C CB  . ASN A 170 ? 0.3811 0.3514 0.3570 0.0620  0.0126  0.0243  170  ASN A CB  
1316 C CG  . ASN A 170 ? 0.4988 0.4665 0.4708 0.0620  0.0156  0.0221  170  ASN A CG  
1317 O OD1 . ASN A 170 ? 0.5259 0.4988 0.5032 0.0547  0.0152  0.0215  170  ASN A OD1 
1318 N ND2 . ASN A 170 ? 0.4887 0.4476 0.4503 0.0707  0.0185  0.0207  170  ASN A ND2 
1319 N N   . VAL A 171 ? 0.4197 0.4227 0.4205 0.0551  0.0035  0.0302  171  VAL A N   
1320 C CA  . VAL A 171 ? 0.3826 0.3841 0.3827 0.0551  0.0003  0.0311  171  VAL A CA  
1321 C C   . VAL A 171 ? 0.4586 0.4527 0.4582 0.0465  -0.0016 0.0294  171  VAL A C   
1322 O O   . VAL A 171 ? 0.4602 0.4469 0.4548 0.0465  -0.0030 0.0294  171  VAL A O   
1323 C CB  . VAL A 171 ? 0.4283 0.4483 0.4374 0.0578  -0.0028 0.0341  171  VAL A CB  
1324 C CG1 . VAL A 171 ? 0.4475 0.4765 0.4571 0.0677  -0.0004 0.0360  171  VAL A CG1 
1325 C CG2 . VAL A 171 ? 0.3721 0.4054 0.3926 0.0494  -0.0054 0.0347  171  VAL A CG2 
1326 N N   . GLY A 172 ? 0.3949 0.3906 0.3988 0.0398  -0.0012 0.0282  172  GLY A N   
1327 C CA  . GLY A 172 ? 0.3910 0.3791 0.3934 0.0330  -0.0021 0.0265  172  GLY A CA  
1328 C C   . GLY A 172 ? 0.4271 0.3991 0.4190 0.0331  0.0002  0.0249  172  GLY A C   
1329 O O   . GLY A 172 ? 0.4690 0.4351 0.4580 0.0300  -0.0007 0.0244  172  GLY A O   
1330 N N   . LEU A 173 ? 0.3964 0.3615 0.3824 0.0363  0.0031  0.0243  173  LEU A N   
1331 C CA  . LEU A 173 ? 0.4156 0.3642 0.3904 0.0361  0.0051  0.0230  173  LEU A CA  
1332 C C   . LEU A 173 ? 0.4162 0.3569 0.3838 0.0410  0.0046  0.0245  173  LEU A C   
1333 O O   . LEU A 173 ? 0.4552 0.3841 0.4154 0.0384  0.0051  0.0244  173  LEU A O   
1334 C CB  . LEU A 173 ? 0.3735 0.3150 0.3422 0.0383  0.0080  0.0215  173  LEU A CB  
1335 C CG  . LEU A 173 ? 0.4809 0.4277 0.4542 0.0333  0.0087  0.0200  173  LEU A CG  
1336 C CD1 . LEU A 173 ? 0.4311 0.3724 0.3976 0.0374  0.0113  0.0184  173  LEU A CD1 
1337 C CD2 . LEU A 173 ? 0.4828 0.4241 0.4548 0.0252  0.0083  0.0187  173  LEU A CD2 
1338 N N   . LEU A 174 ? 0.4291 0.3775 0.3991 0.0481  0.0036  0.0264  174  LEU A N   
1339 C CA  . LEU A 174 ? 0.4522 0.3955 0.4162 0.0536  0.0026  0.0283  174  LEU A CA  
1340 C C   . LEU A 174 ? 0.4643 0.4115 0.4313 0.0491  -0.0004 0.0289  174  LEU A C   
1341 O O   . LEU A 174 ? 0.4273 0.3653 0.3865 0.0504  -0.0006 0.0301  174  LEU A O   
1342 C CB  . LEU A 174 ? 0.4686 0.4216 0.4351 0.0631  0.0021  0.0304  174  LEU A CB  
1343 C CG  . LEU A 174 ? 0.5942 0.5412 0.5546 0.0702  0.0055  0.0298  174  LEU A CG  
1344 C CD1 . LEU A 174 ? 0.5744 0.5365 0.5401 0.0798  0.0051  0.0322  174  LEU A CD1 
1345 C CD2 . LEU A 174 ? 0.5642 0.4880 0.5089 0.0733  0.0076  0.0293  174  LEU A CD2 
1346 N N   . ASP A 175 ? 0.3969 0.3566 0.3741 0.0440  -0.0026 0.0282  175  ASP A N   
1347 C CA  . ASP A 175 ? 0.4675 0.4289 0.4460 0.0395  -0.0052 0.0279  175  ASP A CA  
1348 C C   . ASP A 175 ? 0.4352 0.3841 0.4065 0.0351  -0.0030 0.0268  175  ASP A C   
1349 O O   . ASP A 175 ? 0.4454 0.3894 0.4113 0.0349  -0.0036 0.0275  175  ASP A O   
1350 C CB  . ASP A 175 ? 0.3156 0.2887 0.3044 0.0343  -0.0076 0.0268  175  ASP A CB  
1351 C CG  . ASP A 175 ? 0.4512 0.4390 0.4482 0.0368  -0.0103 0.0284  175  ASP A CG  
1352 O OD1 . ASP A 175 ? 0.4591 0.4500 0.4542 0.0431  -0.0110 0.0303  175  ASP A OD1 
1353 O OD2 . ASP A 175 ? 0.4947 0.4912 0.4998 0.0321  -0.0119 0.0281  175  ASP A OD2 
1354 N N   . GLN A 176 ? 0.3729 0.3178 0.3443 0.0315  -0.0005 0.0254  176  GLN A N   
1355 C CA  . GLN A 176 ? 0.4054 0.3408 0.3710 0.0265  0.0015  0.0248  176  GLN A CA  
1356 C C   . GLN A 176 ? 0.4031 0.3248 0.3573 0.0292  0.0031  0.0264  176  GLN A C   
1357 O O   . GLN A 176 ? 0.4551 0.3711 0.4041 0.0265  0.0037  0.0273  176  GLN A O   
1358 C CB  . GLN A 176 ? 0.4089 0.3435 0.3765 0.0221  0.0034  0.0230  176  GLN A CB  
1359 C CG  . GLN A 176 ? 0.4067 0.3530 0.3844 0.0191  0.0020  0.0219  176  GLN A CG  
1360 C CD  . GLN A 176 ? 0.5055 0.4516 0.4844 0.0163  0.0037  0.0207  176  GLN A CD  
1361 O OE1 . GLN A 176 ? 0.4578 0.3946 0.4297 0.0155  0.0057  0.0201  176  GLN A OE1 
1362 N NE2 . GLN A 176 ? 0.3804 0.3362 0.3674 0.0147  0.0027  0.0203  176  GLN A NE2 
1363 N N   . ARG A 177 ? 0.4288 0.3448 0.3786 0.0348  0.0040  0.0269  177  ARG A N   
1364 C CA  . ARG A 177 ? 0.4881 0.3882 0.4254 0.0379  0.0055  0.0286  177  ARG A CA  
1365 C C   . ARG A 177 ? 0.5341 0.4340 0.4679 0.0409  0.0039  0.0312  177  ARG A C   
1366 O O   . ARG A 177 ? 0.5425 0.4310 0.4673 0.0388  0.0051  0.0328  177  ARG A O   
1367 C CB  . ARG A 177 ? 0.4863 0.3811 0.4192 0.0456  0.0065  0.0286  177  ARG A CB  
1368 C CG  . ARG A 177 ? 0.5293 0.4042 0.4473 0.0496  0.0080  0.0303  177  ARG A CG  
1369 C CD  . ARG A 177 ? 0.5355 0.4043 0.4483 0.0583  0.0093  0.0297  177  ARG A CD  
1370 N NE  . ARG A 177 ? 0.5946 0.4549 0.5037 0.0541  0.0113  0.0266  177  ARG A NE  
1371 C CZ  . ARG A 177 ? 0.5784 0.4346 0.4836 0.0603  0.0128  0.0249  177  ARG A CZ  
1372 N NH1 . ARG A 177 ? 0.5058 0.3673 0.4113 0.0716  0.0129  0.0263  177  ARG A NH1 
1373 N NH2 . ARG A 177 ? 0.4992 0.3469 0.3999 0.0555  0.0143  0.0218  177  ARG A NH2 
1374 N N   . LEU A 178 ? 0.5232 0.4362 0.4640 0.0453  0.0010  0.0318  178  LEU A N   
1375 C CA  . LEU A 178 ? 0.4797 0.3948 0.4177 0.0482  -0.0013 0.0339  178  LEU A CA  
1376 C C   . LEU A 178 ? 0.5157 0.4299 0.4524 0.0417  -0.0011 0.0335  178  LEU A C   
1377 O O   . LEU A 178 ? 0.4487 0.3556 0.3768 0.0426  -0.0008 0.0358  178  LEU A O   
1378 C CB  . LEU A 178 ? 0.3983 0.3299 0.3455 0.0520  -0.0050 0.0340  178  LEU A CB  
1379 C CG  . LEU A 178 ? 0.4967 0.4319 0.4409 0.0557  -0.0082 0.0361  178  LEU A CG  
1380 C CD1 . LEU A 178 ? 0.4621 0.3844 0.3940 0.0627  -0.0069 0.0394  178  LEU A CD1 
1381 C CD2 . LEU A 178 ? 0.5067 0.4595 0.4610 0.0586  -0.0121 0.0361  178  LEU A CD2 
1382 N N   . ALA A 179 ? 0.4685 0.3900 0.4129 0.0356  -0.0011 0.0310  179  ALA A N   
1383 C CA  . ALA A 179 ? 0.5059 0.4268 0.4488 0.0301  -0.0003 0.0306  179  ALA A CA  
1384 C C   . ALA A 179 ? 0.4343 0.3424 0.3681 0.0268  0.0033  0.0323  179  ALA A C   
1385 O O   . ALA A 179 ? 0.4937 0.3991 0.4218 0.0252  0.0041  0.0339  179  ALA A O   
1386 C CB  . ALA A 179 ? 0.3840 0.3141 0.3362 0.0252  -0.0007 0.0277  179  ALA A CB  
1387 N N   . LEU A 180 ? 0.4061 0.3062 0.3376 0.0254  0.0052  0.0320  180  LEU A N   
1388 C CA  . LEU A 180 ? 0.5196 0.4062 0.4417 0.0209  0.0081  0.0336  180  LEU A CA  
1389 C C   . LEU A 180 ? 0.5191 0.3936 0.4296 0.0251  0.0085  0.0372  180  LEU A C   
1390 O O   . LEU A 180 ? 0.5532 0.4196 0.4561 0.0208  0.0104  0.0396  180  LEU A O   
1391 C CB  . LEU A 180 ? 0.3864 0.2649 0.3067 0.0183  0.0096  0.0320  180  LEU A CB  
1392 C CG  . LEU A 180 ? 0.4776 0.3662 0.4078 0.0146  0.0094  0.0288  180  LEU A CG  
1393 C CD1 . LEU A 180 ? 0.4658 0.3438 0.3909 0.0111  0.0109  0.0275  180  LEU A CD1 
1394 C CD2 . LEU A 180 ? 0.4558 0.3558 0.3933 0.0088  0.0095  0.0282  180  LEU A CD2 
1395 N N   . GLN A 181 ? 0.4932 0.3669 0.4021 0.0336  0.0066  0.0380  181  GLN A N   
1396 C CA  . GLN A 181 ? 0.5247 0.3871 0.4221 0.0392  0.0066  0.0418  181  GLN A CA  
1397 C C   . GLN A 181 ? 0.5715 0.4408 0.4684 0.0386  0.0055  0.0435  181  GLN A C   
1398 O O   . GLN A 181 ? 0.5326 0.3919 0.4192 0.0382  0.0068  0.0470  181  GLN A O   
1399 C CB  . GLN A 181 ? 0.5155 0.3787 0.4127 0.0495  0.0047  0.0423  181  GLN A CB  
1400 C CG  . GLN A 181 ? 0.6852 0.5392 0.5800 0.0515  0.0064  0.0406  181  GLN A CG  
1401 C CD  . GLN A 181 ? 0.7288 0.5883 0.6261 0.0622  0.0050  0.0407  181  GLN A CD  
1402 O OE1 . GLN A 181 ? 0.7493 0.6247 0.6545 0.0664  0.0022  0.0412  181  GLN A OE1 
1403 N NE2 . GLN A 181 ? 0.6830 0.5298 0.5732 0.0664  0.0069  0.0400  181  GLN A NE2 
1404 N N   . TRP A 182 ? 0.4978 0.3833 0.4050 0.0383  0.0031  0.0410  182  TRP A N   
1405 C CA  . TRP A 182 ? 0.5144 0.4067 0.4208 0.0378  0.0019  0.0417  182  TRP A CA  
1406 C C   . TRP A 182 ? 0.5742 0.4622 0.4761 0.0306  0.0054  0.0429  182  TRP A C   
1407 O O   . TRP A 182 ? 0.5335 0.4192 0.4279 0.0309  0.0061  0.0456  182  TRP A O   
1408 C CB  . TRP A 182 ? 0.4673 0.3753 0.3849 0.0374  -0.0012 0.0381  182  TRP A CB  
1409 C CG  . TRP A 182 ? 0.5466 0.4605 0.4619 0.0377  -0.0029 0.0379  182  TRP A CG  
1410 C CD1 . TRP A 182 ? 0.5003 0.4195 0.4140 0.0428  -0.0069 0.0383  182  TRP A CD1 
1411 C CD2 . TRP A 182 ? 0.4556 0.3716 0.3696 0.0331  -0.0009 0.0371  182  TRP A CD2 
1412 N NE1 . TRP A 182 ? 0.4961 0.4188 0.4065 0.0414  -0.0075 0.0374  182  TRP A NE1 
1413 C CE2 . TRP A 182 ? 0.5312 0.4522 0.4418 0.0360  -0.0036 0.0367  182  TRP A CE2 
1414 C CE3 . TRP A 182 ? 0.5030 0.4182 0.4185 0.0270  0.0029  0.0367  182  TRP A CE3 
1415 C CZ2 . TRP A 182 ? 0.4968 0.4211 0.4046 0.0338  -0.0022 0.0356  182  TRP A CZ2 
1416 C CZ3 . TRP A 182 ? 0.4364 0.3566 0.3503 0.0249  0.0043  0.0361  182  TRP A CZ3 
1417 C CH2 . TRP A 182 ? 0.5043 0.4284 0.4140 0.0287  0.0020  0.0355  182  TRP A CH2 
1418 N N   . VAL A 183 ? 0.5220 0.4100 0.4284 0.0242  0.0076  0.0411  183  VAL A N   
1419 C CA  . VAL A 183 ? 0.5282 0.4149 0.4317 0.0171  0.0110  0.0426  183  VAL A CA  
1420 C C   . VAL A 183 ? 0.5567 0.4277 0.4474 0.0156  0.0133  0.0472  183  VAL A C   
1421 O O   . VAL A 183 ? 0.5419 0.4121 0.4265 0.0129  0.0153  0.0504  183  VAL A O   
1422 C CB  . VAL A 183 ? 0.5373 0.4289 0.4488 0.0105  0.0124  0.0400  183  VAL A CB  
1423 C CG1 . VAL A 183 ? 0.4998 0.3883 0.4072 0.0025  0.0159  0.0425  183  VAL A CG1 
1424 C CG2 . VAL A 183 ? 0.4519 0.3589 0.3743 0.0113  0.0106  0.0364  183  VAL A CG2 
1425 N N   . GLN A 184 ? 0.5365 0.3943 0.4221 0.0178  0.0131  0.0478  184  GLN A N   
1426 C CA  . GLN A 184 ? 0.6331 0.4723 0.5048 0.0167  0.0150  0.0522  184  GLN A CA  
1427 C C   . GLN A 184 ? 0.6175 0.4553 0.4814 0.0220  0.0144  0.0562  184  GLN A C   
1428 O O   . GLN A 184 ? 0.5937 0.4237 0.4485 0.0179  0.0168  0.0604  184  GLN A O   
1429 C CB  . GLN A 184 ? 0.5740 0.3983 0.4403 0.0210  0.0144  0.0516  184  GLN A CB  
1430 C CG  . GLN A 184 ? 0.5833 0.4041 0.4526 0.0140  0.0156  0.0487  184  GLN A CG  
1431 C CD  . GLN A 184 ? 0.6460 0.4585 0.5091 0.0031  0.0183  0.0511  184  GLN A CD  
1432 O OE1 . GLN A 184 ? 0.7112 0.5055 0.5610 0.0017  0.0195  0.0550  184  GLN A OE1 
1433 N NE2 . GLN A 184 ? 0.5426 0.3687 0.4153 -0.0048 0.0191  0.0492  184  GLN A NE2 
1434 N N   . GLU A 185 ? 0.5643 0.4105 0.4317 0.0305  0.0111  0.0550  185  GLU A N   
1435 C CA  . GLU A 185 ? 0.5770 0.4215 0.4359 0.0362  0.0099  0.0587  185  GLU A CA  
1436 C C   . GLU A 185 ? 0.6288 0.4846 0.4885 0.0331  0.0106  0.0591  185  GLU A C   
1437 O O   . GLU A 185 ? 0.5990 0.4497 0.4485 0.0342  0.0115  0.0635  185  GLU A O   
1438 C CB  . GLU A 185 ? 0.5828 0.4326 0.4441 0.0465  0.0057  0.0579  185  GLU A CB  
1439 C CG  . GLU A 185 ? 0.6643 0.5157 0.5178 0.0521  0.0038  0.0614  185  GLU A CG  
1440 C CD  . GLU A 185 ? 0.8575 0.7077 0.7080 0.0628  0.0004  0.0632  185  GLU A CD  
1441 O OE1 . GLU A 185 ? 0.8621 0.7059 0.7014 0.0679  -0.0003 0.0678  185  GLU A OE1 
1442 O OE2 . GLU A 185 ? 0.8714 0.7285 0.7309 0.0663  -0.0016 0.0602  185  GLU A OE2 
1443 N N   . ASN A 186 ? 0.5214 0.3918 0.3924 0.0298  0.0102  0.0547  186  ASN A N   
1444 C CA  . ASN A 186 ? 0.4588 0.3408 0.3306 0.0298  0.0099  0.0539  186  ASN A CA  
1445 C C   . ASN A 186 ? 0.5115 0.3998 0.3860 0.0225  0.0137  0.0535  186  ASN A C   
1446 O O   . ASN A 186 ? 0.5661 0.4615 0.4377 0.0229  0.0146  0.0540  186  ASN A O   
1447 C CB  . ASN A 186 ? 0.4704 0.3650 0.3513 0.0342  0.0054  0.0490  186  ASN A CB  
1448 C CG  . ASN A 186 ? 0.5882 0.4814 0.4671 0.0420  0.0011  0.0499  186  ASN A CG  
1449 O OD1 . ASN A 186 ? 0.5882 0.4781 0.4577 0.0463  0.0001  0.0531  186  ASN A OD1 
1450 N ND2 . ASN A 186 ? 0.5773 0.4740 0.4649 0.0440  -0.0012 0.0473  186  ASN A ND2 
1451 N N   . ILE A 187 ? 0.5192 0.4065 0.3994 0.0162  0.0159  0.0526  187  ILE A N   
1452 C CA  . ILE A 187 ? 0.4955 0.3932 0.3812 0.0099  0.0189  0.0516  187  ILE A CA  
1453 C C   . ILE A 187 ? 0.5509 0.4481 0.4281 0.0061  0.0230  0.0566  187  ILE A C   
1454 O O   . ILE A 187 ? 0.5225 0.4318 0.4026 0.0043  0.0253  0.0561  187  ILE A O   
1455 C CB  . ILE A 187 ? 0.4570 0.3552 0.3508 0.0036  0.0199  0.0497  187  ILE A CB  
1456 C CG1 . ILE A 187 ? 0.4641 0.3779 0.3672 0.0007  0.0213  0.0470  187  ILE A CG1 
1457 C CG2 . ILE A 187 ? 0.4797 0.3658 0.3665 -0.0035 0.0228  0.0538  187  ILE A CG2 
1458 C CD1 . ILE A 187 ? 0.3972 0.3204 0.3070 0.0070  0.0180  0.0423  187  ILE A CD1 
1459 N N   . ALA A 188 ? 0.4977 0.3808 0.3637 0.0053  0.0241  0.0617  188  ALA A N   
1460 C CA  . ALA A 188 ? 0.4945 0.3768 0.3515 0.0014  0.0280  0.0673  188  ALA A CA  
1461 C C   . ALA A 188 ? 0.6029 0.4959 0.4570 0.0071  0.0279  0.0670  188  ALA A C   
1462 O O   . ALA A 188 ? 0.6193 0.5186 0.4694 0.0040  0.0318  0.0702  188  ALA A O   
1463 C CB  . ALA A 188 ? 0.5189 0.3813 0.3625 0.0001  0.0288  0.0732  188  ALA A CB  
1464 N N   . ALA A 189 ? 0.5576 0.4536 0.4136 0.0152  0.0235  0.0629  189  ALA A N   
1465 C CA  . ALA A 189 ? 0.5399 0.4446 0.3917 0.0205  0.0228  0.0620  189  ALA A CA  
1466 C C   . ALA A 189 ? 0.5822 0.5017 0.4413 0.0185  0.0251  0.0585  189  ALA A C   
1467 O O   . ALA A 189 ? 0.6476 0.5746 0.5021 0.0219  0.0260  0.0579  189  ALA A O   
1468 C CB  . ALA A 189 ? 0.5642 0.4690 0.4167 0.0283  0.0169  0.0583  189  ALA A CB  
1469 N N   . PHE A 190 ? 0.5632 0.4868 0.4332 0.0140  0.0258  0.0560  190  PHE A N   
1470 C CA  . PHE A 190 ? 0.5233 0.4610 0.4013 0.0134  0.0275  0.0523  190  PHE A CA  
1471 C C   . PHE A 190 ? 0.5559 0.5000 0.4360 0.0057  0.0331  0.0563  190  PHE A C   
1472 O O   . PHE A 190 ? 0.6238 0.5807 0.5109 0.0049  0.0351  0.0542  190  PHE A O   
1473 C CB  . PHE A 190 ? 0.5131 0.4532 0.4028 0.0142  0.0239  0.0467  190  PHE A CB  
1474 C CG  . PHE A 190 ? 0.4696 0.4064 0.3593 0.0206  0.0183  0.0427  190  PHE A CG  
1475 C CD1 . PHE A 190 ? 0.5069 0.4341 0.3955 0.0219  0.0151  0.0436  190  PHE A CD1 
1476 C CD2 . PHE A 190 ? 0.5016 0.4450 0.3922 0.0253  0.0160  0.0381  190  PHE A CD2 
1477 C CE1 . PHE A 190 ? 0.4981 0.4251 0.3879 0.0273  0.0098  0.0404  190  PHE A CE1 
1478 C CE2 . PHE A 190 ? 0.4955 0.4364 0.3863 0.0298  0.0103  0.0346  190  PHE A CE2 
1479 C CZ  . PHE A 190 ? 0.4027 0.3367 0.2938 0.0305  0.0072  0.0360  190  PHE A CZ  
1480 N N   . GLY A 191 ? 0.5673 0.5023 0.4411 -0.0002 0.0354  0.0621  191  GLY A N   
1481 C CA  . GLY A 191 ? 0.5545 0.4954 0.4308 -0.0094 0.0401  0.0662  191  GLY A CA  
1482 C C   . GLY A 191 ? 0.5956 0.5319 0.4794 -0.0163 0.0390  0.0651  191  GLY A C   
1483 O O   . GLY A 191 ? 0.5884 0.5301 0.4754 -0.0251 0.0421  0.0680  191  GLY A O   
1484 N N   . GLY A 192 ? 0.5896 0.5169 0.4762 -0.0125 0.0346  0.0610  192  GLY A N   
1485 C CA  . GLY A 192 ? 0.5604 0.4825 0.4529 -0.0179 0.0333  0.0595  192  GLY A CA  
1486 C C   . GLY A 192 ? 0.6172 0.5204 0.5003 -0.0231 0.0336  0.0636  192  GLY A C   
1487 O O   . GLY A 192 ? 0.5902 0.4812 0.4627 -0.0194 0.0332  0.0665  192  GLY A O   
1488 N N   . ASP A 193 ? 0.6084 0.5083 0.4945 -0.0315 0.0341  0.0637  193  ASP A N   
1489 C CA  . ASP A 193 ? 0.5988 0.4788 0.4750 -0.0376 0.0343  0.0671  193  ASP A CA  
1490 C C   . ASP A 193 ? 0.5571 0.4237 0.4332 -0.0338 0.0307  0.0630  193  ASP A C   
1491 O O   . ASP A 193 ? 0.5618 0.4325 0.4456 -0.0373 0.0297  0.0594  193  ASP A O   
1492 C CB  . ASP A 193 ? 0.5608 0.4455 0.4391 -0.0506 0.0370  0.0699  193  ASP A CB  
1493 C CG  . ASP A 193 ? 0.6772 0.5394 0.5436 -0.0588 0.0372  0.0737  193  ASP A CG  
1494 O OD1 . ASP A 193 ? 0.6925 0.5347 0.5489 -0.0531 0.0354  0.0738  193  ASP A OD1 
1495 O OD2 . ASP A 193 ? 0.6842 0.5486 0.5508 -0.0709 0.0391  0.0766  193  ASP A OD2 
1496 N N   . PRO A 194 ? 0.5652 0.4166 0.4323 -0.0262 0.0289  0.0637  194  PRO A N   
1497 C CA  . PRO A 194 ? 0.5656 0.4061 0.4327 -0.0212 0.0259  0.0599  194  PRO A CA  
1498 C C   . PRO A 194 ? 0.6415 0.4668 0.5034 -0.0293 0.0263  0.0600  194  PRO A C   
1499 O O   . PRO A 194 ? 0.5909 0.4094 0.4539 -0.0263 0.0242  0.0561  194  PRO A O   
1500 C CB  . PRO A 194 ? 0.5886 0.4166 0.4456 -0.0117 0.0245  0.0622  194  PRO A CB  
1501 C CG  . PRO A 194 ? 0.6137 0.4380 0.4611 -0.0148 0.0272  0.0683  194  PRO A CG  
1502 C CD  . PRO A 194 ? 0.6063 0.4506 0.4626 -0.0215 0.0297  0.0683  194  PRO A CD  
1503 N N   . MET A 195 ? 0.5809 0.4004 0.4364 -0.0397 0.0288  0.0644  195  MET A N   
1504 C CA  . MET A 195 ? 0.6721 0.4760 0.5214 -0.0492 0.0288  0.0645  195  MET A CA  
1505 C C   . MET A 195 ? 0.6827 0.5027 0.5438 -0.0581 0.0288  0.0616  195  MET A C   
1506 O O   . MET A 195 ? 0.7671 0.5771 0.6243 -0.0671 0.0283  0.0610  195  MET A O   
1507 C CB  . MET A 195 ? 0.6651 0.4510 0.4997 -0.0570 0.0309  0.0710  195  MET A CB  
1508 C CG  . MET A 195 ? 0.6940 0.4597 0.5147 -0.0477 0.0304  0.0740  195  MET A CG  
1509 S SD  . MET A 195 ? 1.0412 0.7791 0.8416 -0.0567 0.0324  0.0817  195  MET A SD  
1510 C CE  . MET A 195 ? 0.8281 0.5868 0.6357 -0.0711 0.0361  0.0865  195  MET A CE  
1511 N N   . SER A 196 ? 0.6203 0.4646 0.4949 -0.0554 0.0292  0.0598  196  SER A N   
1512 C CA  . SER A 196 ? 0.5639 0.4245 0.4505 -0.0611 0.0287  0.0565  196  SER A CA  
1513 C C   . SER A 196 ? 0.5793 0.4553 0.4780 -0.0516 0.0269  0.0516  196  SER A C   
1514 O O   . SER A 196 ? 0.5491 0.4435 0.4561 -0.0488 0.0280  0.0516  196  SER A O   
1515 C CB  . SER A 196 ? 0.4729 0.3502 0.3644 -0.0710 0.0315  0.0604  196  SER A CB  
1516 O OG  . SER A 196 ? 0.5452 0.4392 0.4486 -0.0755 0.0307  0.0575  196  SER A OG  
1517 N N   . VAL A 197 ? 0.5543 0.4219 0.4530 -0.0466 0.0243  0.0475  197  VAL A N   
1518 C CA  . VAL A 197 ? 0.5741 0.4541 0.4832 -0.0382 0.0225  0.0432  197  VAL A CA  
1519 C C   . VAL A 197 ? 0.5546 0.4393 0.4703 -0.0419 0.0210  0.0395  197  VAL A C   
1520 O O   . VAL A 197 ? 0.5926 0.4629 0.5018 -0.0445 0.0201  0.0381  197  VAL A O   
1521 C CB  . VAL A 197 ? 0.6199 0.4898 0.5247 -0.0275 0.0207  0.0420  197  VAL A CB  
1522 C CG1 . VAL A 197 ? 0.6243 0.5070 0.5403 -0.0207 0.0185  0.0377  197  VAL A CG1 
1523 C CG2 . VAL A 197 ? 0.5520 0.4189 0.4504 -0.0229 0.0216  0.0456  197  VAL A CG2 
1524 N N   . THR A 198 ? 0.4892 0.3930 0.4167 -0.0418 0.0208  0.0378  198  THR A N   
1525 C CA  . THR A 198 ? 0.5149 0.4253 0.4491 -0.0446 0.0193  0.0346  198  THR A CA  
1526 C C   . THR A 198 ? 0.4794 0.3972 0.4213 -0.0355 0.0175  0.0315  198  THR A C   
1527 O O   . THR A 198 ? 0.4662 0.3952 0.4139 -0.0309 0.0178  0.0317  198  THR A O   
1528 C CB  . THR A 198 ? 0.4890 0.4167 0.4308 -0.0524 0.0204  0.0360  198  THR A CB  
1529 O OG1 . THR A 198 ? 0.5310 0.4522 0.4658 -0.0624 0.0218  0.0394  198  THR A OG1 
1530 C CG2 . THR A 198 ? 0.4076 0.3440 0.3568 -0.0546 0.0185  0.0329  198  THR A CG2 
1531 N N   . LEU A 199 ? 0.4607 0.3718 0.4019 -0.0330 0.0158  0.0286  199  LEU A N   
1532 C CA  . LEU A 199 ? 0.4718 0.3916 0.4213 -0.0262 0.0142  0.0260  199  LEU A CA  
1533 C C   . LEU A 199 ? 0.5186 0.4523 0.4769 -0.0298 0.0136  0.0246  199  LEU A C   
1534 O O   . LEU A 199 ? 0.5585 0.4913 0.5152 -0.0367 0.0135  0.0243  199  LEU A O   
1535 C CB  . LEU A 199 ? 0.4318 0.3410 0.3773 -0.0213 0.0130  0.0240  199  LEU A CB  
1536 C CG  . LEU A 199 ? 0.4221 0.3149 0.3569 -0.0175 0.0135  0.0253  199  LEU A CG  
1537 C CD1 . LEU A 199 ? 0.4080 0.2941 0.3405 -0.0117 0.0126  0.0231  199  LEU A CD1 
1538 C CD2 . LEU A 199 ? 0.4302 0.3264 0.3658 -0.0121 0.0134  0.0273  199  LEU A CD2 
1539 N N   . PHE A 200 ? 0.4452 0.3910 0.4120 -0.0253 0.0129  0.0239  200  PHE A N   
1540 C CA  . PHE A 200 ? 0.4289 0.3862 0.4034 -0.0266 0.0119  0.0227  200  PHE A CA  
1541 C C   . PHE A 200 ? 0.4318 0.3932 0.4121 -0.0198 0.0103  0.0212  200  PHE A C   
1542 O O   . PHE A 200 ? 0.3951 0.3549 0.3753 -0.0147 0.0099  0.0213  200  PHE A O   
1543 C CB  . PHE A 200 ? 0.3973 0.3681 0.3766 -0.0308 0.0131  0.0243  200  PHE A CB  
1544 C CG  . PHE A 200 ? 0.4314 0.4108 0.4144 -0.0258 0.0140  0.0252  200  PHE A CG  
1545 C CD1 . PHE A 200 ? 0.4156 0.3885 0.3937 -0.0223 0.0148  0.0260  200  PHE A CD1 
1546 C CD2 . PHE A 200 ? 0.3961 0.3902 0.3864 -0.0248 0.0142  0.0254  200  PHE A CD2 
1547 C CE1 . PHE A 200 ? 0.3452 0.3255 0.3252 -0.0179 0.0156  0.0264  200  PHE A CE1 
1548 C CE2 . PHE A 200 ? 0.3561 0.3571 0.3483 -0.0198 0.0152  0.0259  200  PHE A CE2 
1549 C CZ  . PHE A 200 ? 0.3418 0.3356 0.3285 -0.0163 0.0159  0.0261  200  PHE A CZ  
1550 N N   . GLY A 201 ? 0.3796 0.3454 0.3640 -0.0203 0.0091  0.0199  201  GLY A N   
1551 C CA  . GLY A 201 ? 0.3900 0.3593 0.3796 -0.0151 0.0076  0.0190  201  GLY A CA  
1552 C C   . GLY A 201 ? 0.4475 0.4243 0.4417 -0.0170 0.0067  0.0185  201  GLY A C   
1553 O O   . GLY A 201 ? 0.4258 0.4035 0.4182 -0.0219 0.0069  0.0183  201  GLY A O   
1554 N N   . GLU A 202 ? 0.3456 0.3275 0.3452 -0.0132 0.0054  0.0185  202  GLU A N   
1555 C CA  . GLU A 202 ? 0.3717 0.3605 0.3753 -0.0140 0.0045  0.0186  202  GLU A CA  
1556 C C   . GLU A 202 ? 0.3975 0.3838 0.4020 -0.0115 0.0035  0.0183  202  GLU A C   
1557 O O   . GLU A 202 ? 0.3790 0.3623 0.3843 -0.0082 0.0030  0.0184  202  GLU A O   
1558 C CB  . GLU A 202 ? 0.3672 0.3647 0.3760 -0.0119 0.0040  0.0195  202  GLU A CB  
1559 C CG  . GLU A 202 ? 0.4075 0.4129 0.4201 -0.0123 0.0030  0.0202  202  GLU A CG  
1560 C CD  . GLU A 202 ? 0.4627 0.4667 0.4778 -0.0086 0.0015  0.0207  202  GLU A CD  
1561 O OE1 . GLU A 202 ? 0.4642 0.4623 0.4788 -0.0062 0.0012  0.0204  202  GLU A OE1 
1562 O OE2 . GLU A 202 ? 0.4913 0.5005 0.5088 -0.0085 0.0006  0.0217  202  GLU A OE2 
1563 N N   . SBG A 203 ? 0.4145 0.4031 0.4188 -0.0133 0.0033  0.0180  203  SBG A N   
1564 C CA  . SBG A 203 ? 0.3388 0.3271 0.3437 -0.0113 0.0029  0.0182  203  SBG A CA  
1565 C CB  . SBG A 203 ? 0.3239 0.3176 0.3348 -0.0089 0.0016  0.0199  203  SBG A CB  
1566 O OG  . SBG A 203 ? 0.4327 0.4280 0.4447 -0.0080 0.0013  0.0208  203  SBG A OG  
1567 C C   . SBG A 203 ? 0.3712 0.3520 0.3724 -0.0090 0.0038  0.0174  203  SBG A C   
1568 O O   . SBG A 203 ? 0.4248 0.3988 0.4197 -0.0103 0.0048  0.0160  203  SBG A O   
1569 O O2  . SBG A 203 ? 0.3787 0.3773 0.3981 -0.0053 -0.0012 0.0242  203  SBG A O2  
1570 P P1  . SBG A 203 ? 0.3848 0.3808 0.4012 -0.0057 0.0003  0.0227  203  SBG A P1  
1571 O O1  . SBG A 203 ? 0.4330 0.4249 0.4489 -0.0041 0.0003  0.0221  203  SBG A O1  
1572 C C1  . SBG A 203 ? 0.2837 0.2833 0.2998 -0.0058 0.0011  0.0241  203  SBG A C1  
1573 N N   . ALA A 204 ? 0.3056 0.2875 0.3102 -0.0057 0.0033  0.0184  204  ALA A N   
1574 C CA  . ALA A 204 ? 0.3833 0.3607 0.3853 -0.0026 0.0040  0.0182  204  ALA A CA  
1575 C C   . ALA A 204 ? 0.4320 0.4021 0.4293 -0.0022 0.0044  0.0175  204  ALA A C   
1576 O O   . ALA A 204 ? 0.4227 0.3862 0.4146 0.0000  0.0055  0.0169  204  ALA A O   
1577 C CB  . ALA A 204 ? 0.3261 0.3084 0.3338 -0.0001 0.0027  0.0199  204  ALA A CB  
1578 N N   . GLY A 205 ? 0.3761 0.3473 0.3747 -0.0039 0.0039  0.0177  205  GLY A N   
1579 C CA  . GLY A 205 ? 0.3194 0.2844 0.3130 -0.0043 0.0047  0.0175  205  GLY A CA  
1580 C C   . GLY A 205 ? 0.4406 0.3992 0.4276 -0.0080 0.0061  0.0167  205  GLY A C   
1581 O O   . GLY A 205 ? 0.4506 0.3999 0.4308 -0.0074 0.0070  0.0166  205  GLY A O   
1582 N N   . ALA A 206 ? 0.3558 0.3188 0.3441 -0.0118 0.0060  0.0162  206  ALA A N   
1583 C CA  . ALA A 206 ? 0.4195 0.3764 0.4011 -0.0165 0.0067  0.0150  206  ALA A CA  
1584 C C   . ALA A 206 ? 0.4299 0.3774 0.4047 -0.0140 0.0073  0.0135  206  ALA A C   
1585 O O   . ALA A 206 ? 0.4501 0.3861 0.4162 -0.0155 0.0081  0.0126  206  ALA A O   
1586 C CB  . ALA A 206 ? 0.3247 0.2903 0.3095 -0.0211 0.0059  0.0148  206  ALA A CB  
1587 N N   . ALA A 207 ? 0.3898 0.3421 0.3681 -0.0101 0.0071  0.0134  207  ALA A N   
1588 C CA  . ALA A 207 ? 0.4153 0.3606 0.3876 -0.0060 0.0082  0.0121  207  ALA A CA  
1589 C C   . ALA A 207 ? 0.4684 0.4048 0.4360 -0.0017 0.0089  0.0126  207  ALA A C   
1590 O O   . ALA A 207 ? 0.5189 0.4434 0.4771 0.0002  0.0100  0.0113  207  ALA A O   
1591 C CB  . ALA A 207 ? 0.3925 0.3473 0.3710 -0.0021 0.0081  0.0130  207  ALA A CB  
1592 N N   . SER A 208 ? 0.4158 0.3573 0.3893 0.0002  0.0082  0.0145  208  SER A N   
1593 C CA  . SER A 208 ? 0.4039 0.3385 0.3734 0.0043  0.0085  0.0154  208  SER A CA  
1594 C C   . SER A 208 ? 0.4448 0.3661 0.4045 0.0012  0.0094  0.0150  208  SER A C   
1595 O O   . SER A 208 ? 0.4311 0.3407 0.3822 0.0048  0.0103  0.0149  208  SER A O   
1596 C CB  . SER A 208 ? 0.3931 0.3354 0.3696 0.0054  0.0070  0.0171  208  SER A CB  
1597 O OG  . SER A 208 ? 0.3558 0.3083 0.3401 0.0082  0.0059  0.0178  208  SER A OG  
1598 N N   . VAL A 209 ? 0.4137 0.3368 0.3744 -0.0055 0.0092  0.0152  209  VAL A N   
1599 C CA  . VAL A 209 ? 0.4344 0.3466 0.3868 -0.0104 0.0100  0.0155  209  VAL A CA  
1600 C C   . VAL A 209 ? 0.5017 0.4004 0.4437 -0.0114 0.0106  0.0134  209  VAL A C   
1601 O O   . VAL A 209 ? 0.5258 0.4094 0.4574 -0.0115 0.0113  0.0136  209  VAL A O   
1602 C CB  . VAL A 209 ? 0.4399 0.3604 0.3967 -0.0180 0.0098  0.0162  209  VAL A CB  
1603 C CG1 . VAL A 209 ? 0.3974 0.3072 0.3453 -0.0252 0.0105  0.0164  209  VAL A CG1 
1604 C CG2 . VAL A 209 ? 0.3697 0.2996 0.3332 -0.0164 0.0097  0.0181  209  VAL A CG2 
1605 N N   . GLY A 210 ? 0.4802 0.3837 0.4242 -0.0121 0.0101  0.0114  210  GLY A N   
1606 C CA  . GLY A 210 ? 0.4060 0.2971 0.3395 -0.0124 0.0105  0.0086  210  GLY A CA  
1607 C C   . GLY A 210 ? 0.4727 0.3525 0.3986 -0.0036 0.0118  0.0081  210  GLY A C   
1608 O O   . GLY A 210 ? 0.5165 0.3788 0.4295 -0.0032 0.0124  0.0065  210  GLY A O   
1609 N N   . MET A 211 ? 0.4769 0.3667 0.4104 0.0037  0.0120  0.0097  211  MET A N   
1610 C CA  . MET A 211 ? 0.4712 0.3538 0.3990 0.0130  0.0132  0.0097  211  MET A CA  
1611 C C   . MET A 211 ? 0.4767 0.3456 0.3963 0.0152  0.0135  0.0113  211  MET A C   
1612 O O   . MET A 211 ? 0.5035 0.3591 0.4127 0.0218  0.0147  0.0107  211  MET A O   
1613 C CB  . MET A 211 ? 0.4767 0.3760 0.4157 0.0192  0.0131  0.0113  211  MET A CB  
1614 C CG  . MET A 211 ? 0.5914 0.4989 0.5335 0.0191  0.0136  0.0096  211  MET A CG  
1615 S SD  . MET A 211 ? 0.6113 0.5403 0.5684 0.0225  0.0131  0.0122  211  MET A SD  
1616 C CE  . MET A 211 ? 0.4667 0.4035 0.4265 0.0183  0.0133  0.0108  211  MET A CE  
1617 N N   . HIS A 212 ? 0.4211 0.2931 0.3446 0.0104  0.0127  0.0135  212  HIS A N   
1618 C CA  . HIS A 212 ? 0.4406 0.2991 0.3554 0.0111  0.0131  0.0155  212  HIS A CA  
1619 C C   . HIS A 212 ? 0.5069 0.3455 0.4078 0.0056  0.0137  0.0142  212  HIS A C   
1620 O O   . HIS A 212 ? 0.5757 0.3969 0.4648 0.0092  0.0144  0.0151  212  HIS A O   
1621 C CB  . HIS A 212 ? 0.4541 0.3217 0.3759 0.0073  0.0123  0.0182  212  HIS A CB  
1622 C CG  . HIS A 212 ? 0.4841 0.3667 0.4163 0.0132  0.0113  0.0194  212  HIS A CG  
1623 N ND1 . HIS A 212 ? 0.4911 0.3724 0.4214 0.0219  0.0110  0.0208  212  HIS A ND1 
1624 C CD2 . HIS A 212 ? 0.4251 0.3243 0.3692 0.0114  0.0101  0.0194  212  HIS A CD2 
1625 C CE1 . HIS A 212 ? 0.4870 0.3840 0.4281 0.0242  0.0094  0.0216  212  HIS A CE1 
1626 N NE2 . HIS A 212 ? 0.4675 0.3743 0.4166 0.0179  0.0089  0.0206  212  HIS A NE2 
1627 N N   . ILE A 213 ? 0.5278 0.3683 0.4297 -0.0032 0.0132  0.0123  213  ILE A N   
1628 C CA  . ILE A 213 ? 0.5218 0.3434 0.4101 -0.0098 0.0132  0.0104  213  ILE A CA  
1629 C C   . ILE A 213 ? 0.6372 0.4425 0.5131 -0.0021 0.0139  0.0075  213  ILE A C   
1630 O O   . ILE A 213 ? 0.6274 0.4101 0.4880 -0.0032 0.0142  0.0068  213  ILE A O   
1631 C CB  . ILE A 213 ? 0.5428 0.3728 0.4355 -0.0203 0.0119  0.0086  213  ILE A CB  
1632 C CG1 . ILE A 213 ? 0.4925 0.3373 0.3957 -0.0277 0.0115  0.0116  213  ILE A CG1 
1633 C CG2 . ILE A 213 ? 0.5740 0.3837 0.4514 -0.0274 0.0112  0.0058  213  ILE A CG2 
1634 C CD1 . ILE A 213 ? 0.5287 0.3857 0.4381 -0.0367 0.0102  0.0105  213  ILE A CD1 
1635 N N   . LEU A 214 ? 0.5884 0.4047 0.4703 0.0059  0.0144  0.0061  214  LEU A N   
1636 C CA  . LEU A 214 ? 0.5942 0.3983 0.4651 0.0137  0.0156  0.0030  214  LEU A CA  
1637 C C   . LEU A 214 ? 0.6139 0.4126 0.4809 0.0265  0.0170  0.0047  214  LEU A C   
1638 O O   . LEU A 214 ? 0.5942 0.3828 0.4515 0.0351  0.0184  0.0025  214  LEU A O   
1639 C CB  . LEU A 214 ? 0.5179 0.3377 0.3966 0.0153  0.0157  0.0007  214  LEU A CB  
1640 C CG  . LEU A 214 ? 0.5650 0.3901 0.4465 0.0037  0.0141  -0.0011 214  LEU A CG  
1641 C CD1 . LEU A 214 ? 0.5027 0.3450 0.3928 0.0058  0.0142  -0.0025 214  LEU A CD1 
1642 C CD2 . LEU A 214 ? 0.5431 0.3453 0.4077 -0.0026 0.0133  -0.0043 214  LEU A CD2 
1643 N N   . SER A 215 ? 0.5758 0.3825 0.4502 0.0284  0.0167  0.0086  215  SER A N   
1644 C CA  . SER A 215 ? 0.5468 0.3528 0.4196 0.0406  0.0175  0.0108  215  SER A CA  
1645 C C   . SER A 215 ? 0.6617 0.4499 0.5240 0.0405  0.0174  0.0135  215  SER A C   
1646 O O   . SER A 215 ? 0.6275 0.4211 0.4953 0.0342  0.0164  0.0163  215  SER A O   
1647 C CB  . SER A 215 ? 0.5842 0.4161 0.4745 0.0438  0.0168  0.0132  215  SER A CB  
1648 O OG  . SER A 215 ? 0.6214 0.4553 0.5110 0.0557  0.0173  0.0153  215  SER A OG  
1649 N N   . LEU A 216 ? 0.7078 0.4743 0.5540 0.0479  0.0185  0.0128  216  LEU A N   
1650 C CA  . LEU A 216 ? 0.7483 0.4913 0.5800 0.0468  0.0185  0.0150  216  LEU A CA  
1651 C C   . LEU A 216 ? 0.6998 0.4506 0.5375 0.0479  0.0178  0.0201  216  LEU A C   
1652 O O   . LEU A 216 ? 0.6848 0.4275 0.5186 0.0392  0.0173  0.0223  216  LEU A O   
1653 C CB  . LEU A 216 ? 0.9222 0.6421 0.7362 0.0585  0.0199  0.0138  216  LEU A CB  
1654 C CG  . LEU A 216 ? 1.1536 0.8416 0.9478 0.0549  0.0199  0.0149  216  LEU A CG  
1655 C CD1 . LEU A 216 ? 1.1854 0.8608 0.9730 0.0399  0.0190  0.0117  216  LEU A CD1 
1656 C CD2 . LEU A 216 ? 1.2064 0.8719 0.9831 0.0693  0.0213  0.0143  216  LEU A CD2 
1657 N N   . PRO A 217 ? 0.7051 0.4724 0.5518 0.0584  0.0175  0.0220  217  PRO A N   
1658 C CA  . PRO A 217 ? 0.6179 0.3928 0.4694 0.0597  0.0164  0.0265  217  PRO A CA  
1659 C C   . PRO A 217 ? 0.6277 0.4173 0.4909 0.0480  0.0152  0.0274  217  PRO A C   
1660 O O   . PRO A 217 ? 0.6742 0.4655 0.5377 0.0472  0.0145  0.0309  217  PRO A O   
1661 C CB  . PRO A 217 ? 0.6315 0.4255 0.4929 0.0717  0.0158  0.0275  217  PRO A CB  
1662 C CG  . PRO A 217 ? 0.6698 0.4575 0.5250 0.0800  0.0176  0.0244  217  PRO A CG  
1663 C CD  . PRO A 217 ? 0.6291 0.4088 0.4813 0.0694  0.0183  0.0204  217  PRO A CD  
1664 N N   . SER A 218 ? 0.6122 0.4124 0.4841 0.0397  0.0151  0.0245  218  SER A N   
1665 C CA  . SER A 218 ? 0.5878 0.4012 0.4697 0.0298  0.0143  0.0255  218  SER A CA  
1666 C C   . SER A 218 ? 0.6668 0.4655 0.5398 0.0193  0.0150  0.0262  218  SER A C   
1667 O O   . SER A 218 ? 0.6274 0.4339 0.5054 0.0122  0.0149  0.0280  218  SER A O   
1668 C CB  . SER A 218 ? 0.5209 0.3530 0.4164 0.0259  0.0137  0.0227  218  SER A CB  
1669 O OG  . SER A 218 ? 0.5892 0.4385 0.4955 0.0332  0.0127  0.0229  218  SER A OG  
1670 N N   . ARG A 219 ? 0.7163 0.4937 0.5755 0.0182  0.0158  0.0247  219  ARG A N   
1671 C CA  . ARG A 219 ? 0.8036 0.5678 0.6548 0.0059  0.0161  0.0247  219  ARG A CA  
1672 C C   . ARG A 219 ? 0.7990 0.5551 0.6441 0.0014  0.0166  0.0294  219  ARG A C   
1673 O O   . ARG A 219 ? 0.8043 0.5613 0.6500 -0.0103 0.0168  0.0306  219  ARG A O   
1674 C CB  . ARG A 219 ? 0.8765 0.6171 0.7122 0.0059  0.0163  0.0216  219  ARG A CB  
1675 C CG  . ARG A 219 ? 0.8972 0.6461 0.7380 0.0065  0.0160  0.0166  219  ARG A CG  
1676 C CD  . ARG A 219 ? 0.9167 0.6853 0.7709 -0.0043 0.0150  0.0157  219  ARG A CD  
1677 N NE  . ARG A 219 ? 0.9444 0.7060 0.7943 -0.0175 0.0147  0.0173  219  ARG A NE  
1678 C CZ  . ARG A 219 ? 1.0135 0.7614 0.8539 -0.0267 0.0139  0.0149  219  ARG A CZ  
1679 N NH1 . ARG A 219 ? 1.0216 0.7600 0.8547 -0.0235 0.0134  0.0103  219  ARG A NH1 
1680 N NH2 . ARG A 219 ? 1.0438 0.7884 0.8818 -0.0394 0.0135  0.0172  219  ARG A NH2 
1681 N N   . SER A 220 ? 0.7484 0.4979 0.5880 0.0107  0.0168  0.0325  220  SER A N   
1682 C CA  . SER A 220 ? 0.7786 0.5215 0.6123 0.0078  0.0174  0.0376  220  SER A CA  
1683 C C   . SER A 220 ? 0.7183 0.4848 0.5657 0.0053  0.0172  0.0395  220  SER A C   
1684 O O   . SER A 220 ? 0.7494 0.5132 0.5925 0.0035  0.0179  0.0438  220  SER A O   
1685 C CB  . SER A 220 ? 0.9494 0.6766 0.7711 0.0196  0.0175  0.0405  220  SER A CB  
1686 O OG  . SER A 220 ? 0.9712 0.7136 0.8018 0.0318  0.0165  0.0394  220  SER A OG  
1687 N N   . LEU A 221 ? 0.5714 0.3600 0.4342 0.0054  0.0163  0.0365  221  LEU A N   
1688 C CA  . LEU A 221 ? 0.5295 0.3386 0.4039 0.0053  0.0159  0.0379  221  LEU A CA  
1689 C C   . LEU A 221 ? 0.5933 0.4157 0.4765 -0.0052 0.0165  0.0371  221  LEU A C   
1690 O O   . LEU A 221 ? 0.5486 0.3878 0.4411 -0.0054 0.0163  0.0376  221  LEU A O   
1691 C CB  . LEU A 221 ? 0.5571 0.3819 0.4421 0.0146  0.0141  0.0359  221  LEU A CB  
1692 C CG  . LEU A 221 ? 0.6434 0.4592 0.5220 0.0260  0.0134  0.0363  221  LEU A CG  
1693 C CD1 . LEU A 221 ? 0.5509 0.3855 0.4422 0.0330  0.0116  0.0342  221  LEU A CD1 
1694 C CD2 . LEU A 221 ? 0.5314 0.3365 0.3995 0.0309  0.0134  0.0409  221  LEU A CD2 
1695 N N   . PHE A 222 ? 0.5521 0.3671 0.4319 -0.0135 0.0171  0.0357  222  PHE A N   
1696 C CA  . PHE A 222 ? 0.6049 0.4334 0.4929 -0.0235 0.0176  0.0353  222  PHE A CA  
1697 C C   . PHE A 222 ? 0.6284 0.4435 0.5080 -0.0341 0.0180  0.0353  222  PHE A C   
1698 O O   . PHE A 222 ? 0.5550 0.3496 0.4227 -0.0330 0.0177  0.0344  222  PHE A O   
1699 C CB  . PHE A 222 ? 0.5420 0.3891 0.4439 -0.0214 0.0163  0.0316  222  PHE A CB  
1700 C CG  . PHE A 222 ? 0.5442 0.3851 0.4444 -0.0200 0.0153  0.0279  222  PHE A CG  
1701 C CD1 . PHE A 222 ? 0.5127 0.3460 0.4091 -0.0102 0.0148  0.0266  222  PHE A CD1 
1702 C CD2 . PHE A 222 ? 0.5376 0.3817 0.4402 -0.0281 0.0150  0.0257  222  PHE A CD2 
1703 C CE1 . PHE A 222 ? 0.5414 0.3699 0.4357 -0.0082 0.0144  0.0231  222  PHE A CE1 
1704 C CE2 . PHE A 222 ? 0.5645 0.4030 0.4645 -0.0266 0.0141  0.0220  222  PHE A CE2 
1705 C CZ  . PHE A 222 ? 0.5708 0.4013 0.4665 -0.0164 0.0140  0.0206  222  PHE A CZ  
1706 N N   . HIS A 223 ? 0.6399 0.4665 0.5253 -0.0443 0.0187  0.0363  223  HIS A N   
1707 C CA  . HIS A 223 ? 0.6300 0.4448 0.5072 -0.0563 0.0188  0.0371  223  HIS A CA  
1708 C C   . HIS A 223 ? 0.6760 0.5030 0.5612 -0.0637 0.0174  0.0339  223  HIS A C   
1709 O O   . HIS A 223 ? 0.7271 0.5420 0.6046 -0.0720 0.0164  0.0326  223  HIS A O   
1710 C CB  . HIS A 223 ? 0.5657 0.3808 0.4396 -0.0639 0.0208  0.0426  223  HIS A CB  
1711 C CG  . HIS A 223 ? 0.6490 0.4554 0.5161 -0.0558 0.0220  0.0460  223  HIS A CG  
1712 N ND1 . HIS A 223 ? 0.6584 0.4388 0.5094 -0.0543 0.0221  0.0480  223  HIS A ND1 
1713 C CD2 . HIS A 223 ? 0.4691 0.2887 0.3425 -0.0479 0.0227  0.0474  223  HIS A CD2 
1714 C CE1 . HIS A 223 ? 0.6388 0.4184 0.4872 -0.0459 0.0229  0.0510  223  HIS A CE1 
1715 N NE2 . HIS A 223 ? 0.7076 0.5108 0.5694 -0.0422 0.0232  0.0505  223  HIS A NE2 
1716 N N   . ARG A 224 ? 0.5758 0.4259 0.4756 -0.0605 0.0172  0.0326  224  ARG A N   
1717 C CA  . ARG A 224 ? 0.6019 0.4667 0.5105 -0.0665 0.0159  0.0303  224  ARG A CA  
1718 C C   . ARG A 224 ? 0.5628 0.4431 0.4831 -0.0572 0.0151  0.0275  224  ARG A C   
1719 O O   . ARG A 224 ? 0.5589 0.4425 0.4822 -0.0484 0.0157  0.0282  224  ARG A O   
1720 C CB  . ARG A 224 ? 0.6331 0.5144 0.5484 -0.0757 0.0172  0.0338  224  ARG A CB  
1721 C CG  . ARG A 224 ? 0.7646 0.6343 0.6705 -0.0886 0.0173  0.0362  224  ARG A CG  
1722 C CD  . ARG A 224 ? 0.7306 0.6186 0.6434 -0.0971 0.0192  0.0408  224  ARG A CD  
1723 N NE  . ARG A 224 ? 0.7959 0.6848 0.7076 -0.0920 0.0220  0.0447  224  ARG A NE  
1724 C CZ  . ARG A 224 ? 0.8676 0.7375 0.7667 -0.0938 0.0233  0.0480  224  ARG A CZ  
1725 N NH1 . ARG A 224 ? 0.8818 0.7283 0.7679 -0.1003 0.0220  0.0477  224  ARG A NH1 
1726 N NH2 . ARG A 224 ? 0.9198 0.7929 0.8184 -0.0885 0.0257  0.0515  224  ARG A NH2 
1727 N N   . ALA A 225 ? 0.5038 0.3937 0.4302 -0.0597 0.0136  0.0248  225  ALA A N   
1728 C CA  . ALA A 225 ? 0.4998 0.4014 0.4356 -0.0516 0.0126  0.0224  225  ALA A CA  
1729 C C   . ALA A 225 ? 0.5128 0.4332 0.4589 -0.0557 0.0116  0.0217  225  ALA A C   
1730 O O   . ALA A 225 ? 0.4979 0.4191 0.4422 -0.0644 0.0105  0.0212  225  ALA A O   
1731 C CB  . ALA A 225 ? 0.5257 0.4140 0.4550 -0.0462 0.0117  0.0192  225  ALA A CB  
1732 N N   . VAL A 226 ? 0.4105 0.3453 0.3667 -0.0492 0.0115  0.0216  226  VAL A N   
1733 C CA  . VAL A 226 ? 0.4195 0.3716 0.3853 -0.0506 0.0105  0.0211  226  VAL A CA  
1734 C C   . VAL A 226 ? 0.4723 0.4269 0.4424 -0.0433 0.0092  0.0189  226  VAL A C   
1735 O O   . VAL A 226 ? 0.4931 0.4479 0.4659 -0.0358 0.0095  0.0190  226  VAL A O   
1736 C CB  . VAL A 226 ? 0.4215 0.3897 0.3955 -0.0497 0.0118  0.0237  226  VAL A CB  
1737 C CG1 . VAL A 226 ? 0.4372 0.4229 0.4207 -0.0498 0.0106  0.0234  226  VAL A CG1 
1738 C CG2 . VAL A 226 ? 0.4297 0.3978 0.4001 -0.0575 0.0135  0.0267  226  VAL A CG2 
1739 N N   . LEU A 227 ? 0.4473 0.4044 0.4178 -0.0458 0.0076  0.0170  227  LEU A N   
1740 C CA  . LEU A 227 ? 0.4897 0.4496 0.4638 -0.0396 0.0067  0.0154  227  LEU A CA  
1741 C C   . LEU A 227 ? 0.4681 0.4447 0.4512 -0.0401 0.0054  0.0160  227  LEU A C   
1742 O O   . LEU A 227 ? 0.4230 0.4043 0.4056 -0.0456 0.0041  0.0154  227  LEU A O   
1743 C CB  . LEU A 227 ? 0.4670 0.4145 0.4327 -0.0396 0.0061  0.0127  227  LEU A CB  
1744 C CG  . LEU A 227 ? 0.4865 0.4164 0.4426 -0.0361 0.0073  0.0119  227  LEU A CG  
1745 C CD1 . LEU A 227 ? 0.4190 0.3371 0.3662 -0.0430 0.0077  0.0124  227  LEU A CD1 
1746 C CD2 . LEU A 227 ? 0.4452 0.3667 0.3951 -0.0323 0.0071  0.0091  227  LEU A CD2 
1747 N N   . GLN A 228 ? 0.4115 0.3964 0.4019 -0.0343 0.0056  0.0173  228  GLN A N   
1748 C CA  . GLN A 228 ? 0.3838 0.3831 0.3821 -0.0330 0.0046  0.0182  228  GLN A CA  
1749 C C   . GLN A 228 ? 0.4136 0.4128 0.4137 -0.0285 0.0034  0.0175  228  GLN A C   
1750 O O   . GLN A 228 ? 0.4487 0.4436 0.4497 -0.0232 0.0037  0.0176  228  GLN A O   
1751 C CB  . GLN A 228 ? 0.3215 0.3281 0.3252 -0.0290 0.0055  0.0200  228  GLN A CB  
1752 C CG  . GLN A 228 ? 0.3677 0.3755 0.3696 -0.0328 0.0073  0.0213  228  GLN A CG  
1753 C CD  . GLN A 228 ? 0.3875 0.4013 0.3930 -0.0276 0.0086  0.0226  228  GLN A CD  
1754 O OE1 . GLN A 228 ? 0.4132 0.4252 0.4160 -0.0287 0.0104  0.0236  228  GLN A OE1 
1755 N NE2 . GLN A 228 ? 0.3369 0.3566 0.3474 -0.0217 0.0077  0.0225  228  GLN A NE2 
1756 N N   . SER A 229 ? 0.4146 0.4191 0.4149 -0.0310 0.0020  0.0171  229  SER A N   
1757 C CA  . SER A 229 ? 0.2878 0.2942 0.2899 -0.0272 0.0011  0.0172  229  SER A CA  
1758 C C   . SER A 229 ? 0.3743 0.3704 0.3726 -0.0236 0.0020  0.0161  229  SER A C   
1759 O O   . SER A 229 ? 0.3408 0.3384 0.3428 -0.0191 0.0019  0.0173  229  SER A O   
1760 C CB  . SER A 229 ? 0.3321 0.3471 0.3415 -0.0224 0.0006  0.0194  229  SER A CB  
1761 O OG  . SER A 229 ? 0.3805 0.4071 0.3941 -0.0240 0.0000  0.0208  229  SER A OG  
1762 N N   . GLY A 230 ? 0.3224 0.3082 0.3131 -0.0257 0.0028  0.0141  230  GLY A N   
1763 C CA  . GLY A 230 ? 0.4366 0.4139 0.4234 -0.0213 0.0038  0.0131  230  GLY A CA  
1764 C C   . GLY A 230 ? 0.4493 0.4136 0.4260 -0.0234 0.0047  0.0108  230  GLY A C   
1765 O O   . GLY A 230 ? 0.4582 0.4184 0.4316 -0.0283 0.0046  0.0104  230  GLY A O   
1766 N N   . THR A 231 ? 0.4159 0.3734 0.3875 -0.0193 0.0057  0.0094  231  THR A N   
1767 C CA  . THR A 231 ? 0.5098 0.4527 0.4697 -0.0200 0.0064  0.0068  231  THR A CA  
1768 C C   . THR A 231 ? 0.4256 0.3636 0.3828 -0.0122 0.0082  0.0065  231  THR A C   
1769 O O   . THR A 231 ? 0.4461 0.3935 0.4098 -0.0080 0.0086  0.0079  231  THR A O   
1770 C CB  . THR A 231 ? 0.5296 0.4703 0.4824 -0.0245 0.0054  0.0041  231  THR A CB  
1771 O OG1 . THR A 231 ? 0.4728 0.4218 0.4286 -0.0206 0.0056  0.0043  231  THR A OG1 
1772 C CG2 . THR A 231 ? 0.4440 0.3921 0.3999 -0.0326 0.0033  0.0046  231  THR A CG2 
1773 N N   . PRO A 232 ? 0.4585 0.3817 0.4056 -0.0101 0.0093  0.0048  232  PRO A N   
1774 C CA  . PRO A 232 ? 0.4054 0.3256 0.3499 -0.0015 0.0111  0.0047  232  PRO A CA  
1775 C C   . PRO A 232 ? 0.5049 0.4252 0.4441 0.0011  0.0120  0.0024  232  PRO A C   
1776 O O   . PRO A 232 ? 0.4904 0.4176 0.4327 0.0078  0.0136  0.0034  232  PRO A O   
1777 C CB  . PRO A 232 ? 0.3751 0.2781 0.3092 0.0003  0.0119  0.0038  232  PRO A CB  
1778 C CG  . PRO A 232 ? 0.4530 0.3460 0.3795 -0.0086 0.0106  0.0020  232  PRO A CG  
1779 C CD  . PRO A 232 ? 0.4554 0.3641 0.3928 -0.0153 0.0089  0.0035  232  PRO A CD  
1780 N N   . ASN A 233 ? 0.4681 0.3820 0.3993 -0.0045 0.0110  -0.0004 233  ASN A N   
1781 C CA  . ASN A 233 ? 0.4816 0.3963 0.4070 -0.0026 0.0115  -0.0028 233  ASN A CA  
1782 C C   . ASN A 233 ? 0.5157 0.4493 0.4528 -0.0040 0.0108  -0.0002 233  ASN A C   
1783 O O   . ASN A 233 ? 0.5025 0.4459 0.4506 -0.0066 0.0096  0.0028  233  ASN A O   
1784 C CB  . ASN A 233 ? 0.4619 0.3634 0.3743 -0.0092 0.0099  -0.0069 233  ASN A CB  
1785 C CG  . ASN A 233 ? 0.5557 0.4616 0.4730 -0.0194 0.0071  -0.0059 233  ASN A CG  
1786 O OD1 . ASN A 233 ? 0.5444 0.4491 0.4659 -0.0218 0.0069  -0.0039 233  ASN A OD1 
1787 N ND2 . ASN A 233 ? 0.4834 0.3959 0.4003 -0.0251 0.0050  -0.0071 233  ASN A ND2 
1788 N N   . GLY A 234 ? 0.4823 0.4201 0.4161 -0.0019 0.0115  -0.0013 234  GLY A N   
1789 C CA  . GLY A 234 ? 0.4434 0.3976 0.3868 -0.0032 0.0108  0.0017  234  GLY A CA  
1790 C C   . GLY A 234 ? 0.4715 0.4364 0.4218 0.0034  0.0131  0.0048  234  GLY A C   
1791 O O   . GLY A 234 ? 0.4984 0.4600 0.4470 0.0096  0.0153  0.0048  234  GLY A O   
1792 N N   . PRO A 235 ? 0.4887 0.4667 0.4468 0.0020  0.0125  0.0080  235  PRO A N   
1793 C CA  . PRO A 235 ? 0.4341 0.4216 0.3960 0.0074  0.0150  0.0109  235  PRO A CA  
1794 C C   . PRO A 235 ? 0.4393 0.4346 0.4131 0.0091  0.0153  0.0150  235  PRO A C   
1795 O O   . PRO A 235 ? 0.4877 0.4920 0.4653 0.0129  0.0173  0.0177  235  PRO A O   
1796 C CB  . PRO A 235 ? 0.4775 0.4743 0.4409 0.0045  0.0141  0.0127  235  PRO A CB  
1797 C CG  . PRO A 235 ? 0.4446 0.4412 0.4116 -0.0018 0.0107  0.0129  235  PRO A CG  
1798 C CD  . PRO A 235 ? 0.4064 0.3908 0.3684 -0.0039 0.0098  0.0092  235  PRO A CD  
1799 N N   . TRP A 236 ? 0.4161 0.4086 0.3952 0.0063  0.0133  0.0154  236  TRP A N   
1800 C CA  . TRP A 236 ? 0.4551 0.4548 0.4447 0.0071  0.0128  0.0191  236  TRP A CA  
1801 C C   . TRP A 236 ? 0.4339 0.4281 0.4241 0.0096  0.0128  0.0184  236  TRP A C   
1802 O O   . TRP A 236 ? 0.4247 0.4254 0.4220 0.0115  0.0127  0.0210  236  TRP A O   
1803 C CB  . TRP A 236 ? 0.4195 0.4235 0.4165 0.0022  0.0101  0.0215  236  TRP A CB  
1804 C CG  . TRP A 236 ? 0.4423 0.4396 0.4369 -0.0014 0.0083  0.0192  236  TRP A CG  
1805 C CD1 . TRP A 236 ? 0.4175 0.4139 0.4079 -0.0049 0.0073  0.0177  236  TRP A CD1 
1806 C CD2 . TRP A 236 ? 0.3593 0.3515 0.3555 -0.0022 0.0073  0.0185  236  TRP A CD2 
1807 N NE1 . TRP A 236 ? 0.3626 0.3548 0.3528 -0.0080 0.0059  0.0163  236  TRP A NE1 
1808 C CE2 . TRP A 236 ? 0.3604 0.3495 0.3537 -0.0063 0.0061  0.0167  236  TRP A CE2 
1809 C CE3 . TRP A 236 ? 0.3626 0.3535 0.3623 0.0000  0.0072  0.0193  236  TRP A CE3 
1810 C CZ2 . TRP A 236 ? 0.3562 0.3412 0.3501 -0.0081 0.0054  0.0161  236  TRP A CZ2 
1811 C CZ3 . TRP A 236 ? 0.3446 0.3300 0.3439 -0.0015 0.0063  0.0182  236  TRP A CZ3 
1812 C CH2 . TRP A 236 ? 0.3131 0.2958 0.3096 -0.0055 0.0056  0.0168  236  TRP A CH2 
1813 N N   . ALA A 237 ? 0.3806 0.3631 0.3633 0.0092  0.0126  0.0152  237  ALA A N   
1814 C CA  . ALA A 237 ? 0.4297 0.4060 0.4124 0.0109  0.0122  0.0149  237  ALA A CA  
1815 C C   . ALA A 237 ? 0.3764 0.3508 0.3557 0.0182  0.0143  0.0148  237  ALA A C   
1816 O O   . ALA A 237 ? 0.3923 0.3642 0.3729 0.0203  0.0138  0.0154  237  ALA A O   
1817 C CB  . ALA A 237 ? 0.3156 0.2796 0.2912 0.0070  0.0113  0.0122  237  ALA A CB  
1818 N N   . THR A 238 ? 0.3801 0.3556 0.3543 0.0226  0.0167  0.0139  238  THR A N   
1819 C CA  . THR A 238 ? 0.3602 0.3360 0.3316 0.0311  0.0190  0.0141  238  THR A CA  
1820 C C   . THR A 238 ? 0.4263 0.4151 0.4004 0.0352  0.0215  0.0158  238  THR A C   
1821 O O   . THR A 238 ? 0.3944 0.3876 0.3686 0.0318  0.0218  0.0159  238  THR A O   
1822 C CB  . THR A 238 ? 0.4185 0.3766 0.3752 0.0353  0.0204  0.0101  238  THR A CB  
1823 O OG1 . THR A 238 ? 0.4588 0.4110 0.4065 0.0337  0.0213  0.0070  238  THR A OG1 
1824 C CG2 . THR A 238 ? 0.4663 0.4111 0.4193 0.0314  0.0184  0.0090  238  THR A CG2 
1825 N N   . VAL A 239 ? 0.3905 0.3870 0.3672 0.0426  0.0234  0.0176  239  VAL A N   
1826 C CA  . VAL A 239 ? 0.3948 0.4042 0.3728 0.0476  0.0266  0.0193  239  VAL A CA  
1827 C C   . VAL A 239 ? 0.4646 0.4683 0.4334 0.0584  0.0296  0.0174  239  VAL A C   
1828 O O   . VAL A 239 ? 0.5013 0.4957 0.4670 0.0615  0.0287  0.0165  239  VAL A O   
1829 C CB  . VAL A 239 ? 0.4386 0.4687 0.4317 0.0461  0.0262  0.0249  239  VAL A CB  
1830 C CG1 . VAL A 239 ? 0.3517 0.3870 0.3519 0.0368  0.0240  0.0271  239  VAL A CG1 
1831 C CG2 . VAL A 239 ? 0.3697 0.4022 0.3691 0.0476  0.0241  0.0266  239  VAL A CG2 
1832 N N   . SER A 240 ? 0.4175 0.4262 0.3810 0.0648  0.0333  0.0168  240  SER A N   
1833 C CA  . SER A 240 ? 0.5036 0.5089 0.4584 0.0770  0.0367  0.0153  240  SER A CA  
1834 C C   . SER A 240 ? 0.4656 0.4878 0.4320 0.0823  0.0370  0.0199  240  SER A C   
1835 O O   . SER A 240 ? 0.4633 0.5019 0.4444 0.0762  0.0351  0.0243  240  SER A O   
1836 C CB  . SER A 240 ? 0.4256 0.4361 0.3733 0.0829  0.0409  0.0141  240  SER A CB  
1837 O OG  . SER A 240 ? 0.4926 0.5278 0.4537 0.0814  0.0423  0.0194  240  SER A OG  
1838 N N   . ALA A 241 ? 0.5183 0.5368 0.4778 0.0940  0.0394  0.0190  241  ALA A N   
1839 C CA  . ALA A 241 ? 0.4618 0.4986 0.4320 0.1003  0.0398  0.0235  241  ALA A CA  
1840 C C   . ALA A 241 ? 0.4804 0.5446 0.4628 0.1004  0.0422  0.0282  241  ALA A C   
1841 O O   . ALA A 241 ? 0.4816 0.5655 0.4789 0.0974  0.0406  0.0332  241  ALA A O   
1842 C CB  . ALA A 241 ? 0.4849 0.5123 0.4437 0.1148  0.0423  0.0217  241  ALA A CB  
1843 N N   . GLY A 242 ? 0.4784 0.5437 0.4538 0.1032  0.0460  0.0266  242  GLY A N   
1844 C CA  . GLY A 242 ? 0.4441 0.5350 0.4292 0.1037  0.0491  0.0313  242  GLY A CA  
1845 C C   . GLY A 242 ? 0.4907 0.5936 0.4902 0.0898  0.0459  0.0356  242  GLY A C   
1846 O O   . GLY A 242 ? 0.4666 0.5925 0.4802 0.0875  0.0459  0.0414  242  GLY A O   
1847 N N   . GLU A 243 ? 0.4229 0.5098 0.4184 0.0804  0.0428  0.0329  243  GLU A N   
1848 C CA  . GLU A 243 ? 0.4320 0.5263 0.4387 0.0680  0.0396  0.0364  243  GLU A CA  
1849 C C   . GLU A 243 ? 0.3609 0.4608 0.3797 0.0630  0.0353  0.0394  243  GLU A C   
1850 O O   . GLU A 243 ? 0.4268 0.5429 0.4582 0.0566  0.0339  0.0444  243  GLU A O   
1851 C CB  . GLU A 243 ? 0.4708 0.5470 0.4693 0.0609  0.0376  0.0326  243  GLU A CB  
1852 C CG  . GLU A 243 ? 0.4591 0.5395 0.4670 0.0492  0.0342  0.0358  243  GLU A CG  
1853 C CD  . GLU A 243 ? 0.5110 0.6108 0.5266 0.0466  0.0364  0.0414  243  GLU A CD  
1854 O OE1 . GLU A 243 ? 0.4644 0.5677 0.4875 0.0375  0.0337  0.0447  243  GLU A OE1 
1855 O OE2 . GLU A 243 ? 0.5055 0.6168 0.5191 0.0539  0.0409  0.0426  243  GLU A OE2 
1856 N N   . ALA A 244 ? 0.3650 0.4514 0.3792 0.0661  0.0333  0.0364  244  ALA A N   
1857 C CA  . ALA A 244 ? 0.3300 0.4216 0.3540 0.0628  0.0293  0.0387  244  ALA A CA  
1858 C C   . ALA A 244 ? 0.4249 0.5415 0.4603 0.0668  0.0304  0.0440  244  ALA A C   
1859 O O   . ALA A 244 ? 0.4264 0.5558 0.4740 0.0595  0.0271  0.0479  244  ALA A O   
1860 C CB  . ALA A 244 ? 0.3451 0.4183 0.3607 0.0668  0.0276  0.0350  244  ALA A CB  
1861 N N   . ARG A 245 ? 0.3414 0.4654 0.3727 0.0782  0.0348  0.0441  245  ARG A N   
1862 C CA  . ARG A 245 ? 0.4284 0.5790 0.4709 0.0831  0.0363  0.0494  245  ARG A CA  
1863 C C   . ARG A 245 ? 0.4042 0.5749 0.4587 0.0740  0.0366  0.0547  245  ARG A C   
1864 O O   . ARG A 245 ? 0.3663 0.5545 0.4341 0.0678  0.0338  0.0595  245  ARG A O   
1865 C CB  . ARG A 245 ? 0.4131 0.5682 0.4477 0.0986  0.0419  0.0484  245  ARG A CB  
1866 C CG  . ARG A 245 ? 0.4546 0.6417 0.5019 0.1045  0.0442  0.0545  245  ARG A CG  
1867 C CD  . ARG A 245 ? 0.4193 0.6084 0.4580 0.1224  0.0489  0.0531  245  ARG A CD  
1868 N NE  . ARG A 245 ? 0.4553 0.6297 0.4883 0.1285  0.0460  0.0507  245  ARG A NE  
1869 C CZ  . ARG A 245 ? 0.4834 0.6731 0.5268 0.1302  0.0430  0.0545  245  ARG A CZ  
1870 N NH1 . ARG A 245 ? 0.4589 0.6798 0.5195 0.1257  0.0424  0.0607  245  ARG A NH1 
1871 N NH2 . ARG A 245 ? 0.4341 0.6083 0.4705 0.1359  0.0405  0.0522  245  ARG A NH2 
1872 N N   . ARG A 246 ? 0.3255 0.4922 0.3741 0.0724  0.0397  0.0537  246  ARG A N   
1873 C CA  . ARG A 246 ? 0.4361 0.6186 0.4935 0.0637  0.0404  0.0589  246  ARG A CA  
1874 C C   . ARG A 246 ? 0.4587 0.6398 0.5257 0.0494  0.0346  0.0614  246  ARG A C   
1875 O O   . ARG A 246 ? 0.3885 0.5888 0.4677 0.0428  0.0336  0.0673  246  ARG A O   
1876 C CB  . ARG A 246 ? 0.3848 0.5570 0.4312 0.0643  0.0438  0.0562  246  ARG A CB  
1877 C CG  . ARG A 246 ? 0.4081 0.5959 0.4608 0.0574  0.0457  0.0617  246  ARG A CG  
1878 C CD  . ARG A 246 ? 0.5648 0.7352 0.6086 0.0516  0.0449  0.0589  246  ARG A CD  
1879 N NE  . ARG A 246 ? 0.6598 0.8389 0.7138 0.0398  0.0425  0.0647  246  ARG A NE  
1880 C CZ  . ARG A 246 ? 0.5114 0.6771 0.5659 0.0304  0.0380  0.0642  246  ARG A CZ  
1881 N NH1 . ARG A 246 ? 0.4603 0.6043 0.5060 0.0307  0.0355  0.0582  246  ARG A NH1 
1882 N NH2 . ARG A 246 ? 0.6768 0.8512 0.7402 0.0206  0.0362  0.0701  246  ARG A NH2 
1883 N N   . ARG A 247 ? 0.3572 0.5157 0.4180 0.0449  0.0309  0.0570  247  ARG A N   
1884 C CA  . ARG A 247 ? 0.3506 0.5043 0.4180 0.0332  0.0254  0.0584  247  ARG A CA  
1885 C C   . ARG A 247 ? 0.3361 0.5001 0.4133 0.0311  0.0214  0.0607  247  ARG A C   
1886 O O   . ARG A 247 ? 0.3949 0.5666 0.4812 0.0215  0.0181  0.0645  247  ARG A O   
1887 C CB  . ARG A 247 ? 0.3087 0.4372 0.3668 0.0308  0.0228  0.0528  247  ARG A CB  
1888 C CG  . ARG A 247 ? 0.3654 0.4849 0.4156 0.0295  0.0251  0.0512  247  ARG A CG  
1889 C CD  . ARG A 247 ? 0.3452 0.4427 0.3869 0.0276  0.0227  0.0460  247  ARG A CD  
1890 N NE  . ARG A 247 ? 0.3212 0.4111 0.3543 0.0279  0.0249  0.0439  247  ARG A NE  
1891 C CZ  . ARG A 247 ? 0.4529 0.5272 0.4798 0.0243  0.0229  0.0405  247  ARG A CZ  
1892 N NH1 . ARG A 247 ? 0.4115 0.4763 0.4401 0.0206  0.0191  0.0389  247  ARG A NH1 
1893 N NH2 . ARG A 247 ? 0.4096 0.4790 0.4288 0.0245  0.0246  0.0387  247  ARG A NH2 
1894 N N   . ALA A 248 ? 0.3240 0.4871 0.3987 0.0399  0.0216  0.0585  248  ALA A N   
1895 C CA  . ALA A 248 ? 0.3741 0.5479 0.4575 0.0386  0.0175  0.0606  248  ALA A CA  
1896 C C   . ALA A 248 ? 0.3731 0.5757 0.4693 0.0368  0.0185  0.0672  248  ALA A C   
1897 O O   . ALA A 248 ? 0.3558 0.5692 0.4621 0.0285  0.0140  0.0705  248  ALA A O   
1898 C CB  . ALA A 248 ? 0.3520 0.5195 0.4291 0.0497  0.0179  0.0575  248  ALA A CB  
1899 N N   . THR A 249 ? 0.3402 0.5558 0.4359 0.0440  0.0243  0.0691  249  THR A N   
1900 C CA  . THR A 249 ? 0.2936 0.5400 0.4024 0.0429  0.0257  0.0760  249  THR A CA  
1901 C C   . THR A 249 ? 0.2922 0.5467 0.4084 0.0295  0.0248  0.0809  249  THR A C   
1902 O O   . THR A 249 ? 0.3464 0.6213 0.4752 0.0220  0.0224  0.0866  249  THR A O   
1903 C CB  . THR A 249 ? 0.5404 0.8039 0.6479 0.0580  0.0321  0.0772  249  THR A CB  
1904 O OG1 . THR A 249 ? 0.4987 0.7867 0.6143 0.0559  0.0362  0.0832  249  THR A OG1 
1905 C CG2 . THR A 249 ? 0.3370 0.5786 0.4280 0.0695  0.0360  0.0707  249  THR A CG2 
1906 N N   . LEU A 250 ? 0.3552 0.5926 0.4634 0.0257  0.0261  0.0789  250  LEU A N   
1907 C CA  . LEU A 250 ? 0.3269 0.5665 0.4403 0.0125  0.0244  0.0833  250  LEU A CA  
1908 C C   . LEU A 250 ? 0.3486 0.5812 0.4674 0.0016  0.0170  0.0835  250  LEU A C   
1909 O O   . LEU A 250 ? 0.3851 0.6310 0.5137 -0.0086 0.0144  0.0890  250  LEU A O   
1910 C CB  . LEU A 250 ? 0.3616 0.5818 0.4643 0.0113  0.0264  0.0805  250  LEU A CB  
1911 C CG  . LEU A 250 ? 0.3408 0.5598 0.4465 -0.0012 0.0248  0.0851  250  LEU A CG  
1912 C CD1 . LEU A 250 ? 0.3514 0.5981 0.4685 -0.0061 0.0270  0.0935  250  LEU A CD1 
1913 C CD2 . LEU A 250 ? 0.3543 0.5581 0.4490 0.0003  0.0275  0.0828  250  LEU A CD2 
1914 N N   . LEU A 251 ? 0.3603 0.5716 0.4720 0.0035  0.0136  0.0774  251  LEU A N   
1915 C CA  . LEU A 251 ? 0.3722 0.5752 0.4870 -0.0058 0.0068  0.0768  251  LEU A CA  
1916 C C   . LEU A 251 ? 0.3697 0.5947 0.4962 -0.0086 0.0037  0.0809  251  LEU A C   
1917 O O   . LEU A 251 ? 0.3132 0.5426 0.4464 -0.0204 -0.0010 0.0842  251  LEU A O   
1918 C CB  . LEU A 251 ? 0.4535 0.6334 0.5590 -0.0018 0.0043  0.0700  251  LEU A CB  
1919 C CG  . LEU A 251 ? 0.5133 0.6874 0.6221 -0.0109 -0.0026 0.0697  251  LEU A CG  
1920 C CD1 . LEU A 251 ? 0.4337 0.5883 0.5373 -0.0187 -0.0047 0.0683  251  LEU A CD1 
1921 C CD2 . LEU A 251 ? 0.5761 0.7426 0.6811 -0.0051 -0.0052 0.0654  251  LEU A CD2 
1922 N N   . ALA A 252 ? 0.3092 0.5476 0.4375 0.0022  0.0059  0.0806  252  ALA A N   
1923 C CA  . ALA A 252 ? 0.3525 0.6158 0.4927 0.0005  0.0032  0.0850  252  ALA A CA  
1924 C C   . ALA A 252 ? 0.3799 0.6653 0.5315 -0.0100 0.0036  0.0926  252  ALA A C   
1925 O O   . ALA A 252 ? 0.3896 0.6838 0.5497 -0.0210 -0.0021 0.0957  252  ALA A O   
1926 C CB  . ALA A 252 ? 0.3282 0.6052 0.4686 0.0153  0.0068  0.0847  252  ALA A CB  
1927 N N   . ARG A 253 ? 0.3485 0.6417 0.4996 -0.0074 0.0099  0.0954  253  ARG A N   
1928 C CA  A ARG A 253 ? 0.4040 0.7180 0.5652 -0.0175 0.0110  0.1033  253  ARG A CA  
1929 C CA  B ARG A 253 ? 0.3978 0.7123 0.5593 -0.0176 0.0108  0.1033  253  ARG A CA  
1930 C C   . ARG A 253 ? 0.3961 0.6959 0.5579 -0.0340 0.0051  0.1047  253  ARG A C   
1931 O O   . ARG A 253 ? 0.3733 0.6881 0.5452 -0.0457 0.0015  0.1102  253  ARG A O   
1932 C CB  A ARG A 253 ? 0.4276 0.7453 0.5843 -0.0121 0.0188  0.1051  253  ARG A CB  
1933 C CB  B ARG A 253 ? 0.4124 0.7349 0.5711 -0.0117 0.0188  0.1058  253  ARG A CB  
1934 C CG  A ARG A 253 ? 0.4186 0.7644 0.5804 -0.0007 0.0253  0.1085  253  ARG A CG  
1935 C CG  B ARG A 253 ? 0.4079 0.7496 0.5673 0.0040  0.0251  0.1060  253  ARG A CG  
1936 C CD  A ARG A 253 ? 0.5438 0.9029 0.7067 -0.0027 0.0315  0.1141  253  ARG A CD  
1937 C CD  B ARG A 253 ? 0.5068 0.8572 0.6631 0.0079  0.0327  0.1090  253  ARG A CD  
1938 N NE  A ARG A 253 ? 0.5162 0.8561 0.6648 0.0054  0.0365  0.1095  253  ARG A NE  
1939 N NE  B ARG A 253 ? 0.5562 0.9160 0.7077 0.0253  0.0393  0.1069  253  ARG A NE  
1940 C CZ  A ARG A 253 ? 0.5019 0.8286 0.6448 -0.0018 0.0372  0.1104  253  ARG A CZ  
1941 C CZ  B ARG A 253 ? 0.5678 0.9068 0.7044 0.0358  0.0430  0.1006  253  ARG A CZ  
1942 N NH1 A ARG A 253 ? 0.4410 0.7523 0.5708 0.0064  0.0414  0.1059  253  ARG A NH1 
1943 N NH1 B ARG A 253 ? 0.5767 0.9241 0.7083 0.0516  0.0487  0.0988  253  ARG A NH1 
1944 N NH2 A ARG A 253 ? 0.3906 0.7189 0.5400 -0.0171 0.0337  0.1160  253  ARG A NH2 
1945 N NH2 B ARG A 253 ? 0.4186 0.7287 0.5450 0.0305  0.0408  0.0959  253  ARG A NH2 
1946 N N   . LEU A 254 ? 0.3050 0.5752 0.4554 -0.0349 0.0042  0.0996  254  LEU A N   
1947 C CA  . LEU A 254 ? 0.3468 0.6004 0.4955 -0.0487 -0.0009 0.1005  254  LEU A CA  
1948 C C   . LEU A 254 ? 0.3905 0.6428 0.5439 -0.0580 -0.0089 0.1001  254  LEU A C   
1949 O O   . LEU A 254 ? 0.3868 0.6336 0.5421 -0.0713 -0.0132 0.1031  254  LEU A O   
1950 C CB  . LEU A 254 ? 0.2851 0.5086 0.4206 -0.0458 -0.0003 0.0949  254  LEU A CB  
1951 C CG  . LEU A 254 ? 0.3212 0.5458 0.4517 -0.0401 0.0066  0.0961  254  LEU A CG  
1952 C CD1 . LEU A 254 ? 0.2815 0.4790 0.3994 -0.0362 0.0071  0.0903  254  LEU A CD1 
1953 C CD2 . LEU A 254 ? 0.3424 0.5802 0.4788 -0.0499 0.0081  0.1044  254  LEU A CD2 
1954 N N   . VAL A 255 ? 0.4268 0.6831 0.5813 -0.0510 -0.0110 0.0965  255  VAL A N   
1955 C CA  . VAL A 255 ? 0.4049 0.6600 0.5627 -0.0589 -0.0188 0.0955  255  VAL A CA  
1956 C C   . VAL A 255 ? 0.5029 0.7906 0.6741 -0.0599 -0.0201 0.1005  255  VAL A C   
1957 O O   . VAL A 255 ? 0.6037 0.8950 0.7780 -0.0635 -0.0264 0.0994  255  VAL A O   
1958 C CB  . VAL A 255 ? 0.4724 0.7053 0.6203 -0.0518 -0.0216 0.0875  255  VAL A CB  
1959 C CG1 . VAL A 255 ? 0.3577 0.5605 0.4935 -0.0518 -0.0207 0.0830  255  VAL A CG1 
1960 C CG2 . VAL A 255 ? 0.3341 0.5759 0.4811 -0.0362 -0.0176 0.0851  255  VAL A CG2 
1961 N N   . GLY A 256 ? 0.4846 0.7972 0.6636 -0.0565 -0.0143 0.1062  256  GLY A N   
1962 C CA  . GLY A 256 ? 0.5068 0.8541 0.7003 -0.0590 -0.0155 0.1124  256  GLY A CA  
1963 C C   . GLY A 256 ? 0.5933 0.9561 0.7894 -0.0444 -0.0142 0.1105  256  GLY A C   
1964 O O   . GLY A 256 ? 0.6378 1.0214 0.8435 -0.0471 -0.0187 0.1131  256  GLY A O   
1965 N N   . CYS A 257 ? 0.5824 0.9350 0.7695 -0.0289 -0.0082 0.1063  257  CYS A N   
1966 C CA  . CYS A 257 ? 0.4534 0.8167 0.6404 -0.0135 -0.0064 0.1044  257  CYS A CA  
1967 C C   . CYS A 257 ? 0.4987 0.8766 0.6857 -0.0006 0.0026  0.1066  257  CYS A C   
1968 O O   . CYS A 257 ? 0.5690 0.9276 0.7449 0.0056  0.0075  0.1029  257  CYS A O   
1969 C CB  . CYS A 257 ? 0.4093 0.7416 0.5826 -0.0062 -0.0083 0.0962  257  CYS A CB  
1970 S SG  . CYS A 257 ? 0.4367 0.7571 0.6098 -0.0170 -0.0188 0.0933  257  CYS A SG  
1971 N N   . ASN A 265 ? 0.7764 1.1799 0.9183 0.1380  0.0400  0.0950  265  ASN A N   
1972 C CA  . ASN A 265 ? 0.7650 1.1557 0.9028 0.1427  0.0346  0.0926  265  ASN A CA  
1973 C C   . ASN A 265 ? 0.6293 0.9898 0.7617 0.1279  0.0281  0.0881  265  ASN A C   
1974 O O   . ASN A 265 ? 0.5437 0.9123 0.6871 0.1113  0.0229  0.0906  265  ASN A O   
1975 C CB  . ASN A 265 ? 0.7770 1.2046 0.9319 0.1439  0.0309  0.0994  265  ASN A CB  
1976 C CG  . ASN A 265 ? 0.8128 1.2297 0.9635 0.1495  0.0251  0.0976  265  ASN A CG  
1977 O OD1 . ASN A 265 ? 0.7665 1.1849 0.9243 0.1366  0.0176  0.0984  265  ASN A OD1 
1978 N ND2 . ASN A 265 ? 0.8826 1.2882 1.0207 0.1689  0.0286  0.0952  265  ASN A ND2 
1979 N N   . ASP A 266 ? 0.5546 0.8803 0.6697 0.1339  0.0284  0.0817  266  ASP A N   
1980 C CA  . ASP A 266 ? 0.4991 0.7963 0.6082 0.1210  0.0233  0.0773  266  ASP A CA  
1981 C C   . ASP A 266 ? 0.5114 0.8147 0.6285 0.1136  0.0154  0.0790  266  ASP A C   
1982 O O   . ASP A 266 ? 0.4405 0.7349 0.5605 0.0986  0.0106  0.0779  266  ASP A O   
1983 C CB  . ASP A 266 ? 0.5213 0.7819 0.6105 0.1292  0.0254  0.0706  266  ASP A CB  
1984 C CG  . ASP A 266 ? 0.4984 0.7455 0.5775 0.1315  0.0315  0.0673  266  ASP A CG  
1985 O OD1 . ASP A 266 ? 0.5372 0.7997 0.6244 0.1244  0.0336  0.0699  266  ASP A OD1 
1986 O OD2 . ASP A 266 ? 0.5709 0.7914 0.6333 0.1402  0.0341  0.0622  266  ASP A OD2 
1987 N N   . THR A 267 ? 0.4508 0.7689 0.5707 0.1248  0.0142  0.0815  267  THR A N   
1988 C CA  . THR A 267 ? 0.4545 0.7787 0.5804 0.1197  0.0065  0.0830  267  THR A CA  
1989 C C   . THR A 267 ? 0.4079 0.7549 0.5506 0.1023  0.0014  0.0870  267  THR A C   
1990 O O   . THR A 267 ? 0.4876 0.8251 0.6311 0.0904  -0.0052 0.0855  267  THR A O   
1991 C CB  . THR A 267 ? 0.5092 0.8517 0.6369 0.1361  0.0063  0.0863  267  THR A CB  
1992 O OG1 . THR A 267 ? 0.5339 0.8501 0.6438 0.1516  0.0102  0.0823  267  THR A OG1 
1993 C CG2 . THR A 267 ? 0.4435 0.7955 0.5781 0.1301  -0.0021 0.0882  267  THR A CG2 
1994 N N   . GLU A 268 ? 0.3490 0.7258 0.5042 0.1011  0.0044  0.0923  268  GLU A N   
1995 C CA  . GLU A 268 ? 0.4710 0.8713 0.6425 0.0842  0.0001  0.0970  268  GLU A CA  
1996 C C   . GLU A 268 ? 0.4263 0.8047 0.5944 0.0678  -0.0010 0.0942  268  GLU A C   
1997 O O   . GLU A 268 ? 0.4433 0.8197 0.6163 0.0529  -0.0076 0.0945  268  GLU A O   
1998 C CB  . GLU A 268 ? 0.5359 0.9741 0.7207 0.0884  0.0049  0.1039  268  GLU A CB  
1999 C CG  . GLU A 268 ? 0.7894 1.2565 0.9922 0.0711  0.0006  0.1102  268  GLU A CG  
2000 C CD  . GLU A 268 ? 0.9784 1.4858 1.1949 0.0759  0.0061  0.1177  268  GLU A CD  
2001 O OE1 . GLU A 268 ? 1.0203 1.5343 1.2323 0.0945  0.0131  0.1177  268  GLU A OE1 
2002 O OE2 . GLU A 268 ? 0.9740 1.5061 1.2053 0.0611  0.0036  0.1235  268  GLU A OE2 
2003 N N   . LEU A 269 ? 0.3824 0.7442 0.5413 0.0712  0.0053  0.0915  269  LEU A N   
2004 C CA  . LEU A 269 ? 0.4872 0.8267 0.6413 0.0581  0.0047  0.0887  269  LEU A CA  
2005 C C   . LEU A 269 ? 0.4848 0.7961 0.6306 0.0519  -0.0014 0.0834  269  LEU A C   
2006 O O   . LEU A 269 ? 0.4381 0.7441 0.5873 0.0373  -0.0065 0.0834  269  LEU A O   
2007 C CB  . LEU A 269 ? 0.3714 0.6959 0.5146 0.0656  0.0123  0.0859  269  LEU A CB  
2008 C CG  . LEU A 269 ? 0.4570 0.7606 0.5946 0.0547  0.0129  0.0834  269  LEU A CG  
2009 C CD1 . LEU A 269 ? 0.4989 0.8010 0.6299 0.0626  0.0207  0.0828  269  LEU A CD1 
2010 C CD2 . LEU A 269 ? 0.4003 0.6706 0.5258 0.0528  0.0095  0.0769  269  LEU A CD2 
2011 N N   . ILE A 270 ? 0.4338 0.7272 0.5681 0.0633  -0.0008 0.0792  270  ILE A N   
2012 C CA  . ILE A 270 ? 0.4133 0.6804 0.5386 0.0590  -0.0055 0.0743  270  ILE A CA  
2013 C C   . ILE A 270 ? 0.4006 0.6790 0.5339 0.0508  -0.0134 0.0761  270  ILE A C   
2014 O O   . ILE A 270 ? 0.4026 0.6660 0.5337 0.0395  -0.0182 0.0736  270  ILE A O   
2015 C CB  . ILE A 270 ? 0.4108 0.6571 0.5217 0.0730  -0.0028 0.0701  270  ILE A CB  
2016 C CG1 . ILE A 270 ? 0.4139 0.6448 0.5149 0.0789  0.0042  0.0673  270  ILE A CG1 
2017 C CG2 . ILE A 270 ? 0.3356 0.5572 0.4379 0.0680  -0.0075 0.0658  270  ILE A CG2 
2018 C CD1 . ILE A 270 ? 0.5196 0.7346 0.6070 0.0944  0.0077  0.0643  270  ILE A CD1 
2019 N N   . ALA A 271 ? 0.3419 0.6472 0.4844 0.0566  -0.0149 0.0805  271  ALA A N   
2020 C CA  . ALA A 271 ? 0.3571 0.6763 0.5078 0.0484  -0.0230 0.0825  271  ALA A CA  
2021 C C   . ALA A 271 ? 0.3865 0.7118 0.5461 0.0299  -0.0268 0.0844  271  ALA A C   
2022 O O   . ALA A 271 ? 0.4119 0.7295 0.5711 0.0192  -0.0337 0.082