data_2WHR
# 
_entry.id   2WHR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WHR         
PDBE  EBI-39645    
WWPDB D_1290039645 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WHR 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ekstrom, F.'        1 
'Hornberg, A.'       2 
'Artursson, E.'      3 
'Hammarstrom, L.-G.' 4 
'Schneider, G.'      5 
'Pang, Y.-P.'        6 
# 
_citation.id                        primary 
_citation.title                     
;Structure of Hi-6Sarin-Acetylcholinesterase Determined by X-Ray Crystallography and Molecular Dynamics Simulation: Reactivator Mechanism and Design.
;
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            4 
_citation.page_first                E5957 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19536291 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PONE.0005957 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ekstrom, F.'        1 ? 
primary 'Hornberg, A.'       2 ? 
primary 'Artursson, E.'      3 ? 
primary 'Hammarstrom, L.-G.' 4 ? 
primary 'Schneider, G.'      5 ? 
primary 'Pang, Y.-P.'        6 ? 
# 
_cell.entry_id           2WHR 
_cell.length_a           78.320 
_cell.length_b           111.410 
_cell.length_c           226.850 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WHR 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                                                 60233.984 2   3.1.1.7 ? 
'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer syn '4-carbamoyl-1-(3-{4-[(E)-(hydroxyimino)methyl]pyridinium-1-yl}propyl)pyridinium'    286.329   2   ?       ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                             221.208   2   ?       ? ? ? 
4 non-polymer syn 'BROMIDE ION'                                                                        79.904    2   ?       ? ? ? 
5 non-polymer syn '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE'                                                  162.227   3   ?       ? ? ? 
6 non-polymer syn 'CARBONATE ION'                                                                      60.009    2   ?       ? ? ? 
7 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                              106.120   1   ?       ? ? ? 
8 non-polymer syn '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 354.436   1   ?       ? ? ? 
9 water       nat water                                                                                18.015    660 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HUMAN EMBRYONIC KIDNEY (HEK) 293 CELLS' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCDNA3.1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2WHR A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2WHR B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2WHR ALA A 544 ? UNP P21836 ? ? 'expression tag' 544 1  
1 2WHR THR A 545 ? UNP P21836 ? ? 'expression tag' 545 2  
1 2WHR GLU A 546 ? UNP P21836 ? ? 'expression tag' 546 3  
1 2WHR ALA A 547 ? UNP P21836 ? ? 'expression tag' 547 4  
1 2WHR PRO A 548 ? UNP P21836 ? ? 'expression tag' 548 5  
2 2WHR ALA B 544 ? UNP P21836 ? ? 'expression tag' 544 6  
2 2WHR THR B 545 ? UNP P21836 ? ? 'expression tag' 545 7  
2 2WHR GLU B 546 ? UNP P21836 ? ? 'expression tag' 546 8  
2 2WHR ALA B 547 ? UNP P21836 ? ? 'expression tag' 547 9  
2 2WHR PRO B 548 ? UNP P21836 ? ? 'expression tag' 548 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                              ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                                             ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                           ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                      ? 
'C4 H7 N O4'      133.103 
BR  non-polymer                  . 'BROMIDE ION'                                                                        ? 'Br -1' 
79.904  
CO3 non-polymer                  . 'CARBONATE ION'                                                                      ? 
'C O3 -2'         60.009  
CYS 'L-peptide linking'          y CYSTEINE                                                                             ? 
'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                            ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                      ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                                              ? 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                            ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                                                                                ? 'H2 O' 
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                           ? 
'C6 H13 N O2'     131.173 
K27 non-polymer                  . '4-carbamoyl-1-(3-{4-[(E)-(hydroxyimino)methyl]pyridinium-1-yl}propyl)pyridinium'    ? 
'C15 H18 N4 O2 2' 286.329 
LEU 'L-peptide linking'          y LEUCINE                                                                              ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                                               ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                                           ? 
'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                             
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'     221.208 
P4G non-polymer                  . '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE'                                                  ? 
'C8 H18 O3'       162.227 
PE4 non-polymer                  . '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 
'POLYETHYLENE GLYCOL PEG4000' 'C16 H34 O8'      354.436 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                                                              ? 
'C4 H10 O3'       106.120 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                        ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                                              ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE                                                                               ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking'          y THREONINE                                                                            ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                           ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                             ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                                               ? 
'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2WHR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.1 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '26-30 % (V/V) PEG750MME, 0.1 M HEPES PH 7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-02-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.131 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I711' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I711 
_diffrn_source.pdbx_wavelength             1.131 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WHR 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.80 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   64776 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.10 
_reflns.B_iso_Wilson_estimate        43.21 
_reflns.pdbx_redundancy              7.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.54 
_reflns_shell.d_res_low              2.70 
_reflns_shell.percent_possible_all   87.7 
_reflns_shell.Rmerge_I_obs           0.29 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.20 
_reflns_shell.pdbx_redundancy        5.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WHR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     64699 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.41 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.809 
_refine.ls_d_res_high                            2.545 
_refine.ls_percent_reflns_obs                    98.33 
_refine.ls_R_factor_obs                          0.1708 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1698 
_refine.ls_R_factor_R_free                       0.2192 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1292 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.1488 
_refine.aniso_B[2][2]                            0.2844 
_refine.aniso_B[3][3]                            -0.1355 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.366 
_refine.solvent_model_param_bsol                 70.554 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'RESIDUES 258-264 ARE DISORDERED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.33 
_refine.pdbx_overall_phase_error                 19.00 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8336 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         143 
_refine_hist.number_atoms_solvent             660 
_refine_hist.number_atoms_total               9139 
_refine_hist.d_res_high                       2.545 
_refine_hist.d_res_low                        19.809 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 8748  'X-RAY DIFFRACTION' ? 
f_angle_d          0.921  ? ? 11916 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.349 ? ? 3132  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.063  ? ? 1274  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 1564  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.5449 2.6465  5949 0.2138 85.00  0.2704 . . 137 . . 
'X-RAY DIFFRACTION' . 2.6465 2.7667  7083 0.1923 100.00 0.2661 . . 148 . . 
'X-RAY DIFFRACTION' . 2.7667 2.9121  7105 0.1826 100.00 0.2544 . . 143 . . 
'X-RAY DIFFRACTION' . 2.9121 3.0939  7094 0.1768 100.00 0.2086 . . 157 . . 
'X-RAY DIFFRACTION' . 3.0939 3.3318  7118 0.1679 100.00 0.2344 . . 137 . . 
'X-RAY DIFFRACTION' . 3.3318 3.6652  7128 0.1602 100.00 0.1883 . . 141 . . 
'X-RAY DIFFRACTION' . 3.6652 4.1911  7187 0.1381 100.00 0.2112 . . 139 . . 
'X-RAY DIFFRACTION' . 4.1911 5.2639  7259 0.1378 100.00 0.1669 . . 144 . . 
'X-RAY DIFFRACTION' . 5.2639 19.8099 7484 0.1729 100.00 0.2148 . . 146 . . 
# 
_struct.entry_id                  2WHR 
_struct.title                     'Crystal structure of acetylcholinesterase in complex with K027' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WHR 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE ESTERASE, ALTERNATIVE SPLICING, NEUROTRANSMITTER DEGRADATION, K026, OXIME, SYNAPSE, MEMBRANE, SECRETED, HYDROLASE, CELL MEMBRANE, DISULFIDE BOND, CHOLINESTERASE, GPI-ANCHOR, LIPOPROTEIN, GLYCOPROTEIN, CELL JUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 2 ? 
J N N 4 ? 
K N N 7 ? 
L N N 8 ? 
M N N 5 ? 
N N N 5 ? 
O N N 6 ? 
P N N 9 ? 
Q N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 LEU A 216 ? PHE A 222 ? LEU A 216 PHE A 222 5 ? 7  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 274 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P13 13 PRO A 277 ? TRP A 286 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 14 HIS A 287 ? LEU A 289 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P37 37 SER B 215 ? PHE B 222 ? SER B 215 PHE B 222 5 ? 8  
HELX_P HELX_P38 38 SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P39 39 ASN B 265 ? ARG B 274 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P40 40 PRO B 277 ? TRP B 286 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P41 41 HIS B 287 ? LEU B 289 ? HIS B 287 LEU B 289 5 ? 3  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P50 50 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P51 51 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P52 52 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P53 53 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P54 54 ARG B 534 ? ALA B 542 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf2 disulf ?   ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf3 disulf ?   ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf4 disulf ?   ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf5 disulf ?   ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf6 disulf ?   ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
covale1 covale one ? A ASN 350 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 350 A NAG 1544 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale2 covale one ? A ASN 464 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 464 A NAG 1545 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -3.49 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 8.31  
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -2.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
# 
_database_PDB_matrix.entry_id          2WHR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WHR 
_atom_sites.fract_transf_matrix[1][1]   0.012768 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008976 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004408 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 1   ? 31.347  15.095  54.730  1.00 85.73  ? 1    GLU A N   1 
ATOM   2    C  CA  . GLU A 1 1   ? 29.904  14.897  54.757  1.00 82.96  ? 1    GLU A CA  1 
ATOM   3    C  C   . GLU A 1 1   ? 29.387  14.948  56.191  1.00 68.56  ? 1    GLU A C   1 
ATOM   4    O  O   . GLU A 1 1   ? 30.167  14.992  57.141  1.00 52.98  ? 1    GLU A O   1 
ATOM   5    C  CB  . GLU A 1 1   ? 29.532  13.558  54.115  1.00 72.69  ? 1    GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 1   ? 29.560  12.387  55.082  1.00 43.44  ? 1    GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 1   ? 29.424  11.039  54.392  1.00 57.12  ? 1    GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 1   ? 28.461  10.302  54.703  1.00 44.89  ? 1    GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 1   ? 30.283  10.714  53.543  1.00 60.40  ? 1    GLU A OE2 1 
ATOM   10   N  N   . GLY A 1 2   ? 28.067  14.935  56.340  1.00 66.48  ? 2    GLY A N   1 
ATOM   11   C  CA  . GLY A 1 2   ? 27.447  15.025  57.647  1.00 53.81  ? 2    GLY A CA  1 
ATOM   12   C  C   . GLY A 1 2   ? 26.326  16.038  57.624  1.00 51.48  ? 2    GLY A C   1 
ATOM   13   O  O   . GLY A 1 2   ? 25.226  15.771  58.105  1.00 48.79  ? 2    GLY A O   1 
ATOM   14   N  N   . ARG A 1 3   ? 26.616  17.203  57.050  1.00 64.68  ? 3    ARG A N   1 
ATOM   15   C  CA  . ARG A 1 3   ? 25.630  18.268  56.890  1.00 74.21  ? 3    ARG A CA  1 
ATOM   16   C  C   . ARG A 1 3   ? 25.116  18.366  55.457  1.00 60.04  ? 3    ARG A C   1 
ATOM   17   O  O   . ARG A 1 3   ? 24.391  19.298  55.115  1.00 65.81  ? 3    ARG A O   1 
ATOM   18   C  CB  . ARG A 1 3   ? 26.223  19.619  57.309  1.00 59.14  ? 3    ARG A CB  1 
ATOM   19   C  CG  . ARG A 1 3   ? 25.656  20.183  58.602  1.00 77.39  ? 3    ARG A CG  1 
ATOM   20   C  CD  . ARG A 1 3   ? 26.390  19.664  59.829  1.00 74.89  ? 3    ARG A CD  1 
ATOM   21   N  NE  . ARG A 1 3   ? 25.571  19.673  61.047  1.00 71.73  ? 3    ARG A NE  1 
ATOM   22   C  CZ  . ARG A 1 3   ? 24.266  19.405  61.095  1.00 70.98  ? 3    ARG A CZ  1 
ATOM   23   N  NH1 . ARG A 1 3   ? 23.591  19.095  59.992  1.00 70.49  ? 3    ARG A NH1 1 
ATOM   24   N  NH2 . ARG A 1 3   ? 23.630  19.436  62.261  1.00 49.49  ? 3    ARG A NH2 1 
ATOM   25   N  N   . GLU A 1 4   ? 25.493  17.402  54.624  1.00 52.56  ? 4    GLU A N   1 
ATOM   26   C  CA  . GLU A 1 4   ? 25.178  17.453  53.201  1.00 49.72  ? 4    GLU A CA  1 
ATOM   27   C  C   . GLU A 1 4   ? 23.908  16.693  52.866  1.00 52.18  ? 4    GLU A C   1 
ATOM   28   O  O   . GLU A 1 4   ? 23.351  15.995  53.712  1.00 49.28  ? 4    GLU A O   1 
ATOM   29   C  CB  . GLU A 1 4   ? 26.337  16.884  52.382  1.00 65.47  ? 4    GLU A CB  1 
ATOM   30   C  CG  . GLU A 1 4   ? 27.662  17.563  52.650  1.00 77.15  ? 4    GLU A CG  1 
ATOM   31   C  CD  . GLU A 1 4   ? 28.724  17.186  51.641  1.00 85.33  ? 4    GLU A CD  1 
ATOM   32   O  OE1 . GLU A 1 4   ? 28.981  15.974  51.467  1.00 83.51  ? 4    GLU A OE1 1 
ATOM   33   O  OE2 . GLU A 1 4   ? 29.307  18.108  51.030  1.00 83.01  ? 4    GLU A OE2 1 
ATOM   34   N  N   . ASP A 1 5   ? 23.453  16.834  51.624  1.00 43.23  ? 5    ASP A N   1 
ATOM   35   C  CA  . ASP A 1 5   ? 22.322  16.054  51.151  1.00 38.63  ? 5    ASP A CA  1 
ATOM   36   C  C   . ASP A 1 5   ? 22.737  14.599  51.027  1.00 39.85  ? 5    ASP A C   1 
ATOM   37   O  O   . ASP A 1 5   ? 23.587  14.255  50.208  1.00 49.65  ? 5    ASP A O   1 
ATOM   38   C  CB  . ASP A 1 5   ? 21.806  16.577  49.811  1.00 34.92  ? 5    ASP A CB  1 
ATOM   39   C  CG  . ASP A 1 5   ? 20.569  15.836  49.336  1.00 40.49  ? 5    ASP A CG  1 
ATOM   40   O  OD1 . ASP A 1 5   ? 20.330  14.708  49.810  1.00 41.88  ? 5    ASP A OD1 1 
ATOM   41   O  OD2 . ASP A 1 5   ? 19.835  16.377  48.484  1.00 44.33  ? 5    ASP A OD2 1 
ATOM   42   N  N   . PRO A 1 6   ? 22.136  13.738  51.853  1.00 45.97  ? 6    PRO A N   1 
ATOM   43   C  CA  . PRO A 1 6   ? 22.448  12.309  51.924  1.00 39.37  ? 6    PRO A CA  1 
ATOM   44   C  C   . PRO A 1 6   ? 22.099  11.576  50.634  1.00 48.34  ? 6    PRO A C   1 
ATOM   45   O  O   . PRO A 1 6   ? 22.552  10.451  50.428  1.00 42.07  ? 6    PRO A O   1 
ATOM   46   C  CB  . PRO A 1 6   ? 21.546  11.811  53.060  1.00 43.64  ? 6    PRO A CB  1 
ATOM   47   C  CG  . PRO A 1 6   ? 21.169  13.026  53.826  1.00 51.56  ? 6    PRO A CG  1 
ATOM   48   C  CD  . PRO A 1 6   ? 21.102  14.124  52.826  1.00 45.87  ? 6    PRO A CD  1 
ATOM   49   N  N   . GLN A 1 7   ? 21.297  12.204  49.781  1.00 43.45  ? 7    GLN A N   1 
ATOM   50   C  CA  . GLN A 1 7   ? 20.852  11.564  48.549  1.00 38.46  ? 7    GLN A CA  1 
ATOM   51   C  C   . GLN A 1 7   ? 21.849  11.764  47.407  1.00 47.26  ? 7    GLN A C   1 
ATOM   52   O  O   . GLN A 1 7   ? 21.663  11.223  46.322  1.00 50.26  ? 7    GLN A O   1 
ATOM   53   C  CB  . GLN A 1 7   ? 19.486  12.109  48.132  1.00 48.94  ? 7    GLN A CB  1 
ATOM   54   C  CG  . GLN A 1 7   ? 18.485  12.269  49.274  1.00 59.77  ? 7    GLN A CG  1 
ATOM   55   C  CD  . GLN A 1 7   ? 17.518  11.099  49.401  1.00 71.34  ? 7    GLN A CD  1 
ATOM   56   O  OE1 . GLN A 1 7   ? 17.825  9.968   49.014  1.00 68.54  ? 7    GLN A OE1 1 
ATOM   57   N  NE2 . GLN A 1 7   ? 16.337  11.372  49.946  1.00 57.97  ? 7    GLN A NE2 1 
ATOM   58   N  N   . LEU A 1 8   ? 22.909  12.531  47.652  1.00 41.71  ? 8    LEU A N   1 
ATOM   59   C  CA  . LEU A 1 8   ? 23.842  12.901  46.586  1.00 40.08  ? 8    LEU A CA  1 
ATOM   60   C  C   . LEU A 1 8   ? 25.249  12.358  46.797  1.00 42.28  ? 8    LEU A C   1 
ATOM   61   O  O   . LEU A 1 8   ? 26.177  12.729  46.080  1.00 39.24  ? 8    LEU A O   1 
ATOM   62   C  CB  . LEU A 1 8   ? 23.900  14.424  46.432  1.00 28.18  ? 8    LEU A CB  1 
ATOM   63   C  CG  . LEU A 1 8   ? 22.570  15.092  46.076  1.00 40.81  ? 8    LEU A CG  1 
ATOM   64   C  CD1 . LEU A 1 8   ? 22.687  16.603  46.148  1.00 32.73  ? 8    LEU A CD1 1 
ATOM   65   C  CD2 . LEU A 1 8   ? 22.083  14.638  44.699  1.00 31.85  ? 8    LEU A CD2 1 
ATOM   66   N  N   . LEU A 1 9   ? 25.414  11.491  47.788  1.00 39.78  ? 9    LEU A N   1 
ATOM   67   C  CA  . LEU A 1 9   ? 26.714  10.889  48.030  1.00 31.50  ? 9    LEU A CA  1 
ATOM   68   C  C   . LEU A 1 9   ? 26.708  9.477   47.478  1.00 38.08  ? 9    LEU A C   1 
ATOM   69   O  O   . LEU A 1 9   ? 25.835  8.678   47.806  1.00 37.83  ? 9    LEU A O   1 
ATOM   70   C  CB  . LEU A 1 9   ? 27.060  10.909  49.519  1.00 29.05  ? 9    LEU A CB  1 
ATOM   71   C  CG  . LEU A 1 9   ? 26.814  12.271  50.180  1.00 53.09  ? 9    LEU A CG  1 
ATOM   72   C  CD1 . LEU A 1 9   ? 26.844  12.191  51.709  1.00 49.22  ? 9    LEU A CD1 1 
ATOM   73   C  CD2 . LEU A 1 9   ? 27.802  13.317  49.664  1.00 50.60  ? 9    LEU A CD2 1 
ATOM   74   N  N   . VAL A 1 10  ? 27.678  9.187   46.620  1.00 36.12  ? 10   VAL A N   1 
ATOM   75   C  CA  . VAL A 1 10  ? 27.739  7.909   45.935  1.00 27.80  ? 10   VAL A CA  1 
ATOM   76   C  C   . VAL A 1 10  ? 29.190  7.476   45.783  1.00 41.31  ? 10   VAL A C   1 
ATOM   77   O  O   . VAL A 1 10  ? 30.082  8.310   45.605  1.00 38.12  ? 10   VAL A O   1 
ATOM   78   C  CB  . VAL A 1 10  ? 27.078  8.012   44.541  1.00 38.54  ? 10   VAL A CB  1 
ATOM   79   C  CG1 . VAL A 1 10  ? 27.447  6.822   43.673  1.00 34.30  ? 10   VAL A CG1 1 
ATOM   80   C  CG2 . VAL A 1 10  ? 25.563  8.140   44.680  1.00 34.66  ? 10   VAL A CG2 1 
ATOM   81   N  N   . ARG A 1 11  ? 29.438  6.174   45.869  1.00 31.56  ? 11   ARG A N   1 
ATOM   82   C  CA  . ARG A 1 11  ? 30.783  5.673   45.636  1.00 28.51  ? 11   ARG A CA  1 
ATOM   83   C  C   . ARG A 1 11  ? 30.868  4.907   44.325  1.00 32.58  ? 11   ARG A C   1 
ATOM   84   O  O   . ARG A 1 11  ? 29.961  4.156   43.972  1.00 38.07  ? 11   ARG A O   1 
ATOM   85   C  CB  . ARG A 1 11  ? 31.285  4.801   46.795  1.00 33.35  ? 11   ARG A CB  1 
ATOM   86   C  CG  . ARG A 1 11  ? 32.628  4.127   46.496  1.00 31.46  ? 11   ARG A CG  1 
ATOM   87   C  CD  . ARG A 1 11  ? 33.147  3.300   47.663  1.00 33.39  ? 11   ARG A CD  1 
ATOM   88   N  NE  . ARG A 1 11  ? 33.541  4.133   48.797  1.00 36.87  ? 11   ARG A NE  1 
ATOM   89   C  CZ  . ARG A 1 11  ? 34.780  4.557   49.028  1.00 41.52  ? 11   ARG A CZ  1 
ATOM   90   N  NH1 . ARG A 1 11  ? 35.035  5.308   50.090  1.00 40.91  ? 11   ARG A NH1 1 
ATOM   91   N  NH2 . ARG A 1 11  ? 35.766  4.232   48.201  1.00 37.10  ? 11   ARG A NH2 1 
ATOM   92   N  N   . VAL A 1 12  ? 31.965  5.119   43.607  1.00 34.93  ? 12   VAL A N   1 
ATOM   93   C  CA  . VAL A 1 12  ? 32.286  4.344   42.417  1.00 38.53  ? 12   VAL A CA  1 
ATOM   94   C  C   . VAL A 1 12  ? 33.659  3.704   42.596  1.00 30.23  ? 12   VAL A C   1 
ATOM   95   O  O   . VAL A 1 12  ? 34.344  3.966   43.581  1.00 31.91  ? 12   VAL A O   1 
ATOM   96   C  CB  . VAL A 1 12  ? 32.291  5.229   41.158  1.00 33.98  ? 12   VAL A CB  1 
ATOM   97   C  CG1 . VAL A 1 12  ? 30.902  5.770   40.890  1.00 28.32  ? 12   VAL A CG1 1 
ATOM   98   C  CG2 . VAL A 1 12  ? 33.289  6.365   41.321  1.00 30.36  ? 12   VAL A CG2 1 
ATOM   99   N  N   . ARG A 1 13  ? 34.052  2.870   41.639  1.00 25.57  ? 13   ARG A N   1 
ATOM   100  C  CA  . ARG A 1 13  ? 35.308  2.126   41.705  1.00 30.30  ? 13   ARG A CA  1 
ATOM   101  C  C   . ARG A 1 13  ? 36.506  3.011   42.057  1.00 33.25  ? 13   ARG A C   1 
ATOM   102  O  O   . ARG A 1 13  ? 37.444  2.565   42.708  1.00 40.48  ? 13   ARG A O   1 
ATOM   103  C  CB  . ARG A 1 13  ? 35.534  1.400   40.375  1.00 31.73  ? 13   ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 13  ? 36.890  0.743   40.176  1.00 39.31  ? 13   ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 13  ? 37.138  -0.417  41.130  1.00 31.64  ? 13   ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 13  ? 38.191  -0.061  42.071  1.00 47.87  ? 13   ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 13  ? 39.411  -0.581  42.057  1.00 45.05  ? 13   ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 13  ? 39.729  -1.508  41.169  1.00 42.69  ? 13   ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 13  ? 40.308  -0.185  42.946  1.00 56.70  ? 13   ARG A NH2 1 
ATOM   110  N  N   . GLY A 1 14  ? 36.466  4.271   41.642  1.00 35.19  ? 14   GLY A N   1 
ATOM   111  C  CA  . GLY A 1 14  ? 37.576  5.171   41.876  1.00 32.38  ? 14   GLY A CA  1 
ATOM   112  C  C   . GLY A 1 14  ? 37.512  5.967   43.167  1.00 40.57  ? 14   GLY A C   1 
ATOM   113  O  O   . GLY A 1 14  ? 38.505  6.572   43.572  1.00 44.80  ? 14   GLY A O   1 
ATOM   114  N  N   . GLY A 1 15  ? 36.352  5.982   43.814  1.00 37.14  ? 15   GLY A N   1 
ATOM   115  C  CA  . GLY A 1 15  ? 36.201  6.729   45.048  1.00 33.69  ? 15   GLY A CA  1 
ATOM   116  C  C   . GLY A 1 15  ? 34.816  7.309   45.271  1.00 35.84  ? 15   GLY A C   1 
ATOM   117  O  O   . GLY A 1 15  ? 33.854  6.896   44.631  1.00 38.02  ? 15   GLY A O   1 
ATOM   118  N  N   . GLN A 1 16  ? 34.727  8.272   46.185  1.00 31.75  ? 16   GLN A N   1 
ATOM   119  C  CA  . GLN A 1 16  ? 33.462  8.895   46.560  1.00 37.42  ? 16   GLN A CA  1 
ATOM   120  C  C   . GLN A 1 16  ? 33.125  10.137  45.732  1.00 38.14  ? 16   GLN A C   1 
ATOM   121  O  O   . GLN A 1 16  ? 34.009  10.912  45.373  1.00 38.10  ? 16   GLN A O   1 
ATOM   122  C  CB  . GLN A 1 16  ? 33.492  9.271   48.041  1.00 33.20  ? 16   GLN A CB  1 
ATOM   123  C  CG  . GLN A 1 16  ? 33.177  8.134   48.980  1.00 33.41  ? 16   GLN A CG  1 
ATOM   124  C  CD  . GLN A 1 16  ? 33.630  8.418   50.391  1.00 40.59  ? 16   GLN A CD  1 
ATOM   125  O  OE1 . GLN A 1 16  ? 34.825  8.552   50.649  1.00 58.13  ? 16   GLN A OE1 1 
ATOM   126  N  NE2 . GLN A 1 16  ? 32.682  8.512   51.314  1.00 27.28  ? 16   GLN A NE2 1 
ATOM   127  N  N   . LEU A 1 17  ? 31.836  10.327  45.459  1.00 31.86  ? 17   LEU A N   1 
ATOM   128  C  CA  . LEU A 1 17  ? 31.364  11.459  44.670  1.00 26.79  ? 17   LEU A CA  1 
ATOM   129  C  C   . LEU A 1 17  ? 30.272  12.231  45.387  1.00 34.64  ? 17   LEU A C   1 
ATOM   130  O  O   . LEU A 1 17  ? 29.404  11.642  46.037  1.00 36.86  ? 17   LEU A O   1 
ATOM   131  C  CB  . LEU A 1 17  ? 30.781  10.979  43.338  1.00 31.62  ? 17   LEU A CB  1 
ATOM   132  C  CG  . LEU A 1 17  ? 31.660  10.208  42.361  1.00 37.01  ? 17   LEU A CG  1 
ATOM   133  C  CD1 . LEU A 1 17  ? 30.803  9.679   41.224  1.00 34.57  ? 17   LEU A CD1 1 
ATOM   134  C  CD2 . LEU A 1 17  ? 32.778  11.090  41.833  1.00 40.21  ? 17   LEU A CD2 1 
ATOM   135  N  N   . ARG A 1 18  ? 30.295  13.550  45.243  1.00 35.78  ? 18   ARG A N   1 
ATOM   136  C  CA  . ARG A 1 18  ? 29.167  14.357  45.672  1.00 36.33  ? 18   ARG A CA  1 
ATOM   137  C  C   . ARG A 1 18  ? 28.509  15.002  44.458  1.00 37.73  ? 18   ARG A C   1 
ATOM   138  O  O   . ARG A 1 18  ? 29.115  15.829  43.778  1.00 37.97  ? 18   ARG A O   1 
ATOM   139  C  CB  . ARG A 1 18  ? 29.589  15.415  46.685  1.00 32.24  ? 18   ARG A CB  1 
ATOM   140  C  CG  . ARG A 1 18  ? 28.427  16.258  47.177  1.00 39.59  ? 18   ARG A CG  1 
ATOM   141  C  CD  . ARG A 1 18  ? 28.873  17.256  48.226  1.00 45.08  ? 18   ARG A CD  1 
ATOM   142  N  NE  . ARG A 1 18  ? 30.097  17.932  47.817  1.00 56.06  ? 18   ARG A NE  1 
ATOM   143  C  CZ  . ARG A 1 18  ? 31.273  17.769  48.409  1.00 57.00  ? 18   ARG A CZ  1 
ATOM   144  N  NH1 . ARG A 1 18  ? 31.386  16.963  49.458  1.00 43.09  ? 18   ARG A NH1 1 
ATOM   145  N  NH2 . ARG A 1 18  ? 32.336  18.422  47.957  1.00 64.69  ? 18   ARG A NH2 1 
ATOM   146  N  N   . GLY A 1 19  ? 27.274  14.595  44.182  1.00 30.24  ? 19   GLY A N   1 
ATOM   147  C  CA  . GLY A 1 19  ? 26.508  15.145  43.080  1.00 33.61  ? 19   GLY A CA  1 
ATOM   148  C  C   . GLY A 1 19  ? 25.671  16.340  43.493  1.00 36.70  ? 19   GLY A C   1 
ATOM   149  O  O   . GLY A 1 19  ? 25.830  16.872  44.595  1.00 37.20  ? 19   GLY A O   1 
ATOM   150  N  N   . ILE A 1 20  ? 24.773  16.760  42.607  1.00 32.80  ? 20   ILE A N   1 
ATOM   151  C  CA  . ILE A 1 20  ? 23.977  17.960  42.836  1.00 35.85  ? 20   ILE A CA  1 
ATOM   152  C  C   . ILE A 1 20  ? 22.507  17.763  42.477  1.00 33.40  ? 20   ILE A C   1 
ATOM   153  O  O   . ILE A 1 20  ? 22.174  17.074  41.512  1.00 37.82  ? 20   ILE A O   1 
ATOM   154  C  CB  . ILE A 1 20  ? 24.544  19.170  42.056  1.00 42.99  ? 20   ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 20  ? 23.710  20.419  42.321  1.00 33.78  ? 20   ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 20  ? 24.591  18.883  40.561  1.00 34.90  ? 20   ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 20  ? 24.395  21.686  41.886  1.00 37.91  ? 20   ILE A CD1 1 
ATOM   158  N  N   . ARG A 1 21  ? 21.634  18.365  43.273  1.00 34.43  ? 21   ARG A N   1 
ATOM   159  C  CA  . ARG A 1 21  ? 20.200  18.308  43.037  1.00 38.40  ? 21   ARG A CA  1 
ATOM   160  C  C   . ARG A 1 21  ? 19.817  19.419  42.060  1.00 42.47  ? 21   ARG A C   1 
ATOM   161  O  O   . ARG A 1 21  ? 19.946  20.603  42.368  1.00 47.76  ? 21   ARG A O   1 
ATOM   162  C  CB  . ARG A 1 21  ? 19.454  18.453  44.368  1.00 40.37  ? 21   ARG A CB  1 
ATOM   163  C  CG  . ARG A 1 21  ? 17.935  18.334  44.293  1.00 44.32  ? 21   ARG A CG  1 
ATOM   164  C  CD  . ARG A 1 21  ? 17.291  18.740  45.626  1.00 38.33  ? 21   ARG A CD  1 
ATOM   165  N  NE  . ARG A 1 21  ? 16.151  19.629  45.420  1.00 66.16  ? 21   ARG A NE  1 
ATOM   166  C  CZ  . ARG A 1 21  ? 14.892  19.334  45.731  1.00 75.01  ? 21   ARG A CZ  1 
ATOM   167  N  NH1 . ARG A 1 21  ? 14.593  18.167  46.291  1.00 72.19  ? 21   ARG A NH1 1 
ATOM   168  N  NH2 . ARG A 1 21  ? 13.929  20.217  45.492  1.00 54.74  ? 21   ARG A NH2 1 
ATOM   169  N  N   . LEU A 1 22  ? 19.371  19.029  40.871  1.00 38.09  ? 22   LEU A N   1 
ATOM   170  C  CA  . LEU A 1 22  ? 19.003  19.987  39.834  1.00 41.42  ? 22   LEU A CA  1 
ATOM   171  C  C   . LEU A 1 22  ? 17.494  20.128  39.719  1.00 37.43  ? 22   LEU A C   1 
ATOM   172  O  O   . LEU A 1 22  ? 16.757  19.175  39.962  1.00 43.52  ? 22   LEU A O   1 
ATOM   173  C  CB  . LEU A 1 22  ? 19.556  19.549  38.480  1.00 39.50  ? 22   LEU A CB  1 
ATOM   174  C  CG  . LEU A 1 22  ? 21.067  19.586  38.292  1.00 43.20  ? 22   LEU A CG  1 
ATOM   175  C  CD1 . LEU A 1 22  ? 21.381  19.332  36.835  1.00 43.15  ? 22   LEU A CD1 1 
ATOM   176  C  CD2 . LEU A 1 22  ? 21.627  20.921  38.741  1.00 33.15  ? 22   LEU A CD2 1 
ATOM   177  N  N   . LYS A 1 23  ? 17.038  21.314  39.329  1.00 45.47  ? 23   LYS A N   1 
ATOM   178  C  CA  . LYS A 1 23  ? 15.614  21.553  39.122  1.00 43.38  ? 23   LYS A CA  1 
ATOM   179  C  C   . LYS A 1 23  ? 15.216  21.363  37.662  1.00 46.00  ? 23   LYS A C   1 
ATOM   180  O  O   . LYS A 1 23  ? 15.668  22.098  36.787  1.00 47.69  ? 23   LYS A O   1 
ATOM   181  C  CB  . LYS A 1 23  ? 15.229  22.957  39.596  1.00 38.35  ? 23   LYS A CB  1 
ATOM   182  C  CG  . LYS A 1 23  ? 13.885  23.466  39.070  1.00 72.89  ? 23   LYS A CG  1 
ATOM   183  C  CD  . LYS A 1 23  ? 12.733  22.529  39.420  1.00 75.24  ? 23   LYS A CD  1 
ATOM   184  C  CE  . LYS A 1 23  ? 12.473  22.482  40.918  1.00 81.80  ? 23   LYS A CE  1 
ATOM   185  N  NZ  . LYS A 1 23  ? 11.687  21.277  41.321  1.00 57.88  ? 23   LYS A NZ  1 
ATOM   186  N  N   . ALA A 1 24  ? 14.383  20.359  37.405  1.00 42.99  ? 24   ALA A N   1 
ATOM   187  C  CA  . ALA A 1 24  ? 13.742  20.208  36.104  1.00 39.73  ? 24   ALA A CA  1 
ATOM   188  C  C   . ALA A 1 24  ? 12.314  20.721  36.232  1.00 50.14  ? 24   ALA A C   1 
ATOM   189  O  O   . ALA A 1 24  ? 11.791  20.821  37.340  1.00 52.09  ? 24   ALA A O   1 
ATOM   190  C  CB  . ALA A 1 24  ? 13.756  18.761  35.662  1.00 35.43  ? 24   ALA A CB  1 
ATOM   191  N  N   . PRO A 1 25  ? 11.676  21.052  35.101  1.00 53.82  ? 25   PRO A N   1 
ATOM   192  C  CA  . PRO A 1 25  ? 10.340  21.655  35.157  1.00 45.36  ? 25   PRO A CA  1 
ATOM   193  C  C   . PRO A 1 25  ? 9.359   20.903  36.058  1.00 44.49  ? 25   PRO A C   1 
ATOM   194  O  O   . PRO A 1 25  ? 8.525   21.536  36.705  1.00 46.90  ? 25   PRO A O   1 
ATOM   195  C  CB  . PRO A 1 25  ? 9.878   21.598  33.703  1.00 39.35  ? 25   PRO A CB  1 
ATOM   196  C  CG  . PRO A 1 25  ? 11.141  21.671  32.918  1.00 51.36  ? 25   PRO A CG  1 
ATOM   197  C  CD  . PRO A 1 25  ? 12.164  20.914  33.718  1.00 41.42  ? 25   PRO A CD  1 
ATOM   198  N  N   . GLY A 1 26  ? 9.460   19.580  36.105  1.00 49.99  ? 26   GLY A N   1 
ATOM   199  C  CA  . GLY A 1 26  ? 8.526   18.782  36.879  1.00 40.00  ? 26   GLY A CA  1 
ATOM   200  C  C   . GLY A 1 26  ? 9.074   18.256  38.196  1.00 59.05  ? 26   GLY A C   1 
ATOM   201  O  O   . GLY A 1 26  ? 8.438   17.429  38.847  1.00 46.14  ? 26   GLY A O   1 
ATOM   202  N  N   . GLY A 1 27  ? 10.251  18.728  38.597  1.00 52.42  ? 27   GLY A N   1 
ATOM   203  C  CA  . GLY A 1 27  ? 10.847  18.284  39.845  1.00 44.87  ? 27   GLY A CA  1 
ATOM   204  C  C   . GLY A 1 27  ? 12.349  18.082  39.782  1.00 53.25  ? 27   GLY A C   1 
ATOM   205  O  O   . GLY A 1 27  ? 12.971  18.309  38.744  1.00 48.88  ? 27   GLY A O   1 
ATOM   206  N  N   . PRO A 1 28  ? 12.940  17.633  40.898  1.00 45.37  ? 28   PRO A N   1 
ATOM   207  C  CA  . PRO A 1 28  ? 14.394  17.515  41.048  1.00 40.63  ? 28   PRO A CA  1 
ATOM   208  C  C   . PRO A 1 28  ? 14.969  16.292  40.343  1.00 40.57  ? 28   PRO A C   1 
ATOM   209  O  O   . PRO A 1 28  ? 14.303  15.264  40.229  1.00 39.13  ? 28   PRO A O   1 
ATOM   210  C  CB  . PRO A 1 28  ? 14.584  17.350  42.565  1.00 40.48  ? 28   PRO A CB  1 
ATOM   211  C  CG  . PRO A 1 28  ? 13.196  17.400  43.179  1.00 36.85  ? 28   PRO A CG  1 
ATOM   212  C  CD  . PRO A 1 28  ? 12.227  17.130  42.080  1.00 34.34  ? 28   PRO A CD  1 
ATOM   213  N  N   . VAL A 1 29  ? 16.206  16.413  39.879  1.00 33.26  ? 29   VAL A N   1 
ATOM   214  C  CA  . VAL A 1 29  ? 16.954  15.264  39.391  1.00 38.48  ? 29   VAL A CA  1 
ATOM   215  C  C   . VAL A 1 29  ? 18.320  15.248  40.058  1.00 37.30  ? 29   VAL A C   1 
ATOM   216  O  O   . VAL A 1 29  ? 18.801  16.278  40.528  1.00 37.66  ? 29   VAL A O   1 
ATOM   217  C  CB  . VAL A 1 29  ? 17.142  15.302  37.864  1.00 35.85  ? 29   VAL A CB  1 
ATOM   218  C  CG1 . VAL A 1 29  ? 15.801  15.209  37.164  1.00 33.39  ? 29   VAL A CG1 1 
ATOM   219  C  CG2 . VAL A 1 29  ? 17.877  16.564  37.455  1.00 39.16  ? 29   VAL A CG2 1 
ATOM   220  N  N   . SER A 1 30  ? 18.941  14.078  40.112  1.00 29.12  ? 30   SER A N   1 
ATOM   221  C  CA  . SER A 1 30  ? 20.296  13.980  40.631  1.00 43.06  ? 30   SER A CA  1 
ATOM   222  C  C   . SER A 1 30  ? 21.284  14.115  39.477  1.00 37.75  ? 30   SER A C   1 
ATOM   223  O  O   . SER A 1 30  ? 21.152  13.444  38.456  1.00 36.03  ? 30   SER A O   1 
ATOM   224  C  CB  . SER A 1 30  ? 20.498  12.646  41.343  1.00 35.20  ? 30   SER A CB  1 
ATOM   225  O  OG  . SER A 1 30  ? 19.335  12.279  42.065  1.00 50.58  ? 30   SER A OG  1 
ATOM   226  N  N   . ALA A 1 31  ? 22.267  14.992  39.627  1.00 32.54  ? 31   ALA A N   1 
ATOM   227  C  CA  . ALA A 1 31  ? 23.291  15.122  38.598  1.00 39.48  ? 31   ALA A CA  1 
ATOM   228  C  C   . ALA A 1 31  ? 24.672  14.867  39.174  1.00 33.94  ? 31   ALA A C   1 
ATOM   229  O  O   . ALA A 1 31  ? 25.039  15.421  40.209  1.00 36.56  ? 31   ALA A O   1 
ATOM   230  C  CB  . ALA A 1 31  ? 23.225  16.494  37.926  1.00 29.42  ? 31   ALA A CB  1 
ATOM   231  N  N   . PHE A 1 32  ? 25.423  14.005  38.501  1.00 31.14  ? 32   PHE A N   1 
ATOM   232  C  CA  . PHE A 1 32  ? 26.821  13.769  38.834  1.00 31.08  ? 32   PHE A CA  1 
ATOM   233  C  C   . PHE A 1 32  ? 27.677  14.155  37.638  1.00 32.89  ? 32   PHE A C   1 
ATOM   234  O  O   . PHE A 1 32  ? 27.751  13.430  36.645  1.00 35.76  ? 32   PHE A O   1 
ATOM   235  C  CB  . PHE A 1 32  ? 27.027  12.313  39.244  1.00 29.93  ? 32   PHE A CB  1 
ATOM   236  C  CG  . PHE A 1 32  ? 26.288  11.946  40.496  1.00 36.57  ? 32   PHE A CG  1 
ATOM   237  C  CD1 . PHE A 1 32  ? 24.972  11.518  40.440  1.00 27.38  ? 32   PHE A CD1 1 
ATOM   238  C  CD2 . PHE A 1 32  ? 26.895  12.069  41.734  1.00 36.48  ? 32   PHE A CD2 1 
ATOM   239  C  CE1 . PHE A 1 32  ? 24.288  11.201  41.587  1.00 28.37  ? 32   PHE A CE1 1 
ATOM   240  C  CE2 . PHE A 1 32  ? 26.214  11.754  42.887  1.00 32.22  ? 32   PHE A CE2 1 
ATOM   241  C  CZ  . PHE A 1 32  ? 24.909  11.319  42.816  1.00 33.85  ? 32   PHE A CZ  1 
ATOM   242  N  N   . LEU A 1 33  ? 28.308  15.319  37.735  1.00 34.29  ? 33   LEU A N   1 
ATOM   243  C  CA  . LEU A 1 33  ? 28.977  15.921  36.590  1.00 33.03  ? 33   LEU A CA  1 
ATOM   244  C  C   . LEU A 1 33  ? 30.485  15.983  36.764  1.00 37.63  ? 33   LEU A C   1 
ATOM   245  O  O   . LEU A 1 33  ? 30.987  16.298  37.847  1.00 31.87  ? 33   LEU A O   1 
ATOM   246  C  CB  . LEU A 1 33  ? 28.420  17.323  36.341  1.00 34.13  ? 33   LEU A CB  1 
ATOM   247  C  CG  . LEU A 1 33  ? 26.892  17.414  36.271  1.00 35.35  ? 33   LEU A CG  1 
ATOM   248  C  CD1 . LEU A 1 33  ? 26.443  18.853  36.051  1.00 31.02  ? 33   LEU A CD1 1 
ATOM   249  C  CD2 . LEU A 1 33  ? 26.341  16.501  35.183  1.00 24.01  ? 33   LEU A CD2 1 
ATOM   250  N  N   . GLY A 1 34  ? 31.202  15.677  35.687  1.00 31.44  ? 34   GLY A N   1 
ATOM   251  C  CA  . GLY A 1 34  ? 32.649  15.751  35.685  1.00 28.28  ? 34   GLY A CA  1 
ATOM   252  C  C   . GLY A 1 34  ? 33.327  14.628  36.445  1.00 32.04  ? 34   GLY A C   1 
ATOM   253  O  O   . GLY A 1 34  ? 34.330  14.844  37.126  1.00 35.98  ? 34   GLY A O   1 
ATOM   254  N  N   . ILE A 1 35  ? 32.776  13.426  36.330  1.00 33.91  ? 35   ILE A N   1 
ATOM   255  C  CA  . ILE A 1 35  ? 33.392  12.230  36.893  1.00 29.11  ? 35   ILE A CA  1 
ATOM   256  C  C   . ILE A 1 35  ? 34.501  11.719  35.973  1.00 36.82  ? 35   ILE A C   1 
ATOM   257  O  O   . ILE A 1 35  ? 34.260  11.444  34.799  1.00 35.64  ? 35   ILE A O   1 
ATOM   258  C  CB  . ILE A 1 35  ? 32.362  11.108  37.058  1.00 29.16  ? 35   ILE A CB  1 
ATOM   259  C  CG1 . ILE A 1 35  ? 31.137  11.613  37.824  1.00 32.27  ? 35   ILE A CG1 1 
ATOM   260  C  CG2 . ILE A 1 35  ? 32.991  9.908   37.737  1.00 27.58  ? 35   ILE A CG2 1 
ATOM   261  C  CD1 . ILE A 1 35  ? 29.989  10.627  37.844  1.00 28.99  ? 35   ILE A CD1 1 
ATOM   262  N  N   . PRO A 1 36  ? 35.721  11.582  36.507  1.00 36.73  ? 36   PRO A N   1 
ATOM   263  C  CA  . PRO A 1 36  ? 36.874  11.133  35.718  1.00 35.59  ? 36   PRO A CA  1 
ATOM   264  C  C   . PRO A 1 36  ? 36.794  9.640   35.462  1.00 33.41  ? 36   PRO A C   1 
ATOM   265  O  O   . PRO A 1 36  ? 36.592  8.885   36.411  1.00 44.50  ? 36   PRO A O   1 
ATOM   266  C  CB  . PRO A 1 36  ? 38.070  11.405  36.648  1.00 38.79  ? 36   PRO A CB  1 
ATOM   267  C  CG  . PRO A 1 36  ? 37.518  12.141  37.837  1.00 37.18  ? 36   PRO A CG  1 
ATOM   268  C  CD  . PRO A 1 36  ? 36.073  11.793  37.918  1.00 35.93  ? 36   PRO A CD  1 
ATOM   269  N  N   . PHE A 1 37  ? 36.961  9.211   34.216  1.00 36.77  ? 37   PHE A N   1 
ATOM   270  C  CA  . PHE A 1 37  ? 36.951  7.782   33.917  1.00 31.61  ? 37   PHE A CA  1 
ATOM   271  C  C   . PHE A 1 37  ? 38.276  7.282   33.339  1.00 31.26  ? 37   PHE A C   1 
ATOM   272  O  O   . PHE A 1 37  ? 38.442  6.094   33.066  1.00 40.27  ? 37   PHE A O   1 
ATOM   273  C  CB  . PHE A 1 37  ? 35.768  7.412   33.013  1.00 27.15  ? 37   PHE A CB  1 
ATOM   274  C  CG  . PHE A 1 37  ? 35.812  8.035   31.639  1.00 36.16  ? 37   PHE A CG  1 
ATOM   275  C  CD1 . PHE A 1 37  ? 36.434  7.379   30.584  1.00 27.80  ? 37   PHE A CD1 1 
ATOM   276  C  CD2 . PHE A 1 37  ? 35.197  9.256   31.396  1.00 28.31  ? 37   PHE A CD2 1 
ATOM   277  C  CE1 . PHE A 1 37  ? 36.462  7.935   29.320  1.00 31.09  ? 37   PHE A CE1 1 
ATOM   278  C  CE2 . PHE A 1 37  ? 35.221  9.819   30.134  1.00 31.58  ? 37   PHE A CE2 1 
ATOM   279  C  CZ  . PHE A 1 37  ? 35.857  9.159   29.091  1.00 28.12  ? 37   PHE A CZ  1 
ATOM   280  N  N   . ALA A 1 38  ? 39.218  8.193   33.163  1.00 29.97  ? 38   ALA A N   1 
ATOM   281  C  CA  . ALA A 1 38  ? 40.515  7.836   32.621  1.00 33.53  ? 38   ALA A CA  1 
ATOM   282  C  C   . ALA A 1 38  ? 41.578  8.747   33.214  1.00 40.27  ? 38   ALA A C   1 
ATOM   283  O  O   . ALA A 1 38  ? 41.271  9.828   33.726  1.00 31.87  ? 38   ALA A O   1 
ATOM   284  C  CB  . ALA A 1 38  ? 40.499  7.960   31.109  1.00 33.64  ? 38   ALA A CB  1 
ATOM   285  N  N   . GLU A 1 39  ? 42.829  8.308   33.155  1.00 35.49  ? 39   GLU A N   1 
ATOM   286  C  CA  . GLU A 1 39  ? 43.932  9.194   33.478  1.00 36.04  ? 39   GLU A CA  1 
ATOM   287  C  C   . GLU A 1 39  ? 43.991  10.267  32.399  1.00 36.92  ? 39   GLU A C   1 
ATOM   288  O  O   . GLU A 1 39  ? 43.752  9.990   31.224  1.00 38.43  ? 39   GLU A O   1 
ATOM   289  C  CB  . GLU A 1 39  ? 45.253  8.425   33.556  1.00 37.21  ? 39   GLU A CB  1 
ATOM   290  C  CG  . GLU A 1 39  ? 45.409  7.583   34.819  1.00 40.45  ? 39   GLU A CG  1 
ATOM   291  C  CD  . GLU A 1 39  ? 45.345  8.412   36.089  1.00 49.71  ? 39   GLU A CD  1 
ATOM   292  O  OE1 . GLU A 1 39  ? 46.320  9.133   36.387  1.00 51.84  ? 39   GLU A OE1 1 
ATOM   293  O  OE2 . GLU A 1 39  ? 44.317  8.335   36.797  1.00 46.87  ? 39   GLU A OE2 1 
ATOM   294  N  N   . PRO A 1 40  ? 44.274  11.507  32.798  1.00 35.46  ? 40   PRO A N   1 
ATOM   295  C  CA  . PRO A 1 40  ? 44.390  12.580  31.811  1.00 33.00  ? 40   PRO A CA  1 
ATOM   296  C  C   . PRO A 1 40  ? 45.340  12.186  30.685  1.00 32.73  ? 40   PRO A C   1 
ATOM   297  O  O   . PRO A 1 40  ? 46.493  11.858  30.950  1.00 39.05  ? 40   PRO A O   1 
ATOM   298  C  CB  . PRO A 1 40  ? 44.977  13.731  32.627  1.00 31.77  ? 40   PRO A CB  1 
ATOM   299  C  CG  . PRO A 1 40  ? 44.479  13.490  34.008  1.00 23.68  ? 40   PRO A CG  1 
ATOM   300  C  CD  . PRO A 1 40  ? 44.434  11.993  34.180  1.00 30.64  ? 40   PRO A CD  1 
ATOM   301  N  N   . PRO A 1 41  ? 44.858  12.225  29.434  1.00 37.99  ? 41   PRO A N   1 
ATOM   302  C  CA  . PRO A 1 41  ? 45.650  11.817  28.271  1.00 39.21  ? 41   PRO A CA  1 
ATOM   303  C  C   . PRO A 1 41  ? 46.597  12.932  27.857  1.00 39.44  ? 41   PRO A C   1 
ATOM   304  O  O   . PRO A 1 41  ? 46.551  13.377  26.712  1.00 39.88  ? 41   PRO A O   1 
ATOM   305  C  CB  . PRO A 1 41  ? 44.596  11.627  27.171  1.00 31.89  ? 41   PRO A CB  1 
ATOM   306  C  CG  . PRO A 1 41  ? 43.279  12.094  27.757  1.00 41.18  ? 41   PRO A CG  1 
ATOM   307  C  CD  . PRO A 1 41  ? 43.572  12.807  29.033  1.00 33.81  ? 41   PRO A CD  1 
ATOM   308  N  N   . VAL A 1 42  ? 47.441  13.382  28.777  1.00 32.47  ? 42   VAL A N   1 
ATOM   309  C  CA  . VAL A 1 42  ? 48.298  14.532  28.515  1.00 38.09  ? 42   VAL A CA  1 
ATOM   310  C  C   . VAL A 1 42  ? 49.772  14.142  28.499  1.00 36.34  ? 42   VAL A C   1 
ATOM   311  O  O   . VAL A 1 42  ? 50.136  13.048  28.919  1.00 39.21  ? 42   VAL A O   1 
ATOM   312  C  CB  . VAL A 1 42  ? 48.063  15.652  29.551  1.00 38.70  ? 42   VAL A CB  1 
ATOM   313  C  CG1 . VAL A 1 42  ? 46.574  15.969  29.665  1.00 35.33  ? 42   VAL A CG1 1 
ATOM   314  C  CG2 . VAL A 1 42  ? 48.607  15.249  30.901  1.00 30.62  ? 42   VAL A CG2 1 
ATOM   315  N  N   . GLY A 1 43  ? 50.613  15.043  28.003  1.00 40.83  ? 43   GLY A N   1 
ATOM   316  C  CA  . GLY A 1 43  ? 52.042  14.801  27.921  1.00 31.18  ? 43   GLY A CA  1 
ATOM   317  C  C   . GLY A 1 43  ? 52.391  13.594  27.072  1.00 42.98  ? 43   GLY A C   1 
ATOM   318  O  O   . GLY A 1 43  ? 51.988  13.494  25.912  1.00 44.67  ? 43   GLY A O   1 
ATOM   319  N  N   . SER A 1 44  ? 53.147  12.670  27.655  1.00 37.73  ? 44   SER A N   1 
ATOM   320  C  CA  . SER A 1 44  ? 53.565  11.465  26.948  1.00 50.80  ? 44   SER A CA  1 
ATOM   321  C  C   . SER A 1 44  ? 52.376  10.572  26.604  1.00 44.97  ? 44   SER A C   1 
ATOM   322  O  O   . SER A 1 44  ? 52.515  9.599   25.860  1.00 38.47  ? 44   SER A O   1 
ATOM   323  C  CB  . SER A 1 44  ? 54.573  10.676  27.784  1.00 43.94  ? 44   SER A CB  1 
ATOM   324  O  OG  . SER A 1 44  ? 53.965  10.183  28.966  1.00 52.11  ? 44   SER A OG  1 
ATOM   325  N  N   . ARG A 1 45  ? 51.208  10.896  27.148  1.00 34.57  ? 45   ARG A N   1 
ATOM   326  C  CA  . ARG A 1 45  ? 50.027  10.086  26.888  1.00 41.40  ? 45   ARG A CA  1 
ATOM   327  C  C   . ARG A 1 45  ? 49.189  10.591  25.713  1.00 38.01  ? 45   ARG A C   1 
ATOM   328  O  O   . ARG A 1 45  ? 48.218  9.949   25.315  1.00 33.14  ? 45   ARG A O   1 
ATOM   329  C  CB  . ARG A 1 45  ? 49.182  9.922   28.154  1.00 44.06  ? 45   ARG A CB  1 
ATOM   330  C  CG  . ARG A 1 45  ? 49.788  8.932   29.138  1.00 46.42  ? 45   ARG A CG  1 
ATOM   331  C  CD  . ARG A 1 45  ? 48.721  8.097   29.839  1.00 72.07  ? 45   ARG A CD  1 
ATOM   332  N  NE  . ARG A 1 45  ? 48.341  8.641   31.139  1.00 68.31  ? 45   ARG A NE  1 
ATOM   333  C  CZ  . ARG A 1 45  ? 48.958  8.340   32.277  1.00 79.24  ? 45   ARG A CZ  1 
ATOM   334  N  NH1 . ARG A 1 45  ? 49.987  7.501   32.270  1.00 65.18  ? 45   ARG A NH1 1 
ATOM   335  N  NH2 . ARG A 1 45  ? 48.549  8.877   33.421  1.00 77.32  ? 45   ARG A NH2 1 
ATOM   336  N  N   . ARG A 1 46  ? 49.575  11.730  25.149  1.00 34.60  ? 46   ARG A N   1 
ATOM   337  C  CA  . ARG A 1 46  ? 48.888  12.246  23.973  1.00 34.25  ? 46   ARG A CA  1 
ATOM   338  C  C   . ARG A 1 46  ? 48.966  11.228  22.839  1.00 35.62  ? 46   ARG A C   1 
ATOM   339  O  O   . ARG A 1 46  ? 50.009  10.609  22.630  1.00 36.56  ? 46   ARG A O   1 
ATOM   340  C  CB  . ARG A 1 46  ? 49.487  13.580  23.532  1.00 33.88  ? 46   ARG A CB  1 
ATOM   341  C  CG  . ARG A 1 46  ? 48.823  14.169  22.302  1.00 29.65  ? 46   ARG A CG  1 
ATOM   342  C  CD  . ARG A 1 46  ? 49.568  15.398  21.800  1.00 28.42  ? 46   ARG A CD  1 
ATOM   343  N  NE  . ARG A 1 46  ? 49.294  16.586  22.598  1.00 25.81  ? 46   ARG A NE  1 
ATOM   344  C  CZ  . ARG A 1 46  ? 49.921  17.746  22.437  1.00 35.62  ? 46   ARG A CZ  1 
ATOM   345  N  NH1 . ARG A 1 46  ? 50.867  17.862  21.512  1.00 31.34  ? 46   ARG A NH1 1 
ATOM   346  N  NH2 . ARG A 1 46  ? 49.611  18.786  23.201  1.00 24.29  ? 46   ARG A NH2 1 
ATOM   347  N  N   . PHE A 1 47  ? 47.853  11.066  22.122  1.00 30.00  ? 47   PHE A N   1 
ATOM   348  C  CA  . PHE A 1 47  ? 47.717  10.103  21.022  1.00 25.87  ? 47   PHE A CA  1 
ATOM   349  C  C   . PHE A 1 47  ? 47.633  8.659   21.503  1.00 30.93  ? 47   PHE A C   1 
ATOM   350  O  O   . PHE A 1 47  ? 47.393  7.754   20.707  1.00 30.70  ? 47   PHE A O   1 
ATOM   351  C  CB  . PHE A 1 47  ? 48.849  10.223  19.992  1.00 28.76  ? 47   PHE A CB  1 
ATOM   352  C  CG  . PHE A 1 47  ? 49.122  11.623  19.533  1.00 29.79  ? 47   PHE A CG  1 
ATOM   353  C  CD1 . PHE A 1 47  ? 48.120  12.395  18.968  1.00 32.31  ? 47   PHE A CD1 1 
ATOM   354  C  CD2 . PHE A 1 47  ? 50.391  12.162  19.648  1.00 30.41  ? 47   PHE A CD2 1 
ATOM   355  C  CE1 . PHE A 1 47  ? 48.379  13.680  18.536  1.00 26.35  ? 47   PHE A CE1 1 
ATOM   356  C  CE2 . PHE A 1 47  ? 50.656  13.446  19.219  1.00 30.59  ? 47   PHE A CE2 1 
ATOM   357  C  CZ  . PHE A 1 47  ? 49.648  14.207  18.666  1.00 31.45  ? 47   PHE A CZ  1 
ATOM   358  N  N   . MET A 1 48  ? 47.841  8.449   22.799  1.00 32.71  ? 48   MET A N   1 
ATOM   359  C  CA  . MET A 1 48  ? 47.834  7.105   23.374  1.00 31.87  ? 48   MET A CA  1 
ATOM   360  C  C   . MET A 1 48  ? 46.448  6.649   23.806  1.00 30.28  ? 48   MET A C   1 
ATOM   361  O  O   . MET A 1 48  ? 45.605  7.470   24.163  1.00 30.58  ? 48   MET A O   1 
ATOM   362  C  CB  . MET A 1 48  ? 48.794  7.034   24.565  1.00 33.72  ? 48   MET A CB  1 
ATOM   363  C  CG  . MET A 1 48  ? 50.261  7.087   24.183  1.00 43.18  ? 48   MET A CG  1 
ATOM   364  S  SD  . MET A 1 48  ? 50.820  5.552   23.423  1.00 49.89  ? 48   MET A SD  1 
ATOM   365  C  CE  . MET A 1 48  ? 50.046  5.651   21.820  1.00 50.02  ? 48   MET A CE  1 
ATOM   366  N  N   . PRO A 1 49  ? 46.207  5.330   23.773  1.00 33.52  ? 49   PRO A N   1 
ATOM   367  C  CA  . PRO A 1 49  ? 44.957  4.789   24.318  1.00 37.21  ? 49   PRO A CA  1 
ATOM   368  C  C   . PRO A 1 49  ? 44.780  5.256   25.756  1.00 30.55  ? 49   PRO A C   1 
ATOM   369  O  O   . PRO A 1 49  ? 45.770  5.472   26.451  1.00 34.98  ? 49   PRO A O   1 
ATOM   370  C  CB  . PRO A 1 49  ? 45.179  3.272   24.281  1.00 27.51  ? 49   PRO A CB  1 
ATOM   371  C  CG  . PRO A 1 49  ? 46.205  3.061   23.213  1.00 26.05  ? 49   PRO A CG  1 
ATOM   372  C  CD  . PRO A 1 49  ? 47.083  4.280   23.224  1.00 37.89  ? 49   PRO A CD  1 
ATOM   373  N  N   . PRO A 1 50  ? 43.528  5.413   26.201  1.00 34.42  ? 50   PRO A N   1 
ATOM   374  C  CA  . PRO A 1 50  ? 43.267  5.885   27.564  1.00 34.95  ? 50   PRO A CA  1 
ATOM   375  C  C   . PRO A 1 50  ? 43.539  4.805   28.604  1.00 41.30  ? 50   PRO A C   1 
ATOM   376  O  O   . PRO A 1 50  ? 43.229  3.634   28.390  1.00 39.69  ? 50   PRO A O   1 
ATOM   377  C  CB  . PRO A 1 50  ? 41.776  6.194   27.539  1.00 29.99  ? 50   PRO A CB  1 
ATOM   378  C  CG  . PRO A 1 50  ? 41.221  5.255   26.510  1.00 28.58  ? 50   PRO A CG  1 
ATOM   379  C  CD  . PRO A 1 50  ? 42.293  5.041   25.488  1.00 31.82  ? 50   PRO A CD  1 
ATOM   380  N  N   . GLU A 1 51  ? 44.112  5.207   29.728  1.00 45.28  ? 51   GLU A N   1 
ATOM   381  C  CA  . GLU A 1 51  ? 44.291  4.308   30.852  1.00 38.78  ? 51   GLU A CA  1 
ATOM   382  C  C   . GLU A 1 51  ? 43.218  4.612   31.888  1.00 38.54  ? 51   GLU A C   1 
ATOM   383  O  O   . GLU A 1 51  ? 42.877  5.773   32.106  1.00 37.87  ? 51   GLU A O   1 
ATOM   384  C  CB  . GLU A 1 51  ? 45.684  4.489   31.452  1.00 40.12  ? 51   GLU A CB  1 
ATOM   385  C  CG  . GLU A 1 51  ? 46.812  4.134   30.495  1.00 53.81  ? 51   GLU A CG  1 
ATOM   386  C  CD  . GLU A 1 51  ? 48.180  4.509   31.034  1.00 80.14  ? 51   GLU A CD  1 
ATOM   387  O  OE1 . GLU A 1 51  ? 48.262  5.459   31.842  1.00 75.34  ? 51   GLU A OE1 1 
ATOM   388  O  OE2 . GLU A 1 51  ? 49.173  3.856   30.646  1.00 88.94  ? 51   GLU A OE2 1 
ATOM   389  N  N   . PRO A 1 52  ? 42.673  3.566   32.525  1.00 47.08  ? 52   PRO A N   1 
ATOM   390  C  CA  . PRO A 1 52  ? 41.652  3.732   33.565  1.00 34.98  ? 52   PRO A CA  1 
ATOM   391  C  C   . PRO A 1 52  ? 42.078  4.743   34.627  1.00 38.34  ? 52   PRO A C   1 
ATOM   392  O  O   . PRO A 1 52  ? 43.253  4.803   34.989  1.00 35.74  ? 52   PRO A O   1 
ATOM   393  C  CB  . PRO A 1 52  ? 41.556  2.335   34.180  1.00 33.66  ? 52   PRO A CB  1 
ATOM   394  C  CG  . PRO A 1 52  ? 41.966  1.418   33.084  1.00 38.92  ? 52   PRO A CG  1 
ATOM   395  C  CD  . PRO A 1 52  ? 43.019  2.152   32.306  1.00 40.03  ? 52   PRO A CD  1 
ATOM   396  N  N   . LYS A 1 53  ? 41.126  5.531   35.115  1.00 37.84  ? 53   LYS A N   1 
ATOM   397  C  CA  . LYS A 1 53  ? 41.411  6.528   36.136  1.00 35.43  ? 53   LYS A CA  1 
ATOM   398  C  C   . LYS A 1 53  ? 41.864  5.868   37.428  1.00 43.40  ? 53   LYS A C   1 
ATOM   399  O  O   . LYS A 1 53  ? 41.215  4.952   37.934  1.00 42.48  ? 53   LYS A O   1 
ATOM   400  C  CB  . LYS A 1 53  ? 40.178  7.391   36.402  1.00 40.38  ? 53   LYS A CB  1 
ATOM   401  C  CG  . LYS A 1 53  ? 40.309  8.307   37.605  1.00 34.79  ? 53   LYS A CG  1 
ATOM   402  C  CD  . LYS A 1 53  ? 41.365  9.374   37.383  1.00 35.91  ? 53   LYS A CD  1 
ATOM   403  C  CE  . LYS A 1 53  ? 41.385  10.372  38.531  1.00 31.95  ? 53   LYS A CE  1 
ATOM   404  N  NZ  . LYS A 1 53  ? 42.162  11.593  38.180  1.00 38.93  ? 53   LYS A NZ  1 
ATOM   405  N  N   . ARG A 1 54  ? 42.987  6.337   37.954  1.00 38.09  ? 54   ARG A N   1 
ATOM   406  C  CA  . ARG A 1 54  ? 43.500  5.849   39.219  1.00 45.01  ? 54   ARG A CA  1 
ATOM   407  C  C   . ARG A 1 54  ? 42.680  6.444   40.359  1.00 35.48  ? 54   ARG A C   1 
ATOM   408  O  O   . ARG A 1 54  ? 42.397  7.637   40.362  1.00 45.94  ? 54   ARG A O   1 
ATOM   409  C  CB  . ARG A 1 54  ? 44.991  6.182   39.349  1.00 41.05  ? 54   ARG A CB  1 
ATOM   410  C  CG  . ARG A 1 54  ? 45.860  5.334   38.427  1.00 50.82  ? 54   ARG A CG  1 
ATOM   411  C  CD  . ARG A 1 54  ? 47.134  6.046   37.989  1.00 75.83  ? 54   ARG A CD  1 
ATOM   412  N  NE  . ARG A 1 54  ? 48.120  6.153   39.060  1.00 97.04  ? 54   ARG A NE  1 
ATOM   413  C  CZ  . ARG A 1 54  ? 48.448  7.292   39.660  1.00 122.70 ? 54   ARG A CZ  1 
ATOM   414  N  NH1 . ARG A 1 54  ? 47.871  8.429   39.290  1.00 103.43 ? 54   ARG A NH1 1 
ATOM   415  N  NH2 . ARG A 1 54  ? 49.357  7.296   40.627  1.00 142.12 ? 54   ARG A NH2 1 
ATOM   416  N  N   . PRO A 1 55  ? 42.275  5.599   41.316  1.00 37.44  ? 55   PRO A N   1 
ATOM   417  C  CA  . PRO A 1 55  ? 41.412  5.993   42.437  1.00 40.83  ? 55   PRO A CA  1 
ATOM   418  C  C   . PRO A 1 55  ? 41.894  7.252   43.146  1.00 41.99  ? 55   PRO A C   1 
ATOM   419  O  O   . PRO A 1 55  ? 43.096  7.505   43.225  1.00 40.62  ? 55   PRO A O   1 
ATOM   420  C  CB  . PRO A 1 55  ? 41.495  4.790   43.377  1.00 28.79  ? 55   PRO A CB  1 
ATOM   421  C  CG  . PRO A 1 55  ? 41.720  3.637   42.459  1.00 42.46  ? 55   PRO A CG  1 
ATOM   422  C  CD  . PRO A 1 55  ? 42.590  4.160   41.342  1.00 28.08  ? 55   PRO A CD  1 
ATOM   423  N  N   . TRP A 1 56  ? 40.950  8.035   43.655  1.00 39.77  ? 56   TRP A N   1 
ATOM   424  C  CA  . TRP A 1 56  ? 41.274  9.272   44.348  1.00 37.50  ? 56   TRP A CA  1 
ATOM   425  C  C   . TRP A 1 56  ? 40.906  9.194   45.825  1.00 47.49  ? 56   TRP A C   1 
ATOM   426  O  O   . TRP A 1 56  ? 40.089  8.366   46.237  1.00 35.36  ? 56   TRP A O   1 
ATOM   427  C  CB  . TRP A 1 56  ? 40.520  10.435  43.714  1.00 37.32  ? 56   TRP A CB  1 
ATOM   428  C  CG  . TRP A 1 56  ? 39.044  10.270  43.790  1.00 36.82  ? 56   TRP A CG  1 
ATOM   429  C  CD1 . TRP A 1 56  ? 38.235  10.593  44.840  1.00 37.47  ? 56   TRP A CD1 1 
ATOM   430  C  CD2 . TRP A 1 56  ? 38.191  9.730   42.776  1.00 36.89  ? 56   TRP A CD2 1 
ATOM   431  N  NE1 . TRP A 1 56  ? 36.931  10.291  44.542  1.00 38.36  ? 56   TRP A NE1 1 
ATOM   432  C  CE2 . TRP A 1 56  ? 36.876  9.759   43.280  1.00 34.91  ? 56   TRP A CE2 1 
ATOM   433  C  CE3 . TRP A 1 56  ? 38.410  9.228   41.489  1.00 38.71  ? 56   TRP A CE3 1 
ATOM   434  C  CZ2 . TRP A 1 56  ? 35.785  9.305   42.543  1.00 34.83  ? 56   TRP A CZ2 1 
ATOM   435  C  CZ3 . TRP A 1 56  ? 37.325  8.774   40.760  1.00 33.62  ? 56   TRP A CZ3 1 
ATOM   436  C  CH2 . TRP A 1 56  ? 36.029  8.816   41.288  1.00 36.09  ? 56   TRP A CH2 1 
ATOM   437  N  N   . SER A 1 57  ? 41.500  10.076  46.620  1.00 48.38  ? 57   SER A N   1 
ATOM   438  C  CA  . SER A 1 57  ? 41.192  10.132  48.042  1.00 49.21  ? 57   SER A CA  1 
ATOM   439  C  C   . SER A 1 57  ? 40.084  11.140  48.299  1.00 42.30  ? 57   SER A C   1 
ATOM   440  O  O   . SER A 1 57  ? 39.945  12.121  47.572  1.00 50.37  ? 57   SER A O   1 
ATOM   441  C  CB  . SER A 1 57  ? 42.433  10.517  48.844  1.00 48.50  ? 57   SER A CB  1 
ATOM   442  O  OG  . SER A 1 57  ? 42.859  11.825  48.503  1.00 72.75  ? 57   SER A OG  1 
ATOM   443  N  N   . GLY A 1 58  ? 39.294  10.892  49.335  1.00 46.52  ? 58   GLY A N   1 
ATOM   444  C  CA  . GLY A 1 58  ? 38.269  11.835  49.733  1.00 34.33  ? 58   GLY A CA  1 
ATOM   445  C  C   . GLY A 1 58  ? 37.098  11.874  48.777  1.00 40.62  ? 58   GLY A C   1 
ATOM   446  O  O   . GLY A 1 58  ? 36.894  10.960  47.975  1.00 37.53  ? 58   GLY A O   1 
ATOM   447  N  N   . VAL A 1 59  ? 36.325  12.948  48.862  1.00 37.32  ? 59   VAL A N   1 
ATOM   448  C  CA  . VAL A 1 59  ? 35.087  13.045  48.109  1.00 38.21  ? 59   VAL A CA  1 
ATOM   449  C  C   . VAL A 1 59  ? 35.258  13.948  46.905  1.00 36.14  ? 59   VAL A C   1 
ATOM   450  O  O   . VAL A 1 59  ? 35.430  15.157  47.044  1.00 44.34  ? 59   VAL A O   1 
ATOM   451  C  CB  . VAL A 1 59  ? 33.949  13.581  48.985  1.00 37.39  ? 59   VAL A CB  1 
ATOM   452  C  CG1 . VAL A 1 59  ? 32.673  13.712  48.173  1.00 28.28  ? 59   VAL A CG1 1 
ATOM   453  C  CG2 . VAL A 1 59  ? 33.744  12.667  50.175  1.00 28.38  ? 59   VAL A CG2 1 
ATOM   454  N  N   . LEU A 1 60  ? 35.222  13.349  45.723  1.00 36.14  ? 60   LEU A N   1 
ATOM   455  C  CA  . LEU A 1 60  ? 35.328  14.101  44.486  1.00 36.82  ? 60   LEU A CA  1 
ATOM   456  C  C   . LEU A 1 60  ? 34.048  14.893  44.257  1.00 39.69  ? 60   LEU A C   1 
ATOM   457  O  O   . LEU A 1 60  ? 32.956  14.325  44.217  1.00 44.74  ? 60   LEU A O   1 
ATOM   458  C  CB  . LEU A 1 60  ? 35.588  13.155  43.313  1.00 31.01  ? 60   LEU A CB  1 
ATOM   459  C  CG  . LEU A 1 60  ? 35.873  13.821  41.963  1.00 41.01  ? 60   LEU A CG  1 
ATOM   460  C  CD1 . LEU A 1 60  ? 36.892  13.017  41.169  1.00 44.26  ? 60   LEU A CD1 1 
ATOM   461  C  CD2 . LEU A 1 60  ? 34.599  14.015  41.163  1.00 35.13  ? 60   LEU A CD2 1 
ATOM   462  N  N   . ASP A 1 61  ? 34.173  16.209  44.124  1.00 32.74  ? 61   ASP A N   1 
ATOM   463  C  CA  . ASP A 1 61  ? 33.010  17.024  43.809  1.00 37.93  ? 61   ASP A CA  1 
ATOM   464  C  C   . ASP A 1 61  ? 32.592  16.828  42.354  1.00 28.94  ? 61   ASP A C   1 
ATOM   465  O  O   . ASP A 1 61  ? 33.406  16.972  41.441  1.00 40.54  ? 61   ASP A O   1 
ATOM   466  C  CB  . ASP A 1 61  ? 33.263  18.505  44.088  1.00 34.49  ? 61   ASP A CB  1 
ATOM   467  C  CG  . ASP A 1 61  ? 32.147  19.387  43.555  1.00 56.05  ? 61   ASP A CG  1 
ATOM   468  O  OD1 . ASP A 1 61  ? 32.080  19.576  42.319  1.00 51.32  ? 61   ASP A OD1 1 
ATOM   469  O  OD2 . ASP A 1 61  ? 31.332  19.876  44.369  1.00 54.22  ? 61   ASP A OD2 1 
ATOM   470  N  N   . ALA A 1 62  ? 31.321  16.496  42.155  1.00 31.62  ? 62   ALA A N   1 
ATOM   471  C  CA  . ALA A 1 62  ? 30.777  16.235  40.827  1.00 32.36  ? 62   ALA A CA  1 
ATOM   472  C  C   . ALA A 1 62  ? 29.548  17.102  40.595  1.00 34.38  ? 62   ALA A C   1 
ATOM   473  O  O   . ALA A 1 62  ? 28.471  16.601  40.270  1.00 38.09  ? 62   ALA A O   1 
ATOM   474  C  CB  . ALA A 1 62  ? 30.421  14.770  40.686  1.00 23.21  ? 62   ALA A CB  1 
ATOM   475  N  N   . THR A 1 63  ? 29.712  18.408  40.765  1.00 31.64  ? 63   THR A N   1 
ATOM   476  C  CA  . THR A 1 63  ? 28.578  19.320  40.710  1.00 32.06  ? 63   THR A CA  1 
ATOM   477  C  C   . THR A 1 63  ? 28.645  20.258  39.512  1.00 33.72  ? 63   THR A C   1 
ATOM   478  O  O   . THR A 1 63  ? 27.731  21.050  39.290  1.00 38.05  ? 63   THR A O   1 
ATOM   479  C  CB  . THR A 1 63  ? 28.466  20.156  42.002  1.00 41.29  ? 63   THR A CB  1 
ATOM   480  O  OG1 . THR A 1 63  ? 29.651  20.939  42.167  1.00 31.72  ? 63   THR A OG1 1 
ATOM   481  C  CG2 . THR A 1 63  ? 28.284  19.253  43.224  1.00 33.33  ? 63   THR A CG2 1 
ATOM   482  N  N   . THR A 1 64  ? 29.729  20.172  38.747  1.00 37.03  ? 64   THR A N   1 
ATOM   483  C  CA  . THR A 1 64  ? 29.886  21.009  37.563  1.00 35.26  ? 64   THR A CA  1 
ATOM   484  C  C   . THR A 1 64  ? 30.518  20.250  36.413  1.00 29.54  ? 64   THR A C   1 
ATOM   485  O  O   . THR A 1 64  ? 31.304  19.330  36.616  1.00 33.30  ? 64   THR A O   1 
ATOM   486  C  CB  . THR A 1 64  ? 30.760  22.235  37.842  1.00 34.83  ? 64   THR A CB  1 
ATOM   487  O  OG1 . THR A 1 64  ? 32.106  21.811  38.068  1.00 36.49  ? 64   THR A OG1 1 
ATOM   488  C  CG2 . THR A 1 64  ? 30.253  22.985  39.058  1.00 36.93  ? 64   THR A CG2 1 
ATOM   489  N  N   . PHE A 1 65  ? 30.173  20.649  35.198  1.00 33.81  ? 65   PHE A N   1 
ATOM   490  C  CA  . PHE A 1 65  ? 30.774  20.057  34.021  1.00 34.26  ? 65   PHE A CA  1 
ATOM   491  C  C   . PHE A 1 65  ? 32.277  20.290  34.021  1.00 30.88  ? 65   PHE A C   1 
ATOM   492  O  O   . PHE A 1 65  ? 32.760  21.309  34.506  1.00 35.84  ? 65   PHE A O   1 
ATOM   493  C  CB  . PHE A 1 65  ? 30.152  20.633  32.757  1.00 26.96  ? 65   PHE A CB  1 
ATOM   494  C  CG  . PHE A 1 65  ? 28.759  20.144  32.492  1.00 33.27  ? 65   PHE A CG  1 
ATOM   495  C  CD1 . PHE A 1 65  ? 28.520  18.802  32.243  1.00 32.12  ? 65   PHE A CD1 1 
ATOM   496  C  CD2 . PHE A 1 65  ? 27.688  21.029  32.478  1.00 27.72  ? 65   PHE A CD2 1 
ATOM   497  C  CE1 . PHE A 1 65  ? 27.240  18.347  31.991  1.00 38.19  ? 65   PHE A CE1 1 
ATOM   498  C  CE2 . PHE A 1 65  ? 26.406  20.580  32.228  1.00 28.76  ? 65   PHE A CE2 1 
ATOM   499  C  CZ  . PHE A 1 65  ? 26.180  19.238  31.982  1.00 33.17  ? 65   PHE A CZ  1 
ATOM   500  N  N   . GLN A 1 66  ? 33.007  19.333  33.467  1.00 32.63  ? 66   GLN A N   1 
ATOM   501  C  CA  . GLN A 1 66  ? 34.454  19.409  33.393  1.00 30.03  ? 66   GLN A CA  1 
ATOM   502  C  C   . GLN A 1 66  ? 34.930  19.987  32.069  1.00 31.71  ? 66   GLN A C   1 
ATOM   503  O  O   . GLN A 1 66  ? 34.129  20.403  31.230  1.00 29.66  ? 66   GLN A O   1 
ATOM   504  C  CB  . GLN A 1 66  ? 35.059  18.024  33.591  1.00 31.47  ? 66   GLN A CB  1 
ATOM   505  C  CG  . GLN A 1 66  ? 35.471  17.759  35.011  1.00 37.00  ? 66   GLN A CG  1 
ATOM   506  C  CD  . GLN A 1 66  ? 36.689  18.568  35.412  1.00 40.66  ? 66   GLN A CD  1 
ATOM   507  O  OE1 . GLN A 1 66  ? 37.236  19.337  34.615  1.00 42.30  ? 66   GLN A OE1 1 
ATOM   508  N  NE2 . GLN A 1 66  ? 37.125  18.393  36.651  1.00 30.51  ? 66   GLN A NE2 1 
ATOM   509  N  N   . ASN A 1 67  ? 36.246  20.006  31.893  1.00 28.92  ? 67   ASN A N   1 
ATOM   510  C  CA  . ASN A 1 67  ? 36.859  20.547  30.686  1.00 32.60  ? 67   ASN A CA  1 
ATOM   511  C  C   . ASN A 1 67  ? 36.301  19.940  29.413  1.00 28.73  ? 67   ASN A C   1 
ATOM   512  O  O   . ASN A 1 67  ? 35.912  18.779  29.380  1.00 28.79  ? 67   ASN A O   1 
ATOM   513  C  CB  . ASN A 1 67  ? 38.372  20.333  30.722  1.00 26.69  ? 67   ASN A CB  1 
ATOM   514  C  CG  . ASN A 1 67  ? 39.039  21.114  31.829  1.00 36.01  ? 67   ASN A CG  1 
ATOM   515  O  OD1 . ASN A 1 67  ? 38.645  22.242  32.129  1.00 30.41  ? 67   ASN A OD1 1 
ATOM   516  N  ND2 . ASN A 1 67  ? 40.055  20.521  32.445  1.00 35.93  ? 67   ASN A ND2 1 
ATOM   517  N  N   . VAL A 1 68  ? 36.266  20.738  28.358  1.00 27.70  ? 68   VAL A N   1 
ATOM   518  C  CA  . VAL A 1 68  ? 35.952  20.221  27.038  1.00 21.65  ? 68   VAL A CA  1 
ATOM   519  C  C   . VAL A 1 68  ? 37.250  19.809  26.354  1.00 29.68  ? 68   VAL A C   1 
ATOM   520  O  O   . VAL A 1 68  ? 38.265  20.502  26.463  1.00 27.30  ? 68   VAL A O   1 
ATOM   521  C  CB  . VAL A 1 68  ? 35.224  21.277  26.207  1.00 27.67  ? 68   VAL A CB  1 
ATOM   522  C  CG1 . VAL A 1 68  ? 35.177  20.873  24.746  1.00 23.37  ? 68   VAL A CG1 1 
ATOM   523  C  CG2 . VAL A 1 68  ? 33.819  21.491  26.778  1.00 24.57  ? 68   VAL A CG2 1 
ATOM   524  N  N   . CYS A 1 69  ? 37.232  18.671  25.670  1.00 27.15  ? 69   CYS A N   1 
ATOM   525  C  CA  . CYS A 1 69  ? 38.436  18.193  25.001  1.00 19.92  ? 69   CYS A CA  1 
ATOM   526  C  C   . CYS A 1 69  ? 38.923  19.219  23.997  1.00 29.38  ? 69   CYS A C   1 
ATOM   527  O  O   . CYS A 1 69  ? 38.128  19.811  23.269  1.00 24.73  ? 69   CYS A O   1 
ATOM   528  C  CB  . CYS A 1 69  ? 38.194  16.845  24.327  1.00 19.24  ? 69   CYS A CB  1 
ATOM   529  S  SG  . CYS A 1 69  ? 37.944  15.513  25.504  1.00 29.61  ? 69   CYS A SG  1 
ATOM   530  N  N   . TYR A 1 70  ? 40.236  19.431  23.969  1.00 28.97  ? 70   TYR A N   1 
ATOM   531  C  CA  . TYR A 1 70  ? 40.821  20.451  23.115  1.00 27.56  ? 70   TYR A CA  1 
ATOM   532  C  C   . TYR A 1 70  ? 40.337  20.348  21.672  1.00 31.32  ? 70   TYR A C   1 
ATOM   533  O  O   . TYR A 1 70  ? 40.434  19.295  21.044  1.00 28.04  ? 70   TYR A O   1 
ATOM   534  C  CB  . TYR A 1 70  ? 42.350  20.410  23.170  1.00 30.45  ? 70   TYR A CB  1 
ATOM   535  C  CG  . TYR A 1 70  ? 42.920  21.798  23.207  1.00 32.03  ? 70   TYR A CG  1 
ATOM   536  C  CD1 . TYR A 1 70  ? 43.352  22.358  24.404  1.00 34.12  ? 70   TYR A CD1 1 
ATOM   537  C  CD2 . TYR A 1 70  ? 42.966  22.579  22.057  1.00 31.11  ? 70   TYR A CD2 1 
ATOM   538  C  CE1 . TYR A 1 70  ? 43.844  23.650  24.447  1.00 33.47  ? 70   TYR A CE1 1 
ATOM   539  C  CE2 . TYR A 1 70  ? 43.457  23.865  22.092  1.00 32.56  ? 70   TYR A CE2 1 
ATOM   540  C  CZ  . TYR A 1 70  ? 43.893  24.397  23.291  1.00 32.83  ? 70   TYR A CZ  1 
ATOM   541  O  OH  . TYR A 1 70  ? 44.386  25.681  23.330  1.00 55.42  ? 70   TYR A OH  1 
ATOM   542  N  N   . GLN A 1 71  ? 39.820  21.453  21.149  1.00 32.31  ? 71   GLN A N   1 
ATOM   543  C  CA  . GLN A 1 71  ? 39.231  21.430  19.821  1.00 31.57  ? 71   GLN A CA  1 
ATOM   544  C  C   . GLN A 1 71  ? 39.186  22.797  19.155  1.00 29.39  ? 71   GLN A C   1 
ATOM   545  O  O   . GLN A 1 71  ? 39.271  23.835  19.806  1.00 27.86  ? 71   GLN A O   1 
ATOM   546  C  CB  . GLN A 1 71  ? 37.813  20.855  19.882  1.00 28.73  ? 71   GLN A CB  1 
ATOM   547  C  CG  . GLN A 1 71  ? 36.800  21.780  20.541  1.00 22.74  ? 71   GLN A CG  1 
ATOM   548  C  CD  . GLN A 1 71  ? 35.535  21.057  20.950  1.00 24.55  ? 71   GLN A CD  1 
ATOM   549  O  OE1 . GLN A 1 71  ? 34.440  21.410  20.519  1.00 28.17  ? 71   GLN A OE1 1 
ATOM   550  N  NE2 . GLN A 1 71  ? 35.681  20.029  21.778  1.00 21.92  ? 71   GLN A NE2 1 
ATOM   551  N  N   . TYR A 1 72  ? 39.047  22.761  17.838  1.00 31.69  ? 72   TYR A N   1 
ATOM   552  C  CA  . TYR A 1 72  ? 38.805  23.934  17.020  1.00 34.68  ? 72   TYR A CA  1 
ATOM   553  C  C   . TYR A 1 72  ? 37.465  24.553  17.384  1.00 35.02  ? 72   TYR A C   1 
ATOM   554  O  O   . TYR A 1 72  ? 36.516  23.845  17.725  1.00 34.23  ? 72   TYR A O   1 
ATOM   555  C  CB  . TYR A 1 72  ? 38.803  23.510  15.551  1.00 37.08  ? 72   TYR A CB  1 
ATOM   556  C  CG  . TYR A 1 72  ? 38.400  24.589  14.583  1.00 39.03  ? 72   TYR A CG  1 
ATOM   557  C  CD1 . TYR A 1 72  ? 37.122  24.614  14.034  1.00 34.42  ? 72   TYR A CD1 1 
ATOM   558  C  CD2 . TYR A 1 72  ? 39.302  25.574  14.202  1.00 41.11  ? 72   TYR A CD2 1 
ATOM   559  C  CE1 . TYR A 1 72  ? 36.751  25.597  13.136  1.00 37.76  ? 72   TYR A CE1 1 
ATOM   560  C  CE2 . TYR A 1 72  ? 38.942  26.562  13.308  1.00 43.96  ? 72   TYR A CE2 1 
ATOM   561  C  CZ  . TYR A 1 72  ? 37.667  26.569  12.777  1.00 44.29  ? 72   TYR A CZ  1 
ATOM   562  O  OH  . TYR A 1 72  ? 37.313  27.556  11.890  1.00 44.58  ? 72   TYR A OH  1 
ATOM   563  N  N   . VAL A 1 73  ? 37.387  25.876  17.311  1.00 33.26  ? 73   VAL A N   1 
ATOM   564  C  CA  . VAL A 1 73  ? 36.152  26.585  17.623  1.00 35.22  ? 73   VAL A CA  1 
ATOM   565  C  C   . VAL A 1 73  ? 35.622  27.284  16.376  1.00 38.02  ? 73   VAL A C   1 
ATOM   566  O  O   . VAL A 1 73  ? 36.321  28.086  15.765  1.00 40.92  ? 73   VAL A O   1 
ATOM   567  C  CB  . VAL A 1 73  ? 36.371  27.622  18.744  1.00 39.55  ? 73   VAL A CB  1 
ATOM   568  C  CG1 . VAL A 1 73  ? 35.117  28.441  18.968  1.00 27.94  ? 73   VAL A CG1 1 
ATOM   569  C  CG2 . VAL A 1 73  ? 36.793  26.929  20.027  1.00 37.35  ? 73   VAL A CG2 1 
ATOM   570  N  N   . ASP A 1 74  ? 34.386  26.977  16.000  1.00 44.17  ? 74   ASP A N   1 
ATOM   571  C  CA  . ASP A 1 74  ? 33.797  27.553  14.796  1.00 39.82  ? 74   ASP A CA  1 
ATOM   572  C  C   . ASP A 1 74  ? 33.773  29.078  14.846  1.00 42.34  ? 74   ASP A C   1 
ATOM   573  O  O   . ASP A 1 74  ? 33.451  29.668  15.876  1.00 47.62  ? 74   ASP A O   1 
ATOM   574  C  CB  . ASP A 1 74  ? 32.379  27.032  14.579  1.00 39.05  ? 74   ASP A CB  1 
ATOM   575  C  CG  . ASP A 1 74  ? 31.859  27.342  13.193  1.00 60.72  ? 74   ASP A CG  1 
ATOM   576  O  OD1 . ASP A 1 74  ? 32.230  26.610  12.250  1.00 64.68  ? 74   ASP A OD1 1 
ATOM   577  O  OD2 . ASP A 1 74  ? 31.088  28.318  13.046  1.00 54.45  ? 74   ASP A OD2 1 
ATOM   578  N  N   . THR A 1 75  ? 34.097  29.711  13.722  1.00 49.08  ? 75   THR A N   1 
ATOM   579  C  CA  . THR A 1 75  ? 34.186  31.166  13.666  1.00 57.48  ? 75   THR A CA  1 
ATOM   580  C  C   . THR A 1 75  ? 33.430  31.767  12.483  1.00 53.02  ? 75   THR A C   1 
ATOM   581  O  O   . THR A 1 75  ? 33.517  32.969  12.239  1.00 54.15  ? 75   THR A O   1 
ATOM   582  C  CB  . THR A 1 75  ? 35.659  31.633  13.612  1.00 47.06  ? 75   THR A CB  1 
ATOM   583  O  OG1 . THR A 1 75  ? 36.399  30.776  12.734  1.00 52.67  ? 75   THR A OG1 1 
ATOM   584  C  CG2 . THR A 1 75  ? 36.288  31.584  14.994  1.00 38.45  ? 75   THR A CG2 1 
ATOM   585  N  N   . LEU A 1 76  ? 32.682  30.937  11.762  1.00 54.24  ? 76   LEU A N   1 
ATOM   586  C  CA  . LEU A 1 76  ? 31.948  31.404  10.588  1.00 50.48  ? 76   LEU A CA  1 
ATOM   587  C  C   . LEU A 1 76  ? 31.006  32.557  10.915  1.00 56.61  ? 76   LEU A C   1 
ATOM   588  O  O   . LEU A 1 76  ? 31.098  33.625  10.312  1.00 63.20  ? 76   LEU A O   1 
ATOM   589  C  CB  . LEU A 1 76  ? 31.163  30.266  9.933   1.00 51.48  ? 76   LEU A CB  1 
ATOM   590  C  CG  . LEU A 1 76  ? 30.478  30.683  8.628   1.00 53.22  ? 76   LEU A CG  1 
ATOM   591  C  CD1 . LEU A 1 76  ? 31.477  31.397  7.724   1.00 44.33  ? 76   LEU A CD1 1 
ATOM   592  C  CD2 . LEU A 1 76  ? 29.843  29.495  7.912   1.00 42.93  ? 76   LEU A CD2 1 
ATOM   593  N  N   . TYR A 1 77  ? 30.098  32.340  11.862  1.00 47.88  ? 77   TYR A N   1 
ATOM   594  C  CA  . TYR A 1 77  ? 29.159  33.385  12.262  1.00 48.23  ? 77   TYR A CA  1 
ATOM   595  C  C   . TYR A 1 77  ? 29.293  33.722  13.742  1.00 50.41  ? 77   TYR A C   1 
ATOM   596  O  O   . TYR A 1 77  ? 28.487  33.285  14.563  1.00 45.87  ? 77   TYR A O   1 
ATOM   597  C  CB  . TYR A 1 77  ? 27.721  32.975  11.954  1.00 38.13  ? 77   TYR A CB  1 
ATOM   598  C  CG  . TYR A 1 77  ? 27.447  32.718  10.493  1.00 41.92  ? 77   TYR A CG  1 
ATOM   599  C  CD1 . TYR A 1 77  ? 27.381  33.764  9.587   1.00 37.00  ? 77   TYR A CD1 1 
ATOM   600  C  CD2 . TYR A 1 77  ? 27.240  31.426  10.022  1.00 39.32  ? 77   TYR A CD2 1 
ATOM   601  C  CE1 . TYR A 1 77  ? 27.121  33.538  8.249   1.00 41.42  ? 77   TYR A CE1 1 
ATOM   602  C  CE2 . TYR A 1 77  ? 26.983  31.187  8.684   1.00 46.89  ? 77   TYR A CE2 1 
ATOM   603  C  CZ  . TYR A 1 77  ? 26.923  32.249  7.800   1.00 50.31  ? 77   TYR A CZ  1 
ATOM   604  O  OH  . TYR A 1 77  ? 26.666  32.025  6.465   1.00 51.90  ? 77   TYR A OH  1 
ATOM   605  N  N   . PRO A 1 78  ? 30.311  34.518  14.084  1.00 56.31  ? 78   PRO A N   1 
ATOM   606  C  CA  . PRO A 1 78  ? 30.622  34.899  15.468  1.00 51.30  ? 78   PRO A CA  1 
ATOM   607  C  C   . PRO A 1 78  ? 29.442  35.556  16.189  1.00 52.24  ? 78   PRO A C   1 
ATOM   608  O  O   . PRO A 1 78  ? 28.932  36.578  15.729  1.00 51.22  ? 78   PRO A O   1 
ATOM   609  C  CB  . PRO A 1 78  ? 31.765  35.906  15.302  1.00 58.42  ? 78   PRO A CB  1 
ATOM   610  C  CG  . PRO A 1 78  ? 32.381  35.569  13.975  1.00 56.19  ? 78   PRO A CG  1 
ATOM   611  C  CD  . PRO A 1 78  ? 31.246  35.116  13.114  1.00 43.70  ? 78   PRO A CD  1 
ATOM   612  N  N   . GLY A 1 79  ? 29.015  34.968  17.303  1.00 52.58  ? 79   GLY A N   1 
ATOM   613  C  CA  . GLY A 1 79  ? 27.943  35.532  18.110  1.00 52.58  ? 79   GLY A CA  1 
ATOM   614  C  C   . GLY A 1 79  ? 26.559  34.996  17.788  1.00 53.73  ? 79   GLY A C   1 
ATOM   615  O  O   . GLY A 1 79  ? 25.618  35.166  18.567  1.00 44.24  ? 79   GLY A O   1 
ATOM   616  N  N   . PHE A 1 80  ? 26.441  34.342  16.638  1.00 46.56  ? 80   PHE A N   1 
ATOM   617  C  CA  . PHE A 1 80  ? 25.168  33.819  16.145  1.00 45.63  ? 80   PHE A CA  1 
ATOM   618  C  C   . PHE A 1 80  ? 24.782  32.543  16.896  1.00 44.90  ? 80   PHE A C   1 
ATOM   619  O  O   . PHE A 1 80  ? 25.589  31.622  17.018  1.00 43.45  ? 80   PHE A O   1 
ATOM   620  C  CB  . PHE A 1 80  ? 25.299  33.575  14.639  1.00 39.20  ? 80   PHE A CB  1 
ATOM   621  C  CG  . PHE A 1 80  ? 24.145  32.846  14.022  1.00 43.96  ? 80   PHE A CG  1 
ATOM   622  C  CD1 . PHE A 1 80  ? 22.876  33.399  14.015  1.00 38.65  ? 80   PHE A CD1 1 
ATOM   623  C  CD2 . PHE A 1 80  ? 24.346  31.623  13.399  1.00 47.49  ? 80   PHE A CD2 1 
ATOM   624  C  CE1 . PHE A 1 80  ? 21.819  32.733  13.422  1.00 39.96  ? 80   PHE A CE1 1 
ATOM   625  C  CE2 . PHE A 1 80  ? 23.296  30.950  12.802  1.00 40.91  ? 80   PHE A CE2 1 
ATOM   626  C  CZ  . PHE A 1 80  ? 22.030  31.503  12.814  1.00 43.73  ? 80   PHE A CZ  1 
ATOM   627  N  N   . GLU A 1 81  ? 23.557  32.495  17.413  1.00 41.88  ? 81   GLU A N   1 
ATOM   628  C  CA  . GLU A 1 81  ? 23.145  31.397  18.289  1.00 45.48  ? 81   GLU A CA  1 
ATOM   629  C  C   . GLU A 1 81  ? 23.158  30.045  17.581  1.00 48.40  ? 81   GLU A C   1 
ATOM   630  O  O   . GLU A 1 81  ? 23.429  29.014  18.197  1.00 43.23  ? 81   GLU A O   1 
ATOM   631  C  CB  . GLU A 1 81  ? 21.767  31.670  18.903  1.00 48.42  ? 81   GLU A CB  1 
ATOM   632  C  CG  . GLU A 1 81  ? 21.231  30.543  19.793  1.00 74.82  ? 81   GLU A CG  1 
ATOM   633  C  CD  . GLU A 1 81  ? 22.087  30.293  21.031  1.00 98.18  ? 81   GLU A CD  1 
ATOM   634  O  OE1 . GLU A 1 81  ? 22.967  31.130  21.331  1.00 102.22 ? 81   GLU A OE1 1 
ATOM   635  O  OE2 . GLU A 1 81  ? 21.874  29.259  21.705  1.00 83.41  ? 81   GLU A OE2 1 
ATOM   636  N  N   . GLY A 1 82  ? 22.878  30.059  16.285  1.00 42.91  ? 82   GLY A N   1 
ATOM   637  C  CA  . GLY A 1 82  ? 22.843  28.836  15.508  1.00 40.43  ? 82   GLY A CA  1 
ATOM   638  C  C   . GLY A 1 82  ? 24.173  28.108  15.482  1.00 38.22  ? 82   GLY A C   1 
ATOM   639  O  O   . GLY A 1 82  ? 24.214  26.888  15.347  1.00 41.89  ? 82   GLY A O   1 
ATOM   640  N  N   . THR A 1 83  ? 25.266  28.851  15.605  1.00 33.48  ? 83   THR A N   1 
ATOM   641  C  CA  . THR A 1 83  ? 26.591  28.240  15.634  1.00 37.40  ? 83   THR A CA  1 
ATOM   642  C  C   . THR A 1 83  ? 27.161  28.137  17.052  1.00 42.65  ? 83   THR A C   1 
ATOM   643  O  O   . THR A 1 83  ? 27.887  27.197  17.364  1.00 42.27  ? 83   THR A O   1 
ATOM   644  C  CB  . THR A 1 83  ? 27.586  29.005  14.751  1.00 36.00  ? 83   THR A CB  1 
ATOM   645  O  OG1 . THR A 1 83  ? 27.625  30.376  15.159  1.00 47.25  ? 83   THR A OG1 1 
ATOM   646  C  CG2 . THR A 1 83  ? 27.175  28.924  13.291  1.00 36.22  ? 83   THR A CG2 1 
ATOM   647  N  N   . GLU A 1 84  ? 26.826  29.098  17.906  1.00 39.97  ? 84   GLU A N   1 
ATOM   648  C  CA  . GLU A 1 84  ? 27.371  29.132  19.259  1.00 42.19  ? 84   GLU A CA  1 
ATOM   649  C  C   . GLU A 1 84  ? 26.893  27.970  20.133  1.00 36.55  ? 84   GLU A C   1 
ATOM   650  O  O   . GLU A 1 84  ? 27.615  27.529  21.020  1.00 39.21  ? 84   GLU A O   1 
ATOM   651  C  CB  . GLU A 1 84  ? 27.061  30.468  19.944  1.00 42.95  ? 84   GLU A CB  1 
ATOM   652  C  CG  . GLU A 1 84  ? 27.644  31.698  19.251  1.00 50.91  ? 84   GLU A CG  1 
ATOM   653  C  CD  . GLU A 1 84  ? 29.161  31.805  19.362  1.00 59.35  ? 84   GLU A CD  1 
ATOM   654  O  OE1 . GLU A 1 84  ? 29.788  30.951  20.032  1.00 52.58  ? 84   GLU A OE1 1 
ATOM   655  O  OE2 . GLU A 1 84  ? 29.725  32.753  18.771  1.00 54.49  ? 84   GLU A OE2 1 
ATOM   656  N  N   . MET A 1 85  ? 25.684  27.476  19.887  1.00 43.07  ? 85   MET A N   1 
ATOM   657  C  CA  . MET A 1 85  ? 25.138  26.381  20.691  1.00 33.00  ? 85   MET A CA  1 
ATOM   658  C  C   . MET A 1 85  ? 26.036  25.139  20.662  1.00 38.04  ? 85   MET A C   1 
ATOM   659  O  O   . MET A 1 85  ? 26.042  24.352  21.605  1.00 42.67  ? 85   MET A O   1 
ATOM   660  C  CB  . MET A 1 85  ? 23.713  26.025  20.244  1.00 33.49  ? 85   MET A CB  1 
ATOM   661  C  CG  . MET A 1 85  ? 23.614  25.534  18.803  1.00 37.69  ? 85   MET A CG  1 
ATOM   662  S  SD  . MET A 1 85  ? 21.913  25.336  18.221  1.00 39.63  ? 85   MET A SD  1 
ATOM   663  C  CE  . MET A 1 85  ? 21.500  23.727  18.888  1.00 43.84  ? 85   MET A CE  1 
ATOM   664  N  N   . TRP A 1 86  ? 26.799  24.979  19.583  1.00 27.80  ? 86   TRP A N   1 
ATOM   665  C  CA  . TRP A 1 86  ? 27.660  23.818  19.408  1.00 31.79  ? 86   TRP A CA  1 
ATOM   666  C  C   . TRP A 1 86  ? 29.080  24.057  19.933  1.00 36.48  ? 86   TRP A C   1 
ATOM   667  O  O   . TRP A 1 86  ? 29.852  23.119  20.129  1.00 31.08  ? 86   TRP A O   1 
ATOM   668  C  CB  . TRP A 1 86  ? 27.716  23.413  17.932  1.00 31.18  ? 86   TRP A CB  1 
ATOM   669  C  CG  . TRP A 1 86  ? 26.371  23.222  17.288  1.00 34.19  ? 86   TRP A CG  1 
ATOM   670  C  CD1 . TRP A 1 86  ? 25.800  24.011  16.332  1.00 37.24  ? 86   TRP A CD1 1 
ATOM   671  C  CD2 . TRP A 1 86  ? 25.436  22.166  17.546  1.00 31.50  ? 86   TRP A CD2 1 
ATOM   672  N  NE1 . TRP A 1 86  ? 24.566  23.515  15.982  1.00 33.82  ? 86   TRP A NE1 1 
ATOM   673  C  CE2 . TRP A 1 86  ? 24.318  22.386  16.713  1.00 35.63  ? 86   TRP A CE2 1 
ATOM   674  C  CE3 . TRP A 1 86  ? 25.436  21.057  18.400  1.00 30.62  ? 86   TRP A CE3 1 
ATOM   675  C  CZ2 . TRP A 1 86  ? 23.211  21.535  16.708  1.00 35.08  ? 86   TRP A CZ2 1 
ATOM   676  C  CZ3 . TRP A 1 86  ? 24.334  20.216  18.396  1.00 35.11  ? 86   TRP A CZ3 1 
ATOM   677  C  CH2 . TRP A 1 86  ? 23.237  20.461  17.555  1.00 31.68  ? 86   TRP A CH2 1 
ATOM   678  N  N   . ASN A 1 87  ? 29.428  25.315  20.156  1.00 27.28  ? 87   ASN A N   1 
ATOM   679  C  CA  . ASN A 1 87  ? 30.777  25.642  20.592  1.00 36.97  ? 87   ASN A CA  1 
ATOM   680  C  C   . ASN A 1 87  ? 31.028  25.233  22.043  1.00 37.63  ? 87   ASN A C   1 
ATOM   681  O  O   . ASN A 1 87  ? 30.086  25.103  22.828  1.00 27.57  ? 87   ASN A O   1 
ATOM   682  C  CB  . ASN A 1 87  ? 31.057  27.132  20.383  1.00 32.55  ? 87   ASN A CB  1 
ATOM   683  C  CG  . ASN A 1 87  ? 31.441  27.456  18.953  1.00 39.35  ? 87   ASN A CG  1 
ATOM   684  O  OD1 . ASN A 1 87  ? 32.030  26.632  18.249  1.00 42.34  ? 87   ASN A OD1 1 
ATOM   685  N  ND2 . ASN A 1 87  ? 31.115  28.664  18.518  1.00 34.63  ? 87   ASN A ND2 1 
ATOM   686  N  N   . PRO A 1 88  ? 32.303  25.026  22.401  1.00 33.99  ? 88   PRO A N   1 
ATOM   687  C  CA  . PRO A 1 88  ? 32.671  24.621  23.763  1.00 31.68  ? 88   PRO A CA  1 
ATOM   688  C  C   . PRO A 1 88  ? 32.090  25.569  24.803  1.00 28.19  ? 88   PRO A C   1 
ATOM   689  O  O   . PRO A 1 88  ? 32.089  26.776  24.592  1.00 29.72  ? 88   PRO A O   1 
ATOM   690  C  CB  . PRO A 1 88  ? 34.200  24.719  23.761  1.00 24.71  ? 88   PRO A CB  1 
ATOM   691  C  CG  . PRO A 1 88  ? 34.590  24.558  22.332  1.00 31.73  ? 88   PRO A CG  1 
ATOM   692  C  CD  . PRO A 1 88  ? 33.478  25.185  21.528  1.00 33.03  ? 88   PRO A CD  1 
ATOM   693  N  N   . ASN A 1 89  ? 31.597  25.029  25.911  1.00 29.88  ? 89   ASN A N   1 
ATOM   694  C  CA  . ASN A 1 89  ? 31.025  25.864  26.958  1.00 23.72  ? 89   ASN A CA  1 
ATOM   695  C  C   . ASN A 1 89  ? 31.780  25.711  28.275  1.00 30.39  ? 89   ASN A C   1 
ATOM   696  O  O   . ASN A 1 89  ? 31.336  26.168  29.324  1.00 38.20  ? 89   ASN A O   1 
ATOM   697  C  CB  . ASN A 1 89  ? 29.531  25.579  27.129  1.00 25.38  ? 89   ASN A CB  1 
ATOM   698  C  CG  . ASN A 1 89  ? 29.256  24.183  27.651  1.00 34.32  ? 89   ASN A CG  1 
ATOM   699  O  OD1 . ASN A 1 89  ? 30.031  23.254  27.423  1.00 25.80  ? 89   ASN A OD1 1 
ATOM   700  N  ND2 . ASN A 1 89  ? 28.140  24.029  28.356  1.00 30.77  ? 89   ASN A ND2 1 
ATOM   701  N  N   A ARG A 1 90  ? 32.926  25.045  28.207  0.50 29.95  ? 90   ARG A N   1 
ATOM   702  N  N   B ARG A 1 90  ? 32.928  25.049  28.207  0.50 31.46  ? 90   ARG A N   1 
ATOM   703  C  CA  A ARG A 1 90  ? 33.846  24.972  29.334  0.50 34.50  ? 90   ARG A CA  1 
ATOM   704  C  CA  B ARG A 1 90  ? 33.839  24.953  29.341  0.50 34.49  ? 90   ARG A CA  1 
ATOM   705  C  C   A ARG A 1 90  ? 35.259  25.142  28.800  0.50 31.95  ? 90   ARG A C   1 
ATOM   706  C  C   B ARG A 1 90  ? 35.254  25.134  28.805  0.50 31.74  ? 90   ARG A C   1 
ATOM   707  O  O   A ARG A 1 90  ? 35.474  25.140  27.588  0.50 30.22  ? 90   ARG A O   1 
ATOM   708  O  O   B ARG A 1 90  ? 35.465  25.134  27.592  0.50 29.89  ? 90   ARG A O   1 
ATOM   709  C  CB  A ARG A 1 90  ? 33.714  23.637  30.065  0.50 33.21  ? 90   ARG A CB  1 
ATOM   710  C  CB  B ARG A 1 90  ? 33.703  23.594  30.030  0.50 33.07  ? 90   ARG A CB  1 
ATOM   711  C  CG  A ARG A 1 90  ? 32.453  23.504  30.899  0.50 31.66  ? 90   ARG A CG  1 
ATOM   712  C  CG  B ARG A 1 90  ? 32.309  23.282  30.566  0.50 31.85  ? 90   ARG A CG  1 
ATOM   713  C  CD  A ARG A 1 90  ? 32.477  24.444  32.089  0.50 34.94  ? 90   ARG A CD  1 
ATOM   714  C  CD  B ARG A 1 90  ? 32.250  23.344  32.087  0.50 30.69  ? 90   ARG A CD  1 
ATOM   715  N  NE  A ARG A 1 90  ? 31.231  24.389  32.845  0.50 35.35  ? 90   ARG A NE  1 
ATOM   716  N  NE  B ARG A 1 90  ? 32.168  24.710  32.591  0.50 35.15  ? 90   ARG A NE  1 
ATOM   717  C  CZ  A ARG A 1 90  ? 30.165  25.138  32.581  0.50 37.32  ? 90   ARG A CZ  1 
ATOM   718  C  CZ  B ARG A 1 90  ? 32.253  25.038  33.876  0.50 31.08  ? 90   ARG A CZ  1 
ATOM   719  N  NH1 A ARG A 1 90  ? 30.192  26.005  31.578  0.50 31.11  ? 90   ARG A NH1 1 
ATOM   720  N  NH1 B ARG A 1 90  ? 32.428  24.100  34.799  0.50 27.70  ? 90   ARG A NH1 1 
ATOM   721  N  NH2 A ARG A 1 90  ? 29.069  25.019  33.319  0.50 39.59  ? 90   ARG A NH2 1 
ATOM   722  N  NH2 B ARG A 1 90  ? 32.169  26.310  34.237  0.50 40.82  ? 90   ARG A NH2 1 
ATOM   723  N  N   . GLU A 1 91  ? 36.222  25.292  29.697  1.00 29.57  ? 91   GLU A N   1 
ATOM   724  C  CA  . GLU A 1 91  ? 37.607  25.464  29.279  1.00 30.60  ? 91   GLU A CA  1 
ATOM   725  C  C   . GLU A 1 91  ? 38.120  24.309  28.408  1.00 28.98  ? 91   GLU A C   1 
ATOM   726  O  O   . GLU A 1 91  ? 37.867  23.136  28.689  1.00 28.79  ? 91   GLU A O   1 
ATOM   727  C  CB  . GLU A 1 91  ? 38.500  25.631  30.494  1.00 24.80  ? 91   GLU A CB  1 
ATOM   728  C  CG  . GLU A 1 91  ? 39.973  25.660  30.166  1.00 39.15  ? 91   GLU A CG  1 
ATOM   729  C  CD  . GLU A 1 91  ? 40.808  25.811  31.408  1.00 42.97  ? 91   GLU A CD  1 
ATOM   730  O  OE1 . GLU A 1 91  ? 40.236  26.232  32.434  1.00 32.35  ? 91   GLU A OE1 1 
ATOM   731  O  OE2 . GLU A 1 91  ? 42.019  25.503  31.363  1.00 54.77  ? 91   GLU A OE2 1 
ATOM   732  N  N   . LEU A 1 92  ? 38.830  24.652  27.341  1.00 28.32  ? 92   LEU A N   1 
ATOM   733  C  CA  . LEU A 1 92  ? 39.480  23.652  26.508  1.00 27.35  ? 92   LEU A CA  1 
ATOM   734  C  C   . LEU A 1 92  ? 40.700  23.086  27.221  1.00 30.55  ? 92   LEU A C   1 
ATOM   735  O  O   . LEU A 1 92  ? 41.505  23.832  27.775  1.00 35.87  ? 92   LEU A O   1 
ATOM   736  C  CB  . LEU A 1 92  ? 39.892  24.250  25.165  1.00 25.60  ? 92   LEU A CB  1 
ATOM   737  C  CG  . LEU A 1 92  ? 38.745  24.766  24.298  1.00 27.34  ? 92   LEU A CG  1 
ATOM   738  C  CD1 . LEU A 1 92  ? 39.264  25.218  22.946  1.00 27.38  ? 92   LEU A CD1 1 
ATOM   739  C  CD2 . LEU A 1 92  ? 37.705  23.682  24.131  1.00 33.31  ? 92   LEU A CD2 1 
ATOM   740  N  N   . SER A 1 93  ? 40.824  21.764  27.209  1.00 28.91  ? 93   SER A N   1 
ATOM   741  C  CA  . SER A 1 93  ? 41.967  21.093  27.811  1.00 28.60  ? 93   SER A CA  1 
ATOM   742  C  C   . SER A 1 93  ? 42.124  19.672  27.284  1.00 32.24  ? 93   SER A C   1 
ATOM   743  O  O   . SER A 1 93  ? 41.150  19.028  26.890  1.00 26.22  ? 93   SER A O   1 
ATOM   744  C  CB  . SER A 1 93  ? 41.842  21.069  29.337  1.00 33.27  ? 93   SER A CB  1 
ATOM   745  O  OG  . SER A 1 93  ? 42.820  20.218  29.909  1.00 31.12  ? 93   SER A OG  1 
ATOM   746  N  N   . GLU A 1 94  ? 43.362  19.192  27.271  1.00 31.14  ? 94   GLU A N   1 
ATOM   747  C  CA  . GLU A 1 94  ? 43.632  17.816  26.901  1.00 27.45  ? 94   GLU A CA  1 
ATOM   748  C  C   . GLU A 1 94  ? 43.201  16.907  28.043  1.00 26.49  ? 94   GLU A C   1 
ATOM   749  O  O   . GLU A 1 94  ? 42.923  15.727  27.845  1.00 31.78  ? 94   GLU A O   1 
ATOM   750  C  CB  . GLU A 1 94  ? 45.114  17.626  26.594  1.00 33.29  ? 94   GLU A CB  1 
ATOM   751  C  CG  . GLU A 1 94  ? 45.532  18.114  25.224  1.00 33.32  ? 94   GLU A CG  1 
ATOM   752  C  CD  . GLU A 1 94  ? 46.979  17.792  24.926  1.00 35.78  ? 94   GLU A CD  1 
ATOM   753  O  OE1 . GLU A 1 94  ? 47.236  16.770  24.255  1.00 32.40  ? 94   GLU A OE1 1 
ATOM   754  O  OE2 . GLU A 1 94  ? 47.859  18.548  25.382  1.00 42.99  ? 94   GLU A OE2 1 
ATOM   755  N  N   . ASP A 1 95  ? 43.153  17.477  29.241  1.00 27.85  ? 95   ASP A N   1 
ATOM   756  C  CA  . ASP A 1 95  ? 42.644  16.786  30.414  1.00 31.89  ? 95   ASP A CA  1 
ATOM   757  C  C   . ASP A 1 95  ? 41.137  16.955  30.407  1.00 35.40  ? 95   ASP A C   1 
ATOM   758  O  O   . ASP A 1 95  ? 40.609  17.910  30.977  1.00 28.48  ? 95   ASP A O   1 
ATOM   759  C  CB  . ASP A 1 95  ? 43.233  17.407  31.679  1.00 25.68  ? 95   ASP A CB  1 
ATOM   760  C  CG  . ASP A 1 95  ? 42.682  16.790  32.953  1.00 36.03  ? 95   ASP A CG  1 
ATOM   761  O  OD1 . ASP A 1 95  ? 41.918  15.806  32.881  1.00 37.75  ? 95   ASP A OD1 1 
ATOM   762  O  OD2 . ASP A 1 95  ? 43.019  17.297  34.038  1.00 49.62  ? 95   ASP A OD2 1 
ATOM   763  N  N   . CYS A 1 96  ? 40.446  16.029  29.754  1.00 25.35  ? 96   CYS A N   1 
ATOM   764  C  CA  . CYS A 1 96  ? 39.038  16.236  29.444  1.00 30.88  ? 96   CYS A CA  1 
ATOM   765  C  C   . CYS A 1 96  ? 38.208  14.970  29.499  1.00 30.15  ? 96   CYS A C   1 
ATOM   766  O  O   . CYS A 1 96  ? 37.024  14.997  29.171  1.00 31.67  ? 96   CYS A O   1 
ATOM   767  C  CB  . CYS A 1 96  ? 38.908  16.837  28.047  1.00 30.03  ? 96   CYS A CB  1 
ATOM   768  S  SG  . CYS A 1 96  ? 39.535  15.753  26.750  1.00 29.46  ? 96   CYS A SG  1 
ATOM   769  N  N   . LEU A 1 97  ? 38.823  13.863  29.899  1.00 31.97  ? 97   LEU A N   1 
ATOM   770  C  CA  . LEU A 1 97  ? 38.130  12.580  29.906  1.00 30.91  ? 97   LEU A CA  1 
ATOM   771  C  C   . LEU A 1 97  ? 37.246  12.409  31.148  1.00 33.17  ? 97   LEU A C   1 
ATOM   772  O  O   . LEU A 1 97  ? 37.615  11.748  32.120  1.00 31.93  ? 97   LEU A O   1 
ATOM   773  C  CB  . LEU A 1 97  ? 39.125  11.427  29.740  1.00 27.35  ? 97   LEU A CB  1 
ATOM   774  C  CG  . LEU A 1 97  ? 39.842  11.461  28.387  1.00 31.11  ? 97   LEU A CG  1 
ATOM   775  C  CD1 . LEU A 1 97  ? 40.620  10.179  28.124  1.00 28.49  ? 97   LEU A CD1 1 
ATOM   776  C  CD2 . LEU A 1 97  ? 38.844  11.717  27.265  1.00 27.89  ? 97   LEU A CD2 1 
ATOM   777  N  N   . TYR A 1 98  ? 36.070  13.022  31.095  1.00 30.23  ? 98   TYR A N   1 
ATOM   778  C  CA  . TYR A 1 98  ? 35.131  12.997  32.202  1.00 27.36  ? 98   TYR A CA  1 
ATOM   779  C  C   . TYR A 1 98  ? 33.771  12.628  31.651  1.00 26.79  ? 98   TYR A C   1 
ATOM   780  O  O   . TYR A 1 98  ? 33.510  12.816  30.466  1.00 28.50  ? 98   TYR A O   1 
ATOM   781  C  CB  . TYR A 1 98  ? 35.076  14.367  32.893  1.00 31.34  ? 98   TYR A CB  1 
ATOM   782  C  CG  . TYR A 1 98  ? 36.407  14.810  33.455  1.00 38.59  ? 98   TYR A CG  1 
ATOM   783  C  CD1 . TYR A 1 98  ? 36.757  14.523  34.774  1.00 30.78  ? 98   TYR A CD1 1 
ATOM   784  C  CD2 . TYR A 1 98  ? 37.323  15.502  32.663  1.00 30.87  ? 98   TYR A CD2 1 
ATOM   785  C  CE1 . TYR A 1 98  ? 37.980  14.912  35.288  1.00 34.81  ? 98   TYR A CE1 1 
ATOM   786  C  CE2 . TYR A 1 98  ? 38.546  15.895  33.168  1.00 36.20  ? 98   TYR A CE2 1 
ATOM   787  C  CZ  . TYR A 1 98  ? 38.870  15.595  34.481  1.00 42.79  ? 98   TYR A CZ  1 
ATOM   788  O  OH  . TYR A 1 98  ? 40.084  15.983  34.990  1.00 32.10  ? 98   TYR A OH  1 
ATOM   789  N  N   . LEU A 1 99  ? 32.911  12.088  32.506  1.00 29.48  ? 99   LEU A N   1 
ATOM   790  C  CA  . LEU A 1 99  ? 31.565  11.726  32.093  1.00 29.99  ? 99   LEU A CA  1 
ATOM   791  C  C   . LEU A 1 99  ? 30.530  12.230  33.094  1.00 32.87  ? 99   LEU A C   1 
ATOM   792  O  O   . LEU A 1 99  ? 30.865  12.613  34.220  1.00 28.53  ? 99   LEU A O   1 
ATOM   793  C  CB  . LEU A 1 99  ? 31.441  10.211  31.865  1.00 29.96  ? 99   LEU A CB  1 
ATOM   794  C  CG  . LEU A 1 99  ? 31.738  9.233   33.010  1.00 31.19  ? 99   LEU A CG  1 
ATOM   795  C  CD1 . LEU A 1 99  ? 30.660  9.270   34.091  1.00 19.94  ? 99   LEU A CD1 1 
ATOM   796  C  CD2 . LEU A 1 99  ? 31.903  7.811   32.480  1.00 21.74  ? 99   LEU A CD2 1 
ATOM   797  N  N   . ASN A 1 100 ? 29.270  12.221  32.675  1.00 27.99  ? 100  ASN A N   1 
ATOM   798  C  CA  . ASN A 1 100 ? 28.194  12.796  33.466  1.00 26.96  ? 100  ASN A CA  1 
ATOM   799  C  C   . ASN A 1 100 ? 27.042  11.825  33.618  1.00 29.25  ? 100  ASN A C   1 
ATOM   800  O  O   . ASN A 1 100 ? 26.739  11.063  32.700  1.00 32.84  ? 100  ASN A O   1 
ATOM   801  C  CB  . ASN A 1 100 ? 27.691  14.078  32.810  1.00 24.68  ? 100  ASN A CB  1 
ATOM   802  C  CG  . ASN A 1 100 ? 28.820  14.996  32.383  1.00 31.75  ? 100  ASN A CG  1 
ATOM   803  O  OD1 . ASN A 1 100 ? 29.581  15.491  33.215  1.00 33.93  ? 100  ASN A OD1 1 
ATOM   804  N  ND2 . ASN A 1 100 ? 28.933  15.231  31.080  1.00 27.29  ? 100  ASN A ND2 1 
ATOM   805  N  N   . VAL A 1 101 ? 26.401  11.863  34.782  1.00 31.83  ? 101  VAL A N   1 
ATOM   806  C  CA  . VAL A 1 101 ? 25.248  11.015  35.061  1.00 25.56  ? 101  VAL A CA  1 
ATOM   807  C  C   . VAL A 1 101 ? 24.063  11.837  35.576  1.00 31.40  ? 101  VAL A C   1 
ATOM   808  O  O   . VAL A 1 101 ? 24.205  12.630  36.507  1.00 31.43  ? 101  VAL A O   1 
ATOM   809  C  CB  . VAL A 1 101 ? 25.595  9.935   36.113  1.00 30.15  ? 101  VAL A CB  1 
ATOM   810  C  CG1 . VAL A 1 101 ? 24.393  9.049   36.375  1.00 29.53  ? 101  VAL A CG1 1 
ATOM   811  C  CG2 . VAL A 1 101 ? 26.800  9.103   35.657  1.00 24.70  ? 101  VAL A CG2 1 
ATOM   812  N  N   . TRP A 1 102 ? 22.899  11.658  34.959  1.00 29.36  ? 102  TRP A N   1 
ATOM   813  C  CA  . TRP A 1 102 ? 21.653  12.193  35.502  1.00 26.76  ? 102  TRP A CA  1 
ATOM   814  C  C   . TRP A 1 102 ? 20.779  11.009  35.872  1.00 35.73  ? 102  TRP A C   1 
ATOM   815  O  O   . TRP A 1 102 ? 20.750  10.007  35.153  1.00 31.96  ? 102  TRP A O   1 
ATOM   816  C  CB  . TRP A 1 102 ? 20.899  13.029  34.469  1.00 29.95  ? 102  TRP A CB  1 
ATOM   817  C  CG  . TRP A 1 102 ? 21.503  14.346  34.091  1.00 29.56  ? 102  TRP A CG  1 
ATOM   818  C  CD1 . TRP A 1 102 ? 21.198  15.572  34.617  1.00 36.36  ? 102  TRP A CD1 1 
ATOM   819  C  CD2 . TRP A 1 102 ? 22.473  14.583  33.064  1.00 29.51  ? 102  TRP A CD2 1 
ATOM   820  N  NE1 . TRP A 1 102 ? 21.930  16.552  33.994  1.00 35.24  ? 102  TRP A NE1 1 
ATOM   821  C  CE2 . TRP A 1 102 ? 22.723  15.971  33.037  1.00 35.60  ? 102  TRP A CE2 1 
ATOM   822  C  CE3 . TRP A 1 102 ? 23.165  13.755  32.172  1.00 31.00  ? 102  TRP A CE3 1 
ATOM   823  C  CZ2 . TRP A 1 102 ? 23.633  16.550  32.153  1.00 35.54  ? 102  TRP A CZ2 1 
ATOM   824  C  CZ3 . TRP A 1 102 ? 24.068  14.332  31.292  1.00 32.26  ? 102  TRP A CZ3 1 
ATOM   825  C  CH2 . TRP A 1 102 ? 24.293  15.717  31.290  1.00 37.80  ? 102  TRP A CH2 1 
ATOM   826  N  N   . THR A 1 103 ? 20.063  11.125  36.986  1.00 27.98  ? 103  THR A N   1 
ATOM   827  C  CA  . THR A 1 103 ? 19.140  10.090  37.427  1.00 28.82  ? 103  THR A CA  1 
ATOM   828  C  C   . THR A 1 103 ? 17.993  10.768  38.140  1.00 37.81  ? 103  THR A C   1 
ATOM   829  O  O   . THR A 1 103 ? 18.122  11.916  38.567  1.00 35.32  ? 103  THR A O   1 
ATOM   830  C  CB  . THR A 1 103 ? 19.784  9.120   38.443  1.00 36.82  ? 103  THR A CB  1 
ATOM   831  O  OG1 . THR A 1 103 ? 19.963  9.796   39.692  1.00 37.28  ? 103  THR A OG1 1 
ATOM   832  C  CG2 . THR A 1 103 ? 21.130  8.594   37.947  1.00 30.95  ? 103  THR A CG2 1 
ATOM   833  N  N   . PRO A 1 104 ? 16.863  10.062  38.278  1.00 36.01  ? 104  PRO A N   1 
ATOM   834  C  CA  . PRO A 1 104 ? 15.762  10.588  39.086  1.00 34.39  ? 104  PRO A CA  1 
ATOM   835  C  C   . PRO A 1 104 ? 16.251  10.989  40.472  1.00 39.52  ? 104  PRO A C   1 
ATOM   836  O  O   . PRO A 1 104 ? 17.325  10.571  40.902  1.00 39.25  ? 104  PRO A O   1 
ATOM   837  C  CB  . PRO A 1 104 ? 14.812  9.395   39.191  1.00 34.14  ? 104  PRO A CB  1 
ATOM   838  C  CG  . PRO A 1 104 ? 15.066  8.609   37.943  1.00 34.98  ? 104  PRO A CG  1 
ATOM   839  C  CD  . PRO A 1 104 ? 16.532  8.767   37.657  1.00 40.44  ? 104  PRO A CD  1 
ATOM   840  N  N   . TYR A 1 105 ? 15.468  11.810  41.158  1.00 34.63  ? 105  TYR A N   1 
ATOM   841  C  CA  . TYR A 1 105 ? 15.789  12.198  42.518  1.00 38.67  ? 105  TYR A CA  1 
ATOM   842  C  C   . TYR A 1 105 ? 14.579  12.009  43.427  1.00 49.64  ? 105  TYR A C   1 
ATOM   843  O  O   . TYR A 1 105 ? 13.514  12.582  43.181  1.00 47.13  ? 105  TYR A O   1 
ATOM   844  C  CB  . TYR A 1 105 ? 16.248  13.650  42.563  1.00 33.05  ? 105  TYR A CB  1 
ATOM   845  C  CG  . TYR A 1 105 ? 16.621  14.106  43.947  1.00 35.95  ? 105  TYR A CG  1 
ATOM   846  C  CD1 . TYR A 1 105 ? 17.948  14.190  44.329  1.00 30.27  ? 105  TYR A CD1 1 
ATOM   847  C  CD2 . TYR A 1 105 ? 15.645  14.440  44.880  1.00 39.78  ? 105  TYR A CD2 1 
ATOM   848  C  CE1 . TYR A 1 105 ? 18.298  14.602  45.592  1.00 42.07  ? 105  TYR A CE1 1 
ATOM   849  C  CE2 . TYR A 1 105 ? 15.989  14.858  46.149  1.00 39.32  ? 105  TYR A CE2 1 
ATOM   850  C  CZ  . TYR A 1 105 ? 17.320  14.935  46.498  1.00 38.23  ? 105  TYR A CZ  1 
ATOM   851  O  OH  . TYR A 1 105 ? 17.689  15.345  47.755  1.00 33.69  ? 105  TYR A OH  1 
ATOM   852  N  N   . PRO A 1 106 ? 14.733  11.196  44.480  1.00 46.48  ? 106  PRO A N   1 
ATOM   853  C  CA  . PRO A 1 106 ? 15.937  10.418  44.794  1.00 45.68  ? 106  PRO A CA  1 
ATOM   854  C  C   . PRO A 1 106 ? 16.191  9.366   43.728  1.00 39.18  ? 106  PRO A C   1 
ATOM   855  O  O   . PRO A 1 106 ? 15.340  9.162   42.865  1.00 40.59  ? 106  PRO A O   1 
ATOM   856  C  CB  . PRO A 1 106 ? 15.561  9.731   46.112  1.00 45.67  ? 106  PRO A CB  1 
ATOM   857  C  CG  . PRO A 1 106 ? 14.062  9.685   46.075  1.00 42.03  ? 106  PRO A CG  1 
ATOM   858  C  CD  . PRO A 1 106 ? 13.707  11.023  45.519  1.00 43.35  ? 106  PRO A CD  1 
ATOM   859  N  N   . ARG A 1 107 ? 17.343  8.707   43.792  1.00 41.80  ? 107  ARG A N   1 
ATOM   860  C  CA  . ARG A 1 107 ? 17.729  7.734   42.776  1.00 43.68  ? 107  ARG A CA  1 
ATOM   861  C  C   . ARG A 1 107 ? 16.747  6.576   42.731  1.00 38.98  ? 107  ARG A C   1 
ATOM   862  O  O   . ARG A 1 107 ? 16.031  6.340   43.697  1.00 48.15  ? 107  ARG A O   1 
ATOM   863  C  CB  . ARG A 1 107 ? 19.155  7.235   43.025  1.00 35.82  ? 107  ARG A CB  1 
ATOM   864  C  CG  . ARG A 1 107 ? 20.161  8.371   43.100  1.00 47.82  ? 107  ARG A CG  1 
ATOM   865  C  CD  . ARG A 1 107 ? 21.590  7.889   42.956  1.00 50.66  ? 107  ARG A CD  1 
ATOM   866  N  NE  . ARG A 1 107 ? 22.016  7.059   44.078  1.00 44.17  ? 107  ARG A NE  1 
ATOM   867  C  CZ  . ARG A 1 107 ? 22.347  7.533   45.272  1.00 45.94  ? 107  ARG A CZ  1 
ATOM   868  N  NH1 . ARG A 1 107 ? 22.286  8.834   45.506  1.00 41.51  ? 107  ARG A NH1 1 
ATOM   869  N  NH2 . ARG A 1 107 ? 22.731  6.705   46.234  1.00 50.40  ? 107  ARG A NH2 1 
ATOM   870  N  N   . PRO A 1 108 ? 16.703  5.863   41.596  1.00 44.11  ? 108  PRO A N   1 
ATOM   871  C  CA  . PRO A 1 108 ? 15.793  4.739   41.355  1.00 55.24  ? 108  PRO A CA  1 
ATOM   872  C  C   . PRO A 1 108 ? 15.904  3.612   42.379  1.00 61.11  ? 108  PRO A C   1 
ATOM   873  O  O   . PRO A 1 108 ? 16.988  3.332   42.893  1.00 47.96  ? 108  PRO A O   1 
ATOM   874  C  CB  . PRO A 1 108 ? 16.231  4.235   39.980  1.00 45.07  ? 108  PRO A CB  1 
ATOM   875  C  CG  . PRO A 1 108 ? 16.759  5.441   39.307  1.00 34.65  ? 108  PRO A CG  1 
ATOM   876  C  CD  . PRO A 1 108 ? 17.472  6.202   40.387  1.00 46.04  ? 108  PRO A CD  1 
ATOM   877  N  N   . ALA A 1 109 ? 14.770  2.971   42.650  1.00 58.41  ? 109  ALA A N   1 
ATOM   878  C  CA  . ALA A 1 109 ? 14.693  1.856   43.586  1.00 68.22  ? 109  ALA A CA  1 
ATOM   879  C  C   . ALA A 1 109 ? 15.161  0.558   42.931  1.00 66.57  ? 109  ALA A C   1 
ATOM   880  O  O   . ALA A 1 109 ? 16.023  -0.142  43.461  1.00 65.79  ? 109  ALA A O   1 
ATOM   881  C  CB  . ALA A 1 109 ? 13.265  1.705   44.099  1.00 68.09  ? 109  ALA A CB  1 
ATOM   882  N  N   . SER A 1 110 ? 14.582  0.240   41.779  1.00 51.64  ? 110  SER A N   1 
ATOM   883  C  CA  . SER A 1 110 ? 14.980  -0.942  41.030  1.00 56.98  ? 110  SER A CA  1 
ATOM   884  C  C   . SER A 1 110 ? 15.945  -0.543  39.920  1.00 57.17  ? 110  SER A C   1 
ATOM   885  O  O   . SER A 1 110 ? 16.060  0.637   39.590  1.00 51.01  ? 110  SER A O   1 
ATOM   886  C  CB  . SER A 1 110 ? 13.755  -1.638  40.441  1.00 57.53  ? 110  SER A CB  1 
ATOM   887  O  OG  . SER A 1 110 ? 13.089  -0.796  39.518  1.00 61.43  ? 110  SER A OG  1 
ATOM   888  N  N   . PRO A 1 111 ? 16.657  -1.525  39.351  1.00 52.68  ? 111  PRO A N   1 
ATOM   889  C  CA  . PRO A 1 111 ? 17.560  -1.267  38.226  1.00 48.50  ? 111  PRO A CA  1 
ATOM   890  C  C   . PRO A 1 111 ? 16.849  -0.559  37.075  1.00 51.66  ? 111  PRO A C   1 
ATOM   891  O  O   . PRO A 1 111 ? 15.835  -1.035  36.567  1.00 47.07  ? 111  PRO A O   1 
ATOM   892  C  CB  . PRO A 1 111 ? 17.996  -2.671  37.809  1.00 47.07  ? 111  PRO A CB  1 
ATOM   893  C  CG  . PRO A 1 111 ? 17.941  -3.453  39.075  1.00 43.28  ? 111  PRO A CG  1 
ATOM   894  C  CD  . PRO A 1 111 ? 16.754  -2.916  39.824  1.00 48.98  ? 111  PRO A CD  1 
ATOM   895  N  N   . THR A 1 112 ? 17.393  0.581   36.672  1.00 43.53  ? 112  THR A N   1 
ATOM   896  C  CA  . THR A 1 112 ? 16.796  1.402   35.632  1.00 35.29  ? 112  THR A CA  1 
ATOM   897  C  C   . THR A 1 112 ? 17.593  1.322   34.324  1.00 34.22  ? 112  THR A C   1 
ATOM   898  O  O   . THR A 1 112 ? 18.819  1.383   34.338  1.00 35.79  ? 112  THR A O   1 
ATOM   899  C  CB  . THR A 1 112 ? 16.705  2.854   36.114  1.00 36.46  ? 112  THR A CB  1 
ATOM   900  O  OG1 . THR A 1 112 ? 15.954  2.887   37.332  1.00 41.88  ? 112  THR A OG1 1 
ATOM   901  C  CG2 . THR A 1 112 ? 16.037  3.744   35.074  1.00 41.02  ? 112  THR A CG2 1 
ATOM   902  N  N   . PRO A 1 113 ? 16.892  1.177   33.190  1.00 33.72  ? 113  PRO A N   1 
ATOM   903  C  CA  . PRO A 1 113 ? 17.545  1.103   31.878  1.00 42.79  ? 113  PRO A CA  1 
ATOM   904  C  C   . PRO A 1 113 ? 18.372  2.353   31.593  1.00 37.07  ? 113  PRO A C   1 
ATOM   905  O  O   . PRO A 1 113 ? 17.933  3.469   31.869  1.00 33.64  ? 113  PRO A O   1 
ATOM   906  C  CB  . PRO A 1 113 ? 16.366  1.002   30.899  1.00 36.47  ? 113  PRO A CB  1 
ATOM   907  C  CG  . PRO A 1 113 ? 15.224  0.489   31.723  1.00 39.14  ? 113  PRO A CG  1 
ATOM   908  C  CD  . PRO A 1 113 ? 15.425  1.093   33.083  1.00 42.60  ? 113  PRO A CD  1 
ATOM   909  N  N   . VAL A 1 114 ? 19.563  2.160   31.037  1.00 41.09  ? 114  VAL A N   1 
ATOM   910  C  CA  . VAL A 1 114 ? 20.529  3.245   30.900  1.00 33.88  ? 114  VAL A CA  1 
ATOM   911  C  C   . VAL A 1 114 ? 20.656  3.753   29.469  1.00 34.39  ? 114  VAL A C   1 
ATOM   912  O  O   . VAL A 1 114 ? 20.726  2.972   28.522  1.00 37.11  ? 114  VAL A O   1 
ATOM   913  C  CB  . VAL A 1 114 ? 21.916  2.799   31.383  1.00 35.37  ? 114  VAL A CB  1 
ATOM   914  C  CG1 . VAL A 1 114 ? 22.915  3.934   31.236  1.00 31.00  ? 114  VAL A CG1 1 
ATOM   915  C  CG2 . VAL A 1 114 ? 21.842  2.307   32.831  1.00 30.37  ? 114  VAL A CG2 1 
ATOM   916  N  N   . LEU A 1 115 ? 20.686  5.071   29.320  1.00 34.31  ? 115  LEU A N   1 
ATOM   917  C  CA  . LEU A 1 115 ? 20.916  5.692   28.022  1.00 31.43  ? 115  LEU A CA  1 
ATOM   918  C  C   . LEU A 1 115 ? 22.280  6.351   28.034  1.00 30.22  ? 115  LEU A C   1 
ATOM   919  O  O   . LEU A 1 115 ? 22.567  7.164   28.910  1.00 34.61  ? 115  LEU A O   1 
ATOM   920  C  CB  . LEU A 1 115 ? 19.846  6.748   27.727  1.00 37.65  ? 115  LEU A CB  1 
ATOM   921  C  CG  . LEU A 1 115 ? 18.523  6.312   27.101  1.00 34.33  ? 115  LEU A CG  1 
ATOM   922  C  CD1 . LEU A 1 115 ? 17.586  7.495   26.986  1.00 37.89  ? 115  LEU A CD1 1 
ATOM   923  C  CD2 . LEU A 1 115 ? 18.786  5.725   25.737  1.00 45.55  ? 115  LEU A CD2 1 
ATOM   924  N  N   . ILE A 1 116 ? 23.122  6.003   27.069  1.00 28.29  ? 116  ILE A N   1 
ATOM   925  C  CA  . ILE A 1 116 ? 24.426  6.648   26.949  1.00 34.18  ? 116  ILE A CA  1 
ATOM   926  C  C   . ILE A 1 116 ? 24.505  7.494   25.683  1.00 28.13  ? 116  ILE A C   1 
ATOM   927  O  O   . ILE A 1 116 ? 24.423  6.973   24.572  1.00 29.93  ? 116  ILE A O   1 
ATOM   928  C  CB  . ILE A 1 116 ? 25.578  5.624   26.942  1.00 28.34  ? 116  ILE A CB  1 
ATOM   929  C  CG1 . ILE A 1 116 ? 25.513  4.736   28.182  1.00 29.69  ? 116  ILE A CG1 1 
ATOM   930  C  CG2 . ILE A 1 116 ? 26.908  6.333   26.888  1.00 28.32  ? 116  ILE A CG2 1 
ATOM   931  C  CD1 . ILE A 1 116 ? 26.591  3.683   28.219  1.00 21.31  ? 116  ILE A CD1 1 
ATOM   932  N  N   . TRP A 1 117 ? 24.667  8.800   25.857  1.00 26.35  ? 117  TRP A N   1 
ATOM   933  C  CA  . TRP A 1 117 ? 24.791  9.707   24.724  1.00 25.50  ? 117  TRP A CA  1 
ATOM   934  C  C   . TRP A 1 117 ? 26.238  9.859   24.270  1.00 31.69  ? 117  TRP A C   1 
ATOM   935  O  O   . TRP A 1 117 ? 27.153  9.930   25.091  1.00 27.10  ? 117  TRP A O   1 
ATOM   936  C  CB  . TRP A 1 117 ? 24.208  11.073  25.072  1.00 25.45  ? 117  TRP A CB  1 
ATOM   937  C  CG  . TRP A 1 117 ? 24.371  12.108  23.990  1.00 32.83  ? 117  TRP A CG  1 
ATOM   938  C  CD1 . TRP A 1 117 ? 25.218  13.180  24.000  1.00 26.73  ? 117  TRP A CD1 1 
ATOM   939  C  CD2 . TRP A 1 117 ? 23.659  12.174  22.749  1.00 29.56  ? 117  TRP A CD2 1 
ATOM   940  N  NE1 . TRP A 1 117 ? 25.075  13.908  22.846  1.00 27.87  ? 117  TRP A NE1 1 
ATOM   941  C  CE2 . TRP A 1 117 ? 24.125  13.313  22.061  1.00 28.86  ? 117  TRP A CE2 1 
ATOM   942  C  CE3 . TRP A 1 117 ? 22.674  11.383  22.155  1.00 28.72  ? 117  TRP A CE3 1 
ATOM   943  C  CZ2 . TRP A 1 117 ? 23.635  13.680  20.810  1.00 27.65  ? 117  TRP A CZ2 1 
ATOM   944  C  CZ3 . TRP A 1 117 ? 22.192  11.748  20.908  1.00 28.95  ? 117  TRP A CZ3 1 
ATOM   945  C  CH2 . TRP A 1 117 ? 22.674  12.884  20.251  1.00 31.61  ? 117  TRP A CH2 1 
ATOM   946  N  N   . ILE A 1 118 ? 26.430  9.894   22.955  1.00 29.90  ? 118  ILE A N   1 
ATOM   947  C  CA  . ILE A 1 118 ? 27.731  10.177  22.357  1.00 30.14  ? 118  ILE A CA  1 
ATOM   948  C  C   . ILE A 1 118 ? 27.572  11.318  21.358  1.00 28.81  ? 118  ILE A C   1 
ATOM   949  O  O   . ILE A 1 118 ? 26.948  11.147  20.308  1.00 31.92  ? 118  ILE A O   1 
ATOM   950  C  CB  . ILE A 1 118 ? 28.295  8.955   21.607  1.00 23.57  ? 118  ILE A CB  1 
ATOM   951  C  CG1 . ILE A 1 118 ? 28.327  7.726   22.510  1.00 22.71  ? 118  ILE A CG1 1 
ATOM   952  C  CG2 . ILE A 1 118 ? 29.689  9.253   21.076  1.00 25.25  ? 118  ILE A CG2 1 
ATOM   953  C  CD1 . ILE A 1 118 ? 28.772  6.468   21.783  1.00 21.63  ? 118  ILE A CD1 1 
ATOM   954  N  N   . TYR A 1 119 ? 28.133  12.479  21.681  1.00 22.57  ? 119  TYR A N   1 
ATOM   955  C  CA  . TYR A 1 119 ? 27.956  13.667  20.846  1.00 25.88  ? 119  TYR A CA  1 
ATOM   956  C  C   . TYR A 1 119 ? 28.630  13.591  19.472  1.00 28.95  ? 119  TYR A C   1 
ATOM   957  O  O   . TYR A 1 119 ? 29.559  12.810  19.254  1.00 24.22  ? 119  TYR A O   1 
ATOM   958  C  CB  . TYR A 1 119 ? 28.428  14.922  21.582  1.00 29.11  ? 119  TYR A CB  1 
ATOM   959  C  CG  . TYR A 1 119 ? 29.876  14.890  22.024  1.00 31.40  ? 119  TYR A CG  1 
ATOM   960  C  CD1 . TYR A 1 119 ? 30.914  15.023  21.103  1.00 27.65  ? 119  TYR A CD1 1 
ATOM   961  C  CD2 . TYR A 1 119 ? 30.203  14.746  23.368  1.00 23.24  ? 119  TYR A CD2 1 
ATOM   962  C  CE1 . TYR A 1 119 ? 32.235  15.003  21.511  1.00 25.61  ? 119  TYR A CE1 1 
ATOM   963  C  CE2 . TYR A 1 119 ? 31.512  14.726  23.788  1.00 27.25  ? 119  TYR A CE2 1 
ATOM   964  C  CZ  . TYR A 1 119 ? 32.527  14.854  22.859  1.00 32.56  ? 119  TYR A CZ  1 
ATOM   965  O  OH  . TYR A 1 119 ? 33.831  14.826  23.288  1.00 24.26  ? 119  TYR A OH  1 
ATOM   966  N  N   . GLY A 1 120 ? 28.147  14.421  18.554  1.00 24.47  ? 120  GLY A N   1 
ATOM   967  C  CA  . GLY A 1 120 ? 28.747  14.555  17.240  1.00 32.10  ? 120  GLY A CA  1 
ATOM   968  C  C   . GLY A 1 120 ? 29.632  15.787  17.165  1.00 29.98  ? 120  GLY A C   1 
ATOM   969  O  O   . GLY A 1 120 ? 29.925  16.416  18.185  1.00 31.77  ? 120  GLY A O   1 
ATOM   970  N  N   . GLY A 1 121 ? 30.060  16.133  15.956  1.00 32.63  ? 121  GLY A N   1 
ATOM   971  C  CA  . GLY A 1 121 ? 30.963  17.252  15.763  1.00 20.36  ? 121  GLY A CA  1 
ATOM   972  C  C   . GLY A 1 121 ? 32.117  16.899  14.845  1.00 28.82  ? 121  GLY A C   1 
ATOM   973  O  O   . GLY A 1 121 ? 33.246  17.370  15.032  1.00 32.92  ? 121  GLY A O   1 
ATOM   974  N  N   . GLY A 1 122 ? 31.835  16.050  13.862  1.00 24.01  ? 122  GLY A N   1 
ATOM   975  C  CA  . GLY A 1 122 ? 32.791  15.713  12.820  1.00 23.02  ? 122  GLY A CA  1 
ATOM   976  C  C   . GLY A 1 122 ? 34.084  15.114  13.337  1.00 30.72  ? 122  GLY A C   1 
ATOM   977  O  O   . GLY A 1 122 ? 35.109  15.154  12.657  1.00 27.38  ? 122  GLY A O   1 
ATOM   978  N  N   . PHE A 1 123 ? 34.034  14.556  14.543  1.00 26.92  ? 123  PHE A N   1 
ATOM   979  C  CA  . PHE A 1 123 ? 35.225  14.007  15.191  1.00 27.42  ? 123  PHE A CA  1 
ATOM   980  C  C   . PHE A 1 123 ? 36.317  15.043  15.495  1.00 26.76  ? 123  PHE A C   1 
ATOM   981  O  O   . PHE A 1 123 ? 37.408  14.676  15.921  1.00 28.55  ? 123  PHE A O   1 
ATOM   982  C  CB  . PHE A 1 123 ? 35.814  12.863  14.367  1.00 28.16  ? 123  PHE A CB  1 
ATOM   983  C  CG  . PHE A 1 123 ? 34.943  11.649  14.311  1.00 26.42  ? 123  PHE A CG  1 
ATOM   984  C  CD1 . PHE A 1 123 ? 34.769  10.854  15.432  1.00 24.40  ? 123  PHE A CD1 1 
ATOM   985  C  CD2 . PHE A 1 123 ? 34.302  11.298  13.135  1.00 28.67  ? 123  PHE A CD2 1 
ATOM   986  C  CE1 . PHE A 1 123 ? 33.969  9.727   15.384  1.00 23.96  ? 123  PHE A CE1 1 
ATOM   987  C  CE2 . PHE A 1 123 ? 33.502  10.176  13.080  1.00 27.43  ? 123  PHE A CE2 1 
ATOM   988  C  CZ  . PHE A 1 123 ? 33.336  9.389   14.207  1.00 32.21  ? 123  PHE A CZ  1 
ATOM   989  N  N   . TYR A 1 124 ? 36.022  16.324  15.278  1.00 25.82  ? 124  TYR A N   1 
ATOM   990  C  CA  . TYR A 1 124 ? 36.963  17.402  15.587  1.00 27.74  ? 124  TYR A CA  1 
ATOM   991  C  C   . TYR A 1 124 ? 36.415  18.321  16.682  1.00 31.62  ? 124  TYR A C   1 
ATOM   992  O  O   . TYR A 1 124 ? 37.110  19.211  17.165  1.00 30.98  ? 124  TYR A O   1 
ATOM   993  C  CB  . TYR A 1 124 ? 37.274  18.233  14.336  1.00 28.50  ? 124  TYR A CB  1 
ATOM   994  C  CG  . TYR A 1 124 ? 36.109  19.081  13.880  1.00 28.40  ? 124  TYR A CG  1 
ATOM   995  C  CD1 . TYR A 1 124 ? 35.883  20.335  14.431  1.00 25.04  ? 124  TYR A CD1 1 
ATOM   996  C  CD2 . TYR A 1 124 ? 35.226  18.621  12.910  1.00 28.18  ? 124  TYR A CD2 1 
ATOM   997  C  CE1 . TYR A 1 124 ? 34.813  21.110  14.033  1.00 28.84  ? 124  TYR A CE1 1 
ATOM   998  C  CE2 . TYR A 1 124 ? 34.151  19.389  12.499  1.00 30.24  ? 124  TYR A CE2 1 
ATOM   999  C  CZ  . TYR A 1 124 ? 33.949  20.633  13.067  1.00 38.84  ? 124  TYR A CZ  1 
ATOM   1000 O  OH  . TYR A 1 124 ? 32.883  21.402  12.671  1.00 37.02  ? 124  TYR A OH  1 
ATOM   1001 N  N   . SER A 1 125 ? 35.161  18.119  17.064  1.00 26.64  ? 125  SER A N   1 
ATOM   1002 C  CA  . SER A 1 125 ? 34.553  18.986  18.063  1.00 26.03  ? 125  SER A CA  1 
ATOM   1003 C  C   . SER A 1 125 ? 33.463  18.259  18.834  1.00 26.36  ? 125  SER A C   1 
ATOM   1004 O  O   . SER A 1 125 ? 33.171  17.098  18.559  1.00 24.05  ? 125  SER A O   1 
ATOM   1005 C  CB  . SER A 1 125 ? 33.977  20.241  17.401  1.00 24.59  ? 125  SER A CB  1 
ATOM   1006 O  OG  . SER A 1 125 ? 32.971  19.903  16.463  1.00 27.88  ? 125  SER A OG  1 
ATOM   1007 N  N   . GLY A 1 126 ? 32.864  18.957  19.794  1.00 22.88  ? 126  GLY A N   1 
ATOM   1008 C  CA  . GLY A 1 126 ? 31.778  18.407  20.580  1.00 24.51  ? 126  GLY A CA  1 
ATOM   1009 C  C   . GLY A 1 126 ? 32.096  18.366  22.061  1.00 27.40  ? 126  GLY A C   1 
ATOM   1010 O  O   . GLY A 1 126 ? 33.248  18.500  22.465  1.00 24.51  ? 126  GLY A O   1 
ATOM   1011 N  N   . ALA A 1 127 ? 31.063  18.175  22.870  1.00 25.88  ? 127  ALA A N   1 
ATOM   1012 C  CA  . ALA A 1 127 ? 31.200  18.141  24.318  1.00 29.95  ? 127  ALA A CA  1 
ATOM   1013 C  C   . ALA A 1 127 ? 29.890  17.644  24.908  1.00 25.71  ? 127  ALA A C   1 
ATOM   1014 O  O   . ALA A 1 127 ? 28.826  17.919  24.366  1.00 35.84  ? 127  ALA A O   1 
ATOM   1015 C  CB  . ALA A 1 127 ? 31.534  19.523  24.849  1.00 27.39  ? 127  ALA A CB  1 
ATOM   1016 N  N   . ALA A 1 128 ? 29.962  16.906  26.009  1.00 25.46  ? 128  ALA A N   1 
ATOM   1017 C  CA  . ALA A 1 128 ? 28.760  16.338  26.609  1.00 25.92  ? 128  ALA A CA  1 
ATOM   1018 C  C   . ALA A 1 128 ? 28.110  17.337  27.551  1.00 25.96  ? 128  ALA A C   1 
ATOM   1019 O  O   . ALA A 1 128 ? 27.061  17.068  28.131  1.00 35.80  ? 128  ALA A O   1 
ATOM   1020 C  CB  . ALA A 1 128 ? 29.077  15.033  27.334  1.00 25.61  ? 128  ALA A CB  1 
ATOM   1021 N  N   . SER A 1 129 ? 28.738  18.497  27.689  1.00 24.90  ? 129  SER A N   1 
ATOM   1022 C  CA  . SER A 1 129 ? 28.240  19.543  28.575  1.00 25.96  ? 129  SER A CA  1 
ATOM   1023 C  C   . SER A 1 129 ? 27.401  20.606  27.851  1.00 27.76  ? 129  SER A C   1 
ATOM   1024 O  O   . SER A 1 129 ? 26.954  21.569  28.473  1.00 31.01  ? 129  SER A O   1 
ATOM   1025 C  CB  . SER A 1 129 ? 29.413  20.209  29.303  1.00 25.29  ? 129  SER A CB  1 
ATOM   1026 O  OG  . SER A 1 129 ? 30.306  20.801  28.373  1.00 23.45  ? 129  SER A OG  1 
ATOM   1027 N  N   . LEU A 1 130 ? 27.191  20.443  26.546  1.00 23.97  ? 130  LEU A N   1 
ATOM   1028 C  CA  . LEU A 1 130 ? 26.369  21.391  25.786  1.00 26.12  ? 130  LEU A CA  1 
ATOM   1029 C  C   . LEU A 1 130 ? 24.915  21.402  26.271  1.00 27.63  ? 130  LEU A C   1 
ATOM   1030 O  O   . LEU A 1 130 ? 24.392  20.388  26.734  1.00 28.38  ? 130  LEU A O   1 
ATOM   1031 C  CB  . LEU A 1 130 ? 26.420  21.081  24.287  1.00 26.81  ? 130  LEU A CB  1 
ATOM   1032 C  CG  . LEU A 1 130 ? 27.800  21.123  23.626  1.00 33.55  ? 130  LEU A CG  1 
ATOM   1033 C  CD1 . LEU A 1 130 ? 27.678  20.934  22.128  1.00 24.85  ? 130  LEU A CD1 1 
ATOM   1034 C  CD2 . LEU A 1 130 ? 28.517  22.429  23.939  1.00 28.48  ? 130  LEU A CD2 1 
ATOM   1035 N  N   . ASP A 1 131 ? 24.260  22.550  26.155  1.00 33.23  ? 131  ASP A N   1 
ATOM   1036 C  CA  . ASP A 1 131 ? 22.891  22.685  26.641  1.00 29.37  ? 131  ASP A CA  1 
ATOM   1037 C  C   . ASP A 1 131 ? 21.920  21.711  25.977  1.00 35.77  ? 131  ASP A C   1 
ATOM   1038 O  O   . ASP A 1 131 ? 21.002  21.206  26.626  1.00 29.88  ? 131  ASP A O   1 
ATOM   1039 C  CB  . ASP A 1 131 ? 22.394  24.120  26.480  1.00 24.81  ? 131  ASP A CB  1 
ATOM   1040 C  CG  . ASP A 1 131 ? 22.899  25.043  27.576  1.00 31.83  ? 131  ASP A CG  1 
ATOM   1041 O  OD1 . ASP A 1 131 ? 23.461  24.549  28.573  1.00 35.13  ? 131  ASP A OD1 1 
ATOM   1042 O  OD2 . ASP A 1 131 ? 22.729  26.272  27.441  1.00 52.61  ? 131  ASP A OD2 1 
ATOM   1043 N  N   . VAL A 1 132 ? 22.120  21.441  24.690  1.00 29.83  ? 132  VAL A N   1 
ATOM   1044 C  CA  . VAL A 1 132 ? 21.215  20.548  23.972  1.00 31.69  ? 132  VAL A CA  1 
ATOM   1045 C  C   . VAL A 1 132 ? 21.360  19.084  24.383  1.00 33.34  ? 132  VAL A C   1 
ATOM   1046 O  O   . VAL A 1 132 ? 20.560  18.245  23.973  1.00 33.96  ? 132  VAL A O   1 
ATOM   1047 C  CB  . VAL A 1 132 ? 21.366  20.660  22.435  1.00 31.67  ? 132  VAL A CB  1 
ATOM   1048 C  CG1 . VAL A 1 132 ? 20.636  21.887  21.921  1.00 44.61  ? 132  VAL A CG1 1 
ATOM   1049 C  CG2 . VAL A 1 132 ? 22.830  20.681  22.035  1.00 24.47  ? 132  VAL A CG2 1 
ATOM   1050 N  N   . TYR A 1 133 ? 22.375  18.774  25.185  1.00 34.03  ? 133  TYR A N   1 
ATOM   1051 C  CA  . TYR A 1 133 ? 22.558  17.401  25.650  1.00 30.39  ? 133  TYR A CA  1 
ATOM   1052 C  C   . TYR A 1 133 ? 22.172  17.234  27.118  1.00 28.94  ? 133  TYR A C   1 
ATOM   1053 O  O   . TYR A 1 133 ? 22.479  16.216  27.731  1.00 28.47  ? 133  TYR A O   1 
ATOM   1054 C  CB  . TYR A 1 133 ? 23.994  16.919  25.419  1.00 34.42  ? 133  TYR A CB  1 
ATOM   1055 C  CG  . TYR A 1 133 ? 24.510  17.109  24.009  1.00 34.76  ? 133  TYR A CG  1 
ATOM   1056 C  CD1 . TYR A 1 133 ? 23.670  16.958  22.913  1.00 25.97  ? 133  TYR A CD1 1 
ATOM   1057 C  CD2 . TYR A 1 133 ? 25.847  17.419  23.774  1.00 28.25  ? 133  TYR A CD2 1 
ATOM   1058 C  CE1 . TYR A 1 133 ? 24.139  17.126  21.624  1.00 27.48  ? 133  TYR A CE1 1 
ATOM   1059 C  CE2 . TYR A 1 133 ? 26.330  17.584  22.488  1.00 22.82  ? 133  TYR A CE2 1 
ATOM   1060 C  CZ  . TYR A 1 133 ? 25.470  17.436  21.417  1.00 33.69  ? 133  TYR A CZ  1 
ATOM   1061 O  OH  . TYR A 1 133 ? 25.940  17.605  20.139  1.00 24.16  ? 133  TYR A OH  1 
ATOM   1062 N  N   . ASP A 1 134 ? 21.482  18.231  27.665  1.00 31.16  ? 134  ASP A N   1 
ATOM   1063 C  CA  . ASP A 1 134 ? 21.078  18.231  29.073  1.00 34.68  ? 134  ASP A CA  1 
ATOM   1064 C  C   . ASP A 1 134 ? 20.157  17.057  29.399  1.00 34.31  ? 134  ASP A C   1 
ATOM   1065 O  O   . ASP A 1 134 ? 19.035  16.983  28.905  1.00 29.49  ? 134  ASP A O   1 
ATOM   1066 C  CB  . ASP A 1 134 ? 20.384  19.554  29.413  1.00 35.09  ? 134  ASP A CB  1 
ATOM   1067 C  CG  . ASP A 1 134 ? 20.043  19.683  30.888  1.00 37.14  ? 134  ASP A CG  1 
ATOM   1068 O  OD1 . ASP A 1 134 ? 20.074  18.674  31.619  1.00 36.51  ? 134  ASP A OD1 1 
ATOM   1069 O  OD2 . ASP A 1 134 ? 19.732  20.811  31.315  1.00 37.39  ? 134  ASP A OD2 1 
ATOM   1070 N  N   . GLY A 1 135 ? 20.629  16.147  30.245  1.00 32.39  ? 135  GLY A N   1 
ATOM   1071 C  CA  . GLY A 1 135 ? 19.883  14.938  30.540  1.00 30.31  ? 135  GLY A CA  1 
ATOM   1072 C  C   . GLY A 1 135 ? 18.838  15.040  31.639  1.00 30.39  ? 135  GLY A C   1 
ATOM   1073 O  O   . GLY A 1 135 ? 18.207  14.044  31.971  1.00 29.22  ? 135  GLY A O   1 
ATOM   1074 N  N   . ARG A 1 136 ? 18.635  16.230  32.197  1.00 29.78  ? 136  ARG A N   1 
ATOM   1075 C  CA  . ARG A 1 136 ? 17.709  16.378  33.321  1.00 35.33  ? 136  ARG A CA  1 
ATOM   1076 C  C   . ARG A 1 136 ? 16.263  16.010  32.970  1.00 38.45  ? 136  ARG A C   1 
ATOM   1077 O  O   . ARG A 1 136 ? 15.547  15.460  33.805  1.00 34.08  ? 136  ARG A O   1 
ATOM   1078 C  CB  . ARG A 1 136 ? 17.778  17.786  33.938  1.00 29.99  ? 136  ARG A CB  1 
ATOM   1079 C  CG  . ARG A 1 136 ? 17.113  18.895  33.120  1.00 37.63  ? 136  ARG A CG  1 
ATOM   1080 C  CD  . ARG A 1 136 ? 17.214  20.247  33.830  1.00 29.56  ? 136  ARG A CD  1 
ATOM   1081 N  NE  . ARG A 1 136 ? 18.584  20.751  33.841  1.00 34.55  ? 136  ARG A NE  1 
ATOM   1082 C  CZ  . ARG A 1 136 ? 19.057  21.647  34.706  1.00 39.60  ? 136  ARG A CZ  1 
ATOM   1083 N  NH1 . ARG A 1 136 ? 20.319  22.035  34.623  1.00 40.53  ? 136  ARG A NH1 1 
ATOM   1084 N  NH2 . ARG A 1 136 ? 18.281  22.153  35.656  1.00 36.58  ? 136  ARG A NH2 1 
ATOM   1085 N  N   . PHE A 1 137 ? 15.846  16.299  31.739  1.00 34.88  ? 137  PHE A N   1 
ATOM   1086 C  CA  . PHE A 1 137 ? 14.454  16.089  31.324  1.00 36.01  ? 137  PHE A CA  1 
ATOM   1087 C  C   . PHE A 1 137 ? 14.109  14.622  31.118  1.00 29.28  ? 137  PHE A C   1 
ATOM   1088 O  O   . PHE A 1 137 ? 13.048  14.169  31.538  1.00 36.01  ? 137  PHE A O   1 
ATOM   1089 C  CB  . PHE A 1 137 ? 14.125  16.891  30.058  1.00 32.72  ? 137  PHE A CB  1 
ATOM   1090 C  CG  . PHE A 1 137 ? 14.506  18.337  30.149  1.00 33.92  ? 137  PHE A CG  1 
ATOM   1091 C  CD1 . PHE A 1 137 ? 13.729  19.229  30.872  1.00 37.04  ? 137  PHE A CD1 1 
ATOM   1092 C  CD2 . PHE A 1 137 ? 15.655  18.802  29.528  1.00 30.47  ? 137  PHE A CD2 1 
ATOM   1093 C  CE1 . PHE A 1 137 ? 14.083  20.565  30.966  1.00 35.23  ? 137  PHE A CE1 1 
ATOM   1094 C  CE2 . PHE A 1 137 ? 16.019  20.133  29.621  1.00 29.47  ? 137  PHE A CE2 1 
ATOM   1095 C  CZ  . PHE A 1 137 ? 15.232  21.017  30.341  1.00 36.42  ? 137  PHE A CZ  1 
ATOM   1096 N  N   . LEU A 1 138 ? 14.995  13.882  30.462  1.00 29.56  ? 138  LEU A N   1 
ATOM   1097 C  CA  . LEU A 1 138 ? 14.767  12.457  30.259  1.00 34.73  ? 138  LEU A CA  1 
ATOM   1098 C  C   . LEU A 1 138 ? 14.810  11.744  31.603  1.00 40.62  ? 138  LEU A C   1 
ATOM   1099 O  O   . LEU A 1 138 ? 14.114  10.751  31.821  1.00 39.07  ? 138  LEU A O   1 
ATOM   1100 C  CB  . LEU A 1 138 ? 15.802  11.867  29.297  1.00 27.15  ? 138  LEU A CB  1 
ATOM   1101 C  CG  . LEU A 1 138 ? 15.517  12.070  27.805  1.00 40.88  ? 138  LEU A CG  1 
ATOM   1102 C  CD1 . LEU A 1 138 ? 16.783  11.941  26.964  1.00 29.33  ? 138  LEU A CD1 1 
ATOM   1103 C  CD2 . LEU A 1 138 ? 14.449  11.091  27.331  1.00 36.66  ? 138  LEU A CD2 1 
ATOM   1104 N  N   . ALA A 1 139 ? 15.633  12.269  32.503  1.00 37.68  ? 139  ALA A N   1 
ATOM   1105 C  CA  . ALA A 1 139 ? 15.778  11.699  33.832  1.00 41.50  ? 139  ALA A CA  1 
ATOM   1106 C  C   . ALA A 1 139 ? 14.512  11.931  34.650  1.00 41.05  ? 139  ALA A C   1 
ATOM   1107 O  O   . ALA A 1 139 ? 14.009  11.019  35.302  1.00 43.61  ? 139  ALA A O   1 
ATOM   1108 C  CB  . ALA A 1 139 ? 16.990  12.307  34.536  1.00 32.01  ? 139  ALA A CB  1 
ATOM   1109 N  N   . GLN A 1 140 ? 13.996  13.154  34.599  1.00 38.92  ? 140  GLN A N   1 
ATOM   1110 C  CA  . GLN A 1 140 ? 12.876  13.548  35.441  1.00 38.52  ? 140  GLN A CA  1 
ATOM   1111 C  C   . GLN A 1 140 ? 11.557  13.018  34.905  1.00 46.45  ? 140  GLN A C   1 
ATOM   1112 O  O   . GLN A 1 140 ? 10.744  12.472  35.652  1.00 51.83  ? 140  GLN A O   1 
ATOM   1113 C  CB  . GLN A 1 140 ? 12.813  15.069  35.558  1.00 29.32  ? 140  GLN A CB  1 
ATOM   1114 C  CG  . GLN A 1 140 ? 12.072  15.563  36.789  1.00 44.68  ? 140  GLN A CG  1 
ATOM   1115 C  CD  . GLN A 1 140 ? 10.572  15.339  36.705  1.00 54.08  ? 140  GLN A CD  1 
ATOM   1116 O  OE1 . GLN A 1 140 ? 9.954   15.579  35.667  1.00 53.91  ? 140  GLN A OE1 1 
ATOM   1117 N  NE2 . GLN A 1 140 ? 9.979   14.881  37.802  1.00 42.45  ? 140  GLN A NE2 1 
ATOM   1118 N  N   . VAL A 1 141 ? 11.350  13.180  33.606  1.00 41.93  ? 141  VAL A N   1 
ATOM   1119 C  CA  . VAL A 1 141 ? 10.080  12.826  32.999  1.00 34.97  ? 141  VAL A CA  1 
ATOM   1120 C  C   . VAL A 1 141 ? 9.975   11.332  32.725  1.00 41.63  ? 141  VAL A C   1 
ATOM   1121 O  O   . VAL A 1 141 ? 8.926   10.733  32.941  1.00 44.90  ? 141  VAL A O   1 
ATOM   1122 C  CB  . VAL A 1 141 ? 9.838   13.621  31.707  1.00 38.92  ? 141  VAL A CB  1 
ATOM   1123 C  CG1 . VAL A 1 141 ? 8.627   13.069  30.961  1.00 30.85  ? 141  VAL A CG1 1 
ATOM   1124 C  CG2 . VAL A 1 141 ? 9.660   15.098  32.027  1.00 33.41  ? 141  VAL A CG2 1 
ATOM   1125 N  N   . GLU A 1 142 ? 11.065  10.730  32.264  1.00 37.97  ? 142  GLU A N   1 
ATOM   1126 C  CA  . GLU A 1 142 ? 11.045  9.314   31.911  1.00 32.70  ? 142  GLU A CA  1 
ATOM   1127 C  C   . GLU A 1 142 ? 11.692  8.427   32.969  1.00 34.34  ? 142  GLU A C   1 
ATOM   1128 O  O   . GLU A 1 142 ? 11.718  7.204   32.832  1.00 31.61  ? 142  GLU A O   1 
ATOM   1129 C  CB  . GLU A 1 142 ? 11.712  9.090   30.554  1.00 32.66  ? 142  GLU A CB  1 
ATOM   1130 C  CG  . GLU A 1 142 ? 10.890  9.611   29.395  1.00 37.07  ? 142  GLU A CG  1 
ATOM   1131 C  CD  . GLU A 1 142 ? 9.543   8.914   29.273  1.00 50.24  ? 142  GLU A CD  1 
ATOM   1132 O  OE1 . GLU A 1 142 ? 9.430   7.734   29.677  1.00 58.02  ? 142  GLU A OE1 1 
ATOM   1133 O  OE2 . GLU A 1 142 ? 8.596   9.547   28.767  1.00 45.06  ? 142  GLU A OE2 1 
ATOM   1134 N  N   . GLY A 1 143 ? 12.214  9.050   34.020  1.00 34.64  ? 143  GLY A N   1 
ATOM   1135 C  CA  . GLY A 1 143 ? 12.873  8.322   35.087  1.00 38.58  ? 143  GLY A CA  1 
ATOM   1136 C  C   . GLY A 1 143 ? 14.097  7.586   34.591  1.00 39.13  ? 143  GLY A C   1 
ATOM   1137 O  O   . GLY A 1 143 ? 14.511  6.586   35.176  1.00 38.45  ? 143  GLY A O   1 
ATOM   1138 N  N   . ALA A 1 144 ? 14.679  8.087   33.505  1.00 34.35  ? 144  ALA A N   1 
ATOM   1139 C  CA  . ALA A 1 144 ? 15.819  7.429   32.876  1.00 37.86  ? 144  ALA A CA  1 
ATOM   1140 C  C   . ALA A 1 144 ? 17.127  7.698   33.609  1.00 34.99  ? 144  ALA A C   1 
ATOM   1141 O  O   . ALA A 1 144 ? 17.277  8.707   34.296  1.00 34.70  ? 144  ALA A O   1 
ATOM   1142 C  CB  . ALA A 1 144 ? 15.941  7.858   31.425  1.00 31.16  ? 144  ALA A CB  1 
ATOM   1143 N  N   . VAL A 1 145 ? 18.064  6.772   33.473  1.00 30.84  ? 145  VAL A N   1 
ATOM   1144 C  CA  . VAL A 1 145 ? 19.432  7.029   33.872  1.00 28.94  ? 145  VAL A CA  1 
ATOM   1145 C  C   . VAL A 1 145 ? 20.184  7.403   32.603  1.00 35.80  ? 145  VAL A C   1 
ATOM   1146 O  O   . VAL A 1 145 ? 20.229  6.629   31.647  1.00 33.70  ? 145  VAL A O   1 
ATOM   1147 C  CB  . VAL A 1 145 ? 20.081  5.802   34.543  1.00 29.63  ? 145  VAL A CB  1 
ATOM   1148 C  CG1 . VAL A 1 145 ? 21.589  5.982   34.628  1.00 34.66  ? 145  VAL A CG1 1 
ATOM   1149 C  CG2 . VAL A 1 145 ? 19.492  5.580   35.925  1.00 30.69  ? 145  VAL A CG2 1 
ATOM   1150 N  N   . LEU A 1 146 ? 20.747  8.603   32.581  1.00 33.46  ? 146  LEU A N   1 
ATOM   1151 C  CA  . LEU A 1 146 ? 21.409  9.085   31.377  1.00 36.41  ? 146  LEU A CA  1 
ATOM   1152 C  C   . LEU A 1 146 ? 22.883  9.408   31.619  1.00 31.26  ? 146  LEU A C   1 
ATOM   1153 O  O   . LEU A 1 146 ? 23.245  10.053  32.609  1.00 30.92  ? 146  LEU A O   1 
ATOM   1154 C  CB  . LEU A 1 146 ? 20.661  10.288  30.790  1.00 31.67  ? 146  LEU A CB  1 
ATOM   1155 C  CG  . LEU A 1 146 ? 20.916  10.554  29.305  1.00 40.37  ? 146  LEU A CG  1 
ATOM   1156 C  CD1 . LEU A 1 146 ? 19.688  11.143  28.638  1.00 41.30  ? 146  LEU A CD1 1 
ATOM   1157 C  CD2 . LEU A 1 146 ? 22.127  11.455  29.118  1.00 38.57  ? 146  LEU A CD2 1 
ATOM   1158 N  N   . VAL A 1 147 ? 23.723  8.943   30.701  1.00 33.47  ? 147  VAL A N   1 
ATOM   1159 C  CA  . VAL A 1 147 ? 25.167  9.086   30.817  1.00 28.38  ? 147  VAL A CA  1 
ATOM   1160 C  C   . VAL A 1 147 ? 25.754  9.650   29.536  1.00 30.25  ? 147  VAL A C   1 
ATOM   1161 O  O   . VAL A 1 147 ? 25.468  9.164   28.444  1.00 34.57  ? 147  VAL A O   1 
ATOM   1162 C  CB  . VAL A 1 147 ? 25.835  7.723   31.068  1.00 30.20  ? 147  VAL A CB  1 
ATOM   1163 C  CG1 . VAL A 1 147 ? 27.353  7.878   31.124  1.00 30.01  ? 147  VAL A CG1 1 
ATOM   1164 C  CG2 . VAL A 1 147 ? 25.294  7.087   32.340  1.00 23.86  ? 147  VAL A CG2 1 
ATOM   1165 N  N   . SER A 1 148 ? 26.586  10.672  29.666  1.00 28.54  ? 148  SER A N   1 
ATOM   1166 C  CA  . SER A 1 148 ? 27.307  11.196  28.514  1.00 27.00  ? 148  SER A CA  1 
ATOM   1167 C  C   . SER A 1 148 ? 28.783  11.348  28.857  1.00 31.53  ? 148  SER A C   1 
ATOM   1168 O  O   . SER A 1 148 ? 29.130  11.715  29.979  1.00 31.37  ? 148  SER A O   1 
ATOM   1169 C  CB  . SER A 1 148 ? 26.723  12.538  28.091  1.00 24.86  ? 148  SER A CB  1 
ATOM   1170 O  OG  . SER A 1 148 ? 26.862  13.477  29.138  1.00 33.06  ? 148  SER A OG  1 
ATOM   1171 N  N   . MET A 1 149 ? 29.654  11.064  27.895  1.00 28.94  ? 149  MET A N   1 
ATOM   1172 C  CA  . MET A 1 149 ? 31.088  11.149  28.140  1.00 29.95  ? 149  MET A CA  1 
ATOM   1173 C  C   . MET A 1 149 ? 31.764  12.115  27.181  1.00 33.28  ? 149  MET A C   1 
ATOM   1174 O  O   . MET A 1 149 ? 31.329  12.287  26.039  1.00 29.76  ? 149  MET A O   1 
ATOM   1175 C  CB  . MET A 1 149 ? 31.741  9.770   28.001  1.00 23.94  ? 149  MET A CB  1 
ATOM   1176 C  CG  . MET A 1 149 ? 32.146  9.391   26.569  1.00 30.62  ? 149  MET A CG  1 
ATOM   1177 S  SD  . MET A 1 149 ? 30.770  8.914   25.486  1.00 35.21  ? 149  MET A SD  1 
ATOM   1178 C  CE  . MET A 1 149 ? 30.305  7.323   26.163  1.00 31.35  ? 149  MET A CE  1 
ATOM   1179 N  N   . ASN A 1 150 ? 32.831  12.751  27.642  1.00 25.98  ? 150  ASN A N   1 
ATOM   1180 C  CA  . ASN A 1 150 ? 33.701  13.451  26.715  1.00 27.80  ? 150  ASN A CA  1 
ATOM   1181 C  C   . ASN A 1 150 ? 34.660  12.436  26.124  1.00 27.93  ? 150  ASN A C   1 
ATOM   1182 O  O   . ASN A 1 150 ? 35.089  11.512  26.807  1.00 30.73  ? 150  ASN A O   1 
ATOM   1183 C  CB  . ASN A 1 150 ? 34.471  14.579  27.404  1.00 23.51  ? 150  ASN A CB  1 
ATOM   1184 C  CG  . ASN A 1 150 ? 33.599  15.783  27.706  1.00 28.00  ? 150  ASN A CG  1 
ATOM   1185 O  OD1 . ASN A 1 150 ? 32.422  15.821  27.347  1.00 31.77  ? 150  ASN A OD1 1 
ATOM   1186 N  ND2 . ASN A 1 150 ? 34.176  16.776  28.368  1.00 24.81  ? 150  ASN A ND2 1 
ATOM   1187 N  N   . TYR A 1 151 ? 34.976  12.587  24.847  1.00 26.52  ? 151  TYR A N   1 
ATOM   1188 C  CA  . TYR A 1 151 ? 36.008  11.769  24.239  1.00 21.30  ? 151  TYR A CA  1 
ATOM   1189 C  C   . TYR A 1 151 ? 36.896  12.664  23.389  1.00 23.95  ? 151  TYR A C   1 
ATOM   1190 O  O   . TYR A 1 151 ? 36.439  13.669  22.850  1.00 27.52  ? 151  TYR A O   1 
ATOM   1191 C  CB  . TYR A 1 151 ? 35.395  10.628  23.415  1.00 25.68  ? 151  TYR A CB  1 
ATOM   1192 C  CG  . TYR A 1 151 ? 34.551  11.080  22.246  1.00 26.29  ? 151  TYR A CG  1 
ATOM   1193 C  CD1 . TYR A 1 151 ? 33.210  11.413  22.414  1.00 30.66  ? 151  TYR A CD1 1 
ATOM   1194 C  CD2 . TYR A 1 151 ? 35.095  11.173  20.969  1.00 30.19  ? 151  TYR A CD2 1 
ATOM   1195 C  CE1 . TYR A 1 151 ? 32.432  11.830  21.341  1.00 28.29  ? 151  TYR A CE1 1 
ATOM   1196 C  CE2 . TYR A 1 151 ? 34.327  11.591  19.894  1.00 33.39  ? 151  TYR A CE2 1 
ATOM   1197 C  CZ  . TYR A 1 151 ? 32.999  11.919  20.084  1.00 28.08  ? 151  TYR A CZ  1 
ATOM   1198 O  OH  . TYR A 1 151 ? 32.241  12.326  19.010  1.00 30.28  ? 151  TYR A OH  1 
ATOM   1199 N  N   . ARG A 1 152 ? 38.172  12.315  23.285  1.00 26.36  ? 152  ARG A N   1 
ATOM   1200 C  CA  . ARG A 1 152 ? 39.116  13.142  22.540  1.00 26.77  ? 152  ARG A CA  1 
ATOM   1201 C  C   . ARG A 1 152 ? 38.720  13.289  21.075  1.00 27.77  ? 152  ARG A C   1 
ATOM   1202 O  O   . ARG A 1 152 ? 38.353  12.316  20.412  1.00 28.64  ? 152  ARG A O   1 
ATOM   1203 C  CB  . ARG A 1 152 ? 40.531  12.581  22.656  1.00 29.41  ? 152  ARG A CB  1 
ATOM   1204 C  CG  . ARG A 1 152 ? 41.174  12.809  24.009  1.00 28.26  ? 152  ARG A CG  1 
ATOM   1205 C  CD  . ARG A 1 152 ? 42.489  12.047  24.118  1.00 33.37  ? 152  ARG A CD  1 
ATOM   1206 N  NE  . ARG A 1 152 ? 42.262  10.629  24.373  1.00 32.56  ? 152  ARG A NE  1 
ATOM   1207 C  CZ  . ARG A 1 152 ? 43.209  9.699   24.323  1.00 32.61  ? 152  ARG A CZ  1 
ATOM   1208 N  NH1 . ARG A 1 152 ? 44.452  10.038  24.010  1.00 25.45  ? 152  ARG A NH1 1 
ATOM   1209 N  NH2 . ARG A 1 152 ? 42.907  8.428   24.574  1.00 30.59  ? 152  ARG A NH2 1 
ATOM   1210 N  N   . VAL A 1 153 ? 38.787  14.518  20.577  1.00 25.03  ? 153  VAL A N   1 
ATOM   1211 C  CA  . VAL A 1 153 ? 38.488  14.779  19.179  1.00 26.50  ? 153  VAL A CA  1 
ATOM   1212 C  C   . VAL A 1 153 ? 39.708  15.306  18.430  1.00 33.98  ? 153  VAL A C   1 
ATOM   1213 O  O   . VAL A 1 153 ? 40.774  15.515  19.017  1.00 28.40  ? 153  VAL A O   1 
ATOM   1214 C  CB  . VAL A 1 153 ? 37.313  15.764  19.018  1.00 27.08  ? 153  VAL A CB  1 
ATOM   1215 C  CG1 . VAL A 1 153 ? 36.024  15.124  19.494  1.00 23.57  ? 153  VAL A CG1 1 
ATOM   1216 C  CG2 . VAL A 1 153 ? 37.591  17.067  19.759  1.00 20.80  ? 153  VAL A CG2 1 
ATOM   1217 N  N   . GLY A 1 154 ? 39.541  15.518  17.128  1.00 24.80  ? 154  GLY A N   1 
ATOM   1218 C  CA  . GLY A 1 154 ? 40.616  16.003  16.286  1.00 31.44  ? 154  GLY A CA  1 
ATOM   1219 C  C   . GLY A 1 154 ? 41.835  15.103  16.319  1.00 31.68  ? 154  GLY A C   1 
ATOM   1220 O  O   . GLY A 1 154 ? 41.725  13.873  16.382  1.00 30.58  ? 154  GLY A O   1 
ATOM   1221 N  N   . THR A 1 155 ? 43.008  15.723  16.281  1.00 31.47  ? 155  THR A N   1 
ATOM   1222 C  CA  . THR A 1 155 ? 44.260  14.980  16.299  1.00 29.76  ? 155  THR A CA  1 
ATOM   1223 C  C   . THR A 1 155 ? 44.419  14.190  17.595  1.00 27.18  ? 155  THR A C   1 
ATOM   1224 O  O   . THR A 1 155 ? 44.819  13.029  17.579  1.00 33.88  ? 155  THR A O   1 
ATOM   1225 C  CB  . THR A 1 155 ? 45.472  15.911  16.110  1.00 29.85  ? 155  THR A CB  1 
ATOM   1226 O  OG1 . THR A 1 155 ? 45.447  16.944  17.104  1.00 28.21  ? 155  THR A OG1 1 
ATOM   1227 C  CG2 . THR A 1 155 ? 45.451  16.535  14.725  1.00 21.36  ? 155  THR A CG2 1 
ATOM   1228 N  N   . PHE A 1 156 ? 44.083  14.823  18.711  1.00 27.52  ? 156  PHE A N   1 
ATOM   1229 C  CA  . PHE A 1 156 ? 44.251  14.216  20.029  1.00 29.51  ? 156  PHE A CA  1 
ATOM   1230 C  C   . PHE A 1 156 ? 43.500  12.900  20.128  1.00 28.68  ? 156  PHE A C   1 
ATOM   1231 O  O   . PHE A 1 156 ? 43.928  11.977  20.820  1.00 32.89  ? 156  PHE A O   1 
ATOM   1232 C  CB  . PHE A 1 156 ? 43.798  15.194  21.118  1.00 23.29  ? 156  PHE A CB  1 
ATOM   1233 C  CG  . PHE A 1 156 ? 44.321  16.586  20.913  1.00 30.01  ? 156  PHE A CG  1 
ATOM   1234 C  CD1 . PHE A 1 156 ? 45.603  16.923  21.326  1.00 28.51  ? 156  PHE A CD1 1 
ATOM   1235 C  CD2 . PHE A 1 156 ? 43.551  17.545  20.267  1.00 24.42  ? 156  PHE A CD2 1 
ATOM   1236 C  CE1 . PHE A 1 156 ? 46.101  18.197  21.123  1.00 27.30  ? 156  PHE A CE1 1 
ATOM   1237 C  CE2 . PHE A 1 156 ? 44.041  18.822  20.059  1.00 31.96  ? 156  PHE A CE2 1 
ATOM   1238 C  CZ  . PHE A 1 156 ? 45.319  19.150  20.489  1.00 34.48  ? 156  PHE A CZ  1 
ATOM   1239 N  N   . GLY A 1 157 ? 42.390  12.808  19.407  1.00 29.16  ? 157  GLY A N   1 
ATOM   1240 C  CA  . GLY A 1 157 ? 41.562  11.626  19.467  1.00 24.94  ? 157  GLY A CA  1 
ATOM   1241 C  C   . GLY A 1 157 ? 41.702  10.690  18.285  1.00 28.23  ? 157  GLY A C   1 
ATOM   1242 O  O   . GLY A 1 157 ? 41.322  9.521   18.390  1.00 25.06  ? 157  GLY A O   1 
ATOM   1243 N  N   . PHE A 1 158 ? 42.241  11.183  17.167  1.00 25.96  ? 158  PHE A N   1 
ATOM   1244 C  CA  . PHE A 1 158 ? 42.225  10.395  15.931  1.00 25.88  ? 158  PHE A CA  1 
ATOM   1245 C  C   . PHE A 1 158 ? 43.437  10.480  14.993  1.00 30.05  ? 158  PHE A C   1 
ATOM   1246 O  O   . PHE A 1 158 ? 43.442  9.842   13.941  1.00 28.23  ? 158  PHE A O   1 
ATOM   1247 C  CB  . PHE A 1 158 ? 40.923  10.660  15.162  1.00 21.54  ? 158  PHE A CB  1 
ATOM   1248 C  CG  . PHE A 1 158 ? 39.708  10.278  15.935  1.00 27.26  ? 158  PHE A CG  1 
ATOM   1249 C  CD1 . PHE A 1 158 ? 39.297  8.957   15.988  1.00 26.03  ? 158  PHE A CD1 1 
ATOM   1250 C  CD2 . PHE A 1 158 ? 39.011  11.225  16.667  1.00 21.98  ? 158  PHE A CD2 1 
ATOM   1251 C  CE1 . PHE A 1 158 ? 38.193  8.594   16.729  1.00 33.63  ? 158  PHE A CE1 1 
ATOM   1252 C  CE2 . PHE A 1 158 ? 37.910  10.867  17.409  1.00 29.84  ? 158  PHE A CE2 1 
ATOM   1253 C  CZ  . PHE A 1 158 ? 37.498  9.550   17.442  1.00 26.74  ? 158  PHE A CZ  1 
ATOM   1254 N  N   . LEU A 1 159 ? 44.459  11.246  15.352  1.00 28.25  ? 159  LEU A N   1 
ATOM   1255 C  CA  . LEU A 1 159 ? 45.670  11.222  14.546  1.00 25.61  ? 159  LEU A CA  1 
ATOM   1256 C  C   . LEU A 1 159 ? 46.290  9.835   14.647  1.00 31.50  ? 159  LEU A C   1 
ATOM   1257 O  O   . LEU A 1 159 ? 46.457  9.295   15.740  1.00 30.21  ? 159  LEU A O   1 
ATOM   1258 C  CB  . LEU A 1 159 ? 46.668  12.292  14.986  1.00 29.16  ? 159  LEU A CB  1 
ATOM   1259 C  CG  . LEU A 1 159 ? 47.980  12.286  14.189  1.00 37.54  ? 159  LEU A CG  1 
ATOM   1260 C  CD1 . LEU A 1 159 ? 48.539  13.693  14.042  1.00 31.39  ? 159  LEU A CD1 1 
ATOM   1261 C  CD2 . LEU A 1 159 ? 49.009  11.344  14.814  1.00 23.80  ? 159  LEU A CD2 1 
ATOM   1262 N  N   . ALA A 1 160 ? 46.634  9.257   13.506  1.00 28.43  ? 160  ALA A N   1 
ATOM   1263 C  CA  . ALA A 1 160 ? 47.148  7.898   13.501  1.00 36.83  ? 160  ALA A CA  1 
ATOM   1264 C  C   . ALA A 1 160 ? 48.326  7.688   12.555  1.00 35.88  ? 160  ALA A C   1 
ATOM   1265 O  O   . ALA A 1 160 ? 48.317  8.130   11.404  1.00 30.66  ? 160  ALA A O   1 
ATOM   1266 C  CB  . ALA A 1 160 ? 46.031  6.916   13.182  1.00 32.23  ? 160  ALA A CB  1 
ATOM   1267 N  N   . LEU A 1 161 ? 49.351  7.021   13.066  1.00 38.28  ? 161  LEU A N   1 
ATOM   1268 C  CA  . LEU A 1 161 ? 50.352  6.407   12.213  1.00 36.64  ? 161  LEU A CA  1 
ATOM   1269 C  C   . LEU A 1 161 ? 50.094  4.920   12.331  1.00 33.35  ? 161  LEU A C   1 
ATOM   1270 O  O   . LEU A 1 161 ? 50.652  4.255   13.197  1.00 33.32  ? 161  LEU A O   1 
ATOM   1271 C  CB  . LEU A 1 161 ? 51.758  6.783   12.667  1.00 31.66  ? 161  LEU A CB  1 
ATOM   1272 C  CG  . LEU A 1 161 ? 52.028  8.269   12.405  1.00 39.73  ? 161  LEU A CG  1 
ATOM   1273 C  CD1 . LEU A 1 161 ? 53.149  8.793   13.261  1.00 50.50  ? 161  LEU A CD1 1 
ATOM   1274 C  CD2 . LEU A 1 161 ? 52.317  8.514   10.929  1.00 36.14  ? 161  LEU A CD2 1 
ATOM   1275 N  N   . PRO A 1 162 ? 49.198  4.401   11.477  1.00 33.75  ? 162  PRO A N   1 
ATOM   1276 C  CA  . PRO A 1 162 ? 48.695  3.031   11.622  1.00 38.58  ? 162  PRO A CA  1 
ATOM   1277 C  C   . PRO A 1 162 ? 49.835  2.027   11.757  1.00 41.70  ? 162  PRO A C   1 
ATOM   1278 O  O   . PRO A 1 162 ? 50.777  2.051   10.969  1.00 40.83  ? 162  PRO A O   1 
ATOM   1279 C  CB  . PRO A 1 162 ? 47.913  2.808   10.324  1.00 28.03  ? 162  PRO A CB  1 
ATOM   1280 C  CG  . PRO A 1 162 ? 47.497  4.188   9.904   1.00 35.35  ? 162  PRO A CG  1 
ATOM   1281 C  CD  . PRO A 1 162 ? 48.649  5.069   10.284  1.00 26.53  ? 162  PRO A CD  1 
ATOM   1282 N  N   . GLY A 1 163 ? 49.752  1.163   12.762  1.00 49.40  ? 163  GLY A N   1 
ATOM   1283 C  CA  . GLY A 1 163 ? 50.789  0.177   12.999  1.00 40.19  ? 163  GLY A CA  1 
ATOM   1284 C  C   . GLY A 1 163 ? 51.764  0.595   14.085  1.00 46.37  ? 163  GLY A C   1 
ATOM   1285 O  O   . GLY A 1 163 ? 52.394  -0.250  14.717  1.00 46.92  ? 163  GLY A O   1 
ATOM   1286 N  N   . SER A 1 164 ? 51.889  1.899   14.309  1.00 35.79  ? 164  SER A N   1 
ATOM   1287 C  CA  . SER A 1 164 ? 52.783  2.400   15.348  1.00 32.12  ? 164  SER A CA  1 
ATOM   1288 C  C   . SER A 1 164 ? 52.270  2.100   16.757  1.00 43.18  ? 164  SER A C   1 
ATOM   1289 O  O   . SER A 1 164 ? 51.099  1.761   16.957  1.00 39.67  ? 164  SER A O   1 
ATOM   1290 C  CB  . SER A 1 164 ? 53.015  3.905   15.192  1.00 35.89  ? 164  SER A CB  1 
ATOM   1291 O  OG  . SER A 1 164 ? 51.981  4.654   15.807  1.00 34.57  ? 164  SER A OG  1 
ATOM   1292 N  N   . ARG A 1 165 ? 53.159  2.232   17.733  1.00 45.81  ? 165  ARG A N   1 
ATOM   1293 C  CA  . ARG A 1 165 ? 52.799  2.019   19.125  1.00 53.93  ? 165  ARG A CA  1 
ATOM   1294 C  C   . ARG A 1 165 ? 52.367  3.341   19.747  1.00 54.90  ? 165  ARG A C   1 
ATOM   1295 O  O   . ARG A 1 165 ? 51.521  3.377   20.639  1.00 42.72  ? 165  ARG A O   1 
ATOM   1296 C  CB  . ARG A 1 165 ? 53.996  1.465   19.897  1.00 51.46  ? 165  ARG A CB  1 
ATOM   1297 C  CG  . ARG A 1 165 ? 53.629  0.702   21.159  1.00 75.77  ? 165  ARG A CG  1 
ATOM   1298 C  CD  . ARG A 1 165 ? 54.732  0.789   22.207  1.00 74.42  ? 165  ARG A CD  1 
ATOM   1299 N  NE  . ARG A 1 165 ? 54.557  1.946   23.083  1.00 85.69  ? 165  ARG A NE  1 
ATOM   1300 C  CZ  . ARG A 1 165 ? 55.234  3.086   22.975  1.00 86.44  ? 165  ARG A CZ  1 
ATOM   1301 N  NH1 . ARG A 1 165 ? 56.151  3.231   22.026  1.00 90.42  ? 165  ARG A NH1 1 
ATOM   1302 N  NH2 . ARG A 1 165 ? 54.997  4.082   23.821  1.00 69.43  ? 165  ARG A NH2 1 
ATOM   1303 N  N   . GLU A 1 166 ? 52.954  4.428   19.259  1.00 43.72  ? 166  GLU A N   1 
ATOM   1304 C  CA  . GLU A 1 166 ? 52.799  5.733   19.883  1.00 34.91  ? 166  GLU A CA  1 
ATOM   1305 C  C   . GLU A 1 166 ? 51.620  6.533   19.332  1.00 45.92  ? 166  GLU A C   1 
ATOM   1306 O  O   . GLU A 1 166 ? 51.288  7.597   19.861  1.00 44.16  ? 166  GLU A O   1 
ATOM   1307 C  CB  . GLU A 1 166 ? 54.090  6.543   19.748  1.00 49.92  ? 166  GLU A CB  1 
ATOM   1308 C  CG  . GLU A 1 166 ? 55.359  5.790   20.141  1.00 56.85  ? 166  GLU A CG  1 
ATOM   1309 C  CD  . GLU A 1 166 ? 55.975  4.990   18.990  1.00 70.69  ? 166  GLU A CD  1 
ATOM   1310 O  OE1 . GLU A 1 166 ? 55.261  4.654   18.015  1.00 55.97  ? 166  GLU A OE1 1 
ATOM   1311 O  OE2 . GLU A 1 166 ? 57.186  4.695   19.068  1.00 64.95  ? 166  GLU A OE2 1 
ATOM   1312 N  N   . ALA A 1 167 ? 50.991  6.022   18.277  1.00 41.04  ? 167  ALA A N   1 
ATOM   1313 C  CA  . ALA A 1 167 ? 49.800  6.654   17.706  1.00 31.32  ? 167  ALA A CA  1 
ATOM   1314 C  C   . ALA A 1 167 ? 49.005  5.653   16.882  1.00 33.73  ? 167  ALA A C   1 
ATOM   1315 O  O   . ALA A 1 167 ? 48.896  5.795   15.660  1.00 35.69  ? 167  ALA A O   1 
ATOM   1316 C  CB  . ALA A 1 167 ? 50.182  7.854   16.856  1.00 27.72  ? 167  ALA A CB  1 
ATOM   1317 N  N   . PRO A 1 168 ? 48.442  4.639   17.557  1.00 36.70  ? 168  PRO A N   1 
ATOM   1318 C  CA  . PRO A 1 168 ? 47.743  3.493   16.961  1.00 34.45  ? 168  PRO A CA  1 
ATOM   1319 C  C   . PRO A 1 168 ? 46.465  3.894   16.234  1.00 37.82  ? 168  PRO A C   1 
ATOM   1320 O  O   . PRO A 1 168 ? 46.025  3.185   15.328  1.00 39.33  ? 168  PRO A O   1 
ATOM   1321 C  CB  . PRO A 1 168 ? 47.391  2.638   18.184  1.00 32.96  ? 168  PRO A CB  1 
ATOM   1322 C  CG  . PRO A 1 168 ? 47.352  3.630   19.318  1.00 34.56  ? 168  PRO A CG  1 
ATOM   1323 C  CD  . PRO A 1 168 ? 48.499  4.526   19.025  1.00 34.91  ? 168  PRO A CD  1 
ATOM   1324 N  N   . GLY A 1 169 ? 45.874  5.015   16.638  1.00 35.81  ? 169  GLY A N   1 
ATOM   1325 C  CA  . GLY A 1 169 ? 44.647  5.496   16.031  1.00 31.32  ? 169  GLY A CA  1 
ATOM   1326 C  C   . GLY A 1 169 ? 43.402  5.120   16.815  1.00 37.24  ? 169  GLY A C   1 
ATOM   1327 O  O   . GLY A 1 169 ? 43.447  4.276   17.709  1.00 37.22  ? 169  GLY A O   1 
ATOM   1328 N  N   . ASN A 1 170 ? 42.289  5.762   16.480  1.00 30.38  ? 170  ASN A N   1 
ATOM   1329 C  CA  . ASN A 1 170 ? 40.996  5.462   17.090  1.00 31.45  ? 170  ASN A CA  1 
ATOM   1330 C  C   . ASN A 1 170 ? 40.922  5.628   18.608  1.00 31.13  ? 170  ASN A C   1 
ATOM   1331 O  O   . ASN A 1 170 ? 39.961  5.173   19.227  1.00 32.25  ? 170  ASN A O   1 
ATOM   1332 C  CB  . ASN A 1 170 ? 40.537  4.050   16.708  1.00 27.05  ? 170  ASN A CB  1 
ATOM   1333 C  CG  . ASN A 1 170 ? 40.280  3.900   15.218  1.00 37.46  ? 170  ASN A CG  1 
ATOM   1334 O  OD1 . ASN A 1 170 ? 39.759  4.808   14.566  1.00 30.00  ? 170  ASN A OD1 1 
ATOM   1335 N  ND2 . ASN A 1 170 ? 40.640  2.744   14.671  1.00 29.61  ? 170  ASN A ND2 1 
ATOM   1336 N  N   . VAL A 1 171 ? 41.912  6.276   19.216  1.00 26.35  ? 171  VAL A N   1 
ATOM   1337 C  CA  . VAL A 1 171 ? 41.917  6.384   20.677  1.00 29.54  ? 171  VAL A CA  1 
ATOM   1338 C  C   . VAL A 1 171 ? 40.697  7.151   21.199  1.00 32.72  ? 171  VAL A C   1 
ATOM   1339 O  O   . VAL A 1 171 ? 40.248  6.930   22.324  1.00 30.04  ? 171  VAL A O   1 
ATOM   1340 C  CB  . VAL A 1 171 ? 43.234  6.975   21.240  1.00 28.75  ? 171  VAL A CB  1 
ATOM   1341 C  CG1 . VAL A 1 171 ? 44.432  6.168   20.747  1.00 31.97  ? 171  VAL A CG1 1 
ATOM   1342 C  CG2 . VAL A 1 171 ? 43.374  8.440   20.883  1.00 30.60  ? 171  VAL A CG2 1 
ATOM   1343 N  N   . GLY A 1 172 ? 40.149  8.034   20.371  1.00 29.48  ? 172  GLY A N   1 
ATOM   1344 C  CA  . GLY A 1 172 ? 38.904  8.700   20.710  1.00 30.35  ? 172  GLY A CA  1 
ATOM   1345 C  C   . GLY A 1 172 ? 37.768  7.706   20.878  1.00 30.88  ? 172  GLY A C   1 
ATOM   1346 O  O   . GLY A 1 172 ? 36.917  7.862   21.750  1.00 26.41  ? 172  GLY A O   1 
ATOM   1347 N  N   . LEU A 1 173 ? 37.751  6.680   20.032  1.00 25.44  ? 173  LEU A N   1 
ATOM   1348 C  CA  . LEU A 1 173 ? 36.783  5.598   20.162  1.00 27.48  ? 173  LEU A CA  1 
ATOM   1349 C  C   . LEU A 1 173 ? 37.057  4.763   21.411  1.00 32.02  ? 173  LEU A C   1 
ATOM   1350 O  O   . LEU A 1 173 ? 36.131  4.310   22.081  1.00 27.02  ? 173  LEU A O   1 
ATOM   1351 C  CB  . LEU A 1 173 ? 36.801  4.715   18.915  1.00 28.88  ? 173  LEU A CB  1 
ATOM   1352 C  CG  . LEU A 1 173 ? 36.193  5.368   17.670  1.00 34.86  ? 173  LEU A CG  1 
ATOM   1353 C  CD1 . LEU A 1 173 ? 36.333  4.459   16.457  1.00 26.23  ? 173  LEU A CD1 1 
ATOM   1354 C  CD2 . LEU A 1 173 ? 34.735  5.718   17.924  1.00 23.27  ? 173  LEU A CD2 1 
ATOM   1355 N  N   . LEU A 1 174 ? 38.337  4.578   21.724  1.00 32.40  ? 174  LEU A N   1 
ATOM   1356 C  CA  . LEU A 1 174 ? 38.742  3.874   22.930  1.00 25.29  ? 174  LEU A CA  1 
ATOM   1357 C  C   . LEU A 1 174 ? 38.313  4.628   24.188  1.00 35.42  ? 174  LEU A C   1 
ATOM   1358 O  O   . LEU A 1 174 ? 37.950  4.009   25.190  1.00 31.41  ? 174  LEU A O   1 
ATOM   1359 C  CB  . LEU A 1 174 ? 40.252  3.646   22.939  1.00 27.12  ? 174  LEU A CB  1 
ATOM   1360 C  CG  . LEU A 1 174 ? 40.799  2.672   21.892  1.00 34.41  ? 174  LEU A CG  1 
ATOM   1361 C  CD1 . LEU A 1 174 ? 42.313  2.622   21.970  1.00 25.67  ? 174  LEU A CD1 1 
ATOM   1362 C  CD2 . LEU A 1 174 ? 40.212  1.282   22.067  1.00 23.17  ? 174  LEU A CD2 1 
ATOM   1363 N  N   . ASP A 1 175 ? 38.356  5.958   24.137  1.00 28.83  ? 175  ASP A N   1 
ATOM   1364 C  CA  . ASP A 1 175 ? 37.838  6.770   25.233  1.00 26.64  ? 175  ASP A CA  1 
ATOM   1365 C  C   . ASP A 1 175 ? 36.373  6.399   25.460  1.00 35.95  ? 175  ASP A C   1 
ATOM   1366 O  O   . ASP A 1 175 ? 35.942  6.133   26.587  1.00 30.78  ? 175  ASP A O   1 
ATOM   1367 C  CB  . ASP A 1 175 ? 37.941  8.261   24.905  1.00 26.76  ? 175  ASP A CB  1 
ATOM   1368 C  CG  . ASP A 1 175 ? 39.379  8.756   24.831  1.00 36.87  ? 175  ASP A CG  1 
ATOM   1369 O  OD1 . ASP A 1 175 ? 40.287  8.053   25.319  1.00 35.64  ? 175  ASP A OD1 1 
ATOM   1370 O  OD2 . ASP A 1 175 ? 39.599  9.862   24.291  1.00 33.53  ? 175  ASP A OD2 1 
ATOM   1371 N  N   . GLN A 1 176 ? 35.611  6.380   24.373  1.00 29.86  ? 176  GLN A N   1 
ATOM   1372 C  CA  . GLN A 1 176 ? 34.203  6.028   24.436  1.00 30.35  ? 176  GLN A CA  1 
ATOM   1373 C  C   . GLN A 1 176 ? 34.009  4.645   25.057  1.00 34.96  ? 176  GLN A C   1 
ATOM   1374 O  O   . GLN A 1 176 ? 33.173  4.463   25.946  1.00 31.72  ? 176  GLN A O   1 
ATOM   1375 C  CB  . GLN A 1 176 ? 33.585  6.082   23.038  1.00 28.04  ? 176  GLN A CB  1 
ATOM   1376 C  CG  . GLN A 1 176 ? 33.618  7.466   22.405  1.00 34.17  ? 176  GLN A CG  1 
ATOM   1377 C  CD  . GLN A 1 176 ? 33.049  7.481   20.995  1.00 42.07  ? 176  GLN A CD  1 
ATOM   1378 O  OE1 . GLN A 1 176 ? 32.470  6.493   20.535  1.00 30.71  ? 176  GLN A OE1 1 
ATOM   1379 N  NE2 . GLN A 1 176 ? 33.213  8.604   20.301  1.00 31.31  ? 176  GLN A NE2 1 
ATOM   1380 N  N   . ARG A 1 177 ? 34.791  3.675   24.597  1.00 28.65  ? 177  ARG A N   1 
ATOM   1381 C  CA  . ARG A 1 177 ? 34.646  2.309   25.080  1.00 36.32  ? 177  ARG A CA  1 
ATOM   1382 C  C   . ARG A 1 177 ? 34.954  2.219   26.570  1.00 37.00  ? 177  ARG A C   1 
ATOM   1383 O  O   . ARG A 1 177 ? 34.271  1.508   27.312  1.00 26.17  ? 177  ARG A O   1 
ATOM   1384 C  CB  . ARG A 1 177 ? 35.544  1.352   24.296  1.00 38.05  ? 177  ARG A CB  1 
ATOM   1385 C  CG  . ARG A 1 177 ? 35.621  -0.040  24.900  1.00 36.11  ? 177  ARG A CG  1 
ATOM   1386 C  CD  . ARG A 1 177 ? 36.487  -0.954  24.058  1.00 28.64  ? 177  ARG A CD  1 
ATOM   1387 N  NE  . ARG A 1 177 ? 35.859  -1.232  22.773  1.00 39.95  ? 177  ARG A NE  1 
ATOM   1388 C  CZ  . ARG A 1 177 ? 36.521  -1.619  21.687  1.00 48.51  ? 177  ARG A CZ  1 
ATOM   1389 N  NH1 . ARG A 1 177 ? 37.843  -1.767  21.724  1.00 29.06  ? 177  ARG A NH1 1 
ATOM   1390 N  NH2 . ARG A 1 177 ? 35.861  -1.849  20.558  1.00 31.73  ? 177  ARG A NH2 1 
ATOM   1391 N  N   . LEU A 1 178 ? 35.984  2.945   26.999  1.00 29.59  ? 178  LEU A N   1 
ATOM   1392 C  CA  . LEU A 1 178 ? 36.380  2.953   28.399  1.00 28.66  ? 178  LEU A CA  1 
ATOM   1393 C  C   . LEU A 1 178 ? 35.230  3.437   29.270  1.00 35.44  ? 178  LEU A C   1 
ATOM   1394 O  O   . LEU A 1 178 ? 34.986  2.899   30.348  1.00 36.33  ? 178  LEU A O   1 
ATOM   1395 C  CB  . LEU A 1 178 ? 37.607  3.836   28.605  1.00 27.09  ? 178  LEU A CB  1 
ATOM   1396 C  CG  . LEU A 1 178 ? 38.121  3.995   30.033  1.00 30.81  ? 178  LEU A CG  1 
ATOM   1397 C  CD1 . LEU A 1 178 ? 38.263  2.641   30.710  1.00 26.84  ? 178  LEU A CD1 1 
ATOM   1398 C  CD2 . LEU A 1 178 ? 39.449  4.744   30.027  1.00 32.04  ? 178  LEU A CD2 1 
ATOM   1399 N  N   . ALA A 1 179 ? 34.521  4.454   28.792  1.00 32.90  ? 179  ALA A N   1 
ATOM   1400 C  CA  . ALA A 1 179 ? 33.371  4.976   29.517  1.00 30.02  ? 179  ALA A CA  1 
ATOM   1401 C  C   . ALA A 1 179 ? 32.241  3.951   29.558  1.00 31.12  ? 179  ALA A C   1 
ATOM   1402 O  O   . ALA A 1 179 ? 31.542  3.836   30.565  1.00 29.53  ? 179  ALA A O   1 
ATOM   1403 C  CB  . ALA A 1 179 ? 32.886  6.292   28.901  1.00 30.33  ? 179  ALA A CB  1 
ATOM   1404 N  N   . LEU A 1 180 ? 32.061  3.207   28.468  1.00 25.72  ? 180  LEU A N   1 
ATOM   1405 C  CA  . LEU A 1 180 ? 31.035  2.168   28.445  1.00 33.02  ? 180  LEU A CA  1 
ATOM   1406 C  C   . LEU A 1 180 ? 31.340  1.127   29.517  1.00 37.53  ? 180  LEU A C   1 
ATOM   1407 O  O   . LEU A 1 180 ? 30.441  0.633   30.195  1.00 34.81  ? 180  LEU A O   1 
ATOM   1408 C  CB  . LEU A 1 180 ? 30.931  1.506   27.068  1.00 26.71  ? 180  LEU A CB  1 
ATOM   1409 C  CG  . LEU A 1 180 ? 30.604  2.392   25.860  1.00 34.64  ? 180  LEU A CG  1 
ATOM   1410 C  CD1 . LEU A 1 180 ? 30.117  1.546   24.695  1.00 29.35  ? 180  LEU A CD1 1 
ATOM   1411 C  CD2 . LEU A 1 180 ? 29.575  3.450   26.199  1.00 26.83  ? 180  LEU A CD2 1 
ATOM   1412 N  N   . GLN A 1 181 ? 32.619  0.812   29.676  1.00 29.78  ? 181  GLN A N   1 
ATOM   1413 C  CA  . GLN A 1 181 ? 33.035  -0.159  30.674  1.00 35.43  ? 181  GLN A CA  1 
ATOM   1414 C  C   . GLN A 1 181 ? 32.811  0.402   32.068  1.00 40.96  ? 181  GLN A C   1 
ATOM   1415 O  O   . GLN A 1 181 ? 32.338  -0.296  32.967  1.00 39.23  ? 181  GLN A O   1 
ATOM   1416 C  CB  . GLN A 1 181 ? 34.495  -0.545  30.464  1.00 35.21  ? 181  GLN A CB  1 
ATOM   1417 C  CG  . GLN A 1 181 ? 34.725  -1.276  29.151  1.00 45.80  ? 181  GLN A CG  1 
ATOM   1418 C  CD  . GLN A 1 181 ? 36.172  -1.665  28.945  1.00 56.16  ? 181  GLN A CD  1 
ATOM   1419 O  OE1 . GLN A 1 181 ? 37.078  -0.850  29.113  1.00 48.80  ? 181  GLN A OE1 1 
ATOM   1420 N  NE2 . GLN A 1 181 ? 36.397  -2.918  28.575  1.00 67.53  ? 181  GLN A NE2 1 
ATOM   1421 N  N   . TRP A 1 182 ? 33.137  1.677   32.231  1.00 35.67  ? 182  TRP A N   1 
ATOM   1422 C  CA  . TRP A 1 182 ? 32.854  2.386   33.466  1.00 32.52  ? 182  TRP A CA  1 
ATOM   1423 C  C   . TRP A 1 182 ? 31.373  2.285   33.825  1.00 35.01  ? 182  TRP A C   1 
ATOM   1424 O  O   . TRP A 1 182 ? 31.013  2.141   34.993  1.00 33.75  ? 182  TRP A O   1 
ATOM   1425 C  CB  . TRP A 1 182 ? 33.251  3.848   33.327  1.00 23.14  ? 182  TRP A CB  1 
ATOM   1426 C  CG  . TRP A 1 182 ? 33.166  4.616   34.601  1.00 27.68  ? 182  TRP A CG  1 
ATOM   1427 C  CD1 . TRP A 1 182 ? 34.191  4.899   35.456  1.00 29.42  ? 182  TRP A CD1 1 
ATOM   1428 C  CD2 . TRP A 1 182 ? 31.995  5.215   35.168  1.00 27.66  ? 182  TRP A CD2 1 
ATOM   1429 N  NE1 . TRP A 1 182 ? 33.733  5.638   36.518  1.00 32.15  ? 182  TRP A NE1 1 
ATOM   1430 C  CE2 . TRP A 1 182 ? 32.387  5.847   36.365  1.00 26.98  ? 182  TRP A CE2 1 
ATOM   1431 C  CE3 . TRP A 1 182 ? 30.653  5.279   34.781  1.00 29.29  ? 182  TRP A CE3 1 
ATOM   1432 C  CZ2 . TRP A 1 182 ? 31.487  6.530   37.178  1.00 27.57  ? 182  TRP A CZ2 1 
ATOM   1433 C  CZ3 . TRP A 1 182 ? 29.762  5.962   35.589  1.00 25.36  ? 182  TRP A CZ3 1 
ATOM   1434 C  CH2 . TRP A 1 182 ? 30.182  6.574   36.775  1.00 32.54  ? 182  TRP A CH2 1 
ATOM   1435 N  N   . VAL A 1 183 ? 30.510  2.356   32.822  1.00 25.94  ? 183  VAL A N   1 
ATOM   1436 C  CA  . VAL A 1 183 ? 29.086  2.258   33.090  1.00 32.98  ? 183  VAL A CA  1 
ATOM   1437 C  C   . VAL A 1 183 ? 28.746  0.845   33.559  1.00 39.26  ? 183  VAL A C   1 
ATOM   1438 O  O   . VAL A 1 183 ? 27.964  0.663   34.491  1.00 32.75  ? 183  VAL A O   1 
ATOM   1439 C  CB  . VAL A 1 183 ? 28.242  2.648   31.867  1.00 32.93  ? 183  VAL A CB  1 
ATOM   1440 C  CG1 . VAL A 1 183 ? 26.781  2.279   32.086  1.00 23.88  ? 183  VAL A CG1 1 
ATOM   1441 C  CG2 . VAL A 1 183 ? 28.391  4.136   31.580  1.00 26.66  ? 183  VAL A CG2 1 
ATOM   1442 N  N   . GLN A 1 184 ? 29.358  -0.148  32.922  1.00 38.87  ? 184  GLN A N   1 
ATOM   1443 C  CA  . GLN A 1 184 ? 29.169  -1.542  33.310  1.00 37.23  ? 184  GLN A CA  1 
ATOM   1444 C  C   . GLN A 1 184 ? 29.593  -1.793  34.752  1.00 37.40  ? 184  GLN A C   1 
ATOM   1445 O  O   . GLN A 1 184 ? 28.906  -2.488  35.491  1.00 33.61  ? 184  GLN A O   1 
ATOM   1446 C  CB  . GLN A 1 184 ? 29.950  -2.472  32.382  1.00 34.53  ? 184  GLN A CB  1 
ATOM   1447 C  CG  . GLN A 1 184 ? 29.311  -2.645  31.026  1.00 38.57  ? 184  GLN A CG  1 
ATOM   1448 C  CD  . GLN A 1 184 ? 27.971  -3.336  31.110  1.00 43.16  ? 184  GLN A CD  1 
ATOM   1449 O  OE1 . GLN A 1 184 ? 27.887  -4.505  31.484  1.00 53.35  ? 184  GLN A OE1 1 
ATOM   1450 N  NE2 . GLN A 1 184 ? 26.912  -2.619  30.755  1.00 37.05  ? 184  GLN A NE2 1 
ATOM   1451 N  N   . GLU A 1 185 ? 30.724  -1.230  35.157  1.00 34.78  ? 185  GLU A N   1 
ATOM   1452 C  CA  . GLU A 1 185 ? 31.197  -1.454  36.512  1.00 35.43  ? 185  GLU A CA  1 
ATOM   1453 C  C   . GLU A 1 185 ? 30.441  -0.643  37.565  1.00 41.05  ? 185  GLU A C   1 
ATOM   1454 O  O   . GLU A 1 185 ? 30.218  -1.126  38.674  1.00 41.61  ? 185  GLU A O   1 
ATOM   1455 C  CB  . GLU A 1 185 ? 32.697  -1.177  36.628  1.00 30.96  ? 185  GLU A CB  1 
ATOM   1456 C  CG  . GLU A 1 185 ? 33.202  -1.273  38.062  1.00 44.98  ? 185  GLU A CG  1 
ATOM   1457 C  CD  . GLU A 1 185 ? 34.679  -1.596  38.156  1.00 45.57  ? 185  GLU A CD  1 
ATOM   1458 O  OE1 . GLU A 1 185 ? 35.108  -2.114  39.212  1.00 39.80  ? 185  GLU A OE1 1 
ATOM   1459 O  OE2 . GLU A 1 185 ? 35.408  -1.333  37.178  1.00 45.69  ? 185  GLU A OE2 1 
ATOM   1460 N  N   . ASN A 1 186 ? 30.037  0.574   37.214  1.00 36.18  ? 186  ASN A N   1 
ATOM   1461 C  CA  . ASN A 1 186 ? 29.641  1.556   38.223  1.00 27.78  ? 186  ASN A CA  1 
ATOM   1462 C  C   . ASN A 1 186 ? 28.186  2.023   38.205  1.00 37.01  ? 186  ASN A C   1 
ATOM   1463 O  O   . ASN A 1 186 ? 27.698  2.547   39.205  1.00 40.27  ? 186  ASN A O   1 
ATOM   1464 C  CB  . ASN A 1 186 ? 30.548  2.788   38.127  1.00 30.84  ? 186  ASN A CB  1 
ATOM   1465 C  CG  . ASN A 1 186 ? 32.009  2.455   38.309  1.00 35.06  ? 186  ASN A CG  1 
ATOM   1466 O  OD1 . ASN A 1 186 ? 32.455  2.151   39.414  1.00 35.13  ? 186  ASN A OD1 1 
ATOM   1467 N  ND2 . ASN A 1 186 ? 32.771  2.524   37.222  1.00 36.19  ? 186  ASN A ND2 1 
ATOM   1468 N  N   . ILE A 1 187 ? 27.493  1.857   37.083  1.00 32.21  ? 187  ILE A N   1 
ATOM   1469 C  CA  . ILE A 1 187 ? 26.182  2.482   36.947  1.00 31.58  ? 187  ILE A CA  1 
ATOM   1470 C  C   . ILE A 1 187 ? 25.150  1.965   37.960  1.00 37.37  ? 187  ILE A C   1 
ATOM   1471 O  O   . ILE A 1 187 ? 24.195  2.668   38.298  1.00 36.41  ? 187  ILE A O   1 
ATOM   1472 C  CB  . ILE A 1 187 ? 25.630  2.411   35.502  1.00 34.37  ? 187  ILE A CB  1 
ATOM   1473 C  CG1 . ILE A 1 187 ? 24.674  3.586   35.254  1.00 33.29  ? 187  ILE A CG1 1 
ATOM   1474 C  CG2 . ILE A 1 187 ? 24.955  1.061   35.227  1.00 27.30  ? 187  ILE A CG2 1 
ATOM   1475 C  CD1 . ILE A 1 187 ? 25.282  4.941   35.602  1.00 20.64  ? 187  ILE A CD1 1 
ATOM   1476 N  N   . ALA A 1 188 ? 25.349  0.745   38.448  1.00 34.00  ? 188  ALA A N   1 
ATOM   1477 C  CA  . ALA A 1 188 ? 24.452  0.173   39.449  1.00 37.98  ? 188  ALA A CA  1 
ATOM   1478 C  C   . ALA A 1 188 ? 24.431  1.028   40.715  1.00 37.43  ? 188  ALA A C   1 
ATOM   1479 O  O   . ALA A 1 188 ? 23.422  1.086   41.418  1.00 37.93  ? 188  ALA A O   1 
ATOM   1480 C  CB  . ALA A 1 188 ? 24.860  -1.260  39.776  1.00 32.96  ? 188  ALA A CB  1 
ATOM   1481 N  N   . ALA A 1 189 ? 25.543  1.705   40.992  1.00 32.88  ? 189  ALA A N   1 
ATOM   1482 C  CA  . ALA A 1 189 ? 25.656  2.538   42.185  1.00 25.84  ? 189  ALA A CA  1 
ATOM   1483 C  C   . ALA A 1 189 ? 24.688  3.715   42.155  1.00 34.78  ? 189  ALA A C   1 
ATOM   1484 O  O   . ALA A 1 189 ? 24.444  4.348   43.180  1.00 38.65  ? 189  ALA A O   1 
ATOM   1485 C  CB  . ALA A 1 189 ? 27.088  3.028   42.365  1.00 32.24  ? 189  ALA A CB  1 
ATOM   1486 N  N   . PHE A 1 190 ? 24.139  4.004   40.978  1.00 38.66  ? 190  PHE A N   1 
ATOM   1487 C  CA  . PHE A 1 190 ? 23.207  5.114   40.813  1.00 33.02  ? 190  PHE A CA  1 
ATOM   1488 C  C   . PHE A 1 190 ? 21.786  4.593   40.614  1.00 43.25  ? 190  PHE A C   1 
ATOM   1489 O  O   . PHE A 1 190 ? 20.831  5.365   40.539  1.00 42.53  ? 190  PHE A O   1 
ATOM   1490 C  CB  . PHE A 1 190 ? 23.611  5.984   39.615  1.00 33.00  ? 190  PHE A CB  1 
ATOM   1491 C  CG  . PHE A 1 190 ? 24.998  6.567   39.718  1.00 31.19  ? 190  PHE A CG  1 
ATOM   1492 C  CD1 . PHE A 1 190 ? 26.102  5.846   39.298  1.00 32.10  ? 190  PHE A CD1 1 
ATOM   1493 C  CD2 . PHE A 1 190 ? 25.194  7.839   40.233  1.00 33.04  ? 190  PHE A CD2 1 
ATOM   1494 C  CE1 . PHE A 1 190 ? 27.377  6.383   39.390  1.00 35.23  ? 190  PHE A CE1 1 
ATOM   1495 C  CE2 . PHE A 1 190 ? 26.464  8.382   40.327  1.00 27.47  ? 190  PHE A CE2 1 
ATOM   1496 C  CZ  . PHE A 1 190 ? 27.555  7.658   39.903  1.00 26.77  ? 190  PHE A CZ  1 
ATOM   1497 N  N   . GLY A 1 191 ? 21.648  3.277   40.524  1.00 31.99  ? 191  GLY A N   1 
ATOM   1498 C  CA  . GLY A 1 191 ? 20.350  2.677   40.288  1.00 25.89  ? 191  GLY A CA  1 
ATOM   1499 C  C   . GLY A 1 191 ? 20.185  2.332   38.827  1.00 34.89  ? 191  GLY A C   1 
ATOM   1500 O  O   . GLY A 1 191 ? 19.087  2.032   38.365  1.00 36.02  ? 191  GLY A O   1 
ATOM   1501 N  N   . GLY A 1 192 ? 21.292  2.382   38.095  1.00 41.91  ? 192  GLY A N   1 
ATOM   1502 C  CA  . GLY A 1 192 ? 21.286  2.033   36.689  1.00 38.77  ? 192  GLY A CA  1 
ATOM   1503 C  C   . GLY A 1 192 ? 21.464  0.544   36.486  1.00 37.93  ? 192  GLY A C   1 
ATOM   1504 O  O   . GLY A 1 192 ? 22.137  -0.130  37.269  1.00 38.64  ? 192  GLY A O   1 
ATOM   1505 N  N   . ASP A 1 193 ? 20.857  0.036   35.421  1.00 33.62  ? 193  ASP A N   1 
ATOM   1506 C  CA  . ASP A 1 193 ? 20.885  -1.385  35.095  1.00 33.93  ? 193  ASP A CA  1 
ATOM   1507 C  C   . ASP A 1 193 ? 21.930  -1.669  34.014  1.00 34.50  ? 193  ASP A C   1 
ATOM   1508 O  O   . ASP A 1 193 ? 21.712  -1.369  32.841  1.00 29.03  ? 193  ASP A O   1 
ATOM   1509 C  CB  . ASP A 1 193 ? 19.492  -1.815  34.624  1.00 40.57  ? 193  ASP A CB  1 
ATOM   1510 C  CG  . ASP A 1 193 ? 19.393  -3.298  34.327  1.00 46.29  ? 193  ASP A CG  1 
ATOM   1511 O  OD1 . ASP A 1 193 ? 20.406  -4.024  34.458  1.00 37.93  ? 193  ASP A OD1 1 
ATOM   1512 O  OD2 . ASP A 1 193 ? 18.278  -3.734  33.964  1.00 45.97  ? 193  ASP A OD2 1 
ATOM   1513 N  N   . PRO A 1 194 ? 23.066  -2.265  34.408  1.00 37.24  ? 194  PRO A N   1 
ATOM   1514 C  CA  . PRO A 1 194 ? 24.149  -2.525  33.457  1.00 33.67  ? 194  PRO A CA  1 
ATOM   1515 C  C   . PRO A 1 194 ? 23.702  -3.495  32.373  1.00 42.87  ? 194  PRO A C   1 
ATOM   1516 O  O   . PRO A 1 194 ? 24.359  -3.603  31.337  1.00 40.80  ? 194  PRO A O   1 
ATOM   1517 C  CB  . PRO A 1 194 ? 25.237  -3.179  34.321  1.00 37.45  ? 194  PRO A CB  1 
ATOM   1518 C  CG  . PRO A 1 194 ? 24.842  -2.914  35.738  1.00 40.95  ? 194  PRO A CG  1 
ATOM   1519 C  CD  . PRO A 1 194 ? 23.358  -2.819  35.740  1.00 33.58  ? 194  PRO A CD  1 
ATOM   1520 N  N   . MET A 1 195 ? 22.597  -4.192  32.610  1.00 40.53  ? 195  MET A N   1 
ATOM   1521 C  CA  . MET A 1 195 ? 22.120  -5.195  31.667  1.00 42.86  ? 195  MET A CA  1 
ATOM   1522 C  C   . MET A 1 195 ? 21.103  -4.609  30.705  1.00 38.59  ? 195  MET A C   1 
ATOM   1523 O  O   . MET A 1 195 ? 20.549  -5.318  29.864  1.00 40.02  ? 195  MET A O   1 
ATOM   1524 C  CB  . MET A 1 195 ? 21.529  -6.395  32.404  1.00 39.90  ? 195  MET A CB  1 
ATOM   1525 C  CG  . MET A 1 195 ? 22.424  -6.935  33.496  1.00 56.23  ? 195  MET A CG  1 
ATOM   1526 S  SD  . MET A 1 195 ? 22.294  -8.719  33.645  1.00 68.19  ? 195  MET A SD  1 
ATOM   1527 C  CE  . MET A 1 195 ? 23.026  -9.214  32.086  1.00 71.23  ? 195  MET A CE  1 
ATOM   1528 N  N   . SER A 1 196 ? 20.862  -3.310  30.832  1.00 35.68  ? 196  SER A N   1 
ATOM   1529 C  CA  . SER A 1 196 ? 20.011  -2.600  29.887  1.00 39.03  ? 196  SER A CA  1 
ATOM   1530 C  C   . SER A 1 196 ? 20.637  -1.259  29.503  1.00 43.98  ? 196  SER A C   1 
ATOM   1531 O  O   . SER A 1 196 ? 20.243  -0.202  30.008  1.00 33.70  ? 196  SER A O   1 
ATOM   1532 C  CB  . SER A 1 196 ? 18.613  -2.394  30.468  1.00 36.73  ? 196  SER A CB  1 
ATOM   1533 O  OG  . SER A 1 196 ? 17.743  -1.848  29.496  1.00 40.15  ? 196  SER A OG  1 
ATOM   1534 N  N   . VAL A 1 197 ? 21.619  -1.317  28.610  1.00 33.17  ? 197  VAL A N   1 
ATOM   1535 C  CA  . VAL A 1 197 ? 22.335  -0.129  28.157  1.00 35.90  ? 197  VAL A CA  1 
ATOM   1536 C  C   . VAL A 1 197 ? 22.067  0.147   26.684  1.00 34.37  ? 197  VAL A C   1 
ATOM   1537 O  O   . VAL A 1 197 ? 22.313  -0.702  25.823  1.00 35.33  ? 197  VAL A O   1 
ATOM   1538 C  CB  . VAL A 1 197 ? 23.865  -0.271  28.364  1.00 40.32  ? 197  VAL A CB  1 
ATOM   1539 C  CG1 . VAL A 1 197 ? 24.613  0.876   27.680  1.00 31.31  ? 197  VAL A CG1 1 
ATOM   1540 C  CG2 . VAL A 1 197 ? 24.201  -0.343  29.849  1.00 31.31  ? 197  VAL A CG2 1 
ATOM   1541 N  N   . THR A 1 198 ? 21.565  1.343   26.406  1.00 30.09  ? 198  THR A N   1 
ATOM   1542 C  CA  . THR A 1 198 ? 21.279  1.771   25.045  1.00 29.57  ? 198  THR A CA  1 
ATOM   1543 C  C   . THR A 1 198 ? 22.170  2.950   24.653  1.00 33.13  ? 198  THR A C   1 
ATOM   1544 O  O   . THR A 1 198 ? 22.129  4.011   25.285  1.00 32.24  ? 198  THR A O   1 
ATOM   1545 C  CB  . THR A 1 198 ? 19.803  2.186   24.904  1.00 34.54  ? 198  THR A CB  1 
ATOM   1546 O  OG1 . THR A 1 198 ? 18.968  1.041   25.101  1.00 41.19  ? 198  THR A OG1 1 
ATOM   1547 C  CG2 . THR A 1 198 ? 19.537  2.775   23.529  1.00 30.07  ? 198  THR A CG2 1 
ATOM   1548 N  N   . LEU A 1 199 ? 22.981  2.759   23.618  1.00 30.31  ? 199  LEU A N   1 
ATOM   1549 C  CA  . LEU A 1 199 ? 23.785  3.848   23.069  1.00 31.89  ? 199  LEU A CA  1 
ATOM   1550 C  C   . LEU A 1 199 ? 22.946  4.733   22.159  1.00 31.69  ? 199  LEU A C   1 
ATOM   1551 O  O   . LEU A 1 199 ? 22.141  4.235   21.375  1.00 35.44  ? 199  LEU A O   1 
ATOM   1552 C  CB  . LEU A 1 199 ? 24.959  3.300   22.257  1.00 23.33  ? 199  LEU A CB  1 
ATOM   1553 C  CG  . LEU A 1 199 ? 25.840  2.242   22.910  1.00 27.55  ? 199  LEU A CG  1 
ATOM   1554 C  CD1 . LEU A 1 199 ? 27.031  1.916   22.018  1.00 24.36  ? 199  LEU A CD1 1 
ATOM   1555 C  CD2 . LEU A 1 199 ? 26.292  2.713   24.273  1.00 32.97  ? 199  LEU A CD2 1 
ATOM   1556 N  N   . PHE A 1 200 ? 23.132  6.044   22.254  1.00 25.28  ? 200  PHE A N   1 
ATOM   1557 C  CA  . PHE A 1 200 ? 22.598  6.920   21.217  1.00 30.76  ? 200  PHE A CA  1 
ATOM   1558 C  C   . PHE A 1 200 ? 23.493  8.118   20.950  1.00 28.53  ? 200  PHE A C   1 
ATOM   1559 O  O   . PHE A 1 200 ? 24.163  8.620   21.851  1.00 32.34  ? 200  PHE A O   1 
ATOM   1560 C  CB  . PHE A 1 200 ? 21.125  7.303   21.461  1.00 27.58  ? 200  PHE A CB  1 
ATOM   1561 C  CG  . PHE A 1 200 ? 20.905  8.297   22.572  1.00 27.35  ? 200  PHE A CG  1 
ATOM   1562 C  CD1 . PHE A 1 200 ? 21.467  8.112   23.826  1.00 27.03  ? 200  PHE A CD1 1 
ATOM   1563 C  CD2 . PHE A 1 200 ? 20.069  9.385   22.376  1.00 21.89  ? 200  PHE A CD2 1 
ATOM   1564 C  CE1 . PHE A 1 200 ? 21.232  9.020   24.852  1.00 27.81  ? 200  PHE A CE1 1 
ATOM   1565 C  CE2 . PHE A 1 200 ? 19.827  10.297  23.401  1.00 30.22  ? 200  PHE A CE2 1 
ATOM   1566 C  CZ  . PHE A 1 200 ? 20.411  10.118  24.637  1.00 22.62  ? 200  PHE A CZ  1 
ATOM   1567 N  N   . GLY A 1 201 ? 23.527  8.538   19.689  1.00 31.27  ? 201  GLY A N   1 
ATOM   1568 C  CA  . GLY A 1 201 ? 24.364  9.644   19.265  1.00 24.72  ? 201  GLY A CA  1 
ATOM   1569 C  C   . GLY A 1 201 ? 23.923  10.210  17.929  1.00 30.65  ? 201  GLY A C   1 
ATOM   1570 O  O   . GLY A 1 201 ? 23.162  9.589   17.189  1.00 29.59  ? 201  GLY A O   1 
ATOM   1571 N  N   . GLU A 1 202 ? 24.408  11.401  17.613  1.00 30.10  ? 202  GLU A N   1 
ATOM   1572 C  CA  . GLU A 1 202 ? 24.024  12.052  16.376  1.00 29.54  ? 202  GLU A CA  1 
ATOM   1573 C  C   . GLU A 1 202 ? 25.264  12.427  15.578  1.00 28.47  ? 202  GLU A C   1 
ATOM   1574 O  O   . GLU A 1 202 ? 26.314  12.719  16.147  1.00 31.39  ? 202  GLU A O   1 
ATOM   1575 C  CB  . GLU A 1 202 ? 23.151  13.276  16.673  1.00 34.32  ? 202  GLU A CB  1 
ATOM   1576 C  CG  . GLU A 1 202 ? 22.625  13.996  15.444  1.00 28.46  ? 202  GLU A CG  1 
ATOM   1577 C  CD  . GLU A 1 202 ? 23.543  15.109  14.985  1.00 36.34  ? 202  GLU A CD  1 
ATOM   1578 O  OE1 . GLU A 1 202 ? 24.523  15.408  15.705  1.00 31.87  ? 202  GLU A OE1 1 
ATOM   1579 O  OE2 . GLU A 1 202 ? 23.279  15.687  13.910  1.00 29.34  ? 202  GLU A OE2 1 
ATOM   1580 N  N   . SER A 1 203 ? 25.134  12.406  14.256  1.00 31.59  ? 203  SER A N   1 
ATOM   1581 C  CA  . SER A 1 203 ? 26.236  12.740  13.362  1.00 29.08  ? 203  SER A CA  1 
ATOM   1582 C  C   . SER A 1 203 ? 27.443  11.825  13.633  1.00 35.52  ? 203  SER A C   1 
ATOM   1583 O  O   . SER A 1 203 ? 27.345  10.603  13.492  1.00 31.65  ? 203  SER A O   1 
ATOM   1584 C  CB  . SER A 1 203 ? 26.603  14.220  13.502  1.00 30.40  ? 203  SER A CB  1 
ATOM   1585 O  OG  . SER A 1 203 ? 27.231  14.712  12.333  1.00 37.78  ? 203  SER A OG  1 
ATOM   1586 N  N   . ALA A 1 204 ? 28.572  12.404  14.031  1.00 23.90  ? 204  ALA A N   1 
ATOM   1587 C  CA  . ALA A 1 204 ? 29.762  11.607  14.317  1.00 29.67  ? 204  ALA A CA  1 
ATOM   1588 C  C   . ALA A 1 204 ? 29.550  10.709  15.533  1.00 33.74  ? 204  ALA A C   1 
ATOM   1589 O  O   . ALA A 1 204 ? 30.200  9.670   15.668  1.00 31.13  ? 204  ALA A O   1 
ATOM   1590 C  CB  . ALA A 1 204 ? 30.983  12.503  14.516  1.00 27.26  ? 204  ALA A CB  1 
ATOM   1591 N  N   . GLY A 1 205 ? 28.646  11.127  16.418  1.00 25.86  ? 205  GLY A N   1 
ATOM   1592 C  CA  . GLY A 1 205 ? 28.264  10.326  17.562  1.00 22.80  ? 205  GLY A CA  1 
ATOM   1593 C  C   . GLY A 1 205 ? 27.528  9.080   17.104  1.00 32.92  ? 205  GLY A C   1 
ATOM   1594 O  O   . GLY A 1 205 ? 27.785  7.982   17.594  1.00 32.75  ? 205  GLY A O   1 
ATOM   1595 N  N   . ALA A 1 206 ? 26.613  9.254   16.154  1.00 26.34  ? 206  ALA A N   1 
ATOM   1596 C  CA  . ALA A 1 206 ? 25.902  8.129   15.563  1.00 29.79  ? 206  ALA A CA  1 
ATOM   1597 C  C   . ALA A 1 206 ? 26.879  7.164   14.891  1.00 33.55  ? 206  ALA A C   1 
ATOM   1598 O  O   . ALA A 1 206 ? 26.777  5.948   15.049  1.00 33.00  ? 206  ALA A O   1 
ATOM   1599 C  CB  . ALA A 1 206 ? 24.850  8.618   14.567  1.00 25.80  ? 206  ALA A CB  1 
ATOM   1600 N  N   . ALA A 1 207 ? 27.831  7.710   14.147  1.00 29.48  ? 207  ALA A N   1 
ATOM   1601 C  CA  . ALA A 1 207 ? 28.836  6.884   13.499  1.00 24.14  ? 207  ALA A CA  1 
ATOM   1602 C  C   . ALA A 1 207 ? 29.638  6.136   14.559  1.00 33.19  ? 207  ALA A C   1 
ATOM   1603 O  O   . ALA A 1 207 ? 30.011  4.976   14.372  1.00 34.57  ? 207  ALA A O   1 
ATOM   1604 C  CB  . ALA A 1 207 ? 29.753  7.743   12.646  1.00 27.10  ? 207  ALA A CB  1 
ATOM   1605 N  N   . SER A 1 208 ? 29.902  6.816   15.671  1.00 31.56  ? 208  SER A N   1 
ATOM   1606 C  CA  . SER A 1 208 ? 30.631  6.226   16.786  1.00 31.53  ? 208  SER A CA  1 
ATOM   1607 C  C   . SER A 1 208 ? 29.857  5.027   17.314  1.00 34.17  ? 208  SER A C   1 
ATOM   1608 O  O   . SER A 1 208 ? 30.422  3.954   17.537  1.00 29.83  ? 208  SER A O   1 
ATOM   1609 C  CB  . SER A 1 208 ? 30.831  7.254   17.902  1.00 28.88  ? 208  SER A CB  1 
ATOM   1610 O  OG  . SER A 1 208 ? 31.729  8.278   17.507  1.00 33.55  ? 208  SER A OG  1 
ATOM   1611 N  N   . VAL A 1 209 ? 28.556  5.223   17.506  1.00 27.57  ? 209  VAL A N   1 
ATOM   1612 C  CA  . VAL A 1 209 ? 27.674  4.159   17.946  1.00 25.88  ? 209  VAL A CA  1 
ATOM   1613 C  C   . VAL A 1 209 ? 27.787  3.010   16.964  1.00 31.44  ? 209  VAL A C   1 
ATOM   1614 O  O   . VAL A 1 209 ? 27.924  1.846   17.351  1.00 35.09  ? 209  VAL A O   1 
ATOM   1615 C  CB  . VAL A 1 209 ? 26.209  4.636   18.015  1.00 27.07  ? 209  VAL A CB  1 
ATOM   1616 C  CG1 . VAL A 1 209 ? 25.259  3.447   18.152  1.00 21.37  ? 209  VAL A CG1 1 
ATOM   1617 C  CG2 . VAL A 1 209 ? 26.026  5.606   19.171  1.00 26.32  ? 209  VAL A CG2 1 
ATOM   1618 N  N   . GLY A 1 210 ? 27.750  3.352   15.683  1.00 27.04  ? 210  GLY A N   1 
ATOM   1619 C  CA  . GLY A 1 210 ? 27.833  2.357   14.634  1.00 27.08  ? 210  GLY A CA  1 
ATOM   1620 C  C   . GLY A 1 210 ? 29.106  1.545   14.732  1.00 33.01  ? 210  GLY A C   1 
ATOM   1621 O  O   . GLY A 1 210 ? 29.130  0.353   14.422  1.00 33.66  ? 210  GLY A O   1 
ATOM   1622 N  N   . MET A 1 211 ? 30.178  2.183   15.179  1.00 26.16  ? 211  MET A N   1 
ATOM   1623 C  CA  . MET A 1 211 ? 31.453  1.492   15.230  1.00 30.15  ? 211  MET A CA  1 
ATOM   1624 C  C   . MET A 1 211 ? 31.576  0.560   16.424  1.00 34.15  ? 211  MET A C   1 
ATOM   1625 O  O   . MET A 1 211 ? 32.269  -0.451  16.358  1.00 33.56  ? 211  MET A O   1 
ATOM   1626 C  CB  . MET A 1 211 ? 32.608  2.483   15.137  1.00 32.13  ? 211  MET A CB  1 
ATOM   1627 C  CG  . MET A 1 211 ? 32.843  2.901   13.698  1.00 33.61  ? 211  MET A CG  1 
ATOM   1628 S  SD  . MET A 1 211 ? 33.795  4.393   13.560  1.00 46.36  ? 211  MET A SD  1 
ATOM   1629 C  CE  . MET A 1 211 ? 33.024  5.162   12.140  1.00 38.79  ? 211  MET A CE  1 
ATOM   1630 N  N   . HIS A 1 212 ? 30.885  0.884   17.507  1.00 29.72  ? 212  HIS A N   1 
ATOM   1631 C  CA  . HIS A 1 212 ? 30.829  -0.031  18.632  1.00 30.30  ? 212  HIS A CA  1 
ATOM   1632 C  C   . HIS A 1 212 ? 30.067  -1.284  18.236  1.00 37.37  ? 212  HIS A C   1 
ATOM   1633 O  O   . HIS A 1 212 ? 30.442  -2.394  18.606  1.00 38.24  ? 212  HIS A O   1 
ATOM   1634 C  CB  . HIS A 1 212 ? 30.202  0.643   19.844  1.00 27.24  ? 212  HIS A CB  1 
ATOM   1635 C  CG  . HIS A 1 212 ? 31.044  1.742   20.402  1.00 28.21  ? 212  HIS A CG  1 
ATOM   1636 N  ND1 . HIS A 1 212 ? 32.319  1.526   20.875  1.00 27.39  ? 212  HIS A ND1 1 
ATOM   1637 C  CD2 . HIS A 1 212 ? 30.809  3.066   20.538  1.00 30.50  ? 212  HIS A CD2 1 
ATOM   1638 C  CE1 . HIS A 1 212 ? 32.830  2.670   21.290  1.00 32.54  ? 212  HIS A CE1 1 
ATOM   1639 N  NE2 . HIS A 1 212 ? 31.931  3.621   21.102  1.00 31.18  ? 212  HIS A NE2 1 
ATOM   1640 N  N   . ILE A 1 213 ? 29.000  -1.096  17.470  1.00 35.72  ? 213  ILE A N   1 
ATOM   1641 C  CA  . ILE A 1 213 ? 28.276  -2.216  16.899  1.00 34.02  ? 213  ILE A CA  1 
ATOM   1642 C  C   . ILE A 1 213 ? 29.213  -3.104  16.081  1.00 38.13  ? 213  ILE A C   1 
ATOM   1643 O  O   . ILE A 1 213 ? 29.122  -4.326  16.128  1.00 43.27  ? 213  ILE A O   1 
ATOM   1644 C  CB  . ILE A 1 213 ? 27.122  -1.726  16.003  1.00 34.90  ? 213  ILE A CB  1 
ATOM   1645 C  CG1 . ILE A 1 213 ? 26.051  -1.044  16.856  1.00 33.91  ? 213  ILE A CG1 1 
ATOM   1646 C  CG2 . ILE A 1 213 ? 26.527  -2.879  15.209  1.00 28.48  ? 213  ILE A CG2 1 
ATOM   1647 C  CD1 . ILE A 1 213 ? 24.834  -0.620  16.078  1.00 31.53  ? 213  ILE A CD1 1 
ATOM   1648 N  N   . LEU A 1 214 ? 30.125  -2.487  15.340  1.00 37.90  ? 214  LEU A N   1 
ATOM   1649 C  CA  . LEU A 1 214 ? 30.984  -3.236  14.432  1.00 34.89  ? 214  LEU A CA  1 
ATOM   1650 C  C   . LEU A 1 214 ? 32.261  -3.753  15.092  1.00 33.89  ? 214  LEU A C   1 
ATOM   1651 O  O   . LEU A 1 214 ? 33.036  -4.470  14.466  1.00 38.24  ? 214  LEU A O   1 
ATOM   1652 C  CB  . LEU A 1 214 ? 31.332  -2.386  13.207  1.00 30.33  ? 214  LEU A CB  1 
ATOM   1653 C  CG  . LEU A 1 214 ? 30.134  -2.018  12.339  1.00 36.32  ? 214  LEU A CG  1 
ATOM   1654 C  CD1 . LEU A 1 214 ? 30.567  -1.206  11.137  1.00 31.83  ? 214  LEU A CD1 1 
ATOM   1655 C  CD2 . LEU A 1 214 ? 29.432  -3.287  11.907  1.00 35.25  ? 214  LEU A CD2 1 
ATOM   1656 N  N   . SER A 1 215 ? 32.483  -3.390  16.349  1.00 28.45  ? 215  SER A N   1 
ATOM   1657 C  CA  . SER A 1 215 ? 33.716  -3.765  17.032  1.00 31.97  ? 215  SER A CA  1 
ATOM   1658 C  C   . SER A 1 215 ? 33.460  -4.746  18.180  1.00 35.33  ? 215  SER A C   1 
ATOM   1659 O  O   . SER A 1 215 ? 32.754  -4.432  19.138  1.00 37.65  ? 215  SER A O   1 
ATOM   1660 C  CB  . SER A 1 215 ? 34.442  -2.519  17.533  1.00 30.78  ? 215  SER A CB  1 
ATOM   1661 O  OG  . SER A 1 215 ? 35.760  -2.829  17.942  1.00 38.09  ? 215  SER A OG  1 
ATOM   1662 N  N   . LEU A 1 216 ? 34.049  -5.933  18.076  1.00 45.38  ? 216  LEU A N   1 
ATOM   1663 C  CA  . LEU A 1 216 ? 33.748  -7.034  18.994  1.00 44.24  ? 216  LEU A CA  1 
ATOM   1664 C  C   . LEU A 1 216 ? 33.881  -6.695  20.484  1.00 44.01  ? 216  LEU A C   1 
ATOM   1665 O  O   . LEU A 1 216 ? 32.972  -6.984  21.268  1.00 36.69  ? 216  LEU A O   1 
ATOM   1666 C  CB  . LEU A 1 216 ? 34.576  -8.276  18.645  1.00 43.16  ? 216  LEU A CB  1 
ATOM   1667 C  CG  . LEU A 1 216 ? 34.273  -9.535  19.465  1.00 66.71  ? 216  LEU A CG  1 
ATOM   1668 C  CD1 . LEU A 1 216 ? 32.776  -9.881  19.447  1.00 48.45  ? 216  LEU A CD1 1 
ATOM   1669 C  CD2 . LEU A 1 216 ? 35.111  -10.711 18.977  1.00 53.43  ? 216  LEU A CD2 1 
ATOM   1670 N  N   . PRO A 1 217 ? 35.012  -6.091  20.881  1.00 38.72  ? 217  PRO A N   1 
ATOM   1671 C  CA  . PRO A 1 217 ? 35.220  -5.740  22.293  1.00 33.81  ? 217  PRO A CA  1 
ATOM   1672 C  C   . PRO A 1 217 ? 34.135  -4.833  22.878  1.00 39.52  ? 217  PRO A C   1 
ATOM   1673 O  O   . PRO A 1 217 ? 34.042  -4.719  24.099  1.00 49.20  ? 217  PRO A O   1 
ATOM   1674 C  CB  . PRO A 1 217 ? 36.566  -5.007  22.276  1.00 34.39  ? 217  PRO A CB  1 
ATOM   1675 C  CG  . PRO A 1 217 ? 37.278  -5.556  21.085  1.00 27.66  ? 217  PRO A CG  1 
ATOM   1676 C  CD  . PRO A 1 217 ? 36.197  -5.797  20.057  1.00 33.13  ? 217  PRO A CD  1 
ATOM   1677 N  N   . SER A 1 218 ? 33.332  -4.197  22.030  1.00 39.02  ? 218  SER A N   1 
ATOM   1678 C  CA  . SER A 1 218 ? 32.255  -3.337  22.519  1.00 35.08  ? 218  SER A CA  1 
ATOM   1679 C  C   . SER A 1 218 ? 30.946  -4.102  22.688  1.00 42.27  ? 218  SER A C   1 
ATOM   1680 O  O   . SER A 1 218 ? 30.054  -3.648  23.399  1.00 36.13  ? 218  SER A O   1 
ATOM   1681 C  CB  . SER A 1 218 ? 32.037  -2.147  21.582  1.00 37.43  ? 218  SER A CB  1 
ATOM   1682 O  OG  . SER A 1 218 ? 33.147  -1.270  21.596  1.00 34.26  ? 218  SER A OG  1 
ATOM   1683 N  N   . ARG A 1 219 ? 30.840  -5.258  22.034  1.00 39.93  ? 219  ARG A N   1 
ATOM   1684 C  CA  . ARG A 1 219 ? 29.611  -6.050  22.060  1.00 43.37  ? 219  ARG A CA  1 
ATOM   1685 C  C   . ARG A 1 219 ? 29.028  -6.211  23.459  1.00 40.70  ? 219  ARG A C   1 
ATOM   1686 O  O   . ARG A 1 219 ? 27.832  -6.018  23.664  1.00 49.03  ? 219  ARG A O   1 
ATOM   1687 C  CB  . ARG A 1 219 ? 29.832  -7.435  21.440  1.00 49.03  ? 219  ARG A CB  1 
ATOM   1688 C  CG  . ARG A 1 219 ? 28.739  -8.447  21.814  1.00 62.39  ? 219  ARG A CG  1 
ATOM   1689 C  CD  . ARG A 1 219 ? 28.862  -9.756  21.046  1.00 43.72  ? 219  ARG A CD  1 
ATOM   1690 N  NE  . ARG A 1 219 ? 28.482  -9.603  19.643  1.00 77.97  ? 219  ARG A NE  1 
ATOM   1691 C  CZ  . ARG A 1 219 ? 27.321  -10.005 19.133  1.00 74.96  ? 219  ARG A CZ  1 
ATOM   1692 N  NH1 . ARG A 1 219 ? 26.425  -10.598 19.909  1.00 69.95  ? 219  ARG A NH1 1 
ATOM   1693 N  NH2 . ARG A 1 219 ? 27.058  -9.820  17.844  1.00 75.77  ? 219  ARG A NH2 1 
ATOM   1694 N  N   . SER A 1 220 ? 29.872  -6.568  24.417  1.00 35.58  ? 220  SER A N   1 
ATOM   1695 C  CA  . SER A 1 220 ? 29.403  -6.840  25.772  1.00 45.60  ? 220  SER A CA  1 
ATOM   1696 C  C   . SER A 1 220 ? 29.064  -5.583  26.564  1.00 42.56  ? 220  SER A C   1 
ATOM   1697 O  O   . SER A 1 220 ? 28.669  -5.672  27.724  1.00 51.05  ? 220  SER A O   1 
ATOM   1698 C  CB  . SER A 1 220 ? 30.446  -7.651  26.542  1.00 43.37  ? 220  SER A CB  1 
ATOM   1699 O  OG  . SER A 1 220 ? 31.643  -6.912  26.705  1.00 52.32  ? 220  SER A OG  1 
ATOM   1700 N  N   . LEU A 1 221 ? 29.213  -4.415  25.948  1.00 37.33  ? 221  LEU A N   1 
ATOM   1701 C  CA  . LEU A 1 221 ? 29.094  -3.165  26.690  1.00 35.39  ? 221  LEU A CA  1 
ATOM   1702 C  C   . LEU A 1 221 ? 27.754  -2.464  26.487  1.00 41.98  ? 221  LEU A C   1 
ATOM   1703 O  O   . LEU A 1 221 ? 27.452  -1.481  27.169  1.00 31.55  ? 221  LEU A O   1 
ATOM   1704 C  CB  . LEU A 1 221 ? 30.246  -2.219  26.340  1.00 30.82  ? 221  LEU A CB  1 
ATOM   1705 C  CG  . LEU A 1 221 ? 31.663  -2.765  26.539  1.00 43.86  ? 221  LEU A CG  1 
ATOM   1706 C  CD1 . LEU A 1 221 ? 32.696  -1.684  26.252  1.00 36.90  ? 221  LEU A CD1 1 
ATOM   1707 C  CD2 . LEU A 1 221 ? 31.844  -3.322  27.948  1.00 34.08  ? 221  LEU A CD2 1 
ATOM   1708 N  N   . PHE A 1 222 ? 26.948  -2.969  25.559  1.00 32.60  ? 222  PHE A N   1 
ATOM   1709 C  CA  . PHE A 1 222 ? 25.651  -2.357  25.279  1.00 38.61  ? 222  PHE A CA  1 
ATOM   1710 C  C   . PHE A 1 222 ? 24.685  -3.370  24.669  1.00 35.34  ? 222  PHE A C   1 
ATOM   1711 O  O   . PHE A 1 222 ? 25.095  -4.437  24.221  1.00 36.68  ? 222  PHE A O   1 
ATOM   1712 C  CB  . PHE A 1 222 ? 25.813  -1.141  24.354  1.00 34.31  ? 222  PHE A CB  1 
ATOM   1713 C  CG  . PHE A 1 222 ? 26.223  -1.497  22.954  1.00 30.05  ? 222  PHE A CG  1 
ATOM   1714 C  CD1 . PHE A 1 222 ? 27.550  -1.747  22.650  1.00 34.22  ? 222  PHE A CD1 1 
ATOM   1715 C  CD2 . PHE A 1 222 ? 25.277  -1.589  21.943  1.00 31.64  ? 222  PHE A CD2 1 
ATOM   1716 C  CE1 . PHE A 1 222 ? 27.933  -2.081  21.361  1.00 38.02  ? 222  PHE A CE1 1 
ATOM   1717 C  CE2 . PHE A 1 222 ? 25.651  -1.924  20.654  1.00 39.40  ? 222  PHE A CE2 1 
ATOM   1718 C  CZ  . PHE A 1 222 ? 26.983  -2.170  20.362  1.00 37.31  ? 222  PHE A CZ  1 
ATOM   1719 N  N   . HIS A 1 223 ? 23.403  -3.025  24.632  1.00 38.27  ? 223  HIS A N   1 
ATOM   1720 C  CA  . HIS A 1 223 ? 22.383  -3.969  24.189  1.00 36.52  ? 223  HIS A CA  1 
ATOM   1721 C  C   . HIS A 1 223 ? 21.574  -3.451  23.001  1.00 40.74  ? 223  HIS A C   1 
ATOM   1722 O  O   . HIS A 1 223 ? 21.081  -4.232  22.189  1.00 45.65  ? 223  HIS A O   1 
ATOM   1723 C  CB  . HIS A 1 223 ? 21.463  -4.315  25.363  1.00 31.05  ? 223  HIS A CB  1 
ATOM   1724 C  CG  . HIS A 1 223 ? 22.202  -4.582  26.636  1.00 42.32  ? 223  HIS A CG  1 
ATOM   1725 N  ND1 . HIS A 1 223 ? 22.639  -5.841  26.994  1.00 41.00  ? 223  HIS A ND1 1 
ATOM   1726 C  CD2 . HIS A 1 223 ? 22.615  -3.748  27.619  1.00 33.88  ? 223  HIS A CD2 1 
ATOM   1727 C  CE1 . HIS A 1 223 ? 23.270  -5.773  28.152  1.00 38.32  ? 223  HIS A CE1 1 
ATOM   1728 N  NE2 . HIS A 1 223 ? 23.272  -4.514  28.552  1.00 45.78  ? 223  HIS A NE2 1 
ATOM   1729 N  N   . ARG A 1 224 ? 21.450  -2.132  22.904  1.00 41.66  ? 224  ARG A N   1 
ATOM   1730 C  CA  . ARG A 1 224 ? 20.646  -1.505  21.861  1.00 38.99  ? 224  ARG A CA  1 
ATOM   1731 C  C   . ARG A 1 224 ? 21.284  -0.204  21.393  1.00 39.31  ? 224  ARG A C   1 
ATOM   1732 O  O   . ARG A 1 224 ? 22.045  0.425   22.127  1.00 38.89  ? 224  ARG A O   1 
ATOM   1733 C  CB  . ARG A 1 224 ? 19.232  -1.232  22.375  1.00 42.96  ? 224  ARG A CB  1 
ATOM   1734 C  CG  . ARG A 1 224 ? 18.323  -2.434  22.313  1.00 47.79  ? 224  ARG A CG  1 
ATOM   1735 C  CD  . ARG A 1 224 ? 16.983  -2.151  22.961  1.00 44.47  ? 224  ARG A CD  1 
ATOM   1736 N  NE  . ARG A 1 224 ? 17.107  -1.944  24.397  1.00 49.87  ? 224  ARG A NE  1 
ATOM   1737 C  CZ  . ARG A 1 224 ? 17.439  -2.900  25.262  1.00 53.47  ? 224  ARG A CZ  1 
ATOM   1738 N  NH1 . ARG A 1 224 ? 17.693  -4.131  24.838  1.00 37.13  ? 224  ARG A NH1 1 
ATOM   1739 N  NH2 . ARG A 1 224 ? 17.530  -2.622  26.555  1.00 47.47  ? 224  ARG A NH2 1 
ATOM   1740 N  N   . ALA A 1 225 ? 20.955  0.211   20.177  1.00 35.65  ? 225  ALA A N   1 
ATOM   1741 C  CA  . ALA A 1 225 ? 21.620  1.358   19.581  1.00 27.57  ? 225  ALA A CA  1 
ATOM   1742 C  C   . ALA A 1 225 ? 20.672  2.275   18.815  1.00 34.53  ? 225  ALA A C   1 
ATOM   1743 O  O   . ALA A 1 225 ? 19.803  1.811   18.078  1.00 30.94  ? 225  ALA A O   1 
ATOM   1744 C  CB  . ALA A 1 225 ? 22.737  0.887   18.672  1.00 30.59  ? 225  ALA A CB  1 
ATOM   1745 N  N   . VAL A 1 226 ? 20.860  3.581   18.994  1.00 32.06  ? 226  VAL A N   1 
ATOM   1746 C  CA  . VAL A 1 226 ? 20.198  4.583   18.167  1.00 35.74  ? 226  VAL A CA  1 
ATOM   1747 C  C   . VAL A 1 226 ? 21.211  5.396   17.359  1.00 33.55  ? 226  VAL A C   1 
ATOM   1748 O  O   . VAL A 1 226 ? 22.149  5.964   17.915  1.00 34.55  ? 226  VAL A O   1 
ATOM   1749 C  CB  . VAL A 1 226 ? 19.386  5.558   19.012  1.00 36.21  ? 226  VAL A CB  1 
ATOM   1750 C  CG1 . VAL A 1 226 ? 18.619  6.523   18.101  1.00 30.45  ? 226  VAL A CG1 1 
ATOM   1751 C  CG2 . VAL A 1 226 ? 18.449  4.797   19.931  1.00 31.79  ? 226  VAL A CG2 1 
ATOM   1752 N  N   . LEU A 1 227 ? 21.015  5.454   16.048  1.00 28.92  ? 227  LEU A N   1 
ATOM   1753 C  CA  . LEU A 1 227 ? 21.895  6.228   15.186  1.00 24.77  ? 227  LEU A CA  1 
ATOM   1754 C  C   . LEU A 1 227 ? 21.138  7.347   14.488  1.00 26.83  ? 227  LEU A C   1 
ATOM   1755 O  O   . LEU A 1 227 ? 20.396  7.107   13.537  1.00 30.59  ? 227  LEU A O   1 
ATOM   1756 C  CB  . LEU A 1 227 ? 22.586  5.329   14.160  1.00 31.19  ? 227  LEU A CB  1 
ATOM   1757 C  CG  . LEU A 1 227 ? 23.620  4.353   14.730  1.00 35.80  ? 227  LEU A CG  1 
ATOM   1758 C  CD1 . LEU A 1 227 ? 22.928  3.166   15.387  1.00 30.91  ? 227  LEU A CD1 1 
ATOM   1759 C  CD2 . LEU A 1 227 ? 24.580  3.882   13.652  1.00 22.58  ? 227  LEU A CD2 1 
ATOM   1760 N  N   . GLN A 1 228 ? 21.343  8.571   14.966  1.00 31.94  ? 228  GLN A N   1 
ATOM   1761 C  CA  . GLN A 1 228 ? 20.667  9.746   14.428  1.00 26.91  ? 228  GLN A CA  1 
ATOM   1762 C  C   . GLN A 1 228 ? 21.557  10.513  13.447  1.00 35.04  ? 228  GLN A C   1 
ATOM   1763 O  O   . GLN A 1 228 ? 22.545  11.131  13.845  1.00 33.01  ? 228  GLN A O   1 
ATOM   1764 C  CB  . GLN A 1 228 ? 20.237  10.668  15.573  1.00 20.97  ? 228  GLN A CB  1 
ATOM   1765 C  CG  . GLN A 1 228 ? 19.695  9.914   16.781  1.00 25.09  ? 228  GLN A CG  1 
ATOM   1766 C  CD  . GLN A 1 228 ? 19.272  10.823  17.919  1.00 28.59  ? 228  GLN A CD  1 
ATOM   1767 O  OE1 . GLN A 1 228 ? 19.041  10.365  19.035  1.00 30.97  ? 228  GLN A OE1 1 
ATOM   1768 N  NE2 . GLN A 1 228 ? 19.171  12.118  17.643  1.00 33.93  ? 228  GLN A NE2 1 
ATOM   1769 N  N   . SER A 1 229 ? 21.201  10.469  12.166  1.00 30.47  ? 229  SER A N   1 
ATOM   1770 C  CA  . SER A 1 229 ? 21.884  11.261  11.145  1.00 26.51  ? 229  SER A CA  1 
ATOM   1771 C  C   . SER A 1 229 ? 23.381  10.963  11.063  1.00 30.74  ? 229  SER A C   1 
ATOM   1772 O  O   . SER A 1 229 ? 24.196  11.874  10.960  1.00 31.99  ? 229  SER A O   1 
ATOM   1773 C  CB  . SER A 1 229 ? 21.666  12.755  11.396  1.00 29.49  ? 229  SER A CB  1 
ATOM   1774 O  OG  . SER A 1 229 ? 20.289  13.064  11.511  1.00 31.56  ? 229  SER A OG  1 
ATOM   1775 N  N   . GLY A 1 230 ? 23.739  9.686   11.111  1.00 28.68  ? 230  GLY A N   1 
ATOM   1776 C  CA  . GLY A 1 230 ? 25.130  9.288   11.049  1.00 27.47  ? 230  GLY A CA  1 
ATOM   1777 C  C   . GLY A 1 230 ? 25.270  7.782   10.979  1.00 30.76  ? 230  GLY A C   1 
ATOM   1778 O  O   . GLY A 1 230 ? 24.402  7.052   11.453  1.00 33.15  ? 230  GLY A O   1 
ATOM   1779 N  N   . THR A 1 231 ? 26.367  7.321   10.387  1.00 24.38  ? 231  THR A N   1 
ATOM   1780 C  CA  . THR A 1 231 ? 26.599  5.900   10.161  1.00 31.47  ? 231  THR A CA  1 
ATOM   1781 C  C   . THR A 1 231 ? 28.095  5.615   10.097  1.00 29.63  ? 231  THR A C   1 
ATOM   1782 O  O   . THR A 1 231 ? 28.872  6.476   9.697   1.00 29.90  ? 231  THR A O   1 
ATOM   1783 C  CB  . THR A 1 231 ? 25.957  5.422   8.829   1.00 38.83  ? 231  THR A CB  1 
ATOM   1784 O  OG1 . THR A 1 231 ? 26.510  6.160   7.731   1.00 34.91  ? 231  THR A OG1 1 
ATOM   1785 C  CG2 . THR A 1 231 ? 24.450  5.605   8.847   1.00 29.09  ? 231  THR A CG2 1 
ATOM   1786 N  N   . PRO A 1 232 ? 28.503  4.395   10.479  1.00 35.39  ? 232  PRO A N   1 
ATOM   1787 C  CA  . PRO A 1 232 ? 29.925  4.047   10.413  1.00 26.58  ? 232  PRO A CA  1 
ATOM   1788 C  C   . PRO A 1 232 ? 30.372  3.975   8.957   1.00 29.01  ? 232  PRO A C   1 
ATOM   1789 O  O   . PRO A 1 232 ? 31.508  4.310   8.627   1.00 30.40  ? 232  PRO A O   1 
ATOM   1790 C  CB  . PRO A 1 232 ? 29.982  2.645   11.039  1.00 30.75  ? 232  PRO A CB  1 
ATOM   1791 C  CG  . PRO A 1 232 ? 28.598  2.343   11.532  1.00 28.23  ? 232  PRO A CG  1 
ATOM   1792 C  CD  . PRO A 1 232 ? 27.659  3.239   10.822  1.00 29.13  ? 232  PRO A CD  1 
ATOM   1793 N  N   . ASN A 1 233 ? 29.470  3.518   8.099   1.00 29.65  ? 233  ASN A N   1 
ATOM   1794 C  CA  . ASN A 1 233 ? 29.720  3.445   6.669   1.00 34.41  ? 233  ASN A CA  1 
ATOM   1795 C  C   . ASN A 1 233 ? 29.460  4.808   6.051   1.00 34.12  ? 233  ASN A C   1 
ATOM   1796 O  O   . ASN A 1 233 ? 28.934  5.707   6.710   1.00 29.86  ? 233  ASN A O   1 
ATOM   1797 C  CB  . ASN A 1 233 ? 28.790  2.415   6.029   1.00 24.08  ? 233  ASN A CB  1 
ATOM   1798 C  CG  . ASN A 1 233 ? 27.333  2.686   6.346   1.00 30.29  ? 233  ASN A CG  1 
ATOM   1799 O  OD1 . ASN A 1 233 ? 26.919  2.637   7.507   1.00 32.59  ? 233  ASN A OD1 1 
ATOM   1800 N  ND2 . ASN A 1 233 ? 26.550  2.991   5.319   1.00 27.61  ? 233  ASN A ND2 1 
ATOM   1801 N  N   . GLY A 1 234 ? 29.813  4.959   4.781   1.00 29.17  ? 234  GLY A N   1 
ATOM   1802 C  CA  . GLY A 1 234 ? 29.669  6.239   4.116   1.00 32.91  ? 234  GLY A CA  1 
ATOM   1803 C  C   . GLY A 1 234 ? 31.003  6.913   3.859   1.00 33.71  ? 234  GLY A C   1 
ATOM   1804 O  O   . GLY A 1 234 ? 32.056  6.372   4.192   1.00 33.36  ? 234  GLY A O   1 
ATOM   1805 N  N   . PRO A 1 235 ? 30.963  8.117   3.281   1.00 35.13  ? 235  PRO A N   1 
ATOM   1806 C  CA  . PRO A 1 235 ? 32.159  8.773   2.743   1.00 29.40  ? 235  PRO A CA  1 
ATOM   1807 C  C   . PRO A 1 235 ? 33.010  9.538   3.762   1.00 26.93  ? 235  PRO A C   1 
ATOM   1808 O  O   . PRO A 1 235 ? 34.128  9.907   3.409   1.00 34.21  ? 235  PRO A O   1 
ATOM   1809 C  CB  . PRO A 1 235 ? 31.583  9.766   1.717   1.00 26.49  ? 235  PRO A CB  1 
ATOM   1810 C  CG  . PRO A 1 235 ? 30.065  9.696   1.855   1.00 29.26  ? 235  PRO A CG  1 
ATOM   1811 C  CD  . PRO A 1 235 ? 29.759  8.940   3.103   1.00 25.30  ? 235  PRO A CD  1 
ATOM   1812 N  N   . TRP A 1 236 ? 32.517  9.779   4.976   1.00 26.60  ? 236  TRP A N   1 
ATOM   1813 C  CA  . TRP A 1 236 ? 33.218  10.678  5.905   1.00 33.07  ? 236  TRP A CA  1 
ATOM   1814 C  C   . TRP A 1 236 ? 33.640  10.079  7.259   1.00 30.03  ? 236  TRP A C   1 
ATOM   1815 O  O   . TRP A 1 236 ? 34.543  10.600  7.914   1.00 28.12  ? 236  TRP A O   1 
ATOM   1816 C  CB  . TRP A 1 236 ? 32.391  11.956  6.139   1.00 26.55  ? 236  TRP A CB  1 
ATOM   1817 C  CG  . TRP A 1 236 ? 31.024  11.693  6.712   1.00 34.08  ? 236  TRP A CG  1 
ATOM   1818 C  CD1 . TRP A 1 236 ? 29.843  11.603  6.023   1.00 30.30  ? 236  TRP A CD1 1 
ATOM   1819 C  CD2 . TRP A 1 236 ? 30.699  11.475  8.091   1.00 29.87  ? 236  TRP A CD2 1 
ATOM   1820 N  NE1 . TRP A 1 236 ? 28.810  11.347  6.888   1.00 24.10  ? 236  TRP A NE1 1 
ATOM   1821 C  CE2 . TRP A 1 236 ? 29.306  11.262  8.162   1.00 28.87  ? 236  TRP A CE2 1 
ATOM   1822 C  CE3 . TRP A 1 236 ? 31.448  11.446  9.271   1.00 27.23  ? 236  TRP A CE3 1 
ATOM   1823 C  CZ2 . TRP A 1 236 ? 28.648  11.019  9.370   1.00 27.11  ? 236  TRP A CZ2 1 
ATOM   1824 C  CZ3 . TRP A 1 236 ? 30.794  11.202  10.467  1.00 33.89  ? 236  TRP A CZ3 1 
ATOM   1825 C  CH2 . TRP A 1 236 ? 29.406  10.991  10.507  1.00 25.87  ? 236  TRP A CH2 1 
ATOM   1826 N  N   . ALA A 1 237 ? 32.995  8.999   7.683   1.00 30.18  ? 237  ALA A N   1 
ATOM   1827 C  CA  . ALA A 1 237 ? 33.192  8.498   9.048   1.00 28.44  ? 237  ALA A CA  1 
ATOM   1828 C  C   . ALA A 1 237 ? 34.525  7.776   9.272   1.00 28.80  ? 237  ALA A C   1 
ATOM   1829 O  O   . ALA A 1 237 ? 34.999  7.678   10.407  1.00 25.88  ? 237  ALA A O   1 
ATOM   1830 C  CB  . ALA A 1 237 ? 32.019  7.624   9.482   1.00 21.76  ? 237  ALA A CB  1 
ATOM   1831 N  N   . THR A 1 238 ? 35.133  7.279   8.199   1.00 26.50  ? 238  THR A N   1 
ATOM   1832 C  CA  . THR A 1 238 ? 36.428  6.610   8.320   1.00 31.87  ? 238  THR A CA  1 
ATOM   1833 C  C   . THR A 1 238 ? 37.413  6.985   7.212   1.00 35.46  ? 238  THR A C   1 
ATOM   1834 O  O   . THR A 1 238 ? 37.028  7.487   6.158   1.00 36.37  ? 238  THR A O   1 
ATOM   1835 C  CB  . THR A 1 238 ? 36.277  5.073   8.327   1.00 32.45  ? 238  THR A CB  1 
ATOM   1836 O  OG1 . THR A 1 238 ? 35.668  4.643   7.100   1.00 34.20  ? 238  THR A OG1 1 
ATOM   1837 C  CG2 . THR A 1 238 ? 35.426  4.623   9.507   1.00 31.24  ? 238  THR A CG2 1 
ATOM   1838 N  N   . VAL A 1 239 ? 38.691  6.743   7.470   1.00 34.29  ? 239  VAL A N   1 
ATOM   1839 C  CA  . VAL A 1 239 ? 39.718  6.850   6.445   1.00 34.61  ? 239  VAL A CA  1 
ATOM   1840 C  C   . VAL A 1 239 ? 40.549  5.575   6.446   1.00 33.25  ? 239  VAL A C   1 
ATOM   1841 O  O   . VAL A 1 239 ? 40.651  4.886   7.463   1.00 25.43  ? 239  VAL A O   1 
ATOM   1842 C  CB  . VAL A 1 239 ? 40.651  8.066   6.663   1.00 28.22  ? 239  VAL A CB  1 
ATOM   1843 C  CG1 . VAL A 1 239 ? 39.939  9.363   6.297   1.00 28.00  ? 239  VAL A CG1 1 
ATOM   1844 C  CG2 . VAL A 1 239 ? 41.185  8.101   8.102   1.00 23.33  ? 239  VAL A CG2 1 
ATOM   1845 N  N   . SER A 1 240 ? 41.133  5.258   5.299   1.00 29.83  ? 240  SER A N   1 
ATOM   1846 C  CA  . SER A 1 240 ? 42.031  4.120   5.203   1.00 31.60  ? 240  SER A CA  1 
ATOM   1847 C  C   . SER A 1 240 ? 43.257  4.367   6.076   1.00 28.35  ? 240  SER A C   1 
ATOM   1848 O  O   . SER A 1 240 ? 43.507  5.493   6.513   1.00 34.57  ? 240  SER A O   1 
ATOM   1849 C  CB  . SER A 1 240 ? 42.468  3.921   3.755   1.00 24.45  ? 240  SER A CB  1 
ATOM   1850 O  OG  . SER A 1 240 ? 43.277  5.003   3.328   1.00 38.16  ? 240  SER A OG  1 
ATOM   1851 N  N   . ALA A 1 241 ? 44.029  3.319   6.325   1.00 33.77  ? 241  ALA A N   1 
ATOM   1852 C  CA  . ALA A 1 241 ? 45.271  3.479   7.064   1.00 38.19  ? 241  ALA A CA  1 
ATOM   1853 C  C   . ALA A 1 241 ? 46.217  4.368   6.264   1.00 34.53  ? 241  ALA A C   1 
ATOM   1854 O  O   . ALA A 1 241 ? 46.908  5.223   6.820   1.00 32.52  ? 241  ALA A O   1 
ATOM   1855 C  CB  . ALA A 1 241 ? 45.905  2.129   7.341   1.00 34.10  ? 241  ALA A CB  1 
ATOM   1856 N  N   . GLY A 1 242 ? 46.232  4.174   4.950   1.00 32.55  ? 242  GLY A N   1 
ATOM   1857 C  CA  . GLY A 1 242 ? 47.098  4.950   4.087   1.00 30.65  ? 242  GLY A CA  1 
ATOM   1858 C  C   . GLY A 1 242 ? 46.789  6.430   4.154   1.00 37.23  ? 242  GLY A C   1 
ATOM   1859 O  O   . GLY A 1 242 ? 47.692  7.255   4.282   1.00 35.45  ? 242  GLY A O   1 
ATOM   1860 N  N   . GLU A 1 243 ? 45.506  6.767   4.070   1.00 35.22  ? 243  GLU A N   1 
ATOM   1861 C  CA  . GLU A 1 243 ? 45.094  8.167   4.086   1.00 36.49  ? 243  GLU A CA  1 
ATOM   1862 C  C   . GLU A 1 243 ? 45.353  8.813   5.447   1.00 33.18  ? 243  GLU A C   1 
ATOM   1863 O  O   . GLU A 1 243 ? 45.713  9.985   5.522   1.00 32.04  ? 243  GLU A O   1 
ATOM   1864 C  CB  . GLU A 1 243 ? 43.625  8.310   3.663   1.00 33.99  ? 243  GLU A CB  1 
ATOM   1865 C  CG  . GLU A 1 243 ? 43.036  9.715   3.818   1.00 35.76  ? 243  GLU A CG  1 
ATOM   1866 C  CD  . GLU A 1 243 ? 43.663  10.766  2.902   1.00 42.62  ? 243  GLU A CD  1 
ATOM   1867 O  OE1 . GLU A 1 243 ? 43.202  11.925  2.948   1.00 36.78  ? 243  GLU A OE1 1 
ATOM   1868 O  OE2 . GLU A 1 243 ? 44.606  10.451  2.143   1.00 41.46  ? 243  GLU A OE2 1 
ATOM   1869 N  N   . ALA A 1 244 ? 45.186  8.044   6.519   1.00 33.38  ? 244  ALA A N   1 
ATOM   1870 C  CA  . ALA A 1 244 ? 45.468  8.549   7.861   1.00 34.07  ? 244  ALA A CA  1 
ATOM   1871 C  C   . ALA A 1 244 ? 46.959  8.824   8.038   1.00 33.29  ? 244  ALA A C   1 
ATOM   1872 O  O   . ALA A 1 244 ? 47.348  9.864   8.569   1.00 34.66  ? 244  ALA A O   1 
ATOM   1873 C  CB  . ALA A 1 244 ? 44.966  7.582   8.923   1.00 22.87  ? 244  ALA A CB  1 
ATOM   1874 N  N   . ARG A 1 245 ? 47.788  7.892   7.580   1.00 30.14  ? 245  ARG A N   1 
ATOM   1875 C  CA  . ARG A 1 245 ? 49.234  8.068   7.626   1.00 32.91  ? 245  ARG A CA  1 
ATOM   1876 C  C   . ARG A 1 245 ? 49.625  9.321   6.851   1.00 34.39  ? 245  ARG A C   1 
ATOM   1877 O  O   . ARG A 1 245 ? 50.447  10.130  7.300   1.00 31.88  ? 245  ARG A O   1 
ATOM   1878 C  CB  . ARG A 1 245 ? 49.945  6.838   7.050   1.00 36.07  ? 245  ARG A CB  1 
ATOM   1879 C  CG  . ARG A 1 245 ? 51.463  6.966   6.954   1.00 34.60  ? 245  ARG A CG  1 
ATOM   1880 C  CD  . ARG A 1 245 ? 52.137  5.605   6.798   1.00 30.23  ? 245  ARG A CD  1 
ATOM   1881 N  NE  . ARG A 1 245 ? 52.063  4.805   8.018   1.00 32.55  ? 245  ARG A NE  1 
ATOM   1882 C  CZ  . ARG A 1 245 ? 52.861  4.988   9.066   1.00 37.42  ? 245  ARG A CZ  1 
ATOM   1883 N  NH1 . ARG A 1 245 ? 53.789  5.938   9.040   1.00 30.00  ? 245  ARG A NH1 1 
ATOM   1884 N  NH2 . ARG A 1 245 ? 52.732  4.230   10.143  1.00 36.17  ? 245  ARG A NH2 1 
ATOM   1885 N  N   . ARG A 1 246 ? 49.017  9.480   5.683   1.00 28.78  ? 246  ARG A N   1 
ATOM   1886 C  CA  . ARG A 1 246 ? 49.267  10.640  4.851   1.00 26.62  ? 246  ARG A CA  1 
ATOM   1887 C  C   . ARG A 1 246 ? 48.913  11.937  5.588   1.00 35.54  ? 246  ARG A C   1 
ATOM   1888 O  O   . ARG A 1 246 ? 49.692  12.892  5.607   1.00 34.42  ? 246  ARG A O   1 
ATOM   1889 C  CB  . ARG A 1 246 ? 48.474  10.520  3.558   1.00 33.67  ? 246  ARG A CB  1 
ATOM   1890 C  CG  . ARG A 1 246 ? 48.797  11.590  2.556   1.00 35.15  ? 246  ARG A CG  1 
ATOM   1891 C  CD  . ARG A 1 246 ? 47.572  11.975  1.745   1.00 24.65  ? 246  ARG A CD  1 
ATOM   1892 N  NE  . ARG A 1 246 ? 47.531  13.427  1.639   1.00 52.03  ? 246  ARG A NE  1 
ATOM   1893 C  CZ  . ARG A 1 246 ? 46.513  14.179  2.033   1.00 33.26  ? 246  ARG A CZ  1 
ATOM   1894 N  NH1 . ARG A 1 246 ? 45.417  13.612  2.512   1.00 32.46  ? 246  ARG A NH1 1 
ATOM   1895 N  NH2 . ARG A 1 246 ? 46.581  15.499  1.909   1.00 60.72  ? 246  ARG A NH2 1 
ATOM   1896 N  N   . ARG A 1 247 ? 47.743  11.965  6.212   1.00 36.45  ? 247  ARG A N   1 
ATOM   1897 C  CA  . ARG A 1 247 ? 47.303  13.166  6.912   1.00 35.62  ? 247  ARG A CA  1 
ATOM   1898 C  C   . ARG A 1 247 ? 48.144  13.480  8.149   1.00 31.58  ? 247  ARG A C   1 
ATOM   1899 O  O   . ARG A 1 247 ? 48.426  14.643  8.435   1.00 30.14  ? 247  ARG A O   1 
ATOM   1900 C  CB  . ARG A 1 247 ? 45.823  13.072  7.277   1.00 26.94  ? 247  ARG A CB  1 
ATOM   1901 C  CG  . ARG A 1 247 ? 44.911  12.980  6.071   1.00 31.94  ? 247  ARG A CG  1 
ATOM   1902 C  CD  . ARG A 1 247 ? 43.459  12.886  6.489   1.00 26.64  ? 247  ARG A CD  1 
ATOM   1903 N  NE  . ARG A 1 247 ? 42.577  12.715  5.342   1.00 31.00  ? 247  ARG A NE  1 
ATOM   1904 C  CZ  . ARG A 1 247 ? 41.248  12.706  5.411   1.00 31.86  ? 247  ARG A CZ  1 
ATOM   1905 N  NH1 . ARG A 1 247 ? 40.640  12.868  6.579   1.00 23.20  ? 247  ARG A NH1 1 
ATOM   1906 N  NH2 . ARG A 1 247 ? 40.527  12.543  4.309   1.00 22.80  ? 247  ARG A NH2 1 
ATOM   1907 N  N   . ALA A 1 248 ? 48.538  12.446  8.884   1.00 34.97  ? 248  ALA A N   1 
ATOM   1908 C  CA  . ALA A 1 248 ? 49.345  12.640  10.085  1.00 25.70  ? 248  ALA A CA  1 
ATOM   1909 C  C   . ALA A 1 248 ? 50.720  13.215  9.744   1.00 37.36  ? 248  ALA A C   1 
ATOM   1910 O  O   . ALA A 1 248 ? 51.189  14.142  10.404  1.00 38.54  ? 248  ALA A O   1 
ATOM   1911 C  CB  . ALA A 1 248 ? 49.486  11.341  10.851  1.00 30.90  ? 248  ALA A CB  1 
ATOM   1912 N  N   . THR A 1 249 ? 51.360  12.675  8.710   1.00 30.66  ? 249  THR A N   1 
ATOM   1913 C  CA  . THR A 1 249 ? 52.685  13.155  8.326   1.00 36.32  ? 249  THR A CA  1 
ATOM   1914 C  C   . THR A 1 249 ? 52.611  14.582  7.800   1.00 32.31  ? 249  THR A C   1 
ATOM   1915 O  O   . THR A 1 249 ? 53.481  15.407  8.092   1.00 32.94  ? 249  THR A O   1 
ATOM   1916 C  CB  . THR A 1 249 ? 53.382  12.230  7.295   1.00 33.78  ? 249  THR A CB  1 
ATOM   1917 O  OG1 . THR A 1 249 ? 52.756  12.369  6.015   1.00 63.25  ? 249  THR A OG1 1 
ATOM   1918 C  CG2 . THR A 1 249 ? 53.303  10.779  7.739   1.00 33.67  ? 249  THR A CG2 1 
ATOM   1919 N  N   . LEU A 1 250 ? 51.561  14.880  7.040   1.00 34.74  ? 250  LEU A N   1 
ATOM   1920 C  CA  . LEU A 1 250 ? 51.369  16.236  6.544   1.00 30.57  ? 250  LEU A CA  1 
ATOM   1921 C  C   . LEU A 1 250 ? 51.180  17.216  7.700   1.00 30.13  ? 250  LEU A C   1 
ATOM   1922 O  O   . LEU A 1 250 ? 51.759  18.303  7.700   1.00 38.29  ? 250  LEU A O   1 
ATOM   1923 C  CB  . LEU A 1 250 ? 50.193  16.321  5.567   1.00 30.63  ? 250  LEU A CB  1 
ATOM   1924 C  CG  . LEU A 1 250 ? 49.936  17.742  5.044   1.00 38.41  ? 250  LEU A CG  1 
ATOM   1925 C  CD1 . LEU A 1 250 ? 51.226  18.402  4.553   1.00 25.85  ? 250  LEU A CD1 1 
ATOM   1926 C  CD2 . LEU A 1 250 ? 48.880  17.761  3.954   1.00 26.87  ? 250  LEU A CD2 1 
ATOM   1927 N  N   . LEU A 1 251 ? 50.378  16.833  8.689   1.00 30.96  ? 251  LEU A N   1 
ATOM   1928 C  CA  . LEU A 1 251 ? 50.149  17.709  9.827   1.00 33.65  ? 251  LEU A CA  1 
ATOM   1929 C  C   . LEU A 1 251 ? 51.458  17.917  10.558  1.00 30.78  ? 251  LEU A C   1 
ATOM   1930 O  O   . LEU A 1 251 ? 51.803  19.037  10.937  1.00 30.52  ? 251  LEU A O   1 
ATOM   1931 C  CB  . LEU A 1 251 ? 49.116  17.133  10.793  1.00 37.95  ? 251  LEU A CB  1 
ATOM   1932 C  CG  . LEU A 1 251 ? 49.055  17.982  12.068  1.00 43.52  ? 251  LEU A CG  1 
ATOM   1933 C  CD1 . LEU A 1 251 ? 48.121  19.173  11.882  1.00 34.65  ? 251  LEU A CD1 1 
ATOM   1934 C  CD2 . LEU A 1 251 ? 48.653  17.162  13.277  1.00 45.83  ? 251  LEU A CD2 1 
ATOM   1935 N  N   . ALA A 1 252 ? 52.182  16.822  10.755  1.00 29.82  ? 252  ALA A N   1 
ATOM   1936 C  CA  . ALA A 1 252 ? 53.513  16.884  11.345  1.00 37.90  ? 252  ALA A CA  1 
ATOM   1937 C  C   . ALA A 1 252 ? 54.380  17.925  10.628  1.00 36.31  ? 252  ALA A C   1 
ATOM   1938 O  O   . ALA A 1 252 ? 54.918  18.829  11.266  1.00 31.66  ? 252  ALA A O   1 
ATOM   1939 C  CB  . ALA A 1 252 ? 54.172  15.512  11.316  1.00 35.03  ? 252  ALA A CB  1 
ATOM   1940 N  N   . ARG A 1 253 ? 54.496  17.813  9.305   1.00 32.59  ? 253  ARG A N   1 
ATOM   1941 C  CA  . ARG A 1 253 ? 55.264  18.793  8.532   1.00 38.36  ? 253  ARG A CA  1 
ATOM   1942 C  C   . ARG A 1 253 ? 54.807  20.228  8.789   1.00 35.97  ? 253  ARG A C   1 
ATOM   1943 O  O   . ARG A 1 253 ? 55.628  21.115  9.006   1.00 38.98  ? 253  ARG A O   1 
ATOM   1944 C  CB  . ARG A 1 253 ? 55.211  18.494  7.031   1.00 29.45  ? 253  ARG A CB  1 
ATOM   1945 C  CG  . ARG A 1 253 ? 55.922  17.227  6.628   1.00 39.80  ? 253  ARG A CG  1 
ATOM   1946 C  CD  . ARG A 1 253 ? 56.442  17.291  5.189   1.00 53.21  ? 253  ARG A CD  1 
ATOM   1947 N  NE  . ARG A 1 253 ? 55.388  17.500  4.199   1.00 70.25  ? 253  ARG A NE  1 
ATOM   1948 C  CZ  . ARG A 1 253 ? 55.303  18.565  3.404   1.00 98.28  ? 253  ARG A CZ  1 
ATOM   1949 N  NH1 . ARG A 1 253 ? 54.308  18.664  2.530   1.00 73.11  ? 253  ARG A NH1 1 
ATOM   1950 N  NH2 . ARG A 1 253 ? 56.213  19.530  3.474   1.00 76.38  ? 253  ARG A NH2 1 
ATOM   1951 N  N   . LEU A 1 254 ? 53.497  20.453  8.764   1.00 34.21  ? 254  LEU A N   1 
ATOM   1952 C  CA  . LEU A 1 254 ? 52.950  21.795  8.947   1.00 33.03  ? 254  LEU A CA  1 
ATOM   1953 C  C   . LEU A 1 254 ? 53.304  22.406  10.299  1.00 39.47  ? 254  LEU A C   1 
ATOM   1954 O  O   . LEU A 1 254 ? 53.178  23.615  10.486  1.00 39.16  ? 254  LEU A O   1 
ATOM   1955 C  CB  . LEU A 1 254 ? 51.430  21.793  8.751   1.00 31.12  ? 254  LEU A CB  1 
ATOM   1956 C  CG  . LEU A 1 254 ? 50.994  21.335  7.356   1.00 47.19  ? 254  LEU A CG  1 
ATOM   1957 C  CD1 . LEU A 1 254 ? 49.482  21.225  7.253   1.00 28.19  ? 254  LEU A CD1 1 
ATOM   1958 C  CD2 . LEU A 1 254 ? 51.558  22.262  6.273   1.00 23.98  ? 254  LEU A CD2 1 
ATOM   1959 N  N   . VAL A 1 255 ? 53.740  21.571  11.239  1.00 30.78  ? 255  VAL A N   1 
ATOM   1960 C  CA  . VAL A 1 255 ? 54.158  22.059  12.550  1.00 38.29  ? 255  VAL A CA  1 
ATOM   1961 C  C   . VAL A 1 255 ? 55.635  21.757  12.825  1.00 41.63  ? 255  VAL A C   1 
ATOM   1962 O  O   . VAL A 1 255 ? 56.084  21.781  13.969  1.00 43.59  ? 255  VAL A O   1 
ATOM   1963 C  CB  . VAL A 1 255 ? 53.259  21.506  13.694  1.00 37.79  ? 255  VAL A CB  1 
ATOM   1964 C  CG1 . VAL A 1 255 ? 51.805  21.912  13.473  1.00 26.60  ? 255  VAL A CG1 1 
ATOM   1965 C  CG2 . VAL A 1 255 ? 53.391  19.991  13.816  1.00 27.84  ? 255  VAL A CG2 1 
ATOM   1966 N  N   . GLY A 1 256 ? 56.382  21.470  11.762  1.00 38.33  ? 256  GLY A N   1 
ATOM   1967 C  CA  . GLY A 1 256 ? 57.820  21.277  11.853  1.00 38.20  ? 256  GLY A CA  1 
ATOM   1968 C  C   . GLY A 1 256 ? 58.283  19.987  12.505  1.00 36.01  ? 256  GLY A C   1 
ATOM   1969 O  O   . GLY A 1 256 ? 59.195  20.006  13.326  1.00 50.80  ? 256  GLY A O   1 
ATOM   1970 N  N   . CYS A 1 257 ? 57.670  18.867  12.133  1.00 41.54  ? 257  CYS A N   1 
ATOM   1971 C  CA  . CYS A 1 257 ? 58.016  17.573  12.708  1.00 41.61  ? 257  CYS A CA  1 
ATOM   1972 C  C   . CYS A 1 257 ? 58.354  16.543  11.639  1.00 41.23  ? 257  CYS A C   1 
ATOM   1973 O  O   . CYS A 1 257 ? 58.395  16.859  10.457  1.00 54.91  ? 257  CYS A O   1 
ATOM   1974 C  CB  . CYS A 1 257 ? 56.878  17.052  13.586  1.00 36.10  ? 257  CYS A CB  1 
ATOM   1975 S  SG  . CYS A 1 257 ? 56.680  17.915  15.157  1.00 43.49  ? 257  CYS A SG  1 
ATOM   1976 N  N   . ASN A 1 265 ? 60.741  7.601   10.630  1.00 57.22  ? 265  ASN A N   1 
ATOM   1977 C  CA  . ASN A 1 265 ? 60.533  6.898   11.889  1.00 55.35  ? 265  ASN A CA  1 
ATOM   1978 C  C   . ASN A 1 265 ? 59.325  7.430   12.663  1.00 54.38  ? 265  ASN A C   1 
ATOM   1979 O  O   . ASN A 1 265 ? 59.340  8.559   13.157  1.00 49.37  ? 265  ASN A O   1 
ATOM   1980 C  CB  . ASN A 1 265 ? 61.794  6.984   12.750  1.00 61.28  ? 265  ASN A CB  1 
ATOM   1981 C  CG  . ASN A 1 265 ? 61.632  6.301   14.093  1.00 63.78  ? 265  ASN A CG  1 
ATOM   1982 O  OD1 . ASN A 1 265 ? 61.541  6.961   15.126  1.00 72.16  ? 265  ASN A OD1 1 
ATOM   1983 N  ND2 . ASN A 1 265 ? 61.589  4.973   14.084  1.00 63.05  ? 265  ASN A ND2 1 
ATOM   1984 N  N   . ASP A 1 266 ? 58.283  6.612   12.769  1.00 52.64  ? 266  ASP A N   1 
ATOM   1985 C  CA  . ASP A 1 266 ? 57.059  7.016   13.457  1.00 43.80  ? 266  ASP A CA  1 
ATOM   1986 C  C   . ASP A 1 266 ? 57.341  7.573   14.853  1.00 44.30  ? 266  ASP A C   1 
ATOM   1987 O  O   . ASP A 1 266 ? 56.852  8.640   15.217  1.00 45.66  ? 266  ASP A O   1 
ATOM   1988 C  CB  . ASP A 1 266 ? 56.087  5.837   13.553  1.00 39.01  ? 266  ASP A CB  1 
ATOM   1989 C  CG  . ASP A 1 266 ? 55.421  5.512   12.225  1.00 43.62  ? 266  ASP A CG  1 
ATOM   1990 O  OD1 . ASP A 1 266 ? 55.600  6.275   11.255  1.00 43.01  ? 266  ASP A OD1 1 
ATOM   1991 O  OD2 . ASP A 1 266 ? 54.707  4.491   12.152  1.00 42.27  ? 266  ASP A OD2 1 
ATOM   1992 N  N   . THR A 1 267 ? 58.139  6.844   15.624  1.00 48.37  ? 267  THR A N   1 
ATOM   1993 C  CA  . THR A 1 267 ? 58.415  7.188   17.016  1.00 46.73  ? 267  THR A CA  1 
ATOM   1994 C  C   . THR A 1 267 ? 58.889  8.624   17.178  1.00 43.99  ? 267  THR A C   1 
ATOM   1995 O  O   . THR A 1 267 ? 58.461  9.341   18.083  1.00 43.29  ? 267  THR A O   1 
ATOM   1996 C  CB  . THR A 1 267 ? 59.498  6.267   17.600  1.00 39.47  ? 267  THR A CB  1 
ATOM   1997 O  OG1 . THR A 1 267 ? 59.095  4.899   17.452  1.00 57.39  ? 267  THR A OG1 1 
ATOM   1998 C  CG2 . THR A 1 267 ? 59.719  6.573   19.066  1.00 29.86  ? 267  THR A CG2 1 
ATOM   1999 N  N   . GLU A 1 268 ? 59.783  9.031   16.292  1.00 43.05  ? 268  GLU A N   1 
ATOM   2000 C  CA  . GLU A 1 268 ? 60.427  10.331  16.381  1.00 47.48  ? 268  GLU A CA  1 
ATOM   2001 C  C   . GLU A 1 268 ? 59.460  11.448  15.981  1.00 41.68  ? 268  GLU A C   1 
ATOM   2002 O  O   . GLU A 1 268 ? 59.411  12.506  16.609  1.00 38.84  ? 268  GLU A O   1 
ATOM   2003 C  CB  . GLU A 1 268 ? 61.674  10.319  15.492  1.00 49.51  ? 268  GLU A CB  1 
ATOM   2004 C  CG  . GLU A 1 268 ? 62.440  11.621  15.406  1.00 69.85  ? 268  GLU A CG  1 
ATOM   2005 C  CD  . GLU A 1 268 ? 63.530  11.563  14.349  1.00 97.86  ? 268  GLU A CD  1 
ATOM   2006 O  OE1 . GLU A 1 268 ? 64.058  12.632  13.971  1.00 98.66  ? 268  GLU A OE1 1 
ATOM   2007 O  OE2 . GLU A 1 268 ? 63.852  10.445  13.889  1.00 90.44  ? 268  GLU A OE2 1 
ATOM   2008 N  N   . LEU A 1 269 ? 58.689  11.195  14.930  1.00 42.90  ? 269  LEU A N   1 
ATOM   2009 C  CA  . LEU A 1 269 ? 57.682  12.131  14.456  1.00 37.16  ? 269  LEU A CA  1 
ATOM   2010 C  C   . LEU A 1 269 ? 56.655  12.395  15.555  1.00 43.62  ? 269  LEU A C   1 
ATOM   2011 O  O   . LEU A 1 269 ? 56.373  13.543  15.901  1.00 36.97  ? 269  LEU A O   1 
ATOM   2012 C  CB  . LEU A 1 269 ? 57.005  11.549  13.214  1.00 43.81  ? 269  LEU A CB  1 
ATOM   2013 C  CG  . LEU A 1 269 ? 55.904  12.315  12.485  1.00 39.61  ? 269  LEU A CG  1 
ATOM   2014 C  CD1 . LEU A 1 269 ? 55.666  11.692  11.128  1.00 37.96  ? 269  LEU A CD1 1 
ATOM   2015 C  CD2 . LEU A 1 269 ? 54.623  12.309  13.290  1.00 42.65  ? 269  LEU A CD2 1 
ATOM   2016 N  N   . ILE A 1 270 ? 56.103  11.317  16.100  1.00 37.15  ? 270  ILE A N   1 
ATOM   2017 C  CA  . ILE A 1 270 ? 55.104  11.413  17.150  1.00 38.52  ? 270  ILE A CA  1 
ATOM   2018 C  C   . ILE A 1 270 ? 55.663  12.133  18.366  1.00 41.82  ? 270  ILE A C   1 
ATOM   2019 O  O   . ILE A 1 270 ? 54.988  12.962  18.977  1.00 42.73  ? 270  ILE A O   1 
ATOM   2020 C  CB  . ILE A 1 270 ? 54.619  10.021  17.572  1.00 41.67  ? 270  ILE A CB  1 
ATOM   2021 C  CG1 . ILE A 1 270 ? 53.878  9.353   16.415  1.00 38.20  ? 270  ILE A CG1 1 
ATOM   2022 C  CG2 . ILE A 1 270 ? 53.720  10.116  18.792  1.00 30.76  ? 270  ILE A CG2 1 
ATOM   2023 C  CD1 . ILE A 1 270 ? 53.756  7.853   16.561  1.00 46.72  ? 270  ILE A CD1 1 
ATOM   2024 N  N   . ALA A 1 271 ? 56.901  11.808  18.712  1.00 37.68  ? 271  ALA A N   1 
ATOM   2025 C  CA  . ALA A 1 271 ? 57.548  12.419  19.858  1.00 36.15  ? 271  ALA A CA  1 
ATOM   2026 C  C   . ALA A 1 271 ? 57.612  13.922  19.660  1.00 33.53  ? 271  ALA A C   1 
ATOM   2027 O  O   . ALA A 1 271 ? 57.480  14.688  20.612  1.00 40.02  ? 271  ALA A O   1 
ATOM   2028 C  CB  . ALA A 1 271 ? 58.944  11.846  20.048  1.00 30.71  ? 271  ALA A CB  1 
ATOM   2029 N  N   . CYS A 1 272 ? 57.807  14.343  18.416  1.00 31.93  ? 272  CYS A N   1 
ATOM   2030 C  CA  . CYS A 1 272 ? 57.900  15.764  18.116  1.00 31.43  ? 272  CYS A CA  1 
ATOM   2031 C  C   . CYS A 1 272 ? 56.532  16.400  18.264  1.00 37.63  ? 272  CYS A C   1 
ATOM   2032 O  O   . CYS A 1 272 ? 56.394  17.474  18.853  1.00 34.65  ? 272  CYS A O   1 
ATOM   2033 C  CB  . CYS A 1 272 ? 58.440  15.992  16.703  1.00 30.29  ? 272  CYS A CB  1 
ATOM   2034 S  SG  . CYS A 1 272 ? 58.439  17.731  16.191  1.00 38.61  ? 272  CYS A SG  1 
ATOM   2035 N  N   . LEU A 1 273 ? 55.523  15.721  17.727  1.00 30.63  ? 273  LEU A N   1 
ATOM   2036 C  CA  . LEU A 1 273 ? 54.145  16.169  17.852  1.00 33.63  ? 273  LEU A CA  1 
ATOM   2037 C  C   . LEU A 1 273 ? 53.742  16.348  19.312  1.00 39.46  ? 273  LEU A C   1 
ATOM   2038 O  O   . LEU A 1 273 ? 52.981  17.257  19.641  1.00 35.09  ? 273  LEU A O   1 
ATOM   2039 C  CB  . LEU A 1 273 ? 53.197  15.189  17.162  1.00 33.69  ? 273  LEU A CB  1 
ATOM   2040 C  CG  . LEU A 1 273 ? 53.125  15.316  15.644  1.00 32.58  ? 273  LEU A CG  1 
ATOM   2041 C  CD1 . LEU A 1 273 ? 52.145  14.310  15.056  1.00 35.93  ? 273  LEU A CD1 1 
ATOM   2042 C  CD2 . LEU A 1 273 ? 52.730  16.730  15.275  1.00 30.06  ? 273  LEU A CD2 1 
ATOM   2043 N  N   . ARG A 1 274 ? 54.258  15.491  20.190  1.00 31.83  ? 274  ARG A N   1 
ATOM   2044 C  CA  . ARG A 1 274 ? 53.875  15.555  21.595  1.00 33.34  ? 274  ARG A CA  1 
ATOM   2045 C  C   . ARG A 1 274 ? 54.451  16.776  22.298  1.00 36.41  ? 274  ARG A C   1 
ATOM   2046 O  O   . ARG A 1 274 ? 54.021  17.120  23.398  1.00 39.66  ? 274  ARG A O   1 
ATOM   2047 C  CB  . ARG A 1 274 ? 54.235  14.268  22.344  1.00 26.48  ? 274  ARG A CB  1 
ATOM   2048 C  CG  . ARG A 1 274 ? 53.289  13.105  22.059  1.00 34.64  ? 274  ARG A CG  1 
ATOM   2049 C  CD  . ARG A 1 274 ? 53.446  12.005  23.094  1.00 42.51  ? 274  ARG A CD  1 
ATOM   2050 N  NE  . ARG A 1 274 ? 54.854  11.707  23.304  1.00 57.03  ? 274  ARG A NE  1 
ATOM   2051 C  CZ  . ARG A 1 274 ? 55.469  10.635  22.822  1.00 59.50  ? 274  ARG A CZ  1 
ATOM   2052 N  NH1 . ARG A 1 274 ? 54.786  9.738   22.121  1.00 47.90  ? 274  ARG A NH1 1 
ATOM   2053 N  NH2 . ARG A 1 274 ? 56.765  10.457  23.055  1.00 56.85  ? 274  ARG A NH2 1 
ATOM   2054 N  N   . THR A 1 275 ? 55.407  17.442  21.657  1.00 32.49  ? 275  THR A N   1 
ATOM   2055 C  CA  . THR A 1 275 ? 55.990  18.649  22.236  1.00 34.66  ? 275  THR A CA  1 
ATOM   2056 C  C   . THR A 1 275 ? 55.276  19.911  21.770  1.00 36.32  ? 275  THR A C   1 
ATOM   2057 O  O   . THR A 1 275 ? 55.548  20.997  22.265  1.00 35.64  ? 275  THR A O   1 
ATOM   2058 C  CB  . THR A 1 275 ? 57.484  18.803  21.876  1.00 32.34  ? 275  THR A CB  1 
ATOM   2059 O  OG1 . THR A 1 275 ? 57.612  19.099  20.481  1.00 37.81  ? 275  THR A OG1 1 
ATOM   2060 C  CG2 . THR A 1 275 ? 58.251  17.535  22.198  1.00 29.66  ? 275  THR A CG2 1 
ATOM   2061 N  N   . ARG A 1 276 ? 54.376  19.775  20.805  1.00 33.76  ? 276  ARG A N   1 
ATOM   2062 C  CA  . ARG A 1 276 ? 53.683  20.940  20.275  1.00 32.02  ? 276  ARG A CA  1 
ATOM   2063 C  C   . ARG A 1 276 ? 52.512  21.330  21.170  1.00 38.29  ? 276  ARG A C   1 
ATOM   2064 O  O   . ARG A 1 276 ? 51.817  20.464  21.707  1.00 35.49  ? 276  ARG A O   1 
ATOM   2065 C  CB  . ARG A 1 276 ? 53.201  20.677  18.848  1.00 38.03  ? 276  ARG A CB  1 
ATOM   2066 C  CG  . ARG A 1 276 ? 54.325  20.502  17.844  1.00 32.53  ? 276  ARG A CG  1 
ATOM   2067 C  CD  . ARG A 1 276 ? 55.166  21.769  17.729  1.00 38.33  ? 276  ARG A CD  1 
ATOM   2068 N  NE  . ARG A 1 276 ? 56.248  21.603  16.763  1.00 49.86  ? 276  ARG A NE  1 
ATOM   2069 C  CZ  . ARG A 1 276 ? 57.499  21.294  17.088  1.00 52.29  ? 276  ARG A CZ  1 
ATOM   2070 N  NH1 . ARG A 1 276 ? 57.830  21.128  18.361  1.00 44.82  ? 276  ARG A NH1 1 
ATOM   2071 N  NH2 . ARG A 1 276 ? 58.420  21.151  16.143  1.00 41.78  ? 276  ARG A NH2 1 
ATOM   2072 N  N   . PRO A 1 277 ? 52.297  22.641  21.344  1.00 36.03  ? 277  PRO A N   1 
ATOM   2073 C  CA  . PRO A 1 277 ? 51.137  23.109  22.108  1.00 34.12  ? 277  PRO A CA  1 
ATOM   2074 C  C   . PRO A 1 277 ? 49.872  22.609  21.425  1.00 37.61  ? 277  PRO A C   1 
ATOM   2075 O  O   . PRO A 1 277 ? 49.851  22.486  20.196  1.00 33.10  ? 277  PRO A O   1 
ATOM   2076 C  CB  . PRO A 1 277 ? 51.227  24.638  21.998  1.00 34.64  ? 277  PRO A CB  1 
ATOM   2077 C  CG  . PRO A 1 277 ? 52.618  24.929  21.513  1.00 23.16  ? 277  PRO A CG  1 
ATOM   2078 C  CD  . PRO A 1 277 ? 53.026  23.747  20.703  1.00 32.14  ? 277  PRO A CD  1 
ATOM   2079 N  N   . ALA A 1 278 ? 48.839  22.311  22.203  1.00 35.63  ? 278  ALA A N   1 
ATOM   2080 C  CA  . ALA A 1 278 ? 47.611  21.771  21.633  1.00 30.27  ? 278  ALA A CA  1 
ATOM   2081 C  C   . ALA A 1 278 ? 47.027  22.713  20.579  1.00 32.07  ? 278  ALA A C   1 
ATOM   2082 O  O   . ALA A 1 278 ? 46.623  22.279  19.501  1.00 29.37  ? 278  ALA A O   1 
ATOM   2083 C  CB  . ALA A 1 278 ? 46.593  21.476  22.729  1.00 27.65  ? 278  ALA A CB  1 
ATOM   2084 N  N   . GLN A 1 279 ? 47.003  24.006  20.883  1.00 28.88  ? 279  GLN A N   1 
ATOM   2085 C  CA  . GLN A 1 279 ? 46.425  24.976  19.962  1.00 31.78  ? 279  GLN A CA  1 
ATOM   2086 C  C   . GLN A 1 279 ? 47.082  24.922  18.591  1.00 33.50  ? 279  GLN A C   1 
ATOM   2087 O  O   . GLN A 1 279 ? 46.443  25.164  17.566  1.00 39.59  ? 279  GLN A O   1 
ATOM   2088 C  CB  . GLN A 1 279 ? 46.534  26.391  20.520  1.00 23.70  ? 279  GLN A CB  1 
ATOM   2089 C  CG  . GLN A 1 279 ? 45.768  27.401  19.698  1.00 35.21  ? 279  GLN A CG  1 
ATOM   2090 C  CD  . GLN A 1 279 ? 44.291  27.068  19.628  1.00 39.88  ? 279  GLN A CD  1 
ATOM   2091 O  OE1 . GLN A 1 279 ? 43.625  26.920  20.656  1.00 31.76  ? 279  GLN A OE1 1 
ATOM   2092 N  NE2 . GLN A 1 279 ? 43.772  26.941  18.414  1.00 34.19  ? 279  GLN A NE2 1 
ATOM   2093 N  N   . ASP A 1 280 ? 48.365  24.597  18.581  1.00 29.82  ? 280  ASP A N   1 
ATOM   2094 C  CA  . ASP A 1 280 ? 49.126  24.580  17.348  1.00 33.31  ? 280  ASP A CA  1 
ATOM   2095 C  C   . ASP A 1 280 ? 48.645  23.454  16.438  1.00 34.03  ? 280  ASP A C   1 
ATOM   2096 O  O   . ASP A 1 280 ? 48.634  23.592  15.214  1.00 38.68  ? 280  ASP A O   1 
ATOM   2097 C  CB  . ASP A 1 280 ? 50.617  24.438  17.653  1.00 38.85  ? 280  ASP A CB  1 
ATOM   2098 C  CG  . ASP A 1 280 ? 51.486  24.858  16.494  1.00 54.01  ? 280  ASP A CG  1 
ATOM   2099 O  OD1 . ASP A 1 280 ? 50.953  25.486  15.554  1.00 71.57  ? 280  ASP A OD1 1 
ATOM   2100 O  OD2 . ASP A 1 280 ? 52.701  24.563  16.521  1.00 69.88  ? 280  ASP A OD2 1 
ATOM   2101 N  N   . LEU A 1 281 ? 48.236  22.343  17.042  1.00 30.37  ? 281  LEU A N   1 
ATOM   2102 C  CA  . LEU A 1 281 ? 47.707  21.221  16.281  1.00 24.95  ? 281  LEU A CA  1 
ATOM   2103 C  C   . LEU A 1 281 ? 46.312  21.550  15.752  1.00 32.30  ? 281  LEU A C   1 
ATOM   2104 O  O   . LEU A 1 281 ? 45.972  21.232  14.608  1.00 30.29  ? 281  LEU A O   1 
ATOM   2105 C  CB  . LEU A 1 281 ? 47.688  19.951  17.134  1.00 31.35  ? 281  LEU A CB  1 
ATOM   2106 C  CG  . LEU A 1 281 ? 49.048  19.499  17.675  1.00 27.96  ? 281  LEU A CG  1 
ATOM   2107 C  CD1 . LEU A 1 281 ? 48.949  18.120  18.278  1.00 28.91  ? 281  LEU A CD1 1 
ATOM   2108 C  CD2 . LEU A 1 281 ? 50.102  19.510  16.576  1.00 30.12  ? 281  LEU A CD2 1 
ATOM   2109 N  N   . VAL A 1 282 ? 45.512  22.208  16.584  1.00 27.68  ? 282  VAL A N   1 
ATOM   2110 C  CA  . VAL A 1 282 ? 44.180  22.627  16.177  1.00 37.37  ? 282  VAL A CA  1 
ATOM   2111 C  C   . VAL A 1 282 ? 44.252  23.617  15.014  1.00 31.99  ? 282  VAL A C   1 
ATOM   2112 O  O   . VAL A 1 282 ? 43.455  23.553  14.080  1.00 27.66  ? 282  VAL A O   1 
ATOM   2113 C  CB  . VAL A 1 282 ? 43.398  23.247  17.355  1.00 31.70  ? 282  VAL A CB  1 
ATOM   2114 C  CG1 . VAL A 1 282 ? 42.166  23.967  16.851  1.00 24.03  ? 282  VAL A CG1 1 
ATOM   2115 C  CG2 . VAL A 1 282 ? 43.018  22.174  18.355  1.00 21.46  ? 282  VAL A CG2 1 
ATOM   2116 N  N   . ASP A 1 283 ? 45.220  24.522  15.066  1.00 29.55  ? 283  ASP A N   1 
ATOM   2117 C  CA  . ASP A 1 283 ? 45.363  25.538  14.027  1.00 28.86  ? 283  ASP A CA  1 
ATOM   2118 C  C   . ASP A 1 283 ? 45.694  24.964  12.649  1.00 33.02  ? 283  ASP A C   1 
ATOM   2119 O  O   . ASP A 1 283 ? 45.544  25.645  11.643  1.00 29.82  ? 283  ASP A O   1 
ATOM   2120 C  CB  . ASP A 1 283 ? 46.423  26.567  14.424  1.00 30.59  ? 283  ASP A CB  1 
ATOM   2121 C  CG  . ASP A 1 283 ? 45.971  27.469  15.558  1.00 40.64  ? 283  ASP A CG  1 
ATOM   2122 O  OD1 . ASP A 1 283 ? 44.757  27.513  15.845  1.00 38.82  ? 283  ASP A OD1 1 
ATOM   2123 O  OD2 . ASP A 1 283 ? 46.833  28.139  16.161  1.00 42.65  ? 283  ASP A OD2 1 
ATOM   2124 N  N   . HIS A 1 284 ? 46.140  23.713  12.598  1.00 31.19  ? 284  HIS A N   1 
ATOM   2125 C  CA  . HIS A 1 284 ? 46.592  23.141  11.335  1.00 32.94  ? 284  HIS A CA  1 
ATOM   2126 C  C   . HIS A 1 284 ? 45.820  21.905  10.872  1.00 30.82  ? 284  HIS A C   1 
ATOM   2127 O  O   . HIS A 1 284 ? 45.946  21.498  9.718   1.00 27.18  ? 284  HIS A O   1 
ATOM   2128 C  CB  . HIS A 1 284 ? 48.088  22.827  11.397  1.00 35.18  ? 284  HIS A CB  1 
ATOM   2129 C  CG  . HIS A 1 284 ? 48.954  24.045  11.428  1.00 40.39  ? 284  HIS A CG  1 
ATOM   2130 N  ND1 . HIS A 1 284 ? 49.430  24.591  12.602  1.00 45.62  ? 284  HIS A ND1 1 
ATOM   2131 C  CD2 . HIS A 1 284 ? 49.425  24.827  10.430  1.00 38.32  ? 284  HIS A CD2 1 
ATOM   2132 C  CE1 . HIS A 1 284 ? 50.158  25.657  12.325  1.00 46.35  ? 284  HIS A CE1 1 
ATOM   2133 N  NE2 . HIS A 1 284 ? 50.171  25.823  11.012  1.00 44.99  ? 284  HIS A NE2 1 
ATOM   2134 N  N   . GLU A 1 285 ? 45.027  21.313  11.761  1.00 28.09  ? 285  GLU A N   1 
ATOM   2135 C  CA  . GLU A 1 285 ? 44.323  20.073  11.433  1.00 33.96  ? 285  GLU A CA  1 
ATOM   2136 C  C   . GLU A 1 285 ? 43.468  20.181  10.169  1.00 30.68  ? 285  GLU A C   1 
ATOM   2137 O  O   . GLU A 1 285 ? 43.455  19.270  9.347   1.00 29.75  ? 285  GLU A O   1 
ATOM   2138 C  CB  . GLU A 1 285 ? 43.474  19.593  12.611  1.00 24.05  ? 285  GLU A CB  1 
ATOM   2139 C  CG  . GLU A 1 285 ? 42.381  20.561  13.020  1.00 28.62  ? 285  GLU A CG  1 
ATOM   2140 C  CD  . GLU A 1 285 ? 41.443  19.967  14.053  1.00 37.34  ? 285  GLU A CD  1 
ATOM   2141 O  OE1 . GLU A 1 285 ? 40.497  20.667  14.469  1.00 43.58  ? 285  GLU A OE1 1 
ATOM   2142 O  OE2 . GLU A 1 285 ? 41.650  18.798  14.444  1.00 30.80  ? 285  GLU A OE2 1 
ATOM   2143 N  N   . TRP A 1 286 ? 42.770  21.297  10.007  1.00 26.42  ? 286  TRP A N   1 
ATOM   2144 C  CA  . TRP A 1 286 ? 41.869  21.464  8.869   1.00 34.58  ? 286  TRP A CA  1 
ATOM   2145 C  C   . TRP A 1 286 ? 42.613  21.555  7.526   1.00 33.28  ? 286  TRP A C   1 
ATOM   2146 O  O   . TRP A 1 286 ? 42.004  21.446  6.464   1.00 36.20  ? 286  TRP A O   1 
ATOM   2147 C  CB  . TRP A 1 286 ? 40.983  22.697  9.075   1.00 28.20  ? 286  TRP A CB  1 
ATOM   2148 C  CG  . TRP A 1 286 ? 39.698  22.662  8.317   1.00 32.01  ? 286  TRP A CG  1 
ATOM   2149 C  CD1 . TRP A 1 286 ? 39.343  21.772  7.347   1.00 35.90  ? 286  TRP A CD1 1 
ATOM   2150 C  CD2 . TRP A 1 286 ? 38.600  23.573  8.446   1.00 41.59  ? 286  TRP A CD2 1 
ATOM   2151 N  NE1 . TRP A 1 286 ? 38.089  22.063  6.873   1.00 33.02  ? 286  TRP A NE1 1 
ATOM   2152 C  CE2 . TRP A 1 286 ? 37.612  23.169  7.526   1.00 38.27  ? 286  TRP A CE2 1 
ATOM   2153 C  CE3 . TRP A 1 286 ? 38.354  24.692  9.251   1.00 39.42  ? 286  TRP A CE3 1 
ATOM   2154 C  CZ2 . TRP A 1 286 ? 36.399  23.846  7.386   1.00 37.50  ? 286  TRP A CZ2 1 
ATOM   2155 C  CZ3 . TRP A 1 286 ? 37.148  25.361  9.111   1.00 44.07  ? 286  TRP A CZ3 1 
ATOM   2156 C  CH2 . TRP A 1 286 ? 36.186  24.936  8.187   1.00 33.97  ? 286  TRP A CH2 1 
ATOM   2157 N  N   . HIS A 1 287 ? 43.928  21.731  7.573   1.00 37.27  ? 287  HIS A N   1 
ATOM   2158 C  CA  . HIS A 1 287 ? 44.703  21.933  6.347   1.00 39.91  ? 287  HIS A CA  1 
ATOM   2159 C  C   . HIS A 1 287 ? 45.125  20.654  5.625   1.00 35.16  ? 287  HIS A C   1 
ATOM   2160 O  O   . HIS A 1 287 ? 45.706  20.723  4.547   1.00 36.15  ? 287  HIS A O   1 
ATOM   2161 C  CB  . HIS A 1 287 ? 45.940  22.794  6.617   1.00 30.76  ? 287  HIS A CB  1 
ATOM   2162 C  CG  . HIS A 1 287 ? 45.623  24.143  7.178   1.00 49.21  ? 287  HIS A CG  1 
ATOM   2163 N  ND1 . HIS A 1 287 ? 44.475  24.833  6.847   1.00 59.27  ? 287  HIS A ND1 1 
ATOM   2164 C  CD2 . HIS A 1 287 ? 46.305  24.936  8.037   1.00 43.56  ? 287  HIS A CD2 1 
ATOM   2165 C  CE1 . HIS A 1 287 ? 44.459  25.987  7.489   1.00 52.71  ? 287  HIS A CE1 1 
ATOM   2166 N  NE2 . HIS A 1 287 ? 45.559  26.075  8.215   1.00 58.10  ? 287  HIS A NE2 1 
ATOM   2167 N  N   . VAL A 1 288 ? 44.831  19.493  6.198   1.00 29.89  ? 288  VAL A N   1 
ATOM   2168 C  CA  . VAL A 1 288 ? 45.335  18.249  5.621   1.00 29.75  ? 288  VAL A CA  1 
ATOM   2169 C  C   . VAL A 1 288 ? 44.350  17.479  4.727   1.00 34.41  ? 288  VAL A C   1 
ATOM   2170 O  O   . VAL A 1 288 ? 44.667  16.387  4.264   1.00 34.90  ? 288  VAL A O   1 
ATOM   2171 C  CB  . VAL A 1 288 ? 45.897  17.302  6.715   1.00 39.93  ? 288  VAL A CB  1 
ATOM   2172 C  CG1 . VAL A 1 288 ? 46.906  18.038  7.596   1.00 28.57  ? 288  VAL A CG1 1 
ATOM   2173 C  CG2 . VAL A 1 288 ? 44.772  16.719  7.554   1.00 24.52  ? 288  VAL A CG2 1 
ATOM   2174 N  N   . LEU A 1 289 ? 43.166  18.038  4.485   1.00 35.72  ? 289  LEU A N   1 
ATOM   2175 C  CA  . LEU A 1 289 ? 42.181  17.383  3.617   1.00 31.41  ? 289  LEU A CA  1 
ATOM   2176 C  C   . LEU A 1 289 ? 42.646  17.330  2.157   1.00 30.77  ? 289  LEU A C   1 
ATOM   2177 O  O   . LEU A 1 289 ? 43.228  18.282  1.652   1.00 30.63  ? 289  LEU A O   1 
ATOM   2178 C  CB  . LEU A 1 289 ? 40.812  18.069  3.707   1.00 28.71  ? 289  LEU A CB  1 
ATOM   2179 C  CG  . LEU A 1 289 ? 39.986  17.844  4.975   1.00 45.02  ? 289  LEU A CG  1 
ATOM   2180 C  CD1 . LEU A 1 289 ? 38.752  18.753  4.989   1.00 31.91  ? 289  LEU A CD1 1 
ATOM   2181 C  CD2 . LEU A 1 289 ? 39.594  16.372  5.128   1.00 27.38  ? 289  LEU A CD2 1 
ATOM   2182 N  N   . PRO A 1 290 ? 42.360  16.215  1.470   1.00 35.49  ? 290  PRO A N   1 
ATOM   2183 C  CA  . PRO A 1 290 ? 42.892  15.978  0.125   1.00 35.73  ? 290  PRO A CA  1 
ATOM   2184 C  C   . PRO A 1 290 ? 42.299  16.917  -0.915  1.00 34.23  ? 290  PRO A C   1 
ATOM   2185 O  O   . PRO A 1 290 ? 42.974  17.250  -1.883  1.00 34.82  ? 290  PRO A O   1 
ATOM   2186 C  CB  . PRO A 1 290 ? 42.455  14.536  -0.186  1.00 32.61  ? 290  PRO A CB  1 
ATOM   2187 C  CG  . PRO A 1 290 ? 41.922  13.977  1.103   1.00 33.96  ? 290  PRO A CG  1 
ATOM   2188 C  CD  . PRO A 1 290 ? 41.437  15.149  1.888   1.00 35.45  ? 290  PRO A CD  1 
ATOM   2189 N  N   . GLN A 1 291 ? 41.048  17.324  -0.732  1.00 38.38  ? 291  GLN A N   1 
ATOM   2190 C  CA  . GLN A 1 291 ? 40.401  18.205  -1.700  1.00 42.55  ? 291  GLN A CA  1 
ATOM   2191 C  C   . GLN A 1 291 ? 39.666  19.360  -1.021  1.00 37.95  ? 291  GLN A C   1 
ATOM   2192 O  O   . GLN A 1 291 ? 39.552  19.401  0.202   1.00 45.78  ? 291  GLN A O   1 
ATOM   2193 C  CB  . GLN A 1 291 ? 39.432  17.414  -2.589  1.00 33.11  ? 291  GLN A CB  1 
ATOM   2194 C  CG  . GLN A 1 291 ? 40.053  16.224  -3.318  1.00 36.34  ? 291  GLN A CG  1 
ATOM   2195 C  CD  . GLN A 1 291 ? 39.774  14.898  -2.619  1.00 58.98  ? 291  GLN A CD  1 
ATOM   2196 O  OE1 . GLN A 1 291 ? 40.226  13.835  -3.062  1.00 48.32  ? 291  GLN A OE1 1 
ATOM   2197 N  NE2 . GLN A 1 291 ? 39.017  14.956  -1.525  1.00 52.87  ? 291  GLN A NE2 1 
ATOM   2198 N  N   . GLU A 1 292 ? 39.185  20.308  -1.819  1.00 34.42  ? 292  GLU A N   1 
ATOM   2199 C  CA  . GLU A 1 292 ? 38.294  21.333  -1.305  1.00 36.47  ? 292  GLU A CA  1 
ATOM   2200 C  C   . GLU A 1 292 ? 36.944  20.658  -1.121  1.00 41.37  ? 292  GLU A C   1 
ATOM   2201 O  O   . GLU A 1 292 ? 36.406  20.072  -2.058  1.00 35.05  ? 292  GLU A O   1 
ATOM   2202 C  CB  . GLU A 1 292 ? 38.181  22.499  -2.285  1.00 34.17  ? 292  GLU A CB  1 
ATOM   2203 C  CG  . GLU A 1 292 ? 37.447  23.713  -1.721  1.00 50.95  ? 292  GLU A CG  1 
ATOM   2204 C  CD  . GLU A 1 292 ? 37.131  24.761  -2.777  1.00 75.43  ? 292  GLU A CD  1 
ATOM   2205 O  OE1 . GLU A 1 292 ? 37.596  24.611  -3.927  1.00 63.83  ? 292  GLU A OE1 1 
ATOM   2206 O  OE2 . GLU A 1 292 ? 36.413  25.735  -2.456  1.00 72.18  ? 292  GLU A OE2 1 
ATOM   2207 N  N   . SER A 1 293 ? 36.396  20.715  0.083   1.00 29.42  ? 293  SER A N   1 
ATOM   2208 C  CA  . SER A 1 293 ? 35.229  19.897  0.365   1.00 32.39  ? 293  SER A CA  1 
ATOM   2209 C  C   . SER A 1 293 ? 34.365  20.426  1.492   1.00 24.28  ? 293  SER A C   1 
ATOM   2210 O  O   . SER A 1 293 ? 34.745  21.347  2.203   1.00 33.06  ? 293  SER A O   1 
ATOM   2211 C  CB  . SER A 1 293 ? 35.668  18.464  0.685   1.00 24.39  ? 293  SER A CB  1 
ATOM   2212 O  OG  . SER A 1 293 ? 36.538  18.441  1.796   1.00 29.63  ? 293  SER A OG  1 
ATOM   2213 N  N   . ILE A 1 294 ? 33.182  19.841  1.623   1.00 31.15  ? 294  ILE A N   1 
ATOM   2214 C  CA  . ILE A 1 294 ? 32.369  19.996  2.819   1.00 33.22  ? 294  ILE A CA  1 
ATOM   2215 C  C   . ILE A 1 294 ? 32.011  18.597  3.303   1.00 29.45  ? 294  ILE A C   1 
ATOM   2216 O  O   . ILE A 1 294 ? 32.153  17.626  2.559   1.00 30.50  ? 294  ILE A O   1 
ATOM   2217 C  CB  . ILE A 1 294 ? 31.087  20.820  2.563   1.00 28.99  ? 294  ILE A CB  1 
ATOM   2218 C  CG1 . ILE A 1 294 ? 30.337  20.288  1.343   1.00 30.50  ? 294  ILE A CG1 1 
ATOM   2219 C  CG2 . ILE A 1 294 ? 31.424  22.295  2.374   1.00 22.95  ? 294  ILE A CG2 1 
ATOM   2220 C  CD1 . ILE A 1 294 ? 29.024  20.991  1.101   1.00 30.44  ? 294  ILE A CD1 1 
ATOM   2221 N  N   . PHE A 1 295 ? 31.560  18.495  4.549   1.00 32.72  ? 295  PHE A N   1 
ATOM   2222 C  CA  . PHE A 1 295 ? 31.228  17.205  5.145   1.00 26.13  ? 295  PHE A CA  1 
ATOM   2223 C  C   . PHE A 1 295 ? 32.397  16.229  5.029   1.00 28.37  ? 295  PHE A C   1 
ATOM   2224 O  O   . PHE A 1 295 ? 32.219  15.050  4.727   1.00 27.67  ? 295  PHE A O   1 
ATOM   2225 C  CB  . PHE A 1 295 ? 29.975  16.609  4.496   1.00 29.19  ? 295  PHE A CB  1 
ATOM   2226 C  CG  . PHE A 1 295 ? 29.021  16.004  5.481   1.00 32.27  ? 295  PHE A CG  1 
ATOM   2227 C  CD1 . PHE A 1 295 ? 29.478  15.120  6.452   1.00 28.95  ? 295  PHE A CD1 1 
ATOM   2228 C  CD2 . PHE A 1 295 ? 27.670  16.328  5.449   1.00 25.29  ? 295  PHE A CD2 1 
ATOM   2229 C  CE1 . PHE A 1 295 ? 28.602  14.563  7.372   1.00 28.29  ? 295  PHE A CE1 1 
ATOM   2230 C  CE2 . PHE A 1 295 ? 26.787  15.775  6.364   1.00 28.97  ? 295  PHE A CE2 1 
ATOM   2231 C  CZ  . PHE A 1 295 ? 27.251  14.889  7.327   1.00 28.78  ? 295  PHE A CZ  1 
ATOM   2232 N  N   . ARG A 1 296 ? 33.600  16.741  5.245   1.00 28.13  ? 296  ARG A N   1 
ATOM   2233 C  CA  . ARG A 1 296 ? 34.784  15.903  5.324   1.00 26.46  ? 296  ARG A CA  1 
ATOM   2234 C  C   . ARG A 1 296 ? 35.605  16.400  6.493   1.00 29.39  ? 296  ARG A C   1 
ATOM   2235 O  O   . ARG A 1 296 ? 35.730  17.604  6.707   1.00 29.25  ? 296  ARG A O   1 
ATOM   2236 C  CB  . ARG A 1 296 ? 35.602  15.973  4.036   1.00 20.23  ? 296  ARG A CB  1 
ATOM   2237 C  CG  . ARG A 1 296 ? 34.935  15.342  2.831   1.00 24.08  ? 296  ARG A CG  1 
ATOM   2238 C  CD  . ARG A 1 296 ? 34.880  13.817  2.916   1.00 25.61  ? 296  ARG A CD  1 
ATOM   2239 N  NE  . ARG A 1 296 ? 34.291  13.253  1.705   1.00 33.40  ? 296  ARG A NE  1 
ATOM   2240 C  CZ  . ARG A 1 296 ? 32.982  13.139  1.503   1.00 33.51  ? 296  ARG A CZ  1 
ATOM   2241 N  NH1 . ARG A 1 296 ? 32.134  13.533  2.442   1.00 29.35  ? 296  ARG A NH1 1 
ATOM   2242 N  NH2 . ARG A 1 296 ? 32.520  12.634  0.366   1.00 28.10  ? 296  ARG A NH2 1 
ATOM   2243 N  N   . PHE A 1 297 ? 36.160  15.474  7.260   1.00 26.32  ? 297  PHE A N   1 
ATOM   2244 C  CA  . PHE A 1 297 ? 36.880  15.854  8.460   1.00 28.00  ? 297  PHE A CA  1 
ATOM   2245 C  C   . PHE A 1 297 ? 38.251  15.205  8.492   1.00 32.15  ? 297  PHE A C   1 
ATOM   2246 O  O   . PHE A 1 297 ? 38.410  14.047  8.105   1.00 29.69  ? 297  PHE A O   1 
ATOM   2247 C  CB  . PHE A 1 297 ? 36.042  15.516  9.685   1.00 24.74  ? 297  PHE A CB  1 
ATOM   2248 C  CG  . PHE A 1 297 ? 34.588  15.784  9.485   1.00 27.55  ? 297  PHE A CG  1 
ATOM   2249 C  CD1 . PHE A 1 297 ? 34.100  17.082  9.522   1.00 29.00  ? 297  PHE A CD1 1 
ATOM   2250 C  CD2 . PHE A 1 297 ? 33.710  14.749  9.217   1.00 22.10  ? 297  PHE A CD2 1 
ATOM   2251 C  CE1 . PHE A 1 297 ? 32.757  17.342  9.322   1.00 28.12  ? 297  PHE A CE1 1 
ATOM   2252 C  CE2 . PHE A 1 297 ? 32.361  15.003  9.016   1.00 29.31  ? 297  PHE A CE2 1 
ATOM   2253 C  CZ  . PHE A 1 297 ? 31.885  16.300  9.070   1.00 26.85  ? 297  PHE A CZ  1 
ATOM   2254 N  N   . SER A 1 298 ? 39.238  15.975  8.934   1.00 29.06  ? 298  SER A N   1 
ATOM   2255 C  CA  . SER A 1 298 ? 40.636  15.590  8.810   1.00 34.91  ? 298  SER A CA  1 
ATOM   2256 C  C   . SER A 1 298 ? 41.015  14.361  9.618   1.00 29.77  ? 298  SER A C   1 
ATOM   2257 O  O   . SER A 1 298 ? 41.737  13.490  9.137   1.00 33.23  ? 298  SER A O   1 
ATOM   2258 C  CB  . SER A 1 298 ? 41.532  16.757  9.201   1.00 22.62  ? 298  SER A CB  1 
ATOM   2259 O  OG  . SER A 1 298 ? 41.301  17.844  8.334   1.00 42.57  ? 298  SER A OG  1 
ATOM   2260 N  N   . PHE A 1 299 ? 40.527  14.298  10.847  1.00 27.96  ? 299  PHE A N   1 
ATOM   2261 C  CA  . PHE A 1 299 ? 40.936  13.240  11.755  1.00 29.50  ? 299  PHE A CA  1 
ATOM   2262 C  C   . PHE A 1 299 ? 39.745  12.497  12.322  1.00 32.23  ? 299  PHE A C   1 
ATOM   2263 O  O   . PHE A 1 299 ? 39.028  12.995  13.190  1.00 35.52  ? 299  PHE A O   1 
ATOM   2264 C  CB  . PHE A 1 299 ? 41.878  13.791  12.832  1.00 31.21  ? 299  PHE A CB  1 
ATOM   2265 C  CG  . PHE A 1 299 ? 43.194  14.247  12.271  1.00 25.70  ? 299  PHE A CG  1 
ATOM   2266 C  CD1 . PHE A 1 299 ? 44.202  13.334  12.018  1.00 28.15  ? 299  PHE A CD1 1 
ATOM   2267 C  CD2 . PHE A 1 299 ? 43.398  15.572  11.935  1.00 27.48  ? 299  PHE A CD2 1 
ATOM   2268 C  CE1 . PHE A 1 299 ? 45.406  13.742  11.469  1.00 27.47  ? 299  PHE A CE1 1 
ATOM   2269 C  CE2 . PHE A 1 299 ? 44.600  15.987  11.389  1.00 30.91  ? 299  PHE A CE2 1 
ATOM   2270 C  CZ  . PHE A 1 299 ? 45.603  15.069  11.157  1.00 27.48  ? 299  PHE A CZ  1 
ATOM   2271 N  N   . VAL A 1 300 ? 39.544  11.299  11.786  1.00 30.95  ? 300  VAL A N   1 
ATOM   2272 C  CA  . VAL A 1 300 ? 38.379  10.482  12.077  1.00 27.80  ? 300  VAL A CA  1 
ATOM   2273 C  C   . VAL A 1 300 ? 38.850  9.050   12.307  1.00 24.71  ? 300  VAL A C   1 
ATOM   2274 O  O   . VAL A 1 300 ? 40.026  8.751   12.129  1.00 32.87  ? 300  VAL A O   1 
ATOM   2275 C  CB  . VAL A 1 300 ? 37.392  10.520  10.894  1.00 26.07  ? 300  VAL A CB  1 
ATOM   2276 C  CG1 . VAL A 1 300 ? 36.943  11.947  10.621  1.00 22.66  ? 300  VAL A CG1 1 
ATOM   2277 C  CG2 . VAL A 1 300 ? 38.037  9.930   9.649   1.00 27.47  ? 300  VAL A CG2 1 
ATOM   2278 N  N   . PRO A 1 301 ? 37.939  8.159   12.719  1.00 28.69  ? 301  PRO A N   1 
ATOM   2279 C  CA  . PRO A 1 301 ? 38.323  6.752   12.865  1.00 28.12  ? 301  PRO A CA  1 
ATOM   2280 C  C   . PRO A 1 301 ? 39.009  6.189   11.622  1.00 32.54  ? 301  PRO A C   1 
ATOM   2281 O  O   . PRO A 1 301 ? 38.583  6.425   10.488  1.00 28.72  ? 301  PRO A O   1 
ATOM   2282 C  CB  . PRO A 1 301 ? 36.984  6.056   13.106  1.00 26.19  ? 301  PRO A CB  1 
ATOM   2283 C  CG  . PRO A 1 301 ? 36.176  7.089   13.829  1.00 29.32  ? 301  PRO A CG  1 
ATOM   2284 C  CD  . PRO A 1 301 ? 36.578  8.415   13.224  1.00 30.49  ? 301  PRO A CD  1 
ATOM   2285 N  N   . VAL A 1 302 ? 40.083  5.448   11.854  1.00 29.83  ? 302  VAL A N   1 
ATOM   2286 C  CA  . VAL A 1 302 ? 40.828  4.810   10.783  1.00 31.12  ? 302  VAL A CA  1 
ATOM   2287 C  C   . VAL A 1 302 ? 40.532  3.305   10.748  1.00 35.28  ? 302  VAL A C   1 
ATOM   2288 O  O   . VAL A 1 302 ? 40.362  2.670   11.793  1.00 32.44  ? 302  VAL A O   1 
ATOM   2289 C  CB  . VAL A 1 302 ? 42.352  5.038   10.962  1.00 32.98  ? 302  VAL A CB  1 
ATOM   2290 C  CG1 . VAL A 1 302 ? 42.828  4.483   12.303  1.00 26.21  ? 302  VAL A CG1 1 
ATOM   2291 C  CG2 . VAL A 1 302 ? 43.127  4.412   9.818   1.00 32.45  ? 302  VAL A CG2 1 
ATOM   2292 N  N   . VAL A 1 303 ? 40.457  2.740   9.546   1.00 29.03  ? 303  VAL A N   1 
ATOM   2293 C  CA  . VAL A 1 303 ? 40.342  1.293   9.400   1.00 29.47  ? 303  VAL A CA  1 
ATOM   2294 C  C   . VAL A 1 303 ? 41.693  0.648   9.715   1.00 33.65  ? 303  VAL A C   1 
ATOM   2295 O  O   . VAL A 1 303 ? 42.541  0.487   8.842   1.00 37.63  ? 303  VAL A O   1 
ATOM   2296 C  CB  . VAL A 1 303 ? 39.865  0.888   7.994   1.00 35.93  ? 303  VAL A CB  1 
ATOM   2297 C  CG1 . VAL A 1 303 ? 39.721  -0.620  7.905   1.00 39.04  ? 303  VAL A CG1 1 
ATOM   2298 C  CG2 . VAL A 1 303 ? 38.545  1.553   7.677   1.00 31.07  ? 303  VAL A CG2 1 
ATOM   2299 N  N   . ASP A 1 304 ? 41.875  0.292   10.983  1.00 41.37  ? 304  ASP A N   1 
ATOM   2300 C  CA  . ASP A 1 304 ? 43.170  -0.120  11.514  1.00 36.18  ? 304  ASP A CA  1 
ATOM   2301 C  C   . ASP A 1 304 ? 43.386  -1.629  11.494  1.00 40.91  ? 304  ASP A C   1 
ATOM   2302 O  O   . ASP A 1 304 ? 44.469  -2.103  11.812  1.00 39.01  ? 304  ASP A O   1 
ATOM   2303 C  CB  . ASP A 1 304 ? 43.321  0.388   12.953  1.00 34.54  ? 304  ASP A CB  1 
ATOM   2304 C  CG  . ASP A 1 304 ? 42.194  -0.094  13.867  1.00 42.06  ? 304  ASP A CG  1 
ATOM   2305 O  OD1 . ASP A 1 304 ? 41.203  -0.673  13.358  1.00 36.27  ? 304  ASP A OD1 1 
ATOM   2306 O  OD2 . ASP A 1 304 ? 42.295  0.110   15.097  1.00 34.27  ? 304  ASP A OD2 1 
ATOM   2307 N  N   . GLY A 1 305 ? 42.355  -2.384  11.137  1.00 42.37  ? 305  GLY A N   1 
ATOM   2308 C  CA  . GLY A 1 305 ? 42.428  -3.829  11.222  1.00 37.13  ? 305  GLY A CA  1 
ATOM   2309 C  C   . GLY A 1 305 ? 42.439  -4.300  12.667  1.00 42.81  ? 305  GLY A C   1 
ATOM   2310 O  O   . GLY A 1 305 ? 42.804  -5.438  12.951  1.00 55.05  ? 305  GLY A O   1 
ATOM   2311 N  N   . ASP A 1 306 ? 42.032  -3.424  13.581  1.00 38.46  ? 306  ASP A N   1 
ATOM   2312 C  CA  . ASP A 1 306 ? 42.006  -3.739  15.007  1.00 29.33  ? 306  ASP A CA  1 
ATOM   2313 C  C   . ASP A 1 306 ? 40.646  -3.397  15.623  1.00 36.24  ? 306  ASP A C   1 
ATOM   2314 O  O   . ASP A 1 306 ? 39.786  -4.266  15.767  1.00 42.08  ? 306  ASP A O   1 
ATOM   2315 C  CB  . ASP A 1 306 ? 43.129  -2.989  15.730  1.00 36.80  ? 306  ASP A CB  1 
ATOM   2316 C  CG  . ASP A 1 306 ? 43.202  -3.322  17.210  1.00 47.49  ? 306  ASP A CG  1 
ATOM   2317 O  OD1 . ASP A 1 306 ? 42.524  -4.280  17.643  1.00 45.68  ? 306  ASP A OD1 1 
ATOM   2318 O  OD2 . ASP A 1 306 ? 43.943  -2.628  17.941  1.00 45.82  ? 306  ASP A OD2 1 
ATOM   2319 N  N   . PHE A 1 307 ? 40.455  -2.134  15.996  1.00 33.77  ? 307  PHE A N   1 
ATOM   2320 C  CA  . PHE A 1 307 ? 39.137  -1.669  16.417  1.00 38.81  ? 307  PHE A CA  1 
ATOM   2321 C  C   . PHE A 1 307 ? 38.129  -1.916  15.299  1.00 36.99  ? 307  PHE A C   1 
ATOM   2322 O  O   . PHE A 1 307 ? 37.006  -2.354  15.540  1.00 36.59  ? 307  PHE A O   1 
ATOM   2323 C  CB  . PHE A 1 307 ? 39.164  -0.185  16.778  1.00 32.97  ? 307  PHE A CB  1 
ATOM   2324 C  CG  . PHE A 1 307 ? 37.950  0.270   17.526  1.00 35.65  ? 307  PHE A CG  1 
ATOM   2325 C  CD1 . PHE A 1 307 ? 36.738  0.439   16.871  1.00 32.22  ? 307  PHE A CD1 1 
ATOM   2326 C  CD2 . PHE A 1 307 ? 38.016  0.526   18.888  1.00 33.35  ? 307  PHE A CD2 1 
ATOM   2327 C  CE1 . PHE A 1 307 ? 35.612  0.852   17.559  1.00 30.56  ? 307  PHE A CE1 1 
ATOM   2328 C  CE2 . PHE A 1 307 ? 36.894  0.946   19.585  1.00 27.93  ? 307  PHE A CE2 1 
ATOM   2329 C  CZ  . PHE A 1 307 ? 35.690  1.106   18.921  1.00 26.54  ? 307  PHE A CZ  1 
ATOM   2330 N  N   . LEU A 1 308 ? 38.541  -1.624  14.072  1.00 37.15  ? 308  LEU A N   1 
ATOM   2331 C  CA  . LEU A 1 308 ? 37.758  -1.978  12.899  1.00 40.44  ? 308  LEU A CA  1 
ATOM   2332 C  C   . LEU A 1 308 ? 38.538  -3.016  12.105  1.00 40.14  ? 308  LEU A C   1 
ATOM   2333 O  O   . LEU A 1 308 ? 39.544  -2.697  11.473  1.00 39.09  ? 308  LEU A O   1 
ATOM   2334 C  CB  . LEU A 1 308 ? 37.477  -0.742  12.042  1.00 33.44  ? 308  LEU A CB  1 
ATOM   2335 C  CG  . LEU A 1 308 ? 36.584  0.315   12.692  1.00 36.13  ? 308  LEU A CG  1 
ATOM   2336 C  CD1 . LEU A 1 308 ? 36.509  1.557   11.821  1.00 32.80  ? 308  LEU A CD1 1 
ATOM   2337 C  CD2 . LEU A 1 308 ? 35.189  -0.249  12.972  1.00 35.88  ? 308  LEU A CD2 1 
ATOM   2338 N  N   . SER A 1 309 ? 38.081  -4.261  12.154  1.00 41.22  ? 309  SER A N   1 
ATOM   2339 C  CA  . SER A 1 309 ? 38.806  -5.367  11.533  1.00 46.31  ? 309  SER A CA  1 
ATOM   2340 C  C   . SER A 1 309 ? 38.827  -5.255  10.010  1.00 48.13  ? 309  SER A C   1 
ATOM   2341 O  O   . SER A 1 309 ? 39.683  -5.841  9.350   1.00 44.93  ? 309  SER A O   1 
ATOM   2342 C  CB  . SER A 1 309 ? 38.202  -6.703  11.959  1.00 34.06  ? 309  SER A CB  1 
ATOM   2343 O  OG  . SER A 1 309 ? 36.814  -6.738  11.690  1.00 49.70  ? 309  SER A OG  1 
ATOM   2344 N  N   . ASP A 1 310 ? 37.880  -4.494  9.470   1.00 45.74  ? 310  ASP A N   1 
ATOM   2345 C  CA  . ASP A 1 310 ? 37.786  -4.239  8.036   1.00 35.28  ? 310  ASP A CA  1 
ATOM   2346 C  C   . ASP A 1 310 ? 37.018  -2.930  7.848   1.00 39.09  ? 310  ASP A C   1 
ATOM   2347 O  O   . ASP A 1 310 ? 36.650  -2.279  8.825   1.00 39.76  ? 310  ASP A O   1 
ATOM   2348 C  CB  . ASP A 1 310 ? 37.048  -5.391  7.345   1.00 39.14  ? 310  ASP A CB  1 
ATOM   2349 C  CG  . ASP A 1 310 ? 37.316  -5.459  5.843   1.00 54.13  ? 310  ASP A CG  1 
ATOM   2350 O  OD1 . ASP A 1 310 ? 37.918  -4.524  5.270   1.00 46.63  ? 310  ASP A OD1 1 
ATOM   2351 O  OD2 . ASP A 1 310 ? 36.917  -6.470  5.229   1.00 54.53  ? 310  ASP A OD2 1 
ATOM   2352 N  N   . THR A 1 311 ? 36.773  -2.535  6.604   1.00 34.21  ? 311  THR A N   1 
ATOM   2353 C  CA  . THR A 1 311 ? 35.970  -1.347  6.365   1.00 43.34  ? 311  THR A CA  1 
ATOM   2354 C  C   . THR A 1 311 ? 34.580  -1.595  6.912   1.00 43.47  ? 311  THR A C   1 
ATOM   2355 O  O   . THR A 1 311 ? 34.134  -2.739  6.973   1.00 40.17  ? 311  THR A O   1 
ATOM   2356 C  CB  . THR A 1 311 ? 35.850  -1.011  4.877   1.00 35.56  ? 311  THR A CB  1 
ATOM   2357 O  OG1 . THR A 1 311 ? 34.942  -1.927  4.256   1.00 47.78  ? 311  THR A OG1 1 
ATOM   2358 C  CG2 . THR A 1 311 ? 37.210  -1.089  4.207   1.00 38.43  ? 311  THR A CG2 1 
ATOM   2359 N  N   . PRO A 1 312 ? 33.902  -0.522  7.336   1.00 43.61  ? 312  PRO A N   1 
ATOM   2360 C  CA  . PRO A 1 312 ? 32.523  -0.616  7.816   1.00 39.58  ? 312  PRO A CA  1 
ATOM   2361 C  C   . PRO A 1 312 ? 31.619  -1.235  6.755   1.00 42.52  ? 312  PRO A C   1 
ATOM   2362 O  O   . PRO A 1 312 ? 30.765  -2.059  7.076   1.00 39.56  ? 312  PRO A O   1 
ATOM   2363 C  CB  . PRO A 1 312 ? 32.145  0.845   8.060   1.00 32.99  ? 312  PRO A CB  1 
ATOM   2364 C  CG  . PRO A 1 312 ? 33.441  1.508   8.380   1.00 39.35  ? 312  PRO A CG  1 
ATOM   2365 C  CD  . PRO A 1 312 ? 34.466  0.827   7.524   1.00 38.76  ? 312  PRO A CD  1 
ATOM   2366 N  N   . GLU A 1 313 ? 31.812  -0.838  5.503   1.00 44.78  ? 313  GLU A N   1 
ATOM   2367 C  CA  . GLU A 1 313 ? 31.057  -1.406  4.393   1.00 50.15  ? 313  GLU A CA  1 
ATOM   2368 C  C   . GLU A 1 313 ? 31.140  -2.933  4.396   1.00 50.15  ? 313  GLU A C   1 
ATOM   2369 O  O   . GLU A 1 313 ? 30.125  -3.620  4.302   1.00 44.14  ? 313  GLU A O   1 
ATOM   2370 C  CB  . GLU A 1 313 ? 31.575  -0.849  3.065   1.00 50.43  ? 313  GLU A CB  1 
ATOM   2371 C  CG  . GLU A 1 313 ? 30.909  -1.438  1.831   1.00 74.59  ? 313  GLU A CG  1 
ATOM   2372 C  CD  . GLU A 1 313 ? 31.622  -1.054  0.541   1.00 95.37  ? 313  GLU A CD  1 
ATOM   2373 O  OE1 . GLU A 1 313 ? 32.873  -1.080  0.514   1.00 76.99  ? 313  GLU A OE1 1 
ATOM   2374 O  OE2 . GLU A 1 313 ? 30.929  -0.731  -0.448  1.00 82.87  ? 313  GLU A OE2 1 
ATOM   2375 N  N   . ALA A 1 314 ? 32.352  -3.462  4.510   1.00 39.40  ? 314  ALA A N   1 
ATOM   2376 C  CA  . ALA A 1 314 ? 32.539  -4.905  4.533   1.00 39.77  ? 314  ALA A CA  1 
ATOM   2377 C  C   . ALA A 1 314 ? 31.849  -5.518  5.741   1.00 45.35  ? 314  ALA A C   1 
ATOM   2378 O  O   . ALA A 1 314 ? 31.170  -6.541  5.630   1.00 48.05  ? 314  ALA A O   1 
ATOM   2379 C  CB  . ALA A 1 314 ? 34.019  -5.248  4.545   1.00 36.37  ? 314  ALA A CB  1 
ATOM   2380 N  N   . LEU A 1 315 ? 32.032  -4.884  6.895   1.00 38.01  ? 315  LEU A N   1 
ATOM   2381 C  CA  . LEU A 1 315 ? 31.539  -5.418  8.160   1.00 36.74  ? 315  LEU A CA  1 
ATOM   2382 C  C   . LEU A 1 315 ? 30.014  -5.488  8.212   1.00 43.56  ? 315  LEU A C   1 
ATOM   2383 O  O   . LEU A 1 315 ? 29.455  -6.433  8.760   1.00 53.59  ? 315  LEU A O   1 
ATOM   2384 C  CB  . LEU A 1 315 ? 32.080  -4.604  9.344   1.00 36.82  ? 315  LEU A CB  1 
ATOM   2385 C  CG  . LEU A 1 315 ? 33.603  -4.625  9.525   1.00 47.68  ? 315  LEU A CG  1 
ATOM   2386 C  CD1 . LEU A 1 315 ? 34.038  -3.743  10.678  1.00 37.85  ? 315  LEU A CD1 1 
ATOM   2387 C  CD2 . LEU A 1 315 ? 34.102  -6.039  9.730   1.00 36.78  ? 315  LEU A CD2 1 
ATOM   2388 N  N   . ILE A 1 316 ? 29.339  -4.498  7.643   1.00 37.56  ? 316  ILE A N   1 
ATOM   2389 C  CA  . ILE A 1 316 ? 27.884  -4.510  7.657   1.00 48.92  ? 316  ILE A CA  1 
ATOM   2390 C  C   . ILE A 1 316 ? 27.335  -5.495  6.625   1.00 54.69  ? 316  ILE A C   1 
ATOM   2391 O  O   . ILE A 1 316 ? 26.232  -6.015  6.779   1.00 53.93  ? 316  ILE A O   1 
ATOM   2392 C  CB  . ILE A 1 316 ? 27.272  -3.095  7.462   1.00 44.14  ? 316  ILE A CB  1 
ATOM   2393 C  CG1 . ILE A 1 316 ? 27.420  -2.618  6.017   1.00 49.32  ? 316  ILE A CG1 1 
ATOM   2394 C  CG2 . ILE A 1 316 ? 27.900  -2.104  8.427   1.00 39.88  ? 316  ILE A CG2 1 
ATOM   2395 C  CD1 . ILE A 1 316 ? 26.664  -1.328  5.722   1.00 42.95  ? 316  ILE A CD1 1 
ATOM   2396 N  N   . ASN A 1 317 ? 28.123  -5.761  5.587   1.00 46.36  ? 317  ASN A N   1 
ATOM   2397 C  CA  . ASN A 1 317 ? 27.722  -6.676  4.523   1.00 46.63  ? 317  ASN A CA  1 
ATOM   2398 C  C   . ASN A 1 317 ? 27.747  -8.141  4.945   1.00 50.79  ? 317  ASN A C   1 
ATOM   2399 O  O   . ASN A 1 317 ? 26.952  -8.950  4.470   1.00 59.13  ? 317  ASN A O   1 
ATOM   2400 C  CB  . ASN A 1 317 ? 28.622  -6.496  3.295   1.00 48.06  ? 317  ASN A CB  1 
ATOM   2401 C  CG  . ASN A 1 317 ? 28.287  -5.247  2.494   1.00 59.49  ? 317  ASN A CG  1 
ATOM   2402 O  OD1 . ASN A 1 317 ? 27.328  -4.530  2.795   1.00 54.51  ? 317  ASN A OD1 1 
ATOM   2403 N  ND2 . ASN A 1 317 ? 29.084  -4.982  1.461   1.00 57.75  ? 317  ASN A ND2 1 
ATOM   2404 N  N   . THR A 1 318 ? 28.663  -8.480  5.841   1.00 51.01  ? 318  THR A N   1 
ATOM   2405 C  CA  . THR A 1 318 ? 28.909  -9.876  6.172   1.00 50.12  ? 318  THR A CA  1 
ATOM   2406 C  C   . THR A 1 318 ? 28.643  -10.171 7.639   1.00 55.73  ? 318  THR A C   1 
ATOM   2407 O  O   . THR A 1 318 ? 28.923  -11.267 8.119   1.00 61.57  ? 318  THR A O   1 
ATOM   2408 C  CB  . THR A 1 318 ? 30.366  -10.246 5.882   1.00 51.70  ? 318  THR A CB  1 
ATOM   2409 O  OG1 . THR A 1 318 ? 31.221  -9.535  6.788   1.00 45.72  ? 318  THR A OG1 1 
ATOM   2410 C  CG2 . THR A 1 318 ? 30.731  -9.876  4.453   1.00 49.94  ? 318  THR A CG2 1 
ATOM   2411 N  N   . GLY A 1 319 ? 28.110  -9.192  8.355   1.00 50.92  ? 319  GLY A N   1 
ATOM   2412 C  CA  . GLY A 1 319 ? 27.909  -9.346  9.781   1.00 48.99  ? 319  GLY A CA  1 
ATOM   2413 C  C   . GLY A 1 319 ? 26.632  -10.072 10.145  1.00 47.40  ? 319  GLY A C   1 
ATOM   2414 O  O   . GLY A 1 319 ? 25.706  -10.174 9.342   1.00 56.81  ? 319  GLY A O   1 
ATOM   2415 N  N   . ASP A 1 320 ? 26.595  -10.587 11.367  1.00 49.17  ? 320  ASP A N   1 
ATOM   2416 C  CA  . ASP A 1 320 ? 25.382  -11.155 11.933  1.00 56.50  ? 320  ASP A CA  1 
ATOM   2417 C  C   . ASP A 1 320 ? 24.874  -10.209 13.020  1.00 53.51  ? 320  ASP A C   1 
ATOM   2418 O  O   . ASP A 1 320 ? 25.625  -9.824  13.916  1.00 61.23  ? 320  ASP A O   1 
ATOM   2419 C  CB  . ASP A 1 320 ? 25.667  -12.545 12.506  1.00 58.27  ? 320  ASP A CB  1 
ATOM   2420 C  CG  . ASP A 1 320 ? 24.497  -13.107 13.283  1.00 68.33  ? 320  ASP A CG  1 
ATOM   2421 O  OD1 . ASP A 1 320 ? 23.800  -13.999 12.753  1.00 78.15  ? 320  ASP A OD1 1 
ATOM   2422 O  OD2 . ASP A 1 320 ? 24.264  -12.647 14.419  1.00 76.89  ? 320  ASP A OD2 1 
ATOM   2423 N  N   . PHE A 1 321 ? 23.604  -9.831  12.945  1.00 51.23  ? 321  PHE A N   1 
ATOM   2424 C  CA  . PHE A 1 321 ? 23.093  -8.784  13.824  1.00 57.00  ? 321  PHE A CA  1 
ATOM   2425 C  C   . PHE A 1 321 ? 21.827  -9.173  14.583  1.00 59.58  ? 321  PHE A C   1 
ATOM   2426 O  O   . PHE A 1 321 ? 20.990  -8.322  14.881  1.00 53.82  ? 321  PHE A O   1 
ATOM   2427 C  CB  . PHE A 1 321 ? 22.873  -7.498  13.021  1.00 50.21  ? 321  PHE A CB  1 
ATOM   2428 C  CG  . PHE A 1 321 ? 24.122  -6.988  12.353  1.00 48.47  ? 321  PHE A CG  1 
ATOM   2429 C  CD1 . PHE A 1 321 ? 25.189  -6.529  13.114  1.00 38.48  ? 321  PHE A CD1 1 
ATOM   2430 C  CD2 . PHE A 1 321 ? 24.235  -6.977  10.970  1.00 48.45  ? 321  PHE A CD2 1 
ATOM   2431 C  CE1 . PHE A 1 321 ? 26.341  -6.064  12.510  1.00 40.86  ? 321  PHE A CE1 1 
ATOM   2432 C  CE2 . PHE A 1 321 ? 25.390  -6.513  10.358  1.00 49.77  ? 321  PHE A CE2 1 
ATOM   2433 C  CZ  . PHE A 1 321 ? 26.443  -6.057  11.129  1.00 44.14  ? 321  PHE A CZ  1 
ATOM   2434 N  N   . GLN A 1 322 ? 21.717  -10.456 14.917  1.00 67.22  ? 322  GLN A N   1 
ATOM   2435 C  CA  . GLN A 1 322 ? 20.517  -11.017 15.537  1.00 67.37  ? 322  GLN A CA  1 
ATOM   2436 C  C   . GLN A 1 322 ? 20.111  -10.369 16.861  1.00 70.44  ? 322  GLN A C   1 
ATOM   2437 O  O   . GLN A 1 322 ? 19.027  -9.791  16.980  1.00 69.93  ? 322  GLN A O   1 
ATOM   2438 C  CB  . GLN A 1 322 ? 20.714  -12.509 15.787  1.00 64.21  ? 322  GLN A CB  1 
ATOM   2439 C  CG  . GLN A 1 322 ? 21.246  -13.291 14.610  1.00 90.24  ? 322  GLN A CG  1 
ATOM   2440 C  CD  . GLN A 1 322 ? 21.896  -14.588 15.050  1.00 96.23  ? 322  GLN A CD  1 
ATOM   2441 O  OE1 . GLN A 1 322 ? 21.953  -15.557 14.293  1.00 94.55  ? 322  GLN A OE1 1 
ATOM   2442 N  NE2 . GLN A 1 322 ? 22.386  -14.612 16.288  1.00 72.51  ? 322  GLN A NE2 1 
ATOM   2443 N  N   . ASP A 1 323 ? 20.979  -10.500 17.859  1.00 47.31  ? 323  ASP A N   1 
ATOM   2444 C  CA  . ASP A 1 323 ? 20.675  -10.070 19.220  1.00 62.17  ? 323  ASP A CA  1 
ATOM   2445 C  C   . ASP A 1 323 ? 20.785  -8.552  19.341  1.00 58.33  ? 323  ASP A C   1 
ATOM   2446 O  O   . ASP A 1 323 ? 21.454  -8.037  20.239  1.00 63.17  ? 323  ASP A O   1 
ATOM   2447 C  CB  . ASP A 1 323 ? 21.638  -10.754 20.199  1.00 65.97  ? 323  ASP A CB  1 
ATOM   2448 C  CG  . ASP A 1 323 ? 21.237  -10.568 21.653  1.00 74.87  ? 323  ASP A CG  1 
ATOM   2449 O  OD1 . ASP A 1 323 ? 22.145  -10.527 22.517  1.00 67.16  ? 323  ASP A OD1 1 
ATOM   2450 O  OD2 . ASP A 1 323 ? 20.021  -10.467 21.931  1.00 61.41  ? 323  ASP A OD2 1 
ATOM   2451 N  N   . LEU A 1 324 ? 20.123  -7.837  18.439  1.00 47.90  ? 324  LEU A N   1 
ATOM   2452 C  CA  . LEU A 1 324 ? 20.349  -6.404  18.315  1.00 54.74  ? 324  LEU A CA  1 
ATOM   2453 C  C   . LEU A 1 324 ? 19.142  -5.642  17.797  1.00 42.38  ? 324  LEU A C   1 
ATOM   2454 O  O   . LEU A 1 324 ? 18.578  -5.982  16.757  1.00 40.58  ? 324  LEU A O   1 
ATOM   2455 C  CB  . LEU A 1 324 ? 21.537  -6.140  17.387  1.00 53.06  ? 324  LEU A CB  1 
ATOM   2456 C  CG  . LEU A 1 324 ? 21.928  -4.667  17.256  1.00 46.29  ? 324  LEU A CG  1 
ATOM   2457 C  CD1 . LEU A 1 324 ? 22.437  -4.149  18.586  1.00 45.90  ? 324  LEU A CD1 1 
ATOM   2458 C  CD2 . LEU A 1 324 ? 22.974  -4.481  16.180  1.00 39.42  ? 324  LEU A CD2 1 
ATOM   2459 N  N   . GLN A 1 325 ? 18.758  -4.601  18.525  1.00 37.12  ? 325  GLN A N   1 
ATOM   2460 C  CA  . GLN A 1 325 ? 17.745  -3.677  18.036  1.00 48.03  ? 325  GLN A CA  1 
ATOM   2461 C  C   . GLN A 1 325 ? 18.371  -2.317  17.784  1.00 38.43  ? 325  GLN A C   1 
ATOM   2462 O  O   . GLN A 1 325 ? 19.208  -1.851  18.551  1.00 40.47  ? 325  GLN A O   1 
ATOM   2463 C  CB  . GLN A 1 325 ? 16.578  -3.548  19.012  1.00 40.56  ? 325  GLN A CB  1 
ATOM   2464 C  CG  . GLN A 1 325 ? 15.882  -4.852  19.309  1.00 44.95  ? 325  GLN A CG  1 
ATOM   2465 C  CD  . GLN A 1 325 ? 16.494  -5.556  20.487  1.00 44.49  ? 325  GLN A CD  1 
ATOM   2466 O  OE1 . GLN A 1 325 ? 16.540  -5.011  21.588  1.00 49.18  ? 325  GLN A OE1 1 
ATOM   2467 N  NE2 . GLN A 1 325 ? 16.975  -6.771  20.267  1.00 54.99  ? 325  GLN A NE2 1 
ATOM   2468 N  N   . VAL A 1 326 ? 17.954  -1.689  16.697  1.00 39.10  ? 326  VAL A N   1 
ATOM   2469 C  CA  . VAL A 1 326 ? 18.541  -0.437  16.265  1.00 42.30  ? 326  VAL A CA  1 
ATOM   2470 C  C   . VAL A 1 326 ? 17.454  0.528   15.820  1.00 34.87  ? 326  VAL A C   1 
ATOM   2471 O  O   . VAL A 1 326 ? 16.556  0.159   15.064  1.00 35.12  ? 326  VAL A O   1 
ATOM   2472 C  CB  . VAL A 1 326 ? 19.504  -0.656  15.076  1.00 38.33  ? 326  VAL A CB  1 
ATOM   2473 C  CG1 . VAL A 1 326 ? 20.005  0.669   14.562  1.00 42.80  ? 326  VAL A CG1 1 
ATOM   2474 C  CG2 . VAL A 1 326 ? 20.668  -1.543  15.477  1.00 39.98  ? 326  VAL A CG2 1 
ATOM   2475 N  N   . LEU A 1 327 ? 17.540  1.763   16.299  1.00 35.20  ? 327  LEU A N   1 
ATOM   2476 C  CA  . LEU A 1 327 ? 16.701  2.844   15.806  1.00 35.62  ? 327  LEU A CA  1 
ATOM   2477 C  C   . LEU A 1 327 ? 17.572  3.781   14.970  1.00 37.35  ? 327  LEU A C   1 
ATOM   2478 O  O   . LEU A 1 327 ? 18.641  4.188   15.412  1.00 39.95  ? 327  LEU A O   1 
ATOM   2479 C  CB  . LEU A 1 327 ? 16.075  3.594   16.980  1.00 34.29  ? 327  LEU A CB  1 
ATOM   2480 C  CG  . LEU A 1 327 ? 15.245  4.827   16.630  1.00 38.57  ? 327  LEU A CG  1 
ATOM   2481 C  CD1 . LEU A 1 327 ? 14.222  4.486   15.574  1.00 42.24  ? 327  LEU A CD1 1 
ATOM   2482 C  CD2 . LEU A 1 327 ? 14.572  5.369   17.871  1.00 34.81  ? 327  LEU A CD2 1 
ATOM   2483 N  N   . VAL A 1 328 ? 17.136  4.099   13.755  1.00 34.79  ? 328  VAL A N   1 
ATOM   2484 C  CA  . VAL A 1 328 ? 17.912  4.961   12.863  1.00 27.47  ? 328  VAL A CA  1 
ATOM   2485 C  C   . VAL A 1 328 ? 17.012  5.976   12.192  1.00 31.86  ? 328  VAL A C   1 
ATOM   2486 O  O   . VAL A 1 328 ? 15.816  5.744   12.036  1.00 35.76  ? 328  VAL A O   1 
ATOM   2487 C  CB  . VAL A 1 328 ? 18.612  4.163   11.744  1.00 39.91  ? 328  VAL A CB  1 
ATOM   2488 C  CG1 . VAL A 1 328 ? 19.582  3.159   12.321  1.00 37.90  ? 328  VAL A CG1 1 
ATOM   2489 C  CG2 . VAL A 1 328 ? 17.581  3.475   10.856  1.00 35.11  ? 328  VAL A CG2 1 
ATOM   2490 N  N   . GLY A 1 329 ? 17.582  7.098   11.774  1.00 31.61  ? 329  GLY A N   1 
ATOM   2491 C  CA  . GLY A 1 329 ? 16.781  8.120   11.130  1.00 34.77  ? 329  GLY A CA  1 
ATOM   2492 C  C   . GLY A 1 329 ? 17.554  9.332   10.671  1.00 33.88  ? 329  GLY A C   1 
ATOM   2493 O  O   . GLY A 1 329 ? 18.754  9.450   10.917  1.00 35.31  ? 329  GLY A O   1 
ATOM   2494 N  N   . VAL A 1 330 ? 16.847  10.239  10.004  1.00 33.88  ? 330  VAL A N   1 
ATOM   2495 C  CA  . VAL A 1 330 ? 17.455  11.421  9.411   1.00 30.25  ? 330  VAL A CA  1 
ATOM   2496 C  C   . VAL A 1 330 ? 16.526  12.603  9.603   1.00 32.80  ? 330  VAL A C   1 
ATOM   2497 O  O   . VAL A 1 330 ? 15.359  12.428  9.945   1.00 32.34  ? 330  VAL A O   1 
ATOM   2498 C  CB  . VAL A 1 330 ? 17.665  11.242  7.893   1.00 35.38  ? 330  VAL A CB  1 
ATOM   2499 C  CG1 . VAL A 1 330 ? 18.532  10.016  7.598   1.00 28.43  ? 330  VAL A CG1 1 
ATOM   2500 C  CG2 . VAL A 1 330 ? 16.326  11.135  7.187   1.00 28.07  ? 330  VAL A CG2 1 
ATOM   2501 N  N   . VAL A 1 331 ? 17.045  13.806  9.379   1.00 33.48  ? 331  VAL A N   1 
ATOM   2502 C  CA  . VAL A 1 331 ? 16.215  15.005  9.382   1.00 30.38  ? 331  VAL A CA  1 
ATOM   2503 C  C   . VAL A 1 331 ? 15.871  15.375  7.943   1.00 31.69  ? 331  VAL A C   1 
ATOM   2504 O  O   . VAL A 1 331 ? 16.471  14.853  7.004   1.00 33.77  ? 331  VAL A O   1 
ATOM   2505 C  CB  . VAL A 1 331 ? 16.913  16.187  10.090  1.00 31.94  ? 331  VAL A CB  1 
ATOM   2506 C  CG1 . VAL A 1 331 ? 17.159  15.856  11.550  1.00 28.88  ? 331  VAL A CG1 1 
ATOM   2507 C  CG2 . VAL A 1 331 ? 18.217  16.538  9.393   1.00 28.19  ? 331  VAL A CG2 1 
ATOM   2508 N  N   . LYS A 1 332 ? 14.906  16.267  7.765   1.00 28.09  ? 332  LYS A N   1 
ATOM   2509 C  CA  . LYS A 1 332 ? 14.438  16.608  6.425   1.00 38.13  ? 332  LYS A CA  1 
ATOM   2510 C  C   . LYS A 1 332 ? 15.550  17.179  5.536   1.00 34.14  ? 332  LYS A C   1 
ATOM   2511 O  O   . LYS A 1 332 ? 15.581  16.927  4.333   1.00 36.06  ? 332  LYS A O   1 
ATOM   2512 C  CB  . LYS A 1 332 ? 13.255  17.582  6.495   1.00 38.33  ? 332  LYS A CB  1 
ATOM   2513 C  CG  . LYS A 1 332 ? 12.337  17.528  5.276   1.00 33.02  ? 332  LYS A CG  1 
ATOM   2514 C  CD  . LYS A 1 332 ? 11.203  18.559  5.351   1.00 44.57  ? 332  LYS A CD  1 
ATOM   2515 C  CE  . LYS A 1 332 ? 11.563  19.890  4.661   1.00 63.39  ? 332  LYS A CE  1 
ATOM   2516 N  NZ  . LYS A 1 332 ? 12.132  20.944  5.568   1.00 40.75  ? 332  LYS A NZ  1 
ATOM   2517 N  N   . ASP A 1 333 ? 16.469  17.930  6.132   1.00 30.42  ? 333  ASP A N   1 
ATOM   2518 C  CA  . ASP A 1 333 ? 17.467  18.661  5.353   1.00 29.22  ? 333  ASP A CA  1 
ATOM   2519 C  C   . ASP A 1 333 ? 18.882  18.465  5.879   1.00 32.93  ? 333  ASP A C   1 
ATOM   2520 O  O   . ASP A 1 333 ? 19.487  19.392  6.418   1.00 33.53  ? 333  ASP A O   1 
ATOM   2521 C  CB  . ASP A 1 333 ? 17.115  20.149  5.333   1.00 33.72  ? 333  ASP A CB  1 
ATOM   2522 C  CG  . ASP A 1 333 ? 15.686  20.396  4.884   1.00 39.15  ? 333  ASP A CG  1 
ATOM   2523 O  OD1 . ASP A 1 333 ? 14.805  20.552  5.756   1.00 40.46  ? 333  ASP A OD1 1 
ATOM   2524 O  OD2 . ASP A 1 333 ? 15.440  20.406  3.661   1.00 33.17  ? 333  ASP A OD2 1 
ATOM   2525 N  N   . GLU A 1 334 ? 19.406  17.255  5.714   1.00 31.27  ? 334  GLU A N   1 
ATOM   2526 C  CA  . GLU A 1 334 ? 20.719  16.906  6.242   1.00 31.36  ? 334  GLU A CA  1 
ATOM   2527 C  C   . GLU A 1 334 ? 21.842  17.790  5.693   1.00 32.86  ? 334  GLU A C   1 
ATOM   2528 O  O   . GLU A 1 334 ? 22.817  18.064  6.389   1.00 31.57  ? 334  GLU A O   1 
ATOM   2529 C  CB  . GLU A 1 334 ? 21.030  15.435  5.954   1.00 25.49  ? 334  GLU A CB  1 
ATOM   2530 C  CG  . GLU A 1 334 ? 20.134  14.454  6.686   1.00 26.75  ? 334  GLU A CG  1 
ATOM   2531 C  CD  . GLU A 1 334 ? 20.483  14.332  8.157   1.00 34.71  ? 334  GLU A CD  1 
ATOM   2532 O  OE1 . GLU A 1 334 ? 21.538  14.856  8.563   1.00 34.37  ? 334  GLU A OE1 1 
ATOM   2533 O  OE2 . GLU A 1 334 ? 19.707  13.707  8.909   1.00 38.47  ? 334  GLU A OE2 1 
ATOM   2534 N  N   . GLY A 1 335 ? 21.696  18.245  4.453   1.00 26.36  ? 335  GLY A N   1 
ATOM   2535 C  CA  . GLY A 1 335 ? 22.788  18.900  3.760   1.00 27.01  ? 335  GLY A CA  1 
ATOM   2536 C  C   . GLY A 1 335 ? 22.897  20.413  3.866   1.00 36.30  ? 335  GLY A C   1 
ATOM   2537 O  O   . GLY A 1 335 ? 23.989  20.960  3.707   1.00 32.31  ? 335  GLY A O   1 
ATOM   2538 N  N   . SER A 1 336 ? 21.788  21.098  4.134   1.00 28.31  ? 336  SER A N   1 
ATOM   2539 C  CA  . SER A 1 336 ? 21.777  22.562  4.066   1.00 28.80  ? 336  SER A CA  1 
ATOM   2540 C  C   . SER A 1 336 ? 22.839  23.250  4.938   1.00 32.17  ? 336  SER A C   1 
ATOM   2541 O  O   . SER A 1 336 ? 23.498  24.188  4.497   1.00 33.97  ? 336  SER A O   1 
ATOM   2542 C  CB  . SER A 1 336 ? 20.390  23.102  4.402   1.00 33.06  ? 336  SER A CB  1 
ATOM   2543 O  OG  . SER A 1 336 ? 20.110  22.941  5.776   1.00 31.44  ? 336  SER A OG  1 
ATOM   2544 N  N   . TYR A 1 337 ? 22.992  22.783  6.173   1.00 33.15  ? 337  TYR A N   1 
ATOM   2545 C  CA  . TYR A 1 337 ? 23.942  23.357  7.122   1.00 28.05  ? 337  TYR A CA  1 
ATOM   2546 C  C   . TYR A 1 337 ? 25.360  23.430  6.549   1.00 28.69  ? 337  TYR A C   1 
ATOM   2547 O  O   . TYR A 1 337 ? 26.094  24.387  6.787   1.00 36.34  ? 337  TYR A O   1 
ATOM   2548 C  CB  . TYR A 1 337 ? 23.942  22.519  8.403   1.00 28.07  ? 337  TYR A CB  1 
ATOM   2549 C  CG  . TYR A 1 337 ? 24.545  23.176  9.628   1.00 28.10  ? 337  TYR A CG  1 
ATOM   2550 C  CD1 . TYR A 1 337 ? 23.835  23.233  10.821  1.00 28.05  ? 337  TYR A CD1 1 
ATOM   2551 C  CD2 . TYR A 1 337 ? 25.825  23.714  9.604   1.00 32.54  ? 337  TYR A CD2 1 
ATOM   2552 C  CE1 . TYR A 1 337 ? 24.379  23.815  11.956  1.00 31.32  ? 337  TYR A CE1 1 
ATOM   2553 C  CE2 . TYR A 1 337 ? 26.380  24.303  10.732  1.00 36.50  ? 337  TYR A CE2 1 
ATOM   2554 C  CZ  . TYR A 1 337 ? 25.650  24.350  11.907  1.00 40.14  ? 337  TYR A CZ  1 
ATOM   2555 O  OH  . TYR A 1 337 ? 26.185  24.930  13.035  1.00 33.32  ? 337  TYR A OH  1 
ATOM   2556 N  N   . PHE A 1 338 ? 25.736  22.415  5.784   1.00 29.37  ? 338  PHE A N   1 
ATOM   2557 C  CA  . PHE A 1 338 ? 27.103  22.282  5.306   1.00 26.43  ? 338  PHE A CA  1 
ATOM   2558 C  C   . PHE A 1 338 ? 27.426  23.194  4.128   1.00 38.07  ? 338  PHE A C   1 
ATOM   2559 O  O   . PHE A 1 338 ? 28.589  23.544  3.904   1.00 35.50  ? 338  PHE A O   1 
ATOM   2560 C  CB  . PHE A 1 338 ? 27.393  20.815  4.967   1.00 32.27  ? 338  PHE A CB  1 
ATOM   2561 C  CG  . PHE A 1 338 ? 27.376  19.915  6.167   1.00 32.45  ? 338  PHE A CG  1 
ATOM   2562 C  CD1 . PHE A 1 338 ? 26.185  19.373  6.626   1.00 32.80  ? 338  PHE A CD1 1 
ATOM   2563 C  CD2 . PHE A 1 338 ? 28.545  19.647  6.863   1.00 32.52  ? 338  PHE A CD2 1 
ATOM   2564 C  CE1 . PHE A 1 338 ? 26.167  18.559  7.742   1.00 35.14  ? 338  PHE A CE1 1 
ATOM   2565 C  CE2 . PHE A 1 338 ? 28.535  18.835  7.979   1.00 26.39  ? 338  PHE A CE2 1 
ATOM   2566 C  CZ  . PHE A 1 338 ? 27.345  18.289  8.418   1.00 36.32  ? 338  PHE A CZ  1 
ATOM   2567 N  N   . LEU A 1 339 ? 26.394  23.586  3.388   1.00 30.00  ? 339  LEU A N   1 
ATOM   2568 C  CA  . LEU A 1 339 ? 26.577  24.422  2.206   1.00 34.53  ? 339  LEU A CA  1 
ATOM   2569 C  C   . LEU A 1 339 ? 27.250  25.764  2.507   1.00 32.20  ? 339  LEU A C   1 
ATOM   2570 O  O   . LEU A 1 339 ? 28.071  26.237  1.724   1.00 35.83  ? 339  LEU A O   1 
ATOM   2571 C  CB  . LEU A 1 339 ? 25.242  24.644  1.495   1.00 29.15  ? 339  LEU A CB  1 
ATOM   2572 C  CG  . LEU A 1 339 ? 24.516  23.357  1.121   1.00 32.82  ? 339  LEU A CG  1 
ATOM   2573 C  CD1 . LEU A 1 339 ? 23.329  23.664  0.232   1.00 32.46  ? 339  LEU A CD1 1 
ATOM   2574 C  CD2 . LEU A 1 339 ? 25.479  22.397  0.433   1.00 30.88  ? 339  LEU A CD2 1 
ATOM   2575 N  N   . VAL A 1 340 ? 26.905  26.375  3.636   1.00 29.53  ? 340  VAL A N   1 
ATOM   2576 C  CA  . VAL A 1 340 ? 27.443  27.695  3.973   1.00 40.15  ? 340  VAL A CA  1 
ATOM   2577 C  C   . VAL A 1 340 ? 28.888  27.640  4.471   1.00 42.59  ? 340  VAL A C   1 
ATOM   2578 O  O   . VAL A 1 340 ? 29.499  28.668  4.742   1.00 44.21  ? 340  VAL A O   1 
ATOM   2579 C  CB  . VAL A 1 340 ? 26.582  28.415  5.021   1.00 35.55  ? 340  VAL A CB  1 
ATOM   2580 C  CG1 . VAL A 1 340 ? 25.119  28.397  4.597   1.00 37.02  ? 340  VAL A CG1 1 
ATOM   2581 C  CG2 . VAL A 1 340 ? 26.757  27.767  6.386   1.00 41.09  ? 340  VAL A CG2 1 
ATOM   2582 N  N   . TYR A 1 341 ? 29.442  26.443  4.585   1.00 38.41  ? 341  TYR A N   1 
ATOM   2583 C  CA  . TYR A 1 341 ? 30.819  26.330  5.037   1.00 41.87  ? 341  TYR A CA  1 
ATOM   2584 C  C   . TYR A 1 341 ? 31.789  26.071  3.896   1.00 43.89  ? 341  TYR A C   1 
ATOM   2585 O  O   . TYR A 1 341 ? 32.936  25.692  4.132   1.00 54.10  ? 341  TYR A O   1 
ATOM   2586 C  CB  . TYR A 1 341 ? 30.965  25.256  6.122   1.00 34.03  ? 341  TYR A CB  1 
ATOM   2587 C  CG  . TYR A 1 341 ? 30.575  25.750  7.487   1.00 38.35  ? 341  TYR A CG  1 
ATOM   2588 C  CD1 . TYR A 1 341 ? 29.259  25.663  7.926   1.00 34.76  ? 341  TYR A CD1 1 
ATOM   2589 C  CD2 . TYR A 1 341 ? 31.519  26.316  8.337   1.00 40.13  ? 341  TYR A CD2 1 
ATOM   2590 C  CE1 . TYR A 1 341 ? 28.898  26.122  9.173   1.00 41.32  ? 341  TYR A CE1 1 
ATOM   2591 C  CE2 . TYR A 1 341 ? 31.166  26.776  9.587   1.00 37.06  ? 341  TYR A CE2 1 
ATOM   2592 C  CZ  . TYR A 1 341 ? 29.851  26.678  10.001  1.00 43.21  ? 341  TYR A CZ  1 
ATOM   2593 O  OH  . TYR A 1 341 ? 29.478  27.139  11.247  1.00 45.66  ? 341  TYR A OH  1 
ATOM   2594 N  N   . GLY A 1 342 ? 31.347  26.272  2.660   1.00 33.13  ? 342  GLY A N   1 
ATOM   2595 C  CA  . GLY A 1 342 ? 32.274  26.123  1.557   1.00 36.24  ? 342  GLY A CA  1 
ATOM   2596 C  C   . GLY A 1 342 ? 31.733  26.047  0.145   1.00 44.12  ? 342  GLY A C   1 
ATOM   2597 O  O   . GLY A 1 342 ? 32.510  25.886  -0.798  1.00 43.68  ? 342  GLY A O   1 
ATOM   2598 N  N   . VAL A 1 343 ? 30.420  26.150  -0.025  1.00 31.18  ? 343  VAL A N   1 
ATOM   2599 C  CA  . VAL A 1 343 ? 29.876  26.221  -1.375  1.00 32.03  ? 343  VAL A CA  1 
ATOM   2600 C  C   . VAL A 1 343 ? 29.594  27.668  -1.759  1.00 34.22  ? 343  VAL A C   1 
ATOM   2601 O  O   . VAL A 1 343 ? 28.713  28.313  -1.191  1.00 31.13  ? 343  VAL A O   1 
ATOM   2602 C  CB  . VAL A 1 343 ? 28.623  25.355  -1.554  1.00 36.50  ? 343  VAL A CB  1 
ATOM   2603 C  CG1 . VAL A 1 343 ? 28.168  25.391  -3.010  1.00 26.22  ? 343  VAL A CG1 1 
ATOM   2604 C  CG2 . VAL A 1 343 ? 28.918  23.925  -1.119  1.00 32.13  ? 343  VAL A CG2 1 
ATOM   2605 N  N   . PRO A 1 344 ? 30.364  28.192  -2.719  1.00 37.46  ? 344  PRO A N   1 
ATOM   2606 C  CA  . PRO A 1 344 ? 30.162  29.582  -3.128  1.00 34.07  ? 344  PRO A CA  1 
ATOM   2607 C  C   . PRO A 1 344 ? 28.716  29.777  -3.555  1.00 35.95  ? 344  PRO A C   1 
ATOM   2608 O  O   . PRO A 1 344 ? 28.179  28.947  -4.293  1.00 29.55  ? 344  PRO A O   1 
ATOM   2609 C  CB  . PRO A 1 344 ? 31.104  29.737  -4.327  1.00 33.12  ? 344  PRO A CB  1 
ATOM   2610 C  CG  . PRO A 1 344 ? 32.120  28.654  -4.163  1.00 33.99  ? 344  PRO A CG  1 
ATOM   2611 C  CD  . PRO A 1 344 ? 31.385  27.512  -3.533  1.00 33.46  ? 344  PRO A CD  1 
ATOM   2612 N  N   . GLY A 1 345 ? 28.091  30.849  -3.080  1.00 37.96  ? 345  GLY A N   1 
ATOM   2613 C  CA  . GLY A 1 345 ? 26.704  31.123  -3.401  1.00 35.57  ? 345  GLY A CA  1 
ATOM   2614 C  C   . GLY A 1 345 ? 25.799  30.939  -2.201  1.00 41.28  ? 345  GLY A C   1 
ATOM   2615 O  O   . GLY A 1 345 ? 24.702  31.490  -2.161  1.00 42.91  ? 345  GLY A O   1 
ATOM   2616 N  N   . PHE A 1 346 ? 26.261  30.177  -1.213  1.00 34.81  ? 346  PHE A N   1 
ATOM   2617 C  CA  . PHE A 1 346 ? 25.435  29.876  -0.046  1.00 32.61  ? 346  PHE A CA  1 
ATOM   2618 C  C   . PHE A 1 346 ? 25.761  30.702  1.198   1.00 38.97  ? 346  PHE A C   1 
ATOM   2619 O  O   . PHE A 1 346 ? 26.925  30.877  1.564   1.00 42.67  ? 346  PHE A O   1 
ATOM   2620 C  CB  . PHE A 1 346 ? 25.461  28.380  0.261   1.00 25.65  ? 346  PHE A CB  1 
ATOM   2621 C  CG  . PHE A 1 346 ? 24.834  27.544  -0.814  1.00 31.82  ? 346  PHE A CG  1 
ATOM   2622 C  CD1 . PHE A 1 346 ? 25.562  27.174  -1.934  1.00 31.22  ? 346  PHE A CD1 1 
ATOM   2623 C  CD2 . PHE A 1 346 ? 23.509  27.152  -0.723  1.00 28.63  ? 346  PHE A CD2 1 
ATOM   2624 C  CE1 . PHE A 1 346 ? 24.987  26.417  -2.934  1.00 28.20  ? 346  PHE A CE1 1 
ATOM   2625 C  CE2 . PHE A 1 346 ? 22.926  26.392  -1.720  1.00 25.03  ? 346  PHE A CE2 1 
ATOM   2626 C  CZ  . PHE A 1 346 ? 23.663  26.024  -2.826  1.00 31.04  ? 346  PHE A CZ  1 
ATOM   2627 N  N   . SER A 1 347 ? 24.711  31.213  1.834   1.00 38.48  ? 347  SER A N   1 
ATOM   2628 C  CA  . SER A 1 347 ? 24.842  31.996  3.057   1.00 45.04  ? 347  SER A CA  1 
ATOM   2629 C  C   . SER A 1 347 ? 23.582  31.882  3.917   1.00 36.59  ? 347  SER A C   1 
ATOM   2630 O  O   . SER A 1 347 ? 22.496  31.612  3.410   1.00 41.14  ? 347  SER A O   1 
ATOM   2631 C  CB  . SER A 1 347 ? 25.114  33.464  2.724   1.00 37.36  ? 347  SER A CB  1 
ATOM   2632 O  OG  . SER A 1 347 ? 25.322  34.218  3.903   1.00 39.36  ? 347  SER A OG  1 
ATOM   2633 N  N   . LYS A 1 348 ? 23.730  32.087  5.220   1.00 30.66  ? 348  LYS A N   1 
ATOM   2634 C  CA  . LYS A 1 348 ? 22.583  32.073  6.114   1.00 35.56  ? 348  LYS A CA  1 
ATOM   2635 C  C   . LYS A 1 348 ? 21.839  33.395  6.019   1.00 38.46  ? 348  LYS A C   1 
ATOM   2636 O  O   . LYS A 1 348 ? 20.726  33.527  6.522   1.00 45.35  ? 348  LYS A O   1 
ATOM   2637 C  CB  . LYS A 1 348 ? 23.022  31.825  7.561   1.00 40.30  ? 348  LYS A CB  1 
ATOM   2638 C  CG  . LYS A 1 348 ? 23.568  33.054  8.283   1.00 32.96  ? 348  LYS A CG  1 
ATOM   2639 C  CD  . LYS A 1 348 ? 23.900  32.728  9.738   1.00 43.65  ? 348  LYS A CD  1 
ATOM   2640 C  CE  . LYS A 1 348 ? 24.174  33.984  10.563  1.00 44.49  ? 348  LYS A CE  1 
ATOM   2641 N  NZ  . LYS A 1 348 ? 23.010  34.922  10.564  1.00 48.27  ? 348  LYS A NZ  1 
ATOM   2642 N  N   . ASP A 1 349 ? 22.458  34.369  5.358   1.00 34.95  ? 349  ASP A N   1 
ATOM   2643 C  CA  . ASP A 1 349 ? 21.940  35.736  5.351   1.00 43.61  ? 349  ASP A CA  1 
ATOM   2644 C  C   . ASP A 1 349 ? 21.161  36.129  4.098   1.00 44.23  ? 349  ASP A C   1 
ATOM   2645 O  O   . ASP A 1 349 ? 20.611  37.223  4.029   1.00 50.26  ? 349  ASP A O   1 
ATOM   2646 C  CB  . ASP A 1 349 ? 23.066  36.731  5.629   1.00 34.36  ? 349  ASP A CB  1 
ATOM   2647 C  CG  . ASP A 1 349 ? 23.579  36.626  7.047   1.00 42.93  ? 349  ASP A CG  1 
ATOM   2648 O  OD1 . ASP A 1 349 ? 22.753  36.392  7.955   1.00 47.33  ? 349  ASP A OD1 1 
ATOM   2649 O  OD2 . ASP A 1 349 ? 24.802  36.760  7.255   1.00 48.21  ? 349  ASP A OD2 1 
ATOM   2650 N  N   . ASN A 1 350 ? 21.113  35.241  3.113   1.00 43.21  ? 350  ASN A N   1 
ATOM   2651 C  CA  . ASN A 1 350 ? 20.203  35.422  1.992   1.00 41.19  ? 350  ASN A CA  1 
ATOM   2652 C  C   . ASN A 1 350 ? 19.610  34.100  1.558   1.00 49.48  ? 350  ASN A C   1 
ATOM   2653 O  O   . ASN A 1 350 ? 19.847  33.072  2.191   1.00 50.03  ? 350  ASN A O   1 
ATOM   2654 C  CB  . ASN A 1 350 ? 20.877  36.124  0.817   1.00 29.32  ? 350  ASN A CB  1 
ATOM   2655 C  CG  . ASN A 1 350 ? 22.119  35.420  0.356   1.00 50.94  ? 350  ASN A CG  1 
ATOM   2656 O  OD1 . ASN A 1 350 ? 22.067  34.284  -0.115  1.00 54.48  ? 350  ASN A OD1 1 
ATOM   2657 N  ND2 . ASN A 1 350 ? 23.254  36.098  0.474   1.00 53.38  ? 350  ASN A ND2 1 
ATOM   2658 N  N   . GLU A 1 351 ? 18.845  34.132  0.473   1.00 42.13  ? 351  GLU A N   1 
ATOM   2659 C  CA  . GLU A 1 351 ? 18.088  32.966  0.037   1.00 42.70  ? 351  GLU A CA  1 
ATOM   2660 C  C   . GLU A 1 351 ? 18.956  31.904  -0.629  1.00 38.17  ? 351  GLU A C   1 
ATOM   2661 O  O   . GLU A 1 351 ? 18.507  30.779  -0.857  1.00 35.76  ? 351  GLU A O   1 
ATOM   2662 C  CB  . GLU A 1 351 ? 16.952  33.399  -0.888  1.00 50.58  ? 351  GLU A CB  1 
ATOM   2663 C  CG  . GLU A 1 351 ? 15.912  34.232  -0.174  1.00 43.08  ? 351  GLU A CG  1 
ATOM   2664 C  CD  . GLU A 1 351 ? 15.417  33.549  1.082   1.00 67.12  ? 351  GLU A CD  1 
ATOM   2665 O  OE1 . GLU A 1 351 ? 14.657  32.562  0.957   1.00 75.07  ? 351  GLU A OE1 1 
ATOM   2666 O  OE2 . GLU A 1 351 ? 15.790  33.994  2.189   1.00 74.13  ? 351  GLU A OE2 1 
ATOM   2667 N  N   . SER A 1 352 ? 20.195  32.270  -0.935  1.00 31.71  ? 352  SER A N   1 
ATOM   2668 C  CA  . SER A 1 352 ? 21.147  31.350  -1.543  1.00 35.72  ? 352  SER A CA  1 
ATOM   2669 C  C   . SER A 1 352 ? 20.633  30.739  -2.844  1.00 35.29  ? 352  SER A C   1 
ATOM   2670 O  O   . SER A 1 352 ? 20.935  29.588  -3.162  1.00 34.42  ? 352  SER A O   1 
ATOM   2671 C  CB  . SER A 1 352 ? 21.533  30.241  -0.559  1.00 36.07  ? 352  SER A CB  1 
ATOM   2672 O  OG  . SER A 1 352 ? 21.956  30.791  0.672   1.00 35.05  ? 352  SER A OG  1 
ATOM   2673 N  N   . LEU A 1 353 ? 19.848  31.502  -3.592  1.00 33.95  ? 353  LEU A N   1 
ATOM   2674 C  CA  . LEU A 1 353 ? 19.501  31.095  -4.942  1.00 34.01  ? 353  LEU A CA  1 
ATOM   2675 C  C   . LEU A 1 353 ? 20.792  31.035  -5.755  1.00 39.87  ? 353  LEU A C   1 
ATOM   2676 O  O   . LEU A 1 353 ? 21.561  31.993  -5.777  1.00 43.63  ? 353  LEU A O   1 
ATOM   2677 C  CB  . LEU A 1 353 ? 18.514  32.080  -5.560  1.00 41.39  ? 353  LEU A CB  1 
ATOM   2678 C  CG  . LEU A 1 353 ? 17.192  32.238  -4.803  1.00 46.16  ? 353  LEU A CG  1 
ATOM   2679 C  CD1 . LEU A 1 353 ? 16.174  32.971  -5.655  1.00 36.99  ? 353  LEU A CD1 1 
ATOM   2680 C  CD2 . LEU A 1 353 ? 16.652  30.886  -4.384  1.00 38.22  ? 353  LEU A CD2 1 
ATOM   2681 N  N   . ILE A 1 354 ? 21.053  29.903  -6.396  1.00 32.73  ? 354  ILE A N   1 
ATOM   2682 C  CA  . ILE A 1 354 ? 22.301  29.748  -7.129  1.00 35.32  ? 354  ILE A CA  1 
ATOM   2683 C  C   . ILE A 1 354 ? 22.075  29.458  -8.603  1.00 33.03  ? 354  ILE A C   1 
ATOM   2684 O  O   . ILE A 1 354 ? 20.990  29.053  -9.019  1.00 37.06  ? 354  ILE A O   1 
ATOM   2685 C  CB  . ILE A 1 354 ? 23.199  28.630  -6.541  1.00 33.23  ? 354  ILE A CB  1 
ATOM   2686 C  CG1 . ILE A 1 354 ? 22.434  27.308  -6.476  1.00 22.97  ? 354  ILE A CG1 1 
ATOM   2687 C  CG2 . ILE A 1 354 ? 23.721  29.027  -5.177  1.00 31.59  ? 354  ILE A CG2 1 
ATOM   2688 C  CD1 . ILE A 1 354 ? 23.321  26.087  -6.491  1.00 30.63  ? 354  ILE A CD1 1 
ATOM   2689 N  N   . SER A 1 355 ? 23.126  29.666  -9.384  1.00 29.56  ? 355  SER A N   1 
ATOM   2690 C  CA  . SER A 1 355 ? 23.099  29.401  -10.809 1.00 32.65  ? 355  SER A CA  1 
ATOM   2691 C  C   . SER A 1 355 ? 23.526  27.971  -11.088 1.00 37.57  ? 355  SER A C   1 
ATOM   2692 O  O   . SER A 1 355 ? 24.164  27.313  -10.259 1.00 34.33  ? 355  SER A O   1 
ATOM   2693 C  CB  . SER A 1 355 ? 24.060  30.343  -11.526 1.00 33.85  ? 355  SER A CB  1 
ATOM   2694 O  OG  . SER A 1 355 ? 25.403  30.032  -11.179 1.00 30.67  ? 355  SER A OG  1 
ATOM   2695 N  N   . ARG A 1 356 ? 23.194  27.504  -12.279 1.00 33.35  ? 356  ARG A N   1 
ATOM   2696 C  CA  . ARG A 1 356 ? 23.602  26.183  -12.699 1.00 35.49  ? 356  ARG A CA  1 
ATOM   2697 C  C   . ARG A 1 356 ? 25.115  26.004  -12.546 1.00 33.79  ? 356  ARG A C   1 
ATOM   2698 O  O   . ARG A 1 356 ? 25.586  24.939  -12.148 1.00 39.16  ? 356  ARG A O   1 
ATOM   2699 C  CB  . ARG A 1 356 ? 23.156  25.934  -14.139 1.00 31.38  ? 356  ARG A CB  1 
ATOM   2700 C  CG  . ARG A 1 356 ? 23.540  24.577  -14.658 1.00 39.07  ? 356  ARG A CG  1 
ATOM   2701 C  CD  . ARG A 1 356 ? 22.477  24.002  -15.561 1.00 43.50  ? 356  ARG A CD  1 
ATOM   2702 N  NE  . ARG A 1 356 ? 22.727  22.585  -15.791 1.00 42.16  ? 356  ARG A NE  1 
ATOM   2703 C  CZ  . ARG A 1 356 ? 22.175  21.607  -15.081 1.00 37.95  ? 356  ARG A CZ  1 
ATOM   2704 N  NH1 . ARG A 1 356 ? 21.321  21.884  -14.102 1.00 38.61  ? 356  ARG A NH1 1 
ATOM   2705 N  NH2 . ARG A 1 356 ? 22.469  20.348  -15.359 1.00 38.65  ? 356  ARG A NH2 1 
ATOM   2706 N  N   . ALA A 1 357 ? 25.874  27.050  -12.849 1.00 30.29  ? 357  ALA A N   1 
ATOM   2707 C  CA  . ALA A 1 357 ? 27.331  26.968  -12.770 1.00 42.48  ? 357  ALA A CA  1 
ATOM   2708 C  C   . ALA A 1 357 ? 27.793  26.750  -11.334 1.00 40.17  ? 357  ALA A C   1 
ATOM   2709 O  O   . ALA A 1 357 ? 28.708  25.968  -11.072 1.00 32.48  ? 357  ALA A O   1 
ATOM   2710 C  CB  . ALA A 1 357 ? 27.970  28.223  -13.338 1.00 33.98  ? 357  ALA A CB  1 
ATOM   2711 N  N   . GLN A 1 358 ? 27.161  27.456  -10.404 1.00 30.46  ? 358  GLN A N   1 
ATOM   2712 C  CA  . GLN A 1 358 ? 27.493  27.304  -9.002  1.00 32.68  ? 358  GLN A CA  1 
ATOM   2713 C  C   . GLN A 1 358 ? 27.097  25.918  -8.516  1.00 34.88  ? 358  GLN A C   1 
ATOM   2714 O  O   . GLN A 1 358 ? 27.729  25.364  -7.620  1.00 32.19  ? 358  GLN A O   1 
ATOM   2715 C  CB  . GLN A 1 358 ? 26.811  28.387  -8.176  1.00 31.09  ? 358  GLN A CB  1 
ATOM   2716 C  CG  . GLN A 1 358 ? 27.320  29.782  -8.480  1.00 30.12  ? 358  GLN A CG  1 
ATOM   2717 C  CD  . GLN A 1 358 ? 26.629  30.844  -7.656  1.00 38.25  ? 358  GLN A CD  1 
ATOM   2718 O  OE1 . GLN A 1 358 ? 25.418  31.064  -7.781  1.00 36.79  ? 358  GLN A OE1 1 
ATOM   2719 N  NE2 . GLN A 1 358 ? 27.394  31.510  -6.800  1.00 36.98  ? 358  GLN A NE2 1 
ATOM   2720 N  N   . PHE A 1 359 ? 26.058  25.359  -9.126  1.00 27.27  ? 359  PHE A N   1 
ATOM   2721 C  CA  . PHE A 1 359 ? 25.613  24.015  -8.792  1.00 25.58  ? 359  PHE A CA  1 
ATOM   2722 C  C   . PHE A 1 359 ? 26.679  22.990  -9.156  1.00 34.30  ? 359  PHE A C   1 
ATOM   2723 O  O   . PHE A 1 359 ? 27.007  22.110  -8.358  1.00 35.72  ? 359  PHE A O   1 
ATOM   2724 C  CB  . PHE A 1 359 ? 24.300  23.700  -9.504  1.00 32.45  ? 359  PHE A CB  1 
ATOM   2725 C  CG  . PHE A 1 359 ? 23.775  22.323  -9.231  1.00 26.55  ? 359  PHE A CG  1 
ATOM   2726 C  CD1 . PHE A 1 359 ? 23.490  21.460  -10.274 1.00 26.19  ? 359  PHE A CD1 1 
ATOM   2727 C  CD2 . PHE A 1 359 ? 23.566  21.891  -7.933  1.00 31.14  ? 359  PHE A CD2 1 
ATOM   2728 C  CE1 . PHE A 1 359 ? 23.003  20.192  -10.029 1.00 33.13  ? 359  PHE A CE1 1 
ATOM   2729 C  CE2 . PHE A 1 359 ? 23.088  20.623  -7.681  1.00 29.18  ? 359  PHE A CE2 1 
ATOM   2730 C  CZ  . PHE A 1 359 ? 22.801  19.773  -8.730  1.00 26.39  ? 359  PHE A CZ  1 
ATOM   2731 N  N   . LEU A 1 360 ? 27.229  23.116  -10.360 1.00 31.27  ? 360  LEU A N   1 
ATOM   2732 C  CA  . LEU A 1 360 ? 28.271  22.207  -10.815 1.00 28.07  ? 360  LEU A CA  1 
ATOM   2733 C  C   . LEU A 1 360 ? 29.503  22.325  -9.929  1.00 31.82  ? 360  LEU A C   1 
ATOM   2734 O  O   . LEU A 1 360 ? 30.110  21.325  -9.553  1.00 38.90  ? 360  LEU A O   1 
ATOM   2735 C  CB  . LEU A 1 360 ? 28.643  22.485  -12.275 1.00 30.79  ? 360  LEU A CB  1 
ATOM   2736 C  CG  . LEU A 1 360 ? 27.518  22.547  -13.315 1.00 50.33  ? 360  LEU A CG  1 
ATOM   2737 C  CD1 . LEU A 1 360 ? 28.089  22.405  -14.718 1.00 47.61  ? 360  LEU A CD1 1 
ATOM   2738 C  CD2 . LEU A 1 360 ? 26.475  21.481  -13.072 1.00 37.39  ? 360  LEU A CD2 1 
ATOM   2739 N  N   . ALA A 1 361 ? 29.872  23.555  -9.602  1.00 32.98  ? 361  ALA A N   1 
ATOM   2740 C  CA  . ALA A 1 361 ? 31.012  23.799  -8.732  1.00 31.72  ? 361  ALA A CA  1 
ATOM   2741 C  C   . ALA A 1 361 ? 30.761  23.212  -7.341  1.00 39.44  ? 361  ALA A C   1 
ATOM   2742 O  O   . ALA A 1 361 ? 31.674  22.682  -6.703  1.00 38.55  ? 361  ALA A O   1 
ATOM   2743 C  CB  . ALA A 1 361 ? 31.295  25.296  -8.641  1.00 27.97  ? 361  ALA A CB  1 
ATOM   2744 N  N   . GLY A 1 362 ? 29.516  23.308  -6.877  1.00 28.81  ? 362  GLY A N   1 
ATOM   2745 C  CA  . GLY A 1 362 ? 29.156  22.828  -5.560  1.00 26.61  ? 362  GLY A CA  1 
ATOM   2746 C  C   . GLY A 1 362 ? 29.239  21.318  -5.494  1.00 35.58  ? 362  GLY A C   1 
ATOM   2747 O  O   . GLY A 1 362 ? 29.653  20.743  -4.488  1.00 28.47  ? 362  GLY A O   1 
ATOM   2748 N  N   . VAL A 1 363 ? 28.845  20.672  -6.584  1.00 30.28  ? 363  VAL A N   1 
ATOM   2749 C  CA  . VAL A 1 363 ? 28.881  19.220  -6.659  1.00 25.42  ? 363  VAL A CA  1 
ATOM   2750 C  C   . VAL A 1 363 ? 30.310  18.691  -6.539  1.00 32.99  ? 363  VAL A C   1 
ATOM   2751 O  O   . VAL A 1 363 ? 30.537  17.662  -5.910  1.00 31.50  ? 363  VAL A O   1 
ATOM   2752 C  CB  . VAL A 1 363 ? 28.219  18.711  -7.957  1.00 26.88  ? 363  VAL A CB  1 
ATOM   2753 C  CG1 . VAL A 1 363 ? 28.646  17.278  -8.267  1.00 21.66  ? 363  VAL A CG1 1 
ATOM   2754 C  CG2 . VAL A 1 363 ? 26.697  18.831  -7.852  1.00 30.62  ? 363  VAL A CG2 1 
ATOM   2755 N  N   . ARG A 1 364 ? 31.273  19.398  -7.128  1.00 30.96  ? 364  ARG A N   1 
ATOM   2756 C  CA  . ARG A 1 364 ? 32.672  18.998  -7.006  1.00 34.87  ? 364  ARG A CA  1 
ATOM   2757 C  C   . ARG A 1 364 ? 33.127  19.116  -5.557  1.00 35.55  ? 364  ARG A C   1 
ATOM   2758 O  O   . ARG A 1 364 ? 33.914  18.305  -5.077  1.00 31.06  ? 364  ARG A O   1 
ATOM   2759 C  CB  . ARG A 1 364 ? 33.583  19.843  -7.900  1.00 32.36  ? 364  ARG A CB  1 
ATOM   2760 C  CG  . ARG A 1 364 ? 33.297  19.752  -9.389  1.00 29.22  ? 364  ARG A CG  1 
ATOM   2761 C  CD  . ARG A 1 364 ? 32.843  18.360  -9.804  1.00 38.22  ? 364  ARG A CD  1 
ATOM   2762 N  NE  . ARG A 1 364 ? 33.885  17.340  -9.688  1.00 46.25  ? 364  ARG A NE  1 
ATOM   2763 C  CZ  . ARG A 1 364 ? 34.738  17.027  -10.660 1.00 52.64  ? 364  ARG A CZ  1 
ATOM   2764 N  NH1 . ARG A 1 364 ? 34.688  17.666  -11.822 1.00 49.71  ? 364  ARG A NH1 1 
ATOM   2765 N  NH2 . ARG A 1 364 ? 35.647  16.079  -10.470 1.00 49.50  ? 364  ARG A NH2 1 
ATOM   2766 N  N   . ILE A 1 365 ? 32.627  20.130  -4.862  1.00 28.15  ? 365  ILE A N   1 
ATOM   2767 C  CA  . ILE A 1 365 ? 33.010  20.353  -3.476  1.00 30.35  ? 365  ILE A CA  1 
ATOM   2768 C  C   . ILE A 1 365 ? 32.299  19.379  -2.535  1.00 35.61  ? 365  ILE A C   1 
ATOM   2769 O  O   . ILE A 1 365 ? 32.905  18.838  -1.611  1.00 28.30  ? 365  ILE A O   1 
ATOM   2770 C  CB  . ILE A 1 365 ? 32.734  21.803  -3.045  1.00 29.73  ? 365  ILE A CB  1 
ATOM   2771 C  CG1 . ILE A 1 365 ? 33.522  22.773  -3.930  1.00 36.65  ? 365  ILE A CG1 1 
ATOM   2772 C  CG2 . ILE A 1 365 ? 33.100  22.005  -1.583  1.00 25.54  ? 365  ILE A CG2 1 
ATOM   2773 C  CD1 . ILE A 1 365 ? 33.206  24.237  -3.681  1.00 25.70  ? 365  ILE A CD1 1 
ATOM   2774 N  N   . GLY A 1 366 ? 31.013  19.155  -2.785  1.00 36.33  ? 366  GLY A N   1 
ATOM   2775 C  CA  . GLY A 1 366 ? 30.214  18.267  -1.964  1.00 28.63  ? 366  GLY A CA  1 
ATOM   2776 C  C   . GLY A 1 366 ? 30.483  16.799  -2.235  1.00 32.38  ? 366  GLY A C   1 
ATOM   2777 O  O   . GLY A 1 366 ? 30.209  15.950  -1.392  1.00 33.93  ? 366  GLY A O   1 
ATOM   2778 N  N   . VAL A 1 367 ? 31.015  16.495  -3.414  1.00 29.71  ? 367  VAL A N   1 
ATOM   2779 C  CA  . VAL A 1 367 ? 31.406  15.128  -3.747  1.00 32.47  ? 367  VAL A CA  1 
ATOM   2780 C  C   . VAL A 1 367 ? 32.870  15.116  -4.158  1.00 34.94  ? 367  VAL A C   1 
ATOM   2781 O  O   . VAL A 1 367 ? 33.194  14.799  -5.303  1.00 37.83  ? 367  VAL A O   1 
ATOM   2782 C  CB  . VAL A 1 367 ? 30.570  14.548  -4.911  1.00 34.64  ? 367  VAL A CB  1 
ATOM   2783 C  CG1 . VAL A 1 367 ? 30.770  13.046  -5.004  1.00 27.92  ? 367  VAL A CG1 1 
ATOM   2784 C  CG2 . VAL A 1 367 ? 29.090  14.880  -4.741  1.00 21.84  ? 367  VAL A CG2 1 
ATOM   2785 N  N   . PRO A 1 368 ? 33.763  15.461  -3.218  1.00 38.95  ? 368  PRO A N   1 
ATOM   2786 C  CA  . PRO A 1 368 ? 35.174  15.742  -3.520  1.00 31.59  ? 368  PRO A CA  1 
ATOM   2787 C  C   . PRO A 1 368 ? 35.923  14.559  -4.135  1.00 37.66  ? 368  PRO A C   1 
ATOM   2788 O  O   . PRO A 1 368 ? 36.912  14.760  -4.844  1.00 38.87  ? 368  PRO A O   1 
ATOM   2789 C  CB  . PRO A 1 368 ? 35.755  16.087  -2.146  1.00 31.82  ? 368  PRO A CB  1 
ATOM   2790 C  CG  . PRO A 1 368 ? 34.798  15.440  -1.166  1.00 32.59  ? 368  PRO A CG  1 
ATOM   2791 C  CD  . PRO A 1 368 ? 33.470  15.658  -1.788  1.00 27.52  ? 368  PRO A CD  1 
ATOM   2792 N  N   . GLN A 1 369 ? 35.458  13.343  -3.872  1.00 31.78  ? 369  GLN A N   1 
ATOM   2793 C  CA  . GLN A 1 369 ? 36.117  12.158  -4.410  1.00 38.36  ? 369  GLN A CA  1 
ATOM   2794 C  C   . GLN A 1 369 ? 35.688  11.822  -5.833  1.00 41.86  ? 369  GLN A C   1 
ATOM   2795 O  O   . GLN A 1 369 ? 36.260  10.933  -6.458  1.00 45.39  ? 369  GLN A O   1 
ATOM   2796 C  CB  . GLN A 1 369 ? 35.927  10.939  -3.495  1.00 26.83  ? 369  GLN A CB  1 
ATOM   2797 C  CG  . GLN A 1 369 ? 35.008  11.153  -2.306  1.00 57.97  ? 369  GLN A CG  1 
ATOM   2798 C  CD  . GLN A 1 369 ? 33.561  11.338  -2.688  1.00 41.51  ? 369  GLN A CD  1 
ATOM   2799 O  OE1 . GLN A 1 369 ? 32.886  10.392  -3.092  1.00 43.73  ? 369  GLN A OE1 1 
ATOM   2800 N  NE2 . GLN A 1 369 ? 33.067  12.558  -2.539  1.00 39.25  ? 369  GLN A NE2 1 
ATOM   2801 N  N   . ALA A 1 370 ? 34.696  12.536  -6.352  1.00 36.31  ? 370  ALA A N   1 
ATOM   2802 C  CA  . ALA A 1 370 ? 34.151  12.204  -7.665  1.00 41.86  ? 370  ALA A CA  1 
ATOM   2803 C  C   . ALA A 1 370 ? 35.105  12.538  -8.803  1.00 43.85  ? 370  ALA A C   1 
ATOM   2804 O  O   . ALA A 1 370 ? 35.743  13.591  -8.807  1.00 38.66  ? 370  ALA A O   1 
ATOM   2805 C  CB  . ALA A 1 370 ? 32.813  12.901  -7.883  1.00 36.49  ? 370  ALA A CB  1 
ATOM   2806 N  N   . SER A 1 371 ? 35.199  11.629  -9.766  1.00 41.44  ? 371  SER A N   1 
ATOM   2807 C  CA  . SER A 1 371 ? 35.822  11.938  -11.042 1.00 42.34  ? 371  SER A CA  1 
ATOM   2808 C  C   . SER A 1 371 ? 34.864  12.823  -11.823 1.00 46.85  ? 371  SER A C   1 
ATOM   2809 O  O   . SER A 1 371 ? 33.752  13.102  -11.371 1.00 43.64  ? 371  SER A O   1 
ATOM   2810 C  CB  . SER A 1 371 ? 36.099  10.664  -11.831 1.00 41.66  ? 371  SER A CB  1 
ATOM   2811 O  OG  . SER A 1 371 ? 34.900  9.963   -12.102 1.00 50.82  ? 371  SER A OG  1 
ATOM   2812 N  N   . ASP A 1 372 ? 35.286  13.262  -12.999 1.00 46.52  ? 372  ASP A N   1 
ATOM   2813 C  CA  . ASP A 1 372 ? 34.448  14.140  -13.795 1.00 43.81  ? 372  ASP A CA  1 
ATOM   2814 C  C   . ASP A 1 372 ? 33.151  13.451  -14.196 1.00 49.88  ? 372  ASP A C   1 
ATOM   2815 O  O   . ASP A 1 372 ? 32.079  14.054  -14.142 1.00 49.07  ? 372  ASP A O   1 
ATOM   2816 C  CB  . ASP A 1 372 ? 35.202  14.640  -15.026 1.00 46.21  ? 372  ASP A CB  1 
ATOM   2817 C  CG  . ASP A 1 372 ? 36.275  15.647  -14.676 1.00 52.61  ? 372  ASP A CG  1 
ATOM   2818 O  OD1 . ASP A 1 372 ? 36.310  16.096  -13.511 1.00 54.91  ? 372  ASP A OD1 1 
ATOM   2819 O  OD2 . ASP A 1 372 ? 37.080  15.991  -15.564 1.00 67.44  ? 372  ASP A OD2 1 
ATOM   2820 N  N   . LEU A 1 373 ? 33.246  12.184  -14.588 1.00 44.16  ? 373  LEU A N   1 
ATOM   2821 C  CA  . LEU A 1 373 ? 32.066  11.465  -15.049 1.00 43.08  ? 373  LEU A CA  1 
ATOM   2822 C  C   . LEU A 1 373 ? 31.070  11.235  -13.913 1.00 44.19  ? 373  LEU A C   1 
ATOM   2823 O  O   . LEU A 1 373 ? 29.863  11.387  -14.093 1.00 41.62  ? 373  LEU A O   1 
ATOM   2824 C  CB  . LEU A 1 373 ? 32.445  10.132  -15.702 1.00 40.19  ? 373  LEU A CB  1 
ATOM   2825 C  CG  . LEU A 1 373 ? 31.249  9.414   -16.343 1.00 42.09  ? 373  LEU A CG  1 
ATOM   2826 C  CD1 . LEU A 1 373 ? 30.603  10.307  -17.383 1.00 32.55  ? 373  LEU A CD1 1 
ATOM   2827 C  CD2 . LEU A 1 373 ? 31.643  8.085   -16.957 1.00 46.59  ? 373  LEU A CD2 1 
ATOM   2828 N  N   . ALA A 1 374 ? 31.584  10.860  -12.746 1.00 44.73  ? 374  ALA A N   1 
ATOM   2829 C  CA  . ALA A 1 374 ? 30.739  10.615  -11.585 1.00 43.11  ? 374  ALA A CA  1 
ATOM   2830 C  C   . ALA A 1 374 ? 30.018  11.890  -11.163 1.00 40.23  ? 374  ALA A C   1 
ATOM   2831 O  O   . ALA A 1 374 ? 28.865  11.854  -10.739 1.00 38.25  ? 374  ALA A O   1 
ATOM   2832 C  CB  . ALA A 1 374 ? 31.567  10.064  -10.439 1.00 41.74  ? 374  ALA A CB  1 
ATOM   2833 N  N   . ALA A 1 375 ? 30.709  13.017  -11.288 1.00 36.86  ? 375  ALA A N   1 
ATOM   2834 C  CA  . ALA A 1 375 ? 30.140  14.311  -10.942 1.00 34.85  ? 375  ALA A CA  1 
ATOM   2835 C  C   . ALA A 1 375 ? 29.049  14.679  -11.934 1.00 44.91  ? 375  ALA A C   1 
ATOM   2836 O  O   . ALA A 1 375 ? 27.984  15.168  -11.552 1.00 46.82  ? 375  ALA A O   1 
ATOM   2837 C  CB  . ALA A 1 375 ? 31.219  15.374  -10.925 1.00 29.75  ? 375  ALA A CB  1 
ATOM   2838 N  N   . GLU A 1 376 ? 29.320  14.450  -13.214 1.00 41.13  ? 376  GLU A N   1 
ATOM   2839 C  CA  . GLU A 1 376 ? 28.307  14.659  -14.235 1.00 41.12  ? 376  GLU A CA  1 
ATOM   2840 C  C   . GLU A 1 376 ? 27.096  13.791  -13.939 1.00 37.57  ? 376  GLU A C   1 
ATOM   2841 O  O   . GLU A 1 376 ? 25.965  14.245  -14.057 1.00 37.55  ? 376  GLU A O   1 
ATOM   2842 C  CB  . GLU A 1 376 ? 28.858  14.366  -15.634 1.00 51.22  ? 376  GLU A CB  1 
ATOM   2843 C  CG  . GLU A 1 376 ? 29.349  15.603  -16.370 1.00 73.25  ? 376  GLU A CG  1 
ATOM   2844 C  CD  . GLU A 1 376 ? 30.101  15.278  -17.651 1.00 100.13 ? 376  GLU A CD  1 
ATOM   2845 O  OE1 . GLU A 1 376 ? 30.953  14.362  -17.633 1.00 76.46  ? 376  GLU A OE1 1 
ATOM   2846 O  OE2 . GLU A 1 376 ? 29.848  15.951  -18.673 1.00 116.48 ? 376  GLU A OE2 1 
ATOM   2847 N  N   . ALA A 1 377 ? 27.338  12.546  -13.538 1.00 31.12  ? 377  ALA A N   1 
ATOM   2848 C  CA  . ALA A 1 377 ? 26.254  11.644  -13.177 1.00 32.12  ? 377  ALA A CA  1 
ATOM   2849 C  C   . ALA A 1 377 ? 25.388  12.268  -12.088 1.00 39.24  ? 377  ALA A C   1 
ATOM   2850 O  O   . ALA A 1 377 ? 24.157  12.274  -12.189 1.00 34.44  ? 377  ALA A O   1 
ATOM   2851 C  CB  . ALA A 1 377 ? 26.797  10.301  -12.732 1.00 26.27  ? 377  ALA A CB  1 
ATOM   2852 N  N   . VAL A 1 378 ? 26.041  12.805  -11.060 1.00 32.71  ? 378  VAL A N   1 
ATOM   2853 C  CA  . VAL A 1 378 ? 25.347  13.444  -9.947  1.00 31.31  ? 378  VAL A CA  1 
ATOM   2854 C  C   . VAL A 1 378 ? 24.494  14.606  -10.444 1.00 31.83  ? 378  VAL A C   1 
ATOM   2855 O  O   . VAL A 1 378 ? 23.304  14.690  -10.145 1.00 30.18  ? 378  VAL A O   1 
ATOM   2856 C  CB  . VAL A 1 378 ? 26.340  13.948  -8.858  1.00 32.57  ? 378  VAL A CB  1 
ATOM   2857 C  CG1 . VAL A 1 378 ? 25.622  14.790  -7.821  1.00 24.96  ? 378  VAL A CG1 1 
ATOM   2858 C  CG2 . VAL A 1 378 ? 27.042  12.779  -8.180  1.00 27.39  ? 378  VAL A CG2 1 
ATOM   2859 N  N   . VAL A 1 379 ? 25.114  15.498  -11.210 1.00 39.42  ? 379  VAL A N   1 
ATOM   2860 C  CA  . VAL A 1 379 ? 24.439  16.685  -11.715 1.00 34.46  ? 379  VAL A CA  1 
ATOM   2861 C  C   . VAL A 1 379 ? 23.248  16.307  -12.578 1.00 35.57  ? 379  VAL A C   1 
ATOM   2862 O  O   . VAL A 1 379 ? 22.179  16.909  -12.479 1.00 34.44  ? 379  VAL A O   1 
ATOM   2863 C  CB  . VAL A 1 379 ? 25.392  17.551  -12.553 1.00 38.55  ? 379  VAL A CB  1 
ATOM   2864 C  CG1 . VAL A 1 379 ? 24.609  18.570  -13.365 1.00 29.73  ? 379  VAL A CG1 1 
ATOM   2865 C  CG2 . VAL A 1 379 ? 26.407  18.232  -11.657 1.00 36.53  ? 379  VAL A CG2 1 
ATOM   2866 N  N   . LEU A 1 380 ? 23.437  15.303  -13.424 1.00 35.85  ? 380  LEU A N   1 
ATOM   2867 C  CA  . LEU A 1 380 ? 22.376  14.857  -14.312 1.00 37.52  ? 380  LEU A CA  1 
ATOM   2868 C  C   . LEU A 1 380 ? 21.207  14.291  -13.520 1.00 38.28  ? 380  LEU A C   1 
ATOM   2869 O  O   . LEU A 1 380 ? 20.049  14.571  -13.821 1.00 39.31  ? 380  LEU A O   1 
ATOM   2870 C  CB  . LEU A 1 380 ? 22.909  13.839  -15.320 1.00 42.22  ? 380  LEU A CB  1 
ATOM   2871 C  CG  . LEU A 1 380 ? 24.041  14.417  -16.177 1.00 52.53  ? 380  LEU A CG  1 
ATOM   2872 C  CD1 . LEU A 1 380 ? 24.410  13.504  -17.336 1.00 54.67  ? 380  LEU A CD1 1 
ATOM   2873 C  CD2 . LEU A 1 380 ? 23.676  15.806  -16.682 1.00 54.28  ? 380  LEU A CD2 1 
ATOM   2874 N  N   . HIS A 1 381 ? 21.515  13.512  -12.492 1.00 33.23  ? 381  HIS A N   1 
ATOM   2875 C  CA  . HIS A 1 381 ? 20.477  12.914  -11.673 1.00 31.97  ? 381  HIS A CA  1 
ATOM   2876 C  C   . HIS A 1 381 ? 19.664  13.947  -10.893 1.00 35.25  ? 381  HIS A C   1 
ATOM   2877 O  O   . HIS A 1 381 ? 18.450  13.815  -10.756 1.00 33.60  ? 381  HIS A O   1 
ATOM   2878 C  CB  . HIS A 1 381 ? 21.081  11.901  -10.704 1.00 40.50  ? 381  HIS A CB  1 
ATOM   2879 C  CG  . HIS A 1 381 ? 20.060  11.171  -9.894  1.00 41.28  ? 381  HIS A CG  1 
ATOM   2880 N  ND1 . HIS A 1 381 ? 19.562  9.940   -10.262 1.00 48.73  ? 381  HIS A ND1 1 
ATOM   2881 C  CD2 . HIS A 1 381 ? 19.422  11.509  -8.749  1.00 43.57  ? 381  HIS A CD2 1 
ATOM   2882 C  CE1 . HIS A 1 381 ? 18.670  9.546   -9.371  1.00 58.21  ? 381  HIS A CE1 1 
ATOM   2883 N  NE2 . HIS A 1 381 ? 18.565  10.480  -8.443  1.00 47.68  ? 381  HIS A NE2 1 
ATOM   2884 N  N   . TYR A 1 382 ? 20.332  14.972  -10.375 1.00 34.44  ? 382  TYR A N   1 
ATOM   2885 C  CA  . TYR A 1 382 ? 19.667  15.920  -9.485  1.00 30.60  ? 382  TYR A CA  1 
ATOM   2886 C  C   . TYR A 1 382 ? 19.050  17.106  -10.216 1.00 34.63  ? 382  TYR A C   1 
ATOM   2887 O  O   . TYR A 1 382 ? 18.240  17.844  -9.648  1.00 34.22  ? 382  TYR A O   1 
ATOM   2888 C  CB  . TYR A 1 382 ? 20.619  16.392  -8.385  1.00 31.40  ? 382  TYR A CB  1 
ATOM   2889 C  CG  . TYR A 1 382 ? 20.730  15.417  -7.237  1.00 21.63  ? 382  TYR A CG  1 
ATOM   2890 C  CD1 . TYR A 1 382 ? 21.618  14.352  -7.289  1.00 30.72  ? 382  TYR A CD1 1 
ATOM   2891 C  CD2 . TYR A 1 382 ? 19.948  15.562  -6.099  1.00 26.98  ? 382  TYR A CD2 1 
ATOM   2892 C  CE1 . TYR A 1 382 ? 21.727  13.453  -6.243  1.00 30.58  ? 382  TYR A CE1 1 
ATOM   2893 C  CE2 . TYR A 1 382 ? 20.047  14.669  -5.040  1.00 22.72  ? 382  TYR A CE2 1 
ATOM   2894 C  CZ  . TYR A 1 382 ? 20.936  13.615  -5.122  1.00 31.38  ? 382  TYR A CZ  1 
ATOM   2895 O  OH  . TYR A 1 382 ? 21.041  12.723  -4.082  1.00 32.29  ? 382  TYR A OH  1 
ATOM   2896 N  N   . THR A 1 383 ? 19.429  17.285  -11.477 1.00 34.43  ? 383  THR A N   1 
ATOM   2897 C  CA  . THR A 1 383 ? 18.851  18.344  -12.293 1.00 31.62  ? 383  THR A CA  1 
ATOM   2898 C  C   . THR A 1 383 ? 17.365  18.094  -12.522 1.00 33.54  ? 383  THR A C   1 
ATOM   2899 O  O   . THR A 1 383 ? 16.940  16.961  -12.739 1.00 37.74  ? 383  THR A O   1 
ATOM   2900 C  CB  . THR A 1 383 ? 19.569  18.471  -13.656 1.00 37.34  ? 383  THR A CB  1 
ATOM   2901 O  OG1 . THR A 1 383 ? 20.862  19.049  -13.462 1.00 38.09  ? 383  THR A OG1 1 
ATOM   2902 C  CG2 . THR A 1 383 ? 18.775  19.354  -14.605 1.00 32.14  ? 383  THR A CG2 1 
ATOM   2903 N  N   . ASP A 1 384 ? 16.575  19.156  -12.447 1.00 34.33  ? 384  ASP A N   1 
ATOM   2904 C  CA  . ASP A 1 384 ? 15.187  19.091  -12.871 1.00 43.16  ? 384  ASP A CA  1 
ATOM   2905 C  C   . ASP A 1 384 ? 15.125  19.508  -14.340 1.00 44.72  ? 384  ASP A C   1 
ATOM   2906 O  O   . ASP A 1 384 ? 15.220  20.693  -14.666 1.00 41.22  ? 384  ASP A O   1 
ATOM   2907 C  CB  . ASP A 1 384 ? 14.323  20.006  -12.009 1.00 37.69  ? 384  ASP A CB  1 
ATOM   2908 C  CG  . ASP A 1 384 ? 12.926  20.166  -12.559 1.00 46.50  ? 384  ASP A CG  1 
ATOM   2909 O  OD1 . ASP A 1 384 ? 12.553  19.386  -13.461 1.00 44.35  ? 384  ASP A OD1 1 
ATOM   2910 O  OD2 . ASP A 1 384 ? 12.205  21.077  -12.099 1.00 53.33  ? 384  ASP A OD2 1 
ATOM   2911 N  N   . TRP A 1 385 ? 14.976  18.530  -15.227 1.00 34.35  ? 385  TRP A N   1 
ATOM   2912 C  CA  . TRP A 1 385 ? 15.142  18.788  -16.654 1.00 42.45  ? 385  TRP A CA  1 
ATOM   2913 C  C   . TRP A 1 385 ? 13.989  19.560  -17.286 1.00 44.32  ? 385  TRP A C   1 
ATOM   2914 O  O   . TRP A 1 385 ? 14.061  19.952  -18.451 1.00 45.23  ? 385  TRP A O   1 
ATOM   2915 C  CB  . TRP A 1 385 ? 15.474  17.498  -17.403 1.00 35.70  ? 385  TRP A CB  1 
ATOM   2916 C  CG  . TRP A 1 385 ? 16.832  17.027  -17.041 1.00 33.70  ? 385  TRP A CG  1 
ATOM   2917 C  CD1 . TRP A 1 385 ? 17.152  16.022  -16.176 1.00 34.66  ? 385  TRP A CD1 1 
ATOM   2918 C  CD2 . TRP A 1 385 ? 18.070  17.581  -17.491 1.00 31.94  ? 385  TRP A CD2 1 
ATOM   2919 N  NE1 . TRP A 1 385 ? 18.515  15.906  -16.072 1.00 29.77  ? 385  TRP A NE1 1 
ATOM   2920 C  CE2 . TRP A 1 385 ? 19.103  16.851  -16.869 1.00 33.25  ? 385  TRP A CE2 1 
ATOM   2921 C  CE3 . TRP A 1 385 ? 18.406  18.623  -18.361 1.00 35.74  ? 385  TRP A CE3 1 
ATOM   2922 C  CZ2 . TRP A 1 385 ? 20.452  17.127  -17.092 1.00 38.47  ? 385  TRP A CZ2 1 
ATOM   2923 C  CZ3 . TRP A 1 385 ? 19.747  18.900  -18.579 1.00 40.01  ? 385  TRP A CZ3 1 
ATOM   2924 C  CH2 . TRP A 1 385 ? 20.753  18.154  -17.948 1.00 45.61  ? 385  TRP A CH2 1 
ATOM   2925 N  N   . LEU A 1 386 ? 12.940  19.790  -16.501 1.00 38.48  ? 386  LEU A N   1 
ATOM   2926 C  CA  . LEU A 1 386 ? 11.901  20.750  -16.858 1.00 45.11  ? 386  LEU A CA  1 
ATOM   2927 C  C   . LEU A 1 386 ? 12.311  22.187  -16.534 1.00 47.59  ? 386  LEU A C   1 
ATOM   2928 O  O   . LEU A 1 386 ? 11.793  23.134  -17.124 1.00 53.09  ? 386  LEU A O   1 
ATOM   2929 C  CB  . LEU A 1 386 ? 10.596  20.430  -16.132 1.00 47.31  ? 386  LEU A CB  1 
ATOM   2930 C  CG  . LEU A 1 386 ? 9.477   19.863  -17.000 1.00 57.01  ? 386  LEU A CG  1 
ATOM   2931 C  CD1 . LEU A 1 386 ? 8.145   20.101  -16.326 1.00 45.39  ? 386  LEU A CD1 1 
ATOM   2932 C  CD2 . LEU A 1 386 ? 9.499   20.524  -18.371 1.00 58.21  ? 386  LEU A CD2 1 
ATOM   2933 N  N   . HIS A 1 387 ? 13.236  22.338  -15.590 1.00 49.22  ? 387  HIS A N   1 
ATOM   2934 C  CA  . HIS A 1 387 ? 13.652  23.650  -15.098 1.00 38.70  ? 387  HIS A CA  1 
ATOM   2935 C  C   . HIS A 1 387 ? 15.127  23.627  -14.694 1.00 44.24  ? 387  HIS A C   1 
ATOM   2936 O  O   . HIS A 1 387 ? 15.464  23.921  -13.547 1.00 43.22  ? 387  HIS A O   1 
ATOM   2937 C  CB  . HIS A 1 387 ? 12.809  24.047  -13.880 1.00 40.85  ? 387  HIS A CB  1 
ATOM   2938 C  CG  . HIS A 1 387 ? 11.351  24.224  -14.172 1.00 52.85  ? 387  HIS A CG  1 
ATOM   2939 N  ND1 . HIS A 1 387 ? 10.415  23.242  -13.924 1.00 51.22  ? 387  HIS A ND1 1 
ATOM   2940 C  CD2 . HIS A 1 387 ? 10.664  25.278  -14.677 1.00 55.37  ? 387  HIS A CD2 1 
ATOM   2941 C  CE1 . HIS A 1 387 ? 9.217   23.682  -14.267 1.00 51.44  ? 387  HIS A CE1 1 
ATOM   2942 N  NE2 . HIS A 1 387 ? 9.340   24.913  -14.727 1.00 53.91  ? 387  HIS A NE2 1 
ATOM   2943 N  N   . PRO A 1 388 ? 16.014  23.296  -15.645 1.00 46.55  ? 388  PRO A N   1 
ATOM   2944 C  CA  . PRO A 1 388 ? 17.430  23.028  -15.370 1.00 37.35  ? 388  PRO A CA  1 
ATOM   2945 C  C   . PRO A 1 388 ? 18.188  24.232  -14.817 1.00 35.19  ? 388  PRO A C   1 
ATOM   2946 O  O   . PRO A 1 388 ? 19.254  24.061  -14.227 1.00 46.33  ? 388  PRO A O   1 
ATOM   2947 C  CB  . PRO A 1 388 ? 17.999  22.680  -16.753 1.00 39.41  ? 388  PRO A CB  1 
ATOM   2948 C  CG  . PRO A 1 388 ? 16.821  22.536  -17.664 1.00 38.26  ? 388  PRO A CG  1 
ATOM   2949 C  CD  . PRO A 1 388 ? 15.739  23.364  -17.089 1.00 42.44  ? 388  PRO A CD  1 
ATOM   2950 N  N   . GLU A 1 389 ? 17.650  25.429  -15.019 1.00 39.01  ? 389  GLU A N   1 
ATOM   2951 C  CA  . GLU A 1 389 ? 18.361  26.658  -14.688 1.00 36.10  ? 389  GLU A CA  1 
ATOM   2952 C  C   . GLU A 1 389 ? 17.738  27.367  -13.498 1.00 37.83  ? 389  GLU A C   1 
ATOM   2953 O  O   . GLU A 1 389 ? 18.199  28.434  -13.095 1.00 40.90  ? 389  GLU A O   1 
ATOM   2954 C  CB  . GLU A 1 389 ? 18.353  27.607  -15.888 1.00 54.72  ? 389  GLU A CB  1 
ATOM   2955 C  CG  . GLU A 1 389 ? 19.129  27.122  -17.101 1.00 56.74  ? 389  GLU A CG  1 
ATOM   2956 C  CD  . GLU A 1 389 ? 20.590  27.516  -17.050 1.00 72.30  ? 389  GLU A CD  1 
ATOM   2957 O  OE1 . GLU A 1 389 ? 21.061  27.925  -15.965 1.00 80.88  ? 389  GLU A OE1 1 
ATOM   2958 O  OE2 . GLU A 1 389 ? 21.266  27.424  -18.098 1.00 66.49  ? 389  GLU A OE2 1 
ATOM   2959 N  N   . ASP A 1 390 ? 16.686  26.777  -12.943 1.00 34.97  ? 390  ASP A N   1 
ATOM   2960 C  CA  . ASP A 1 390 ? 15.965  27.397  -11.841 1.00 35.25  ? 390  ASP A CA  1 
ATOM   2961 C  C   . ASP A 1 390 ? 16.779  27.458  -10.547 1.00 31.41  ? 390  ASP A C   1 
ATOM   2962 O  O   . ASP A 1 390 ? 17.105  26.429  -9.963  1.00 30.09  ? 390  ASP A O   1 
ATOM   2963 C  CB  . ASP A 1 390 ? 14.650  26.674  -11.578 1.00 28.98  ? 390  ASP A CB  1 
ATOM   2964 C  CG  . ASP A 1 390 ? 13.794  27.408  -10.581 1.00 33.50  ? 390  ASP A CG  1 
ATOM   2965 O  OD1 . ASP A 1 390 ? 13.225  28.450  -10.953 1.00 44.77  ? 390  ASP A OD1 1 
ATOM   2966 O  OD2 . ASP A 1 390 ? 13.705  26.962  -9.421  1.00 40.18  ? 390  ASP A OD2 1 
ATOM   2967 N  N   . PRO A 1 391 ? 17.080  28.679  -10.087 1.00 33.10  ? 391  PRO A N   1 
ATOM   2968 C  CA  . PRO A 1 391 ? 17.946  28.948  -8.934  1.00 35.08  ? 391  PRO A CA  1 
ATOM   2969 C  C   . PRO A 1 391 ? 17.442  28.297  -7.652  1.00 40.03  ? 391  PRO A C   1 
ATOM   2970 O  O   . PRO A 1 391 ? 18.241  27.823  -6.842  1.00 36.67  ? 391  PRO A O   1 
ATOM   2971 C  CB  . PRO A 1 391 ? 17.885  30.473  -8.798  1.00 33.32  ? 391  PRO A CB  1 
ATOM   2972 C  CG  . PRO A 1 391 ? 17.498  30.963  -10.142 1.00 30.55  ? 391  PRO A CG  1 
ATOM   2973 C  CD  . PRO A 1 391 ? 16.584  29.920  -10.703 1.00 32.76  ? 391  PRO A CD  1 
ATOM   2974 N  N   . THR A 1 392 ? 16.128  28.282  -7.465  1.00 37.23  ? 392  THR A N   1 
ATOM   2975 C  CA  . THR A 1 392 ? 15.565  27.725  -6.247  1.00 28.04  ? 392  THR A CA  1 
ATOM   2976 C  C   . THR A 1 392 ? 15.731  26.212  -6.234  1.00 32.52  ? 392  THR A C   1 
ATOM   2977 O  O   . THR A 1 392 ? 16.134  25.635  -5.222  1.00 34.90  ? 392  THR A O   1 
ATOM   2978 C  CB  . THR A 1 392 ? 14.088  28.100  -6.072  1.00 34.03  ? 392  THR A CB  1 
ATOM   2979 O  OG1 . THR A 1 392 ? 13.968  29.525  -6.004  1.00 34.81  ? 392  THR A OG1 1 
ATOM   2980 C  CG2 . THR A 1 392 ? 13.540  27.495  -4.790  1.00 23.69  ? 392  THR A CG2 1 
ATOM   2981 N  N   . HIS A 1 393 ? 15.438  25.568  -7.358  1.00 30.06  ? 393  HIS A N   1 
ATOM   2982 C  CA  . HIS A 1 393 ? 15.595  24.126  -7.419  1.00 32.31  ? 393  HIS A CA  1 
ATOM   2983 C  C   . HIS A 1 393 ? 17.059  23.726  -7.268  1.00 34.92  ? 393  HIS A C   1 
ATOM   2984 O  O   . HIS A 1 393 ? 17.373  22.736  -6.614  1.00 33.75  ? 393  HIS A O   1 
ATOM   2985 C  CB  . HIS A 1 393 ? 15.049  23.533  -8.715  1.00 23.66  ? 393  HIS A CB  1 
ATOM   2986 C  CG  . HIS A 1 393 ? 15.442  22.102  -8.907  1.00 46.77  ? 393  HIS A CG  1 
ATOM   2987 N  ND1 . HIS A 1 393 ? 14.831  21.066  -8.231  1.00 46.53  ? 393  HIS A ND1 1 
ATOM   2988 C  CD2 . HIS A 1 393 ? 16.421  21.536  -9.654  1.00 45.94  ? 393  HIS A CD2 1 
ATOM   2989 C  CE1 . HIS A 1 393 ? 15.399  19.923  -8.576  1.00 51.49  ? 393  HIS A CE1 1 
ATOM   2990 N  NE2 . HIS A 1 393 ? 16.368  20.181  -9.435  1.00 43.21  ? 393  HIS A NE2 1 
ATOM   2991 N  N   . LEU A 1 394 ? 17.949  24.494  -7.888  1.00 32.18  ? 394  LEU A N   1 
ATOM   2992 C  CA  . LEU A 1 394 ? 19.371  24.189  -7.842  1.00 34.92  ? 394  LEU A CA  1 
ATOM   2993 C  C   . LEU A 1 394 ? 19.895  24.311  -6.416  1.00 35.55  ? 394  LEU A C   1 
ATOM   2994 O  O   . LEU A 1 394 ? 20.709  23.506  -5.978  1.00 26.58  ? 394  LEU A O   1 
ATOM   2995 C  CB  . LEU A 1 394 ? 20.146  25.093  -8.797  1.00 26.20  ? 394  LEU A CB  1 
ATOM   2996 C  CG  . LEU A 1 394 ? 19.857  24.795  -10.269 1.00 32.85  ? 394  LEU A CG  1 
ATOM   2997 C  CD1 . LEU A 1 394 ? 20.276  25.951  -11.160 1.00 34.90  ? 394  LEU A CD1 1 
ATOM   2998 C  CD2 . LEU A 1 394 ? 20.512  23.490  -10.717 1.00 23.80  ? 394  LEU A CD2 1 
ATOM   2999 N  N   . ARG A 1 395 ? 19.405  25.310  -5.691  1.00 32.37  ? 395  ARG A N   1 
ATOM   3000 C  CA  . ARG A 1 395 ? 19.774  25.483  -4.297  1.00 29.13  ? 395  ARG A CA  1 
ATOM   3001 C  C   . ARG A 1 395 ? 19.341  24.278  -3.464  1.00 33.20  ? 395  ARG A C   1 
ATOM   3002 O  O   . ARG A 1 395 ? 20.122  23.736  -2.687  1.00 36.96  ? 395  ARG A O   1 
ATOM   3003 C  CB  . ARG A 1 395 ? 19.169  26.776  -3.753  1.00 31.01  ? 395  ARG A CB  1 
ATOM   3004 C  CG  . ARG A 1 395 ? 19.380  26.994  -2.267  1.00 32.58  ? 395  ARG A CG  1 
ATOM   3005 C  CD  . ARG A 1 395 ? 18.064  26.910  -1.524  1.00 31.59  ? 395  ARG A CD  1 
ATOM   3006 N  NE  . ARG A 1 395 ? 17.434  28.219  -1.410  1.00 40.59  ? 395  ARG A NE  1 
ATOM   3007 C  CZ  . ARG A 1 395 ? 16.124  28.413  -1.292  1.00 45.48  ? 395  ARG A CZ  1 
ATOM   3008 N  NH1 . ARG A 1 395 ? 15.291  27.380  -1.297  1.00 23.49  ? 395  ARG A NH1 1 
ATOM   3009 N  NH2 . ARG A 1 395 ? 15.647  29.645  -1.184  1.00 41.89  ? 395  ARG A NH2 1 
ATOM   3010 N  N   . ASP A 1 396 ? 18.099  23.847  -3.649  1.00 36.38  ? 396  ASP A N   1 
ATOM   3011 C  CA  . ASP A 1 396 ? 17.557  22.734  -2.883  1.00 27.33  ? 396  ASP A CA  1 
ATOM   3012 C  C   . ASP A 1 396 ? 18.171  21.418  -3.335  1.00 29.12  ? 396  ASP A C   1 
ATOM   3013 O  O   . ASP A 1 396 ? 18.292  20.479  -2.551  1.00 31.69  ? 396  ASP A O   1 
ATOM   3014 C  CB  . ASP A 1 396 ? 16.028  22.686  -2.996  1.00 27.67  ? 396  ASP A CB  1 
ATOM   3015 C  CG  . ASP A 1 396 ? 15.356  23.921  -2.410  1.00 38.47  ? 396  ASP A CG  1 
ATOM   3016 O  OD1 . ASP A 1 396 ? 16.024  24.684  -1.678  1.00 36.82  ? 396  ASP A OD1 1 
ATOM   3017 O  OD2 . ASP A 1 396 ? 14.154  24.130  -2.680  1.00 48.12  ? 396  ASP A OD2 1 
ATOM   3018 N  N   . ALA A 1 397 ? 18.568  21.356  -4.601  1.00 29.64  ? 397  ALA A N   1 
ATOM   3019 C  CA  . ALA A 1 397 ? 19.233  20.168  -5.129  1.00 35.56  ? 397  ALA A CA  1 
ATOM   3020 C  C   . ALA A 1 397 ? 20.638  20.023  -4.549  1.00 34.54  ? 397  ALA A C   1 
ATOM   3021 O  O   . ALA A 1 397 ? 21.080  18.916  -4.245  1.00 29.01  ? 397  ALA A O   1 
ATOM   3022 C  CB  . ALA A 1 397 ? 19.291  20.212  -6.648  1.00 28.16  ? 397  ALA A CB  1 
ATOM   3023 N  N   . MET A 1 398 ? 21.335  21.146  -4.405  1.00 30.27  ? 398  MET A N   1 
ATOM   3024 C  CA  . MET A 1 398 ? 22.671  21.149  -3.830  1.00 29.78  ? 398  MET A CA  1 
ATOM   3025 C  C   . MET A 1 398 ? 22.606  20.647  -2.388  1.00 35.75  ? 398  MET A C   1 
ATOM   3026 O  O   . MET A 1 398 ? 23.459  19.878  -1.945  1.00 26.27  ? 398  MET A O   1 
ATOM   3027 C  CB  . MET A 1 398 ? 23.265  22.556  -3.876  1.00 31.60  ? 398  MET A CB  1 
ATOM   3028 C  CG  . MET A 1 398 ? 24.745  22.632  -3.520  1.00 26.76  ? 398  MET A CG  1 
ATOM   3029 S  SD  . MET A 1 398 ? 25.814  21.834  -4.744  1.00 32.19  ? 398  MET A SD  1 
ATOM   3030 C  CE  . MET A 1 398 ? 26.183  20.282  -3.937  1.00 25.94  ? 398  MET A CE  1 
ATOM   3031 N  N   . SER A 1 399 ? 21.590  21.087  -1.657  1.00 31.96  ? 399  SER A N   1 
ATOM   3032 C  CA  . SER A 1 399 ? 21.378  20.599  -0.304  1.00 36.35  ? 399  SER A CA  1 
ATOM   3033 C  C   . SER A 1 399 ? 21.170  19.082  -0.303  1.00 33.13  ? 399  SER A C   1 
ATOM   3034 O  O   . SER A 1 399 ? 21.793  18.357  0.472   1.00 29.08  ? 399  SER A O   1 
ATOM   3035 C  CB  . SER A 1 399 ? 20.177  21.297  0.332   1.00 28.22  ? 399  SER A CB  1 
ATOM   3036 O  OG  . SER A 1 399 ? 19.912  20.767  1.619   1.00 32.15  ? 399  SER A OG  1 
ATOM   3037 N  N   . ALA A 1 400 ? 20.296  18.611  -1.186  1.00 33.52  ? 400  ALA A N   1 
ATOM   3038 C  CA  . ALA A 1 400 ? 19.971  17.189  -1.273  1.00 31.99  ? 400  ALA A CA  1 
ATOM   3039 C  C   . ALA A 1 400 ? 21.170  16.313  -1.654  1.00 31.87  ? 400  ALA A C   1 
ATOM   3040 O  O   . ALA A 1 400 ? 21.368  15.243  -1.082  1.00 28.80  ? 400  ALA A O   1 
ATOM   3041 C  CB  . ALA A 1 400 ? 18.825  16.969  -2.245  1.00 19.94  ? 400  ALA A CB  1 
ATOM   3042 N  N   . VAL A 1 401 ? 21.952  16.760  -2.632  1.00 31.09  ? 401  VAL A N   1 
ATOM   3043 C  CA  . VAL A 1 401 ? 23.174  16.062  -3.016  1.00 32.16  ? 401  VAL A CA  1 
ATOM   3044 C  C   . VAL A 1 401 ? 24.029  15.788  -1.778  1.00 33.75  ? 401  VAL A C   1 
ATOM   3045 O  O   . VAL A 1 401 ? 24.445  14.660  -1.522  1.00 31.04  ? 401  VAL A O   1 
ATOM   3046 C  CB  . VAL A 1 401 ? 24.006  16.895  -4.020  1.00 34.52  ? 401  VAL A CB  1 
ATOM   3047 C  CG1 . VAL A 1 401 ? 25.440  16.365  -4.106  1.00 22.49  ? 401  VAL A CG1 1 
ATOM   3048 C  CG2 . VAL A 1 401 ? 23.332  16.919  -5.392  1.00 22.24  ? 401  VAL A CG2 1 
ATOM   3049 N  N   . VAL A 1 402 ? 24.274  16.838  -1.007  1.00 28.31  ? 402  VAL A N   1 
ATOM   3050 C  CA  . VAL A 1 402 ? 25.074  16.735  0.198   1.00 26.82  ? 402  VAL A CA  1 
ATOM   3051 C  C   . VAL A 1 402 ? 24.399  15.862  1.255   1.00 32.39  ? 402  VAL A C   1 
ATOM   3052 O  O   . VAL A 1 402 ? 25.043  15.012  1.873   1.00 30.96  ? 402  VAL A O   1 
ATOM   3053 C  CB  . VAL A 1 402 ? 25.366  18.135  0.762   1.00 27.31  ? 402  VAL A CB  1 
ATOM   3054 C  CG1 . VAL A 1 402 ? 26.054  18.044  2.120   1.00 24.74  ? 402  VAL A CG1 1 
ATOM   3055 C  CG2 . VAL A 1 402 ? 26.205  18.921  -0.230  1.00 26.20  ? 402  VAL A CG2 1 
ATOM   3056 N  N   . GLY A 1 403 ? 23.100  16.074  1.451   1.00 27.90  ? 403  GLY A N   1 
ATOM   3057 C  CA  . GLY A 1 403 ? 22.333  15.317  2.425   1.00 23.22  ? 403  GLY A CA  1 
ATOM   3058 C  C   . GLY A 1 403 ? 22.243  13.835  2.107   1.00 33.00  ? 403  GLY A C   1 
ATOM   3059 O  O   . GLY A 1 403 ? 22.389  12.988  2.993   1.00 31.79  ? 403  GLY A O   1 
ATOM   3060 N  N   . ASP A 1 404 ? 22.009  13.521  0.835   1.00 25.66  ? 404  ASP A N   1 
ATOM   3061 C  CA  . ASP A 1 404 ? 21.843  12.139  0.399   1.00 28.78  ? 404  ASP A CA  1 
ATOM   3062 C  C   . ASP A 1 404 ? 23.167  11.391  0.427   1.00 29.60  ? 404  ASP A C   1 
ATOM   3063 O  O   . ASP A 1 404 ? 23.238  10.244  0.859   1.00 33.54  ? 404  ASP A O   1 
ATOM   3064 C  CB  . ASP A 1 404 ? 21.248  12.082  -1.012  1.00 22.29  ? 404  ASP A CB  1 
ATOM   3065 C  CG  . ASP A 1 404 ? 19.834  12.636  -1.077  1.00 35.03  ? 404  ASP A CG  1 
ATOM   3066 O  OD1 . ASP A 1 404 ? 19.215  12.854  -0.010  1.00 31.15  ? 404  ASP A OD1 1 
ATOM   3067 O  OD2 . ASP A 1 404 ? 19.338  12.851  -2.202  1.00 37.42  ? 404  ASP A OD2 1 
ATOM   3068 N  N   . HIS A 1 405 ? 24.214  12.053  -0.039  1.00 29.11  ? 405  HIS A N   1 
ATOM   3069 C  CA  . HIS A 1 405 ? 25.526  11.435  -0.140  1.00 33.15  ? 405  HIS A CA  1 
ATOM   3070 C  C   . HIS A 1 405 ? 26.101  11.108  1.237   1.00 33.40  ? 405  HIS A C   1 
ATOM   3071 O  O   . HIS A 1 405 ? 26.725  10.064  1.437   1.00 31.18  ? 405  HIS A O   1 
ATOM   3072 C  CB  . HIS A 1 405 ? 26.465  12.373  -0.899  1.00 32.13  ? 405  HIS A CB  1 
ATOM   3073 C  CG  . HIS A 1 405 ? 27.873  11.877  -1.006  1.00 33.13  ? 405  HIS A CG  1 
ATOM   3074 N  ND1 . HIS A 1 405 ? 28.185  10.570  -1.311  1.00 28.46  ? 405  HIS A ND1 1 
ATOM   3075 C  CD2 . HIS A 1 405 ? 29.055  12.528  -0.889  1.00 24.12  ? 405  HIS A CD2 1 
ATOM   3076 C  CE1 . HIS A 1 405 ? 29.497  10.434  -1.364  1.00 26.57  ? 405  HIS A CE1 1 
ATOM   3077 N  NE2 . HIS A 1 405 ? 30.048  11.609  -1.117  1.00 32.47  ? 405  HIS A NE2 1 
ATOM   3078 N  N   . ASN A 1 406 ? 25.884  12.002  2.190   1.00 28.06  ? 406  ASN A N   1 
ATOM   3079 C  CA  . ASN A 1 406 ? 26.551  11.884  3.480   1.00 32.03  ? 406  ASN A CA  1 
ATOM   3080 C  C   . ASN A 1 406 ? 25.733  11.183  4.565   1.00 31.33  ? 406  ASN A C   1 
ATOM   3081 O  O   . ASN A 1 406 ? 26.289  10.471  5.394   1.00 31.32  ? 406  ASN A O   1 
ATOM   3082 C  CB  . ASN A 1 406 ? 27.026  13.260  3.959   1.00 31.51  ? 406  ASN A CB  1 
ATOM   3083 C  CG  . ASN A 1 406 ? 28.116  13.837  3.073   1.00 34.20  ? 406  ASN A CG  1 
ATOM   3084 O  OD1 . ASN A 1 406 ? 29.222  13.298  3.002   1.00 29.42  ? 406  ASN A OD1 1 
ATOM   3085 N  ND2 . ASN A 1 406 ? 27.806  14.933  2.386   1.00 30.18  ? 406  ASN A ND2 1 
ATOM   3086 N  N   . VAL A 1 407 ? 24.417  11.371  4.555   1.00 29.42  ? 407  VAL A N   1 
ATOM   3087 C  CA  . VAL A 1 407 ? 23.592  10.824  5.624   1.00 30.15  ? 407  VAL A CA  1 
ATOM   3088 C  C   . VAL A 1 407 ? 22.492  9.876   5.150   1.00 33.46  ? 407  VAL A C   1 
ATOM   3089 O  O   . VAL A 1 407 ? 22.499  8.697   5.494   1.00 33.90  ? 407  VAL A O   1 
ATOM   3090 C  CB  . VAL A 1 407 ? 22.971  11.946  6.487   1.00 32.48  ? 407  VAL A CB  1 
ATOM   3091 C  CG1 . VAL A 1 407 ? 22.263  11.356  7.693   1.00 31.55  ? 407  VAL A CG1 1 
ATOM   3092 C  CG2 . VAL A 1 407 ? 24.042  12.914  6.933   1.00 24.64  ? 407  VAL A CG2 1 
ATOM   3093 N  N   . VAL A 1 408 ? 21.554  10.392  4.360   1.00 37.29  ? 408  VAL A N   1 
ATOM   3094 C  CA  . VAL A 1 408 ? 20.340  9.644   4.034   1.00 30.40  ? 408  VAL A CA  1 
ATOM   3095 C  C   . VAL A 1 408 ? 20.612  8.297   3.366   1.00 37.18  ? 408  VAL A C   1 
ATOM   3096 O  O   . VAL A 1 408 ? 19.999  7.291   3.718   1.00 35.44  ? 408  VAL A O   1 
ATOM   3097 C  CB  . VAL A 1 408 ? 19.362  10.466  3.166   1.00 34.49  ? 408  VAL A CB  1 
ATOM   3098 C  CG1 . VAL A 1 408 ? 18.131  9.635   2.836   1.00 26.53  ? 408  VAL A CG1 1 
ATOM   3099 C  CG2 . VAL A 1 408 ? 18.953  11.744  3.884   1.00 22.76  ? 408  VAL A CG2 1 
ATOM   3100 N  N   . CYS A 1 409 ? 21.533  8.272   2.410   1.00 31.02  ? 409  CYS A N   1 
ATOM   3101 C  CA  . CYS A 1 409 ? 21.820  7.031   1.698   1.00 34.21  ? 409  CYS A CA  1 
ATOM   3102 C  C   . CYS A 1 409 ? 22.718  6.074   2.482   1.00 36.10  ? 409  CYS A C   1 
ATOM   3103 O  O   . CYS A 1 409 ? 22.519  4.864   2.437   1.00 38.18  ? 409  CYS A O   1 
ATOM   3104 C  CB  . CYS A 1 409 ? 22.380  7.315   0.305   1.00 25.71  ? 409  CYS A CB  1 
ATOM   3105 S  SG  . CYS A 1 409 ? 21.151  8.077   -0.774  1.00 33.47  ? 409  CYS A SG  1 
ATOM   3106 N  N   . PRO A 1 410 ? 23.717  6.607   3.199   1.00 34.28  ? 410  PRO A N   1 
ATOM   3107 C  CA  . PRO A 1 410 ? 24.454  5.703   4.086   1.00 34.42  ? 410  PRO A CA  1 
ATOM   3108 C  C   . PRO A 1 410 ? 23.550  5.086   5.159   1.00 32.92  ? 410  PRO A C   1 
ATOM   3109 O  O   . PRO A 1 410 ? 23.721  3.918   5.498   1.00 31.17  ? 410  PRO A O   1 
ATOM   3110 C  CB  . PRO A 1 410 ? 25.511  6.618   4.708   1.00 31.01  ? 410  PRO A CB  1 
ATOM   3111 C  CG  . PRO A 1 410 ? 25.749  7.651   3.649   1.00 31.77  ? 410  PRO A CG  1 
ATOM   3112 C  CD  . PRO A 1 410 ? 24.392  7.908   3.053   1.00 27.29  ? 410  PRO A CD  1 
ATOM   3113 N  N   . VAL A 1 411 ? 22.595  5.854   5.672   1.00 29.62  ? 411  VAL A N   1 
ATOM   3114 C  CA  . VAL A 1 411 ? 21.644  5.330   6.642   1.00 28.22  ? 411  VAL A CA  1 
ATOM   3115 C  C   . VAL A 1 411 ? 20.751  4.261   6.004   1.00 38.33  ? 411  VAL A C   1 
ATOM   3116 O  O   . VAL A 1 411 ? 20.562  3.180   6.562   1.00 33.94  ? 411  VAL A O   1 
ATOM   3117 C  CB  . VAL A 1 411 ? 20.759  6.443   7.240   1.00 29.45  ? 411  VAL A CB  1 
ATOM   3118 C  CG1 . VAL A 1 411 ? 19.539  5.843   7.924   1.00 20.42  ? 411  VAL A CG1 1 
ATOM   3119 C  CG2 . VAL A 1 411 ? 21.558  7.311   8.209   1.00 25.49  ? 411  VAL A CG2 1 
ATOM   3120 N  N   . ALA A 1 412 ? 20.202  4.569   4.835   1.00 32.67  ? 412  ALA A N   1 
ATOM   3121 C  CA  . ALA A 1 412 ? 19.362  3.614   4.122   1.00 36.56  ? 412  ALA A CA  1 
ATOM   3122 C  C   . ALA A 1 412 ? 20.132  2.314   3.912   1.00 37.73  ? 412  ALA A C   1 
ATOM   3123 O  O   . ALA A 1 412 ? 19.647  1.224   4.212   1.00 40.44  ? 412  ALA A O   1 
ATOM   3124 C  CB  . ALA A 1 412 ? 18.908  4.195   2.787   1.00 27.62  ? 412  ALA A CB  1 
ATOM   3125 N  N   . GLN A 1 413 ? 21.344  2.452   3.397   1.00 30.68  ? 413  GLN A N   1 
ATOM   3126 C  CA  . GLN A 1 413 ? 22.263  1.340   3.234   1.00 33.64  ? 413  GLN A CA  1 
ATOM   3127 C  C   . GLN A 1 413 ? 22.393  0.513   4.520   1.00 45.96  ? 413  GLN A C   1 
ATOM   3128 O  O   . GLN A 1 413 ? 22.284  -0.714  4.501   1.00 38.05  ? 413  GLN A O   1 
ATOM   3129 C  CB  . GLN A 1 413 ? 23.624  1.901   2.848   1.00 34.32  ? 413  GLN A CB  1 
ATOM   3130 C  CG  . GLN A 1 413 ? 24.761  0.932   2.951   1.00 48.96  ? 413  GLN A CG  1 
ATOM   3131 C  CD  . GLN A 1 413 ? 25.165  0.407   1.609   1.00 57.65  ? 413  GLN A CD  1 
ATOM   3132 O  OE1 . GLN A 1 413 ? 24.383  -0.256  0.926   1.00 64.65  ? 413  GLN A OE1 1 
ATOM   3133 N  NE2 . GLN A 1 413 ? 26.393  0.706   1.208   1.00 62.14  ? 413  GLN A NE2 1 
ATOM   3134 N  N   . LEU A 1 414 ? 22.635  1.197   5.635   1.00 42.28  ? 414  LEU A N   1 
ATOM   3135 C  CA  . LEU A 1 414 ? 22.848  0.534   6.917   1.00 34.62  ? 414  LEU A CA  1 
ATOM   3136 C  C   . LEU A 1 414 ? 21.597  -0.188  7.418   1.00 39.97  ? 414  LEU A C   1 
ATOM   3137 O  O   . LEU A 1 414 ? 21.666  -1.343  7.828   1.00 36.49  ? 414  LEU A O   1 
ATOM   3138 C  CB  . LEU A 1 414 ? 23.326  1.541   7.965   1.00 35.83  ? 414  LEU A CB  1 
ATOM   3139 C  CG  . LEU A 1 414 ? 23.476  1.030   9.400   1.00 33.83  ? 414  LEU A CG  1 
ATOM   3140 C  CD1 . LEU A 1 414 ? 24.663  0.081   9.529   1.00 33.96  ? 414  LEU A CD1 1 
ATOM   3141 C  CD2 . LEU A 1 414 ? 23.624  2.196   10.353  1.00 44.55  ? 414  LEU A CD2 1 
ATOM   3142 N  N   . ALA A 1 415 ? 20.459  0.498   7.395   1.00 33.50  ? 415  ALA A N   1 
ATOM   3143 C  CA  . ALA A 1 415 ? 19.204  -0.103  7.827   1.00 31.94  ? 415  ALA A CA  1 
ATOM   3144 C  C   . ALA A 1 415 ? 18.957  -1.393  7.058   1.00 44.63  ? 415  ALA A C   1 
ATOM   3145 O  O   . ALA A 1 415 ? 18.574  -2.411  7.633   1.00 40.43  ? 415  ALA A O   1 
ATOM   3146 C  CB  . ALA A 1 415 ? 18.053  0.864   7.618   1.00 33.08  ? 415  ALA A CB  1 
ATOM   3147 N  N   . GLY A 1 416 ? 19.189  -1.337  5.752   1.00 39.90  ? 416  GLY A N   1 
ATOM   3148 C  CA  . GLY A 1 416 ? 18.979  -2.476  4.885   1.00 38.72  ? 416  GLY A CA  1 
ATOM   3149 C  C   . GLY A 1 416 ? 19.803  -3.685  5.272   1.00 43.07  ? 416  GLY A C   1 
ATOM   3150 O  O   . GLY A 1 416 ? 19.264  -4.774  5.452   1.00 53.96  ? 416  GLY A O   1 
ATOM   3151 N  N   . ARG A 1 417 ? 21.111  -3.499  5.396   1.00 43.05  ? 417  ARG A N   1 
ATOM   3152 C  CA  . ARG A 1 417 ? 21.994  -4.603  5.743   1.00 38.35  ? 417  ARG A CA  1 
ATOM   3153 C  C   . ARG A 1 417 ? 21.630  -5.164  7.111   1.00 41.71  ? 417  ARG A C   1 
ATOM   3154 O  O   . ARG A 1 417 ? 21.473  -6.369  7.277   1.00 46.17  ? 417  ARG A O   1 
ATOM   3155 C  CB  . ARG A 1 417 ? 23.451  -4.149  5.728   1.00 40.53  ? 417  ARG A CB  1 
ATOM   3156 C  CG  . ARG A 1 417 ? 23.886  -3.505  4.431   1.00 49.33  ? 417  ARG A CG  1 
ATOM   3157 C  CD  . ARG A 1 417 ? 23.644  -4.428  3.254   1.00 58.50  ? 417  ARG A CD  1 
ATOM   3158 N  NE  . ARG A 1 417 ? 24.191  -5.759  3.492   1.00 68.27  ? 417  ARG A NE  1 
ATOM   3159 C  CZ  . ARG A 1 417 ? 24.563  -6.596  2.529   1.00 68.44  ? 417  ARG A CZ  1 
ATOM   3160 N  NH1 . ARG A 1 417 ? 24.457  -6.233  1.256   1.00 55.07  ? 417  ARG A NH1 1 
ATOM   3161 N  NH2 . ARG A 1 417 ? 25.052  -7.791  2.839   1.00 56.29  ? 417  ARG A NH2 1 
ATOM   3162 N  N   . LEU A 1 418 ? 21.492  -4.273  8.085   1.00 42.69  ? 418  LEU A N   1 
ATOM   3163 C  CA  . LEU A 1 418 ? 21.124  -4.654  9.441   1.00 39.43  ? 418  LEU A CA  1 
ATOM   3164 C  C   . LEU A 1 418 ? 19.865  -5.509  9.459   1.00 46.57  ? 418  LEU A C   1 
ATOM   3165 O  O   . LEU A 1 418 ? 19.846  -6.590  10.050  1.00 39.63  ? 418  LEU A O   1 
ATOM   3166 C  CB  . LEU A 1 418 ? 20.919  -3.407  10.306  1.00 33.36  ? 418  LEU A CB  1 
ATOM   3167 C  CG  . LEU A 1 418 ? 22.039  -2.959  11.249  1.00 34.52  ? 418  LEU A CG  1 
ATOM   3168 C  CD1 . LEU A 1 418 ? 23.389  -3.511  10.840  1.00 39.44  ? 418  LEU A CD1 1 
ATOM   3169 C  CD2 . LEU A 1 418 ? 22.080  -1.440  11.336  1.00 35.54  ? 418  LEU A CD2 1 
ATOM   3170 N  N   . ALA A 1 419 ? 18.812  -5.018  8.815   1.00 42.32  ? 419  ALA A N   1 
ATOM   3171 C  CA  . ALA A 1 419 ? 17.545  -5.738  8.771   1.00 47.97  ? 419  ALA A CA  1 
ATOM   3172 C  C   . ALA A 1 419 ? 17.737  -7.103  8.122   1.00 49.87  ? 419  ALA A C   1 
ATOM   3173 O  O   . ALA A 1 419 ? 17.368  -8.132  8.687   1.00 56.65  ? 419  ALA A O   1 
ATOM   3174 C  CB  . ALA A 1 419 ? 16.497  -4.927  8.017   1.00 41.32  ? 419  ALA A CB  1 
ATOM   3175 N  N   . ALA A 1 420 ? 18.336  -7.101  6.938   1.00 48.08  ? 420  ALA A N   1 
ATOM   3176 C  CA  . ALA A 1 420 ? 18.563  -8.325  6.185   1.00 45.83  ? 420  ALA A CA  1 
ATOM   3177 C  C   . ALA A 1 420 ? 19.377  -9.345  6.965   1.00 46.96  ? 420  ALA A C   1 
ATOM   3178 O  O   . ALA A 1 420 ? 19.418  -10.517 6.596   1.00 51.93  ? 420  ALA A O   1 
ATOM   3179 C  CB  . ALA A 1 420 ? 19.253  -8.009  4.861   1.00 40.98  ? 420  ALA A CB  1 
ATOM   3180 N  N   . GLN A 1 421 ? 20.021  -8.911  8.043   1.00 43.24  ? 421  GLN A N   1 
ATOM   3181 C  CA  . GLN A 1 421 ? 20.966  -9.783  8.731   1.00 34.03  ? 421  GLN A CA  1 
ATOM   3182 C  C   . GLN A 1 421 ? 20.741  -9.955  10.231  1.00 40.16  ? 421  GLN A C   1 
ATOM   3183 O  O   . GLN A 1 421 ? 21.699  -10.092 10.995  1.00 53.50  ? 421  GLN A O   1 
ATOM   3184 C  CB  . GLN A 1 421 ? 22.402  -9.344  8.430   1.00 41.85  ? 421  GLN A CB  1 
ATOM   3185 C  CG  . GLN A 1 421 ? 22.807  -9.618  6.992   1.00 43.97  ? 421  GLN A CG  1 
ATOM   3186 C  CD  . GLN A 1 421 ? 23.933  -8.728  6.516   1.00 57.40  ? 421  GLN A CD  1 
ATOM   3187 O  OE1 . GLN A 1 421 ? 23.847  -8.114  5.451   1.00 57.01  ? 421  GLN A OE1 1 
ATOM   3188 N  NE2 . GLN A 1 421 ? 24.995  -8.645  7.305   1.00 60.54  ? 421  GLN A NE2 1 
ATOM   3189 N  N   . GLY A 1 422 ? 19.477  -9.960  10.648  1.00 41.66  ? 422  GLY A N   1 
ATOM   3190 C  CA  . GLY A 1 422 ? 19.135  -10.338 12.009  1.00 49.98  ? 422  GLY A CA  1 
ATOM   3191 C  C   . GLY A 1 422 ? 18.696  -9.236  12.955  1.00 52.21  ? 422  GLY A C   1 
ATOM   3192 O  O   . GLY A 1 422 ? 17.986  -9.493  13.929  1.00 61.05  ? 422  GLY A O   1 
ATOM   3193 N  N   . ALA A 1 423 ? 19.120  -8.010  12.682  1.00 55.85  ? 423  ALA A N   1 
ATOM   3194 C  CA  . ALA A 1 423 ? 18.797  -6.898  13.564  1.00 48.67  ? 423  ALA A CA  1 
ATOM   3195 C  C   . ALA A 1 423 ? 17.331  -6.518  13.446  1.00 37.77  ? 423  ALA A C   1 
ATOM   3196 O  O   . ALA A 1 423 ? 16.744  -6.619  12.371  1.00 47.18  ? 423  ALA A O   1 
ATOM   3197 C  CB  . ALA A 1 423 ? 19.678  -5.706  13.249  1.00 49.82  ? 423  ALA A CB  1 
ATOM   3198 N  N   . ARG A 1 424 ? 16.737  -6.095  14.555  1.00 42.57  ? 424  ARG A N   1 
ATOM   3199 C  CA  . ARG A 1 424 ? 15.442  -5.436  14.490  1.00 42.97  ? 424  ARG A CA  1 
ATOM   3200 C  C   . ARG A 1 424 ? 15.701  -3.947  14.304  1.00 42.37  ? 424  ARG A C   1 
ATOM   3201 O  O   . ARG A 1 424 ? 16.388  -3.324  15.113  1.00 37.24  ? 424  ARG A O   1 
ATOM   3202 C  CB  . ARG A 1 424 ? 14.606  -5.691  15.749  1.00 36.73  ? 424  ARG A CB  1 
ATOM   3203 C  CG  . ARG A 1 424 ? 13.258  -4.968  15.723  1.00 43.81  ? 424  ARG A CG  1 
ATOM   3204 C  CD  . ARG A 1 424 ? 12.122  -5.821  16.284  1.00 78.76  ? 424  ARG A CD  1 
ATOM   3205 N  NE  . ARG A 1 424 ? 11.811  -5.507  17.678  1.00 79.26  ? 424  ARG A NE  1 
ATOM   3206 C  CZ  . ARG A 1 424 ? 12.164  -6.259  18.717  1.00 86.10  ? 424  ARG A CZ  1 
ATOM   3207 N  NH1 . ARG A 1 424 ? 12.846  -7.384  18.528  1.00 79.97  ? 424  ARG A NH1 1 
ATOM   3208 N  NH2 . ARG A 1 424 ? 11.832  -5.887  19.948  1.00 70.09  ? 424  ARG A NH2 1 
ATOM   3209 N  N   . VAL A 1 425 ? 15.161  -3.386  13.229  1.00 36.06  ? 425  VAL A N   1 
ATOM   3210 C  CA  . VAL A 1 425 ? 15.440  -2.004  12.869  1.00 36.41  ? 425  VAL A CA  1 
ATOM   3211 C  C   . VAL A 1 425 ? 14.180  -1.152  12.830  1.00 38.73  ? 425  VAL A C   1 
ATOM   3212 O  O   . VAL A 1 425 ? 13.194  -1.533  12.211  1.00 40.39  ? 425  VAL A O   1 
ATOM   3213 C  CB  . VAL A 1 425 ? 16.103  -1.924  11.480  1.00 40.74  ? 425  VAL A CB  1 
ATOM   3214 C  CG1 . VAL A 1 425 ? 16.474  -0.480  11.146  1.00 31.53  ? 425  VAL A CG1 1 
ATOM   3215 C  CG2 . VAL A 1 425 ? 17.321  -2.844  11.410  1.00 37.29  ? 425  VAL A CG2 1 
ATOM   3216 N  N   . TYR A 1 426 ? 14.220  0.001   13.490  1.00 38.28  ? 426  TYR A N   1 
ATOM   3217 C  CA  . TYR A 1 426 ? 13.185  1.014   13.317  1.00 35.55  ? 426  TYR A CA  1 
ATOM   3218 C  C   . TYR A 1 426 ? 13.812  2.239   12.668  1.00 39.05  ? 426  TYR A C   1 
ATOM   3219 O  O   . TYR A 1 426 ? 14.962  2.573   12.946  1.00 38.39  ? 426  TYR A O   1 
ATOM   3220 C  CB  . TYR A 1 426 ? 12.539  1.390   14.652  1.00 41.09  ? 426  TYR A CB  1 
ATOM   3221 C  CG  . TYR A 1 426 ? 11.770  0.260   15.298  1.00 47.57  ? 426  TYR A CG  1 
ATOM   3222 C  CD1 . TYR A 1 426 ? 12.421  -0.683  16.078  1.00 44.51  ? 426  TYR A CD1 1 
ATOM   3223 C  CD2 . TYR A 1 426 ? 10.395  0.136   15.127  1.00 44.14  ? 426  TYR A CD2 1 
ATOM   3224 C  CE1 . TYR A 1 426 ? 11.732  -1.720  16.670  1.00 52.34  ? 426  TYR A CE1 1 
ATOM   3225 C  CE2 . TYR A 1 426 ? 9.694   -0.902  15.718  1.00 49.96  ? 426  TYR A CE2 1 
ATOM   3226 C  CZ  . TYR A 1 426 ? 10.372  -1.827  16.489  1.00 52.52  ? 426  TYR A CZ  1 
ATOM   3227 O  OH  . TYR A 1 426 ? 9.700   -2.864  17.087  1.00 49.34  ? 426  TYR A OH  1 
ATOM   3228 N  N   . ALA A 1 427 ? 13.052  2.902   11.802  1.00 35.89  ? 427  ALA A N   1 
ATOM   3229 C  CA  . ALA A 1 427 ? 13.564  4.033   11.042  1.00 28.73  ? 427  ALA A CA  1 
ATOM   3230 C  C   . ALA A 1 427 ? 12.579  5.197   11.027  1.00 37.10  ? 427  ALA A C   1 
ATOM   3231 O  O   . ALA A 1 427 ? 11.362  4.999   11.050  1.00 40.57  ? 427  ALA A O   1 
ATOM   3232 C  CB  . ALA A 1 427 ? 13.897  3.605   9.626   1.00 30.01  ? 427  ALA A CB  1 
ATOM   3233 N  N   . TYR A 1 428 ? 13.115  6.412   10.992  1.00 37.19  ? 428  TYR A N   1 
ATOM   3234 C  CA  . TYR A 1 428 ? 12.292  7.614   10.993  1.00 34.22  ? 428  TYR A CA  1 
ATOM   3235 C  C   . TYR A 1 428 ? 12.902  8.692   10.109  1.00 37.80  ? 428  TYR A C   1 
ATOM   3236 O  O   . TYR A 1 428 ? 14.070  8.625   9.730   1.00 28.22  ? 428  TYR A O   1 
ATOM   3237 C  CB  . TYR A 1 428 ? 12.168  8.171   12.410  1.00 33.23  ? 428  TYR A CB  1 
ATOM   3238 C  CG  . TYR A 1 428 ? 13.475  8.728   12.920  1.00 44.70  ? 428  TYR A CG  1 
ATOM   3239 C  CD1 . TYR A 1 428 ? 13.861  10.035  12.629  1.00 34.48  ? 428  TYR A CD1 1 
ATOM   3240 C  CD2 . TYR A 1 428 ? 14.340  7.938   13.670  1.00 35.23  ? 428  TYR A CD2 1 
ATOM   3241 C  CE1 . TYR A 1 428 ? 15.071  10.536  13.082  1.00 27.70  ? 428  TYR A CE1 1 
ATOM   3242 C  CE2 . TYR A 1 428 ? 15.538  8.433   14.132  1.00 28.30  ? 428  TYR A CE2 1 
ATOM   3243 C  CZ  . TYR A 1 428 ? 15.902  9.726   13.835  1.00 32.10  ? 428  TYR A CZ  1 
ATOM   3244 O  OH  . TYR A 1 428 ? 17.106  10.205  14.296  1.00 34.98  ? 428  TYR A OH  1 
ATOM   3245 N  N   . ILE A 1 429 ? 12.088  9.683   9.777   1.00 37.52  ? 429  ILE A N   1 
ATOM   3246 C  CA  . ILE A 1 429 ? 12.592  10.937  9.268   1.00 32.20  ? 429  ILE A CA  1 
ATOM   3247 C  C   . ILE A 1 429 ? 11.969  12.029  10.117  1.00 38.63  ? 429  ILE A C   1 
ATOM   3248 O  O   . ILE A 1 429 ? 10.765  12.016  10.375  1.00 41.93  ? 429  ILE A O   1 
ATOM   3249 C  CB  . ILE A 1 429 ? 12.251  11.158  7.794   1.00 40.35  ? 429  ILE A CB  1 
ATOM   3250 C  CG1 . ILE A 1 429 ? 12.743  12.542  7.352   1.00 33.19  ? 429  ILE A CG1 1 
ATOM   3251 C  CG2 . ILE A 1 429 ? 10.759  11.005  7.569   1.00 32.96  ? 429  ILE A CG2 1 
ATOM   3252 C  CD1 . ILE A 1 429 ? 12.356  12.913  5.943   1.00 37.95  ? 429  ILE A CD1 1 
ATOM   3253 N  N   . PHE A 1 430 ? 12.797  12.962  10.565  1.00 31.28  ? 430  PHE A N   1 
ATOM   3254 C  CA  . PHE A 1 430 ? 12.355  14.020  11.458  1.00 33.05  ? 430  PHE A CA  1 
ATOM   3255 C  C   . PHE A 1 430 ? 12.119  15.307  10.670  1.00 27.58  ? 430  PHE A C   1 
ATOM   3256 O  O   . PHE A 1 430 ? 13.046  15.864  10.088  1.00 34.39  ? 430  PHE A O   1 
ATOM   3257 C  CB  . PHE A 1 430 ? 13.411  14.226  12.537  1.00 27.84  ? 430  PHE A CB  1 
ATOM   3258 C  CG  . PHE A 1 430 ? 13.070  15.280  13.531  1.00 22.84  ? 430  PHE A CG  1 
ATOM   3259 C  CD1 . PHE A 1 430 ? 13.252  16.617  13.229  1.00 25.30  ? 430  PHE A CD1 1 
ATOM   3260 C  CD2 . PHE A 1 430 ? 12.598  14.934  14.786  1.00 28.56  ? 430  PHE A CD2 1 
ATOM   3261 C  CE1 . PHE A 1 430 ? 12.948  17.596  14.154  1.00 28.72  ? 430  PHE A CE1 1 
ATOM   3262 C  CE2 . PHE A 1 430 ? 12.296  15.908  15.720  1.00 29.99  ? 430  PHE A CE2 1 
ATOM   3263 C  CZ  . PHE A 1 430 ? 12.468  17.244  15.400  1.00 27.26  ? 430  PHE A CZ  1 
ATOM   3264 N  N   . GLU A 1 431 ? 10.877  15.779  10.658  1.00 34.28  ? 431  GLU A N   1 
ATOM   3265 C  CA  . GLU A 1 431 ? 10.491  16.853  9.749   1.00 32.23  ? 431  GLU A CA  1 
ATOM   3266 C  C   . GLU A 1 431 ? 10.034  18.138  10.427  1.00 37.69  ? 431  GLU A C   1 
ATOM   3267 O  O   . GLU A 1 431 ? 9.620   19.077  9.750   1.00 33.76  ? 431  GLU A O   1 
ATOM   3268 C  CB  . GLU A 1 431 ? 9.374   16.379  8.825   1.00 30.76  ? 431  GLU A CB  1 
ATOM   3269 C  CG  . GLU A 1 431 ? 9.678   15.123  8.048   1.00 48.38  ? 431  GLU A CG  1 
ATOM   3270 C  CD  . GLU A 1 431 ? 8.538   14.745  7.128   1.00 50.96  ? 431  GLU A CD  1 
ATOM   3271 O  OE1 . GLU A 1 431 ? 7.374   14.759  7.589   1.00 47.13  ? 431  GLU A OE1 1 
ATOM   3272 O  OE2 . GLU A 1 431 ? 8.805   14.439  5.946   1.00 44.58  ? 431  GLU A OE2 1 
ATOM   3273 N  N   . HIS A 1 432 ? 10.081  18.193  11.751  1.00 29.36  ? 432  HIS A N   1 
ATOM   3274 C  CA  . HIS A 1 432 ? 9.651   19.414  12.412  1.00 31.20  ? 432  HIS A CA  1 
ATOM   3275 C  C   . HIS A 1 432 ? 10.785  20.422  12.577  1.00 43.56  ? 432  HIS A C   1 
ATOM   3276 O  O   . HIS A 1 432 ? 11.806  20.128  13.197  1.00 33.27  ? 432  HIS A O   1 
ATOM   3277 C  CB  . HIS A 1 432 ? 9.007   19.138  13.769  1.00 32.67  ? 432  HIS A CB  1 
ATOM   3278 C  CG  . HIS A 1 432 ? 8.716   20.384  14.543  1.00 39.25  ? 432  HIS A CG  1 
ATOM   3279 N  ND1 . HIS A 1 432 ? 7.697   21.247  14.202  1.00 37.72  ? 432  HIS A ND1 1 
ATOM   3280 C  CD2 . HIS A 1 432 ? 9.335   20.936  15.613  1.00 40.13  ? 432  HIS A CD2 1 
ATOM   3281 C  CE1 . HIS A 1 432 ? 7.691   22.270  15.039  1.00 36.54  ? 432  HIS A CE1 1 
ATOM   3282 N  NE2 . HIS A 1 432 ? 8.673   22.106  15.903  1.00 44.10  ? 432  HIS A NE2 1 
ATOM   3283 N  N   . ARG A 1 433 ? 10.593  21.613  12.020  1.00 32.66  ? 433  ARG A N   1 
ATOM   3284 C  CA  . ARG A 1 433 ? 11.531  22.710  12.209  1.00 37.51  ? 433  ARG A CA  1 
ATOM   3285 C  C   . ARG A 1 433 ? 11.145  23.545  13.430  1.00 44.65  ? 433  ARG A C   1 
ATOM   3286 O  O   . ARG A 1 433 ? 10.041  24.083  13.507  1.00 42.37  ? 433  ARG A O   1 
ATOM   3287 C  CB  . ARG A 1 433 ? 11.601  23.590  10.956  1.00 38.93  ? 433  ARG A CB  1 
ATOM   3288 C  CG  . ARG A 1 433 ? 12.044  25.013  11.241  1.00 46.17  ? 433  ARG A CG  1 
ATOM   3289 C  CD  . ARG A 1 433 ? 11.889  25.907  10.032  1.00 40.77  ? 433  ARG A CD  1 
ATOM   3290 N  NE  . ARG A 1 433 ? 13.161  26.132  9.360   1.00 56.86  ? 433  ARG A NE  1 
ATOM   3291 C  CZ  . ARG A 1 433 ? 13.901  27.223  9.514   1.00 42.68  ? 433  ARG A CZ  1 
ATOM   3292 N  NH1 . ARG A 1 433 ? 13.496  28.194  10.316  1.00 41.36  ? 433  ARG A NH1 1 
ATOM   3293 N  NH2 . ARG A 1 433 ? 15.048  27.339  8.863   1.00 48.57  ? 433  ARG A NH2 1 
ATOM   3294 N  N   . ALA A 1 434 ? 12.069  23.652  14.380  1.00 41.69  ? 434  ALA A N   1 
ATOM   3295 C  CA  . ALA A 1 434 ? 11.804  24.338  15.636  1.00 32.50  ? 434  ALA A CA  1 
ATOM   3296 C  C   . ALA A 1 434 ? 11.324  25.761  15.405  1.00 45.13  ? 434  ALA A C   1 
ATOM   3297 O  O   . ALA A 1 434 ? 11.901  26.496  14.605  1.00 41.96  ? 434  ALA A O   1 
ATOM   3298 C  CB  . ALA A 1 434 ? 13.040  24.337  16.511  1.00 36.17  ? 434  ALA A CB  1 
ATOM   3299 N  N   . SER A 1 435 ? 10.267  26.143  16.114  1.00 36.68  ? 435  SER A N   1 
ATOM   3300 C  CA  . SER A 1 435 ? 9.791   27.519  16.090  1.00 36.40  ? 435  SER A CA  1 
ATOM   3301 C  C   . SER A 1 435 ? 10.903  28.473  16.514  1.00 44.36  ? 435  SER A C   1 
ATOM   3302 O  O   . SER A 1 435 ? 10.859  29.662  16.215  1.00 40.96  ? 435  SER A O   1 
ATOM   3303 C  CB  . SER A 1 435 ? 8.585   27.684  17.018  1.00 37.88  ? 435  SER A CB  1 
ATOM   3304 O  OG  . SER A 1 435 ? 8.936   27.436  18.368  1.00 41.63  ? 435  SER A OG  1 
ATOM   3305 N  N   . THR A 1 436 ? 11.902  27.935  17.205  1.00 44.38  ? 436  THR A N   1 
ATOM   3306 C  CA  . THR A 1 436 ? 12.975  28.740  17.779  1.00 43.55  ? 436  THR A CA  1 
ATOM   3307 C  C   . THR A 1 436 ? 14.227  28.780  16.901  1.00 40.98  ? 436  THR A C   1 
ATOM   3308 O  O   . THR A 1 436 ? 15.238  29.368  17.282  1.00 44.89  ? 436  THR A O   1 
ATOM   3309 C  CB  . THR A 1 436 ? 13.379  28.200  19.171  1.00 42.00  ? 436  THR A CB  1 
ATOM   3310 O  OG1 . THR A 1 436 ? 14.064  26.949  19.027  1.00 45.29  ? 436  THR A OG1 1 
ATOM   3311 C  CG2 . THR A 1 436 ? 12.147  27.991  20.034  1.00 51.30  ? 436  THR A CG2 1 
ATOM   3312 N  N   . LEU A 1 437 ? 14.164  28.148  15.735  1.00 40.84  ? 437  LEU A N   1 
ATOM   3313 C  CA  . LEU A 1 437 ? 15.339  28.024  14.875  1.00 37.99  ? 437  LEU A CA  1 
ATOM   3314 C  C   . LEU A 1 437 ? 15.819  29.389  14.387  1.00 41.89  ? 437  LEU A C   1 
ATOM   3315 O  O   . LEU A 1 437 ? 15.018  30.221  13.966  1.00 41.27  ? 437  LEU A O   1 
ATOM   3316 C  CB  . LEU A 1 437 ? 15.029  27.112  13.687  1.00 37.78  ? 437  LEU A CB  1 
ATOM   3317 C  CG  . LEU A 1 437 ? 16.209  26.449  12.979  1.00 41.87  ? 437  LEU A CG  1 
ATOM   3318 C  CD1 . LEU A 1 437 ? 17.148  25.819  13.988  1.00 40.89  ? 437  LEU A CD1 1 
ATOM   3319 C  CD2 . LEU A 1 437 ? 15.704  25.405  12.000  1.00 47.92  ? 437  LEU A CD2 1 
ATOM   3320 N  N   . THR A 1 438 ? 17.128  29.615  14.438  1.00 38.97  ? 438  THR A N   1 
ATOM   3321 C  CA  . THR A 1 438 ? 17.688  30.907  14.050  1.00 38.96  ? 438  THR A CA  1 
ATOM   3322 C  C   . THR A 1 438 ? 18.262  30.925  12.631  1.00 40.00  ? 438  THR A C   1 
ATOM   3323 O  O   . THR A 1 438 ? 18.594  31.986  12.109  1.00 52.30  ? 438  THR A O   1 
ATOM   3324 C  CB  . THR A 1 438 ? 18.760  31.390  15.051  1.00 42.84  ? 438  THR A CB  1 
ATOM   3325 O  OG1 . THR A 1 438 ? 19.792  30.403  15.160  1.00 51.70  ? 438  THR A OG1 1 
ATOM   3326 C  CG2 . THR A 1 438 ? 18.140  31.616  16.419  1.00 40.92  ? 438  THR A CG2 1 
ATOM   3327 N  N   . TRP A 1 439 ? 18.385  29.756  12.012  1.00 36.70  ? 439  TRP A N   1 
ATOM   3328 C  CA  . TRP A 1 439 ? 18.776  29.691  10.606  1.00 41.05  ? 439  TRP A CA  1 
ATOM   3329 C  C   . TRP A 1 439 ? 17.578  30.061  9.726   1.00 43.80  ? 439  TRP A C   1 
ATOM   3330 O  O   . TRP A 1 439 ? 16.428  29.964  10.164  1.00 36.50  ? 439  TRP A O   1 
ATOM   3331 C  CB  . TRP A 1 439 ? 19.289  28.295  10.240  1.00 32.47  ? 439  TRP A CB  1 
ATOM   3332 C  CG  . TRP A 1 439 ? 20.468  27.829  11.043  1.00 30.39  ? 439  TRP A CG  1 
ATOM   3333 C  CD1 . TRP A 1 439 ? 20.436  27.091  12.190  1.00 34.43  ? 439  TRP A CD1 1 
ATOM   3334 C  CD2 . TRP A 1 439 ? 21.856  28.056  10.751  1.00 31.59  ? 439  TRP A CD2 1 
ATOM   3335 N  NE1 . TRP A 1 439 ? 21.716  26.853  12.637  1.00 30.51  ? 439  TRP A NE1 1 
ATOM   3336 C  CE2 . TRP A 1 439 ? 22.604  27.431  11.772  1.00 30.72  ? 439  TRP A CE2 1 
ATOM   3337 C  CE3 . TRP A 1 439 ? 22.536  28.730  9.734   1.00 23.17  ? 439  TRP A CE3 1 
ATOM   3338 C  CZ2 . TRP A 1 439 ? 23.999  27.457  11.798  1.00 39.08  ? 439  TRP A CZ2 1 
ATOM   3339 C  CZ3 . TRP A 1 439 ? 23.921  28.755  9.762   1.00 37.93  ? 439  TRP A CZ3 1 
ATOM   3340 C  CH2 . TRP A 1 439 ? 24.638  28.122  10.787  1.00 37.50  ? 439  TRP A CH2 1 
ATOM   3341 N  N   . PRO A 1 440 ? 17.843  30.497  8.484   1.00 39.89  ? 440  PRO A N   1 
ATOM   3342 C  CA  . PRO A 1 440 ? 16.783  30.883  7.548   1.00 36.18  ? 440  PRO A CA  1 
ATOM   3343 C  C   . PRO A 1 440 ? 15.938  29.701  7.120   1.00 38.17  ? 440  PRO A C   1 
ATOM   3344 O  O   . PRO A 1 440 ? 16.389  28.560  7.188   1.00 35.10  ? 440  PRO A O   1 
ATOM   3345 C  CB  . PRO A 1 440 ? 17.568  31.398  6.332   1.00 36.40  ? 440  PRO A CB  1 
ATOM   3346 C  CG  . PRO A 1 440 ? 18.890  30.736  6.446   1.00 30.93  ? 440  PRO A CG  1 
ATOM   3347 C  CD  . PRO A 1 440 ? 19.165  30.803  7.922   1.00 38.60  ? 440  PRO A CD  1 
ATOM   3348 N  N   . LEU A 1 441 ? 14.730  29.996  6.655   1.00 38.87  ? 441  LEU A N   1 
ATOM   3349 C  CA  . LEU A 1 441 ? 13.796  28.981  6.195   1.00 39.51  ? 441  LEU A CA  1 
ATOM   3350 C  C   . LEU A 1 441 ? 14.354  28.085  5.100   1.00 41.36  ? 441  LEU A C   1 
ATOM   3351 O  O   . LEU A 1 441 ? 14.013  26.907  5.050   1.00 43.81  ? 441  LEU A O   1 
ATOM   3352 C  CB  . LEU A 1 441 ? 12.508  29.641  5.708   1.00 45.81  ? 441  LEU A CB  1 
ATOM   3353 C  CG  . LEU A 1 441 ? 11.803  30.473  6.777   1.00 52.45  ? 441  LEU A CG  1 
ATOM   3354 C  CD1 . LEU A 1 441 ? 10.788  31.419  6.155   1.00 49.45  ? 441  LEU A CD1 1 
ATOM   3355 C  CD2 . LEU A 1 441 ? 11.152  29.568  7.814   1.00 44.53  ? 441  LEU A CD2 1 
ATOM   3356 N  N   . TRP A 1 442 ? 15.196  28.625  4.220   1.00 34.26  ? 442  TRP A N   1 
ATOM   3357 C  CA  . TRP A 1 442 ? 15.680  27.824  3.092   1.00 36.37  ? 442  TRP A CA  1 
ATOM   3358 C  C   . TRP A 1 442 ? 16.443  26.577  3.551   1.00 36.33  ? 442  TRP A C   1 
ATOM   3359 O  O   . TRP A 1 442 ? 16.535  25.598  2.816   1.00 38.15  ? 442  TRP A O   1 
ATOM   3360 C  CB  . TRP A 1 442 ? 16.481  28.655  2.063   1.00 30.10  ? 442  TRP A CB  1 
ATOM   3361 C  CG  . TRP A 1 442 ? 17.912  28.991  2.437   1.00 33.96  ? 442  TRP A CG  1 
ATOM   3362 C  CD1 . TRP A 1 442 ? 18.382  30.195  2.882   1.00 37.74  ? 442  TRP A CD1 1 
ATOM   3363 C  CD2 . TRP A 1 442 ? 19.053  28.120  2.370   1.00 31.65  ? 442  TRP A CD2 1 
ATOM   3364 N  NE1 . TRP A 1 442 ? 19.738  30.124  3.111   1.00 33.07  ? 442  TRP A NE1 1 
ATOM   3365 C  CE2 . TRP A 1 442 ? 20.174  28.862  2.805   1.00 33.31  ? 442  TRP A CE2 1 
ATOM   3366 C  CE3 . TRP A 1 442 ? 19.234  26.782  1.998   1.00 29.74  ? 442  TRP A CE3 1 
ATOM   3367 C  CZ2 . TRP A 1 442 ? 21.455  28.310  2.879   1.00 30.59  ? 442  TRP A CZ2 1 
ATOM   3368 C  CZ3 . TRP A 1 442 ? 20.510  26.238  2.064   1.00 31.61  ? 442  TRP A CZ3 1 
ATOM   3369 C  CH2 . TRP A 1 442 ? 21.602  27.002  2.502   1.00 34.57  ? 442  TRP A CH2 1 
ATOM   3370 N  N   . MET A 1 443 ? 16.962  26.606  4.776   1.00 27.54  ? 443  MET A N   1 
ATOM   3371 C  CA  . MET A 1 443 ? 17.721  25.478  5.304   1.00 30.78  ? 443  MET A CA  1 
ATOM   3372 C  C   . MET A 1 443 ? 16.834  24.382  5.885   1.00 37.29  ? 443  MET A C   1 
ATOM   3373 O  O   . MET A 1 443 ? 17.323  23.321  6.281   1.00 33.39  ? 443  MET A O   1 
ATOM   3374 C  CB  . MET A 1 443 ? 18.750  25.946  6.331   1.00 29.74  ? 443  MET A CB  1 
ATOM   3375 C  CG  . MET A 1 443 ? 20.038  26.425  5.691   1.00 37.25  ? 443  MET A CG  1 
ATOM   3376 S  SD  . MET A 1 443 ? 21.318  26.813  6.890   1.00 42.70  ? 443  MET A SD  1 
ATOM   3377 C  CE  . MET A 1 443 ? 20.918  28.505  7.167   1.00 32.41  ? 443  MET A CE  1 
ATOM   3378 N  N   . GLY A 1 444 ? 15.531  24.644  5.926   1.00 33.58  ? 444  GLY A N   1 
ATOM   3379 C  CA  . GLY A 1 444 ? 14.562  23.667  6.390   1.00 27.75  ? 444  GLY A CA  1 
ATOM   3380 C  C   . GLY A 1 444 ? 14.837  23.152  7.787   1.00 31.42  ? 444  GLY A C   1 
ATOM   3381 O  O   . GLY A 1 444 ? 14.992  23.934  8.722   1.00 31.85  ? 444  GLY A O   1 
ATOM   3382 N  N   . VAL A 1 445 ? 14.883  21.830  7.925   1.00 28.55  ? 445  VAL A N   1 
ATOM   3383 C  CA  . VAL A 1 445 ? 15.203  21.190  9.197   1.00 30.42  ? 445  VAL A CA  1 
ATOM   3384 C  C   . VAL A 1 445 ? 16.619  20.650  9.114   1.00 36.64  ? 445  VAL A C   1 
ATOM   3385 O  O   . VAL A 1 445 ? 16.836  19.538  8.620   1.00 35.63  ? 445  VAL A O   1 
ATOM   3386 C  CB  . VAL A 1 445 ? 14.244  20.023  9.521   1.00 36.65  ? 445  VAL A CB  1 
ATOM   3387 C  CG1 . VAL A 1 445 ? 14.576  19.429  10.885  1.00 28.73  ? 445  VAL A CG1 1 
ATOM   3388 C  CG2 . VAL A 1 445 ? 12.786  20.484  9.464   1.00 34.96  ? 445  VAL A CG2 1 
ATOM   3389 N  N   . PRO A 1 446 ? 17.591  21.441  9.590   1.00 32.02  ? 446  PRO A N   1 
ATOM   3390 C  CA  . PRO A 1 446 ? 19.014  21.163  9.385   1.00 29.69  ? 446  PRO A CA  1 
ATOM   3391 C  C   . PRO A 1 446 ? 19.584  20.076  10.295  1.00 33.44  ? 446  PRO A C   1 
ATOM   3392 O  O   . PRO A 1 446 ? 19.060  19.789  11.369  1.00 27.47  ? 446  PRO A O   1 
ATOM   3393 C  CB  . PRO A 1 446 ? 19.685  22.508  9.700   1.00 26.35  ? 446  PRO A CB  1 
ATOM   3394 C  CG  . PRO A 1 446 ? 18.567  23.512  9.802   1.00 27.10  ? 446  PRO A CG  1 
ATOM   3395 C  CD  . PRO A 1 446 ? 17.379  22.741  10.243  1.00 29.39  ? 446  PRO A CD  1 
ATOM   3396 N  N   . HIS A 1 447 ? 20.672  19.483  9.822   1.00 31.85  ? 447  HIS A N   1 
ATOM   3397 C  CA  . HIS A 1 447 ? 21.487  18.539  10.569  1.00 28.84  ? 447  HIS A CA  1 
ATOM   3398 C  C   . HIS A 1 447 ? 21.650  18.987  12.020  1.00 28.38  ? 447  HIS A C   1 
ATOM   3399 O  O   . HIS A 1 447 ? 22.102  20.099  12.290  1.00 27.01  ? 447  HIS A O   1 
ATOM   3400 C  CB  . HIS A 1 447 ? 22.851  18.452  9.877   1.00 27.15  ? 447  HIS A CB  1 
ATOM   3401 C  CG  . HIS A 1 447 ? 23.710  17.310  10.324  1.00 37.83  ? 447  HIS A CG  1 
ATOM   3402 N  ND1 . HIS A 1 447 ? 23.398  15.993  10.062  1.00 37.31  ? 447  HIS A ND1 1 
ATOM   3403 C  CD2 . HIS A 1 447 ? 24.903  17.294  10.963  1.00 29.80  ? 447  HIS A CD2 1 
ATOM   3404 C  CE1 . HIS A 1 447 ? 24.350  15.214  10.544  1.00 33.46  ? 447  HIS A CE1 1 
ATOM   3405 N  NE2 . HIS A 1 447 ? 25.278  15.979  11.093  1.00 29.92  ? 447  HIS A NE2 1 
ATOM   3406 N  N   . GLY A 1 448 ? 21.258  18.124  12.950  1.00 29.03  ? 448  GLY A N   1 
ATOM   3407 C  CA  . GLY A 1 448 ? 21.470  18.376  14.363  1.00 29.59  ? 448  GLY A CA  1 
ATOM   3408 C  C   . GLY A 1 448 ? 20.281  18.948  15.113  1.00 25.93  ? 448  GLY A C   1 
ATOM   3409 O  O   . GLY A 1 448 ? 20.299  19.014  16.337  1.00 24.99  ? 448  GLY A O   1 
ATOM   3410 N  N   . TYR A 1 449 ? 19.234  19.343  14.399  1.00 26.88  ? 449  TYR A N   1 
ATOM   3411 C  CA  . TYR A 1 449 ? 18.139  20.063  15.055  1.00 31.35  ? 449  TYR A CA  1 
ATOM   3412 C  C   . TYR A 1 449 ? 16.930  19.243  15.486  1.00 30.76  ? 449  TYR A C   1 
ATOM   3413 O  O   . TYR A 1 449 ? 15.864  19.798  15.753  1.00 31.96  ? 449  TYR A O   1 
ATOM   3414 C  CB  . TYR A 1 449 ? 17.747  21.315  14.265  1.00 23.14  ? 449  TYR A CB  1 
ATOM   3415 C  CG  . TYR A 1 449 ? 18.842  22.336  14.373  1.00 30.48  ? 449  TYR A CG  1 
ATOM   3416 C  CD1 . TYR A 1 449 ? 19.867  22.382  13.438  1.00 29.36  ? 449  TYR A CD1 1 
ATOM   3417 C  CD2 . TYR A 1 449 ? 18.895  23.210  15.453  1.00 32.48  ? 449  TYR A CD2 1 
ATOM   3418 C  CE1 . TYR A 1 449 ? 20.893  23.295  13.556  1.00 35.01  ? 449  TYR A CE1 1 
ATOM   3419 C  CE2 . TYR A 1 449 ? 19.916  24.130  15.576  1.00 34.60  ? 449  TYR A CE2 1 
ATOM   3420 C  CZ  . TYR A 1 449 ? 20.912  24.167  14.625  1.00 32.50  ? 449  TYR A CZ  1 
ATOM   3421 O  OH  . TYR A 1 449 ? 21.938  25.071  14.736  1.00 39.18  ? 449  TYR A OH  1 
ATOM   3422 N  N   . GLU A 1 450 ? 17.111  17.929  15.582  1.00 28.25  ? 450  GLU A N   1 
ATOM   3423 C  CA  . GLU A 1 450 ? 16.128  17.075  16.238  1.00 29.43  ? 450  GLU A CA  1 
ATOM   3424 C  C   . GLU A 1 450 ? 16.547  16.847  17.687  1.00 31.31  ? 450  GLU A C   1 
ATOM   3425 O  O   . GLU A 1 450 ? 15.722  16.527  18.545  1.00 31.08  ? 450  GLU A O   1 
ATOM   3426 C  CB  . GLU A 1 450 ? 15.999  15.731  15.517  1.00 29.55  ? 450  GLU A CB  1 
ATOM   3427 C  CG  . GLU A 1 450 ? 17.011  14.670  15.956  1.00 26.81  ? 450  GLU A CG  1 
ATOM   3428 C  CD  . GLU A 1 450 ? 18.390  14.856  15.338  1.00 32.83  ? 450  GLU A CD  1 
ATOM   3429 O  OE1 . GLU A 1 450 ? 18.736  15.992  14.945  1.00 29.94  ? 450  GLU A OE1 1 
ATOM   3430 O  OE2 . GLU A 1 450 ? 19.131  13.857  15.242  1.00 33.29  ? 450  GLU A OE2 1 
ATOM   3431 N  N   . ILE A 1 451 ? 17.835  17.028  17.957  1.00 30.24  ? 451  ILE A N   1 
ATOM   3432 C  CA  . ILE A 1 451 ? 18.394  16.693  19.265  1.00 33.98  ? 451  ILE A CA  1 
ATOM   3433 C  C   . ILE A 1 451 ? 17.670  17.364  20.433  1.00 28.47  ? 451  ILE A C   1 
ATOM   3434 O  O   . ILE A 1 451 ? 17.336  16.708  21.422  1.00 27.88  ? 451  ILE A O   1 
ATOM   3435 C  CB  . ILE A 1 451 ? 19.904  17.011  19.342  1.00 27.48  ? 451  ILE A CB  1 
ATOM   3436 C  CG1 . ILE A 1 451 ? 20.671  16.243  18.262  1.00 23.78  ? 451  ILE A CG1 1 
ATOM   3437 C  CG2 . ILE A 1 451 ? 20.442  16.661  20.713  1.00 21.09  ? 451  ILE A CG2 1 
ATOM   3438 C  CD1 . ILE A 1 451 ? 22.150  16.580  18.208  1.00 30.52  ? 451  ILE A CD1 1 
ATOM   3439 N  N   . GLU A 1 452 ? 17.432  18.667  20.317  1.00 27.21  ? 452  GLU A N   1 
ATOM   3440 C  CA  . GLU A 1 452 ? 16.807  19.431  21.393  1.00 29.02  ? 452  GLU A CA  1 
ATOM   3441 C  C   . GLU A 1 452 ? 15.439  18.863  21.769  1.00 31.46  ? 452  GLU A C   1 
ATOM   3442 O  O   . GLU A 1 452 ? 14.999  18.988  22.914  1.00 32.63  ? 452  GLU A O   1 
ATOM   3443 C  CB  . GLU A 1 452 ? 16.706  20.918  21.022  1.00 24.42  ? 452  GLU A CB  1 
ATOM   3444 C  CG  . GLU A 1 452 ? 16.038  21.183  19.678  1.00 32.32  ? 452  GLU A CG  1 
ATOM   3445 C  CD  . GLU A 1 452 ? 16.359  22.558  19.120  1.00 36.57  ? 452  GLU A CD  1 
ATOM   3446 O  OE1 . GLU A 1 452 ? 15.505  23.461  19.232  1.00 37.99  ? 452  GLU A OE1 1 
ATOM   3447 O  OE2 . GLU A 1 452 ? 17.466  22.739  18.570  1.00 36.65  ? 452  GLU A OE2 1 
ATOM   3448 N  N   . PHE A 1 453 ? 14.780  18.228  20.805  1.00 26.90  ? 453  PHE A N   1 
ATOM   3449 C  CA  . PHE A 1 453 ? 13.486  17.600  21.048  1.00 30.00  ? 453  PHE A CA  1 
ATOM   3450 C  C   . PHE A 1 453 ? 13.604  16.232  21.725  1.00 32.23  ? 453  PHE A C   1 
ATOM   3451 O  O   . PHE A 1 453 ? 12.861  15.938  22.661  1.00 37.35  ? 453  PHE A O   1 
ATOM   3452 C  CB  . PHE A 1 453 ? 12.682  17.509  19.751  1.00 28.42  ? 453  PHE A CB  1 
ATOM   3453 C  CG  . PHE A 1 453 ? 12.236  18.848  19.229  1.00 38.76  ? 453  PHE A CG  1 
ATOM   3454 C  CD1 . PHE A 1 453 ? 11.048  19.415  19.663  1.00 33.16  ? 453  PHE A CD1 1 
ATOM   3455 C  CD2 . PHE A 1 453 ? 13.015  19.548  18.322  1.00 29.68  ? 453  PHE A CD2 1 
ATOM   3456 C  CE1 . PHE A 1 453 ? 10.642  20.650  19.197  1.00 26.48  ? 453  PHE A CE1 1 
ATOM   3457 C  CE2 . PHE A 1 453 ? 12.614  20.782  17.851  1.00 36.34  ? 453  PHE A CE2 1 
ATOM   3458 C  CZ  . PHE A 1 453 ? 11.424  21.334  18.289  1.00 39.89  ? 453  PHE A CZ  1 
ATOM   3459 N  N   . ILE A 1 454 ? 14.531  15.404  21.252  1.00 23.12  ? 454  ILE A N   1 
ATOM   3460 C  CA  . ILE A 1 454 ? 14.799  14.113  21.877  1.00 20.41  ? 454  ILE A CA  1 
ATOM   3461 C  C   . ILE A 1 454 ? 15.142  14.282  23.360  1.00 31.56  ? 454  ILE A C   1 
ATOM   3462 O  O   . ILE A 1 454 ? 14.766  13.457  24.191  1.00 37.10  ? 454  ILE A O   1 
ATOM   3463 C  CB  . ILE A 1 454 ? 15.969  13.377  21.185  1.00 35.04  ? 454  ILE A CB  1 
ATOM   3464 C  CG1 . ILE A 1 454 ? 15.696  13.192  19.686  1.00 32.19  ? 454  ILE A CG1 1 
ATOM   3465 C  CG2 . ILE A 1 454 ? 16.235  12.034  21.856  1.00 22.75  ? 454  ILE A CG2 1 
ATOM   3466 C  CD1 . ILE A 1 454 ? 14.456  12.383  19.391  1.00 41.76  ? 454  ILE A CD1 1 
ATOM   3467 N  N   . PHE A 1 455 ? 15.855  15.353  23.688  1.00 30.32  ? 455  PHE A N   1 
ATOM   3468 C  CA  . PHE A 1 455 ? 16.289  15.582  25.063  1.00 34.24  ? 455  PHE A CA  1 
ATOM   3469 C  C   . PHE A 1 455 ? 15.229  16.312  25.881  1.00 36.23  ? 455  PHE A C   1 
ATOM   3470 O  O   . PHE A 1 455 ? 15.370  16.468  27.093  1.00 35.26  ? 455  PHE A O   1 
ATOM   3471 C  CB  . PHE A 1 455 ? 17.621  16.343  25.104  1.00 24.67  ? 455  PHE A CB  1 
ATOM   3472 C  CG  . PHE A 1 455 ? 18.836  15.451  25.029  1.00 31.51  ? 455  PHE A CG  1 
ATOM   3473 C  CD1 . PHE A 1 455 ? 19.345  15.049  23.806  1.00 24.59  ? 455  PHE A CD1 1 
ATOM   3474 C  CD2 . PHE A 1 455 ? 19.470  15.021  26.186  1.00 31.30  ? 455  PHE A CD2 1 
ATOM   3475 C  CE1 . PHE A 1 455 ? 20.459  14.232  23.738  1.00 30.94  ? 455  PHE A CE1 1 
ATOM   3476 C  CE2 . PHE A 1 455 ? 20.586  14.203  26.125  1.00 27.05  ? 455  PHE A CE2 1 
ATOM   3477 C  CZ  . PHE A 1 455 ? 21.079  13.805  24.896  1.00 33.23  ? 455  PHE A CZ  1 
ATOM   3478 N  N   . GLY A 1 456 ? 14.173  16.761  25.210  1.00 29.50  ? 456  GLY A N   1 
ATOM   3479 C  CA  . GLY A 1 456 ? 13.058  17.404  25.877  1.00 27.59  ? 456  GLY A CA  1 
ATOM   3480 C  C   . GLY A 1 456 ? 13.282  18.836  26.333  1.00 40.04  ? 456  GLY A C   1 
ATOM   3481 O  O   . GLY A 1 456 ? 12.601  19.310  27.241  1.00 36.05  ? 456  GLY A O   1 
ATOM   3482 N  N   . LEU A 1 457 ? 14.226  19.536  25.712  1.00 32.08  ? 457  LEU A N   1 
ATOM   3483 C  CA  . LEU A 1 457 ? 14.429  20.949  26.029  1.00 34.37  ? 457  LEU A CA  1 
ATOM   3484 C  C   . LEU A 1 457 ? 13.141  21.781  25.961  1.00 39.98  ? 457  LEU A C   1 
ATOM   3485 O  O   . LEU A 1 457 ? 12.958  22.697  26.760  1.00 39.71  ? 457  LEU A O   1 
ATOM   3486 C  CB  . LEU A 1 457 ? 15.514  21.574  25.144  1.00 33.79  ? 457  LEU A CB  1 
ATOM   3487 C  CG  . LEU A 1 457 ? 16.938  21.525  25.713  1.00 33.89  ? 457  LEU A CG  1 
ATOM   3488 C  CD1 . LEU A 1 457 ? 17.432  20.081  25.849  1.00 26.68  ? 457  LEU A CD1 1 
ATOM   3489 C  CD2 . LEU A 1 457 ? 17.897  22.347  24.867  1.00 31.13  ? 457  LEU A CD2 1 
ATOM   3490 N  N   . PRO A 1 458 ? 12.245  21.478  25.004  1.00 38.07  ? 458  PRO A N   1 
ATOM   3491 C  CA  . PRO A 1 458 ? 11.023  22.288  24.950  1.00 40.18  ? 458  PRO A CA  1 
ATOM   3492 C  C   . PRO A 1 458 ? 10.222  22.271  26.255  1.00 45.53  ? 458  PRO A C   1 
ATOM   3493 O  O   . PRO A 1 458 ? 9.382   23.148  26.441  1.00 42.88  ? 458  PRO A O   1 
ATOM   3494 C  CB  . PRO A 1 458 ? 10.227  21.647  23.808  1.00 35.87  ? 458  PRO A CB  1 
ATOM   3495 C  CG  . PRO A 1 458 ? 11.272  21.058  22.924  1.00 42.51  ? 458  PRO A CG  1 
ATOM   3496 C  CD  . PRO A 1 458 ? 12.335  20.549  23.862  1.00 33.32  ? 458  PRO A CD  1 
ATOM   3497 N  N   . LEU A 1 459 ? 10.480  21.309  27.140  1.00 40.89  ? 459  LEU A N   1 
ATOM   3498 C  CA  . LEU A 1 459 ? 9.810   21.271  28.443  1.00 39.52  ? 459  LEU A CA  1 
ATOM   3499 C  C   . LEU A 1 459 ? 10.228  22.424  29.350  1.00 43.95  ? 459  LEU A C   1 
ATOM   3500 O  O   . LEU A 1 459 ? 9.508   22.778  30.282  1.00 54.19  ? 459  LEU A O   1 
ATOM   3501 C  CB  . LEU A 1 459 ? 10.073  19.953  29.168  1.00 32.47  ? 459  LEU A CB  1 
ATOM   3502 C  CG  . LEU A 1 459 ? 9.178   18.760  28.856  1.00 36.02  ? 459  LEU A CG  1 
ATOM   3503 C  CD1 . LEU A 1 459 ? 8.924   18.633  27.365  1.00 40.77  ? 459  LEU A CD1 1 
ATOM   3504 C  CD2 . LEU A 1 459 ? 9.813   17.497  29.408  1.00 38.53  ? 459  LEU A CD2 1 
ATOM   3505 N  N   . ASP A 1 460 ? 11.398  22.997  29.089  1.00 37.76  ? 460  ASP A N   1 
ATOM   3506 C  CA  . ASP A 1 460 ? 11.863  24.128  29.877  1.00 44.98  ? 460  ASP A CA  1 
ATOM   3507 C  C   . ASP A 1 460 ? 11.074  25.366  29.477  1.00 46.75  ? 460  ASP A C   1 
ATOM   3508 O  O   . ASP A 1 460 ? 11.259  25.904  28.385  1.00 44.93  ? 460  ASP A O   1 
ATOM   3509 C  CB  . ASP A 1 460 ? 13.367  24.356  29.695  1.00 43.82  ? 460  ASP A CB  1 
ATOM   3510 C  CG  . ASP A 1 460 ? 13.921  25.384  30.664  1.00 45.11  ? 460  ASP A CG  1 
ATOM   3511 O  OD1 . ASP A 1 460 ? 13.265  26.428  30.867  1.00 56.69  ? 460  ASP A OD1 1 
ATOM   3512 O  OD2 . ASP A 1 460 ? 15.010  25.149  31.227  1.00 68.03  ? 460  ASP A OD2 1 
ATOM   3513 N  N   . PRO A 1 461 ? 10.189  25.822  30.370  1.00 48.28  ? 461  PRO A N   1 
ATOM   3514 C  CA  . PRO A 1 461 ? 9.247   26.904  30.072  1.00 55.36  ? 461  PRO A CA  1 
ATOM   3515 C  C   . PRO A 1 461 ? 9.968   28.129  29.526  1.00 57.58  ? 461  PRO A C   1 
ATOM   3516 O  O   . PRO A 1 461 ? 9.470   28.787  28.611  1.00 58.58  ? 461  PRO A O   1 
ATOM   3517 C  CB  . PRO A 1 461 ? 8.637   27.223  31.439  1.00 58.85  ? 461  PRO A CB  1 
ATOM   3518 C  CG  . PRO A 1 461 ? 8.871   26.004  32.267  1.00 61.38  ? 461  PRO A CG  1 
ATOM   3519 C  CD  . PRO A 1 461 ? 10.168  25.442  31.792  1.00 57.83  ? 461  PRO A CD  1 
ATOM   3520 N  N   . SER A 1 462 ? 11.142  28.420  30.077  1.00 37.00  ? 462  SER A N   1 
ATOM   3521 C  CA  . SER A 1 462 ? 11.891  29.611  29.690  1.00 53.47  ? 462  SER A CA  1 
ATOM   3522 C  C   . SER A 1 462 ? 12.542  29.523  28.305  1.00 56.07  ? 462  SER A C   1 
ATOM   3523 O  O   . SER A 1 462 ? 13.327  30.394  27.937  1.00 58.64  ? 462  SER A O   1 
ATOM   3524 C  CB  . SER A 1 462 ? 12.965  29.920  30.734  1.00 51.35  ? 462  SER A CB  1 
ATOM   3525 O  OG  . SER A 1 462 ? 14.064  29.040  30.604  1.00 45.29  ? 462  SER A OG  1 
ATOM   3526 N  N   . LEU A 1 463 ? 12.224  28.487  27.535  1.00 49.56  ? 463  LEU A N   1 
ATOM   3527 C  CA  . LEU A 1 463 ? 12.858  28.323  26.229  1.00 46.86  ? 463  LEU A CA  1 
ATOM   3528 C  C   . LEU A 1 463 ? 12.009  28.805  25.057  1.00 51.01  ? 463  LEU A C   1 
ATOM   3529 O  O   . LEU A 1 463 ? 12.513  28.940  23.939  1.00 56.45  ? 463  LEU A O   1 
ATOM   3530 C  CB  . LEU A 1 463 ? 13.319  26.880  26.013  1.00 48.54  ? 463  LEU A CB  1 
ATOM   3531 C  CG  . LEU A 1 463 ? 14.535  26.505  26.860  1.00 56.40  ? 463  LEU A CG  1 
ATOM   3532 C  CD1 . LEU A 1 463 ? 15.069  25.146  26.462  1.00 35.96  ? 463  LEU A CD1 1 
ATOM   3533 C  CD2 . LEU A 1 463 ? 15.619  27.572  26.734  1.00 39.07  ? 463  LEU A CD2 1 
ATOM   3534 N  N   . ASN A 1 464 ? 10.728  29.060  25.309  1.00 52.28  ? 464  ASN A N   1 
ATOM   3535 C  CA  . ASN A 1 464 ? 9.858   29.686  24.308  1.00 56.93  ? 464  ASN A CA  1 
ATOM   3536 C  C   . ASN A 1 464 ? 9.318   28.767  23.225  1.00 47.69  ? 464  ASN A C   1 
ATOM   3537 O  O   . ASN A 1 464 ? 8.840   29.241  22.197  1.00 51.96  ? 464  ASN A O   1 
ATOM   3538 C  CB  . ASN A 1 464 ? 10.567  30.850  23.617  1.00 47.93  ? 464  ASN A CB  1 
ATOM   3539 C  CG  . ASN A 1 464 ? 10.706  32.055  24.503  1.00 64.38  ? 464  ASN A CG  1 
ATOM   3540 O  OD1 . ASN A 1 464 ? 10.149  32.109  25.603  1.00 63.16  ? 464  ASN A OD1 1 
ATOM   3541 N  ND2 . ASN A 1 464 ? 11.449  33.042  24.025  1.00 73.84  ? 464  ASN A ND2 1 
ATOM   3542 N  N   . TYR A 1 465 ? 9.402   27.462  23.430  1.00 42.24  ? 465  TYR A N   1 
ATOM   3543 C  CA  . TYR A 1 465 ? 8.795   26.551  22.480  1.00 38.15  ? 465  TYR A CA  1 
ATOM   3544 C  C   . TYR A 1 465 ? 7.275   26.663  22.565  1.00 38.40  ? 465  TYR A C   1 
ATOM   3545 O  O   . TYR A 1 465 ? 6.739   27.093  23.580  1.00 37.02  ? 465  TYR A O   1 
ATOM   3546 C  CB  . TYR A 1 465 ? 9.233   25.124  22.767  1.00 41.59  ? 465  TYR A CB  1 
ATOM   3547 C  CG  . TYR A 1 465 ? 10.681  24.862  22.454  1.00 42.86  ? 465  TYR A CG  1 
ATOM   3548 C  CD1 . TYR A 1 465 ? 11.068  24.440  21.189  1.00 38.63  ? 465  TYR A CD1 1 
ATOM   3549 C  CD2 . TYR A 1 465 ? 11.663  25.034  23.423  1.00 41.46  ? 465  TYR A CD2 1 
ATOM   3550 C  CE1 . TYR A 1 465 ? 12.390  24.196  20.894  1.00 39.07  ? 465  TYR A CE1 1 
ATOM   3551 C  CE2 . TYR A 1 465 ? 12.987  24.792  23.140  1.00 35.94  ? 465  TYR A CE2 1 
ATOM   3552 C  CZ  . TYR A 1 465 ? 13.346  24.374  21.873  1.00 41.19  ? 465  TYR A CZ  1 
ATOM   3553 O  OH  . TYR A 1 465 ? 14.663  24.123  21.586  1.00 33.12  ? 465  TYR A OH  1 
ATOM   3554 N  N   . THR A 1 466 ? 6.585   26.283  21.496  1.00 44.93  ? 466  THR A N   1 
ATOM   3555 C  CA  . THR A 1 466 ? 5.129   26.233  21.511  1.00 39.08  ? 466  THR A CA  1 
ATOM   3556 C  C   . THR A 1 466 ? 4.668   25.050  22.342  1.00 47.23  ? 466  THR A C   1 
ATOM   3557 O  O   . THR A 1 466 ? 5.435   24.121  22.596  1.00 51.02  ? 466  THR A O   1 
ATOM   3558 C  CB  . THR A 1 466 ? 4.551   26.061  20.100  1.00 39.64  ? 466  THR A CB  1 
ATOM   3559 O  OG1 . THR A 1 466 ? 4.820   24.732  19.627  1.00 38.42  ? 466  THR A OG1 1 
ATOM   3560 C  CG2 . THR A 1 466 ? 5.157   27.076  19.151  1.00 32.34  ? 466  THR A CG2 1 
ATOM   3561 N  N   . THR A 1 467 ? 3.403   25.077  22.744  1.00 50.16  ? 467  THR A N   1 
ATOM   3562 C  CA  . THR A 1 467 ? 2.836   23.987  23.522  1.00 46.80  ? 467  THR A CA  1 
ATOM   3563 C  C   . THR A 1 467 ? 2.825   22.693  22.717  1.00 44.10  ? 467  THR A C   1 
ATOM   3564 O  O   . THR A 1 467 ? 3.059   21.611  23.260  1.00 42.55  ? 467  THR A O   1 
ATOM   3565 C  CB  . THR A 1 467 ? 1.412   24.322  24.006  1.00 50.95  ? 467  THR A CB  1 
ATOM   3566 O  OG1 . THR A 1 467 ? 1.458   25.480  24.849  1.00 48.83  ? 467  THR A OG1 1 
ATOM   3567 C  CG2 . THR A 1 467 ? 0.830   23.161  24.793  1.00 50.39  ? 467  THR A CG2 1 
ATOM   3568 N  N   . GLU A 1 468 ? 2.558   22.810  21.420  1.00 41.24  ? 468  GLU A N   1 
ATOM   3569 C  CA  . GLU A 1 468 ? 2.563   21.646  20.542  1.00 48.88  ? 468  GLU A CA  1 
ATOM   3570 C  C   . GLU A 1 468 ? 3.962   21.050  20.504  1.00 47.02  ? 468  GLU A C   1 
ATOM   3571 O  O   . GLU A 1 468 ? 4.129   19.832  20.445  1.00 40.83  ? 468  GLU A O   1 
ATOM   3572 C  CB  . GLU A 1 468 ? 2.117   22.019  19.126  1.00 50.17  ? 468  GLU A CB  1 
ATOM   3573 C  CG  . GLU A 1 468 ? 0.816   22.803  19.057  1.00 54.99  ? 468  GLU A CG  1 
ATOM   3574 C  CD  . GLU A 1 468 ? 1.009   24.289  19.316  1.00 75.80  ? 468  GLU A CD  1 
ATOM   3575 O  OE1 . GLU A 1 468 ? 1.113   24.689  20.498  1.00 59.66  ? 468  GLU A OE1 1 
ATOM   3576 O  OE2 . GLU A 1 468 ? 1.045   25.061  18.332  1.00 86.18  ? 468  GLU A OE2 1 
ATOM   3577 N  N   . GLU A 1 469 ? 4.968   21.918  20.543  1.00 37.13  ? 469  GLU A N   1 
ATOM   3578 C  CA  . GLU A 1 469 ? 6.349   21.465  20.581  1.00 41.12  ? 469  GLU A CA  1 
ATOM   3579 C  C   . GLU A 1 469 ? 6.656   20.744  21.891  1.00 44.80  ? 469  GLU A C   1 
ATOM   3580 O  O   . GLU A 1 469 ? 7.349   19.726  21.898  1.00 43.05  ? 469  GLU A O   1 
ATOM   3581 C  CB  . GLU A 1 469 ? 7.312   22.629  20.345  1.00 44.86  ? 469  GLU A CB  1 
ATOM   3582 C  CG  . GLU A 1 469 ? 7.481   22.968  18.868  1.00 47.03  ? 469  GLU A CG  1 
ATOM   3583 C  CD  . GLU A 1 469 ? 8.296   24.221  18.640  1.00 41.96  ? 469  GLU A CD  1 
ATOM   3584 O  OE1 . GLU A 1 469 ? 8.183   25.162  19.454  1.00 37.31  ? 469  GLU A OE1 1 
ATOM   3585 O  OE2 . GLU A 1 469 ? 9.047   24.263  17.644  1.00 39.41  ? 469  GLU A OE2 1 
ATOM   3586 N  N   . ARG A 1 470 ? 6.131   21.265  22.996  1.00 41.10  ? 470  ARG A N   1 
ATOM   3587 C  CA  . ARG A 1 470 ? 6.287   20.600  24.284  1.00 38.10  ? 470  ARG A CA  1 
ATOM   3588 C  C   . ARG A 1 470 ? 5.724   19.182  24.214  1.00 48.23  ? 470  ARG A C   1 
ATOM   3589 O  O   . ARG A 1 470 ? 6.396   18.213  24.575  1.00 42.63  ? 470  ARG A O   1 
ATOM   3590 C  CB  . ARG A 1 470 ? 5.597   21.396  25.392  1.00 43.07  ? 470  ARG A CB  1 
ATOM   3591 C  CG  . ARG A 1 470 ? 5.692   20.744  26.763  1.00 57.85  ? 470  ARG A CG  1 
ATOM   3592 C  CD  . ARG A 1 470 ? 4.895   21.510  27.821  1.00 66.43  ? 470  ARG A CD  1 
ATOM   3593 N  NE  . ARG A 1 470 ? 3.471   21.590  27.500  1.00 80.42  ? 470  ARG A NE  1 
ATOM   3594 C  CZ  . ARG A 1 470 ? 2.610   20.586  27.649  1.00 81.38  ? 470  ARG A CZ  1 
ATOM   3595 N  NH1 . ARG A 1 470 ? 3.027   19.413  28.110  1.00 72.01  ? 470  ARG A NH1 1 
ATOM   3596 N  NH2 . ARG A 1 470 ? 1.332   20.753  27.331  1.00 78.65  ? 470  ARG A NH2 1 
ATOM   3597 N  N   . ILE A 1 471 ? 4.490   19.072  23.729  1.00 44.16  ? 471  ILE A N   1 
ATOM   3598 C  CA  . ILE A 1 471 ? 3.811   17.789  23.600  1.00 35.00  ? 471  ILE A CA  1 
ATOM   3599 C  C   . ILE A 1 471 ? 4.556   16.853  22.653  1.00 40.12  ? 471  ILE A C   1 
ATOM   3600 O  O   . ILE A 1 471 ? 4.657   15.646  22.901  1.00 44.18  ? 471  ILE A O   1 
ATOM   3601 C  CB  . ILE A 1 471 ? 2.354   17.990  23.120  1.00 51.80  ? 471  ILE A CB  1 
ATOM   3602 C  CG1 . ILE A 1 471 ? 1.513   18.599  24.246  1.00 47.44  ? 471  ILE A CG1 1 
ATOM   3603 C  CG2 . ILE A 1 471 ? 1.742   16.673  22.653  1.00 34.90  ? 471  ILE A CG2 1 
ATOM   3604 C  CD1 . ILE A 1 471 ? 0.331   19.409  23.762  1.00 53.00  ? 471  ILE A CD1 1 
ATOM   3605 N  N   . PHE A 1 472 ? 5.075   17.424  21.572  1.00 39.45  ? 472  PHE A N   1 
ATOM   3606 C  CA  . PHE A 1 472 ? 5.866   16.690  20.584  1.00 40.28  ? 472  PHE A CA  1 
ATOM   3607 C  C   . PHE A 1 472 ? 7.129   16.095  21.210  1.00 33.61  ? 472  PHE A C   1 
ATOM   3608 O  O   . PHE A 1 472 ? 7.458   14.932  20.985  1.00 38.86  ? 472  PHE A O   1 
ATOM   3609 C  CB  . PHE A 1 472 ? 6.226   17.632  19.427  1.00 35.26  ? 472  PHE A CB  1 
ATOM   3610 C  CG  . PHE A 1 472 ? 7.051   16.996  18.348  1.00 33.91  ? 472  PHE A CG  1 
ATOM   3611 C  CD1 . PHE A 1 472 ? 6.702   15.764  17.821  1.00 36.31  ? 472  PHE A CD1 1 
ATOM   3612 C  CD2 . PHE A 1 472 ? 8.168   17.649  17.841  1.00 39.87  ? 472  PHE A CD2 1 
ATOM   3613 C  CE1 . PHE A 1 472 ? 7.462   15.182  16.817  1.00 36.56  ? 472  PHE A CE1 1 
ATOM   3614 C  CE2 . PHE A 1 472 ? 8.931   17.078  16.837  1.00 36.01  ? 472  PHE A CE2 1 
ATOM   3615 C  CZ  . PHE A 1 472 ? 8.577   15.842  16.323  1.00 42.81  ? 472  PHE A CZ  1 
ATOM   3616 N  N   . ALA A 1 473 ? 7.828   16.900  22.004  1.00 31.63  ? 473  ALA A N   1 
ATOM   3617 C  CA  . ALA A 1 473 ? 9.034   16.447  22.684  1.00 34.78  ? 473  ALA A CA  1 
ATOM   3618 C  C   . ALA A 1 473 ? 8.717   15.271  23.599  1.00 38.92  ? 473  ALA A C   1 
ATOM   3619 O  O   . ALA A 1 473 ? 9.453   14.283  23.638  1.00 38.51  ? 473  ALA A O   1 
ATOM   3620 C  CB  . ALA A 1 473 ? 9.666   17.586  23.467  1.00 28.49  ? 473  ALA A CB  1 
ATOM   3621 N  N   . GLN A 1 474 ? 7.607   15.379  24.325  1.00 40.03  ? 474  GLN A N   1 
ATOM   3622 C  CA  . GLN A 1 474 ? 7.159   14.301  25.200  1.00 34.81  ? 474  GLN A CA  1 
ATOM   3623 C  C   . GLN A 1 474 ? 6.953   13.003  24.429  1.00 37.07  ? 474  GLN A C   1 
ATOM   3624 O  O   . GLN A 1 474 ? 7.356   11.932  24.884  1.00 39.07  ? 474  GLN A O   1 
ATOM   3625 C  CB  . GLN A 1 474 ? 5.884   14.704  25.942  1.00 39.80  ? 474  GLN A CB  1 
ATOM   3626 C  CG  . GLN A 1 474 ? 6.136   15.723  27.041  1.00 51.74  ? 474  GLN A CG  1 
ATOM   3627 C  CD  . GLN A 1 474 ? 4.870   16.383  27.545  1.00 57.79  ? 474  GLN A CD  1 
ATOM   3628 O  OE1 . GLN A 1 474 ? 3.841   16.385  26.868  1.00 61.95  ? 474  GLN A OE1 1 
ATOM   3629 N  NE2 . GLN A 1 474 ? 4.942   16.959  28.739  1.00 62.99  ? 474  GLN A NE2 1 
ATOM   3630 N  N   . ARG A 1 475 ? 6.333   13.096  23.255  1.00 37.84  ? 475  ARG A N   1 
ATOM   3631 C  CA  . ARG A 1 475 ? 6.171   11.918  22.413  1.00 41.94  ? 475  ARG A CA  1 
ATOM   3632 C  C   . ARG A 1 475 ? 7.532   11.313  22.060  1.00 43.45  ? 475  ARG A C   1 
ATOM   3633 O  O   . ARG A 1 475 ? 7.739   10.100  22.193  1.00 32.61  ? 475  ARG A O   1 
ATOM   3634 C  CB  . ARG A 1 475 ? 5.411   12.258  21.134  1.00 39.52  ? 475  ARG A CB  1 
ATOM   3635 C  CG  . ARG A 1 475 ? 3.929   12.511  21.320  1.00 58.54  ? 475  ARG A CG  1 
ATOM   3636 C  CD  . ARG A 1 475 ? 3.280   12.801  19.975  1.00 51.85  ? 475  ARG A CD  1 
ATOM   3637 N  NE  . ARG A 1 475 ? 3.711   11.837  18.967  1.00 43.15  ? 475  ARG A NE  1 
ATOM   3638 C  CZ  . ARG A 1 475 ? 3.988   12.156  17.705  1.00 40.34  ? 475  ARG A CZ  1 
ATOM   3639 N  NH1 . ARG A 1 475 ? 3.886   13.414  17.297  1.00 34.45  ? 475  ARG A NH1 1 
ATOM   3640 N  NH2 . ARG A 1 475 ? 4.382   11.220  16.854  1.00 40.20  ? 475  ARG A NH2 1 
ATOM   3641 N  N   . LEU A 1 476 ? 8.457   12.162  21.614  1.00 39.33  ? 476  LEU A N   1 
ATOM   3642 C  CA  . LEU A 1 476 ? 9.786   11.702  21.204  1.00 30.94  ? 476  LEU A CA  1 
ATOM   3643 C  C   . LEU A 1 476 ? 10.546  11.046  22.352  1.00 26.61  ? 476  LEU A C   1 
ATOM   3644 O  O   . LEU A 1 476 ? 11.185  10.013  22.167  1.00 37.92  ? 476  LEU A O   1 
ATOM   3645 C  CB  . LEU A 1 476 ? 10.599  12.851  20.607  1.00 35.03  ? 476  LEU A CB  1 
ATOM   3646 C  CG  . LEU A 1 476 ? 10.026  13.439  19.318  1.00 31.85  ? 476  LEU A CG  1 
ATOM   3647 C  CD1 . LEU A 1 476 ? 10.854  14.606  18.839  1.00 35.93  ? 476  LEU A CD1 1 
ATOM   3648 C  CD2 . LEU A 1 476 ? 9.951   12.367  18.258  1.00 32.54  ? 476  LEU A CD2 1 
ATOM   3649 N  N   . MET A 1 477 ? 10.476  11.645  23.536  1.00 27.27  ? 477  MET A N   1 
ATOM   3650 C  CA  . MET A 1 477 ? 11.137  11.072  24.702  1.00 36.31  ? 477  MET A CA  1 
ATOM   3651 C  C   . MET A 1 477 ? 10.547  9.707   25.000  1.00 32.47  ? 477  MET A C   1 
ATOM   3652 O  O   . MET A 1 477 ? 11.247  8.801   25.442  1.00 38.29  ? 477  MET A O   1 
ATOM   3653 C  CB  . MET A 1 477 ? 11.002  11.986  25.920  1.00 35.89  ? 477  MET A CB  1 
ATOM   3654 C  CG  . MET A 1 477 ? 11.740  13.299  25.777  1.00 35.02  ? 477  MET A CG  1 
ATOM   3655 S  SD  . MET A 1 477 ? 11.225  14.519  26.993  1.00 45.05  ? 477  MET A SD  1 
ATOM   3656 C  CE  . MET A 1 477 ? 12.309  14.118  28.353  1.00 34.23  ? 477  MET A CE  1 
ATOM   3657 N  N   . LYS A 1 478 ? 9.252   9.564   24.749  1.00 39.35  ? 478  LYS A N   1 
ATOM   3658 C  CA  . LYS A 1 478 ? 8.592   8.279   24.910  1.00 38.66  ? 478  LYS A CA  1 
ATOM   3659 C  C   . LYS A 1 478 ? 9.163   7.264   23.932  1.00 33.92  ? 478  LYS A C   1 
ATOM   3660 O  O   . LYS A 1 478 ? 9.608   6.191   24.340  1.00 32.92  ? 478  LYS A O   1 
ATOM   3661 C  CB  . LYS A 1 478 ? 7.082   8.415   24.724  1.00 44.67  ? 478  LYS A CB  1 
ATOM   3662 C  CG  . LYS A 1 478 ? 6.334   8.600   26.020  1.00 47.24  ? 478  LYS A CG  1 
ATOM   3663 C  CD  . LYS A 1 478 ? 6.284   7.295   26.797  1.00 69.71  ? 478  LYS A CD  1 
ATOM   3664 C  CE  . LYS A 1 478 ? 6.264   7.555   28.295  1.00 73.61  ? 478  LYS A CE  1 
ATOM   3665 N  NZ  . LYS A 1 478 ? 5.531   8.814   28.617  1.00 63.19  ? 478  LYS A NZ  1 
ATOM   3666 N  N   . TYR A 1 479 ? 9.167   7.603   22.644  1.00 29.64  ? 479  TYR A N   1 
ATOM   3667 C  CA  . TYR A 1 479 ? 9.713   6.692   21.639  1.00 31.69  ? 479  TYR A CA  1 
ATOM   3668 C  C   . TYR A 1 479 ? 11.108  6.221   22.033  1.00 34.21  ? 479  TYR A C   1 
ATOM   3669 O  O   . TYR A 1 479 ? 11.386  5.019   22.055  1.00 32.57  ? 479  TYR A O   1 
ATOM   3670 C  CB  . TYR A 1 479 ? 9.778   7.353   20.267  1.00 32.01  ? 479  TYR A CB  1 
ATOM   3671 C  CG  . TYR A 1 479 ? 8.439   7.671   19.651  1.00 45.57  ? 479  TYR A CG  1 
ATOM   3672 C  CD1 . TYR A 1 479 ? 7.411   6.732   19.640  1.00 40.42  ? 479  TYR A CD1 1 
ATOM   3673 C  CD2 . TYR A 1 479 ? 8.212   8.901   19.048  1.00 36.40  ? 479  TYR A CD2 1 
ATOM   3674 C  CE1 . TYR A 1 479 ? 6.190   7.022   19.065  1.00 35.17  ? 479  TYR A CE1 1 
ATOM   3675 C  CE2 . TYR A 1 479 ? 7.000   9.201   18.473  1.00 47.58  ? 479  TYR A CE2 1 
ATOM   3676 C  CZ  . TYR A 1 479 ? 5.989   8.260   18.480  1.00 54.50  ? 479  TYR A CZ  1 
ATOM   3677 O  OH  . TYR A 1 479 ? 4.779   8.571   17.898  1.00 43.44  ? 479  TYR A OH  1 
ATOM   3678 N  N   . TRP A 1 480 ? 11.980  7.178   22.345  1.00 28.71  ? 480  TRP A N   1 
ATOM   3679 C  CA  . TRP A 1 480 ? 13.367  6.874   22.679  1.00 36.41  ? 480  TRP A CA  1 
ATOM   3680 C  C   . TRP A 1 480 ? 13.493  6.000   23.925  1.00 35.27  ? 480  TRP A C   1 
ATOM   3681 O  O   . TRP A 1 480 ? 14.165  4.969   23.896  1.00 37.03  ? 480  TRP A O   1 
ATOM   3682 C  CB  . TRP A 1 480 ? 14.194  8.161   22.813  1.00 36.97  ? 480  TRP A CB  1 
ATOM   3683 C  CG  . TRP A 1 480 ? 15.006  8.489   21.584  1.00 31.82  ? 480  TRP A CG  1 
ATOM   3684 C  CD1 . TRP A 1 480 ? 16.366  8.614   21.508  1.00 35.97  ? 480  TRP A CD1 1 
ATOM   3685 C  CD2 . TRP A 1 480 ? 14.511  8.714   20.257  1.00 39.95  ? 480  TRP A CD2 1 
ATOM   3686 N  NE1 . TRP A 1 480 ? 16.745  8.906   20.219  1.00 31.11  ? 480  TRP A NE1 1 
ATOM   3687 C  CE2 . TRP A 1 480 ? 15.625  8.974   19.433  1.00 32.84  ? 480  TRP A CE2 1 
ATOM   3688 C  CE3 . TRP A 1 480 ? 13.235  8.720   19.687  1.00 36.64  ? 480  TRP A CE3 1 
ATOM   3689 C  CZ2 . TRP A 1 480 ? 15.501  9.237   18.071  1.00 31.90  ? 480  TRP A CZ2 1 
ATOM   3690 C  CZ3 . TRP A 1 480 ? 13.115  8.985   18.337  1.00 39.07  ? 480  TRP A CZ3 1 
ATOM   3691 C  CH2 . TRP A 1 480 ? 14.241  9.241   17.543  1.00 37.39  ? 480  TRP A CH2 1 
ATOM   3692 N  N   . THR A 1 481 ? 12.839  6.397   25.013  1.00 31.44  ? 481  THR A N   1 
ATOM   3693 C  CA  . THR A 1 481 ? 12.902  5.616   26.250  1.00 33.43  ? 481  THR A CA  1 
ATOM   3694 C  C   . THR A 1 481 ? 12.204  4.256   26.150  1.00 36.81  ? 481  THR A C   1 
ATOM   3695 O  O   . THR A 1 481 ? 12.655  3.284   26.752  1.00 41.07  ? 481  THR A O   1 
ATOM   3696 C  CB  . THR A 1 481 ? 12.343  6.391   27.455  1.00 38.48  ? 481  THR A CB  1 
ATOM   3697 O  OG1 . THR A 1 481 ? 10.986  6.778   27.195  1.00 40.63  ? 481  THR A OG1 1 
ATOM   3698 C  CG2 . THR A 1 481 ? 13.182  7.624   27.715  1.00 34.31  ? 481  THR A CG2 1 
ATOM   3699 N  N   . ASN A 1 482 ? 11.106  4.184   25.402  1.00 34.88  ? 482  ASN A N   1 
ATOM   3700 C  CA  . ASN A 1 482 ? 10.456  2.897   25.154  1.00 32.69  ? 482  ASN A CA  1 
ATOM   3701 C  C   . ASN A 1 482 ? 11.384  1.936   24.436  1.00 39.16  ? 482  ASN A C   1 
ATOM   3702 O  O   . ASN A 1 482 ? 11.421  0.742   24.750  1.00 37.93  ? 482  ASN A O   1 
ATOM   3703 C  CB  . ASN A 1 482 ? 9.170   3.068   24.350  1.00 38.80  ? 482  ASN A CB  1 
ATOM   3704 C  CG  . ASN A 1 482 ? 7.999   3.471   25.216  1.00 48.22  ? 482  ASN A CG  1 
ATOM   3705 O  OD1 . ASN A 1 482 ? 8.067   3.392   26.443  1.00 45.58  ? 482  ASN A OD1 1 
ATOM   3706 N  ND2 . ASN A 1 482 ? 6.918   3.910   24.585  1.00 48.52  ? 482  ASN A ND2 1 
ATOM   3707 N  N   . PHE A 1 483 ? 12.133  2.464   23.470  1.00 37.59  ? 483  PHE A N   1 
ATOM   3708 C  CA  . PHE A 1 483 ? 13.081  1.661   22.713  1.00 32.79  ? 483  PHE A CA  1 
ATOM   3709 C  C   . PHE A 1 483 ? 14.258  1.245   23.594  1.00 39.44  ? 483  PHE A C   1 
ATOM   3710 O  O   . PHE A 1 483 ? 14.776  0.132   23.481  1.00 38.37  ? 483  PHE A O   1 
ATOM   3711 C  CB  . PHE A 1 483 ? 13.576  2.418   21.475  1.00 34.02  ? 483  PHE A CB  1 
ATOM   3712 C  CG  . PHE A 1 483 ? 14.719  1.739   20.778  1.00 36.05  ? 483  PHE A CG  1 
ATOM   3713 C  CD1 . PHE A 1 483 ? 14.488  0.717   19.872  1.00 30.65  ? 483  PHE A CD1 1 
ATOM   3714 C  CD2 . PHE A 1 483 ? 16.030  2.102   21.051  1.00 23.64  ? 483  PHE A CD2 1 
ATOM   3715 C  CE1 . PHE A 1 483 ? 15.541  0.076   19.242  1.00 30.86  ? 483  PHE A CE1 1 
ATOM   3716 C  CE2 . PHE A 1 483 ? 17.087  1.464   20.425  1.00 29.34  ? 483  PHE A CE2 1 
ATOM   3717 C  CZ  . PHE A 1 483 ? 16.839  0.450   19.515  1.00 34.75  ? 483  PHE A CZ  1 
ATOM   3718 N  N   . ALA A 1 484 ? 14.683  2.144   24.472  1.00 40.28  ? 484  ALA A N   1 
ATOM   3719 C  CA  . ALA A 1 484 ? 15.750  1.824   25.408  1.00 37.65  ? 484  ALA A CA  1 
ATOM   3720 C  C   . ALA A 1 484 ? 15.310  0.678   26.309  1.00 45.47  ? 484  ALA A C   1 
ATOM   3721 O  O   . ALA A 1 484 ? 16.066  -0.267  26.546  1.00 35.73  ? 484  ALA A O   1 
ATOM   3722 C  CB  . ALA A 1 484 ? 16.109  3.039   26.238  1.00 38.15  ? 484  ALA A CB  1 
ATOM   3723 N  N   . ARG A 1 485 ? 14.074  0.762   26.796  1.00 39.10  ? 485  ARG A N   1 
ATOM   3724 C  CA  . ARG A 1 485 ? 13.534  -0.244  27.705  1.00 41.03  ? 485  ARG A CA  1 
ATOM   3725 C  C   . ARG A 1 485 ? 13.320  -1.604  27.045  1.00 43.52  ? 485  ARG A C   1 
ATOM   3726 O  O   . ARG A 1 485 ? 13.664  -2.637  27.617  1.00 36.39  ? 485  ARG A O   1 
ATOM   3727 C  CB  . ARG A 1 485 ? 12.219  0.238   28.331  1.00 33.89  ? 485  ARG A CB  1 
ATOM   3728 C  CG  . ARG A 1 485 ? 12.388  1.229   29.478  1.00 59.03  ? 485  ARG A CG  1 
ATOM   3729 C  CD  . ARG A 1 485 ? 11.041  1.679   30.043  1.00 53.99  ? 485  ARG A CD  1 
ATOM   3730 N  NE  . ARG A 1 485 ? 10.373  2.645   29.175  1.00 55.21  ? 485  ARG A NE  1 
ATOM   3731 C  CZ  . ARG A 1 485 ? 10.265  3.946   29.443  1.00 62.83  ? 485  ARG A CZ  1 
ATOM   3732 N  NH1 . ARG A 1 485 ? 10.774  4.440   30.567  1.00 46.68  ? 485  ARG A NH1 1 
ATOM   3733 N  NH2 . ARG A 1 485 ? 9.639   4.754   28.591  1.00 50.00  ? 485  ARG A NH2 1 
ATOM   3734 N  N   . THR A 1 486 ? 12.766  -1.601  25.837  1.00 47.72  ? 486  THR A N   1 
ATOM   3735 C  CA  . THR A 1 486 ? 12.229  -2.824  25.250  1.00 39.66  ? 486  THR A CA  1 
ATOM   3736 C  C   . THR A 1 486 ? 12.795  -3.178  23.878  1.00 48.92  ? 486  THR A C   1 
ATOM   3737 O  O   . THR A 1 486 ? 12.582  -4.284  23.382  1.00 53.91  ? 486  THR A O   1 
ATOM   3738 C  CB  . THR A 1 486 ? 10.713  -2.705  25.097  1.00 40.32  ? 486  THR A CB  1 
ATOM   3739 O  OG1 . THR A 1 486 ? 10.413  -1.836  23.994  1.00 43.46  ? 486  THR A OG1 1 
ATOM   3740 C  CG2 . THR A 1 486 ? 10.102  -2.132  26.365  1.00 28.38  ? 486  THR A CG2 1 
ATOM   3741 N  N   . GLY A 1 487 ? 13.505  -2.240  23.261  1.00 47.05  ? 487  GLY A N   1 
ATOM   3742 C  CA  . GLY A 1 487 ? 13.969  -2.423  21.898  1.00 39.15  ? 487  GLY A CA  1 
ATOM   3743 C  C   . GLY A 1 487 ? 12.836  -2.157  20.929  1.00 47.34  ? 487  GLY A C   1 
ATOM   3744 O  O   . GLY A 1 487 ? 12.858  -2.605  19.783  1.00 43.67  ? 487  GLY A O   1 
ATOM   3745 N  N   . ASP A 1 488 ? 11.841  -1.412  21.402  1.00 39.58  ? 488  ASP A N   1 
ATOM   3746 C  CA  . ASP A 1 488 ? 10.642  -1.148  20.629  1.00 43.31  ? 488  ASP A CA  1 
ATOM   3747 C  C   . ASP A 1 488 ? 10.075  0.222   21.005  1.00 37.97  ? 488  ASP A C   1 
ATOM   3748 O  O   . ASP A 1 488 ? 9.642   0.429   22.130  1.00 36.85  ? 488  ASP A O   1 
ATOM   3749 C  CB  . ASP A 1 488 ? 9.620   -2.253  20.896  1.00 40.60  ? 488  ASP A CB  1 
ATOM   3750 C  CG  . ASP A 1 488 ? 8.400   -2.158  20.002  1.00 46.22  ? 488  ASP A CG  1 
ATOM   3751 O  OD1 . ASP A 1 488 ? 8.084   -1.056  19.499  1.00 52.91  ? 488  ASP A OD1 1 
ATOM   3752 O  OD2 . ASP A 1 488 ? 7.748   -3.202  19.809  1.00 48.82  ? 488  ASP A OD2 1 
ATOM   3753 N  N   . PRO A 1 489 ? 10.075  1.163   20.053  1.00 42.07  ? 489  PRO A N   1 
ATOM   3754 C  CA  . PRO A 1 489 ? 9.670   2.540   20.353  1.00 38.83  ? 489  PRO A CA  1 
ATOM   3755 C  C   . PRO A 1 489 ? 8.199   2.644   20.724  1.00 38.13  ? 489  PRO A C   1 
ATOM   3756 O  O   . PRO A 1 489 ? 7.786   3.646   21.305  1.00 43.66  ? 489  PRO A O   1 
ATOM   3757 C  CB  . PRO A 1 489 ? 9.915   3.267   19.023  1.00 32.17  ? 489  PRO A CB  1 
ATOM   3758 C  CG  . PRO A 1 489 ? 9.806   2.181   17.998  1.00 44.12  ? 489  PRO A CG  1 
ATOM   3759 C  CD  . PRO A 1 489 ? 10.489  1.016   18.647  1.00 35.59  ? 489  PRO A CD  1 
ATOM   3760 N  N   . ASN A 1 490 ? 7.419   1.625   20.385  1.00 42.45  ? 490  ASN A N   1 
ATOM   3761 C  CA  . ASN A 1 490 ? 5.973   1.667   20.598  1.00 47.30  ? 490  ASN A CA  1 
ATOM   3762 C  C   . ASN A 1 490 ? 5.579   1.549   22.063  1.00 48.47  ? 490  ASN A C   1 
ATOM   3763 O  O   . ASN A 1 490 ? 6.167   0.770   22.817  1.00 51.25  ? 490  ASN A O   1 
ATOM   3764 C  CB  . ASN A 1 490 ? 5.280   0.574   19.782  1.00 41.37  ? 490  ASN A CB  1 
ATOM   3765 C  CG  . ASN A 1 490 ? 5.389   0.805   18.285  1.00 45.38  ? 490  ASN A CG  1 
ATOM   3766 O  OD1 . ASN A 1 490 ? 4.749   1.702   17.734  1.00 45.54  ? 490  ASN A OD1 1 
ATOM   3767 N  ND2 . ASN A 1 490 ? 6.197   -0.011  17.619  1.00 38.20  ? 490  ASN A ND2 1 
ATOM   3768 N  N   . ASP A 1 491 ? 4.580   2.328   22.462  1.00 59.06  ? 491  ASP A N   1 
ATOM   3769 C  CA  . ASP A 1 491 ? 4.056   2.254   23.820  1.00 76.58  ? 491  ASP A CA  1 
ATOM   3770 C  C   . ASP A 1 491 ? 3.283   0.950   24.001  1.00 75.15  ? 491  ASP A C   1 
ATOM   3771 O  O   . ASP A 1 491 ? 2.397   0.634   23.209  1.00 76.73  ? 491  ASP A O   1 
ATOM   3772 C  CB  . ASP A 1 491 ? 3.156   3.455   24.115  1.00 87.13  ? 491  ASP A CB  1 
ATOM   3773 C  CG  . ASP A 1 491 ? 3.001   3.717   25.603  1.00 90.37  ? 491  ASP A CG  1 
ATOM   3774 O  OD1 . ASP A 1 491 ? 3.399   4.812   26.053  1.00 82.75  ? 491  ASP A OD1 1 
ATOM   3775 O  OD2 . ASP A 1 491 ? 2.490   2.829   26.322  1.00 87.09  ? 491  ASP A OD2 1 
ATOM   3776 N  N   . PRO A 1 492 ? 3.629   0.183   25.045  1.00 86.42  ? 492  PRO A N   1 
ATOM   3777 C  CA  . PRO A 1 492 ? 2.998   -1.116  25.300  1.00 93.61  ? 492  PRO A CA  1 
ATOM   3778 C  C   . PRO A 1 492 ? 1.495   -0.975  25.517  1.00 102.56 ? 492  PRO A C   1 
ATOM   3779 O  O   . PRO A 1 492 ? 0.719   -1.812  25.057  1.00 99.31  ? 492  PRO A O   1 
ATOM   3780 C  CB  . PRO A 1 492 ? 3.674   -1.586  26.594  1.00 99.32  ? 492  PRO A CB  1 
ATOM   3781 C  CG  . PRO A 1 492 ? 4.951   -0.810  26.673  1.00 89.86  ? 492  PRO A CG  1 
ATOM   3782 C  CD  . PRO A 1 492 ? 4.642   0.518   26.060  1.00 88.91  ? 492  PRO A CD  1 
ATOM   3783 N  N   . ARG A 1 493 ? 1.098   0.084   26.213  1.00 105.03 ? 493  ARG A N   1 
ATOM   3784 C  CA  . ARG A 1 493 ? -0.306  0.326   26.515  1.00 106.05 ? 493  ARG A CA  1 
ATOM   3785 C  C   . ARG A 1 493 ? -1.002  1.005   25.346  1.00 120.56 ? 493  ARG A C   1 
ATOM   3786 O  O   . ARG A 1 493 ? -1.848  0.406   24.681  1.00 129.61 ? 493  ARG A O   1 
ATOM   3787 C  CB  . ARG A 1 493 ? -0.430  1.203   27.759  1.00 105.38 ? 493  ARG A CB  1 
ATOM   3788 C  CG  . ARG A 1 493 ? 0.451   0.760   28.910  1.00 113.87 ? 493  ARG A CG  1 
ATOM   3789 C  CD  . ARG A 1 493 ? 0.737   1.914   29.848  1.00 121.86 ? 493  ARG A CD  1 
ATOM   3790 N  NE  . ARG A 1 493 ? 1.746   1.569   30.843  1.00 129.71 ? 493  ARG A NE  1 
ATOM   3791 C  CZ  . ARG A 1 493 ? 2.249   2.429   31.722  1.00 132.60 ? 493  ARG A CZ  1 
ATOM   3792 N  NH1 . ARG A 1 493 ? 1.837   3.689   31.729  1.00 121.16 ? 493  ARG A NH1 1 
ATOM   3793 N  NH2 . ARG A 1 493 ? 3.165   2.029   32.593  1.00 126.64 ? 493  ARG A NH2 1 
ATOM   3794 N  N   . ASP A 1 494 ? -0.632  2.258   25.102  1.00 114.49 ? 494  ASP A N   1 
ATOM   3795 C  CA  . ASP A 1 494 ? -1.268  3.081   24.078  1.00 112.98 ? 494  ASP A CA  1 
ATOM   3796 C  C   . ASP A 1 494 ? -1.184  2.471   22.682  1.00 119.16 ? 494  ASP A C   1 
ATOM   3797 O  O   . ASP A 1 494 ? -0.308  2.824   21.890  1.00 123.93 ? 494  ASP A O   1 
ATOM   3798 C  CB  . ASP A 1 494 ? -0.649  4.480   24.072  1.00 112.94 ? 494  ASP A CB  1 
ATOM   3799 C  CG  . ASP A 1 494 ? -1.267  5.387   23.030  1.00 120.01 ? 494  ASP A CG  1 
ATOM   3800 O  OD1 . ASP A 1 494 ? -0.654  6.428   22.716  1.00 126.60 ? 494  ASP A OD1 1 
ATOM   3801 O  OD2 . ASP A 1 494 ? -2.362  5.061   22.525  1.00 121.38 ? 494  ASP A OD2 1 
ATOM   3802 N  N   . SER A 1 495 ? -2.102  1.556   22.385  1.00 124.15 ? 495  SER A N   1 
ATOM   3803 C  CA  . SER A 1 495 ? -2.211  0.986   21.049  1.00 127.38 ? 495  SER A CA  1 
ATOM   3804 C  C   . SER A 1 495 ? -3.287  1.734   20.270  1.00 126.39 ? 495  SER A C   1 
ATOM   3805 O  O   . SER A 1 495 ? -3.574  1.415   19.115  1.00 116.30 ? 495  SER A O   1 
ATOM   3806 C  CB  . SER A 1 495 ? -2.530  -0.509  21.117  1.00 133.55 ? 495  SER A CB  1 
ATOM   3807 O  OG  . SER A 1 495 ? -3.705  -0.750  21.871  1.00 141.06 ? 495  SER A OG  1 
ATOM   3808 N  N   . LYS A 1 496 ? -3.880  2.732   20.919  1.00 120.15 ? 496  LYS A N   1 
ATOM   3809 C  CA  . LYS A 1 496 ? -4.840  3.616   20.270  1.00 112.61 ? 496  LYS A CA  1 
ATOM   3810 C  C   . LYS A 1 496 ? -4.110  4.602   19.363  1.00 116.22 ? 496  LYS A C   1 
ATOM   3811 O  O   . LYS A 1 496 ? -4.685  5.128   18.409  1.00 113.08 ? 496  LYS A O   1 
ATOM   3812 C  CB  . LYS A 1 496 ? -5.667  4.369   21.312  1.00 99.67  ? 496  LYS A CB  1 
ATOM   3813 N  N   . SER A 1 497 ? -2.841  4.852   19.674  1.00 111.95 ? 497  SER A N   1 
ATOM   3814 C  CA  . SER A 1 497 ? -1.986  5.680   18.829  1.00 94.67  ? 497  SER A CA  1 
ATOM   3815 C  C   . SER A 1 497 ? -1.403  4.848   17.692  1.00 83.81  ? 497  SER A C   1 
ATOM   3816 O  O   . SER A 1 497 ? -1.205  3.640   17.840  1.00 80.94  ? 497  SER A O   1 
ATOM   3817 C  CB  . SER A 1 497 ? -0.860  6.311   19.652  1.00 90.89  ? 497  SER A CB  1 
ATOM   3818 O  OG  . SER A 1 497 ? -1.340  7.395   20.427  1.00 109.40 ? 497  SER A OG  1 
ATOM   3819 N  N   . PRO A 1 498 ? -1.118  5.494   16.551  1.00 68.31  ? 498  PRO A N   1 
ATOM   3820 C  CA  . PRO A 1 498 ? -0.624  4.756   15.384  1.00 61.08  ? 498  PRO A CA  1 
ATOM   3821 C  C   . PRO A 1 498 ? 0.666   4.030   15.736  1.00 63.21  ? 498  PRO A C   1 
ATOM   3822 O  O   . PRO A 1 498 ? 1.443   4.521   16.555  1.00 61.69  ? 498  PRO A O   1 
ATOM   3823 C  CB  . PRO A 1 498 ? -0.347  5.858   14.353  1.00 59.93  ? 498  PRO A CB  1 
ATOM   3824 C  CG  . PRO A 1 498 ? -1.069  7.072   14.857  1.00 63.04  ? 498  PRO A CG  1 
ATOM   3825 C  CD  . PRO A 1 498 ? -1.082  6.951   16.343  1.00 58.46  ? 498  PRO A CD  1 
ATOM   3826 N  N   . GLN A 1 499 ? 0.889   2.872   15.129  1.00 54.76  ? 499  GLN A N   1 
ATOM   3827 C  CA  . GLN A 1 499 ? 2.062   2.074   15.448  1.00 47.93  ? 499  GLN A CA  1 
ATOM   3828 C  C   . GLN A 1 499 ? 3.237   2.387   14.530  1.00 52.83  ? 499  GLN A C   1 
ATOM   3829 O  O   . GLN A 1 499 ? 3.065   2.877   13.414  1.00 46.87  ? 499  GLN A O   1 
ATOM   3830 C  CB  . GLN A 1 499 ? 1.735   0.579   15.396  1.00 51.26  ? 499  GLN A CB  1 
ATOM   3831 C  CG  . GLN A 1 499 ? 0.726   0.133   16.437  1.00 55.96  ? 499  GLN A CG  1 
ATOM   3832 C  CD  . GLN A 1 499 ? 1.267   0.222   17.850  1.00 66.24  ? 499  GLN A CD  1 
ATOM   3833 O  OE1 . GLN A 1 499 ? 2.170   -0.531  18.228  1.00 60.41  ? 499  GLN A OE1 1 
ATOM   3834 N  NE2 . GLN A 1 499 ? 0.712   1.138   18.643  1.00 55.34  ? 499  GLN A NE2 1 
ATOM   3835 N  N   . TRP A 1 500 ? 4.431   2.093   15.028  1.00 56.63  ? 500  TRP A N   1 
ATOM   3836 C  CA  . TRP A 1 500 ? 5.671   2.301   14.303  1.00 40.51  ? 500  TRP A CA  1 
ATOM   3837 C  C   . TRP A 1 500 ? 6.166   0.927   13.879  1.00 40.33  ? 500  TRP A C   1 
ATOM   3838 O  O   . TRP A 1 500 ? 6.705   0.181   14.698  1.00 47.43  ? 500  TRP A O   1 
ATOM   3839 C  CB  . TRP A 1 500 ? 6.687   2.973   15.235  1.00 48.99  ? 500  TRP A CB  1 
ATOM   3840 C  CG  . TRP A 1 500 ? 8.011   3.364   14.621  1.00 40.59  ? 500  TRP A CG  1 
ATOM   3841 C  CD1 . TRP A 1 500 ? 8.600   2.832   13.509  1.00 35.06  ? 500  TRP A CD1 1 
ATOM   3842 C  CD2 . TRP A 1 500 ? 8.928   4.342   15.129  1.00 41.45  ? 500  TRP A CD2 1 
ATOM   3843 N  NE1 . TRP A 1 500 ? 9.813   3.435   13.280  1.00 43.18  ? 500  TRP A NE1 1 
ATOM   3844 C  CE2 . TRP A 1 500 ? 10.039  4.365   14.262  1.00 46.59  ? 500  TRP A CE2 1 
ATOM   3845 C  CE3 . TRP A 1 500 ? 8.912   5.208   16.227  1.00 39.59  ? 500  TRP A CE3 1 
ATOM   3846 C  CZ2 . TRP A 1 500 ? 11.123  5.222   14.458  1.00 41.73  ? 500  TRP A CZ2 1 
ATOM   3847 C  CZ3 . TRP A 1 500 ? 9.988   6.058   16.421  1.00 37.51  ? 500  TRP A CZ3 1 
ATOM   3848 C  CH2 . TRP A 1 500 ? 11.078  6.059   15.539  1.00 41.69  ? 500  TRP A CH2 1 
ATOM   3849 N  N   . PRO A 1 501 ? 5.968   0.576   12.601  1.00 40.35  ? 501  PRO A N   1 
ATOM   3850 C  CA  . PRO A 1 501 ? 6.403   -0.729  12.087  1.00 37.77  ? 501  PRO A CA  1 
ATOM   3851 C  C   . PRO A 1 501 ? 7.921   -0.823  12.050  1.00 36.69  ? 501  PRO A C   1 
ATOM   3852 O  O   . PRO A 1 501 ? 8.579   0.190   11.837  1.00 41.67  ? 501  PRO A O   1 
ATOM   3853 C  CB  . PRO A 1 501 ? 5.869   -0.720  10.650  1.00 34.04  ? 501  PRO A CB  1 
ATOM   3854 C  CG  . PRO A 1 501 ? 5.800   0.745   10.303  1.00 35.27  ? 501  PRO A CG  1 
ATOM   3855 C  CD  . PRO A 1 501 ? 5.277   1.359   11.562  1.00 34.49  ? 501  PRO A CD  1 
ATOM   3856 N  N   . PRO A 1 502 ? 8.478   -2.022  12.260  1.00 39.70  ? 502  PRO A N   1 
ATOM   3857 C  CA  . PRO A 1 502 ? 9.912   -2.178  12.012  1.00 39.64  ? 502  PRO A CA  1 
ATOM   3858 C  C   . PRO A 1 502 ? 10.237  -1.924  10.545  1.00 46.27  ? 502  PRO A C   1 
ATOM   3859 O  O   . PRO A 1 502 ? 9.372   -2.065  9.683   1.00 50.76  ? 502  PRO A O   1 
ATOM   3860 C  CB  . PRO A 1 502 ? 10.168  -3.650  12.346  1.00 35.74  ? 502  PRO A CB  1 
ATOM   3861 C  CG  . PRO A 1 502 ? 9.093   -4.006  13.311  1.00 43.03  ? 502  PRO A CG  1 
ATOM   3862 C  CD  . PRO A 1 502 ? 7.885   -3.228  12.862  1.00 39.60  ? 502  PRO A CD  1 
ATOM   3863 N  N   . TYR A 1 503 ? 11.476  -1.540  10.272  1.00 41.74  ? 503  TYR A N   1 
ATOM   3864 C  CA  . TYR A 1 503 ? 11.946  -1.388  8.910   1.00 46.39  ? 503  TYR A CA  1 
ATOM   3865 C  C   . TYR A 1 503 ? 12.390  -2.747  8.387   1.00 46.91  ? 503  TYR A C   1 
ATOM   3866 O  O   . TYR A 1 503 ? 13.094  -3.482  9.081   1.00 43.06  ? 503  TYR A O   1 
ATOM   3867 C  CB  . TYR A 1 503 ? 13.113  -0.399  8.866   1.00 40.44  ? 503  TYR A CB  1 
ATOM   3868 C  CG  . TYR A 1 503 ? 13.672  -0.168  7.483   1.00 42.23  ? 503  TYR A CG  1 
ATOM   3869 C  CD1 . TYR A 1 503 ? 14.684  -0.976  6.979   1.00 36.78  ? 503  TYR A CD1 1 
ATOM   3870 C  CD2 . TYR A 1 503 ? 13.194  0.863   6.683   1.00 36.73  ? 503  TYR A CD2 1 
ATOM   3871 C  CE1 . TYR A 1 503 ? 15.203  -0.770  5.721   1.00 31.09  ? 503  TYR A CE1 1 
ATOM   3872 C  CE2 . TYR A 1 503 ? 13.704  1.077   5.420   1.00 35.22  ? 503  TYR A CE2 1 
ATOM   3873 C  CZ  . TYR A 1 503 ? 14.709  0.255   4.942   1.00 43.07  ? 503  TYR A CZ  1 
ATOM   3874 O  OH  . TYR A 1 503 ? 15.228  0.457   3.684   1.00 42.91  ? 503  TYR A OH  1 
ATOM   3875 N  N   . THR A 1 504 ? 11.979  -3.083  7.169   1.00 42.76  ? 504  THR A N   1 
ATOM   3876 C  CA  . THR A 1 504 ? 12.403  -4.337  6.554   1.00 50.93  ? 504  THR A CA  1 
ATOM   3877 C  C   . THR A 1 504 ? 12.856  -4.132  5.123   1.00 47.26  ? 504  THR A C   1 
ATOM   3878 O  O   . THR A 1 504 ? 12.508  -3.140  4.481   1.00 44.70  ? 504  THR A O   1 
ATOM   3879 C  CB  . THR A 1 504 ? 11.270  -5.380  6.530   1.00 45.52  ? 504  THR A CB  1 
ATOM   3880 O  OG1 . THR A 1 504 ? 10.159  -4.859  5.786   1.00 41.39  ? 504  THR A OG1 1 
ATOM   3881 C  CG2 . THR A 1 504 ? 10.830  -5.731  7.949   1.00 28.56  ? 504  THR A CG2 1 
ATOM   3882 N  N   . THR A 1 505 ? 13.630  -5.089  4.628   1.00 39.92  ? 505  THR A N   1 
ATOM   3883 C  CA  . THR A 1 505 ? 14.055  -5.083  3.238   1.00 46.10  ? 505  THR A CA  1 
ATOM   3884 C  C   . THR A 1 505 ? 12.843  -5.151  2.313   1.00 48.45  ? 505  THR A C   1 
ATOM   3885 O  O   . THR A 1 505 ? 12.782  -4.455  1.299   1.00 47.23  ? 505  THR A O   1 
ATOM   3886 C  CB  . THR A 1 505 ? 14.998  -6.258  2.952   1.00 51.47  ? 505  THR A CB  1 
ATOM   3887 O  OG1 . THR A 1 505 ? 14.411  -7.465  3.449   1.00 71.10  ? 505  THR A OG1 1 
ATOM   3888 C  CG2 . THR A 1 505 ? 16.336  -6.040  3.652   1.00 58.00  ? 505  THR A CG2 1 
ATOM   3889 N  N   . ALA A 1 506 ? 11.869  -5.975  2.685   1.00 51.95  ? 506  ALA A N   1 
ATOM   3890 C  CA  . ALA A 1 506 ? 10.665  -6.159  1.881   1.00 48.71  ? 506  ALA A CA  1 
ATOM   3891 C  C   . ALA A 1 506 ? 9.833   -4.883  1.736   1.00 58.40  ? 506  ALA A C   1 
ATOM   3892 O  O   . ALA A 1 506 ? 9.597   -4.415  0.620   1.00 66.54  ? 506  ALA A O   1 
ATOM   3893 C  CB  . ALA A 1 506 ? 9.811   -7.281  2.455   1.00 48.95  ? 506  ALA A CB  1 
ATOM   3894 N  N   . ALA A 1 507 ? 9.386   -4.327  2.860   1.00 49.59  ? 507  ALA A N   1 
ATOM   3895 C  CA  . ALA A 1 507 ? 8.463   -3.191  2.832   1.00 49.62  ? 507  ALA A CA  1 
ATOM   3896 C  C   . ALA A 1 507 ? 9.120   -1.822  3.042   1.00 52.90  ? 507  ALA A C   1 
ATOM   3897 O  O   . ALA A 1 507 ? 8.498   -0.790  2.787   1.00 46.95  ? 507  ALA A O   1 
ATOM   3898 C  CB  . ALA A 1 507 ? 7.341   -3.396  3.838   1.00 36.19  ? 507  ALA A CB  1 
ATOM   3899 N  N   . GLN A 1 508 ? 10.360  -1.819  3.520   1.00 43.19  ? 508  GLN A N   1 
ATOM   3900 C  CA  . GLN A 1 508 ? 11.113  -0.581  3.709   1.00 43.48  ? 508  GLN A CA  1 
ATOM   3901 C  C   . GLN A 1 508 ? 10.276  0.527   4.348   1.00 41.67  ? 508  GLN A C   1 
ATOM   3902 O  O   . GLN A 1 508 ? 10.228  1.653   3.846   1.00 45.42  ? 508  GLN A O   1 
ATOM   3903 C  CB  . GLN A 1 508 ? 11.679  -0.102  2.371   1.00 38.14  ? 508  GLN A CB  1 
ATOM   3904 C  CG  . GLN A 1 508 ? 12.320  -1.206  1.547   1.00 48.89  ? 508  GLN A CG  1 
ATOM   3905 C  CD  . GLN A 1 508 ? 12.737  -0.739  0.165   1.00 56.07  ? 508  GLN A CD  1 
ATOM   3906 O  OE1 . GLN A 1 508 ? 13.282  0.353   0.003   1.00 56.26  ? 508  GLN A OE1 1 
ATOM   3907 N  NE2 . GLN A 1 508 ? 12.486  -1.569  -0.840  1.00 56.56  ? 508  GLN A NE2 1 
ATOM   3908 N  N   . GLN A 1 509 ? 9.618   0.207   5.456   1.00 32.68  ? 509  GLN A N   1 
ATOM   3909 C  CA  . GLN A 1 509 ? 8.779   1.187   6.142   1.00 45.80  ? 509  GLN A CA  1 
ATOM   3910 C  C   . GLN A 1 509 ? 9.530   2.004   7.192   1.00 42.24  ? 509  GLN A C   1 
ATOM   3911 O  O   . GLN A 1 509 ? 10.384  1.486   7.910   1.00 35.46  ? 509  GLN A O   1 
ATOM   3912 C  CB  . GLN A 1 509 ? 7.582   0.503   6.799   1.00 43.15  ? 509  GLN A CB  1 
ATOM   3913 C  CG  . GLN A 1 509 ? 6.599   -0.115  5.835   1.00 49.25  ? 509  GLN A CG  1 
ATOM   3914 C  CD  . GLN A 1 509 ? 5.548   -0.928  6.554   1.00 48.56  ? 509  GLN A CD  1 
ATOM   3915 O  OE1 . GLN A 1 509 ? 5.861   -1.916  7.213   1.00 42.98  ? 509  GLN A OE1 1 
ATOM   3916 N  NE2 . GLN A 1 509 ? 4.292   -0.511  6.439   1.00 41.23  ? 509  GLN A NE2 1 
ATOM   3917 N  N   . TYR A 1 510 ? 9.190   3.285   7.270   1.00 34.87  ? 510  TYR A N   1 
ATOM   3918 C  CA  . TYR A 1 510 ? 9.717   4.187   8.285   1.00 38.11  ? 510  TYR A CA  1 
ATOM   3919 C  C   . TYR A 1 510 ? 8.633   5.206   8.622   1.00 36.85  ? 510  TYR A C   1 
ATOM   3920 O  O   . TYR A 1 510 ? 7.653   5.340   7.888   1.00 47.99  ? 510  TYR A O   1 
ATOM   3921 C  CB  . TYR A 1 510 ? 10.963  4.903   7.769   1.00 35.44  ? 510  TYR A CB  1 
ATOM   3922 C  CG  . TYR A 1 510 ? 10.686  5.822   6.608   1.00 35.22  ? 510  TYR A CG  1 
ATOM   3923 C  CD1 . TYR A 1 510 ? 10.531  5.316   5.321   1.00 39.51  ? 510  TYR A CD1 1 
ATOM   3924 C  CD2 . TYR A 1 510 ? 10.573  7.193   6.795   1.00 32.12  ? 510  TYR A CD2 1 
ATOM   3925 C  CE1 . TYR A 1 510 ? 10.271  6.148   4.255   1.00 35.11  ? 510  TYR A CE1 1 
ATOM   3926 C  CE2 . TYR A 1 510 ? 10.312  8.033   5.735   1.00 43.78  ? 510  TYR A CE2 1 
ATOM   3927 C  CZ  . TYR A 1 510 ? 10.163  7.506   4.467   1.00 46.33  ? 510  TYR A CZ  1 
ATOM   3928 O  OH  . TYR A 1 510 ? 9.909   8.343   3.407   1.00 45.61  ? 510  TYR A OH  1 
ATOM   3929 N  N   . VAL A 1 511 ? 8.793   5.930   9.721   1.00 30.91  ? 511  VAL A N   1 
ATOM   3930 C  CA  . VAL A 1 511 ? 7.764   6.890   10.101  1.00 37.72  ? 511  VAL A CA  1 
ATOM   3931 C  C   . VAL A 1 511 ? 8.230   8.336   10.002  1.00 37.63  ? 511  VAL A C   1 
ATOM   3932 O  O   . VAL A 1 511 ? 9.423   8.628   10.063  1.00 38.15  ? 511  VAL A O   1 
ATOM   3933 C  CB  . VAL A 1 511 ? 7.216   6.622   11.517  1.00 37.73  ? 511  VAL A CB  1 
ATOM   3934 C  CG1 . VAL A 1 511 ? 6.550   5.252   11.573  1.00 35.57  ? 511  VAL A CG1 1 
ATOM   3935 C  CG2 . VAL A 1 511 ? 8.324   6.723   12.543  1.00 35.73  ? 511  VAL A CG2 1 
ATOM   3936 N  N   . SER A 1 512 ? 7.270   9.233   9.831   1.00 37.91  ? 512  SER A N   1 
ATOM   3937 C  CA  . SER A 1 512 ? 7.530   10.658  9.908   1.00 38.86  ? 512  SER A CA  1 
ATOM   3938 C  C   . SER A 1 512 ? 7.353   11.124  11.347  1.00 40.06  ? 512  SER A C   1 
ATOM   3939 O  O   . SER A 1 512 ? 6.357   10.800  11.997  1.00 44.47  ? 512  SER A O   1 
ATOM   3940 C  CB  . SER A 1 512 ? 6.582   11.426  8.987   1.00 39.59  ? 512  SER A CB  1 
ATOM   3941 O  OG  . SER A 1 512 ? 5.243   10.993  9.157   1.00 44.58  ? 512  SER A OG  1 
ATOM   3942 N  N   . LEU A 1 513 ? 8.333   11.867  11.846  1.00 38.62  ? 513  LEU A N   1 
ATOM   3943 C  CA  . LEU A 1 513 ? 8.234   12.480  13.162  1.00 38.52  ? 513  LEU A CA  1 
ATOM   3944 C  C   . LEU A 1 513 ? 7.990   13.977  13.014  1.00 41.77  ? 513  LEU A C   1 
ATOM   3945 O  O   . LEU A 1 513 ? 8.885   14.728  12.618  1.00 35.68  ? 513  LEU A O   1 
ATOM   3946 C  CB  . LEU A 1 513 ? 9.503   12.227  13.980  1.00 39.74  ? 513  LEU A CB  1 
ATOM   3947 C  CG  . LEU A 1 513 ? 9.837   10.774  14.334  1.00 47.27  ? 513  LEU A CG  1 
ATOM   3948 C  CD1 . LEU A 1 513 ? 11.197  10.676  15.014  1.00 28.32  ? 513  LEU A CD1 1 
ATOM   3949 C  CD2 . LEU A 1 513 ? 8.752   10.176  15.215  1.00 38.29  ? 513  LEU A CD2 1 
ATOM   3950 N  N   . ASN A 1 514 ? 6.769   14.400  13.320  1.00 33.68  ? 514  ASN A N   1 
ATOM   3951 C  CA  . ASN A 1 514 ? 6.420   15.813  13.298  1.00 35.51  ? 514  ASN A CA  1 
ATOM   3952 C  C   . ASN A 1 514 ? 5.228   16.090  14.211  1.00 43.32  ? 514  ASN A C   1 
ATOM   3953 O  O   . ASN A 1 514 ? 4.848   15.240  15.021  1.00 44.07  ? 514  ASN A O   1 
ATOM   3954 C  CB  . ASN A 1 514 ? 6.151   16.282  11.867  1.00 38.88  ? 514  ASN A CB  1 
ATOM   3955 C  CG  . ASN A 1 514 ? 5.114   15.429  11.159  1.00 41.58  ? 514  ASN A CG  1 
ATOM   3956 O  OD1 . ASN A 1 514 ? 4.069   15.108  11.721  1.00 41.46  ? 514  ASN A OD1 1 
ATOM   3957 N  ND2 . ASN A 1 514 ? 5.400   15.060  9.917   1.00 40.32  ? 514  ASN A ND2 1 
ATOM   3958 N  N   . LEU A 1 515 ? 4.641   17.276  14.095  1.00 36.27  ? 515  LEU A N   1 
ATOM   3959 C  CA  . LEU A 1 515 ? 3.568   17.661  15.004  1.00 42.15  ? 515  LEU A CA  1 
ATOM   3960 C  C   . LEU A 1 515 ? 2.333   16.779  14.815  1.00 48.22  ? 515  LEU A C   1 
ATOM   3961 O  O   . LEU A 1 515 ? 1.558   16.571  15.745  1.00 46.94  ? 515  LEU A O   1 
ATOM   3962 C  CB  . LEU A 1 515 ? 3.234   19.150  14.858  1.00 29.26  ? 515  LEU A CB  1 
ATOM   3963 C  CG  . LEU A 1 515 ? 4.363   20.073  15.325  1.00 45.61  ? 515  LEU A CG  1 
ATOM   3964 C  CD1 . LEU A 1 515 ? 3.875   21.497  15.508  1.00 33.96  ? 515  LEU A CD1 1 
ATOM   3965 C  CD2 . LEU A 1 515 ? 4.963   19.555  16.623  1.00 38.11  ? 515  LEU A CD2 1 
ATOM   3966 N  N   . LYS A 1 516 ? 2.170   16.254  13.607  1.00 48.19  ? 516  LYS A N   1 
ATOM   3967 C  CA  . LYS A 1 516 ? 1.091   15.318  13.313  1.00 46.56  ? 516  LYS A CA  1 
ATOM   3968 C  C   . LYS A 1 516 ? 1.441   13.925  13.830  1.00 47.25  ? 516  LYS A C   1 
ATOM   3969 O  O   . LYS A 1 516 ? 2.603   13.636  14.104  1.00 51.70  ? 516  LYS A O   1 
ATOM   3970 C  CB  . LYS A 1 516 ? 0.811   15.294  11.807  1.00 43.86  ? 516  LYS A CB  1 
ATOM   3971 C  CG  . LYS A 1 516 ? 0.143   16.566  11.298  1.00 50.85  ? 516  LYS A CG  1 
ATOM   3972 C  CD  . LYS A 1 516 ? 0.540   16.893  9.864   1.00 67.17  ? 516  LYS A CD  1 
ATOM   3973 C  CE  . LYS A 1 516 ? 0.231   15.752  8.909   1.00 77.92  ? 516  LYS A CE  1 
ATOM   3974 N  NZ  . LYS A 1 516 ? 0.478   16.144  7.489   1.00 88.65  ? 516  LYS A NZ  1 
ATOM   3975 N  N   . PRO A 1 517 ? 0.430   13.058  13.988  1.00 47.31  ? 517  PRO A N   1 
ATOM   3976 C  CA  . PRO A 1 517 ? 0.668   11.715  14.524  1.00 43.96  ? 517  PRO A CA  1 
ATOM   3977 C  C   . PRO A 1 517 ? 1.507   10.870  13.581  1.00 47.99  ? 517  PRO A C   1 
ATOM   3978 O  O   . PRO A 1 517 ? 1.560   11.157  12.385  1.00 43.75  ? 517  PRO A O   1 
ATOM   3979 C  CB  . PRO A 1 517 ? -0.740  11.122  14.624  1.00 43.23  ? 517  PRO A CB  1 
ATOM   3980 C  CG  . PRO A 1 517 ? -1.646  12.298  14.686  1.00 38.01  ? 517  PRO A CG  1 
ATOM   3981 C  CD  . PRO A 1 517 ? -1.005  13.333  13.817  1.00 37.88  ? 517  PRO A CD  1 
ATOM   3982 N  N   . LEU A 1 518 ? 2.146   9.836   14.117  1.00 39.58  ? 518  LEU A N   1 
ATOM   3983 C  CA  . LEU A 1 518 ? 2.970   8.953   13.308  1.00 42.51  ? 518  LEU A CA  1 
ATOM   3984 C  C   . LEU A 1 518 ? 2.298   8.629   11.986  1.00 41.62  ? 518  LEU A C   1 
ATOM   3985 O  O   . LEU A 1 518 ? 1.143   8.214   11.949  1.00 58.47  ? 518  LEU A O   1 
ATOM   3986 C  CB  . LEU A 1 518 ? 3.264   7.647   14.046  1.00 47.87  ? 518  LEU A CB  1 
ATOM   3987 C  CG  . LEU A 1 518 ? 4.476   7.598   14.971  1.00 48.66  ? 518  LEU A CG  1 
ATOM   3988 C  CD1 . LEU A 1 518 ? 4.835   6.149   15.257  1.00 42.33  ? 518  LEU A CD1 1 
ATOM   3989 C  CD2 . LEU A 1 518 ? 5.648   8.324   14.347  1.00 50.61  ? 518  LEU A CD2 1 
ATOM   3990 N  N   . GLU A 1 519 ? 3.032   8.815   10.900  1.00 47.07  ? 519  GLU A N   1 
ATOM   3991 C  CA  . GLU A 1 519 ? 2.576   8.385   9.592   1.00 43.79  ? 519  GLU A CA  1 
ATOM   3992 C  C   . GLU A 1 519 ? 3.637   7.493   8.945   1.00 44.65  ? 519  GLU A C   1 
ATOM   3993 O  O   . GLU A 1 519 ? 4.811   7.853   8.895   1.00 48.54  ? 519  GLU A O   1 
ATOM   3994 C  CB  . GLU A 1 519 ? 2.265   9.600   8.726   1.00 42.75  ? 519  GLU A CB  1 
ATOM   3995 C  CG  . GLU A 1 519 ? 2.324   9.344   7.234   1.00 59.42  ? 519  GLU A CG  1 
ATOM   3996 C  CD  . GLU A 1 519 ? 2.242   10.630  6.434   1.00 69.07  ? 519  GLU A CD  1 
ATOM   3997 O  OE1 . GLU A 1 519 ? 1.543   11.568  6.883   1.00 78.43  ? 519  GLU A OE1 1 
ATOM   3998 O  OE2 . GLU A 1 519 ? 2.880   10.704  5.363   1.00 56.00  ? 519  GLU A OE2 1 
ATOM   3999 N  N   . VAL A 1 520 ? 3.220   6.323   8.471   1.00 39.67  ? 520  VAL A N   1 
ATOM   4000 C  CA  . VAL A 1 520 ? 4.139   5.346   7.896   1.00 41.08  ? 520  VAL A CA  1 
ATOM   4001 C  C   . VAL A 1 520 ? 4.427   5.614   6.424   1.00 48.39  ? 520  VAL A C   1 
ATOM   4002 O  O   . VAL A 1 520 ? 3.516   5.899   5.648   1.00 50.87  ? 520  VAL A O   1 
ATOM   4003 C  CB  . VAL A 1 520 ? 3.571   3.921   8.021   1.00 48.48  ? 520  VAL A CB  1 
ATOM   4004 C  CG1 . VAL A 1 520 ? 4.485   2.913   7.335   1.00 32.59  ? 520  VAL A CG1 1 
ATOM   4005 C  CG2 . VAL A 1 520 ? 3.353   3.564   9.484   1.00 41.30  ? 520  VAL A CG2 1 
ATOM   4006 N  N   . ARG A 1 521 ? 5.696   5.516   6.039   1.00 39.90  ? 521  ARG A N   1 
ATOM   4007 C  CA  . ARG A 1 521 ? 6.084   5.693   4.644   1.00 33.44  ? 521  ARG A CA  1 
ATOM   4008 C  C   . ARG A 1 521 ? 6.959   4.537   4.185   1.00 36.29  ? 521  ARG A C   1 
ATOM   4009 O  O   . ARG A 1 521 ? 7.486   3.780   5.002   1.00 32.66  ? 521  ARG A O   1 
ATOM   4010 C  CB  . ARG A 1 521 ? 6.801   7.030   4.440   1.00 38.85  ? 521  ARG A CB  1 
ATOM   4011 C  CG  . ARG A 1 521 ? 5.977   8.228   4.876   1.00 36.70  ? 521  ARG A CG  1 
ATOM   4012 C  CD  . ARG A 1 521 ? 6.697   9.550   4.651   1.00 39.36  ? 521  ARG A CD  1 
ATOM   4013 N  NE  . ARG A 1 521 ? 5.983   10.645  5.302   1.00 33.01  ? 521  ARG A NE  1 
ATOM   4014 C  CZ  . ARG A 1 521 ? 6.508   11.835  5.571   1.00 35.94  ? 521  ARG A CZ  1 
ATOM   4015 N  NH1 . ARG A 1 521 ? 7.764   12.095  5.249   1.00 40.67  ? 521  ARG A NH1 1 
ATOM   4016 N  NH2 . ARG A 1 521 ? 5.776   12.766  6.174   1.00 40.16  ? 521  ARG A NH2 1 
ATOM   4017 N  N   . ARG A 1 522 ? 7.112   4.401   2.873   1.00 31.87  ? 522  ARG A N   1 
ATOM   4018 C  CA  . ARG A 1 522 ? 7.856   3.275   2.325   1.00 42.45  ? 522  ARG A CA  1 
ATOM   4019 C  C   . ARG A 1 522 ? 8.998   3.731   1.425   1.00 47.20  ? 522  ARG A C   1 
ATOM   4020 O  O   . ARG A 1 522 ? 8.816   4.574   0.546   1.00 42.86  ? 522  ARG A O   1 
ATOM   4021 C  CB  . ARG A 1 522 ? 6.923   2.342   1.554   1.00 43.29  ? 522  ARG A CB  1 
ATOM   4022 C  CG  . ARG A 1 522 ? 5.819   1.715   2.392   1.00 53.93  ? 522  ARG A CG  1 
ATOM   4023 C  CD  . ARG A 1 522 ? 5.198   0.544   1.644   1.00 60.29  ? 522  ARG A CD  1 
ATOM   4024 N  NE  . ARG A 1 522 ? 6.225   -0.219  0.935   1.00 81.96  ? 522  ARG A NE  1 
ATOM   4025 C  CZ  . ARG A 1 522 ? 5.994   -1.313  0.215   1.00 73.80  ? 522  ARG A CZ  1 
ATOM   4026 N  NH1 . ARG A 1 522 ? 4.761   -1.790  0.106   1.00 81.39  ? 522  ARG A NH1 1 
ATOM   4027 N  NH2 . ARG A 1 522 ? 7.000   -1.931  -0.395  1.00 61.42  ? 522  ARG A NH2 1 
ATOM   4028 N  N   . GLY A 1 523 ? 10.177  3.163   1.649   1.00 41.22  ? 523  GLY A N   1 
ATOM   4029 C  CA  . GLY A 1 523 ? 11.346  3.505   0.861   1.00 43.91  ? 523  GLY A CA  1 
ATOM   4030 C  C   . GLY A 1 523 ? 11.967  4.819   1.290   1.00 48.40  ? 523  GLY A C   1 
ATOM   4031 O  O   . GLY A 1 523 ? 11.342  5.878   1.222   1.00 47.88  ? 523  GLY A O   1 
ATOM   4032 N  N   . LEU A 1 524 ? 13.210  4.750   1.743   1.00 40.10  ? 524  LEU A N   1 
ATOM   4033 C  CA  . LEU A 1 524 ? 13.920  5.947   2.146   1.00 40.17  ? 524  LEU A CA  1 
ATOM   4034 C  C   . LEU A 1 524 ? 14.777  6.398   0.973   1.00 40.04  ? 524  LEU A C   1 
ATOM   4035 O  O   . LEU A 1 524 ? 15.860  5.856   0.748   1.00 40.60  ? 524  LEU A O   1 
ATOM   4036 C  CB  . LEU A 1 524 ? 14.780  5.648   3.371   1.00 43.02  ? 524  LEU A CB  1 
ATOM   4037 C  CG  . LEU A 1 524 ? 14.826  6.717   4.462   1.00 62.24  ? 524  LEU A CG  1 
ATOM   4038 C  CD1 . LEU A 1 524 ? 13.700  7.731   4.288   1.00 65.49  ? 524  LEU A CD1 1 
ATOM   4039 C  CD2 . LEU A 1 524 ? 14.762  6.060   5.833   1.00 54.00  ? 524  LEU A CD2 1 
ATOM   4040 N  N   . ARG A 1 525 ? 14.280  7.374   0.217   1.00 38.47  ? 525  ARG A N   1 
ATOM   4041 C  CA  . ARG A 1 525 ? 14.940  7.798   -1.016  1.00 40.18  ? 525  ARG A CA  1 
ATOM   4042 C  C   . ARG A 1 525 ? 15.419  6.594   -1.811  1.00 44.54  ? 525  ARG A C   1 
ATOM   4043 O  O   . ARG A 1 525 ? 16.549  6.585   -2.296  1.00 42.27  ? 525  ARG A O   1 
ATOM   4044 C  CB  . ARG A 1 525 ? 16.153  8.670   -0.706  1.00 47.63  ? 525  ARG A CB  1 
ATOM   4045 C  CG  . ARG A 1 525 ? 15.838  9.996   -0.073  1.00 50.78  ? 525  ARG A CG  1 
ATOM   4046 C  CD  . ARG A 1 525 ? 15.595  11.069  -1.108  1.00 48.23  ? 525  ARG A CD  1 
ATOM   4047 N  NE  . ARG A 1 525 ? 16.066  12.355  -0.611  1.00 55.30  ? 525  ARG A NE  1 
ATOM   4048 C  CZ  . ARG A 1 525 ? 15.580  12.958  0.467   1.00 59.63  ? 525  ARG A CZ  1 
ATOM   4049 N  NH1 . ARG A 1 525 ? 14.601  12.391  1.163   1.00 68.69  ? 525  ARG A NH1 1 
ATOM   4050 N  NH2 . ARG A 1 525 ? 16.075  14.126  0.854   1.00 64.65  ? 525  ARG A NH2 1 
ATOM   4051 N  N   . ALA A 1 526 ? 14.571  5.577   -1.938  1.00 37.61  ? 526  ALA A N   1 
ATOM   4052 C  CA  . ALA A 1 526 ? 14.988  4.322   -2.554  1.00 37.74  ? 526  ALA A CA  1 
ATOM   4053 C  C   . ALA A 1 526 ? 15.621  4.532   -3.929  1.00 43.73  ? 526  ALA A C   1 
ATOM   4054 O  O   . ALA A 1 526 ? 16.730  4.071   -4.190  1.00 35.03  ? 526  ALA A O   1 
ATOM   4055 C  CB  . ALA A 1 526 ? 13.819  3.361   -2.647  1.00 43.16  ? 526  ALA A CB  1 
ATOM   4056 N  N   . GLN A 1 527 ? 14.916  5.239   -4.803  1.00 35.57  ? 527  GLN A N   1 
ATOM   4057 C  CA  . GLN A 1 527 ? 15.372  5.413   -6.176  1.00 41.60  ? 527  GLN A CA  1 
ATOM   4058 C  C   . GLN A 1 527 ? 16.724  6.122   -6.229  1.00 36.26  ? 527  GLN A C   1 
ATOM   4059 O  O   . GLN A 1 527 ? 17.668  5.638   -6.851  1.00 42.99  ? 527  GLN A O   1 
ATOM   4060 C  CB  . GLN A 1 527 ? 14.321  6.178   -6.985  1.00 33.70  ? 527  GLN A CB  1 
ATOM   4061 C  CG  . GLN A 1 527 ? 14.227  5.754   -8.435  1.00 40.12  ? 527  GLN A CG  1 
ATOM   4062 C  CD  . GLN A 1 527 ? 13.989  4.259   -8.609  1.00 51.82  ? 527  GLN A CD  1 
ATOM   4063 O  OE1 . GLN A 1 527 ? 13.389  3.603   -7.752  1.00 47.42  ? 527  GLN A OE1 1 
ATOM   4064 N  NE2 . GLN A 1 527 ? 14.452  3.717   -9.732  1.00 47.63  ? 527  GLN A NE2 1 
ATOM   4065 N  N   . THR A 1 528 ? 16.812  7.267   -5.562  1.00 39.59  ? 528  THR A N   1 
ATOM   4066 C  CA  . THR A 1 528 ? 18.042  8.049   -5.523  1.00 31.34  ? 528  THR A CA  1 
ATOM   4067 C  C   . THR A 1 528 ? 19.175  7.337   -4.787  1.00 34.84  ? 528  THR A C   1 
ATOM   4068 O  O   . THR A 1 528 ? 20.331  7.394   -5.203  1.00 38.82  ? 528  THR A O   1 
ATOM   4069 C  CB  . THR A 1 528 ? 17.801  9.400   -4.854  1.00 40.24  ? 528  THR A CB  1 
ATOM   4070 O  OG1 . THR A 1 528 ? 16.955  10.191  -5.694  1.00 40.22  ? 528  THR A OG1 1 
ATOM   4071 C  CG2 . THR A 1 528 ? 19.116  10.129  -4.624  1.00 34.90  ? 528  THR A CG2 1 
ATOM   4072 N  N   . CYS A 1 529 ? 18.852  6.664   -3.690  1.00 29.30  ? 529  CYS A N   1 
ATOM   4073 C  CA  . CYS A 1 529 ? 19.886  5.963   -2.941  1.00 35.35  ? 529  CYS A CA  1 
ATOM   4074 C  C   . CYS A 1 529 ? 20.431  4.747   -3.693  1.00 34.93  ? 529  CYS A C   1 
ATOM   4075 O  O   . CYS A 1 529 ? 21.554  4.314   -3.444  1.00 36.96  ? 529  CYS A O   1 
ATOM   4076 C  CB  . CYS A 1 529 ? 19.423  5.623   -1.520  1.00 26.97  ? 529  CYS A CB  1 
ATOM   4077 S  SG  . CYS A 1 529 ? 19.422  7.087   -0.404  1.00 33.35  ? 529  CYS A SG  1 
ATOM   4078 N  N   . ALA A 1 530 ? 19.654  4.216   -4.632  1.00 28.90  ? 530  ALA A N   1 
ATOM   4079 C  CA  . ALA A 1 530 ? 20.170  3.168   -5.508  1.00 35.44  ? 530  ALA A CA  1 
ATOM   4080 C  C   . ALA A 1 530 ? 21.295  3.736   -6.360  1.00 39.39  ? 530  ALA A C   1 
ATOM   4081 O  O   . ALA A 1 530 ? 22.270  3.045   -6.664  1.00 38.06  ? 530  ALA A O   1 
ATOM   4082 C  CB  . ALA A 1 530 ? 19.076  2.594   -6.387  1.00 31.43  ? 530  ALA A CB  1 
ATOM   4083 N  N   . PHE A 1 531 ? 21.153  5.001   -6.743  1.00 28.77  ? 531  PHE A N   1 
ATOM   4084 C  CA  . PHE A 1 531 ? 22.219  5.693   -7.454  1.00 35.06  ? 531  PHE A CA  1 
ATOM   4085 C  C   . PHE A 1 531 ? 23.497  5.795   -6.617  1.00 32.32  ? 531  PHE A C   1 
ATOM   4086 O  O   . PHE A 1 531 ? 24.575  5.427   -7.080  1.00 33.56  ? 531  PHE A O   1 
ATOM   4087 C  CB  . PHE A 1 531 ? 21.772  7.086   -7.898  1.00 35.55  ? 531  PHE A CB  1 
ATOM   4088 C  CG  . PHE A 1 531 ? 22.897  7.954   -8.376  1.00 40.54  ? 531  PHE A CG  1 
ATOM   4089 C  CD1 . PHE A 1 531 ? 23.439  7.775   -9.637  1.00 41.61  ? 531  PHE A CD1 1 
ATOM   4090 C  CD2 . PHE A 1 531 ? 23.423  8.942   -7.559  1.00 40.88  ? 531  PHE A CD2 1 
ATOM   4091 C  CE1 . PHE A 1 531 ? 24.477  8.569   -10.079 1.00 44.59  ? 531  PHE A CE1 1 
ATOM   4092 C  CE2 . PHE A 1 531 ? 24.464  9.738   -7.996  1.00 35.10  ? 531  PHE A CE2 1 
ATOM   4093 C  CZ  . PHE A 1 531 ? 24.989  9.553   -9.257  1.00 43.64  ? 531  PHE A CZ  1 
ATOM   4094 N  N   . TRP A 1 532 ? 23.372  6.294   -5.390  1.00 32.00  ? 532  TRP A N   1 
ATOM   4095 C  CA  . TRP A 1 532 ? 24.527  6.461   -4.499  1.00 35.73  ? 532  TRP A CA  1 
ATOM   4096 C  C   . TRP A 1 532 ? 25.120  5.142   -4.009  1.00 38.09  ? 532  TRP A C   1 
ATOM   4097 O  O   . TRP A 1 532 ? 26.342  4.988   -3.956  1.00 36.27  ? 532  TRP A O   1 
ATOM   4098 C  CB  . TRP A 1 532 ? 24.167  7.322   -3.285  1.00 29.10  ? 532  TRP A CB  1 
ATOM   4099 C  CG  . TRP A 1 532 ? 23.889  8.754   -3.619  1.00 32.84  ? 532  TRP A CG  1 
ATOM   4100 C  CD1 . TRP A 1 532 ? 22.670  9.367   -3.651  1.00 28.70  ? 532  TRP A CD1 1 
ATOM   4101 C  CD2 . TRP A 1 532 ? 24.852  9.755   -3.969  1.00 26.70  ? 532  TRP A CD2 1 
ATOM   4102 N  NE1 . TRP A 1 532 ? 22.814  10.685  -4.000  1.00 28.84  ? 532  TRP A NE1 1 
ATOM   4103 C  CE2 . TRP A 1 532 ? 24.143  10.950  -4.201  1.00 27.46  ? 532  TRP A CE2 1 
ATOM   4104 C  CE3 . TRP A 1 532 ? 26.246  9.757   -4.108  1.00 31.71  ? 532  TRP A CE3 1 
ATOM   4105 C  CZ2 . TRP A 1 532 ? 24.778  12.138  -4.565  1.00 26.85  ? 532  TRP A CZ2 1 
ATOM   4106 C  CZ3 . TRP A 1 532 ? 26.877  10.938  -4.467  1.00 24.29  ? 532  TRP A CZ3 1 
ATOM   4107 C  CH2 . TRP A 1 532 ? 26.141  12.113  -4.691  1.00 30.45  ? 532  TRP A CH2 1 
ATOM   4108 N  N   . ASN A 1 533 ? 24.258  4.198   -3.645  1.00 28.89  ? 533  ASN A N   1 
ATOM   4109 C  CA  . ASN A 1 533 ? 24.712  2.961   -3.014  1.00 35.67  ? 533  ASN A CA  1 
ATOM   4110 C  C   . ASN A 1 533 ? 25.110  1.835   -3.972  1.00 36.95  ? 533  ASN A C   1 
ATOM   4111 O  O   . ASN A 1 533 ? 26.011  1.060   -3.672  1.00 38.35  ? 533  ASN A O   1 
ATOM   4112 C  CB  . ASN A 1 533 ? 23.675  2.468   -2.004  1.00 35.43  ? 533  ASN A CB  1 
ATOM   4113 C  CG  . ASN A 1 533 ? 23.393  3.488   -0.922  1.00 34.68  ? 533  ASN A CG  1 
ATOM   4114 O  OD1 . ASN A 1 533 ? 24.183  4.400   -0.703  1.00 32.57  ? 533  ASN A OD1 1 
ATOM   4115 N  ND2 . ASN A 1 533 ? 22.258  3.341   -0.242  1.00 36.98  ? 533  ASN A ND2 1 
ATOM   4116 N  N   . ARG A 1 534 ? 24.453  1.752   -5.124  1.00 36.58  ? 534  ARG A N   1 
ATOM   4117 C  CA  . ARG A 1 534 ? 24.734  0.673   -6.064  1.00 35.57  ? 534  ARG A CA  1 
ATOM   4118 C  C   . ARG A 1 534 ? 25.528  1.119   -7.281  1.00 43.33  ? 534  ARG A C   1 
ATOM   4119 O  O   . ARG A 1 534 ? 26.531  0.498   -7.636  1.00 49.64  ? 534  ARG A O   1 
ATOM   4120 C  CB  . ARG A 1 534 ? 23.441  0.004   -6.521  1.00 36.10  ? 534  ARG A CB  1 
ATOM   4121 C  CG  . ARG A 1 534 ? 22.709  -0.724  -5.416  1.00 45.41  ? 534  ARG A CG  1 
ATOM   4122 C  CD  . ARG A 1 534 ? 21.243  -0.898  -5.759  1.00 43.10  ? 534  ARG A CD  1 
ATOM   4123 N  NE  . ARG A 1 534 ? 20.460  -1.279  -4.589  1.00 45.82  ? 534  ARG A NE  1 
ATOM   4124 C  CZ  . ARG A 1 534 ? 20.335  -2.527  -4.150  1.00 55.48  ? 534  ARG A CZ  1 
ATOM   4125 N  NH1 . ARG A 1 534 ? 20.946  -3.524  -4.782  1.00 41.25  ? 534  ARG A NH1 1 
ATOM   4126 N  NH2 . ARG A 1 534 ? 19.597  -2.779  -3.078  1.00 47.30  ? 534  ARG A NH2 1 
ATOM   4127 N  N   . PHE A 1 535 ? 25.082  2.185   -7.930  1.00 37.26  ? 535  PHE A N   1 
ATOM   4128 C  CA  . PHE A 1 535 ? 25.704  2.572   -9.190  1.00 42.62  ? 535  PHE A CA  1 
ATOM   4129 C  C   . PHE A 1 535 ? 27.007  3.330   -9.009  1.00 37.49  ? 535  PHE A C   1 
ATOM   4130 O  O   . PHE A 1 535 ? 27.997  3.030   -9.664  1.00 43.83  ? 535  PHE A O   1 
ATOM   4131 C  CB  . PHE A 1 535 ? 24.756  3.395   -10.060 1.00 36.08  ? 535  PHE A CB  1 
ATOM   4132 C  CG  . PHE A 1 535 ? 25.382  3.854   -11.337 1.00 33.76  ? 535  PHE A CG  1 
ATOM   4133 C  CD1 . PHE A 1 535 ? 25.737  2.936   -12.311 1.00 38.35  ? 535  PHE A CD1 1 
ATOM   4134 C  CD2 . PHE A 1 535 ? 25.652  5.194   -11.555 1.00 37.97  ? 535  PHE A CD2 1 
ATOM   4135 C  CE1 . PHE A 1 535 ? 26.335  3.346   -13.488 1.00 31.02  ? 535  PHE A CE1 1 
ATOM   4136 C  CE2 . PHE A 1 535 ? 26.246  5.610   -12.733 1.00 44.21  ? 535  PHE A CE2 1 
ATOM   4137 C  CZ  . PHE A 1 535 ? 26.588  4.683   -13.700 1.00 33.66  ? 535  PHE A CZ  1 
ATOM   4138 N  N   . LEU A 1 536 ? 26.994  4.317   -8.123  1.00 40.10  ? 536  LEU A N   1 
ATOM   4139 C  CA  . LEU A 1 536 ? 28.127  5.218   -7.958  1.00 38.30  ? 536  LEU A CA  1 
ATOM   4140 C  C   . LEU A 1 536 ? 29.447  4.483   -7.724  1.00 50.25  ? 536  LEU A C   1 
ATOM   4141 O  O   . LEU A 1 536 ? 30.441  4.767   -8.389  1.00 45.19  ? 536  LEU A O   1 
ATOM   4142 C  CB  . LEU A 1 536 ? 27.854  6.203   -6.825  1.00 41.59  ? 536  LEU A CB  1 
ATOM   4143 C  CG  . LEU A 1 536 ? 28.436  7.597   -7.034  1.00 54.82  ? 536  LEU A CG  1 
ATOM   4144 C  CD1 . LEU A 1 536 ? 29.909  7.618   -6.700  1.00 55.98  ? 536  LEU A CD1 1 
ATOM   4145 C  CD2 . LEU A 1 536 ? 28.195  8.045   -8.468  1.00 53.69  ? 536  LEU A CD2 1 
ATOM   4146 N  N   . PRO A 1 537 ? 29.465  3.533   -6.774  1.00 50.63  ? 537  PRO A N   1 
ATOM   4147 C  CA  . PRO A 1 537 ? 30.707  2.797   -6.528  1.00 46.50  ? 537  PRO A CA  1 
ATOM   4148 C  C   . PRO A 1 537 ? 31.267  2.207   -7.814  1.00 52.78  ? 537  PRO A C   1 
ATOM   4149 O  O   . PRO A 1 537 ? 32.459  2.350   -8.086  1.00 62.70  ? 537  PRO A O   1 
ATOM   4150 C  CB  . PRO A 1 537 ? 30.265  1.675   -5.592  1.00 40.85  ? 537  PRO A CB  1 
ATOM   4151 C  CG  . PRO A 1 537 ? 29.093  2.229   -4.883  1.00 41.35  ? 537  PRO A CG  1 
ATOM   4152 C  CD  . PRO A 1 537 ? 28.380  3.097   -5.878  1.00 38.16  ? 537  PRO A CD  1 
ATOM   4153 N  N   . LYS A 1 538 ? 30.410  1.560   -8.596  1.00 51.88  ? 538  LYS A N   1 
ATOM   4154 C  CA  . LYS A 1 538 ? 30.833  0.929   -9.842  1.00 53.69  ? 538  LYS A CA  1 
ATOM   4155 C  C   . LYS A 1 538 ? 31.305  1.937   -10.890 1.00 44.60  ? 538  LYS A C   1 
ATOM   4156 O  O   . LYS A 1 538 ? 32.152  1.625   -11.723 1.00 54.43  ? 538  LYS A O   1 
ATOM   4157 C  CB  . LYS A 1 538 ? 29.720  0.037   -10.397 1.00 43.33  ? 538  LYS A CB  1 
ATOM   4158 C  CG  . LYS A 1 538 ? 29.296  -1.052  -9.423  1.00 56.54  ? 538  LYS A CG  1 
ATOM   4159 C  CD  . LYS A 1 538 ? 28.772  -2.282  -10.136 1.00 70.33  ? 538  LYS A CD  1 
ATOM   4160 C  CE  . LYS A 1 538 ? 28.769  -3.493  -9.210  1.00 83.07  ? 538  LYS A CE  1 
ATOM   4161 N  NZ  . LYS A 1 538 ? 28.697  -4.778  -9.967  1.00 83.88  ? 538  LYS A NZ  1 
ATOM   4162 N  N   . LEU A 1 539 ? 30.770  3.150   -10.833 1.00 48.19  ? 539  LEU A N   1 
ATOM   4163 C  CA  . LEU A 1 539 ? 31.166  4.192   -11.776 1.00 53.74  ? 539  LEU A CA  1 
ATOM   4164 C  C   . LEU A 1 539 ? 32.531  4.764   -11.432 1.00 60.86  ? 539  LEU A C   1 
ATOM   4165 O  O   . LEU A 1 539 ? 33.308  5.119   -12.317 1.00 64.03  ? 539  LEU A O   1 
ATOM   4166 C  CB  . LEU A 1 539 ? 30.135  5.319   -11.812 1.00 53.66  ? 539  LEU A CB  1 
ATOM   4167 C  CG  . LEU A 1 539 ? 30.556  6.514   -12.667 1.00 51.74  ? 539  LEU A CG  1 
ATOM   4168 C  CD1 . LEU A 1 539 ? 30.897  6.057   -14.077 1.00 45.94  ? 539  LEU A CD1 1 
ATOM   4169 C  CD2 . LEU A 1 539 ? 29.466  7.564   -12.689 1.00 45.06  ? 539  LEU A CD2 1 
ATOM   4170 N  N   . LEU A 1 540 ? 32.817  4.862   -10.139 1.00 71.69  ? 540  LEU A N   1 
ATOM   4171 C  CA  . LEU A 1 540 ? 34.105  5.372   -9.686  1.00 69.44  ? 540  LEU A CA  1 
ATOM   4172 C  C   . LEU A 1 540 ? 35.235  4.398   -10.006 1.00 79.49  ? 540  LEU A C   1 
ATOM   4173 O  O   . LEU A 1 540 ? 36.298  4.809   -10.477 1.00 84.68  ? 540  LEU A O   1 
ATOM   4174 C  CB  . LEU A 1 540 ? 34.069  5.678   -8.190  1.00 60.87  ? 540  LEU A CB  1 
ATOM   4175 C  CG  . LEU A 1 540 ? 33.333  6.964   -7.817  1.00 61.82  ? 540  LEU A CG  1 
ATOM   4176 C  CD1 . LEU A 1 540 ? 33.052  6.995   -6.326  1.00 39.56  ? 540  LEU A CD1 1 
ATOM   4177 C  CD2 . LEU A 1 540 ? 34.127  8.197   -8.254  1.00 50.25  ? 540  LEU A CD2 1 
ATOM   4178 N  N   . SER A 1 541 ? 35.005  3.111   -9.753  1.00 67.92  ? 541  SER A N   1 
ATOM   4179 C  CA  . SER A 1 541 ? 35.975  2.079   -10.113 1.00 62.90  ? 541  SER A CA  1 
ATOM   4180 C  C   . SER A 1 541 ? 35.910  1.783   -11.610 1.00 75.14  ? 541  SER A C   1 
ATOM   4181 O  O   . SER A 1 541 ? 35.555  0.677   -12.022 1.00 87.70  ? 541  SER A O   1 
ATOM   4182 C  CB  . SER A 1 541 ? 35.751  0.800   -9.296  1.00 54.21  ? 541  SER A CB  1 
ATOM   4183 O  OG  . SER A 1 541 ? 34.508  0.191   -9.595  1.00 72.03  ? 541  SER A OG  1 
ATOM   4184 N  N   . ALA A 1 542 ? 36.254  2.788   -12.411 1.00 72.72  ? 542  ALA A N   1 
ATOM   4185 C  CA  . ALA A 1 542 ? 36.213  2.692   -13.867 1.00 68.74  ? 542  ALA A CA  1 
ATOM   4186 C  C   . ALA A 1 542 ? 36.413  4.071   -14.485 1.00 52.86  ? 542  ALA A C   1 
ATOM   4187 O  O   . ALA A 1 542 ? 36.763  5.026   -13.789 1.00 65.37  ? 542  ALA A O   1 
ATOM   4188 C  CB  . ALA A 1 542 ? 34.895  2.085   -14.332 1.00 66.60  ? 542  ALA A CB  1 
ATOM   4189 N  N   . GLU B 1 4   ? -16.592 5.381   -69.835 1.00 76.99  ? 4    GLU B N   1 
ATOM   4190 C  CA  . GLU B 1 4   ? -15.369 6.130   -69.572 1.00 78.80  ? 4    GLU B CA  1 
ATOM   4191 C  C   . GLU B 1 4   ? -15.652 7.402   -68.774 1.00 80.29  ? 4    GLU B C   1 
ATOM   4192 O  O   . GLU B 1 4   ? -16.161 8.389   -69.307 1.00 77.30  ? 4    GLU B O   1 
ATOM   4193 C  CB  . GLU B 1 4   ? -14.654 6.470   -70.881 1.00 73.71  ? 4    GLU B CB  1 
ATOM   4194 C  CG  . GLU B 1 4   ? -13.258 7.055   -70.702 1.00 89.79  ? 4    GLU B CG  1 
ATOM   4195 C  CD  . GLU B 1 4   ? -12.233 6.028   -70.237 1.00 95.56  ? 4    GLU B CD  1 
ATOM   4196 O  OE1 . GLU B 1 4   ? -12.540 5.237   -69.318 1.00 93.73  ? 4    GLU B OE1 1 
ATOM   4197 O  OE2 . GLU B 1 4   ? -11.110 6.022   -70.788 1.00 79.74  ? 4    GLU B OE2 1 
ATOM   4198 N  N   . ASP B 1 5   ? -15.308 7.368   -67.492 1.00 73.63  ? 5    ASP B N   1 
ATOM   4199 C  CA  . ASP B 1 5   ? -15.584 8.470   -66.579 1.00 59.96  ? 5    ASP B CA  1 
ATOM   4200 C  C   . ASP B 1 5   ? -14.453 9.496   -66.585 1.00 59.97  ? 5    ASP B C   1 
ATOM   4201 O  O   . ASP B 1 5   ? -13.359 9.221   -66.100 1.00 67.01  ? 5    ASP B O   1 
ATOM   4202 C  CB  . ASP B 1 5   ? -15.784 7.914   -65.173 1.00 57.35  ? 5    ASP B CB  1 
ATOM   4203 C  CG  . ASP B 1 5   ? -16.199 8.970   -64.176 1.00 62.46  ? 5    ASP B CG  1 
ATOM   4204 O  OD1 . ASP B 1 5   ? -16.723 8.579   -63.111 1.00 48.11  ? 5    ASP B OD1 1 
ATOM   4205 O  OD2 . ASP B 1 5   ? -16.005 10.175  -64.447 1.00 57.80  ? 5    ASP B OD2 1 
ATOM   4206 N  N   . PRO B 1 6   ? -14.723 10.692  -67.126 1.00 61.40  ? 6    PRO B N   1 
ATOM   4207 C  CA  . PRO B 1 6   ? -13.726 11.759  -67.279 1.00 62.88  ? 6    PRO B CA  1 
ATOM   4208 C  C   . PRO B 1 6   ? -13.034 12.083  -65.960 1.00 63.99  ? 6    PRO B C   1 
ATOM   4209 O  O   . PRO B 1 6   ? -11.873 12.497  -65.948 1.00 59.46  ? 6    PRO B O   1 
ATOM   4210 C  CB  . PRO B 1 6   ? -14.564 12.962  -67.731 1.00 54.32  ? 6    PRO B CB  1 
ATOM   4211 C  CG  . PRO B 1 6   ? -15.782 12.369  -68.345 1.00 66.72  ? 6    PRO B CG  1 
ATOM   4212 C  CD  . PRO B 1 6   ? -16.062 11.118  -67.565 1.00 64.25  ? 6    PRO B CD  1 
ATOM   4213 N  N   . GLN B 1 7   ? -13.755 11.904  -64.860 1.00 56.29  ? 7    GLN B N   1 
ATOM   4214 C  CA  . GLN B 1 7   ? -13.196 12.133  -63.539 1.00 55.48  ? 7    GLN B CA  1 
ATOM   4215 C  C   . GLN B 1 7   ? -12.084 11.142  -63.232 1.00 56.64  ? 7    GLN B C   1 
ATOM   4216 O  O   . GLN B 1 7   ? -11.244 11.393  -62.374 1.00 58.55  ? 7    GLN B O   1 
ATOM   4217 C  CB  . GLN B 1 7   ? -14.291 12.034  -62.474 1.00 63.36  ? 7    GLN B CB  1 
ATOM   4218 C  CG  . GLN B 1 7   ? -15.007 13.343  -62.216 1.00 52.81  ? 7    GLN B CG  1 
ATOM   4219 C  CD  . GLN B 1 7   ? -14.046 14.442  -61.825 1.00 69.19  ? 7    GLN B CD  1 
ATOM   4220 O  OE1 . GLN B 1 7   ? -13.091 14.208  -61.083 1.00 83.25  ? 7    GLN B OE1 1 
ATOM   4221 N  NE2 . GLN B 1 7   ? -14.286 15.647  -62.325 1.00 69.63  ? 7    GLN B NE2 1 
ATOM   4222 N  N   . LEU B 1 8   ? -12.086 10.015  -63.938 1.00 50.06  ? 8    LEU B N   1 
ATOM   4223 C  CA  . LEU B 1 8   ? -11.127 8.946   -63.683 1.00 47.56  ? 8    LEU B CA  1 
ATOM   4224 C  C   . LEU B 1 8   ? -9.995  8.906   -64.706 1.00 49.52  ? 8    LEU B C   1 
ATOM   4225 O  O   . LEU B 1 8   ? -9.156  8.008   -64.681 1.00 52.76  ? 8    LEU B O   1 
ATOM   4226 C  CB  . LEU B 1 8   ? -11.835 7.592   -63.626 1.00 45.03  ? 8    LEU B CB  1 
ATOM   4227 C  CG  . LEU B 1 8   ? -12.860 7.452   -62.502 1.00 52.31  ? 8    LEU B CG  1 
ATOM   4228 C  CD1 . LEU B 1 8   ? -13.194 5.990   -62.268 1.00 43.00  ? 8    LEU B CD1 1 
ATOM   4229 C  CD2 . LEU B 1 8   ? -12.323 8.082   -61.232 1.00 48.54  ? 8    LEU B CD2 1 
ATOM   4230 N  N   . LEU B 1 9   ? -9.971  9.885   -65.600 1.00 47.60  ? 9    LEU B N   1 
ATOM   4231 C  CA  . LEU B 1 9   ? -8.925  9.956   -66.608 1.00 46.40  ? 9    LEU B CA  1 
ATOM   4232 C  C   . LEU B 1 9   ? -7.976  11.113  -66.346 1.00 55.18  ? 9    LEU B C   1 
ATOM   4233 O  O   . LEU B 1 9   ? -8.381  12.275  -66.368 1.00 53.72  ? 9    LEU B O   1 
ATOM   4234 C  CB  . LEU B 1 9   ? -9.530  10.084  -68.005 1.00 50.13  ? 9    LEU B CB  1 
ATOM   4235 C  CG  . LEU B 1 9   ? -9.625  8.805   -68.832 1.00 63.32  ? 9    LEU B CG  1 
ATOM   4236 C  CD1 . LEU B 1 9   ? -10.478 9.043   -70.063 1.00 67.04  ? 9    LEU B CD1 1 
ATOM   4237 C  CD2 . LEU B 1 9   ? -8.230  8.330   -69.222 1.00 62.10  ? 9    LEU B CD2 1 
ATOM   4238 N  N   . VAL B 1 10  ? -6.710  10.791  -66.103 1.00 44.89  ? 10   VAL B N   1 
ATOM   4239 C  CA  . VAL B 1 10  ? -5.701  11.816  -65.885 1.00 39.57  ? 10   VAL B CA  1 
ATOM   4240 C  C   . VAL B 1 10  ? -4.536  11.643  -66.850 1.00 45.27  ? 10   VAL B C   1 
ATOM   4241 O  O   . VAL B 1 10  ? -4.171  10.521  -67.208 1.00 48.39  ? 10   VAL B O   1 
ATOM   4242 C  CB  . VAL B 1 10  ? -5.150  11.789  -64.442 1.00 44.86  ? 10   VAL B CB  1 
ATOM   4243 C  CG1 . VAL B 1 10  ? -4.285  13.017  -64.179 1.00 36.04  ? 10   VAL B CG1 1 
ATOM   4244 C  CG2 . VAL B 1 10  ? -6.286  11.712  -63.436 1.00 44.93  ? 10   VAL B CG2 1 
ATOM   4245 N  N   . ARG B 1 11  ? -3.962  12.765  -67.270 1.00 33.50  ? 11   ARG B N   1 
ATOM   4246 C  CA  . ARG B 1 11  ? -2.752  12.752  -68.071 1.00 46.11  ? 11   ARG B CA  1 
ATOM   4247 C  C   . ARG B 1 11  ? -1.599  13.332  -67.271 1.00 49.55  ? 11   ARG B C   1 
ATOM   4248 O  O   . ARG B 1 11  ? -1.601  14.510  -66.908 1.00 44.98  ? 11   ARG B O   1 
ATOM   4249 C  CB  . ARG B 1 11  ? -2.930  13.542  -69.368 1.00 45.62  ? 11   ARG B CB  1 
ATOM   4250 C  CG  . ARG B 1 11  ? -1.609  14.016  -69.963 1.00 51.76  ? 11   ARG B CG  1 
ATOM   4251 C  CD  . ARG B 1 11  ? -1.775  14.576  -71.362 1.00 61.76  ? 11   ARG B CD  1 
ATOM   4252 N  NE  . ARG B 1 11  ? -1.760  13.515  -72.363 1.00 91.83  ? 11   ARG B NE  1 
ATOM   4253 C  CZ  . ARG B 1 11  ? -2.837  12.844  -72.758 1.00 93.23  ? 11   ARG B CZ  1 
ATOM   4254 N  NH1 . ARG B 1 11  ? -4.026  13.126  -72.240 1.00 98.06  ? 11   ARG B NH1 1 
ATOM   4255 N  NH2 . ARG B 1 11  ? -2.726  11.891  -73.675 1.00 77.03  ? 11   ARG B NH2 1 
ATOM   4256 N  N   . VAL B 1 12  ? -0.616  12.488  -66.990 1.00 46.50  ? 12   VAL B N   1 
ATOM   4257 C  CA  . VAL B 1 12  ? 0.597   12.929  -66.334 1.00 46.95  ? 12   VAL B CA  1 
ATOM   4258 C  C   . VAL B 1 12  ? 1.680   13.027  -67.397 1.00 44.05  ? 12   VAL B C   1 
ATOM   4259 O  O   . VAL B 1 12  ? 1.433   12.708  -68.559 1.00 42.97  ? 12   VAL B O   1 
ATOM   4260 C  CB  . VAL B 1 12  ? 1.008   11.950  -65.227 1.00 50.57  ? 12   VAL B CB  1 
ATOM   4261 C  CG1 . VAL B 1 12  ? -0.125  11.800  -64.224 1.00 41.20  ? 12   VAL B CG1 1 
ATOM   4262 C  CG2 . VAL B 1 12  ? 1.368   10.599  -65.822 1.00 45.52  ? 12   VAL B CG2 1 
ATOM   4263 N  N   . ARG B 1 13  ? 2.871   13.467  -67.008 1.00 42.60  ? 13   ARG B N   1 
ATOM   4264 C  CA  . ARG B 1 13  ? 3.960   13.642  -67.961 1.00 39.93  ? 13   ARG B CA  1 
ATOM   4265 C  C   . ARG B 1 13  ? 4.277   12.371  -68.744 1.00 42.77  ? 13   ARG B C   1 
ATOM   4266 O  O   . ARG B 1 13  ? 4.802   12.437  -69.851 1.00 44.54  ? 13   ARG B O   1 
ATOM   4267 C  CB  . ARG B 1 13  ? 5.223   14.137  -67.255 1.00 45.10  ? 13   ARG B CB  1 
ATOM   4268 C  CG  . ARG B 1 13  ? 5.167   15.587  -66.802 1.00 58.19  ? 13   ARG B CG  1 
ATOM   4269 C  CD  . ARG B 1 13  ? 6.564   16.101  -66.500 1.00 77.05  ? 13   ARG B CD  1 
ATOM   4270 N  NE  . ARG B 1 13  ? 6.554   17.397  -65.826 1.00 96.03  ? 13   ARG B NE  1 
ATOM   4271 C  CZ  . ARG B 1 13  ? 7.636   17.975  -65.311 1.00 98.50  ? 13   ARG B CZ  1 
ATOM   4272 N  NH1 . ARG B 1 13  ? 8.814   17.369  -65.393 1.00 98.90  ? 13   ARG B NH1 1 
ATOM   4273 N  NH2 . ARG B 1 13  ? 7.545   19.154  -64.711 1.00 86.06  ? 13   ARG B NH2 1 
ATOM   4274 N  N   . GLY B 1 14  ? 3.960   11.215  -68.171 1.00 39.36  ? 14   GLY B N   1 
ATOM   4275 C  CA  . GLY B 1 14  ? 4.333   9.951   -68.773 1.00 37.84  ? 14   GLY B CA  1 
ATOM   4276 C  C   . GLY B 1 14  ? 3.293   9.378   -69.714 1.00 45.61  ? 14   GLY B C   1 
ATOM   4277 O  O   . GLY B 1 14  ? 3.558   8.413   -70.431 1.00 42.54  ? 14   GLY B O   1 
ATOM   4278 N  N   . GLY B 1 15  ? 2.105   9.969   -69.716 1.00 44.12  ? 15   GLY B N   1 
ATOM   4279 C  CA  . GLY B 1 15  ? 1.021   9.472   -70.541 1.00 36.79  ? 15   GLY B CA  1 
ATOM   4280 C  C   . GLY B 1 15  ? -0.295  9.463   -69.790 1.00 44.86  ? 15   GLY B C   1 
ATOM   4281 O  O   . GLY B 1 15  ? -0.458  10.182  -68.803 1.00 46.93  ? 15   GLY B O   1 
ATOM   4282 N  N   . GLN B 1 16  ? -1.233  8.639   -70.246 1.00 42.10  ? 16   GLN B N   1 
ATOM   4283 C  CA  . GLN B 1 16  ? -2.573  8.637   -69.672 1.00 49.59  ? 16   GLN B CA  1 
ATOM   4284 C  C   . GLN B 1 16  ? -2.825  7.519   -68.668 1.00 44.69  ? 16   GLN B C   1 
ATOM   4285 O  O   . GLN B 1 16  ? -2.334  6.401   -68.820 1.00 48.29  ? 16   GLN B O   1 
ATOM   4286 C  CB  . GLN B 1 16  ? -3.633  8.608   -70.772 1.00 53.34  ? 16   GLN B CB  1 
ATOM   4287 C  CG  . GLN B 1 16  ? -3.922  9.971   -71.357 1.00 60.51  ? 16   GLN B CG  1 
ATOM   4288 C  CD  . GLN B 1 16  ? -5.273  10.030  -72.040 1.00 91.25  ? 16   GLN B CD  1 
ATOM   4289 O  OE1 . GLN B 1 16  ? -5.570  9.229   -72.930 1.00 70.29  ? 16   GLN B OE1 1 
ATOM   4290 N  NE2 . GLN B 1 16  ? -6.101  10.984  -71.625 1.00 90.85  ? 16   GLN B NE2 1 
ATOM   4291 N  N   . LEU B 1 17  ? -3.608  7.844   -67.644 1.00 41.97  ? 17   LEU B N   1 
ATOM   4292 C  CA  . LEU B 1 17  ? -3.916  6.922   -66.563 1.00 39.86  ? 17   LEU B CA  1 
ATOM   4293 C  C   . LEU B 1 17  ? -5.412  6.812   -66.425 1.00 37.12  ? 17   LEU B C   1 
ATOM   4294 O  O   . LEU B 1 17  ? -6.133  7.777   -66.672 1.00 43.51  ? 17   LEU B O   1 
ATOM   4295 C  CB  . LEU B 1 17  ? -3.377  7.469   -65.241 1.00 39.84  ? 17   LEU B CB  1 
ATOM   4296 C  CG  . LEU B 1 17  ? -1.870  7.646   -65.116 1.00 46.56  ? 17   LEU B CG  1 
ATOM   4297 C  CD1 . LEU B 1 17  ? -1.538  8.513   -63.909 1.00 39.67  ? 17   LEU B CD1 1 
ATOM   4298 C  CD2 . LEU B 1 17  ? -1.181  6.286   -65.038 1.00 46.34  ? 17   LEU B CD2 1 
ATOM   4299 N  N   . ARG B 1 18  ? -5.877  5.647   -65.994 1.00 38.84  ? 18   ARG B N   1 
ATOM   4300 C  CA  . ARG B 1 18  ? -7.281  5.475   -65.659 1.00 39.61  ? 18   ARG B CA  1 
ATOM   4301 C  C   . ARG B 1 18  ? -7.415  4.991   -64.225 1.00 39.97  ? 18   ARG B C   1 
ATOM   4302 O  O   . ARG B 1 18  ? -7.006  3.880   -63.890 1.00 31.95  ? 18   ARG B O   1 
ATOM   4303 C  CB  . ARG B 1 18  ? -7.959  4.495   -66.619 1.00 46.52  ? 18   ARG B CB  1 
ATOM   4304 C  CG  . ARG B 1 18  ? -9.433  4.244   -66.313 1.00 43.89  ? 18   ARG B CG  1 
ATOM   4305 C  CD  . ARG B 1 18  ? -10.160 3.642   -67.513 1.00 65.23  ? 18   ARG B CD  1 
ATOM   4306 N  NE  . ARG B 1 18  ? -9.310  2.710   -68.250 1.00 71.20  ? 18   ARG B NE  1 
ATOM   4307 C  CZ  . ARG B 1 18  ? -9.032  2.813   -69.546 1.00 74.04  ? 18   ARG B CZ  1 
ATOM   4308 N  NH1 . ARG B 1 18  ? -9.551  3.801   -70.264 1.00 65.42  ? 18   ARG B NH1 1 
ATOM   4309 N  NH2 . ARG B 1 18  ? -8.242  1.919   -70.126 1.00 84.67  ? 18   ARG B NH2 1 
ATOM   4310 N  N   . GLY B 1 19  ? -7.987  5.836   -63.376 1.00 37.22  ? 19   GLY B N   1 
ATOM   4311 C  CA  . GLY B 1 19  ? -8.209  5.470   -61.994 1.00 38.98  ? 19   GLY B CA  1 
ATOM   4312 C  C   . GLY B 1 19  ? -9.498  4.698   -61.810 1.00 44.50  ? 19   GLY B C   1 
ATOM   4313 O  O   . GLY B 1 19  ? -10.148 4.304   -62.778 1.00 49.10  ? 19   GLY B O   1 
ATOM   4314 N  N   . ILE B 1 20  ? -9.865  4.482   -60.556 1.00 40.94  ? 20   ILE B N   1 
ATOM   4315 C  CA  . ILE B 1 20  ? -11.097 3.793   -60.227 1.00 40.57  ? 20   ILE B CA  1 
ATOM   4316 C  C   . ILE B 1 20  ? -11.857 4.604   -59.188 1.00 49.98  ? 20   ILE B C   1 
ATOM   4317 O  O   . ILE B 1 20  ? -11.255 5.317   -58.386 1.00 52.19  ? 20   ILE B O   1 
ATOM   4318 C  CB  . ILE B 1 20  ? -10.813 2.392   -59.673 1.00 44.98  ? 20   ILE B CB  1 
ATOM   4319 C  CG1 . ILE B 1 20  ? -12.121 1.646   -59.421 1.00 43.80  ? 20   ILE B CG1 1 
ATOM   4320 C  CG2 . ILE B 1 20  ? -9.987  2.481   -58.391 1.00 38.20  ? 20   ILE B CG2 1 
ATOM   4321 C  CD1 . ILE B 1 20  ? -11.932 0.162   -59.211 1.00 31.23  ? 20   ILE B CD1 1 
ATOM   4322 N  N   . ARG B 1 21  ? -13.180 4.513   -59.214 1.00 45.38  ? 21   ARG B N   1 
ATOM   4323 C  CA  . ARG B 1 21  ? -13.996 5.196   -58.224 1.00 44.08  ? 21   ARG B CA  1 
ATOM   4324 C  C   . ARG B 1 21  ? -14.256 4.223   -57.097 1.00 48.84  ? 21   ARG B C   1 
ATOM   4325 O  O   . ARG B 1 21  ? -14.764 3.126   -57.327 1.00 45.83  ? 21   ARG B O   1 
ATOM   4326 C  CB  . ARG B 1 21  ? -15.319 5.661   -58.833 1.00 49.45  ? 21   ARG B CB  1 
ATOM   4327 C  CG  . ARG B 1 21  ? -16.169 6.513   -57.905 1.00 59.92  ? 21   ARG B CG  1 
ATOM   4328 C  CD  . ARG B 1 21  ? -17.511 6.870   -58.542 1.00 73.00  ? 21   ARG B CD  1 
ATOM   4329 N  NE  . ARG B 1 21  ? -18.268 5.676   -58.906 1.00 73.59  ? 21   ARG B NE  1 
ATOM   4330 C  CZ  . ARG B 1 21  ? -19.097 5.034   -58.089 1.00 90.66  ? 21   ARG B CZ  1 
ATOM   4331 N  NH1 . ARG B 1 21  ? -19.287 5.473   -56.850 1.00 86.65  ? 21   ARG B NH1 1 
ATOM   4332 N  NH2 . ARG B 1 21  ? -19.737 3.950   -58.513 1.00 83.53  ? 21   ARG B NH2 1 
ATOM   4333 N  N   . LEU B 1 22  ? -13.884 4.614   -55.882 1.00 44.74  ? 22   LEU B N   1 
ATOM   4334 C  CA  . LEU B 1 22  ? -14.068 3.756   -54.719 1.00 43.77  ? 22   LEU B CA  1 
ATOM   4335 C  C   . LEU B 1 22  ? -15.123 4.345   -53.802 1.00 49.70  ? 22   LEU B C   1 
ATOM   4336 O  O   . LEU B 1 22  ? -15.383 5.548   -53.831 1.00 50.15  ? 22   LEU B O   1 
ATOM   4337 C  CB  . LEU B 1 22  ? -12.758 3.597   -53.944 1.00 52.45  ? 22   LEU B CB  1 
ATOM   4338 C  CG  . LEU B 1 22  ? -11.525 3.047   -54.661 1.00 45.67  ? 22   LEU B CG  1 
ATOM   4339 C  CD1 . LEU B 1 22  ? -10.348 3.028   -53.705 1.00 58.10  ? 22   LEU B CD1 1 
ATOM   4340 C  CD2 . LEU B 1 22  ? -11.781 1.658   -55.207 1.00 45.52  ? 22   LEU B CD2 1 
ATOM   4341 N  N   . LYS B 1 23  ? -15.722 3.495   -52.977 1.00 60.86  ? 23   LYS B N   1 
ATOM   4342 C  CA  . LYS B 1 23  ? -16.724 3.960   -52.032 1.00 53.13  ? 23   LYS B CA  1 
ATOM   4343 C  C   . LYS B 1 23  ? -16.143 4.145   -50.635 1.00 55.82  ? 23   LYS B C   1 
ATOM   4344 O  O   . LYS B 1 23  ? -15.646 3.198   -50.021 1.00 48.54  ? 23   LYS B O   1 
ATOM   4345 C  CB  . LYS B 1 23  ? -17.913 3.000   -51.980 1.00 50.69  ? 23   LYS B CB  1 
ATOM   4346 C  CG  . LYS B 1 23  ? -19.243 3.727   -51.930 1.00 75.09  ? 23   LYS B CG  1 
ATOM   4347 C  CD  . LYS B 1 23  ? -19.368 4.644   -53.143 1.00 77.89  ? 23   LYS B CD  1 
ATOM   4348 C  CE  . LYS B 1 23  ? -20.199 5.879   -52.847 1.00 66.37  ? 23   LYS B CE  1 
ATOM   4349 N  NZ  . LYS B 1 23  ? -20.191 6.798   -54.017 1.00 76.36  ? 23   LYS B NZ  1 
ATOM   4350 N  N   . ALA B 1 24  ? -16.196 5.380   -50.151 1.00 52.17  ? 24   ALA B N   1 
ATOM   4351 C  CA  . ALA B 1 24  ? -15.942 5.674   -48.749 1.00 54.17  ? 24   ALA B CA  1 
ATOM   4352 C  C   . ALA B 1 24  ? -17.296 5.823   -48.062 1.00 57.86  ? 24   ALA B C   1 
ATOM   4353 O  O   . ALA B 1 24  ? -18.274 6.206   -48.703 1.00 52.09  ? 24   ALA B O   1 
ATOM   4354 C  CB  . ALA B 1 24  ? -15.123 6.942   -48.612 1.00 43.95  ? 24   ALA B CB  1 
ATOM   4355 N  N   . PRO B 1 25  ? -17.357 5.523   -46.757 1.00 61.75  ? 25   PRO B N   1 
ATOM   4356 C  CA  . PRO B 1 25  ? -18.624 5.485   -46.015 1.00 49.08  ? 25   PRO B CA  1 
ATOM   4357 C  C   . PRO B 1 25  ? -19.524 6.683   -46.289 1.00 49.61  ? 25   PRO B C   1 
ATOM   4358 O  O   . PRO B 1 25  ? -20.742 6.555   -46.187 1.00 62.48  ? 25   PRO B O   1 
ATOM   4359 C  CB  . PRO B 1 25  ? -18.173 5.494   -44.554 1.00 49.24  ? 25   PRO B CB  1 
ATOM   4360 C  CG  . PRO B 1 25  ? -16.838 4.842   -44.581 1.00 63.09  ? 25   PRO B CG  1 
ATOM   4361 C  CD  . PRO B 1 25  ? -16.201 5.241   -45.889 1.00 62.12  ? 25   PRO B CD  1 
ATOM   4362 N  N   . GLY B 1 26  ? -18.939 7.824   -46.637 1.00 50.97  ? 26   GLY B N   1 
ATOM   4363 C  CA  . GLY B 1 26  ? -19.721 9.025   -46.865 1.00 39.05  ? 26   GLY B CA  1 
ATOM   4364 C  C   . GLY B 1 26  ? -19.693 9.534   -48.292 1.00 54.07  ? 26   GLY B C   1 
ATOM   4365 O  O   . GLY B 1 26  ? -20.011 10.695  -48.550 1.00 45.76  ? 26   GLY B O   1 
ATOM   4366 N  N   . GLY B 1 27  ? -19.315 8.673   -49.229 1.00 49.79  ? 27   GLY B N   1 
ATOM   4367 C  CA  . GLY B 1 27  ? -19.257 9.079   -50.619 1.00 58.80  ? 27   GLY B CA  1 
ATOM   4368 C  C   . GLY B 1 27  ? -18.093 8.485   -51.380 1.00 56.94  ? 27   GLY B C   1 
ATOM   4369 O  O   . GLY B 1 27  ? -17.347 7.671   -50.842 1.00 56.24  ? 27   GLY B O   1 
ATOM   4370 N  N   . PRO B 1 28  ? -17.929 8.901   -52.644 1.00 57.11  ? 28   PRO B N   1 
ATOM   4371 C  CA  . PRO B 1 28  ? -16.950 8.309   -53.552 1.00 56.45  ? 28   PRO B CA  1 
ATOM   4372 C  C   . PRO B 1 28  ? -15.618 9.034   -53.488 1.00 49.89  ? 28   PRO B C   1 
ATOM   4373 O  O   . PRO B 1 28  ? -15.546 10.192  -53.072 1.00 45.78  ? 28   PRO B O   1 
ATOM   4374 C  CB  . PRO B 1 28  ? -17.570 8.550   -54.936 1.00 54.54  ? 28   PRO B CB  1 
ATOM   4375 C  CG  . PRO B 1 28  ? -18.738 9.510   -54.715 1.00 43.15  ? 28   PRO B CG  1 
ATOM   4376 C  CD  . PRO B 1 28  ? -18.675 9.983   -53.301 1.00 51.00  ? 28   PRO B CD  1 
ATOM   4377 N  N   . VAL B 1 29  ? -14.571 8.346   -53.921 1.00 50.47  ? 29   VAL B N   1 
ATOM   4378 C  CA  . VAL B 1 29  ? -13.264 8.958   -54.077 1.00 50.71  ? 29   VAL B CA  1 
ATOM   4379 C  C   . VAL B 1 29  ? -12.652 8.444   -55.369 1.00 48.00  ? 29   VAL B C   1 
ATOM   4380 O  O   . VAL B 1 29  ? -12.973 7.341   -55.821 1.00 44.36  ? 29   VAL B O   1 
ATOM   4381 C  CB  . VAL B 1 29  ? -12.334 8.603   -52.902 1.00 44.10  ? 29   VAL B CB  1 
ATOM   4382 C  CG1 . VAL B 1 29  ? -12.868 9.184   -51.604 1.00 34.30  ? 29   VAL B CG1 1 
ATOM   4383 C  CG2 . VAL B 1 29  ? -12.182 7.094   -52.789 1.00 44.29  ? 29   VAL B CG2 1 
ATOM   4384 N  N   . SER B 1 30  ? -11.786 9.247   -55.971 1.00 45.35  ? 30   SER B N   1 
ATOM   4385 C  CA  . SER B 1 30  ? -11.014 8.792   -57.115 1.00 40.94  ? 30   SER B CA  1 
ATOM   4386 C  C   . SER B 1 30  ? -9.720  8.166   -56.613 1.00 42.42  ? 30   SER B C   1 
ATOM   4387 O  O   . SER B 1 30  ? -8.949  8.807   -55.900 1.00 51.93  ? 30   SER B O   1 
ATOM   4388 C  CB  . SER B 1 30  ? -10.694 9.960   -58.048 1.00 42.55  ? 30   SER B CB  1 
ATOM   4389 O  OG  . SER B 1 30  ? -11.825 10.790  -58.242 1.00 58.13  ? 30   SER B OG  1 
ATOM   4390 N  N   . ALA B 1 31  ? -9.480  6.912   -56.972 1.00 39.51  ? 31   ALA B N   1 
ATOM   4391 C  CA  . ALA B 1 31  ? -8.213  6.276   -56.631 1.00 44.40  ? 31   ALA B CA  1 
ATOM   4392 C  C   . ALA B 1 31  ? -7.403  5.937   -57.875 1.00 38.80  ? 31   ALA B C   1 
ATOM   4393 O  O   . ALA B 1 31  ? -7.929  5.403   -58.846 1.00 43.45  ? 31   ALA B O   1 
ATOM   4394 C  CB  . ALA B 1 31  ? -8.443  5.033   -55.791 1.00 35.80  ? 31   ALA B CB  1 
ATOM   4395 N  N   . PHE B 1 32  ? -6.117  6.260   -57.837 1.00 40.78  ? 32   PHE B N   1 
ATOM   4396 C  CA  . PHE B 1 32  ? -5.203  5.893   -58.907 1.00 36.85  ? 32   PHE B CA  1 
ATOM   4397 C  C   . PHE B 1 32  ? -4.053  5.085   -58.325 1.00 41.71  ? 32   PHE B C   1 
ATOM   4398 O  O   . PHE B 1 32  ? -3.113  5.641   -57.757 1.00 42.54  ? 32   PHE B O   1 
ATOM   4399 C  CB  . PHE B 1 32  ? -4.698  7.139   -59.624 1.00 37.33  ? 32   PHE B CB  1 
ATOM   4400 C  CG  . PHE B 1 32  ? -5.800  8.044   -60.092 1.00 51.37  ? 32   PHE B CG  1 
ATOM   4401 C  CD1 . PHE B 1 32  ? -6.323  9.013   -59.253 1.00 45.36  ? 32   PHE B CD1 1 
ATOM   4402 C  CD2 . PHE B 1 32  ? -6.324  7.913   -61.366 1.00 53.86  ? 32   PHE B CD2 1 
ATOM   4403 C  CE1 . PHE B 1 32  ? -7.341  9.840   -59.678 1.00 50.74  ? 32   PHE B CE1 1 
ATOM   4404 C  CE2 . PHE B 1 32  ? -7.344  8.738   -61.798 1.00 50.52  ? 32   PHE B CE2 1 
ATOM   4405 C  CZ  . PHE B 1 32  ? -7.854  9.702   -60.953 1.00 49.83  ? 32   PHE B CZ  1 
ATOM   4406 N  N   . LEU B 1 33  ? -4.147  3.767   -58.465 1.00 35.59  ? 33   LEU B N   1 
ATOM   4407 C  CA  . LEU B 1 33  ? -3.214  2.849   -57.828 1.00 39.57  ? 33   LEU B CA  1 
ATOM   4408 C  C   . LEU B 1 33  ? -2.239  2.238   -58.830 1.00 39.49  ? 33   LEU B C   1 
ATOM   4409 O  O   . LEU B 1 33  ? -2.574  2.050   -60.000 1.00 38.52  ? 33   LEU B O   1 
ATOM   4410 C  CB  . LEU B 1 33  ? -3.995  1.744   -57.114 1.00 30.89  ? 33   LEU B CB  1 
ATOM   4411 C  CG  . LEU B 1 33  ? -5.280  2.232   -56.438 1.00 41.81  ? 33   LEU B CG  1 
ATOM   4412 C  CD1 . LEU B 1 33  ? -6.072  1.071   -55.865 1.00 36.04  ? 33   LEU B CD1 1 
ATOM   4413 C  CD2 . LEU B 1 33  ? -4.979  3.271   -55.357 1.00 36.30  ? 33   LEU B CD2 1 
ATOM   4414 N  N   . GLY B 1 34  ? -1.031  1.934   -58.363 1.00 34.04  ? 34   GLY B N   1 
ATOM   4415 C  CA  . GLY B 1 34  ? -0.034  1.273   -59.186 1.00 25.25  ? 34   GLY B CA  1 
ATOM   4416 C  C   . GLY B 1 34  ? 0.539   2.122   -60.306 1.00 32.57  ? 34   GLY B C   1 
ATOM   4417 O  O   . GLY B 1 34  ? 0.837   1.602   -61.378 1.00 42.11  ? 34   GLY B O   1 
ATOM   4418 N  N   . ILE B 1 35  ? 0.692   3.424   -60.066 1.00 30.04  ? 35   ILE B N   1 
ATOM   4419 C  CA  . ILE B 1 35  ? 1.307   4.320   -61.042 1.00 33.22  ? 35   ILE B CA  1 
ATOM   4420 C  C   . ILE B 1 35  ? 2.823   4.183   -60.984 1.00 35.66  ? 35   ILE B C   1 
ATOM   4421 O  O   . ILE B 1 35  ? 3.421   4.344   -59.925 1.00 43.91  ? 35   ILE B O   1 
ATOM   4422 C  CB  . ILE B 1 35  ? 0.956   5.803   -60.774 1.00 30.14  ? 35   ILE B CB  1 
ATOM   4423 C  CG1 . ILE B 1 35  ? -0.545  5.992   -60.590 1.00 36.21  ? 35   ILE B CG1 1 
ATOM   4424 C  CG2 . ILE B 1 35  ? 1.448   6.688   -61.902 1.00 27.24  ? 35   ILE B CG2 1 
ATOM   4425 C  CD1 . ILE B 1 35  ? -0.929  7.425   -60.271 1.00 34.17  ? 35   ILE B CD1 1 
ATOM   4426 N  N   . PRO B 1 36  ? 3.453   3.891   -62.128 1.00 40.58  ? 36   PRO B N   1 
ATOM   4427 C  CA  . PRO B 1 36  ? 4.909   3.716   -62.169 1.00 33.16  ? 36   PRO B CA  1 
ATOM   4428 C  C   . PRO B 1 36  ? 5.622   5.052   -62.041 1.00 36.04  ? 36   PRO B C   1 
ATOM   4429 O  O   . PRO B 1 36  ? 5.295   5.969   -62.797 1.00 35.76  ? 36   PRO B O   1 
ATOM   4430 C  CB  . PRO B 1 36  ? 5.164   3.157   -63.579 1.00 36.15  ? 36   PRO B CB  1 
ATOM   4431 C  CG  . PRO B 1 36  ? 3.818   2.940   -64.204 1.00 38.00  ? 36   PRO B CG  1 
ATOM   4432 C  CD  . PRO B 1 36  ? 2.841   3.780   -63.462 1.00 34.08  ? 36   PRO B CD  1 
ATOM   4433 N  N   . PHE B 1 37  ? 6.577   5.170   -61.120 1.00 38.22  ? 37   PHE B N   1 
ATOM   4434 C  CA  . PHE B 1 37  ? 7.370   6.398   -61.030 1.00 36.20  ? 37   PHE B CA  1 
ATOM   4435 C  C   . PHE B 1 37  ? 8.845   6.182   -61.372 1.00 38.13  ? 37   PHE B C   1 
ATOM   4436 O  O   . PHE B 1 37  ? 9.608   7.142   -61.494 1.00 36.12  ? 37   PHE B O   1 
ATOM   4437 C  CB  . PHE B 1 37  ? 7.197   7.103   -59.672 1.00 34.96  ? 37   PHE B CB  1 
ATOM   4438 C  CG  . PHE B 1 37  ? 7.731   6.331   -58.490 1.00 30.44  ? 37   PHE B CG  1 
ATOM   4439 C  CD1 . PHE B 1 37  ? 9.062   6.446   -58.108 1.00 28.10  ? 37   PHE B CD1 1 
ATOM   4440 C  CD2 . PHE B 1 37  ? 6.893   5.520   -57.737 1.00 33.06  ? 37   PHE B CD2 1 
ATOM   4441 C  CE1 . PHE B 1 37  ? 9.551   5.749   -57.008 1.00 28.85  ? 37   PHE B CE1 1 
ATOM   4442 C  CE2 . PHE B 1 37  ? 7.376   4.818   -56.635 1.00 26.75  ? 37   PHE B CE2 1 
ATOM   4443 C  CZ  . PHE B 1 37  ? 8.703   4.931   -56.272 1.00 22.86  ? 37   PHE B CZ  1 
ATOM   4444 N  N   . ALA B 1 38  ? 9.232   4.922   -61.545 1.00 35.35  ? 38   ALA B N   1 
ATOM   4445 C  CA  . ALA B 1 38  ? 10.608  4.586   -61.902 1.00 31.68  ? 38   ALA B CA  1 
ATOM   4446 C  C   . ALA B 1 38  ? 10.673  3.407   -62.862 1.00 34.42  ? 38   ALA B C   1 
ATOM   4447 O  O   . ALA B 1 38  ? 9.735   2.614   -62.953 1.00 38.26  ? 38   ALA B O   1 
ATOM   4448 C  CB  . ALA B 1 38  ? 11.421  4.279   -60.647 1.00 28.30  ? 38   ALA B CB  1 
ATOM   4449 N  N   . GLU B 1 39  ? 11.783  3.300   -63.584 1.00 30.85  ? 39   GLU B N   1 
ATOM   4450 C  CA  . GLU B 1 39  ? 12.084  2.084   -64.327 1.00 34.72  ? 39   GLU B CA  1 
ATOM   4451 C  C   . GLU B 1 39  ? 12.244  0.948   -63.327 1.00 36.92  ? 39   GLU B C   1 
ATOM   4452 O  O   . GLU B 1 39  ? 12.930  1.105   -62.322 1.00 41.53  ? 39   GLU B O   1 
ATOM   4453 C  CB  . GLU B 1 39  ? 13.376  2.253   -65.128 1.00 29.29  ? 39   GLU B CB  1 
ATOM   4454 C  CG  . GLU B 1 39  ? 13.279  3.303   -66.216 1.00 36.67  ? 39   GLU B CG  1 
ATOM   4455 C  CD  . GLU B 1 39  ? 12.339  2.889   -67.333 1.00 42.39  ? 39   GLU B CD  1 
ATOM   4456 O  OE1 . GLU B 1 39  ? 12.763  2.107   -68.211 1.00 43.46  ? 39   GLU B OE1 1 
ATOM   4457 O  OE2 . GLU B 1 39  ? 11.178  3.348   -67.334 1.00 39.25  ? 39   GLU B OE2 1 
ATOM   4458 N  N   . PRO B 1 40  ? 11.601  -0.200  -63.587 1.00 39.16  ? 40   PRO B N   1 
ATOM   4459 C  CA  . PRO B 1 40  ? 11.757  -1.332  -62.668 1.00 39.92  ? 40   PRO B CA  1 
ATOM   4460 C  C   . PRO B 1 40  ? 13.227  -1.573  -62.335 1.00 38.63  ? 40   PRO B C   1 
ATOM   4461 O  O   . PRO B 1 40  ? 14.028  -1.772  -63.245 1.00 39.54  ? 40   PRO B O   1 
ATOM   4462 C  CB  . PRO B 1 40  ? 11.186  -2.502  -63.468 1.00 39.02  ? 40   PRO B CB  1 
ATOM   4463 C  CG  . PRO B 1 40  ? 10.157  -1.872  -64.343 1.00 33.99  ? 40   PRO B CG  1 
ATOM   4464 C  CD  . PRO B 1 40  ? 10.713  -0.521  -64.718 1.00 31.11  ? 40   PRO B CD  1 
ATOM   4465 N  N   . PRO B 1 41  ? 13.575  -1.556  -61.039 1.00 42.65  ? 41   PRO B N   1 
ATOM   4466 C  CA  . PRO B 1 41  ? 14.963  -1.667  -60.584 1.00 41.38  ? 41   PRO B CA  1 
ATOM   4467 C  C   . PRO B 1 41  ? 15.397  -3.124  -60.569 1.00 43.15  ? 41   PRO B C   1 
ATOM   4468 O  O   . PRO B 1 41  ? 15.782  -3.644  -59.520 1.00 38.26  ? 41   PRO B O   1 
ATOM   4469 C  CB  . PRO B 1 41  ? 14.899  -1.158  -59.139 1.00 36.75  ? 41   PRO B CB  1 
ATOM   4470 C  CG  . PRO B 1 41  ? 13.427  -1.063  -58.787 1.00 37.63  ? 41   PRO B CG  1 
ATOM   4471 C  CD  . PRO B 1 41  ? 12.635  -1.639  -59.913 1.00 38.24  ? 41   PRO B CD  1 
ATOM   4472 N  N   . VAL B 1 42  ? 15.322  -3.778  -61.719 1.00 36.83  ? 42   VAL B N   1 
ATOM   4473 C  CA  . VAL B 1 42  ? 15.607  -5.202  -61.798 1.00 42.93  ? 42   VAL B CA  1 
ATOM   4474 C  C   . VAL B 1 42  ? 16.845  -5.475  -62.646 1.00 43.94  ? 42   VAL B C   1 
ATOM   4475 O  O   . VAL B 1 42  ? 17.236  -4.658  -63.482 1.00 37.87  ? 42   VAL B O   1 
ATOM   4476 C  CB  . VAL B 1 42  ? 14.409  -5.975  -62.380 1.00 33.69  ? 42   VAL B CB  1 
ATOM   4477 C  CG1 . VAL B 1 42  ? 13.162  -5.733  -61.530 1.00 32.13  ? 42   VAL B CG1 1 
ATOM   4478 C  CG2 . VAL B 1 42  ? 14.165  -5.560  -63.820 1.00 32.78  ? 42   VAL B CG2 1 
ATOM   4479 N  N   . GLY B 1 43  ? 17.458  -6.630  -62.419 1.00 38.23  ? 43   GLY B N   1 
ATOM   4480 C  CA  . GLY B 1 43  ? 18.626  -7.035  -63.175 1.00 39.57  ? 43   GLY B CA  1 
ATOM   4481 C  C   . GLY B 1 43  ? 19.851  -6.225  -62.812 1.00 42.89  ? 43   GLY B C   1 
ATOM   4482 O  O   . GLY B 1 43  ? 20.287  -6.217  -61.661 1.00 47.25  ? 43   GLY B O   1 
ATOM   4483 N  N   . SER B 1 44  ? 20.410  -5.538  -63.800 1.00 40.95  ? 44   SER B N   1 
ATOM   4484 C  CA  . SER B 1 44  ? 21.603  -4.736  -63.579 1.00 43.21  ? 44   SER B CA  1 
ATOM   4485 C  C   . SER B 1 44  ? 21.259  -3.493  -62.769 1.00 43.17  ? 44   SER B C   1 
ATOM   4486 O  O   . SER B 1 44  ? 22.143  -2.798  -62.274 1.00 49.63  ? 44   SER B O   1 
ATOM   4487 C  CB  . SER B 1 44  ? 22.226  -4.333  -64.915 1.00 35.93  ? 44   SER B CB  1 
ATOM   4488 O  OG  . SER B 1 44  ? 21.520  -3.244  -65.490 1.00 56.88  ? 44   SER B OG  1 
ATOM   4489 N  N   . ARG B 1 45  ? 19.964  -3.220  -62.648 1.00 47.31  ? 45   ARG B N   1 
ATOM   4490 C  CA  . ARG B 1 45  ? 19.483  -2.057  -61.912 1.00 49.58  ? 45   ARG B CA  1 
ATOM   4491 C  C   . ARG B 1 45  ? 19.405  -2.319  -60.404 1.00 46.33  ? 45   ARG B C   1 
ATOM   4492 O  O   . ARG B 1 45  ? 19.338  -1.385  -59.607 1.00 42.02  ? 45   ARG B O   1 
ATOM   4493 C  CB  . ARG B 1 45  ? 18.122  -1.612  -62.451 1.00 44.88  ? 45   ARG B CB  1 
ATOM   4494 C  CG  . ARG B 1 45  ? 18.191  -0.872  -63.785 1.00 40.00  ? 45   ARG B CG  1 
ATOM   4495 C  CD  . ARG B 1 45  ? 18.732  0.546   -63.608 1.00 71.80  ? 45   ARG B CD  1 
ATOM   4496 N  NE  . ARG B 1 45  ? 20.191  0.584   -63.504 1.00 77.61  ? 45   ARG B NE  1 
ATOM   4497 C  CZ  . ARG B 1 45  ? 20.892  1.642   -63.103 1.00 82.06  ? 45   ARG B CZ  1 
ATOM   4498 N  NH1 . ARG B 1 45  ? 20.278  2.767   -62.745 1.00 61.91  ? 45   ARG B NH1 1 
ATOM   4499 N  NH2 . ARG B 1 45  ? 22.216  1.572   -63.050 1.00 91.79  ? 45   ARG B NH2 1 
ATOM   4500 N  N   . ARG B 1 46  ? 19.421  -3.590  -60.017 1.00 37.14  ? 46   ARG B N   1 
ATOM   4501 C  CA  . ARG B 1 46  ? 19.425  -3.953  -58.604 1.00 41.36  ? 46   ARG B CA  1 
ATOM   4502 C  C   . ARG B 1 46  ? 20.547  -3.224  -57.853 1.00 38.43  ? 46   ARG B C   1 
ATOM   4503 O  O   . ARG B 1 46  ? 21.676  -3.150  -58.337 1.00 39.42  ? 46   ARG B O   1 
ATOM   4504 C  CB  . ARG B 1 46  ? 19.559  -5.470  -58.445 1.00 31.71  ? 46   ARG B CB  1 
ATOM   4505 C  CG  . ARG B 1 46  ? 19.589  -5.943  -57.002 1.00 34.74  ? 46   ARG B CG  1 
ATOM   4506 C  CD  . ARG B 1 46  ? 19.925  -7.425  -56.906 1.00 36.65  ? 46   ARG B CD  1 
ATOM   4507 N  NE  . ARG B 1 46  ? 18.745  -8.277  -56.992 1.00 37.94  ? 46   ARG B NE  1 
ATOM   4508 C  CZ  . ARG B 1 46  ? 18.777  -9.604  -56.917 1.00 40.55  ? 46   ARG B CZ  1 
ATOM   4509 N  NH1 . ARG B 1 46  ? 19.934  -10.236 -56.762 1.00 40.83  ? 46   ARG B NH1 1 
ATOM   4510 N  NH2 . ARG B 1 46  ? 17.655  -10.303 -56.997 1.00 34.19  ? 46   ARG B NH2 1 
ATOM   4511 N  N   . PHE B 1 47  ? 20.213  -2.680  -56.681 1.00 36.17  ? 47   PHE B N   1 
ATOM   4512 C  CA  . PHE B 1 47  ? 21.142  -1.921  -55.831 1.00 31.51  ? 47   PHE B CA  1 
ATOM   4513 C  C   . PHE B 1 47  ? 21.456  -0.526  -56.369 1.00 33.11  ? 47   PHE B C   1 
ATOM   4514 O  O   . PHE B 1 47  ? 22.200  0.227   -55.746 1.00 34.25  ? 47   PHE B O   1 
ATOM   4515 C  CB  . PHE B 1 47  ? 22.462  -2.676  -55.597 1.00 34.73  ? 47   PHE B CB  1 
ATOM   4516 C  CG  . PHE B 1 47  ? 22.287  -4.088  -55.109 1.00 37.50  ? 47   PHE B CG  1 
ATOM   4517 C  CD1 . PHE B 1 47  ? 21.539  -4.360  -53.973 1.00 24.13  ? 47   PHE B CD1 1 
ATOM   4518 C  CD2 . PHE B 1 47  ? 22.891  -5.143  -55.777 1.00 32.32  ? 47   PHE B CD2 1 
ATOM   4519 C  CE1 . PHE B 1 47  ? 21.387  -5.659  -53.521 1.00 32.46  ? 47   PHE B CE1 1 
ATOM   4520 C  CE2 . PHE B 1 47  ? 22.743  -6.445  -55.333 1.00 29.74  ? 47   PHE B CE2 1 
ATOM   4521 C  CZ  . PHE B 1 47  ? 21.991  -6.706  -54.204 1.00 35.37  ? 47   PHE B CZ  1 
ATOM   4522 N  N   . MET B 1 48  ? 20.899  -0.187  -57.525 1.00 32.84  ? 48   MET B N   1 
ATOM   4523 C  CA  . MET B 1 48  ? 21.211  1.082   -58.179 1.00 37.60  ? 48   MET B CA  1 
ATOM   4524 C  C   . MET B 1 48  ? 20.188  2.173   -57.886 1.00 32.32  ? 48   MET B C   1 
ATOM   4525 O  O   . MET B 1 48  ? 19.032  1.884   -57.575 1.00 32.79  ? 48   MET B O   1 
ATOM   4526 C  CB  . MET B 1 48  ? 21.328  0.883   -59.692 1.00 45.56  ? 48   MET B CB  1 
ATOM   4527 C  CG  . MET B 1 48  ? 22.536  0.064   -60.135 1.00 49.90  ? 48   MET B CG  1 
ATOM   4528 S  SD  . MET B 1 48  ? 24.036  1.058   -60.265 1.00 52.05  ? 48   MET B SD  1 
ATOM   4529 C  CE  . MET B 1 48  ? 24.340  1.406   -58.537 1.00 60.38  ? 48   MET B CE  1 
ATOM   4530 N  N   . PRO B 1 49  ? 20.616  3.437   -57.982 1.00 31.62  ? 49   PRO B N   1 
ATOM   4531 C  CA  . PRO B 1 49  ? 19.691  4.568   -57.870 1.00 37.42  ? 49   PRO B CA  1 
ATOM   4532 C  C   . PRO B 1 49  ? 18.556  4.431   -58.875 1.00 35.47  ? 49   PRO B C   1 
ATOM   4533 O  O   . PRO B 1 49  ? 18.768  3.926   -59.977 1.00 39.52  ? 49   PRO B O   1 
ATOM   4534 C  CB  . PRO B 1 49  ? 20.566  5.776   -58.231 1.00 24.96  ? 49   PRO B CB  1 
ATOM   4535 C  CG  . PRO B 1 49  ? 21.941  5.360   -57.871 1.00 31.40  ? 49   PRO B CG  1 
ATOM   4536 C  CD  . PRO B 1 49  ? 22.014  3.877   -58.133 1.00 39.04  ? 49   PRO B CD  1 
ATOM   4537 N  N   . PRO B 1 50  ? 17.356  4.891   -58.506 1.00 42.38  ? 50   PRO B N   1 
ATOM   4538 C  CA  . PRO B 1 50  ? 16.201  4.719   -59.389 1.00 36.79  ? 50   PRO B CA  1 
ATOM   4539 C  C   . PRO B 1 50  ? 16.360  5.576   -60.635 1.00 36.67  ? 50   PRO B C   1 
ATOM   4540 O  O   . PRO B 1 50  ? 17.054  6.590   -60.601 1.00 39.20  ? 50   PRO B O   1 
ATOM   4541 C  CB  . PRO B 1 50  ? 15.029  5.254   -58.555 1.00 32.13  ? 50   PRO B CB  1 
ATOM   4542 C  CG  . PRO B 1 50  ? 15.601  5.639   -57.214 1.00 36.70  ? 50   PRO B CG  1 
ATOM   4543 C  CD  . PRO B 1 50  ? 17.065  5.796   -57.386 1.00 36.13  ? 50   PRO B CD  1 
ATOM   4544 N  N   . GLU B 1 51  ? 15.725  5.167   -61.723 1.00 36.18  ? 51   GLU B N   1 
ATOM   4545 C  CA  . GLU B 1 51  ? 15.685  5.980   -62.925 1.00 31.50  ? 51   GLU B CA  1 
ATOM   4546 C  C   . GLU B 1 51  ? 14.235  6.299   -63.240 1.00 29.88  ? 51   GLU B C   1 
ATOM   4547 O  O   . GLU B 1 51  ? 13.354  5.462   -63.048 1.00 35.70  ? 51   GLU B O   1 
ATOM   4548 C  CB  . GLU B 1 51  ? 16.341  5.248   -64.096 1.00 39.89  ? 51   GLU B CB  1 
ATOM   4549 C  CG  . GLU B 1 51  ? 17.850  5.108   -63.968 1.00 49.82  ? 51   GLU B CG  1 
ATOM   4550 C  CD  . GLU B 1 51  ? 18.470  4.350   -65.129 1.00 78.98  ? 51   GLU B CD  1 
ATOM   4551 O  OE1 . GLU B 1 51  ? 17.819  3.421   -65.656 1.00 68.05  ? 51   GLU B OE1 1 
ATOM   4552 O  OE2 . GLU B 1 51  ? 19.612  4.684   -65.511 1.00 96.76  ? 51   GLU B OE2 1 
ATOM   4553 N  N   . PRO B 1 52  ? 13.983  7.516   -63.725 1.00 29.81  ? 52   PRO B N   1 
ATOM   4554 C  CA  . PRO B 1 52  ? 12.636  7.997   -64.060 1.00 30.44  ? 52   PRO B CA  1 
ATOM   4555 C  C   . PRO B 1 52  ? 11.920  7.066   -65.034 1.00 35.56  ? 52   PRO B C   1 
ATOM   4556 O  O   . PRO B 1 52  ? 12.513  6.639   -66.029 1.00 31.59  ? 52   PRO B O   1 
ATOM   4557 C  CB  . PRO B 1 52  ? 12.906  9.347   -64.741 1.00 34.12  ? 52   PRO B CB  1 
ATOM   4558 C  CG  . PRO B 1 52  ? 14.255  9.769   -64.249 1.00 39.05  ? 52   PRO B CG  1 
ATOM   4559 C  CD  . PRO B 1 52  ? 15.030  8.500   -64.046 1.00 25.36  ? 52   PRO B CD  1 
ATOM   4560 N  N   . LYS B 1 53  ? 10.658  6.761   -64.752 1.00 30.46  ? 53   LYS B N   1 
ATOM   4561 C  CA  . LYS B 1 53  ? 9.856   5.921   -65.641 1.00 37.09  ? 53   LYS B CA  1 
ATOM   4562 C  C   . LYS B 1 53  ? 9.763   6.500   -67.054 1.00 39.74  ? 53   LYS B C   1 
ATOM   4563 O  O   . LYS B 1 53  ? 9.445   7.677   -67.230 1.00 38.95  ? 53   LYS B O   1 
ATOM   4564 C  CB  . LYS B 1 53  ? 8.448   5.724   -65.069 1.00 37.05  ? 53   LYS B CB  1 
ATOM   4565 C  CG  . LYS B 1 53  ? 7.509   4.915   -65.960 1.00 34.82  ? 53   LYS B CG  1 
ATOM   4566 C  CD  . LYS B 1 53  ? 7.914   3.449   -66.012 1.00 39.29  ? 53   LYS B CD  1 
ATOM   4567 C  CE  . LYS B 1 53  ? 6.906   2.613   -66.797 1.00 45.32  ? 53   LYS B CE  1 
ATOM   4568 N  NZ  . LYS B 1 53  ? 6.913   2.941   -68.256 1.00 35.19  ? 53   LYS B NZ  1 
ATOM   4569 N  N   . ARG B 1 54  ? 10.039  5.669   -68.057 1.00 34.99  ? 54   ARG B N   1 
ATOM   4570 C  CA  . ARG B 1 54  ? 9.852   6.071   -69.448 1.00 37.68  ? 54   ARG B CA  1 
ATOM   4571 C  C   . ARG B 1 54  ? 8.362   6.222   -69.756 1.00 39.26  ? 54   ARG B C   1 
ATOM   4572 O  O   . ARG B 1 54  ? 7.526   5.521   -69.177 1.00 35.20  ? 54   ARG B O   1 
ATOM   4573 C  CB  . ARG B 1 54  ? 10.484  5.055   -70.404 1.00 34.62  ? 54   ARG B CB  1 
ATOM   4574 C  CG  . ARG B 1 54  ? 11.998  4.939   -70.294 1.00 34.43  ? 54   ARG B CG  1 
ATOM   4575 C  CD  . ARG B 1 54  ? 12.529  3.760   -71.109 1.00 26.66  ? 54   ARG B CD  1 
ATOM   4576 N  NE  . ARG B 1 54  ? 11.839  2.525   -70.751 1.00 36.27  ? 54   ARG B NE  1 
ATOM   4577 C  CZ  . ARG B 1 54  ? 11.122  1.788   -71.593 1.00 39.79  ? 54   ARG B CZ  1 
ATOM   4578 N  NH1 . ARG B 1 54  ? 10.521  0.689   -71.158 1.00 34.23  ? 54   ARG B NH1 1 
ATOM   4579 N  NH2 . ARG B 1 54  ? 11.018  2.137   -72.870 1.00 41.24  ? 54   ARG B NH2 1 
ATOM   4580 N  N   . PRO B 1 55  ? 8.028   7.148   -70.664 1.00 33.07  ? 55   PRO B N   1 
ATOM   4581 C  CA  . PRO B 1 55  ? 6.651   7.383   -71.122 1.00 43.67  ? 55   PRO B CA  1 
ATOM   4582 C  C   . PRO B 1 55  ? 6.002   6.127   -71.702 1.00 40.54  ? 55   PRO B C   1 
ATOM   4583 O  O   . PRO B 1 55  ? 6.704   5.232   -72.166 1.00 44.79  ? 55   PRO B O   1 
ATOM   4584 C  CB  . PRO B 1 55  ? 6.825   8.436   -72.220 1.00 37.87  ? 55   PRO B CB  1 
ATOM   4585 C  CG  . PRO B 1 55  ? 8.095   9.139   -71.874 1.00 39.59  ? 55   PRO B CG  1 
ATOM   4586 C  CD  . PRO B 1 55  ? 8.985   8.094   -71.263 1.00 38.52  ? 55   PRO B CD  1 
ATOM   4587 N  N   . TRP B 1 56  ? 4.674   6.071   -71.675 1.00 33.79  ? 56   TRP B N   1 
ATOM   4588 C  CA  . TRP B 1 56  ? 3.941   4.915   -72.179 1.00 34.83  ? 56   TRP B CA  1 
ATOM   4589 C  C   . TRP B 1 56  ? 2.828   5.318   -73.141 1.00 48.93  ? 56   TRP B C   1 
ATOM   4590 O  O   . TRP B 1 56  ? 2.292   6.425   -73.068 1.00 44.69  ? 56   TRP B O   1 
ATOM   4591 C  CB  . TRP B 1 56  ? 3.331   4.131   -71.022 1.00 34.59  ? 56   TRP B CB  1 
ATOM   4592 C  CG  . TRP B 1 56  ? 2.428   4.962   -70.178 1.00 40.76  ? 56   TRP B CG  1 
ATOM   4593 C  CD1 . TRP B 1 56  ? 1.100   5.195   -70.378 1.00 43.23  ? 56   TRP B CD1 1 
ATOM   4594 C  CD2 . TRP B 1 56  ? 2.791   5.687   -68.998 1.00 47.57  ? 56   TRP B CD2 1 
ATOM   4595 N  NE1 . TRP B 1 56  ? 0.609   6.017   -69.392 1.00 46.89  ? 56   TRP B NE1 1 
ATOM   4596 C  CE2 . TRP B 1 56  ? 1.628   6.334   -68.532 1.00 50.73  ? 56   TRP B CE2 1 
ATOM   4597 C  CE3 . TRP B 1 56  ? 3.984   5.846   -68.285 1.00 34.60  ? 56   TRP B CE3 1 
ATOM   4598 C  CZ2 . TRP B 1 56  ? 1.622   7.126   -67.384 1.00 44.47  ? 56   TRP B CZ2 1 
ATOM   4599 C  CZ3 . TRP B 1 56  ? 3.978   6.638   -67.149 1.00 42.78  ? 56   TRP B CZ3 1 
ATOM   4600 C  CH2 . TRP B 1 56  ? 2.804   7.267   -66.710 1.00 43.70  ? 56   TRP B CH2 1 
ATOM   4601 N  N   . SER B 1 57  ? 2.476   4.401   -74.036 1.00 42.39  ? 57   SER B N   1 
ATOM   4602 C  CA  . SER B 1 57  ? 1.424   4.646   -75.010 1.00 35.42  ? 57   SER B CA  1 
ATOM   4603 C  C   . SER B 1 57  ? 0.079   4.276   -74.411 1.00 40.51  ? 57   SER B C   1 
ATOM   4604 O  O   . SER B 1 57  ? 0.016   3.589   -73.398 1.00 38.88  ? 57   SER B O   1 
ATOM   4605 C  CB  . SER B 1 57  ? 1.665   3.815   -76.271 1.00 35.81  ? 57   SER B CB  1 
ATOM   4606 O  OG  . SER B 1 57  ? 1.399   2.442   -76.024 1.00 37.75  ? 57   SER B OG  1 
ATOM   4607 N  N   . GLY B 1 58  ? -0.996  4.740   -75.038 1.00 36.84  ? 58   GLY B N   1 
ATOM   4608 C  CA  . GLY B 1 58  ? -2.335  4.391   -74.603 1.00 33.45  ? 58   GLY B CA  1 
ATOM   4609 C  C   . GLY B 1 58  ? -2.712  4.876   -73.217 1.00 44.70  ? 58   GLY B C   1 
ATOM   4610 O  O   . GLY B 1 58  ? -2.178  5.866   -72.711 1.00 39.25  ? 58   GLY B O   1 
ATOM   4611 N  N   . VAL B 1 59  ? -3.654  4.167   -72.607 1.00 34.42  ? 59   VAL B N   1 
ATOM   4612 C  CA  . VAL B 1 59  ? -4.146  4.509   -71.282 1.00 38.71  ? 59   VAL B CA  1 
ATOM   4613 C  C   . VAL B 1 59  ? -3.742  3.439   -70.275 1.00 41.64  ? 59   VAL B C   1 
ATOM   4614 O  O   . VAL B 1 59  ? -4.234  2.312   -70.317 1.00 41.41  ? 59   VAL B O   1 
ATOM   4615 C  CB  . VAL B 1 59  ? -5.680  4.671   -71.289 1.00 52.37  ? 59   VAL B CB  1 
ATOM   4616 C  CG1 . VAL B 1 59  ? -6.228  4.756   -69.866 1.00 44.66  ? 59   VAL B CG1 1 
ATOM   4617 C  CG2 . VAL B 1 59  ? -6.066  5.895   -72.093 1.00 49.89  ? 59   VAL B CG2 1 
ATOM   4618 N  N   . LEU B 1 60  ? -2.836  3.802   -69.374 1.00 50.65  ? 60   LEU B N   1 
ATOM   4619 C  CA  . LEU B 1 60  ? -2.341  2.880   -68.359 1.00 42.55  ? 60   LEU B CA  1 
ATOM   4620 C  C   . LEU B 1 60  ? -3.381  2.619   -67.271 1.00 38.81  ? 60   LEU B C   1 
ATOM   4621 O  O   . LEU B 1 60  ? -3.961  3.546   -66.706 1.00 40.42  ? 60   LEU B O   1 
ATOM   4622 C  CB  . LEU B 1 60  ? -1.051  3.421   -67.747 1.00 42.39  ? 60   LEU B CB  1 
ATOM   4623 C  CG  . LEU B 1 60  ? -0.283  2.484   -66.818 1.00 53.66  ? 60   LEU B CG  1 
ATOM   4624 C  CD1 . LEU B 1 60  ? -0.260  1.080   -67.393 1.00 49.64  ? 60   LEU B CD1 1 
ATOM   4625 C  CD2 . LEU B 1 60  ? 1.132   3.002   -66.598 1.00 49.46  ? 60   LEU B CD2 1 
ATOM   4626 N  N   . ASP B 1 61  ? -3.624  1.347   -66.990 1.00 36.48  ? 61   ASP B N   1 
ATOM   4627 C  CA  . ASP B 1 61  ? -4.580  0.974   -65.964 1.00 37.51  ? 61   ASP B CA  1 
ATOM   4628 C  C   . ASP B 1 61  ? -4.038  1.283   -64.568 1.00 47.27  ? 61   ASP B C   1 
ATOM   4629 O  O   . ASP B 1 61  ? -3.085  0.651   -64.111 1.00 51.30  ? 61   ASP B O   1 
ATOM   4630 C  CB  . ASP B 1 61  ? -4.923  -0.509  -66.067 1.00 28.67  ? 61   ASP B CB  1 
ATOM   4631 C  CG  . ASP B 1 61  ? -5.645  -1.014  -64.837 1.00 57.65  ? 61   ASP B CG  1 
ATOM   4632 O  OD1 . ASP B 1 61  ? -5.063  -1.830  -64.089 1.00 70.09  ? 61   ASP B OD1 1 
ATOM   4633 O  OD2 . ASP B 1 61  ? -6.785  -0.570  -64.604 1.00 52.37  ? 61   ASP B OD2 1 
ATOM   4634 N  N   . ALA B 1 62  ? -4.656  2.252   -63.899 1.00 39.88  ? 62   ALA B N   1 
ATOM   4635 C  CA  . ALA B 1 62  ? -4.261  2.650   -62.551 1.00 39.26  ? 62   ALA B CA  1 
ATOM   4636 C  C   . ALA B 1 62  ? -5.379  2.365   -61.556 1.00 37.87  ? 62   ALA B C   1 
ATOM   4637 O  O   . ALA B 1 62  ? -5.764  3.240   -60.785 1.00 35.39  ? 62   ALA B O   1 
ATOM   4638 C  CB  . ALA B 1 62  ? -3.908  4.132   -62.524 1.00 30.84  ? 62   ALA B CB  1 
ATOM   4639 N  N   . THR B 1 63  ? -5.901  1.143   -61.572 1.00 33.33  ? 63   THR B N   1 
ATOM   4640 C  CA  . THR B 1 63  ? -7.104  0.841   -60.803 1.00 40.59  ? 63   THR B CA  1 
ATOM   4641 C  C   . THR B 1 63  ? -6.848  -0.194  -59.724 1.00 42.92  ? 63   THR B C   1 
ATOM   4642 O  O   . THR B 1 63  ? -7.759  -0.582  -58.994 1.00 39.35  ? 63   THR B O   1 
ATOM   4643 C  CB  . THR B 1 63  ? -8.248  0.324   -61.711 1.00 40.77  ? 63   THR B CB  1 
ATOM   4644 O  OG1 . THR B 1 63  ? -7.953  -1.008  -62.154 1.00 36.65  ? 63   THR B OG1 1 
ATOM   4645 C  CG2 . THR B 1 63  ? -8.431  1.235   -62.917 1.00 30.44  ? 63   THR B CG2 1 
ATOM   4646 N  N   . THR B 1 64  ? -5.605  -0.642  -59.622 1.00 39.97  ? 64   THR B N   1 
ATOM   4647 C  CA  . THR B 1 64  ? -5.279  -1.703  -58.683 1.00 42.93  ? 64   THR B CA  1 
ATOM   4648 C  C   . THR B 1 64  ? -3.871  -1.532  -58.110 1.00 43.17  ? 64   THR B C   1 
ATOM   4649 O  O   . THR B 1 64  ? -2.999  -0.937  -58.742 1.00 36.67  ? 64   THR B O   1 
ATOM   4650 C  CB  . THR B 1 64  ? -5.426  -3.084  -59.354 1.00 47.28  ? 64   THR B CB  1 
ATOM   4651 O  OG1 . THR B 1 64  ? -5.101  -4.111  -58.412 1.00 61.35  ? 64   THR B OG1 1 
ATOM   4652 C  CG2 . THR B 1 64  ? -4.507  -3.193  -60.565 1.00 41.08  ? 64   THR B CG2 1 
ATOM   4653 N  N   . PHE B 1 65  ? -3.655  -2.043  -56.904 1.00 37.88  ? 65   PHE B N   1 
ATOM   4654 C  CA  . PHE B 1 65  ? -2.346  -1.940  -56.272 1.00 37.98  ? 65   PHE B CA  1 
ATOM   4655 C  C   . PHE B 1 65  ? -1.312  -2.744  -57.039 1.00 39.00  ? 65   PHE B C   1 
ATOM   4656 O  O   . PHE B 1 65  ? -1.598  -3.830  -57.529 1.00 35.52  ? 65   PHE B O   1 
ATOM   4657 C  CB  . PHE B 1 65  ? -2.400  -2.426  -54.823 1.00 40.01  ? 65   PHE B CB  1 
ATOM   4658 C  CG  . PHE B 1 65  ? -2.981  -1.427  -53.872 1.00 39.02  ? 65   PHE B CG  1 
ATOM   4659 C  CD1 . PHE B 1 65  ? -2.422  -0.165  -53.748 1.00 40.66  ? 65   PHE B CD1 1 
ATOM   4660 C  CD2 . PHE B 1 65  ? -4.078  -1.750  -53.091 1.00 33.44  ? 65   PHE B CD2 1 
ATOM   4661 C  CE1 . PHE B 1 65  ? -2.954  0.761   -52.874 1.00 33.70  ? 65   PHE B CE1 1 
ATOM   4662 C  CE2 . PHE B 1 65  ? -4.613  -0.833  -52.211 1.00 32.58  ? 65   PHE B CE2 1 
ATOM   4663 C  CZ  . PHE B 1 65  ? -4.052  0.426   -52.104 1.00 42.50  ? 65   PHE B CZ  1 
ATOM   4664 N  N   . GLN B 1 66  ? -0.102  -2.211  -57.141 1.00 39.99  ? 66   GLN B N   1 
ATOM   4665 C  CA  . GLN B 1 66  ? 0.977   -2.952  -57.773 1.00 37.24  ? 66   GLN B CA  1 
ATOM   4666 C  C   . GLN B 1 66  ? 1.678   -3.859  -56.770 1.00 43.76  ? 66   GLN B C   1 
ATOM   4667 O  O   . GLN B 1 66  ? 1.288   -3.933  -55.605 1.00 39.00  ? 66   GLN B O   1 
ATOM   4668 C  CB  . GLN B 1 66  ? 1.971   -2.004  -58.433 1.00 32.82  ? 66   GLN B CB  1 
ATOM   4669 C  CG  . GLN B 1 66  ? 1.672   -1.740  -59.889 1.00 39.04  ? 66   GLN B CG  1 
ATOM   4670 C  CD  . GLN B 1 66  ? 2.113   -2.881  -60.778 1.00 45.84  ? 66   GLN B CD  1 
ATOM   4671 O  OE1 . GLN B 1 66  ? 2.622   -3.895  -60.298 1.00 42.94  ? 66   GLN B OE1 1 
ATOM   4672 N  NE2 . GLN B 1 66  ? 1.929   -2.720  -62.083 1.00 45.97  ? 66   GLN B NE2 1 
ATOM   4673 N  N   . ASN B 1 67  ? 2.712   -4.553  -57.232 1.00 39.10  ? 67   ASN B N   1 
ATOM   4674 C  CA  . ASN B 1 67  ? 3.436   -5.496  -56.391 1.00 38.34  ? 67   ASN B CA  1 
ATOM   4675 C  C   . ASN B 1 67  ? 4.154   -4.864  -55.208 1.00 39.00  ? 67   ASN B C   1 
ATOM   4676 O  O   . ASN B 1 67  ? 4.590   -3.716  -55.268 1.00 40.52  ? 67   ASN B O   1 
ATOM   4677 C  CB  . ASN B 1 67  ? 4.442   -6.282  -57.226 1.00 44.50  ? 67   ASN B CB  1 
ATOM   4678 C  CG  . ASN B 1 67  ? 3.775   -7.179  -58.239 1.00 53.20  ? 67   ASN B CG  1 
ATOM   4679 O  OD1 . ASN B 1 67  ? 2.679   -7.694  -58.006 1.00 43.34  ? 67   ASN B OD1 1 
ATOM   4680 N  ND2 . ASN B 1 67  ? 4.434   -7.376  -59.372 1.00 43.17  ? 67   ASN B ND2 1 
ATOM   4681 N  N   . VAL B 1 68  ? 4.270   -5.638  -54.134 1.00 32.90  ? 68   VAL B N   1 
ATOM   4682 C  CA  . VAL B 1 68  ? 5.045   -5.249  -52.971 1.00 27.04  ? 68   VAL B CA  1 
ATOM   4683 C  C   . VAL B 1 68  ? 6.532   -5.479  -53.218 1.00 35.70  ? 68   VAL B C   1 
ATOM   4684 O  O   . VAL B 1 68  ? 6.928   -6.540  -53.705 1.00 38.00  ? 68   VAL B O   1 
ATOM   4685 C  CB  . VAL B 1 68  ? 4.610   -6.058  -51.735 1.00 37.12  ? 68   VAL B CB  1 
ATOM   4686 C  CG1 . VAL B 1 68  ? 5.499   -5.734  -50.541 1.00 32.96  ? 68   VAL B CG1 1 
ATOM   4687 C  CG2 . VAL B 1 68  ? 3.145   -5.788  -51.419 1.00 31.78  ? 68   VAL B CG2 1 
ATOM   4688 N  N   . CYS B 1 69  ? 7.351   -4.484  -52.886 1.00 34.36  ? 69   CYS B N   1 
ATOM   4689 C  CA  . CYS B 1 69  ? 8.803   -4.622  -52.992 1.00 31.46  ? 69   CYS B CA  1 
ATOM   4690 C  C   . CYS B 1 69  ? 9.295   -5.870  -52.262 1.00 37.29  ? 69   CYS B C   1 
ATOM   4691 O  O   . CYS B 1 69  ? 8.850   -6.164  -51.148 1.00 28.75  ? 69   CYS B O   1 
ATOM   4692 C  CB  . CYS B 1 69  ? 9.506   -3.386  -52.436 1.00 29.30  ? 69   CYS B CB  1 
ATOM   4693 S  SG  . CYS B 1 69  ? 9.425   -1.933  -53.492 1.00 34.38  ? 69   CYS B SG  1 
ATOM   4694 N  N   . TYR B 1 70  ? 10.220  -6.595  -52.889 1.00 35.47  ? 70   TYR B N   1 
ATOM   4695 C  CA  . TYR B 1 70  ? 10.656  -7.879  -52.349 1.00 39.32  ? 70   TYR B CA  1 
ATOM   4696 C  C   . TYR B 1 70  ? 11.204  -7.769  -50.930 1.00 36.73  ? 70   TYR B C   1 
ATOM   4697 O  O   . TYR B 1 70  ? 12.128  -7.003  -50.664 1.00 30.33  ? 70   TYR B O   1 
ATOM   4698 C  CB  . TYR B 1 70  ? 11.654  -8.592  -53.270 1.00 29.62  ? 70   TYR B CB  1 
ATOM   4699 C  CG  . TYR B 1 70  ? 11.521  -10.091 -53.137 1.00 39.27  ? 70   TYR B CG  1 
ATOM   4700 C  CD1 . TYR B 1 70  ? 10.573  -10.787 -53.874 1.00 47.05  ? 70   TYR B CD1 1 
ATOM   4701 C  CD2 . TYR B 1 70  ? 12.295  -10.802 -52.230 1.00 41.21  ? 70   TYR B CD2 1 
ATOM   4702 C  CE1 . TYR B 1 70  ? 10.424  -12.155 -53.740 1.00 43.25  ? 70   TYR B CE1 1 
ATOM   4703 C  CE2 . TYR B 1 70  ? 12.152  -12.169 -52.088 1.00 47.76  ? 70   TYR B CE2 1 
ATOM   4704 C  CZ  . TYR B 1 70  ? 11.212  -12.840 -52.845 1.00 47.22  ? 70   TYR B CZ  1 
ATOM   4705 O  OH  . TYR B 1 70  ? 11.059  -14.200 -52.705 1.00 41.48  ? 70   TYR B OH  1 
ATOM   4706 N  N   . GLN B 1 71  ? 10.629  -8.551  -50.023 1.00 37.36  ? 71   GLN B N   1 
ATOM   4707 C  CA  . GLN B 1 71  ? 10.931  -8.400  -48.610 1.00 37.66  ? 71   GLN B CA  1 
ATOM   4708 C  C   . GLN B 1 71  ? 10.635  -9.660  -47.809 1.00 39.27  ? 71   GLN B C   1 
ATOM   4709 O  O   . GLN B 1 71  ? 9.837   -10.502 -48.218 1.00 34.42  ? 71   GLN B O   1 
ATOM   4710 C  CB  . GLN B 1 71  ? 10.110  -7.249  -48.033 1.00 31.06  ? 71   GLN B CB  1 
ATOM   4711 C  CG  . GLN B 1 71  ? 8.642   -7.583  -47.855 1.00 31.58  ? 71   GLN B CG  1 
ATOM   4712 C  CD  . GLN B 1 71  ? 7.795   -6.356  -47.622 1.00 39.18  ? 71   GLN B CD  1 
ATOM   4713 O  OE1 . GLN B 1 71  ? 7.011   -6.297  -46.676 1.00 36.95  ? 71   GLN B OE1 1 
ATOM   4714 N  NE2 . GLN B 1 71  ? 7.952   -5.362  -48.485 1.00 36.23  ? 71   GLN B NE2 1 
ATOM   4715 N  N   . TYR B 1 72  ? 11.287  -9.762  -46.657 1.00 40.74  ? 72   TYR B N   1 
ATOM   4716 C  CA  . TYR B 1 72  ? 11.013  -10.802 -45.677 1.00 37.35  ? 72   TYR B CA  1 
ATOM   4717 C  C   . TYR B 1 72  ? 9.543   -10.788 -45.259 1.00 38.28  ? 72   TYR B C   1 
ATOM   4718 O  O   . TYR B 1 72  ? 8.898   -9.740  -45.250 1.00 40.34  ? 72   TYR B O   1 
ATOM   4719 C  CB  . TYR B 1 72  ? 11.903  -10.582 -44.453 1.00 43.23  ? 72   TYR B CB  1 
ATOM   4720 C  CG  . TYR B 1 72  ? 11.655  -11.539 -43.314 1.00 49.51  ? 72   TYR B CG  1 
ATOM   4721 C  CD1 . TYR B 1 72  ? 10.941  -11.142 -42.187 1.00 44.01  ? 72   TYR B CD1 1 
ATOM   4722 C  CD2 . TYR B 1 72  ? 12.141  -12.839 -43.360 1.00 42.99  ? 72   TYR B CD2 1 
ATOM   4723 C  CE1 . TYR B 1 72  ? 10.718  -12.018 -41.139 1.00 40.36  ? 72   TYR B CE1 1 
ATOM   4724 C  CE2 . TYR B 1 72  ? 11.923  -13.718 -42.322 1.00 38.97  ? 72   TYR B CE2 1 
ATOM   4725 C  CZ  . TYR B 1 72  ? 11.213  -13.306 -41.214 1.00 46.42  ? 72   TYR B CZ  1 
ATOM   4726 O  OH  . TYR B 1 72  ? 10.998  -14.195 -40.183 1.00 56.94  ? 72   TYR B OH  1 
ATOM   4727 N  N   . VAL B 1 73  ? 9.016   -11.958 -44.917 1.00 38.72  ? 73   VAL B N   1 
ATOM   4728 C  CA  . VAL B 1 73  ? 7.636   -12.067 -44.473 1.00 35.96  ? 73   VAL B CA  1 
ATOM   4729 C  C   . VAL B 1 73  ? 7.608   -12.690 -43.084 1.00 44.10  ? 73   VAL B C   1 
ATOM   4730 O  O   . VAL B 1 73  ? 8.169   -13.760 -42.866 1.00 42.82  ? 73   VAL B O   1 
ATOM   4731 C  CB  . VAL B 1 73  ? 6.784   -12.902 -45.459 1.00 47.39  ? 73   VAL B CB  1 
ATOM   4732 C  CG1 . VAL B 1 73  ? 5.373   -13.099 -44.922 1.00 29.57  ? 73   VAL B CG1 1 
ATOM   4733 C  CG2 . VAL B 1 73  ? 6.744   -12.231 -46.825 1.00 45.34  ? 73   VAL B CG2 1 
ATOM   4734 N  N   . ASP B 1 74  ? 6.961   -12.011 -42.144 1.00 48.29  ? 74   ASP B N   1 
ATOM   4735 C  CA  . ASP B 1 74  ? 6.972   -12.446 -40.754 1.00 49.84  ? 74   ASP B CA  1 
ATOM   4736 C  C   . ASP B 1 74  ? 6.337   -13.822 -40.578 1.00 54.32  ? 74   ASP B C   1 
ATOM   4737 O  O   . ASP B 1 74  ? 5.275   -14.102 -41.135 1.00 56.06  ? 74   ASP B O   1 
ATOM   4738 C  CB  . ASP B 1 74  ? 6.257   -11.430 -39.863 1.00 52.34  ? 74   ASP B CB  1 
ATOM   4739 C  CG  . ASP B 1 74  ? 6.692   -11.526 -38.417 1.00 54.43  ? 74   ASP B CG  1 
ATOM   4740 O  OD1 . ASP B 1 74  ? 5.977   -12.161 -37.613 1.00 50.71  ? 74   ASP B OD1 1 
ATOM   4741 O  OD2 . ASP B 1 74  ? 7.765   -10.980 -38.089 1.00 58.81  ? 74   ASP B OD2 1 
ATOM   4742 N  N   . THR B 1 75  ? 6.988   -14.663 -39.780 1.00 51.88  ? 75   THR B N   1 
ATOM   4743 C  CA  . THR B 1 75  ? 6.540   -16.033 -39.556 1.00 58.36  ? 75   THR B CA  1 
ATOM   4744 C  C   . THR B 1 75  ? 6.254   -16.325 -38.083 1.00 60.75  ? 75   THR B C   1 
ATOM   4745 O  O   . THR B 1 75  ? 5.759   -17.397 -37.744 1.00 57.75  ? 75   THR B O   1 
ATOM   4746 C  CB  . THR B 1 75  ? 7.605   -17.038 -40.039 1.00 56.35  ? 75   THR B CB  1 
ATOM   4747 O  OG1 . THR B 1 75  ? 8.851   -16.768 -39.381 1.00 59.95  ? 75   THR B OG1 1 
ATOM   4748 C  CG2 . THR B 1 75  ? 7.803   -16.927 -41.540 1.00 49.48  ? 75   THR B CG2 1 
ATOM   4749 N  N   . LEU B 1 76  ? 6.567   -15.372 -37.212 1.00 54.60  ? 76   LEU B N   1 
ATOM   4750 C  CA  . LEU B 1 76  ? 6.492   -15.596 -35.771 1.00 56.65  ? 76   LEU B CA  1 
ATOM   4751 C  C   . LEU B 1 76  ? 5.165   -16.197 -35.288 1.00 58.74  ? 76   LEU B C   1 
ATOM   4752 O  O   . LEU B 1 76  ? 5.156   -17.212 -34.589 1.00 60.02  ? 76   LEU B O   1 
ATOM   4753 C  CB  . LEU B 1 76  ? 6.805   -14.309 -35.003 1.00 49.37  ? 76   LEU B CB  1 
ATOM   4754 C  CG  . LEU B 1 76  ? 6.691   -14.464 -33.486 1.00 53.43  ? 76   LEU B CG  1 
ATOM   4755 C  CD1 . LEU B 1 76  ? 7.542   -15.634 -33.016 1.00 47.05  ? 76   LEU B CD1 1 
ATOM   4756 C  CD2 . LEU B 1 76  ? 7.082   -13.184 -32.764 1.00 56.19  ? 76   LEU B CD2 1 
ATOM   4757 N  N   . TYR B 1 77  ? 4.052   -15.566 -35.643 1.00 53.14  ? 77   TYR B N   1 
ATOM   4758 C  CA  . TYR B 1 77  ? 2.738   -16.082 -35.275 1.00 50.45  ? 77   TYR B CA  1 
ATOM   4759 C  C   . TYR B 1 77  ? 1.881   -16.242 -36.520 1.00 50.83  ? 77   TYR B C   1 
ATOM   4760 O  O   . TYR B 1 77  ? 0.991   -15.432 -36.773 1.00 46.18  ? 77   TYR B O   1 
ATOM   4761 C  CB  . TYR B 1 77  ? 2.036   -15.149 -34.291 1.00 46.80  ? 77   TYR B CB  1 
ATOM   4762 C  CG  . TYR B 1 77  ? 2.764   -14.960 -32.981 1.00 59.10  ? 77   TYR B CG  1 
ATOM   4763 C  CD1 . TYR B 1 77  ? 2.840   -15.990 -32.053 1.00 55.77  ? 77   TYR B CD1 1 
ATOM   4764 C  CD2 . TYR B 1 77  ? 3.359   -13.743 -32.662 1.00 52.31  ? 77   TYR B CD2 1 
ATOM   4765 C  CE1 . TYR B 1 77  ? 3.498   -15.820 -30.846 1.00 58.74  ? 77   TYR B CE1 1 
ATOM   4766 C  CE2 . TYR B 1 77  ? 4.018   -13.563 -31.458 1.00 50.75  ? 77   TYR B CE2 1 
ATOM   4767 C  CZ  . TYR B 1 77  ? 4.086   -14.606 -30.553 1.00 65.22  ? 77   TYR B CZ  1 
ATOM   4768 O  OH  . TYR B 1 77  ? 4.740   -14.438 -29.352 1.00 60.46  ? 77   TYR B OH  1 
ATOM   4769 N  N   . PRO B 1 78  ? 2.143   -17.300 -37.299 1.00 54.69  ? 78   PRO B N   1 
ATOM   4770 C  CA  . PRO B 1 78  ? 1.482   -17.521 -38.589 1.00 56.49  ? 78   PRO B CA  1 
ATOM   4771 C  C   . PRO B 1 78  ? -0.028  -17.471 -38.446 1.00 48.18  ? 78   PRO B C   1 
ATOM   4772 O  O   . PRO B 1 78  ? -0.575  -18.149 -37.580 1.00 52.11  ? 78   PRO B O   1 
ATOM   4773 C  CB  . PRO B 1 78  ? 1.918   -18.940 -38.966 1.00 49.63  ? 78   PRO B CB  1 
ATOM   4774 C  CG  . PRO B 1 78  ? 3.182   -19.162 -38.215 1.00 55.02  ? 78   PRO B CG  1 
ATOM   4775 C  CD  . PRO B 1 78  ? 3.006   -18.431 -36.921 1.00 58.87  ? 78   PRO B CD  1 
ATOM   4776 N  N   . GLY B 1 79  ? -0.687  -16.668 -39.276 1.00 47.95  ? 79   GLY B N   1 
ATOM   4777 C  CA  . GLY B 1 79  ? -2.134  -16.569 -39.255 1.00 33.81  ? 79   GLY B CA  1 
ATOM   4778 C  C   . GLY B 1 79  ? -2.692  -15.571 -38.257 1.00 53.00  ? 79   GLY B C   1 
ATOM   4779 O  O   . GLY B 1 79  ? -3.888  -15.280 -38.269 1.00 49.20  ? 79   GLY B O   1 
ATOM   4780 N  N   . PHE B 1 80  ? -1.831  -15.046 -37.388 1.00 47.32  ? 80   PHE B N   1 
ATOM   4781 C  CA  . PHE B 1 80  ? -2.267  -14.106 -36.365 1.00 43.13  ? 80   PHE B CA  1 
ATOM   4782 C  C   . PHE B 1 80  ? -2.512  -12.727 -36.969 1.00 50.33  ? 80   PHE B C   1 
ATOM   4783 O  O   . PHE B 1 80  ? -1.629  -12.154 -37.609 1.00 47.19  ? 80   PHE B O   1 
ATOM   4784 C  CB  . PHE B 1 80  ? -1.241  -14.027 -35.228 1.00 49.62  ? 80   PHE B CB  1 
ATOM   4785 C  CG  . PHE B 1 80  ? -1.554  -12.978 -34.195 1.00 51.12  ? 80   PHE B CG  1 
ATOM   4786 C  CD1 . PHE B 1 80  ? -2.771  -12.978 -33.535 1.00 46.32  ? 80   PHE B CD1 1 
ATOM   4787 C  CD2 . PHE B 1 80  ? -0.627  -11.998 -33.878 1.00 50.53  ? 80   PHE B CD2 1 
ATOM   4788 C  CE1 . PHE B 1 80  ? -3.065  -12.018 -32.585 1.00 50.45  ? 80   PHE B CE1 1 
ATOM   4789 C  CE2 . PHE B 1 80  ? -0.914  -11.038 -32.924 1.00 50.49  ? 80   PHE B CE2 1 
ATOM   4790 C  CZ  . PHE B 1 80  ? -2.136  -11.049 -32.277 1.00 51.41  ? 80   PHE B CZ  1 
ATOM   4791 N  N   . GLU B 1 81  ? -3.718  -12.203 -36.766 1.00 42.06  ? 81   GLU B N   1 
ATOM   4792 C  CA  . GLU B 1 81  ? -4.109  -10.913 -37.330 1.00 52.71  ? 81   GLU B CA  1 
ATOM   4793 C  C   . GLU B 1 81  ? -3.150  -9.789  -36.936 1.00 55.86  ? 81   GLU B C   1 
ATOM   4794 O  O   . GLU B 1 81  ? -2.832  -8.918  -37.749 1.00 47.07  ? 81   GLU B O   1 
ATOM   4795 C  CB  . GLU B 1 81  ? -5.533  -10.553 -36.901 1.00 58.78  ? 81   GLU B CB  1 
ATOM   4796 C  CG  . GLU B 1 81  ? -6.004  -9.190  -37.388 1.00 89.23  ? 81   GLU B CG  1 
ATOM   4797 C  CD  . GLU B 1 81  ? -6.479  -9.215  -38.829 1.00 115.99 ? 81   GLU B CD  1 
ATOM   4798 O  OE1 . GLU B 1 81  ? -7.484  -9.904  -39.110 1.00 134.91 ? 81   GLU B OE1 1 
ATOM   4799 O  OE2 . GLU B 1 81  ? -5.857  -8.540  -39.678 1.00 98.66  ? 81   GLU B OE2 1 
ATOM   4800 N  N   . GLY B 1 82  ? -2.694  -9.817  -35.686 1.00 50.60  ? 82   GLY B N   1 
ATOM   4801 C  CA  . GLY B 1 82  ? -1.787  -8.805  -35.177 1.00 45.41  ? 82   GLY B CA  1 
ATOM   4802 C  C   . GLY B 1 82  ? -0.521  -8.626  -35.996 1.00 37.00  ? 82   GLY B C   1 
ATOM   4803 O  O   . GLY B 1 82  ? -0.051  -7.504  -36.182 1.00 40.81  ? 82   GLY B O   1 
ATOM   4804 N  N   . THR B 1 83  ? 0.030   -9.729  -36.491 1.00 40.81  ? 83   THR B N   1 
ATOM   4805 C  CA  . THR B 1 83  ? 1.283   -9.689  -37.240 1.00 44.04  ? 83   THR B CA  1 
ATOM   4806 C  C   . THR B 1 83  ? 1.054   -9.700  -38.746 1.00 47.64  ? 83   THR B C   1 
ATOM   4807 O  O   . THR B 1 83  ? 1.851   -9.152  -39.508 1.00 41.89  ? 83   THR B O   1 
ATOM   4808 C  CB  . THR B 1 83  ? 2.199   -10.869 -36.877 1.00 45.39  ? 83   THR B CB  1 
ATOM   4809 O  OG1 . THR B 1 83  ? 1.463   -12.093 -36.981 1.00 45.49  ? 83   THR B OG1 1 
ATOM   4810 C  CG2 . THR B 1 83  ? 2.722   -10.721 -35.459 1.00 44.79  ? 83   THR B CG2 1 
ATOM   4811 N  N   . GLU B 1 84  ? -0.038  -10.326 -39.173 1.00 49.63  ? 84   GLU B N   1 
ATOM   4812 C  CA  . GLU B 1 84  ? -0.314  -10.483 -40.598 1.00 44.73  ? 84   GLU B CA  1 
ATOM   4813 C  C   . GLU B 1 84  ? -0.655  -9.153  -41.250 1.00 47.37  ? 84   GLU B C   1 
ATOM   4814 O  O   . GLU B 1 84  ? -0.377  -8.940  -42.432 1.00 50.65  ? 84   GLU B O   1 
ATOM   4815 C  CB  . GLU B 1 84  ? -1.456  -11.473 -40.819 1.00 44.07  ? 84   GLU B CB  1 
ATOM   4816 C  CG  . GLU B 1 84  ? -1.101  -12.913 -40.502 1.00 51.24  ? 84   GLU B CG  1 
ATOM   4817 C  CD  . GLU B 1 84  ? -0.073  -13.482 -41.456 1.00 61.16  ? 84   GLU B CD  1 
ATOM   4818 O  OE1 . GLU B 1 84  ? 0.224   -12.820 -42.477 1.00 58.35  ? 84   GLU B OE1 1 
ATOM   4819 O  OE2 . GLU B 1 84  ? 0.435   -14.591 -41.179 1.00 58.19  ? 84   GLU B OE2 1 
ATOM   4820 N  N   . MET B 1 85  ? -1.255  -8.259  -40.470 1.00 46.55  ? 85   MET B N   1 
ATOM   4821 C  CA  . MET B 1 85  ? -1.700  -6.962  -40.972 1.00 38.26  ? 85   MET B CA  1 
ATOM   4822 C  C   . MET B 1 85  ? -0.549  -6.123  -41.525 1.00 48.31  ? 85   MET B C   1 
ATOM   4823 O  O   . MET B 1 85  ? -0.780  -5.134  -42.224 1.00 42.21  ? 85   MET B O   1 
ATOM   4824 C  CB  . MET B 1 85  ? -2.405  -6.187  -39.864 1.00 28.05  ? 85   MET B CB  1 
ATOM   4825 C  CG  . MET B 1 85  ? -1.546  -6.005  -38.620 1.00 46.01  ? 85   MET B CG  1 
ATOM   4826 S  SD  . MET B 1 85  ? -2.349  -5.006  -37.363 1.00 43.88  ? 85   MET B SD  1 
ATOM   4827 C  CE  . MET B 1 85  ? -2.477  -3.444  -38.231 1.00 37.06  ? 85   MET B CE  1 
ATOM   4828 N  N   . TRP B 1 86  ? 0.682   -6.515  -41.203 1.00 36.23  ? 86   TRP B N   1 
ATOM   4829 C  CA  . TRP B 1 86  ? 1.866   -5.799  -41.664 1.00 39.01  ? 86   TRP B CA  1 
ATOM   4830 C  C   . TRP B 1 86  ? 2.519   -6.518  -42.832 1.00 39.44  ? 86   TRP B C   1 
ATOM   4831 O  O   . TRP B 1 86  ? 3.357   -5.951  -43.532 1.00 39.39  ? 86   TRP B O   1 
ATOM   4832 C  CB  . TRP B 1 86  ? 2.877   -5.640  -40.523 1.00 39.07  ? 86   TRP B CB  1 
ATOM   4833 C  CG  . TRP B 1 86  ? 2.285   -5.003  -39.314 1.00 44.42  ? 86   TRP B CG  1 
ATOM   4834 C  CD1 . TRP B 1 86  ? 2.011   -5.603  -38.121 1.00 43.80  ? 86   TRP B CD1 1 
ATOM   4835 C  CD2 . TRP B 1 86  ? 1.861   -3.642  -39.187 1.00 35.60  ? 86   TRP B CD2 1 
ATOM   4836 N  NE1 . TRP B 1 86  ? 1.453   -4.698  -37.256 1.00 40.56  ? 86   TRP B NE1 1 
ATOM   4837 C  CE2 . TRP B 1 86  ? 1.351   -3.486  -37.885 1.00 38.24  ? 86   TRP B CE2 1 
ATOM   4838 C  CE3 . TRP B 1 86  ? 1.875   -2.538  -40.045 1.00 37.25  ? 86   TRP B CE3 1 
ATOM   4839 C  CZ2 . TRP B 1 86  ? 0.858   -2.267  -37.417 1.00 40.79  ? 86   TRP B CZ2 1 
ATOM   4840 C  CZ3 . TRP B 1 86  ? 1.384   -1.330  -39.581 1.00 38.60  ? 86   TRP B CZ3 1 
ATOM   4841 C  CH2 . TRP B 1 86  ? 0.882   -1.204  -38.279 1.00 37.51  ? 86   TRP B CH2 1 
ATOM   4842 N  N   . ASN B 1 87  ? 2.136   -7.774  -43.034 1.00 42.10  ? 87   ASN B N   1 
ATOM   4843 C  CA  . ASN B 1 87  ? 2.705   -8.579  -44.107 1.00 42.62  ? 87   ASN B CA  1 
ATOM   4844 C  C   . ASN B 1 87  ? 2.235   -8.144  -45.496 1.00 37.91  ? 87   ASN B C   1 
ATOM   4845 O  O   . ASN B 1 87  ? 1.197   -7.500  -45.636 1.00 35.09  ? 87   ASN B O   1 
ATOM   4846 C  CB  . ASN B 1 87  ? 2.410   -10.059 -43.876 1.00 41.05  ? 87   ASN B CB  1 
ATOM   4847 C  CG  . ASN B 1 87  ? 3.404   -10.707 -42.942 1.00 45.53  ? 87   ASN B CG  1 
ATOM   4848 O  OD1 . ASN B 1 87  ? 4.605   -10.441 -43.015 1.00 43.58  ? 87   ASN B OD1 1 
ATOM   4849 N  ND2 . ASN B 1 87  ? 2.914   -11.574 -42.064 1.00 46.85  ? 87   ASN B ND2 1 
ATOM   4850 N  N   . PRO B 1 88  ? 3.012   -8.489  -46.530 1.00 36.74  ? 88   PRO B N   1 
ATOM   4851 C  CA  . PRO B 1 88  ? 2.658   -8.122  -47.905 1.00 43.31  ? 88   PRO B CA  1 
ATOM   4852 C  C   . PRO B 1 88  ? 1.272   -8.636  -48.285 1.00 37.55  ? 88   PRO B C   1 
ATOM   4853 O  O   . PRO B 1 88  ? 0.975   -9.810  -48.078 1.00 39.55  ? 88   PRO B O   1 
ATOM   4854 C  CB  . PRO B 1 88  ? 3.728   -8.829  -48.743 1.00 30.51  ? 88   PRO B CB  1 
ATOM   4855 C  CG  . PRO B 1 88  ? 4.865   -9.049  -47.814 1.00 40.64  ? 88   PRO B CG  1 
ATOM   4856 C  CD  . PRO B 1 88  ? 4.251   -9.283  -46.469 1.00 41.53  ? 88   PRO B CD  1 
ATOM   4857 N  N   . ASN B 1 89  ? 0.438   -7.762  -48.833 1.00 37.17  ? 89   ASN B N   1 
ATOM   4858 C  CA  . ASN B 1 89  ? -0.893  -8.161  -49.271 1.00 37.49  ? 89   ASN B CA  1 
ATOM   4859 C  C   . ASN B 1 89  ? -0.990  -8.187  -50.795 1.00 43.63  ? 89   ASN B C   1 
ATOM   4860 O  O   . ASN B 1 89  ? -2.078  -8.267  -51.360 1.00 41.07  ? 89   ASN B O   1 
ATOM   4861 C  CB  . ASN B 1 89  ? -1.961  -7.248  -48.664 1.00 31.63  ? 89   ASN B CB  1 
ATOM   4862 C  CG  . ASN B 1 89  ? -1.835  -5.813  -49.132 1.00 44.82  ? 89   ASN B CG  1 
ATOM   4863 O  OD1 . ASN B 1 89  ? -0.783  -5.399  -49.630 1.00 33.15  ? 89   ASN B OD1 1 
ATOM   4864 N  ND2 . ASN B 1 89  ? -2.907  -5.044  -48.976 1.00 34.31  ? 89   ASN B ND2 1 
ATOM   4865 N  N   . ARG B 1 90  ? 0.165   -8.110  -51.448 1.00 40.11  ? 90   ARG B N   1 
ATOM   4866 C  CA  . ARG B 1 90  ? 0.266   -8.298  -52.889 1.00 35.43  ? 90   ARG B CA  1 
ATOM   4867 C  C   . ARG B 1 90  ? 1.455   -9.197  -53.178 1.00 40.85  ? 90   ARG B C   1 
ATOM   4868 O  O   . ARG B 1 90  ? 2.215   -9.533  -52.273 1.00 44.58  ? 90   ARG B O   1 
ATOM   4869 C  CB  . ARG B 1 90  ? 0.438   -6.963  -53.615 1.00 36.55  ? 90   ARG B CB  1 
ATOM   4870 C  CG  . ARG B 1 90  ? -0.813  -6.108  -53.658 1.00 41.64  ? 90   ARG B CG  1 
ATOM   4871 C  CD  . ARG B 1 90  ? -2.006  -6.910  -54.146 1.00 44.61  ? 90   ARG B CD  1 
ATOM   4872 N  NE  . ARG B 1 90  ? -3.177  -6.069  -54.378 1.00 43.45  ? 90   ARG B NE  1 
ATOM   4873 C  CZ  . ARG B 1 90  ? -4.111  -5.815  -53.467 1.00 50.70  ? 90   ARG B CZ  1 
ATOM   4874 N  NH1 . ARG B 1 90  ? -4.019  -6.334  -52.247 1.00 42.56  ? 90   ARG B NH1 1 
ATOM   4875 N  NH2 . ARG B 1 90  ? -5.141  -5.037  -53.774 1.00 43.40  ? 90   ARG B NH2 1 
ATOM   4876 N  N   . GLU B 1 91  ? 1.613   -9.588  -54.438 1.00 43.82  ? 91   GLU B N   1 
ATOM   4877 C  CA  . GLU B 1 91  ? 2.741   -10.422 -54.835 1.00 43.90  ? 91   GLU B CA  1 
ATOM   4878 C  C   . GLU B 1 91  ? 4.054   -9.675  -54.636 1.00 40.44  ? 91   GLU B C   1 
ATOM   4879 O  O   . GLU B 1 91  ? 4.146   -8.473  -54.891 1.00 36.67  ? 91   GLU B O   1 
ATOM   4880 C  CB  . GLU B 1 91  ? 2.613   -10.850 -56.301 1.00 52.31  ? 91   GLU B CB  1 
ATOM   4881 C  CG  . GLU B 1 91  ? 1.448   -11.789 -56.593 1.00 58.79  ? 91   GLU B CG  1 
ATOM   4882 C  CD  . GLU B 1 91  ? 1.683   -13.195 -56.073 1.00 69.29  ? 91   GLU B CD  1 
ATOM   4883 O  OE1 . GLU B 1 91  ? 2.830   -13.502 -55.680 1.00 57.36  ? 91   GLU B OE1 1 
ATOM   4884 O  OE2 . GLU B 1 91  ? 0.720   -13.992 -56.057 1.00 87.78  ? 91   GLU B OE2 1 
ATOM   4885 N  N   . LEU B 1 92  ? 5.069   -10.395 -54.180 1.00 33.23  ? 92   LEU B N   1 
ATOM   4886 C  CA  . LEU B 1 92  ? 6.393   -9.822  -54.024 1.00 26.76  ? 92   LEU B CA  1 
ATOM   4887 C  C   . LEU B 1 92  ? 7.077   -9.697  -55.380 1.00 35.05  ? 92   LEU B C   1 
ATOM   4888 O  O   . LEU B 1 92  ? 6.952   -10.573 -56.226 1.00 41.99  ? 92   LEU B O   1 
ATOM   4889 C  CB  . LEU B 1 92  ? 7.237   -10.702 -53.108 1.00 29.56  ? 92   LEU B CB  1 
ATOM   4890 C  CG  . LEU B 1 92  ? 6.706   -10.932 -51.697 1.00 34.87  ? 92   LEU B CG  1 
ATOM   4891 C  CD1 . LEU B 1 92  ? 7.706   -11.754 -50.903 1.00 27.14  ? 92   LEU B CD1 1 
ATOM   4892 C  CD2 . LEU B 1 92  ? 6.437   -9.604  -51.014 1.00 32.49  ? 92   LEU B CD2 1 
ATOM   4893 N  N   . SER B 1 93  ? 7.806   -8.609  -55.582 1.00 38.74  ? 93   SER B N   1 
ATOM   4894 C  CA  . SER B 1 93  ? 8.587   -8.435  -56.797 1.00 32.33  ? 93   SER B CA  1 
ATOM   4895 C  C   . SER B 1 93  ? 9.576   -7.287  -56.630 1.00 37.15  ? 93   SER B C   1 
ATOM   4896 O  O   . SER B 1 93  ? 9.306   -6.329  -55.907 1.00 37.52  ? 93   SER B O   1 
ATOM   4897 C  CB  . SER B 1 93  ? 7.667   -8.167  -57.992 1.00 39.62  ? 93   SER B CB  1 
ATOM   4898 O  OG  . SER B 1 93  ? 8.398   -7.653  -59.091 1.00 35.79  ? 93   SER B OG  1 
ATOM   4899 N  N   . GLU B 1 94  ? 10.721  -7.384  -57.296 1.00 29.80  ? 94   GLU B N   1 
ATOM   4900 C  CA  . GLU B 1 94  ? 11.666  -6.277  -57.322 1.00 30.79  ? 94   GLU B CA  1 
ATOM   4901 C  C   . GLU B 1 94  ? 11.136  -5.182  -58.230 1.00 33.56  ? 94   GLU B C   1 
ATOM   4902 O  O   . GLU B 1 94  ? 11.530  -4.023  -58.126 1.00 35.37  ? 94   GLU B O   1 
ATOM   4903 C  CB  . GLU B 1 94  ? 13.054  -6.741  -57.770 1.00 31.80  ? 94   GLU B CB  1 
ATOM   4904 C  CG  . GLU B 1 94  ? 13.793  -7.539  -56.697 1.00 35.89  ? 94   GLU B CG  1 
ATOM   4905 C  CD  . GLU B 1 94  ? 15.130  -8.087  -57.165 1.00 42.50  ? 94   GLU B CD  1 
ATOM   4906 O  OE1 . GLU B 1 94  ? 16.084  -7.298  -57.351 1.00 35.91  ? 94   GLU B OE1 1 
ATOM   4907 O  OE2 . GLU B 1 94  ? 15.226  -9.318  -57.333 1.00 36.53  ? 94   GLU B OE2 1 
ATOM   4908 N  N   . ASP B 1 95  ? 10.231  -5.559  -59.124 1.00 34.66  ? 95   ASP B N   1 
ATOM   4909 C  CA  . ASP B 1 95  ? 9.530   -4.586  -59.943 1.00 32.76  ? 95   ASP B CA  1 
ATOM   4910 C  C   . ASP B 1 95  ? 8.382   -4.055  -59.099 1.00 33.63  ? 95   ASP B C   1 
ATOM   4911 O  O   . ASP B 1 95  ? 7.292   -4.616  -59.111 1.00 33.44  ? 95   ASP B O   1 
ATOM   4912 C  CB  . ASP B 1 95  ? 9.008   -5.256  -61.212 1.00 24.97  ? 95   ASP B CB  1 
ATOM   4913 C  CG  . ASP B 1 95  ? 8.150   -4.338  -62.055 1.00 31.83  ? 95   ASP B CG  1 
ATOM   4914 O  OD1 . ASP B 1 95  ? 7.976   -3.158  -61.688 1.00 39.72  ? 95   ASP B OD1 1 
ATOM   4915 O  OD2 . ASP B 1 95  ? 7.646   -4.806  -63.095 1.00 34.76  ? 95   ASP B OD2 1 
ATOM   4916 N  N   . CYS B 1 96  ? 8.635   -2.977  -58.359 1.00 34.23  ? 96   CYS B N   1 
ATOM   4917 C  CA  . CYS B 1 96  ? 7.711   -2.525  -57.318 1.00 32.19  ? 96   CYS B CA  1 
ATOM   4918 C  C   . CYS B 1 96  ? 7.655   -1.013  -57.136 1.00 30.36  ? 96   CYS B C   1 
ATOM   4919 O  O   . CYS B 1 96  ? 7.020   -0.526  -56.206 1.00 32.55  ? 96   CYS B O   1 
ATOM   4920 C  CB  . CYS B 1 96  ? 8.095   -3.155  -55.980 1.00 32.39  ? 96   CYS B CB  1 
ATOM   4921 S  SG  . CYS B 1 96  ? 9.730   -2.625  -55.377 1.00 35.86  ? 96   CYS B SG  1 
ATOM   4922 N  N   . LEU B 1 97  ? 8.323   -0.268  -58.004 1.00 30.43  ? 97   LEU B N   1 
ATOM   4923 C  CA  . LEU B 1 97  ? 8.357   1.180   -57.844 1.00 28.72  ? 97   LEU B CA  1 
ATOM   4924 C  C   . LEU B 1 97  ? 7.126   1.842   -58.451 1.00 36.58  ? 97   LEU B C   1 
ATOM   4925 O  O   . LEU B 1 97  ? 7.150   2.366   -59.568 1.00 33.87  ? 97   LEU B O   1 
ATOM   4926 C  CB  . LEU B 1 97  ? 9.667   1.769   -58.376 1.00 23.34  ? 97   LEU B CB  1 
ATOM   4927 C  CG  . LEU B 1 97  ? 10.887  1.225   -57.616 1.00 34.78  ? 97   LEU B CG  1 
ATOM   4928 C  CD1 . LEU B 1 97  ? 12.174  1.936   -58.022 1.00 24.70  ? 97   LEU B CD1 1 
ATOM   4929 C  CD2 . LEU B 1 97  ? 10.672  1.307   -56.087 1.00 23.40  ? 97   LEU B CD2 1 
ATOM   4930 N  N   . TYR B 1 98  ? 6.044   1.797   -57.685 1.00 32.06  ? 98   TYR B N   1 
ATOM   4931 C  CA  . TYR B 1 98  ? 4.784   2.398   -58.074 1.00 34.78  ? 98   TYR B CA  1 
ATOM   4932 C  C   . TYR B 1 98  ? 4.286   3.219   -56.905 1.00 38.28  ? 98   TYR B C   1 
ATOM   4933 O  O   . TYR B 1 98  ? 4.664   2.968   -55.760 1.00 33.75  ? 98   TYR B O   1 
ATOM   4934 C  CB  . TYR B 1 98  ? 3.764   1.308   -58.428 1.00 36.50  ? 98   TYR B CB  1 
ATOM   4935 C  CG  . TYR B 1 98  ? 4.250   0.394   -59.528 1.00 45.33  ? 98   TYR B CG  1 
ATOM   4936 C  CD1 . TYR B 1 98  ? 3.919   0.642   -60.857 1.00 37.23  ? 98   TYR B CD1 1 
ATOM   4937 C  CD2 . TYR B 1 98  ? 5.063   -0.701  -59.243 1.00 34.55  ? 98   TYR B CD2 1 
ATOM   4938 C  CE1 . TYR B 1 98  ? 4.370   -0.182  -61.869 1.00 41.60  ? 98   TYR B CE1 1 
ATOM   4939 C  CE2 . TYR B 1 98  ? 5.525   -1.527  -60.248 1.00 39.72  ? 98   TYR B CE2 1 
ATOM   4940 C  CZ  . TYR B 1 98  ? 5.175   -1.261  -61.561 1.00 43.91  ? 98   TYR B CZ  1 
ATOM   4941 O  OH  . TYR B 1 98  ? 5.631   -2.068  -62.574 1.00 40.62  ? 98   TYR B OH  1 
ATOM   4942 N  N   . LEU B 1 99  ? 3.441   4.203   -57.188 1.00 33.74  ? 99   LEU B N   1 
ATOM   4943 C  CA  . LEU B 1 99  ? 2.815   4.974   -56.128 1.00 30.96  ? 99   LEU B CA  1 
ATOM   4944 C  C   . LEU B 1 99  ? 1.297   5.011   -56.285 1.00 38.09  ? 99   LEU B C   1 
ATOM   4945 O  O   . LEU B 1 99  ? 0.756   4.638   -57.326 1.00 41.37  ? 99   LEU B O   1 
ATOM   4946 C  CB  . LEU B 1 99  ? 3.402   6.386   -56.056 1.00 36.12  ? 99   LEU B CB  1 
ATOM   4947 C  CG  . LEU B 1 99  ? 3.406   7.248   -57.317 1.00 35.94  ? 99   LEU B CG  1 
ATOM   4948 C  CD1 . LEU B 1 99  ? 2.018   7.815   -57.578 1.00 32.24  ? 99   LEU B CD1 1 
ATOM   4949 C  CD2 . LEU B 1 99  ? 4.428   8.364   -57.169 1.00 26.16  ? 99   LEU B CD2 1 
ATOM   4950 N  N   . ASN B 1 100 ? 0.622   5.457   -55.233 1.00 39.85  ? 100  ASN B N   1 
ATOM   4951 C  CA  . ASN B 1 100 ? -0.831  5.492   -55.196 1.00 31.83  ? 100  ASN B CA  1 
ATOM   4952 C  C   . ASN B 1 100 ? -1.335  6.892   -54.892 1.00 36.78  ? 100  ASN B C   1 
ATOM   4953 O  O   . ASN B 1 100 ? -0.715  7.628   -54.129 1.00 40.33  ? 100  ASN B O   1 
ATOM   4954 C  CB  . ASN B 1 100 ? -1.336  4.520   -54.139 1.00 30.60  ? 100  ASN B CB  1 
ATOM   4955 C  CG  . ASN B 1 100 ? -0.706  3.149   -54.270 1.00 36.27  ? 100  ASN B CG  1 
ATOM   4956 O  OD1 . ASN B 1 100 ? -0.799  2.507   -55.317 1.00 33.86  ? 100  ASN B OD1 1 
ATOM   4957 N  ND2 . ASN B 1 100 ? -0.062  2.691   -53.204 1.00 27.87  ? 100  ASN B ND2 1 
ATOM   4958 N  N   . VAL B 1 101 ? -2.460  7.258   -55.496 1.00 39.31  ? 101  VAL B N   1 
ATOM   4959 C  CA  . VAL B 1 101 ? -3.047  8.577   -55.292 1.00 38.66  ? 101  VAL B CA  1 
ATOM   4960 C  C   . VAL B 1 101 ? -4.550  8.474   -55.039 1.00 43.88  ? 101  VAL B C   1 
ATOM   4961 O  O   . VAL B 1 101 ? -5.273  7.823   -55.796 1.00 42.07  ? 101  VAL B O   1 
ATOM   4962 C  CB  . VAL B 1 101 ? -2.805  9.500   -56.509 1.00 37.25  ? 101  VAL B CB  1 
ATOM   4963 C  CG1 . VAL B 1 101 ? -3.541  10.818  -56.340 1.00 33.54  ? 101  VAL B CG1 1 
ATOM   4964 C  CG2 . VAL B 1 101 ? -1.316  9.738   -56.711 1.00 37.38  ? 101  VAL B CG2 1 
ATOM   4965 N  N   . TRP B 1 102 ? -5.011  9.103   -53.962 1.00 34.49  ? 102  TRP B N   1 
ATOM   4966 C  CA  . TRP B 1 102 ? -6.439  9.248   -53.697 1.00 35.96  ? 102  TRP B CA  1 
ATOM   4967 C  C   . TRP B 1 102 ? -6.794  10.726  -53.745 1.00 39.33  ? 102  TRP B C   1 
ATOM   4968 O  O   . TRP B 1 102 ? -6.080  11.557  -53.190 1.00 41.84  ? 102  TRP B O   1 
ATOM   4969 C  CB  . TRP B 1 102 ? -6.802  8.723   -52.308 1.00 34.80  ? 102  TRP B CB  1 
ATOM   4970 C  CG  . TRP B 1 102 ? -6.826  7.231   -52.139 1.00 34.56  ? 102  TRP B CG  1 
ATOM   4971 C  CD1 . TRP B 1 102 ? -7.912  6.411   -52.256 1.00 39.63  ? 102  TRP B CD1 1 
ATOM   4972 C  CD2 . TRP B 1 102 ? -5.728  6.388   -51.769 1.00 34.23  ? 102  TRP B CD2 1 
ATOM   4973 N  NE1 . TRP B 1 102 ? -7.555  5.108   -51.999 1.00 39.64  ? 102  TRP B NE1 1 
ATOM   4974 C  CE2 . TRP B 1 102 ? -6.219  5.067   -51.700 1.00 42.67  ? 102  TRP B CE2 1 
ATOM   4975 C  CE3 . TRP B 1 102 ? -4.376  6.620   -51.498 1.00 36.35  ? 102  TRP B CE3 1 
ATOM   4976 C  CZ2 . TRP B 1 102 ? -5.404  3.984   -51.369 1.00 41.56  ? 102  TRP B CZ2 1 
ATOM   4977 C  CZ3 . TRP B 1 102 ? -3.569  5.542   -51.173 1.00 31.82  ? 102  TRP B CZ3 1 
ATOM   4978 C  CH2 . TRP B 1 102 ? -4.085  4.243   -51.109 1.00 36.00  ? 102  TRP B CH2 1 
ATOM   4979 N  N   . THR B 1 103 ? -7.892  11.057  -54.409 1.00 44.26  ? 103  THR B N   1 
ATOM   4980 C  CA  . THR B 1 103 ? -8.414  12.417  -54.373 1.00 47.59  ? 103  THR B CA  1 
ATOM   4981 C  C   . THR B 1 103 ? -9.902  12.355  -54.089 1.00 48.04  ? 103  THR B C   1 
ATOM   4982 O  O   . THR B 1 103 ? -10.503 11.284  -54.160 1.00 45.59  ? 103  THR B O   1 
ATOM   4983 C  CB  . THR B 1 103 ? -8.208  13.156  -55.700 1.00 40.51  ? 103  THR B CB  1 
ATOM   4984 O  OG1 . THR B 1 103 ? -9.070  12.595  -56.698 1.00 51.97  ? 103  THR B OG1 1 
ATOM   4985 C  CG2 . THR B 1 103 ? -6.768  13.051  -56.155 1.00 47.08  ? 103  THR B CG2 1 
ATOM   4986 N  N   . PRO B 1 104 ? -10.501 13.502  -53.748 1.00 51.09  ? 104  PRO B N   1 
ATOM   4987 C  CA  . PRO B 1 104 ? -11.960 13.557  -53.666 1.00 49.33  ? 104  PRO B CA  1 
ATOM   4988 C  C   . PRO B 1 104 ? -12.569 13.208  -55.018 1.00 51.03  ? 104  PRO B C   1 
ATOM   4989 O  O   . PRO B 1 104 ? -11.934 13.402  -56.056 1.00 53.40  ? 104  PRO B O   1 
ATOM   4990 C  CB  . PRO B 1 104 ? -12.232 15.026  -53.343 1.00 39.63  ? 104  PRO B CB  1 
ATOM   4991 C  CG  . PRO B 1 104 ? -10.996 15.499  -52.675 1.00 48.27  ? 104  PRO B CG  1 
ATOM   4992 C  CD  . PRO B 1 104 ? -9.875  14.774  -53.351 1.00 48.25  ? 104  PRO B CD  1 
ATOM   4993 N  N   . TYR B 1 105 ? -13.780 12.672  -55.001 1.00 50.57  ? 105  TYR B N   1 
ATOM   4994 C  CA  . TYR B 1 105 ? -14.530 12.477  -56.228 1.00 53.96  ? 105  TYR B CA  1 
ATOM   4995 C  C   . TYR B 1 105 ? -15.746 13.394  -56.201 1.00 52.79  ? 105  TYR B C   1 
ATOM   4996 O  O   . TYR B 1 105 ? -16.651 13.206  -55.390 1.00 56.73  ? 105  TYR B O   1 
ATOM   4997 C  CB  . TYR B 1 105 ? -14.962 11.018  -56.388 1.00 53.22  ? 105  TYR B CB  1 
ATOM   4998 C  CG  . TYR B 1 105 ? -15.628 10.768  -57.716 1.00 62.09  ? 105  TYR B CG  1 
ATOM   4999 C  CD1 . TYR B 1 105 ? -14.905 10.289  -58.800 1.00 69.98  ? 105  TYR B CD1 1 
ATOM   5000 C  CD2 . TYR B 1 105 ? -16.973 11.046  -57.897 1.00 58.78  ? 105  TYR B CD2 1 
ATOM   5001 C  CE1 . TYR B 1 105 ? -15.510 10.077  -60.022 1.00 70.92  ? 105  TYR B CE1 1 
ATOM   5002 C  CE2 . TYR B 1 105 ? -17.583 10.838  -59.110 1.00 63.40  ? 105  TYR B CE2 1 
ATOM   5003 C  CZ  . TYR B 1 105 ? -16.851 10.354  -60.169 1.00 69.30  ? 105  TYR B CZ  1 
ATOM   5004 O  OH  . TYR B 1 105 ? -17.472 10.153  -61.378 1.00 68.76  ? 105  TYR B OH  1 
ATOM   5005 N  N   . PRO B 1 106 ? -15.784 14.383  -57.104 1.00 56.65  ? 106  PRO B N   1 
ATOM   5006 C  CA  . PRO B 1 106 ? -14.862 14.578  -58.227 1.00 58.31  ? 106  PRO B CA  1 
ATOM   5007 C  C   . PRO B 1 106 ? -13.562 15.268  -57.835 1.00 55.49  ? 106  PRO B C   1 
ATOM   5008 O  O   . PRO B 1 106 ? -13.398 15.718  -56.701 1.00 53.12  ? 106  PRO B O   1 
ATOM   5009 C  CB  . PRO B 1 106 ? -15.649 15.506  -59.170 1.00 58.36  ? 106  PRO B CB  1 
ATOM   5010 C  CG  . PRO B 1 106 ? -16.980 15.781  -58.485 1.00 54.39  ? 106  PRO B CG  1 
ATOM   5011 C  CD  . PRO B 1 106 ? -16.791 15.451  -57.045 1.00 48.64  ? 106  PRO B CD  1 
ATOM   5012 N  N   . ARG B 1 107 ? -12.652 15.344  -58.799 1.00 59.39  ? 107  ARG B N   1 
ATOM   5013 C  CA  . ARG B 1 107 ? -11.373 16.017  -58.644 1.00 58.74  ? 107  ARG B CA  1 
ATOM   5014 C  C   . ARG B 1 107 ? -11.568 17.392  -58.026 1.00 60.97  ? 107  ARG B C   1 
ATOM   5015 O  O   . ARG B 1 107 ? -12.450 18.140  -58.441 1.00 65.31  ? 107  ARG B O   1 
ATOM   5016 C  CB  . ARG B 1 107 ? -10.714 16.158  -60.016 1.00 60.95  ? 107  ARG B CB  1 
ATOM   5017 C  CG  . ARG B 1 107 ? -9.220  16.418  -59.998 1.00 65.93  ? 107  ARG B CG  1 
ATOM   5018 C  CD  . ARG B 1 107 ? -8.622  16.059  -61.352 1.00 69.03  ? 107  ARG B CD  1 
ATOM   5019 N  NE  . ARG B 1 107 ? -9.156  14.788  -61.838 1.00 63.80  ? 107  ARG B NE  1 
ATOM   5020 C  CZ  . ARG B 1 107 ? -9.127  14.394  -63.106 1.00 63.51  ? 107  ARG B CZ  1 
ATOM   5021 N  NH1 . ARG B 1 107 ? -9.645  13.221  -63.449 1.00 58.10  ? 107  ARG B NH1 1 
ATOM   5022 N  NH2 . ARG B 1 107 ? -8.588  15.171  -64.035 1.00 60.04  ? 107  ARG B NH2 1 
ATOM   5023 N  N   . PRO B 1 108 ? -10.744 17.728  -57.021 1.00 57.04  ? 108  PRO B N   1 
ATOM   5024 C  CA  . PRO B 1 108 ? -10.800 19.031  -56.353 1.00 57.90  ? 108  PRO B CA  1 
ATOM   5025 C  C   . PRO B 1 108 ? -10.869 20.193  -57.340 1.00 60.95  ? 108  PRO B C   1 
ATOM   5026 O  O   . PRO B 1 108 ? -10.183 20.188  -58.362 1.00 52.19  ? 108  PRO B O   1 
ATOM   5027 C  CB  . PRO B 1 108 ? -9.482  19.075  -55.581 1.00 47.52  ? 108  PRO B CB  1 
ATOM   5028 C  CG  . PRO B 1 108 ? -9.206  17.646  -55.262 1.00 61.02  ? 108  PRO B CG  1 
ATOM   5029 C  CD  . PRO B 1 108 ? -9.724  16.845  -56.427 1.00 53.26  ? 108  PRO B CD  1 
ATOM   5030 N  N   . ALA B 1 109 ? -11.695 21.183  -57.022 1.00 72.40  ? 109  ALA B N   1 
ATOM   5031 C  CA  . ALA B 1 109 ? -11.867 22.347  -57.880 1.00 66.41  ? 109  ALA B CA  1 
ATOM   5032 C  C   . ALA B 1 109 ? -10.648 23.261  -57.829 1.00 61.87  ? 109  ALA B C   1 
ATOM   5033 O  O   . ALA B 1 109 ? -10.311 23.916  -58.814 1.00 66.80  ? 109  ALA B O   1 
ATOM   5034 C  CB  . ALA B 1 109 ? -13.117 23.111  -57.482 1.00 76.84  ? 109  ALA B CB  1 
ATOM   5035 N  N   . SER B 1 110 ? -9.996  23.308  -56.674 1.00 50.74  ? 110  SER B N   1 
ATOM   5036 C  CA  . SER B 1 110 ? -8.815  24.148  -56.503 1.00 60.48  ? 110  SER B CA  1 
ATOM   5037 C  C   . SER B 1 110 ? -7.615  23.328  -56.026 1.00 49.16  ? 110  SER B C   1 
ATOM   5038 O  O   . SER B 1 110 ? -7.779  22.213  -55.535 1.00 53.07  ? 110  SER B O   1 
ATOM   5039 C  CB  . SER B 1 110 ? -9.117  25.288  -55.527 1.00 53.10  ? 110  SER B CB  1 
ATOM   5040 O  OG  . SER B 1 110 ? -9.982  24.847  -54.492 1.00 57.76  ? 110  SER B OG  1 
ATOM   5041 N  N   . PRO B 1 111 ? -6.402  23.877  -56.178 1.00 48.41  ? 111  PRO B N   1 
ATOM   5042 C  CA  . PRO B 1 111 ? -5.192  23.182  -55.722 1.00 46.81  ? 111  PRO B CA  1 
ATOM   5043 C  C   . PRO B 1 111 ? -5.306  22.775  -54.257 1.00 46.00  ? 111  PRO B C   1 
ATOM   5044 O  O   . PRO B 1 111 ? -5.452  23.627  -53.381 1.00 46.78  ? 111  PRO B O   1 
ATOM   5045 C  CB  . PRO B 1 111 ? -4.095  24.235  -55.903 1.00 43.07  ? 111  PRO B CB  1 
ATOM   5046 C  CG  . PRO B 1 111 ? -4.600  25.108  -57.006 1.00 43.34  ? 111  PRO B CG  1 
ATOM   5047 C  CD  . PRO B 1 111 ? -6.092  25.178  -56.797 1.00 48.47  ? 111  PRO B CD  1 
ATOM   5048 N  N   . THR B 1 112 ? -5.234  21.474  -54.004 1.00 47.87  ? 112  THR B N   1 
ATOM   5049 C  CA  . THR B 1 112 ? -5.473  20.924  -52.678 1.00 43.58  ? 112  THR B CA  1 
ATOM   5050 C  C   . THR B 1 112 ? -4.186  20.421  -52.037 1.00 46.47  ? 112  THR B C   1 
ATOM   5051 O  O   . THR B 1 112 ? -3.387  19.764  -52.695 1.00 46.76  ? 112  THR B O   1 
ATOM   5052 C  CB  . THR B 1 112 ? -6.456  19.762  -52.775 1.00 40.86  ? 112  THR B CB  1 
ATOM   5053 O  OG1 . THR B 1 112 ? -7.627  20.202  -53.469 1.00 57.99  ? 112  THR B OG1 1 
ATOM   5054 C  CG2 . THR B 1 112 ? -6.835  19.255  -51.391 1.00 41.92  ? 112  THR B CG2 1 
ATOM   5055 N  N   . PRO B 1 113 ? -3.980  20.733  -50.747 1.00 51.69  ? 113  PRO B N   1 
ATOM   5056 C  CA  . PRO B 1 113 ? -2.806  20.249  -50.010 1.00 47.01  ? 113  PRO B CA  1 
ATOM   5057 C  C   . PRO B 1 113 ? -2.624  18.744  -50.150 1.00 34.86  ? 113  PRO B C   1 
ATOM   5058 O  O   . PRO B 1 113 ? -3.596  17.995  -50.072 1.00 37.49  ? 113  PRO B O   1 
ATOM   5059 C  CB  . PRO B 1 113 ? -3.133  20.611  -48.560 1.00 42.97  ? 113  PRO B CB  1 
ATOM   5060 C  CG  . PRO B 1 113 ? -3.987  21.822  -48.678 1.00 39.82  ? 113  PRO B CG  1 
ATOM   5061 C  CD  . PRO B 1 113 ? -4.801  21.647  -49.934 1.00 39.54  ? 113  PRO B CD  1 
ATOM   5062 N  N   . VAL B 1 114 ? -1.381  18.324  -50.359 1.00 30.21  ? 114  VAL B N   1 
ATOM   5063 C  CA  . VAL B 1 114 ? -1.041  16.924  -50.562 1.00 35.68  ? 114  VAL B CA  1 
ATOM   5064 C  C   . VAL B 1 114 ? -0.380  16.314  -49.331 1.00 37.59  ? 114  VAL B C   1 
ATOM   5065 O  O   . VAL B 1 114 ? 0.516   16.910  -48.737 1.00 38.89  ? 114  VAL B O   1 
ATOM   5066 C  CB  . VAL B 1 114 ? -0.044  16.774  -51.718 1.00 38.29  ? 114  VAL B CB  1 
ATOM   5067 C  CG1 . VAL B 1 114 ? 0.197   15.296  -52.023 1.00 26.59  ? 114  VAL B CG1 1 
ATOM   5068 C  CG2 . VAL B 1 114 ? -0.535  17.536  -52.944 1.00 31.75  ? 114  VAL B CG2 1 
ATOM   5069 N  N   . LEU B 1 115 ? -0.817  15.118  -48.956 1.00 36.87  ? 115  LEU B N   1 
ATOM   5070 C  CA  . LEU B 1 115 ? -0.130  14.363  -47.918 1.00 38.16  ? 115  LEU B CA  1 
ATOM   5071 C  C   . LEU B 1 115 ? 0.548   13.163  -48.546 1.00 38.09  ? 115  LEU B C   1 
ATOM   5072 O  O   . LEU B 1 115 ? -0.058  12.438  -49.337 1.00 35.86  ? 115  LEU B O   1 
ATOM   5073 C  CB  . LEU B 1 115 ? -1.096  13.899  -46.824 1.00 41.50  ? 115  LEU B CB  1 
ATOM   5074 C  CG  . LEU B 1 115 ? -1.581  14.957  -45.832 1.00 37.49  ? 115  LEU B CG  1 
ATOM   5075 C  CD1 . LEU B 1 115 ? -2.651  15.822  -46.472 1.00 52.89  ? 115  LEU B CD1 1 
ATOM   5076 C  CD2 . LEU B 1 115 ? -2.115  14.301  -44.586 1.00 30.58  ? 115  LEU B CD2 1 
ATOM   5077 N  N   . ILE B 1 116 ? 1.811   12.961  -48.195 1.00 27.88  ? 116  ILE B N   1 
ATOM   5078 C  CA  . ILE B 1 116 ? 2.559   11.832  -48.714 1.00 31.33  ? 116  ILE B CA  1 
ATOM   5079 C  C   . ILE B 1 116 ? 2.980   10.878  -47.601 1.00 34.46  ? 116  ILE B C   1 
ATOM   5080 O  O   . ILE B 1 116 ? 3.816   11.207  -46.759 1.00 33.49  ? 116  ILE B O   1 
ATOM   5081 C  CB  . ILE B 1 116 ? 3.789   12.293  -49.509 1.00 29.96  ? 116  ILE B CB  1 
ATOM   5082 C  CG1 . ILE B 1 116 ? 3.377   13.350  -50.534 1.00 28.47  ? 116  ILE B CG1 1 
ATOM   5083 C  CG2 . ILE B 1 116 ? 4.440   11.116  -50.198 1.00 32.67  ? 116  ILE B CG2 1 
ATOM   5084 C  CD1 . ILE B 1 116 ? 4.436   13.646  -51.561 1.00 24.20  ? 116  ILE B CD1 1 
ATOM   5085 N  N   . TRP B 1 117 ? 2.384   9.692   -47.606 1.00 28.09  ? 117  TRP B N   1 
ATOM   5086 C  CA  . TRP B 1 117 ? 2.699   8.665   -46.627 1.00 29.55  ? 117  TRP B CA  1 
ATOM   5087 C  C   . TRP B 1 117 ? 3.930   7.843   -47.004 1.00 33.74  ? 117  TRP B C   1 
ATOM   5088 O  O   . TRP B 1 117 ? 4.054   7.366   -48.133 1.00 28.53  ? 117  TRP B O   1 
ATOM   5089 C  CB  . TRP B 1 117 ? 1.510   7.730   -46.454 1.00 30.66  ? 117  TRP B CB  1 
ATOM   5090 C  CG  . TRP B 1 117 ? 1.790   6.603   -45.533 1.00 32.50  ? 117  TRP B CG  1 
ATOM   5091 C  CD1 . TRP B 1 117 ? 2.020   5.303   -45.872 1.00 34.62  ? 117  TRP B CD1 1 
ATOM   5092 C  CD2 . TRP B 1 117 ? 1.886   6.672   -44.109 1.00 33.41  ? 117  TRP B CD2 1 
ATOM   5093 N  NE1 . TRP B 1 117 ? 2.241   4.553   -44.743 1.00 32.41  ? 117  TRP B NE1 1 
ATOM   5094 C  CE2 . TRP B 1 117 ? 2.166   5.372   -43.647 1.00 32.71  ? 117  TRP B CE2 1 
ATOM   5095 C  CE3 . TRP B 1 117 ? 1.759   7.708   -43.179 1.00 29.80  ? 117  TRP B CE3 1 
ATOM   5096 C  CZ2 . TRP B 1 117 ? 2.321   5.078   -42.293 1.00 27.75  ? 117  TRP B CZ2 1 
ATOM   5097 C  CZ3 . TRP B 1 117 ? 1.908   7.416   -41.837 1.00 27.33  ? 117  TRP B CZ3 1 
ATOM   5098 C  CH2 . TRP B 1 117 ? 2.187   6.111   -41.406 1.00 30.82  ? 117  TRP B CH2 1 
ATOM   5099 N  N   . ILE B 1 118 ? 4.836   7.685   -46.044 1.00 30.97  ? 118  ILE B N   1 
ATOM   5100 C  CA  . ILE B 1 118 ? 5.977   6.791   -46.196 1.00 30.85  ? 118  ILE B CA  1 
ATOM   5101 C  C   . ILE B 1 118 ? 5.918   5.704   -45.121 1.00 33.44  ? 118  ILE B C   1 
ATOM   5102 O  O   . ILE B 1 118 ? 6.090   5.982   -43.936 1.00 35.14  ? 118  ILE B O   1 
ATOM   5103 C  CB  . ILE B 1 118 ? 7.303   7.557   -46.101 1.00 23.18  ? 118  ILE B CB  1 
ATOM   5104 C  CG1 . ILE B 1 118 ? 7.249   8.804   -46.982 1.00 28.26  ? 118  ILE B CG1 1 
ATOM   5105 C  CG2 . ILE B 1 118 ? 8.452   6.680   -46.532 1.00 26.02  ? 118  ILE B CG2 1 
ATOM   5106 C  CD1 . ILE B 1 118 ? 8.519   9.620   -46.968 1.00 22.54  ? 118  ILE B CD1 1 
ATOM   5107 N  N   . TYR B 1 119 ? 5.666   4.467   -45.537 1.00 27.91  ? 119  TYR B N   1 
ATOM   5108 C  CA  . TYR B 1 119 ? 5.452   3.375   -44.590 1.00 32.38  ? 119  TYR B CA  1 
ATOM   5109 C  C   . TYR B 1 119 ? 6.723   2.969   -43.852 1.00 33.90  ? 119  TYR B C   1 
ATOM   5110 O  O   . TYR B 1 119 ? 7.836   3.227   -44.312 1.00 28.64  ? 119  TYR B O   1 
ATOM   5111 C  CB  . TYR B 1 119 ? 4.836   2.151   -45.288 1.00 35.09  ? 119  TYR B CB  1 
ATOM   5112 C  CG  . TYR B 1 119 ? 5.658   1.596   -46.439 1.00 32.38  ? 119  TYR B CG  1 
ATOM   5113 C  CD1 . TYR B 1 119 ? 6.812   0.857   -46.207 1.00 35.04  ? 119  TYR B CD1 1 
ATOM   5114 C  CD2 . TYR B 1 119 ? 5.272   1.804   -47.755 1.00 32.43  ? 119  TYR B CD2 1 
ATOM   5115 C  CE1 . TYR B 1 119 ? 7.562   0.347   -47.255 1.00 31.65  ? 119  TYR B CE1 1 
ATOM   5116 C  CE2 . TYR B 1 119 ? 6.014   1.303   -48.809 1.00 31.01  ? 119  TYR B CE2 1 
ATOM   5117 C  CZ  . TYR B 1 119 ? 7.156   0.573   -48.555 1.00 33.41  ? 119  TYR B CZ  1 
ATOM   5118 O  OH  . TYR B 1 119 ? 7.897   0.074   -49.602 1.00 35.14  ? 119  TYR B OH  1 
ATOM   5119 N  N   . GLY B 1 120 ? 6.540   2.320   -42.709 1.00 32.87  ? 120  GLY B N   1 
ATOM   5120 C  CA  . GLY B 1 120 ? 7.651   1.777   -41.948 1.00 35.18  ? 120  GLY B CA  1 
ATOM   5121 C  C   . GLY B 1 120 ? 7.788   0.285   -42.184 1.00 37.68  ? 120  GLY B C   1 
ATOM   5122 O  O   . GLY B 1 120 ? 7.198   -0.261  -43.122 1.00 38.97  ? 120  GLY B O   1 
ATOM   5123 N  N   . GLY B 1 121 ? 8.563   -0.376  -41.330 1.00 35.67  ? 121  GLY B N   1 
ATOM   5124 C  CA  . GLY B 1 121 ? 8.847   -1.792  -41.495 1.00 34.07  ? 121  GLY B CA  1 
ATOM   5125 C  C   . GLY B 1 121 ? 10.330  -2.097  -41.352 1.00 41.97  ? 121  GLY B C   1 
ATOM   5126 O  O   . GLY B 1 121 ? 10.854  -3.007  -42.000 1.00 37.06  ? 121  GLY B O   1 
ATOM   5127 N  N   . GLY B 1 122 ? 11.005  -1.315  -40.511 1.00 37.58  ? 122  GLY B N   1 
ATOM   5128 C  CA  . GLY B 1 122 ? 12.410  -1.520  -40.202 1.00 28.86  ? 122  GLY B CA  1 
ATOM   5129 C  C   . GLY B 1 122 ? 13.351  -1.400  -41.386 1.00 33.70  ? 122  GLY B C   1 
ATOM   5130 O  O   . GLY B 1 122 ? 14.493  -1.856  -41.323 1.00 37.33  ? 122  GLY B O   1 
ATOM   5131 N  N   . PHE B 1 123 ? 12.875  -0.784  -42.463 1.00 29.16  ? 123  PHE B N   1 
ATOM   5132 C  CA  . PHE B 1 123 ? 13.651  -0.675  -43.698 1.00 34.92  ? 123  PHE B CA  1 
ATOM   5133 C  C   . PHE B 1 123 ? 13.835  -2.035  -44.375 1.00 33.71  ? 123  PHE B C   1 
ATOM   5134 O  O   . PHE B 1 123 ? 14.571  -2.149  -45.350 1.00 39.82  ? 123  PHE B O   1 
ATOM   5135 C  CB  . PHE B 1 123 ? 15.019  -0.017  -43.446 1.00 28.60  ? 123  PHE B CB  1 
ATOM   5136 C  CG  . PHE B 1 123 ? 14.943  1.455   -43.117 1.00 37.94  ? 123  PHE B CG  1 
ATOM   5137 C  CD1 . PHE B 1 123 ? 14.567  2.379   -44.082 1.00 34.20  ? 123  PHE B CD1 1 
ATOM   5138 C  CD2 . PHE B 1 123 ? 15.259  1.916   -41.846 1.00 31.09  ? 123  PHE B CD2 1 
ATOM   5139 C  CE1 . PHE B 1 123 ? 14.497  3.733   -43.787 1.00 27.05  ? 123  PHE B CE1 1 
ATOM   5140 C  CE2 . PHE B 1 123 ? 15.196  3.267   -41.544 1.00 28.36  ? 123  PHE B CE2 1 
ATOM   5141 C  CZ  . PHE B 1 123 ? 14.814  4.178   -42.516 1.00 30.74  ? 123  PHE B CZ  1 
ATOM   5142 N  N   . TYR B 1 124 ? 13.167  -3.063  -43.859 1.00 31.72  ? 124  TYR B N   1 
ATOM   5143 C  CA  . TYR B 1 124 ? 13.294  -4.409  -44.418 1.00 37.41  ? 124  TYR B CA  1 
ATOM   5144 C  C   . TYR B 1 124 ? 11.952  -4.936  -44.918 1.00 36.69  ? 124  TYR B C   1 
ATOM   5145 O  O   . TYR B 1 124 ? 11.890  -5.969  -45.581 1.00 36.54  ? 124  TYR B O   1 
ATOM   5146 C  CB  . TYR B 1 124 ? 13.878  -5.381  -43.387 1.00 36.25  ? 124  TYR B CB  1 
ATOM   5147 C  CG  . TYR B 1 124 ? 12.905  -5.735  -42.286 1.00 42.90  ? 124  TYR B CG  1 
ATOM   5148 C  CD1 . TYR B 1 124 ? 11.902  -6.678  -42.493 1.00 31.94  ? 124  TYR B CD1 1 
ATOM   5149 C  CD2 . TYR B 1 124 ? 12.980  -5.117  -41.043 1.00 33.23  ? 124  TYR B CD2 1 
ATOM   5150 C  CE1 . TYR B 1 124 ? 11.005  -6.995  -41.493 1.00 27.87  ? 124  TYR B CE1 1 
ATOM   5151 C  CE2 . TYR B 1 124 ? 12.087  -5.427  -40.037 1.00 32.45  ? 124  TYR B CE2 1 
ATOM   5152 C  CZ  . TYR B 1 124 ? 11.103  -6.367  -40.267 1.00 37.07  ? 124  TYR B CZ  1 
ATOM   5153 O  OH  . TYR B 1 124 ? 10.214  -6.674  -39.265 1.00 40.35  ? 124  TYR B OH  1 
ATOM   5154 N  N   . SER B 1 125 ? 10.877  -4.227  -44.594 1.00 37.65  ? 125  SER B N   1 
ATOM   5155 C  CA  . SER B 1 125 ? 9.552   -4.641  -45.029 1.00 26.98  ? 125  SER B CA  1 
ATOM   5156 C  C   . SER B 1 125 ? 8.622   -3.452  -45.190 1.00 36.56  ? 125  SER B C   1 
ATOM   5157 O  O   . SER B 1 125 ? 9.017   -2.311  -44.964 1.00 34.29  ? 125  SER B O   1 
ATOM   5158 C  CB  . SER B 1 125 ? 8.953   -5.644  -44.041 1.00 35.84  ? 125  SER B CB  1 
ATOM   5159 O  OG  . SER B 1 125 ? 8.841   -5.087  -42.742 1.00 30.57  ? 125  SER B OG  1 
ATOM   5160 N  N   . GLY B 1 126 ? 7.382   -3.734  -45.582 1.00 40.39  ? 126  GLY B N   1 
ATOM   5161 C  CA  . GLY B 1 126 ? 6.363   -2.714  -45.717 1.00 23.39  ? 126  GLY B CA  1 
ATOM   5162 C  C   . GLY B 1 126 ? 5.828   -2.593  -47.127 1.00 32.56  ? 126  GLY B C   1 
ATOM   5163 O  O   . GLY B 1 126 ? 6.458   -3.048  -48.078 1.00 34.87  ? 126  GLY B O   1 
ATOM   5164 N  N   . ALA B 1 127 ? 4.660   -1.973  -47.257 1.00 32.78  ? 127  ALA B N   1 
ATOM   5165 C  CA  . ALA B 1 127 ? 4.035   -1.754  -48.556 1.00 35.26  ? 127  ALA B CA  1 
ATOM   5166 C  C   . ALA B 1 127 ? 2.983   -0.668  -48.428 1.00 34.80  ? 127  ALA B C   1 
ATOM   5167 O  O   . ALA B 1 127 ? 2.324   -0.555  -47.397 1.00 33.75  ? 127  ALA B O   1 
ATOM   5168 C  CB  . ALA B 1 127 ? 3.403   -3.038  -49.074 1.00 28.09  ? 127  ALA B CB  1 
ATOM   5169 N  N   . ALA B 1 128 ? 2.823   0.125   -49.481 1.00 30.39  ? 128  ALA B N   1 
ATOM   5170 C  CA  . ALA B 1 128 ? 1.876   1.229   -49.460 1.00 32.08  ? 128  ALA B CA  1 
ATOM   5171 C  C   . ALA B 1 128 ? 0.458   0.728   -49.662 1.00 35.59  ? 128  ALA B C   1 
ATOM   5172 O  O   . ALA B 1 128 ? -0.493  1.504   -49.607 1.00 35.78  ? 128  ALA B O   1 
ATOM   5173 C  CB  . ALA B 1 128 ? 2.231   2.253   -50.524 1.00 27.70  ? 128  ALA B CB  1 
ATOM   5174 N  N   . SER B 1 129 ? 0.323   -0.575  -49.885 1.00 38.22  ? 129  SER B N   1 
ATOM   5175 C  CA  . SER B 1 129 ? -0.969  -1.165  -50.220 1.00 36.49  ? 129  SER B CA  1 
ATOM   5176 C  C   . SER B 1 129 ? -1.688  -1.772  -49.018 1.00 33.10  ? 129  SER B C   1 
ATOM   5177 O  O   . SER B 1 129 ? -2.784  -2.306  -49.159 1.00 32.32  ? 129  SER B O   1 
ATOM   5178 C  CB  . SER B 1 129 ? -0.798  -2.225  -51.308 1.00 33.61  ? 129  SER B CB  1 
ATOM   5179 O  OG  . SER B 1 129 ? 0.075   -3.248  -50.868 1.00 31.15  ? 129  SER B OG  1 
ATOM   5180 N  N   . LEU B 1 130 ? -1.076  -1.695  -47.841 1.00 30.09  ? 130  LEU B N   1 
ATOM   5181 C  CA  . LEU B 1 130 ? -1.700  -2.235  -46.639 1.00 35.42  ? 130  LEU B CA  1 
ATOM   5182 C  C   . LEU B 1 130 ? -3.015  -1.523  -46.333 1.00 43.48  ? 130  LEU B C   1 
ATOM   5183 O  O   . LEU B 1 130 ? -3.192  -0.351  -46.668 1.00 45.19  ? 130  LEU B O   1 
ATOM   5184 C  CB  . LEU B 1 130 ? -0.757  -2.123  -45.442 1.00 38.37  ? 130  LEU B CB  1 
ATOM   5185 C  CG  . LEU B 1 130 ? 0.612   -2.789  -45.565 1.00 43.28  ? 130  LEU B CG  1 
ATOM   5186 C  CD1 . LEU B 1 130 ? 1.290   -2.776  -44.209 1.00 33.55  ? 130  LEU B CD1 1 
ATOM   5187 C  CD2 . LEU B 1 130 ? 0.504   -4.216  -46.111 1.00 32.58  ? 130  LEU B CD2 1 
ATOM   5188 N  N   . ASP B 1 131 ? -3.930  -2.233  -45.683 1.00 31.54  ? 131  ASP B N   1 
ATOM   5189 C  CA  . ASP B 1 131 ? -5.234  -1.671  -45.336 1.00 41.82  ? 131  ASP B CA  1 
ATOM   5190 C  C   . ASP B 1 131 ? -5.136  -0.478  -44.390 1.00 41.35  ? 131  ASP B C   1 
ATOM   5191 O  O   . ASP B 1 131 ? -5.890  0.484   -44.517 1.00 42.20  ? 131  ASP B O   1 
ATOM   5192 C  CB  . ASP B 1 131 ? -6.137  -2.739  -44.716 1.00 35.77  ? 131  ASP B CB  1 
ATOM   5193 C  CG  . ASP B 1 131 ? -6.483  -3.848  -45.688 1.00 46.07  ? 131  ASP B CG  1 
ATOM   5194 O  OD1 . ASP B 1 131 ? -6.442  -3.604  -46.911 1.00 52.81  ? 131  ASP B OD1 1 
ATOM   5195 O  OD2 . ASP B 1 131 ? -6.802  -4.963  -45.228 1.00 54.79  ? 131  ASP B OD2 1 
ATOM   5196 N  N   . VAL B 1 132 ? -4.212  -0.538  -43.439 1.00 38.06  ? 132  VAL B N   1 
ATOM   5197 C  CA  . VAL B 1 132 ? -4.079  0.544   -42.472 1.00 35.50  ? 132  VAL B CA  1 
ATOM   5198 C  C   . VAL B 1 132 ? -3.597  1.844   -43.110 1.00 38.50  ? 132  VAL B C   1 
ATOM   5199 O  O   . VAL B 1 132 ? -3.648  2.899   -42.477 1.00 40.36  ? 132  VAL B O   1 
ATOM   5200 C  CB  . VAL B 1 132 ? -3.163  0.160   -41.289 1.00 36.23  ? 132  VAL B CB  1 
ATOM   5201 C  CG1 . VAL B 1 132 ? -3.921  -0.693  -40.292 1.00 30.62  ? 132  VAL B CG1 1 
ATOM   5202 C  CG2 . VAL B 1 132 ? -1.913  -0.557  -41.784 1.00 34.63  ? 132  VAL B CG2 1 
ATOM   5203 N  N   . TYR B 1 133 ? -3.129  1.766   -44.355 1.00 35.70  ? 133  TYR B N   1 
ATOM   5204 C  CA  . TYR B 1 133 ? -2.713  2.964   -45.083 1.00 39.66  ? 133  TYR B CA  1 
ATOM   5205 C  C   . TYR B 1 133 ? -3.727  3.355   -46.150 1.00 38.03  ? 133  TYR B C   1 
ATOM   5206 O  O   . TYR B 1 133 ? -3.408  4.102   -47.070 1.00 38.27  ? 133  TYR B O   1 
ATOM   5207 C  CB  . TYR B 1 133 ? -1.343  2.781   -45.741 1.00 37.69  ? 133  TYR B CB  1 
ATOM   5208 C  CG  . TYR B 1 133 ? -0.285  2.185   -44.849 1.00 33.18  ? 133  TYR B CG  1 
ATOM   5209 C  CD1 . TYR B 1 133 ? -0.251  2.470   -43.493 1.00 31.39  ? 133  TYR B CD1 1 
ATOM   5210 C  CD2 . TYR B 1 133 ? 0.695   1.350   -45.372 1.00 29.15  ? 133  TYR B CD2 1 
ATOM   5211 C  CE1 . TYR B 1 133 ? 0.724   1.927   -42.677 1.00 33.87  ? 133  TYR B CE1 1 
ATOM   5212 C  CE2 . TYR B 1 133 ? 1.669   0.798   -44.568 1.00 26.20  ? 133  TYR B CE2 1 
ATOM   5213 C  CZ  . TYR B 1 133 ? 1.684   1.091   -43.223 1.00 35.87  ? 133  TYR B CZ  1 
ATOM   5214 O  OH  . TYR B 1 133 ? 2.655   0.539   -42.421 1.00 27.27  ? 133  TYR B OH  1 
ATOM   5215 N  N   . ASP B 1 134 ? -4.945  2.843   -46.028 1.00 37.04  ? 134  ASP B N   1 
ATOM   5216 C  CA  . ASP B 1 134 ? -6.007  3.151   -46.978 1.00 34.03  ? 134  ASP B CA  1 
ATOM   5217 C  C   . ASP B 1 134 ? -6.325  4.647   -46.951 1.00 38.30  ? 134  ASP B C   1 
ATOM   5218 O  O   . ASP B 1 134 ? -6.797  5.178   -45.943 1.00 33.65  ? 134  ASP B O   1 
ATOM   5219 C  CB  . ASP B 1 134 ? -7.249  2.323   -46.636 1.00 43.66  ? 134  ASP B CB  1 
ATOM   5220 C  CG  . ASP B 1 134 ? -8.340  2.427   -47.680 1.00 42.41  ? 134  ASP B CG  1 
ATOM   5221 O  OD1 . ASP B 1 134 ? -8.358  3.404   -48.458 1.00 40.88  ? 134  ASP B OD1 1 
ATOM   5222 O  OD2 . ASP B 1 134 ? -9.195  1.522   -47.709 1.00 52.11  ? 134  ASP B OD2 1 
ATOM   5223 N  N   . GLY B 1 135 ? -6.070  5.321   -48.068 1.00 38.36  ? 135  GLY B N   1 
ATOM   5224 C  CA  . GLY B 1 135 ? -6.221  6.763   -48.146 1.00 38.16  ? 135  GLY B CA  1 
ATOM   5225 C  C   . GLY B 1 135 ? -7.600  7.302   -48.505 1.00 42.29  ? 135  GLY B C   1 
ATOM   5226 O  O   . GLY B 1 135 ? -7.767  8.515   -48.668 1.00 33.77  ? 135  GLY B O   1 
ATOM   5227 N  N   . ARG B 1 136 ? -8.595  6.427   -48.617 1.00 36.54  ? 136  ARG B N   1 
ATOM   5228 C  CA  . ARG B 1 136 ? -9.914  6.867   -49.078 1.00 45.01  ? 136  ARG B CA  1 
ATOM   5229 C  C   . ARG B 1 136 ? -10.608 7.771   -48.060 1.00 44.17  ? 136  ARG B C   1 
ATOM   5230 O  O   . ARG B 1 136 ? -11.311 8.711   -48.433 1.00 40.05  ? 136  ARG B O   1 
ATOM   5231 C  CB  . ARG B 1 136 ? -10.807 5.671   -49.449 1.00 38.05  ? 136  ARG B CB  1 
ATOM   5232 C  CG  . ARG B 1 136 ? -11.389 4.919   -48.259 1.00 47.87  ? 136  ARG B CG  1 
ATOM   5233 C  CD  . ARG B 1 136 ? -11.416 3.415   -48.506 1.00 46.65  ? 136  ARG B CD  1 
ATOM   5234 N  NE  . ARG B 1 136 ? -12.373 3.030   -49.537 1.00 57.49  ? 136  ARG B NE  1 
ATOM   5235 C  CZ  . ARG B 1 136 ? -12.275 1.928   -50.275 1.00 57.81  ? 136  ARG B CZ  1 
ATOM   5236 N  NH1 . ARG B 1 136 ? -11.250 1.102   -50.111 1.00 45.93  ? 136  ARG B NH1 1 
ATOM   5237 N  NH2 . ARG B 1 136 ? -13.197 1.657   -51.188 1.00 68.00  ? 136  ARG B NH2 1 
ATOM   5238 N  N   . PHE B 1 137 ? -10.398 7.493   -46.778 1.00 37.30  ? 137  PHE B N   1 
ATOM   5239 C  CA  . PHE B 1 137 ? -11.081 8.229   -45.718 1.00 36.41  ? 137  PHE B CA  1 
ATOM   5240 C  C   . PHE B 1 137 ? -10.631 9.682   -45.654 1.00 38.39  ? 137  PHE B C   1 
ATOM   5241 O  O   . PHE B 1 137 ? -11.455 10.595  -45.591 1.00 45.58  ? 137  PHE B O   1 
ATOM   5242 C  CB  . PHE B 1 137 ? -10.885 7.535   -44.369 1.00 37.97  ? 137  PHE B CB  1 
ATOM   5243 C  CG  . PHE B 1 137 ? -11.230 6.082   -44.394 1.00 39.48  ? 137  PHE B CG  1 
ATOM   5244 C  CD1 . PHE B 1 137 ? -12.554 5.673   -44.446 1.00 42.71  ? 137  PHE B CD1 1 
ATOM   5245 C  CD2 . PHE B 1 137 ? -10.235 5.120   -44.388 1.00 47.23  ? 137  PHE B CD2 1 
ATOM   5246 C  CE1 . PHE B 1 137 ? -12.878 4.325   -44.477 1.00 43.10  ? 137  PHE B CE1 1 
ATOM   5247 C  CE2 . PHE B 1 137 ? -10.549 3.771   -44.423 1.00 48.99  ? 137  PHE B CE2 1 
ATOM   5248 C  CZ  . PHE B 1 137 ? -11.873 3.373   -44.468 1.00 44.42  ? 137  PHE B CZ  1 
ATOM   5249 N  N   . LEU B 1 138 ? -9.321  9.892   -45.685 1.00 35.28  ? 138  LEU B N   1 
ATOM   5250 C  CA  . LEU B 1 138 ? -8.761  11.237  -45.656 1.00 36.06  ? 138  LEU B CA  1 
ATOM   5251 C  C   . LEU B 1 138 ? -9.150  12.034  -46.897 1.00 41.09  ? 138  LEU B C   1 
ATOM   5252 O  O   . LEU B 1 138 ? -9.400  13.236  -46.820 1.00 42.00  ? 138  LEU B O   1 
ATOM   5253 C  CB  . LEU B 1 138 ? -7.240  11.175  -45.508 1.00 41.13  ? 138  LEU B CB  1 
ATOM   5254 C  CG  . LEU B 1 138 ? -6.777  10.819  -44.095 1.00 45.41  ? 138  LEU B CG  1 
ATOM   5255 C  CD1 . LEU B 1 138 ? -5.347  10.316  -44.078 1.00 33.12  ? 138  LEU B CD1 1 
ATOM   5256 C  CD2 . LEU B 1 138 ? -6.938  12.030  -43.198 1.00 41.49  ? 138  LEU B CD2 1 
ATOM   5257 N  N   . ALA B 1 139 ? -9.198  11.360  -48.042 1.00 42.19  ? 139  ALA B N   1 
ATOM   5258 C  CA  . ALA B 1 139 ? -9.617  12.004  -49.280 1.00 43.14  ? 139  ALA B CA  1 
ATOM   5259 C  C   . ALA B 1 139 ? -11.093 12.387  -49.204 1.00 39.64  ? 139  ALA B C   1 
ATOM   5260 O  O   . ALA B 1 139 ? -11.469 13.508  -49.536 1.00 35.31  ? 139  ALA B O   1 
ATOM   5261 C  CB  . ALA B 1 139 ? -9.356  11.091  -50.483 1.00 35.64  ? 139  ALA B CB  1 
ATOM   5262 N  N   . GLN B 1 140 ? -11.922 11.455  -48.749 1.00 36.23  ? 140  GLN B N   1 
ATOM   5263 C  CA  . GLN B 1 140 ? -13.362 11.674  -48.709 1.00 41.83  ? 140  GLN B CA  1 
ATOM   5264 C  C   . GLN B 1 140 ? -13.736 12.720  -47.670 1.00 46.01  ? 140  GLN B C   1 
ATOM   5265 O  O   . GLN B 1 140 ? -14.325 13.746  -47.994 1.00 50.30  ? 140  GLN B O   1 
ATOM   5266 C  CB  . GLN B 1 140 ? -14.092 10.364  -48.409 1.00 44.33  ? 140  GLN B CB  1 
ATOM   5267 C  CG  . GLN B 1 140 ? -15.497 10.291  -48.985 1.00 49.79  ? 140  GLN B CG  1 
ATOM   5268 C  CD  . GLN B 1 140 ? -16.488 11.191  -48.269 1.00 53.69  ? 140  GLN B CD  1 
ATOM   5269 O  OE1 . GLN B 1 140 ? -16.676 11.089  -47.056 1.00 56.33  ? 140  GLN B OE1 1 
ATOM   5270 N  NE2 . GLN B 1 140 ? -17.138 12.070  -49.023 1.00 47.32  ? 140  GLN B NE2 1 
ATOM   5271 N  N   . VAL B 1 141 ? -13.378 12.454  -46.420 1.00 50.15  ? 141  VAL B N   1 
ATOM   5272 C  CA  . VAL B 1 141 ? -13.804 13.290  -45.305 1.00 41.20  ? 141  VAL B CA  1 
ATOM   5273 C  C   . VAL B 1 141 ? -13.092 14.642  -45.214 1.00 43.64  ? 141  VAL B C   1 
ATOM   5274 O  O   . VAL B 1 141 ? -13.700 15.635  -44.825 1.00 47.16  ? 141  VAL B O   1 
ATOM   5275 C  CB  . VAL B 1 141 ? -13.645 12.548  -43.971 1.00 49.77  ? 141  VAL B CB  1 
ATOM   5276 C  CG1 . VAL B 1 141 ? -14.164 13.405  -42.826 1.00 38.22  ? 141  VAL B CG1 1 
ATOM   5277 C  CG2 . VAL B 1 141 ? -14.366 11.210  -44.025 1.00 40.52  ? 141  VAL B CG2 1 
ATOM   5278 N  N   . GLU B 1 142 ? -11.812 14.686  -45.569 1.00 43.71  ? 142  GLU B N   1 
ATOM   5279 C  CA  . GLU B 1 142 ? -11.035 15.918  -45.417 1.00 35.11  ? 142  GLU B CA  1 
ATOM   5280 C  C   . GLU B 1 142 ? -10.716 16.611  -46.735 1.00 35.45  ? 142  GLU B C   1 
ATOM   5281 O  O   . GLU B 1 142 ? -10.173 17.717  -46.747 1.00 42.98  ? 142  GLU B O   1 
ATOM   5282 C  CB  . GLU B 1 142 ? -9.746  15.649  -44.636 1.00 36.76  ? 142  GLU B CB  1 
ATOM   5283 C  CG  . GLU B 1 142 ? -9.979  15.386  -43.165 1.00 35.50  ? 142  GLU B CG  1 
ATOM   5284 C  CD  . GLU B 1 142 ? -10.614 16.572  -42.466 1.00 55.10  ? 142  GLU B CD  1 
ATOM   5285 O  OE1 . GLU B 1 142 ? -10.409 17.715  -42.933 1.00 53.60  ? 142  GLU B OE1 1 
ATOM   5286 O  OE2 . GLU B 1 142 ? -11.319 16.358  -41.454 1.00 54.05  ? 142  GLU B OE2 1 
ATOM   5287 N  N   . GLY B 1 143 ? -11.050 15.958  -47.841 1.00 39.29  ? 143  GLY B N   1 
ATOM   5288 C  CA  . GLY B 1 143 ? -10.823 16.528  -49.156 1.00 39.17  ? 143  GLY B CA  1 
ATOM   5289 C  C   . GLY B 1 143 ? -9.352  16.551  -49.512 1.00 48.69  ? 143  GLY B C   1 
ATOM   5290 O  O   . GLY B 1 143 ? -8.917  17.332  -50.362 1.00 48.58  ? 143  GLY B O   1 
ATOM   5291 N  N   . ALA B 1 144 ? -8.583  15.687  -48.859 1.00 41.01  ? 144  ALA B N   1 
ATOM   5292 C  CA  . ALA B 1 144 ? -7.145  15.628  -49.083 1.00 47.66  ? 144  ALA B CA  1 
ATOM   5293 C  C   . ALA B 1 144 ? -6.777  14.877  -50.359 1.00 38.26  ? 144  ALA B C   1 
ATOM   5294 O  O   . ALA B 1 144 ? -7.440  13.915  -50.742 1.00 36.77  ? 144  ALA B O   1 
ATOM   5295 C  CB  . ALA B 1 144 ? -6.455  14.991  -47.885 1.00 32.70  ? 144  ALA B CB  1 
ATOM   5296 N  N   . VAL B 1 145 ? -5.727  15.339  -51.024 1.00 36.88  ? 145  VAL B N   1 
ATOM   5297 C  CA  . VAL B 1 145 ? -5.055  14.517  -52.019 1.00 38.31  ? 145  VAL B CA  1 
ATOM   5298 C  C   . VAL B 1 145 ? -3.983  13.737  -51.268 1.00 37.55  ? 145  VAL B C   1 
ATOM   5299 O  O   . VAL B 1 145 ? -3.128  14.324  -50.609 1.00 32.91  ? 145  VAL B O   1 
ATOM   5300 C  CB  . VAL B 1 145 ? -4.384  15.358  -53.105 1.00 40.73  ? 145  VAL B CB  1 
ATOM   5301 C  CG1 . VAL B 1 145 ? -3.590  14.464  -54.042 1.00 35.28  ? 145  VAL B CG1 1 
ATOM   5302 C  CG2 . VAL B 1 145 ? -5.421  16.162  -53.868 1.00 44.08  ? 145  VAL B CG2 1 
ATOM   5303 N  N   . LEU B 1 146 ? -4.043  12.414  -51.339 1.00 39.21  ? 146  LEU B N   1 
ATOM   5304 C  CA  . LEU B 1 146 ? -3.122  11.592  -50.573 1.00 37.02  ? 146  LEU B CA  1 
ATOM   5305 C  C   . LEU B 1 146 ? -2.295  10.684  -51.469 1.00 39.51  ? 146  LEU B C   1 
ATOM   5306 O  O   . LEU B 1 146 ? -2.834  9.917   -52.268 1.00 44.29  ? 146  LEU B O   1 
ATOM   5307 C  CB  . LEU B 1 146 ? -3.879  10.770  -49.524 1.00 39.84  ? 146  LEU B CB  1 
ATOM   5308 C  CG  . LEU B 1 146 ? -3.027  10.262  -48.353 1.00 47.39  ? 146  LEU B CG  1 
ATOM   5309 C  CD1 . LEU B 1 146 ? -3.863  10.097  -47.101 1.00 50.50  ? 146  LEU B CD1 1 
ATOM   5310 C  CD2 . LEU B 1 146 ? -2.311  8.958   -48.703 1.00 48.22  ? 146  LEU B CD2 1 
ATOM   5311 N  N   . VAL B 1 147 ? -0.980  10.769  -51.318 1.00 33.35  ? 147  VAL B N   1 
ATOM   5312 C  CA  . VAL B 1 147 ? -0.061  9.959   -52.105 1.00 33.70  ? 147  VAL B CA  1 
ATOM   5313 C  C   . VAL B 1 147 ? 0.703   8.975   -51.221 1.00 33.39  ? 147  VAL B C   1 
ATOM   5314 O  O   . VAL B 1 147 ? 1.059   9.295   -50.092 1.00 37.65  ? 147  VAL B O   1 
ATOM   5315 C  CB  . VAL B 1 147 ? 0.952   10.854  -52.840 1.00 35.76  ? 147  VAL B CB  1 
ATOM   5316 C  CG1 . VAL B 1 147 ? 1.771   10.037  -53.829 1.00 29.00  ? 147  VAL B CG1 1 
ATOM   5317 C  CG2 . VAL B 1 147 ? 0.229   11.985  -53.546 1.00 31.16  ? 147  VAL B CG2 1 
ATOM   5318 N  N   . SER B 1 148 ? 0.948   7.775   -51.733 1.00 33.61  ? 148  SER B N   1 
ATOM   5319 C  CA  . SER B 1 148 ? 1.838   6.838   -51.057 1.00 31.22  ? 148  SER B CA  1 
ATOM   5320 C  C   . SER B 1 148 ? 2.627   6.046   -52.091 1.00 34.39  ? 148  SER B C   1 
ATOM   5321 O  O   . SER B 1 148 ? 2.084   5.650   -53.118 1.00 37.61  ? 148  SER B O   1 
ATOM   5322 C  CB  . SER B 1 148 ? 1.062   5.896   -50.140 1.00 29.01  ? 148  SER B CB  1 
ATOM   5323 O  OG  . SER B 1 148 ? 0.229   5.034   -50.887 1.00 36.63  ? 148  SER B OG  1 
ATOM   5324 N  N   . MET B 1 149 ? 3.910   5.823   -51.823 1.00 31.26  ? 149  MET B N   1 
ATOM   5325 C  CA  . MET B 1 149 ? 4.765   5.095   -52.759 1.00 28.68  ? 149  MET B CA  1 
ATOM   5326 C  C   . MET B 1 149 ? 5.339   3.821   -52.143 1.00 32.27  ? 149  MET B C   1 
ATOM   5327 O  O   . MET B 1 149 ? 5.481   3.703   -50.924 1.00 31.06  ? 149  MET B O   1 
ATOM   5328 C  CB  . MET B 1 149 ? 5.921   5.982   -53.229 1.00 27.62  ? 149  MET B CB  1 
ATOM   5329 C  CG  . MET B 1 149 ? 7.123   6.009   -52.262 1.00 36.75  ? 149  MET B CG  1 
ATOM   5330 S  SD  . MET B 1 149 ? 6.818   6.827   -50.670 1.00 33.54  ? 149  MET B SD  1 
ATOM   5331 C  CE  . MET B 1 149 ? 7.093   8.544   -51.109 1.00 27.54  ? 149  MET B CE  1 
ATOM   5332 N  N   . ASN B 1 150 ? 5.658   2.859   -52.995 1.00 29.62  ? 150  ASN B N   1 
ATOM   5333 C  CA  . ASN B 1 150 ? 6.481   1.750   -52.574 1.00 25.04  ? 150  ASN B CA  1 
ATOM   5334 C  C   . ASN B 1 150 ? 7.916   2.201   -52.744 1.00 33.82  ? 150  ASN B C   1 
ATOM   5335 O  O   . ASN B 1 150 ? 8.216   2.972   -53.649 1.00 26.33  ? 150  ASN B O   1 
ATOM   5336 C  CB  . ASN B 1 150 ? 6.207   0.506   -53.416 1.00 28.74  ? 150  ASN B CB  1 
ATOM   5337 C  CG  . ASN B 1 150 ? 4.978   -0.242  -52.963 1.00 37.66  ? 150  ASN B CG  1 
ATOM   5338 O  OD1 . ASN B 1 150 ? 4.333   0.138   -51.986 1.00 35.81  ? 150  ASN B OD1 1 
ATOM   5339 N  ND2 . ASN B 1 150 ? 4.641   -1.315  -53.671 1.00 35.23  ? 150  ASN B ND2 1 
ATOM   5340 N  N   . TYR B 1 151 ? 8.792   1.752   -51.854 1.00 25.50  ? 151  TYR B N   1 
ATOM   5341 C  CA  . TYR B 1 151 ? 10.214  2.011   -51.997 1.00 30.04  ? 151  TYR B CA  1 
ATOM   5342 C  C   . TYR B 1 151 ? 10.958  0.744   -51.587 1.00 27.12  ? 151  TYR B C   1 
ATOM   5343 O  O   . TYR B 1 151 ? 10.482  -0.006  -50.743 1.00 27.42  ? 151  TYR B O   1 
ATOM   5344 C  CB  . TYR B 1 151 ? 10.641  3.216   -51.150 1.00 28.69  ? 151  TYR B CB  1 
ATOM   5345 C  CG  . TYR B 1 151 ? 10.509  2.987   -49.661 1.00 31.01  ? 151  TYR B CG  1 
ATOM   5346 C  CD1 . TYR B 1 151 ? 9.343   3.330   -48.977 1.00 24.29  ? 151  TYR B CD1 1 
ATOM   5347 C  CD2 . TYR B 1 151 ? 11.546  2.414   -48.942 1.00 21.75  ? 151  TYR B CD2 1 
ATOM   5348 C  CE1 . TYR B 1 151 ? 9.228   3.113   -47.614 1.00 25.63  ? 151  TYR B CE1 1 
ATOM   5349 C  CE2 . TYR B 1 151 ? 11.439  2.197   -47.588 1.00 29.49  ? 151  TYR B CE2 1 
ATOM   5350 C  CZ  . TYR B 1 151 ? 10.286  2.544   -46.926 1.00 27.44  ? 151  TYR B CZ  1 
ATOM   5351 O  OH  . TYR B 1 151 ? 10.212  2.310   -45.571 1.00 29.25  ? 151  TYR B OH  1 
ATOM   5352 N  N   . ARG B 1 152 ? 12.109  0.497   -52.201 1.00 26.00  ? 152  ARG B N   1 
ATOM   5353 C  CA  . ARG B 1 152 ? 12.852  -0.739  -51.965 1.00 34.69  ? 152  ARG B CA  1 
ATOM   5354 C  C   . ARG B 1 152 ? 13.273  -0.900  -50.509 1.00 29.66  ? 152  ARG B C   1 
ATOM   5355 O  O   . ARG B 1 152 ? 13.761  0.037   -49.886 1.00 27.99  ? 152  ARG B O   1 
ATOM   5356 C  CB  . ARG B 1 152 ? 14.079  -0.808  -52.876 1.00 28.89  ? 152  ARG B CB  1 
ATOM   5357 C  CG  . ARG B 1 152 ? 13.773  -1.323  -54.267 1.00 30.24  ? 152  ARG B CG  1 
ATOM   5358 C  CD  . ARG B 1 152 ? 14.968  -1.153  -55.183 1.00 24.94  ? 152  ARG B CD  1 
ATOM   5359 N  NE  . ARG B 1 152 ? 15.170  0.251   -55.503 1.00 28.65  ? 152  ARG B NE  1 
ATOM   5360 C  CZ  . ARG B 1 152 ? 16.191  0.715   -56.206 1.00 32.81  ? 152  ARG B CZ  1 
ATOM   5361 N  NH1 . ARG B 1 152 ? 17.111  -0.126  -56.662 1.00 31.38  ? 152  ARG B NH1 1 
ATOM   5362 N  NH2 . ARG B 1 152 ? 16.289  2.017   -56.448 1.00 25.07  ? 152  ARG B NH2 1 
ATOM   5363 N  N   . VAL B 1 153 ? 13.076  -2.094  -49.971 1.00 27.51  ? 153  VAL B N   1 
ATOM   5364 C  CA  . VAL B 1 153 ? 13.491  -2.382  -48.608 1.00 28.32  ? 153  VAL B CA  1 
ATOM   5365 C  C   . VAL B 1 153 ? 14.554  -3.473  -48.587 1.00 34.10  ? 153  VAL B C   1 
ATOM   5366 O  O   . VAL B 1 153 ? 14.929  -4.001  -49.633 1.00 34.90  ? 153  VAL B O   1 
ATOM   5367 C  CB  . VAL B 1 153 ? 12.301  -2.802  -47.730 1.00 34.97  ? 153  VAL B CB  1 
ATOM   5368 C  CG1 . VAL B 1 153 ? 11.364  -1.630  -47.538 1.00 31.25  ? 153  VAL B CG1 1 
ATOM   5369 C  CG2 . VAL B 1 153 ? 11.570  -3.992  -48.348 1.00 25.59  ? 153  VAL B CG2 1 
ATOM   5370 N  N   . GLY B 1 154 ? 15.039  -3.802  -47.392 1.00 31.15  ? 154  GLY B N   1 
ATOM   5371 C  CA  . GLY B 1 154 ? 16.091  -4.787  -47.236 1.00 23.99  ? 154  GLY B CA  1 
ATOM   5372 C  C   . GLY B 1 154 ? 17.331  -4.507  -48.069 1.00 31.37  ? 154  GLY B C   1 
ATOM   5373 O  O   . GLY B 1 154 ? 17.713  -3.357  -48.278 1.00 36.86  ? 154  GLY B O   1 
ATOM   5374 N  N   . THR B 1 155 ? 17.965  -5.570  -48.547 1.00 34.02  ? 155  THR B N   1 
ATOM   5375 C  CA  . THR B 1 155 ? 19.198  -5.443  -49.310 1.00 35.48  ? 155  THR B CA  1 
ATOM   5376 C  C   . THR B 1 155 ? 18.955  -4.672  -50.600 1.00 35.18  ? 155  THR B C   1 
ATOM   5377 O  O   . THR B 1 155 ? 19.806  -3.900  -51.050 1.00 34.44  ? 155  THR B O   1 
ATOM   5378 C  CB  . THR B 1 155 ? 19.776  -6.821  -49.660 1.00 36.84  ? 155  THR B CB  1 
ATOM   5379 O  OG1 . THR B 1 155 ? 18.795  -7.572  -50.381 1.00 35.09  ? 155  THR B OG1 1 
ATOM   5380 C  CG2 . THR B 1 155 ? 20.160  -7.587  -48.391 1.00 30.15  ? 155  THR B CG2 1 
ATOM   5381 N  N   . PHE B 1 156 ? 17.783  -4.875  -51.188 1.00 27.41  ? 156  PHE B N   1 
ATOM   5382 C  CA  . PHE B 1 156 ? 17.462  -4.252  -52.463 1.00 33.92  ? 156  PHE B CA  1 
ATOM   5383 C  C   . PHE B 1 156 ? 17.449  -2.739  -52.358 1.00 30.48  ? 156  PHE B C   1 
ATOM   5384 O  O   . PHE B 1 156 ? 17.773  -2.047  -53.316 1.00 25.77  ? 156  PHE B O   1 
ATOM   5385 C  CB  . PHE B 1 156 ? 16.122  -4.768  -52.981 1.00 36.18  ? 156  PHE B CB  1 
ATOM   5386 C  CG  . PHE B 1 156 ? 16.020  -6.259  -52.964 1.00 42.60  ? 156  PHE B CG  1 
ATOM   5387 C  CD1 . PHE B 1 156 ? 16.594  -7.015  -53.977 1.00 32.17  ? 156  PHE B CD1 1 
ATOM   5388 C  CD2 . PHE B 1 156 ? 15.377  -6.908  -51.921 1.00 35.13  ? 156  PHE B CD2 1 
ATOM   5389 C  CE1 . PHE B 1 156 ? 16.516  -8.390  -53.957 1.00 32.82  ? 156  PHE B CE1 1 
ATOM   5390 C  CE2 . PHE B 1 156 ? 15.289  -8.286  -51.895 1.00 35.06  ? 156  PHE B CE2 1 
ATOM   5391 C  CZ  . PHE B 1 156 ? 15.864  -9.030  -52.914 1.00 36.96  ? 156  PHE B CZ  1 
ATOM   5392 N  N   . GLY B 1 157 ? 17.083  -2.228  -51.186 1.00 33.58  ? 157  GLY B N   1 
ATOM   5393 C  CA  . GLY B 1 157 ? 16.997  -0.795  -50.989 1.00 25.94  ? 157  GLY B CA  1 
ATOM   5394 C  C   . GLY B 1 157 ? 18.161  -0.152  -50.254 1.00 31.36  ? 157  GLY B C   1 
ATOM   5395 O  O   . GLY B 1 157 ? 18.398  1.047   -50.413 1.00 29.31  ? 157  GLY B O   1 
ATOM   5396 N  N   . PHE B 1 158 ? 18.895  -0.936  -49.465 1.00 27.91  ? 158  PHE B N   1 
ATOM   5397 C  CA  . PHE B 1 158 ? 19.869  -0.359  -48.539 1.00 30.86  ? 158  PHE B CA  1 
ATOM   5398 C  C   . PHE B 1 158 ? 21.206  -1.083  -48.401 1.00 37.08  ? 158  PHE B C   1 
ATOM   5399 O  O   . PHE B 1 158 ? 22.077  -0.638  -47.656 1.00 37.63  ? 158  PHE B O   1 
ATOM   5400 C  CB  . PHE B 1 158 ? 19.224  -0.142  -47.168 1.00 25.75  ? 158  PHE B CB  1 
ATOM   5401 C  CG  . PHE B 1 158 ? 18.092  0.830   -47.206 1.00 33.85  ? 158  PHE B CG  1 
ATOM   5402 C  CD1 . PHE B 1 158 ? 18.341  2.191   -47.229 1.00 27.17  ? 158  PHE B CD1 1 
ATOM   5403 C  CD2 . PHE B 1 158 ? 16.780  0.387   -47.271 1.00 32.40  ? 158  PHE B CD2 1 
ATOM   5404 C  CE1 . PHE B 1 158 ? 17.302  3.097   -47.287 1.00 34.96  ? 158  PHE B CE1 1 
ATOM   5405 C  CE2 . PHE B 1 158 ? 15.735  1.288   -47.333 1.00 29.94  ? 158  PHE B CE2 1 
ATOM   5406 C  CZ  . PHE B 1 158 ? 15.995  2.643   -47.343 1.00 35.67  ? 158  PHE B CZ  1 
ATOM   5407 N  N   . LEU B 1 159 ? 21.385  -2.185  -49.116 1.00 40.36  ? 159  LEU B N   1 
ATOM   5408 C  CA  . LEU B 1 159 ? 22.699  -2.807  -49.154 1.00 33.36  ? 159  LEU B CA  1 
ATOM   5409 C  C   . LEU B 1 159 ? 23.679  -1.836  -49.804 1.00 41.37  ? 159  LEU B C   1 
ATOM   5410 O  O   . LEU B 1 159 ? 23.410  -1.296  -50.879 1.00 42.96  ? 159  LEU B O   1 
ATOM   5411 C  CB  . LEU B 1 159 ? 22.654  -4.132  -49.908 1.00 35.24  ? 159  LEU B CB  1 
ATOM   5412 C  CG  . LEU B 1 159 ? 23.988  -4.837  -50.142 1.00 40.60  ? 159  LEU B CG  1 
ATOM   5413 C  CD1 . LEU B 1 159 ? 23.828  -6.341  -49.948 1.00 29.30  ? 159  LEU B CD1 1 
ATOM   5414 C  CD2 . LEU B 1 159 ? 24.522  -4.509  -51.523 1.00 33.59  ? 159  LEU B CD2 1 
ATOM   5415 N  N   . ALA B 1 160 ? 24.809  -1.603  -49.145 1.00 41.85  ? 160  ALA B N   1 
ATOM   5416 C  CA  . ALA B 1 160 ? 25.751  -0.598  -49.618 1.00 44.38  ? 160  ALA B CA  1 
ATOM   5417 C  C   . ALA B 1 160 ? 27.206  -1.037  -49.527 1.00 47.66  ? 160  ALA B C   1 
ATOM   5418 O  O   . ALA B 1 160 ? 27.642  -1.609  -48.527 1.00 49.81  ? 160  ALA B O   1 
ATOM   5419 C  CB  . ALA B 1 160 ? 25.551  0.712   -48.865 1.00 42.99  ? 160  ALA B CB  1 
ATOM   5420 N  N   . LEU B 1 161 ? 27.944  -0.773  -50.598 1.00 46.16  ? 161  LEU B N   1 
ATOM   5421 C  CA  . LEU B 1 161 ? 29.393  -0.826  -50.564 1.00 41.06  ? 161  LEU B CA  1 
ATOM   5422 C  C   . LEU B 1 161 ? 29.846  0.605   -50.769 1.00 48.15  ? 161  LEU B C   1 
ATOM   5423 O  O   . LEU B 1 161 ? 30.116  1.028   -51.893 1.00 40.77  ? 161  LEU B O   1 
ATOM   5424 C  CB  . LEU B 1 161 ? 29.940  -1.752  -51.648 1.00 40.99  ? 161  LEU B CB  1 
ATOM   5425 C  CG  . LEU B 1 161 ? 29.607  -3.225  -51.393 1.00 43.83  ? 161  LEU B CG  1 
ATOM   5426 C  CD1 . LEU B 1 161 ? 30.174  -4.107  -52.475 1.00 57.46  ? 161  LEU B CD1 1 
ATOM   5427 C  CD2 . LEU B 1 161 ? 30.134  -3.656  -50.041 1.00 45.87  ? 161  LEU B CD2 1 
ATOM   5428 N  N   . PRO B 1 162 ? 29.898  1.367   -49.668 1.00 42.68  ? 162  PRO B N   1 
ATOM   5429 C  CA  . PRO B 1 162 ? 30.141  2.808   -49.716 1.00 42.71  ? 162  PRO B CA  1 
ATOM   5430 C  C   . PRO B 1 162 ? 31.312  3.146   -50.618 1.00 42.24  ? 162  PRO B C   1 
ATOM   5431 O  O   . PRO B 1 162 ? 32.394  2.580   -50.467 1.00 46.81  ? 162  PRO B O   1 
ATOM   5432 C  CB  . PRO B 1 162 ? 30.449  3.154   -48.260 1.00 35.29  ? 162  PRO B CB  1 
ATOM   5433 C  CG  . PRO B 1 162 ? 29.675  2.143   -47.481 1.00 39.59  ? 162  PRO B CG  1 
ATOM   5434 C  CD  . PRO B 1 162 ? 29.749  0.875   -48.287 1.00 41.78  ? 162  PRO B CD  1 
ATOM   5435 N  N   . GLY B 1 163 ? 31.077  4.049   -51.564 1.00 49.67  ? 163  GLY B N   1 
ATOM   5436 C  CA  . GLY B 1 163 ? 32.109  4.487   -52.481 1.00 42.92  ? 163  GLY B CA  1 
ATOM   5437 C  C   . GLY B 1 163 ? 32.056  3.765   -53.810 1.00 47.80  ? 163  GLY B C   1 
ATOM   5438 O  O   . GLY B 1 163 ? 32.657  4.211   -54.788 1.00 46.83  ? 163  GLY B O   1 
ATOM   5439 N  N   . SER B 1 164 ? 31.341  2.645   -53.851 1.00 44.24  ? 164  SER B N   1 
ATOM   5440 C  CA  . SER B 1 164 ? 31.187  1.892   -55.092 1.00 39.72  ? 164  SER B CA  1 
ATOM   5441 C  C   . SER B 1 164 ? 30.225  2.590   -56.047 1.00 44.66  ? 164  SER B C   1 
ATOM   5442 O  O   . SER B 1 164 ? 29.438  3.448   -55.644 1.00 43.11  ? 164  SER B O   1 
ATOM   5443 C  CB  . SER B 1 164 ? 30.684  0.483   -54.804 1.00 46.20  ? 164  SER B CB  1 
ATOM   5444 O  OG  . SER B 1 164 ? 29.314  0.506   -54.449 1.00 50.18  ? 164  SER B OG  1 
ATOM   5445 N  N   . ARG B 1 165 ? 30.281  2.219   -57.319 1.00 57.22  ? 165  ARG B N   1 
ATOM   5446 C  CA  . ARG B 1 165 ? 29.375  2.802   -58.297 1.00 54.42  ? 165  ARG B CA  1 
ATOM   5447 C  C   . ARG B 1 165 ? 28.104  1.969   -58.389 1.00 56.80  ? 165  ARG B C   1 
ATOM   5448 O  O   . ARG B 1 165 ? 27.052  2.473   -58.780 1.00 47.55  ? 165  ARG B O   1 
ATOM   5449 C  CB  . ARG B 1 165 ? 30.034  2.889   -59.676 1.00 52.25  ? 165  ARG B CB  1 
ATOM   5450 C  CG  . ARG B 1 165 ? 29.442  3.974   -60.569 1.00 81.82  ? 165  ARG B CG  1 
ATOM   5451 C  CD  . ARG B 1 165 ? 29.576  3.643   -62.052 1.00 94.71  ? 165  ARG B CD  1 
ATOM   5452 N  NE  . ARG B 1 165 ? 28.381  2.989   -62.586 1.00 90.35  ? 165  ARG B NE  1 
ATOM   5453 C  CZ  . ARG B 1 165 ? 28.271  1.681   -62.803 1.00 91.43  ? 165  ARG B CZ  1 
ATOM   5454 N  NH1 . ARG B 1 165 ? 29.288  0.873   -62.534 1.00 89.20  ? 165  ARG B NH1 1 
ATOM   5455 N  NH2 . ARG B 1 165 ? 27.143  1.180   -63.292 1.00 65.49  ? 165  ARG B NH2 1 
ATOM   5456 N  N   . GLU B 1 166 ? 28.207  0.696   -58.014 1.00 39.33  ? 166  GLU B N   1 
ATOM   5457 C  CA  . GLU B 1 166 ? 27.122  -0.254  -58.241 1.00 52.96  ? 166  GLU B CA  1 
ATOM   5458 C  C   . GLU B 1 166 ? 26.279  -0.561  -57.003 1.00 50.87  ? 166  GLU B C   1 
ATOM   5459 O  O   . GLU B 1 166 ? 25.287  -1.288  -57.090 1.00 48.79  ? 166  GLU B O   1 
ATOM   5460 C  CB  . GLU B 1 166 ? 27.657  -1.548  -58.865 1.00 53.96  ? 166  GLU B CB  1 
ATOM   5461 C  CG  . GLU B 1 166 ? 29.004  -1.988  -58.321 1.00 72.13  ? 166  GLU B CG  1 
ATOM   5462 C  CD  . GLU B 1 166 ? 30.170  -1.326  -59.026 1.00 76.99  ? 166  GLU B CD  1 
ATOM   5463 O  OE1 . GLU B 1 166 ? 30.191  -1.356  -60.276 1.00 71.38  ? 166  GLU B OE1 1 
ATOM   5464 O  OE2 . GLU B 1 166 ? 31.064  -0.788  -58.332 1.00 69.04  ? 166  GLU B OE2 1 
ATOM   5465 N  N   . ALA B 1 167 ? 26.665  0.000   -55.861 1.00 42.76  ? 167  ALA B N   1 
ATOM   5466 C  CA  . ALA B 1 167 ? 25.898  -0.165  -54.628 1.00 46.53  ? 167  ALA B CA  1 
ATOM   5467 C  C   . ALA B 1 167 ? 26.176  0.982   -53.668 1.00 41.65  ? 167  ALA B C   1 
ATOM   5468 O  O   . ALA B 1 167 ? 26.740  0.777   -52.593 1.00 45.40  ? 167  ALA B O   1 
ATOM   5469 C  CB  . ALA B 1 167 ? 26.214  -1.500  -53.967 1.00 33.20  ? 167  ALA B CB  1 
ATOM   5470 N  N   . PRO B 1 168 ? 25.760  2.196   -54.051 1.00 46.03  ? 168  PRO B N   1 
ATOM   5471 C  CA  . PRO B 1 168 ? 26.101  3.411   -53.305 1.00 35.54  ? 168  PRO B CA  1 
ATOM   5472 C  C   . PRO B 1 168 ? 25.391  3.472   -51.960 1.00 34.90  ? 168  PRO B C   1 
ATOM   5473 O  O   . PRO B 1 168 ? 25.814  4.221   -51.082 1.00 43.22  ? 168  PRO B O   1 
ATOM   5474 C  CB  . PRO B 1 168 ? 25.593  4.540   -54.212 1.00 30.91  ? 168  PRO B CB  1 
ATOM   5475 C  CG  . PRO B 1 168 ? 25.230  3.885   -55.527 1.00 34.55  ? 168  PRO B CG  1 
ATOM   5476 C  CD  . PRO B 1 168 ? 24.879  2.479   -55.195 1.00 33.08  ? 168  PRO B CD  1 
ATOM   5477 N  N   . GLY B 1 169 ? 24.324  2.695   -51.807 1.00 34.82  ? 169  GLY B N   1 
ATOM   5478 C  CA  . GLY B 1 169 ? 23.506  2.747   -50.609 1.00 33.72  ? 169  GLY B CA  1 
ATOM   5479 C  C   . GLY B 1 169 ? 22.425  3.813   -50.680 1.00 36.82  ? 169  GLY B C   1 
ATOM   5480 O  O   . GLY B 1 169 ? 22.464  4.696   -51.543 1.00 28.41  ? 169  GLY B O   1 
ATOM   5481 N  N   . ASN B 1 170 ? 21.452  3.723   -49.775 1.00 28.18  ? 170  ASN B N   1 
ATOM   5482 C  CA  . ASN B 1 170 ? 20.379  4.712   -49.692 1.00 32.44  ? 170  ASN B CA  1 
ATOM   5483 C  C   . ASN B 1 170 ? 19.441  4.752   -50.911 1.00 35.75  ? 170  ASN B C   1 
ATOM   5484 O  O   . ASN B 1 170 ? 18.731  5.739   -51.110 1.00 37.84  ? 170  ASN B O   1 
ATOM   5485 C  CB  . ASN B 1 170 ? 20.963  6.117   -49.459 1.00 25.03  ? 170  ASN B CB  1 
ATOM   5486 C  CG  . ASN B 1 170 ? 21.692  6.246   -48.124 1.00 33.59  ? 170  ASN B CG  1 
ATOM   5487 O  OD1 . ASN B 1 170 ? 21.434  5.501   -47.177 1.00 27.36  ? 170  ASN B OD1 1 
ATOM   5488 N  ND2 . ASN B 1 170 ? 22.602  7.209   -48.045 1.00 38.14  ? 170  ASN B ND2 1 
ATOM   5489 N  N   . VAL B 1 171 ? 19.432  3.706   -51.731 1.00 29.16  ? 171  VAL B N   1 
ATOM   5490 C  CA  . VAL B 1 171 ? 18.647  3.773   -52.963 1.00 37.35  ? 171  VAL B CA  1 
ATOM   5491 C  C   . VAL B 1 171 ? 17.151  3.749   -52.658 1.00 35.86  ? 171  VAL B C   1 
ATOM   5492 O  O   . VAL B 1 171 ? 16.352  4.310   -53.401 1.00 30.47  ? 171  VAL B O   1 
ATOM   5493 C  CB  . VAL B 1 171 ? 19.031  2.685   -54.005 1.00 31.02  ? 171  VAL B CB  1 
ATOM   5494 C  CG1 . VAL B 1 171 ? 20.505  2.784   -54.356 1.00 28.85  ? 171  VAL B CG1 1 
ATOM   5495 C  CG2 . VAL B 1 171 ? 18.662  1.289   -53.513 1.00 26.67  ? 171  VAL B CG2 1 
ATOM   5496 N  N   . GLY B 1 172 ? 16.781  3.116   -51.552 1.00 28.29  ? 172  GLY B N   1 
ATOM   5497 C  CA  . GLY B 1 172 ? 15.411  3.177   -51.081 1.00 29.36  ? 172  GLY B CA  1 
ATOM   5498 C  C   . GLY B 1 172 ? 14.968  4.602   -50.782 1.00 33.52  ? 172  GLY B C   1 
ATOM   5499 O  O   . GLY B 1 172 ? 13.842  4.981   -51.090 1.00 27.48  ? 172  GLY B O   1 
ATOM   5500 N  N   . LEU B 1 173 ? 15.847  5.399   -50.180 1.00 32.69  ? 173  LEU B N   1 
ATOM   5501 C  CA  . LEU B 1 173 ? 15.524  6.804   -49.929 1.00 29.96  ? 173  LEU B CA  1 
ATOM   5502 C  C   . LEU B 1 173 ? 15.435  7.564   -51.244 1.00 35.76  ? 173  LEU B C   1 
ATOM   5503 O  O   . LEU B 1 173 ? 14.620  8.476   -51.389 1.00 38.08  ? 173  LEU B O   1 
ATOM   5504 C  CB  . LEU B 1 173 ? 16.555  7.465   -49.013 1.00 29.29  ? 173  LEU B CB  1 
ATOM   5505 C  CG  . LEU B 1 173 ? 16.631  6.945   -47.577 1.00 33.38  ? 173  LEU B CG  1 
ATOM   5506 C  CD1 . LEU B 1 173 ? 17.855  7.493   -46.853 1.00 32.96  ? 173  LEU B CD1 1 
ATOM   5507 C  CD2 . LEU B 1 173 ? 15.376  7.299   -46.838 1.00 26.45  ? 173  LEU B CD2 1 
ATOM   5508 N  N   . LEU B 1 174 ? 16.275  7.190   -52.204 1.00 31.66  ? 174  LEU B N   1 
ATOM   5509 C  CA  . LEU B 1 174 ? 16.213  7.811   -53.519 1.00 35.02  ? 174  LEU B CA  1 
ATOM   5510 C  C   . LEU B 1 174 ? 14.903  7.453   -54.224 1.00 34.30  ? 174  LEU B C   1 
ATOM   5511 O  O   . LEU B 1 174 ? 14.391  8.234   -55.019 1.00 31.00  ? 174  LEU B O   1 
ATOM   5512 C  CB  . LEU B 1 174 ? 17.427  7.426   -54.363 1.00 27.64  ? 174  LEU B CB  1 
ATOM   5513 C  CG  . LEU B 1 174 ? 18.752  7.984   -53.835 1.00 42.92  ? 174  LEU B CG  1 
ATOM   5514 C  CD1 . LEU B 1 174 ? 19.943  7.480   -54.646 1.00 30.20  ? 174  LEU B CD1 1 
ATOM   5515 C  CD2 . LEU B 1 174 ? 18.721  9.505   -53.809 1.00 26.79  ? 174  LEU B CD2 1 
ATOM   5516 N  N   . ASP B 1 175 ? 14.362  6.277   -53.918 1.00 28.03  ? 175  ASP B N   1 
ATOM   5517 C  CA  . ASP B 1 175 ? 13.060  5.879   -54.433 1.00 27.76  ? 175  ASP B CA  1 
ATOM   5518 C  C   . ASP B 1 175 ? 12.003  6.872   -53.968 1.00 32.69  ? 175  ASP B C   1 
ATOM   5519 O  O   . ASP B 1 175 ? 11.243  7.407   -54.772 1.00 32.16  ? 175  ASP B O   1 
ATOM   5520 C  CB  . ASP B 1 175 ? 12.690  4.474   -53.947 1.00 32.78  ? 175  ASP B CB  1 
ATOM   5521 C  CG  . ASP B 1 175 ? 13.521  3.379   -54.608 1.00 34.41  ? 175  ASP B CG  1 
ATOM   5522 O  OD1 . ASP B 1 175 ? 14.251  3.679   -55.576 1.00 30.74  ? 175  ASP B OD1 1 
ATOM   5523 O  OD2 . ASP B 1 175 ? 13.436  2.215   -54.154 1.00 32.01  ? 175  ASP B OD2 1 
ATOM   5524 N  N   . GLN B 1 176 ? 11.969  7.110   -52.661 1.00 28.14  ? 176  GLN B N   1 
ATOM   5525 C  CA  . GLN B 1 176 ? 11.053  8.071   -52.062 1.00 28.30  ? 176  GLN B CA  1 
ATOM   5526 C  C   . GLN B 1 176 ? 11.222  9.470   -52.648 1.00 35.16  ? 176  GLN B C   1 
ATOM   5527 O  O   . GLN B 1 176 ? 10.240  10.157  -52.944 1.00 35.06  ? 176  GLN B O   1 
ATOM   5528 C  CB  . GLN B 1 176 ? 11.271  8.132   -50.551 1.00 32.96  ? 176  GLN B CB  1 
ATOM   5529 C  CG  . GLN B 1 176 ? 11.126  6.798   -49.837 1.00 34.29  ? 176  GLN B CG  1 
ATOM   5530 C  CD  . GLN B 1 176 ? 11.650  6.856   -48.413 1.00 36.47  ? 176  GLN B CD  1 
ATOM   5531 O  OE1 . GLN B 1 176 ? 11.998  7.926   -47.914 1.00 31.22  ? 176  GLN B OE1 1 
ATOM   5532 N  NE2 . GLN B 1 176 ? 11.707  5.706   -47.753 1.00 30.09  ? 176  GLN B NE2 1 
ATOM   5533 N  N   . ARG B 1 177 ? 12.468  9.898   -52.803 1.00 32.95  ? 177  ARG B N   1 
ATOM   5534 C  CA  . ARG B 1 177 ? 12.740  11.225  -53.333 1.00 36.63  ? 177  ARG B CA  1 
ATOM   5535 C  C   . ARG B 1 177 ? 12.242  11.353  -54.768 1.00 35.18  ? 177  ARG B C   1 
ATOM   5536 O  O   . ARG B 1 177 ? 11.716  12.399  -55.166 1.00 33.68  ? 177  ARG B O   1 
ATOM   5537 C  CB  . ARG B 1 177 ? 14.231  11.548  -53.267 1.00 27.61  ? 177  ARG B CB  1 
ATOM   5538 C  CG  . ARG B 1 177 ? 14.610  12.767  -54.081 1.00 36.50  ? 177  ARG B CG  1 
ATOM   5539 C  CD  . ARG B 1 177 ? 16.068  13.103  -53.919 1.00 26.63  ? 177  ARG B CD  1 
ATOM   5540 N  NE  . ARG B 1 177 ? 16.361  13.487  -52.547 1.00 49.29  ? 177  ARG B NE  1 
ATOM   5541 C  CZ  . ARG B 1 177 ? 17.579  13.506  -52.021 1.00 48.99  ? 177  ARG B CZ  1 
ATOM   5542 N  NH1 . ARG B 1 177 ? 18.631  13.154  -52.755 1.00 41.38  ? 177  ARG B NH1 1 
ATOM   5543 N  NH2 . ARG B 1 177 ? 17.744  13.877  -50.762 1.00 31.60  ? 177  ARG B NH2 1 
ATOM   5544 N  N   . LEU B 1 178 ? 12.411  10.288  -55.545 1.00 29.72  ? 178  LEU B N   1 
ATOM   5545 C  CA  . LEU B 1 178 ? 11.991  10.307  -56.936 1.00 34.94  ? 178  LEU B CA  1 
ATOM   5546 C  C   . LEU B 1 178 ? 10.474  10.422  -57.000 1.00 33.36  ? 178  LEU B C   1 
ATOM   5547 O  O   . LEU B 1 178 ? 9.928   11.135  -57.839 1.00 33.29  ? 178  LEU B O   1 
ATOM   5548 C  CB  . LEU B 1 178 ? 12.491  9.069   -57.682 1.00 24.53  ? 178  LEU B CB  1 
ATOM   5549 C  CG  . LEU B 1 178 ? 12.007  8.946   -59.131 1.00 37.99  ? 178  LEU B CG  1 
ATOM   5550 C  CD1 . LEU B 1 178 ? 12.384  10.176  -59.939 1.00 29.38  ? 178  LEU B CD1 1 
ATOM   5551 C  CD2 . LEU B 1 178 ? 12.541  7.686   -59.796 1.00 31.67  ? 178  LEU B CD2 1 
ATOM   5552 N  N   . ALA B 1 179 ? 9.803   9.726   -56.091 1.00 32.94  ? 179  ALA B N   1 
ATOM   5553 C  CA  . ALA B 1 179 ? 8.357   9.819   -55.963 1.00 28.49  ? 179  ALA B CA  1 
ATOM   5554 C  C   . ALA B 1 179 ? 7.915   11.238  -55.576 1.00 36.36  ? 179  ALA B C   1 
ATOM   5555 O  O   . ALA B 1 179 ? 6.922   11.745  -56.094 1.00 32.68  ? 179  ALA B O   1 
ATOM   5556 C  CB  . ALA B 1 179 ? 7.848   8.795   -54.954 1.00 26.21  ? 179  ALA B CB  1 
ATOM   5557 N  N   . LEU B 1 180 ? 8.653   11.870  -54.665 1.00 36.09  ? 180  LEU B N   1 
ATOM   5558 C  CA  . LEU B 1 180 ? 8.383   13.253  -54.274 1.00 31.37  ? 180  LEU B CA  1 
ATOM   5559 C  C   . LEU B 1 180 ? 8.496   14.190  -55.475 1.00 37.75  ? 180  LEU B C   1 
ATOM   5560 O  O   . LEU B 1 180 ? 7.703   15.123  -55.627 1.00 40.76  ? 180  LEU B O   1 
ATOM   5561 C  CB  . LEU B 1 180 ? 9.350   13.699  -53.176 1.00 29.26  ? 180  LEU B CB  1 
ATOM   5562 C  CG  . LEU B 1 180 ? 9.013   13.477  -51.696 1.00 34.11  ? 180  LEU B CG  1 
ATOM   5563 C  CD1 . LEU B 1 180 ? 8.226   12.205  -51.451 1.00 26.00  ? 180  LEU B CD1 1 
ATOM   5564 C  CD2 . LEU B 1 180 ? 10.287  13.490  -50.854 1.00 32.62  ? 180  LEU B CD2 1 
ATOM   5565 N  N   . GLN B 1 181 ? 9.494   13.940  -56.318 1.00 33.75  ? 181  GLN B N   1 
ATOM   5566 C  CA  . GLN B 1 181 ? 9.688   14.718  -57.533 1.00 39.63  ? 181  GLN B CA  1 
ATOM   5567 C  C   . GLN B 1 181 ? 8.513   14.497  -58.469 1.00 40.58  ? 181  GLN B C   1 
ATOM   5568 O  O   . GLN B 1 181 ? 8.004   15.431  -59.087 1.00 36.11  ? 181  GLN B O   1 
ATOM   5569 C  CB  . GLN B 1 181 ? 10.996  14.321  -58.225 1.00 35.60  ? 181  GLN B CB  1 
ATOM   5570 C  CG  . GLN B 1 181 ? 12.227  15.026  -57.664 1.00 56.60  ? 181  GLN B CG  1 
ATOM   5571 C  CD  . GLN B 1 181 ? 13.523  14.270  -57.923 1.00 58.37  ? 181  GLN B CD  1 
ATOM   5572 O  OE1 . GLN B 1 181 ? 13.517  13.156  -58.449 1.00 59.26  ? 181  GLN B OE1 1 
ATOM   5573 N  NE2 . GLN B 1 181 ? 14.643  14.872  -57.539 1.00 51.65  ? 181  GLN B NE2 1 
ATOM   5574 N  N   . TRP B 1 182 ? 8.078   13.247  -58.559 1.00 35.61  ? 182  TRP B N   1 
ATOM   5575 C  CA  . TRP B 1 182 ? 6.966   12.895  -59.417 1.00 37.88  ? 182  TRP B CA  1 
ATOM   5576 C  C   . TRP B 1 182 ? 5.725   13.661  -58.985 1.00 44.26  ? 182  TRP B C   1 
ATOM   5577 O  O   . TRP B 1 182 ? 4.971   14.160  -59.821 1.00 41.90  ? 182  TRP B O   1 
ATOM   5578 C  CB  . TRP B 1 182 ? 6.711   11.396  -59.356 1.00 31.13  ? 182  TRP B CB  1 
ATOM   5579 C  CG  . TRP B 1 182 ? 5.638   10.935  -60.285 1.00 38.78  ? 182  TRP B CG  1 
ATOM   5580 C  CD1 . TRP B 1 182 ? 5.805   10.425  -61.541 1.00 38.51  ? 182  TRP B CD1 1 
ATOM   5581 C  CD2 . TRP B 1 182 ? 4.228   10.941  -60.038 1.00 38.47  ? 182  TRP B CD2 1 
ATOM   5582 N  NE1 . TRP B 1 182 ? 4.585   10.108  -62.088 1.00 38.14  ? 182  TRP B NE1 1 
ATOM   5583 C  CE2 . TRP B 1 182 ? 3.601   10.413  -61.186 1.00 36.23  ? 182  TRP B CE2 1 
ATOM   5584 C  CE3 . TRP B 1 182 ? 3.435   11.334  -58.956 1.00 31.39  ? 182  TRP B CE3 1 
ATOM   5585 C  CZ2 . TRP B 1 182 ? 2.221   10.268  -61.282 1.00 37.33  ? 182  TRP B CZ2 1 
ATOM   5586 C  CZ3 . TRP B 1 182 ? 2.063   11.189  -59.053 1.00 34.43  ? 182  TRP B CZ3 1 
ATOM   5587 C  CH2 . TRP B 1 182 ? 1.470   10.662  -60.209 1.00 42.37  ? 182  TRP B CH2 1 
ATOM   5588 N  N   . VAL B 1 183 ? 5.523   13.762  -57.675 1.00 37.56  ? 183  VAL B N   1 
ATOM   5589 C  CA  . VAL B 1 183 ? 4.420   14.542  -57.136 1.00 36.68  ? 183  VAL B CA  1 
ATOM   5590 C  C   . VAL B 1 183 ? 4.538   16.009  -57.554 1.00 44.28  ? 183  VAL B C   1 
ATOM   5591 O  O   . VAL B 1 183 ? 3.555   16.632  -57.947 1.00 40.36  ? 183  VAL B O   1 
ATOM   5592 C  CB  . VAL B 1 183 ? 4.349   14.441  -55.606 1.00 34.68  ? 183  VAL B CB  1 
ATOM   5593 C  CG1 . VAL B 1 183 ? 3.416   15.517  -55.033 1.00 29.69  ? 183  VAL B CG1 1 
ATOM   5594 C  CG2 . VAL B 1 183 ? 3.898   13.049  -55.195 1.00 32.70  ? 183  VAL B CG2 1 
ATOM   5595 N  N   . GLN B 1 184 ? 5.746   16.552  -57.472 1.00 33.91  ? 184  GLN B N   1 
ATOM   5596 C  CA  . GLN B 1 184 ? 5.978   17.932  -57.868 1.00 38.39  ? 184  GLN B CA  1 
ATOM   5597 C  C   . GLN B 1 184 ? 5.576   18.151  -59.316 1.00 43.55  ? 184  GLN B C   1 
ATOM   5598 O  O   . GLN B 1 184 ? 4.921   19.137  -59.642 1.00 42.78  ? 184  GLN B O   1 
ATOM   5599 C  CB  . GLN B 1 184 ? 7.447   18.313  -57.679 1.00 34.86  ? 184  GLN B CB  1 
ATOM   5600 C  CG  . GLN B 1 184 ? 7.815   18.629  -56.252 1.00 43.67  ? 184  GLN B CG  1 
ATOM   5601 C  CD  . GLN B 1 184 ? 6.879   19.649  -55.648 1.00 46.51  ? 184  GLN B CD  1 
ATOM   5602 O  OE1 . GLN B 1 184 ? 6.709   20.743  -56.182 1.00 52.55  ? 184  GLN B OE1 1 
ATOM   5603 N  NE2 . GLN B 1 184 ? 6.253   19.291  -54.536 1.00 36.07  ? 184  GLN B NE2 1 
ATOM   5604 N  N   . GLU B 1 185 ? 5.965   17.222  -60.181 1.00 45.36  ? 185  GLU B N   1 
ATOM   5605 C  CA  . GLU B 1 185 ? 5.761   17.383  -61.616 1.00 45.11  ? 185  GLU B CA  1 
ATOM   5606 C  C   . GLU B 1 185 ? 4.355   17.022  -62.076 1.00 43.99  ? 185  GLU B C   1 
ATOM   5607 O  O   . GLU B 1 185 ? 3.922   17.456  -63.142 1.00 50.56  ? 185  GLU B O   1 
ATOM   5608 C  CB  . GLU B 1 185 ? 6.766   16.533  -62.391 1.00 49.07  ? 185  GLU B CB  1 
ATOM   5609 C  CG  . GLU B 1 185 ? 8.214   16.918  -62.184 1.00 60.98  ? 185  GLU B CG  1 
ATOM   5610 C  CD  . GLU B 1 185 ? 9.163   15.861  -62.713 1.00 85.33  ? 185  GLU B CD  1 
ATOM   5611 O  OE1 . GLU B 1 185 ? 8.674   14.807  -63.180 1.00 70.92  ? 185  GLU B OE1 1 
ATOM   5612 O  OE2 . GLU B 1 185 ? 10.393  16.082  -62.658 1.00 79.69  ? 185  GLU B OE2 1 
ATOM   5613 N  N   . ASN B 1 186 ? 3.641   16.232  -61.279 1.00 36.12  ? 186  ASN B N   1 
ATOM   5614 C  CA  . ASN B 1 186 ? 2.385   15.651  -61.741 1.00 35.03  ? 186  ASN B CA  1 
ATOM   5615 C  C   . ASN B 1 186 ? 1.141   15.874  -60.874 1.00 40.75  ? 186  ASN B C   1 
ATOM   5616 O  O   . ASN B 1 186 ? 0.023   15.715  -61.361 1.00 38.75  ? 186  ASN B O   1 
ATOM   5617 C  CB  . ASN B 1 186 ? 2.575   14.151  -61.990 1.00 36.94  ? 186  ASN B CB  1 
ATOM   5618 C  CG  . ASN B 1 186 ? 3.599   13.869  -63.072 1.00 43.02  ? 186  ASN B CG  1 
ATOM   5619 O  OD1 . ASN B 1 186 ? 3.404   14.231  -64.231 1.00 49.35  ? 186  ASN B OD1 1 
ATOM   5620 N  ND2 . ASN B 1 186 ? 4.701   13.226  -62.698 1.00 32.84  ? 186  ASN B ND2 1 
ATOM   5621 N  N   . ILE B 1 187 ? 1.317   16.231  -59.604 1.00 34.02  ? 187  ILE B N   1 
ATOM   5622 C  CA  . ILE B 1 187 ? 0.183   16.203  -58.673 1.00 32.48  ? 187  ILE B CA  1 
ATOM   5623 C  C   . ILE B 1 187 ? -0.908  17.219  -59.024 1.00 37.95  ? 187  ILE B C   1 
ATOM   5624 O  O   . ILE B 1 187 ? -2.080  17.009  -58.720 1.00 38.14  ? 187  ILE B O   1 
ATOM   5625 C  CB  . ILE B 1 187 ? 0.615   16.342  -57.190 1.00 32.07  ? 187  ILE B CB  1 
ATOM   5626 C  CG1 . ILE B 1 187 ? -0.389  15.635  -56.280 1.00 30.89  ? 187  ILE B CG1 1 
ATOM   5627 C  CG2 . ILE B 1 187 ? 0.786   17.805  -56.793 1.00 30.24  ? 187  ILE B CG2 1 
ATOM   5628 C  CD1 . ILE B 1 187 ? -0.564  14.160  -56.597 1.00 27.99  ? 187  ILE B CD1 1 
ATOM   5629 N  N   . ALA B 1 188 ? -0.524  18.306  -59.682 1.00 32.63  ? 188  ALA B N   1 
ATOM   5630 C  CA  . ALA B 1 188 ? -1.490  19.302  -60.121 1.00 36.85  ? 188  ALA B CA  1 
ATOM   5631 C  C   . ALA B 1 188 ? -2.550  18.687  -61.036 1.00 40.81  ? 188  ALA B C   1 
ATOM   5632 O  O   . ALA B 1 188 ? -3.709  19.087  -61.011 1.00 42.66  ? 188  ALA B O   1 
ATOM   5633 C  CB  . ALA B 1 188 ? -0.784  20.454  -60.813 1.00 30.54  ? 188  ALA B CB  1 
ATOM   5634 N  N   . ALA B 1 189 ? -2.152  17.706  -61.838 1.00 43.79  ? 189  ALA B N   1 
ATOM   5635 C  CA  . ALA B 1 189 ? -3.080  17.054  -62.756 1.00 34.73  ? 189  ALA B CA  1 
ATOM   5636 C  C   . ALA B 1 189 ? -4.214  16.369  -62.003 1.00 43.54  ? 189  ALA B C   1 
ATOM   5637 O  O   . ALA B 1 189 ? -5.262  16.070  -62.575 1.00 44.84  ? 189  ALA B O   1 
ATOM   5638 C  CB  . ALA B 1 189 ? -2.346  16.053  -63.630 1.00 31.67  ? 189  ALA B CB  1 
ATOM   5639 N  N   . PHE B 1 190 ? -3.996  16.117  -60.718 1.00 43.21  ? 190  PHE B N   1 
ATOM   5640 C  CA  . PHE B 1 190 ? -4.981  15.426  -59.897 1.00 38.93  ? 190  PHE B CA  1 
ATOM   5641 C  C   . PHE B 1 190 ? -5.758  16.404  -59.028 1.00 38.59  ? 190  PHE B C   1 
ATOM   5642 O  O   . PHE B 1 190 ? -6.664  16.004  -58.296 1.00 43.66  ? 190  PHE B O   1 
ATOM   5643 C  CB  . PHE B 1 190 ? -4.295  14.389  -59.006 1.00 39.43  ? 190  PHE B CB  1 
ATOM   5644 C  CG  . PHE B 1 190 ? -3.628  13.281  -59.764 1.00 35.72  ? 190  PHE B CG  1 
ATOM   5645 C  CD1 . PHE B 1 190 ? -2.376  13.464  -60.325 1.00 38.61  ? 190  PHE B CD1 1 
ATOM   5646 C  CD2 . PHE B 1 190 ? -4.250  12.050  -59.909 1.00 40.52  ? 190  PHE B CD2 1 
ATOM   5647 C  CE1 . PHE B 1 190 ? -1.759  12.441  -61.023 1.00 39.10  ? 190  PHE B CE1 1 
ATOM   5648 C  CE2 . PHE B 1 190 ? -3.638  11.024  -60.603 1.00 36.68  ? 190  PHE B CE2 1 
ATOM   5649 C  CZ  . PHE B 1 190 ? -2.389  11.221  -61.161 1.00 37.99  ? 190  PHE B CZ  1 
ATOM   5650 N  N   . GLY B 1 191 ? -5.394  17.683  -59.112 1.00 38.58  ? 191  GLY B N   1 
ATOM   5651 C  CA  . GLY B 1 191 ? -5.987  18.713  -58.276 1.00 39.25  ? 191  GLY B CA  1 
ATOM   5652 C  C   . GLY B 1 191 ? -5.195  18.978  -57.006 1.00 46.85  ? 191  GLY B C   1 
ATOM   5653 O  O   . GLY B 1 191 ? -5.655  19.685  -56.111 1.00 55.15  ? 191  GLY B O   1 
ATOM   5654 N  N   . GLY B 1 192 ? -3.999  18.405  -56.926 1.00 47.42  ? 192  GLY B N   1 
ATOM   5655 C  CA  . GLY B 1 192 ? -3.142  18.578  -55.768 1.00 33.71  ? 192  GLY B CA  1 
ATOM   5656 C  C   . GLY B 1 192 ? -2.283  19.820  -55.886 1.00 39.43  ? 192  GLY B C   1 
ATOM   5657 O  O   . GLY B 1 192 ? -1.944  20.245  -56.989 1.00 48.37  ? 192  GLY B O   1 
ATOM   5658 N  N   . ASP B 1 193 ? -1.934  20.405  -54.745 1.00 37.68  ? 193  ASP B N   1 
ATOM   5659 C  CA  . ASP B 1 193 ? -1.128  21.618  -54.716 1.00 38.93  ? 193  ASP B CA  1 
ATOM   5660 C  C   . ASP B 1 193 ? 0.342   21.301  -54.428 1.00 43.23  ? 193  ASP B C   1 
ATOM   5661 O  O   . ASP B 1 193 ? 0.711   21.005  -53.293 1.00 41.67  ? 193  ASP B O   1 
ATOM   5662 C  CB  . ASP B 1 193 ? -1.679  22.586  -53.669 1.00 35.80  ? 193  ASP B CB  1 
ATOM   5663 C  CG  . ASP B 1 193 ? -0.956  23.922  -53.666 1.00 44.34  ? 193  ASP B CG  1 
ATOM   5664 O  OD1 . ASP B 1 193 ? -0.056  24.124  -54.509 1.00 38.54  ? 193  ASP B OD1 1 
ATOM   5665 O  OD2 . ASP B 1 193 ? -1.292  24.774  -52.816 1.00 45.38  ? 193  ASP B OD2 1 
ATOM   5666 N  N   . PRO B 1 194 ? 1.188   21.374  -55.461 1.00 38.86  ? 194  PRO B N   1 
ATOM   5667 C  CA  . PRO B 1 194 ? 2.608   21.041  -55.304 1.00 40.41  ? 194  PRO B CA  1 
ATOM   5668 C  C   . PRO B 1 194 ? 3.273   21.947  -54.279 1.00 37.39  ? 194  PRO B C   1 
ATOM   5669 O  O   . PRO B 1 194 ? 4.329   21.609  -53.743 1.00 42.17  ? 194  PRO B O   1 
ATOM   5670 C  CB  . PRO B 1 194 ? 3.201   21.308  -56.699 1.00 33.62  ? 194  PRO B CB  1 
ATOM   5671 C  CG  . PRO B 1 194 ? 2.025   21.399  -57.627 1.00 46.12  ? 194  PRO B CG  1 
ATOM   5672 C  CD  . PRO B 1 194 ? 0.874   21.882  -56.807 1.00 40.05  ? 194  PRO B CD  1 
ATOM   5673 N  N   . MET B 1 195 ? 2.658   23.091  -54.008 1.00 37.55  ? 195  MET B N   1 
ATOM   5674 C  CA  . MET B 1 195 ? 3.267   24.071  -53.113 1.00 47.45  ? 195  MET B CA  1 
ATOM   5675 C  C   . MET B 1 195 ? 2.867   23.858  -51.658 1.00 37.96  ? 195  MET B C   1 
ATOM   5676 O  O   . MET B 1 195 ? 3.321   24.579  -50.770 1.00 43.24  ? 195  MET B O   1 
ATOM   5677 C  CB  . MET B 1 195 ? 2.943   25.494  -53.563 1.00 35.97  ? 195  MET B CB  1 
ATOM   5678 C  CG  . MET B 1 195 ? 3.598   25.880  -54.875 1.00 35.97  ? 195  MET B CG  1 
ATOM   5679 S  SD  . MET B 1 195 ? 3.347   27.618  -55.267 1.00 79.63  ? 195  MET B SD  1 
ATOM   5680 C  CE  . MET B 1 195 ? 1.624   27.836  -54.817 1.00 75.70  ? 195  MET B CE  1 
ATOM   5681 N  N   . SER B 1 196 ? 2.017   22.867  -51.422 1.00 33.09  ? 196  SER B N   1 
ATOM   5682 C  CA  . SER B 1 196 ? 1.698   22.440  -50.068 1.00 39.38  ? 196  SER B CA  1 
ATOM   5683 C  C   . SER B 1 196 ? 1.779   20.914  -49.960 1.00 38.92  ? 196  SER B C   1 
ATOM   5684 O  O   . SER B 1 196 ? 0.793   20.203  -50.157 1.00 33.49  ? 196  SER B O   1 
ATOM   5685 C  CB  . SER B 1 196 ? 0.319   22.945  -49.647 1.00 31.07  ? 196  SER B CB  1 
ATOM   5686 O  OG  . SER B 1 196 ? -0.030  22.450  -48.365 1.00 41.24  ? 196  SER B OG  1 
ATOM   5687 N  N   . VAL B 1 197 ? 2.969   20.419  -49.654 1.00 32.78  ? 197  VAL B N   1 
ATOM   5688 C  CA  . VAL B 1 197 ? 3.199   18.987  -49.556 1.00 36.13  ? 197  VAL B CA  1 
ATOM   5689 C  C   . VAL B 1 197 ? 3.702   18.638  -48.168 1.00 31.22  ? 197  VAL B C   1 
ATOM   5690 O  O   . VAL B 1 197 ? 4.700   19.179  -47.697 1.00 38.20  ? 197  VAL B O   1 
ATOM   5691 C  CB  . VAL B 1 197 ? 4.214   18.499  -50.615 1.00 36.24  ? 197  VAL B CB  1 
ATOM   5692 C  CG1 . VAL B 1 197 ? 4.498   17.019  -50.438 1.00 31.98  ? 197  VAL B CG1 1 
ATOM   5693 C  CG2 . VAL B 1 197 ? 3.687   18.780  -52.013 1.00 30.38  ? 197  VAL B CG2 1 
ATOM   5694 N  N   . THR B 1 198 ? 2.991   17.737  -47.511 1.00 30.22  ? 198  THR B N   1 
ATOM   5695 C  CA  . THR B 1 198 ? 3.348   17.321  -46.171 1.00 28.16  ? 198  THR B CA  1 
ATOM   5696 C  C   . THR B 1 198 ? 3.716   15.848  -46.196 1.00 34.19  ? 198  THR B C   1 
ATOM   5697 O  O   . THR B 1 198 ? 2.919   15.011  -46.623 1.00 42.07  ? 198  THR B O   1 
ATOM   5698 C  CB  . THR B 1 198 ? 2.171   17.526  -45.201 1.00 33.62  ? 198  THR B CB  1 
ATOM   5699 O  OG1 . THR B 1 198 ? 1.810   18.910  -45.172 1.00 39.75  ? 198  THR B OG1 1 
ATOM   5700 C  CG2 . THR B 1 198 ? 2.534   17.067  -43.796 1.00 25.33  ? 198  THR B CG2 1 
ATOM   5701 N  N   . LEU B 1 199 ? 4.929   15.532  -45.757 1.00 29.64  ? 199  LEU B N   1 
ATOM   5702 C  CA  . LEU B 1 199 ? 5.327   14.143  -45.588 1.00 32.58  ? 199  LEU B CA  1 
ATOM   5703 C  C   . LEU B 1 199 ? 4.890   13.673  -44.215 1.00 32.74  ? 199  LEU B C   1 
ATOM   5704 O  O   . LEU B 1 199 ? 5.123   14.357  -43.225 1.00 43.50  ? 199  LEU B O   1 
ATOM   5705 C  CB  . LEU B 1 199 ? 6.845   13.990  -45.689 1.00 27.47  ? 199  LEU B CB  1 
ATOM   5706 C  CG  . LEU B 1 199 ? 7.558   14.689  -46.843 1.00 35.64  ? 199  LEU B CG  1 
ATOM   5707 C  CD1 . LEU B 1 199 ? 9.058   14.445  -46.745 1.00 28.48  ? 199  LEU B CD1 1 
ATOM   5708 C  CD2 . LEU B 1 199 ? 7.009   14.215  -48.179 1.00 25.51  ? 199  LEU B CD2 1 
ATOM   5709 N  N   . PHE B 1 200 ? 4.250   12.514  -44.152 1.00 34.95  ? 200  PHE B N   1 
ATOM   5710 C  CA  . PHE B 1 200 ? 4.067   11.850  -42.873 1.00 32.68  ? 200  PHE B CA  1 
ATOM   5711 C  C   . PHE B 1 200 ? 4.395   10.366  -42.988 1.00 37.63  ? 200  PHE B C   1 
ATOM   5712 O  O   . PHE B 1 200 ? 4.203   9.752   -44.039 1.00 34.69  ? 200  PHE B O   1 
ATOM   5713 C  CB  . PHE B 1 200 ? 2.679   12.120  -42.270 1.00 27.46  ? 200  PHE B CB  1 
ATOM   5714 C  CG  . PHE B 1 200 ? 1.541   11.447  -42.986 1.00 31.93  ? 200  PHE B CG  1 
ATOM   5715 C  CD1 . PHE B 1 200 ? 1.423   11.512  -44.364 1.00 29.38  ? 200  PHE B CD1 1 
ATOM   5716 C  CD2 . PHE B 1 200 ? 0.551   10.793  -42.264 1.00 26.55  ? 200  PHE B CD2 1 
ATOM   5717 C  CE1 . PHE B 1 200 ? 0.356   10.911  -45.011 1.00 33.73  ? 200  PHE B CE1 1 
ATOM   5718 C  CE2 . PHE B 1 200 ? -0.518  10.190  -42.907 1.00 29.50  ? 200  PHE B CE2 1 
ATOM   5719 C  CZ  . PHE B 1 200 ? -0.616  10.248  -44.281 1.00 30.04  ? 200  PHE B CZ  1 
ATOM   5720 N  N   . GLY B 1 201 ? 4.933   9.811   -41.910 1.00 33.59  ? 201  GLY B N   1 
ATOM   5721 C  CA  . GLY B 1 201 ? 5.372   8.433   -41.904 1.00 26.70  ? 201  GLY B CA  1 
ATOM   5722 C  C   . GLY B 1 201 ? 5.549   7.931   -40.489 1.00 34.06  ? 201  GLY B C   1 
ATOM   5723 O  O   . GLY B 1 201 ? 5.646   8.717   -39.545 1.00 31.70  ? 201  GLY B O   1 
ATOM   5724 N  N   . GLU B 1 202 ? 5.595   6.611   -40.343 1.00 32.49  ? 202  GLU B N   1 
ATOM   5725 C  CA  . GLU B 1 202 ? 5.690   5.998   -39.031 1.00 27.50  ? 202  GLU B CA  1 
ATOM   5726 C  C   . GLU B 1 202 ? 6.885   5.055   -38.947 1.00 33.36  ? 202  GLU B C   1 
ATOM   5727 O  O   . GLU B 1 202 ? 7.169   4.312   -39.885 1.00 30.97  ? 202  GLU B O   1 
ATOM   5728 C  CB  . GLU B 1 202 ? 4.384   5.273   -38.701 1.00 25.59  ? 202  GLU B CB  1 
ATOM   5729 C  CG  . GLU B 1 202 ? 4.289   4.749   -37.279 1.00 32.48  ? 202  GLU B CG  1 
ATOM   5730 C  CD  . GLU B 1 202 ? 4.757   3.319   -37.170 1.00 37.77  ? 202  GLU B CD  1 
ATOM   5731 O  OE1 . GLU B 1 202 ? 5.055   2.721   -38.222 1.00 36.60  ? 202  GLU B OE1 1 
ATOM   5732 O  OE2 . GLU B 1 202 ? 4.825   2.793   -36.041 1.00 38.00  ? 202  GLU B OE2 1 
ATOM   5733 N  N   . SER B 1 203 ? 7.591   5.106   -37.820 1.00 32.01  ? 203  SER B N   1 
ATOM   5734 C  CA  . SER B 1 203 ? 8.731   4.232   -37.586 1.00 27.91  ? 203  SER B CA  1 
ATOM   5735 C  C   . SER B 1 203 ? 9.805   4.499   -38.639 1.00 29.78  ? 203  SER B C   1 
ATOM   5736 O  O   . SER B 1 203 ? 10.256  5.635   -38.795 1.00 30.15  ? 203  SER B O   1 
ATOM   5737 C  CB  . SER B 1 203 ? 8.284   2.771   -37.608 1.00 21.07  ? 203  SER B CB  1 
ATOM   5738 O  OG  . SER B 1 203 ? 9.210   1.938   -36.936 1.00 33.36  ? 203  SER B OG  1 
ATOM   5739 N  N   . ALA B 1 204 ? 10.208  3.464   -39.370 1.00 28.78  ? 204  ALA B N   1 
ATOM   5740 C  CA  . ALA B 1 204 ? 11.188  3.646   -40.438 1.00 32.88  ? 204  ALA B CA  1 
ATOM   5741 C  C   . ALA B 1 204 ? 10.727  4.741   -41.398 1.00 30.44  ? 204  ALA B C   1 
ATOM   5742 O  O   . ALA B 1 204 ? 11.535  5.519   -41.905 1.00 32.58  ? 204  ALA B O   1 
ATOM   5743 C  CB  . ALA B 1 204 ? 11.433  2.338   -41.180 1.00 29.25  ? 204  ALA B CB  1 
ATOM   5744 N  N   . GLY B 1 205 ? 9.420   4.804   -41.633 1.00 29.62  ? 205  GLY B N   1 
ATOM   5745 C  CA  . GLY B 1 205 ? 8.842   5.863   -42.441 1.00 30.20  ? 205  GLY B CA  1 
ATOM   5746 C  C   . GLY B 1 205 ? 9.052   7.234   -41.818 1.00 31.43  ? 205  GLY B C   1 
ATOM   5747 O  O   . GLY B 1 205 ? 9.320   8.210   -42.515 1.00 29.34  ? 205  GLY B O   1 
ATOM   5748 N  N   . ALA B 1 206 ? 8.932   7.310   -40.496 1.00 29.32  ? 206  ALA B N   1 
ATOM   5749 C  CA  . ALA B 1 206 ? 9.179   8.560   -39.791 1.00 28.26  ? 206  ALA B CA  1 
ATOM   5750 C  C   . ALA B 1 206 ? 10.649  8.944   -39.927 1.00 31.21  ? 206  ALA B C   1 
ATOM   5751 O  O   . ALA B 1 206 ? 10.979  10.091  -40.227 1.00 34.18  ? 206  ALA B O   1 
ATOM   5752 C  CB  . ALA B 1 206 ? 8.780   8.440   -38.334 1.00 27.54  ? 206  ALA B CB  1 
ATOM   5753 N  N   . ALA B 1 207 ? 11.529  7.971   -39.722 1.00 26.07  ? 207  ALA B N   1 
ATOM   5754 C  CA  . ALA B 1 207 ? 12.955  8.183   -39.916 1.00 26.46  ? 207  ALA B CA  1 
ATOM   5755 C  C   . ALA B 1 207 ? 13.268  8.636   -41.345 1.00 30.13  ? 207  ALA B C   1 
ATOM   5756 O  O   . ALA B 1 207 ? 14.142  9.483   -41.557 1.00 30.96  ? 207  ALA B O   1 
ATOM   5757 C  CB  . ALA B 1 207 ? 13.729  6.917   -39.575 1.00 28.80  ? 207  ALA B CB  1 
ATOM   5758 N  N   . SER B 1 208 ? 12.561  8.069   -42.322 1.00 30.31  ? 208  SER B N   1 
ATOM   5759 C  CA  . SER B 1 208 ? 12.761  8.445   -43.724 1.00 30.27  ? 208  SER B CA  1 
ATOM   5760 C  C   . SER B 1 208 ? 12.410  9.910   -43.920 1.00 28.60  ? 208  SER B C   1 
ATOM   5761 O  O   . SER B 1 208 ? 13.184  10.677  -44.492 1.00 28.40  ? 208  SER B O   1 
ATOM   5762 C  CB  . SER B 1 208 ? 11.919  7.573   -44.659 1.00 34.19  ? 208  SER B CB  1 
ATOM   5763 O  OG  . SER B 1 208 ? 12.375  6.229   -44.665 1.00 32.58  ? 208  SER B OG  1 
ATOM   5764 N  N   . VAL B 1 209 ? 11.233  10.293  -43.440 1.00 29.24  ? 209  VAL B N   1 
ATOM   5765 C  CA  . VAL B 1 209 ? 10.829  11.692  -43.443 1.00 33.77  ? 209  VAL B CA  1 
ATOM   5766 C  C   . VAL B 1 209 ? 11.912  12.558  -42.813 1.00 32.56  ? 209  VAL B C   1 
ATOM   5767 O  O   . VAL B 1 209 ? 12.287  13.602  -43.358 1.00 35.59  ? 209  VAL B O   1 
ATOM   5768 C  CB  . VAL B 1 209 ? 9.529   11.907  -42.659 1.00 30.01  ? 209  VAL B CB  1 
ATOM   5769 C  CG1 . VAL B 1 209 ? 9.323   13.391  -42.394 1.00 24.49  ? 209  VAL B CG1 1 
ATOM   5770 C  CG2 . VAL B 1 209 ? 8.355   11.316  -43.421 1.00 30.11  ? 209  VAL B CG2 1 
ATOM   5771 N  N   . GLY B 1 210 ? 12.410  12.119  -41.660 1.00 28.57  ? 210  GLY B N   1 
ATOM   5772 C  CA  . GLY B 1 210 ? 13.482  12.822  -40.977 1.00 29.95  ? 210  GLY B CA  1 
ATOM   5773 C  C   . GLY B 1 210 ? 14.691  13.016  -41.875 1.00 29.41  ? 210  GLY B C   1 
ATOM   5774 O  O   . GLY B 1 210 ? 15.295  14.089  -41.915 1.00 30.70  ? 210  GLY B O   1 
ATOM   5775 N  N   . MET B 1 211 ? 15.038  11.979  -42.622 1.00 21.16  ? 211  MET B N   1 
ATOM   5776 C  CA  . MET B 1 211 ? 16.189  12.070  -43.505 1.00 29.52  ? 211  MET B CA  1 
ATOM   5777 C  C   . MET B 1 211 ? 15.982  12.973  -44.706 1.00 37.76  ? 211  MET B C   1 
ATOM   5778 O  O   . MET B 1 211 ? 16.942  13.554  -45.210 1.00 41.08  ? 211  MET B O   1 
ATOM   5779 C  CB  . MET B 1 211 ? 16.671  10.687  -43.912 1.00 33.07  ? 211  MET B CB  1 
ATOM   5780 C  CG  . MET B 1 211 ? 17.472  10.057  -42.793 1.00 36.28  ? 211  MET B CG  1 
ATOM   5781 S  SD  . MET B 1 211 ? 17.527  8.290   -42.920 1.00 46.78  ? 211  MET B SD  1 
ATOM   5782 C  CE  . MET B 1 211 ? 17.636  7.829   -41.193 1.00 43.46  ? 211  MET B CE  1 
ATOM   5783 N  N   . HIS B 1 212 ? 14.739  13.114  -45.158 1.00 30.89  ? 212  HIS B N   1 
ATOM   5784 C  CA  . HIS B 1 212 ? 14.468  14.068  -46.226 1.00 34.19  ? 212  HIS B CA  1 
ATOM   5785 C  C   . HIS B 1 212 ? 14.624  15.483  -45.691 1.00 39.87  ? 212  HIS B C   1 
ATOM   5786 O  O   . HIS B 1 212 ? 15.087  16.376  -46.395 1.00 39.69  ? 212  HIS B O   1 
ATOM   5787 C  CB  . HIS B 1 212 ? 13.094  13.836  -46.861 1.00 29.04  ? 212  HIS B CB  1 
ATOM   5788 C  CG  . HIS B 1 212 ? 13.021  12.571  -47.654 1.00 33.69  ? 212  HIS B CG  1 
ATOM   5789 N  ND1 . HIS B 1 212 ? 13.621  12.433  -48.888 1.00 35.69  ? 212  HIS B ND1 1 
ATOM   5790 C  CD2 . HIS B 1 212 ? 12.462  11.371  -47.373 1.00 32.28  ? 212  HIS B CD2 1 
ATOM   5791 C  CE1 . HIS B 1 212 ? 13.419  11.208  -49.339 1.00 30.20  ? 212  HIS B CE1 1 
ATOM   5792 N  NE2 . HIS B 1 212 ? 12.719  10.543  -48.438 1.00 32.32  ? 212  HIS B NE2 1 
ATOM   5793 N  N   . ILE B 1 213 ? 14.260  15.671  -44.427 1.00 36.67  ? 213  ILE B N   1 
ATOM   5794 C  CA  . ILE B 1 213 ? 14.488  16.937  -43.748 1.00 28.72  ? 213  ILE B CA  1 
ATOM   5795 C  C   . ILE B 1 213 ? 15.983  17.263  -43.688 1.00 39.72  ? 213  ILE B C   1 
ATOM   5796 O  O   . ILE B 1 213 ? 16.379  18.423  -43.796 1.00 33.46  ? 213  ILE B O   1 
ATOM   5797 C  CB  . ILE B 1 213 ? 13.917  16.902  -42.321 1.00 31.63  ? 213  ILE B CB  1 
ATOM   5798 C  CG1 . ILE B 1 213 ? 12.389  16.931  -42.363 1.00 34.02  ? 213  ILE B CG1 1 
ATOM   5799 C  CG2 . ILE B 1 213 ? 14.450  18.062  -41.491 1.00 27.11  ? 213  ILE B CG2 1 
ATOM   5800 C  CD1 . ILE B 1 213 ? 11.744  16.704  -41.023 1.00 28.53  ? 213  ILE B CD1 1 
ATOM   5801 N  N   . LEU B 1 214 ? 16.810  16.232  -43.529 1.00 38.27  ? 214  LEU B N   1 
ATOM   5802 C  CA  . LEU B 1 214 ? 18.246  16.419  -43.334 1.00 27.54  ? 214  LEU B CA  1 
ATOM   5803 C  C   . LEU B 1 214 ? 19.062  16.278  -44.617 1.00 34.62  ? 214  LEU B C   1 
ATOM   5804 O  O   . LEU B 1 214 ? 20.288  16.195  -44.563 1.00 40.78  ? 214  LEU B O   1 
ATOM   5805 C  CB  . LEU B 1 214 ? 18.775  15.432  -42.285 1.00 25.45  ? 214  LEU B CB  1 
ATOM   5806 C  CG  . LEU B 1 214 ? 18.174  15.532  -40.881 1.00 30.78  ? 214  LEU B CG  1 
ATOM   5807 C  CD1 . LEU B 1 214 ? 18.649  14.390  -40.008 1.00 25.76  ? 214  LEU B CD1 1 
ATOM   5808 C  CD2 . LEU B 1 214 ? 18.511  16.867  -40.238 1.00 28.53  ? 214  LEU B CD2 1 
ATOM   5809 N  N   . SER B 1 215 ? 18.391  16.237  -45.764 1.00 35.93  ? 215  SER B N   1 
ATOM   5810 C  CA  . SER B 1 215 ? 19.087  16.120  -47.046 1.00 35.27  ? 215  SER B CA  1 
ATOM   5811 C  C   . SER B 1 215 ? 18.700  17.244  -48.007 1.00 44.42  ? 215  SER B C   1 
ATOM   5812 O  O   . SER B 1 215 ? 17.525  17.423  -48.340 1.00 38.75  ? 215  SER B O   1 
ATOM   5813 C  CB  . SER B 1 215 ? 18.827  14.754  -47.686 1.00 35.27  ? 215  SER B CB  1 
ATOM   5814 O  OG  . SER B 1 215 ? 19.709  14.527  -48.769 1.00 42.88  ? 215  SER B OG  1 
ATOM   5815 N  N   . LEU B 1 216 ? 19.701  17.996  -48.454 1.00 40.92  ? 216  LEU B N   1 
ATOM   5816 C  CA  . LEU B 1 216 ? 19.465  19.195  -49.255 1.00 44.07  ? 216  LEU B CA  1 
ATOM   5817 C  C   . LEU B 1 216 ? 18.550  18.986  -50.479 1.00 44.80  ? 216  LEU B C   1 
ATOM   5818 O  O   . LEU B 1 216 ? 17.559  19.692  -50.637 1.00 42.04  ? 216  LEU B O   1 
ATOM   5819 C  CB  . LEU B 1 216 ? 20.793  19.839  -49.664 1.00 53.18  ? 216  LEU B CB  1 
ATOM   5820 C  CG  . LEU B 1 216 ? 20.666  21.197  -50.358 1.00 70.78  ? 216  LEU B CG  1 
ATOM   5821 C  CD1 . LEU B 1 216 ? 19.908  22.169  -49.469 1.00 55.22  ? 216  LEU B CD1 1 
ATOM   5822 C  CD2 . LEU B 1 216 ? 22.032  21.757  -50.742 1.00 63.53  ? 216  LEU B CD2 1 
ATOM   5823 N  N   . PRO B 1 217 ? 18.876  18.018  -51.349 1.00 39.36  ? 217  PRO B N   1 
ATOM   5824 C  CA  . PRO B 1 217 ? 18.045  17.804  -52.544 1.00 44.55  ? 217  PRO B CA  1 
ATOM   5825 C  C   . PRO B 1 217 ? 16.548  17.562  -52.277 1.00 46.00  ? 217  PRO B C   1 
ATOM   5826 O  O   . PRO B 1 217 ? 15.734  17.842  -53.160 1.00 42.33  ? 217  PRO B O   1 
ATOM   5827 C  CB  . PRO B 1 217 ? 18.679  16.571  -53.194 1.00 42.37  ? 217  PRO B CB  1 
ATOM   5828 C  CG  . PRO B 1 217 ? 20.103  16.600  -52.733 1.00 32.96  ? 217  PRO B CG  1 
ATOM   5829 C  CD  . PRO B 1 217 ? 20.048  17.124  -51.324 1.00 40.73  ? 217  PRO B CD  1 
ATOM   5830 N  N   . SER B 1 218 ? 16.187  17.062  -51.097 1.00 41.62  ? 218  SER B N   1 
ATOM   5831 C  CA  . SER B 1 218 ? 14.779  16.796  -50.787 1.00 30.39  ? 218  SER B CA  1 
ATOM   5832 C  C   . SER B 1 218 ? 14.018  18.061  -50.405 1.00 43.08  ? 218  SER B C   1 
ATOM   5833 O  O   . SER B 1 218 ? 12.795  18.125  -50.547 1.00 39.88  ? 218  SER B O   1 
ATOM   5834 C  CB  . SER B 1 218 ? 14.646  15.769  -49.661 1.00 31.71  ? 218  SER B CB  1 
ATOM   5835 O  OG  . SER B 1 218 ? 15.135  14.497  -50.048 1.00 33.57  ? 218  SER B OG  1 
ATOM   5836 N  N   . ARG B 1 219 ? 14.751  19.061  -49.921 1.00 39.08  ? 219  ARG B N   1 
ATOM   5837 C  CA  . ARG B 1 219 ? 14.162  20.289  -49.387 1.00 40.81  ? 219  ARG B CA  1 
ATOM   5838 C  C   . ARG B 1 219 ? 13.111  20.927  -50.288 1.00 46.36  ? 219  ARG B C   1 
ATOM   5839 O  O   . ARG B 1 219 ? 12.049  21.339  -49.823 1.00 43.69  ? 219  ARG B O   1 
ATOM   5840 C  CB  . ARG B 1 219 ? 15.248  21.324  -49.095 1.00 52.58  ? 219  ARG B CB  1 
ATOM   5841 C  CG  . ARG B 1 219 ? 14.691  22.696  -48.758 1.00 66.83  ? 219  ARG B CG  1 
ATOM   5842 C  CD  . ARG B 1 219 ? 15.773  23.759  -48.733 1.00 65.39  ? 219  ARG B CD  1 
ATOM   5843 N  NE  . ARG B 1 219 ? 15.314  24.963  -48.046 1.00 81.46  ? 219  ARG B NE  1 
ATOM   5844 C  CZ  . ARG B 1 219 ? 15.493  25.193  -46.748 1.00 79.17  ? 219  ARG B CZ  1 
ATOM   5845 N  NH1 . ARG B 1 219 ? 16.129  24.302  -45.999 1.00 70.78  ? 219  ARG B NH1 1 
ATOM   5846 N  NH2 . ARG B 1 219 ? 15.042  26.315  -46.200 1.00 87.59  ? 219  ARG B NH2 1 
ATOM   5847 N  N   . SER B 1 220 ? 13.419  21.028  -51.573 1.00 40.48  ? 220  SER B N   1 
ATOM   5848 C  CA  . SER B 1 220 ? 12.518  21.682  -52.507 1.00 46.51  ? 220  SER B CA  1 
ATOM   5849 C  C   . SER B 1 220 ? 11.281  20.844  -52.822 1.00 41.22  ? 220  SER B C   1 
ATOM   5850 O  O   . SER B 1 220 ? 10.432  21.265  -53.608 1.00 43.51  ? 220  SER B O   1 
ATOM   5851 C  CB  . SER B 1 220 ? 13.259  22.010  -53.799 1.00 42.76  ? 220  SER B CB  1 
ATOM   5852 O  OG  . SER B 1 220 ? 13.791  20.834  -54.380 1.00 50.43  ? 220  SER B OG  1 
ATOM   5853 N  N   . LEU B 1 221 ? 11.168  19.670  -52.206 1.00 32.61  ? 221  LEU B N   1 
ATOM   5854 C  CA  . LEU B 1 221 ? 10.109  18.727  -52.574 1.00 34.82  ? 221  LEU B CA  1 
ATOM   5855 C  C   . LEU B 1 221 ? 8.965   18.610  -51.565 1.00 35.93  ? 221  LEU B C   1 
ATOM   5856 O  O   . LEU B 1 221 ? 8.000   17.885  -51.801 1.00 37.44  ? 221  LEU B O   1 
ATOM   5857 C  CB  . LEU B 1 221 ? 10.700  17.340  -52.846 1.00 37.39  ? 221  LEU B CB  1 
ATOM   5858 C  CG  . LEU B 1 221 ? 11.895  17.287  -53.799 1.00 37.44  ? 221  LEU B CG  1 
ATOM   5859 C  CD1 . LEU B 1 221 ? 12.379  15.859  -53.947 1.00 29.32  ? 221  LEU B CD1 1 
ATOM   5860 C  CD2 . LEU B 1 221 ? 11.534  17.877  -55.151 1.00 32.93  ? 221  LEU B CD2 1 
ATOM   5861 N  N   . PHE B 1 222 ? 9.070   19.312  -50.444 1.00 34.10  ? 222  PHE B N   1 
ATOM   5862 C  CA  . PHE B 1 222 ? 8.020   19.275  -49.430 1.00 33.50  ? 222  PHE B CA  1 
ATOM   5863 C  C   . PHE B 1 222 ? 8.137   20.484  -48.520 1.00 33.16  ? 222  PHE B C   1 
ATOM   5864 O  O   . PHE B 1 222 ? 9.170   21.148  -48.501 1.00 36.82  ? 222  PHE B O   1 
ATOM   5865 C  CB  . PHE B 1 222 ? 8.106   17.989  -48.609 1.00 35.46  ? 222  PHE B CB  1 
ATOM   5866 C  CG  . PHE B 1 222 ? 9.270   17.955  -47.667 1.00 37.24  ? 222  PHE B CG  1 
ATOM   5867 C  CD1 . PHE B 1 222 ? 10.550  17.707  -48.139 1.00 33.15  ? 222  PHE B CD1 1 
ATOM   5868 C  CD2 . PHE B 1 222 ? 9.089   18.178  -46.310 1.00 30.48  ? 222  PHE B CD2 1 
ATOM   5869 C  CE1 . PHE B 1 222 ? 11.630  17.677  -47.275 1.00 39.43  ? 222  PHE B CE1 1 
ATOM   5870 C  CE2 . PHE B 1 222 ? 10.163  18.148  -45.439 1.00 37.19  ? 222  PHE B CE2 1 
ATOM   5871 C  CZ  . PHE B 1 222 ? 11.439  17.900  -45.924 1.00 42.14  ? 222  PHE B CZ  1 
ATOM   5872 N  N   . HIS B 1 223 ? 7.087   20.764  -47.755 1.00 34.70  ? 223  HIS B N   1 
ATOM   5873 C  CA  . HIS B 1 223 ? 7.057   21.979  -46.942 1.00 34.97  ? 223  HIS B CA  1 
ATOM   5874 C  C   . HIS B 1 223 ? 6.882   21.694  -45.459 1.00 38.53  ? 223  HIS B C   1 
ATOM   5875 O  O   . HIS B 1 223 ? 7.253   22.513  -44.619 1.00 43.71  ? 223  HIS B O   1 
ATOM   5876 C  CB  . HIS B 1 223 ? 5.951   22.903  -47.438 1.00 31.73  ? 223  HIS B CB  1 
ATOM   5877 C  CG  . HIS B 1 223 ? 5.790   22.882  -48.922 1.00 45.49  ? 223  HIS B CG  1 
ATOM   5878 N  ND1 . HIS B 1 223 ? 6.475   23.739  -49.757 1.00 37.36  ? 223  HIS B ND1 1 
ATOM   5879 C  CD2 . HIS B 1 223 ? 5.053   22.081  -49.727 1.00 35.49  ? 223  HIS B CD2 1 
ATOM   5880 C  CE1 . HIS B 1 223 ? 6.153   23.476  -51.010 1.00 41.71  ? 223  HIS B CE1 1 
ATOM   5881 N  NE2 . HIS B 1 223 ? 5.293   22.473  -51.019 1.00 41.04  ? 223  HIS B NE2 1 
ATOM   5882 N  N   . ARG B 1 224 ? 6.326   20.529  -45.145 1.00 36.97  ? 224  ARG B N   1 
ATOM   5883 C  CA  . ARG B 1 224 ? 6.046   20.150  -43.765 1.00 33.78  ? 224  ARG B CA  1 
ATOM   5884 C  C   . ARG B 1 224 ? 6.241   18.660  -43.556 1.00 30.88  ? 224  ARG B C   1 
ATOM   5885 O  O   . ARG B 1 224 ? 6.220   17.882  -44.509 1.00 33.00  ? 224  ARG B O   1 
ATOM   5886 C  CB  . ARG B 1 224 ? 4.616   20.529  -43.393 1.00 37.28  ? 224  ARG B CB  1 
ATOM   5887 C  CG  . ARG B 1 224 ? 4.448   21.990  -43.113 1.00 46.83  ? 224  ARG B CG  1 
ATOM   5888 C  CD  . ARG B 1 224 ? 3.009   22.328  -42.821 1.00 47.01  ? 224  ARG B CD  1 
ATOM   5889 N  NE  . ARG B 1 224 ? 2.215   22.406  -44.038 1.00 45.92  ? 224  ARG B NE  1 
ATOM   5890 C  CZ  . ARG B 1 224 ? 2.408   23.310  -44.990 1.00 42.96  ? 224  ARG B CZ  1 
ATOM   5891 N  NH1 . ARG B 1 224 ? 3.384   24.200  -44.871 1.00 32.99  ? 224  ARG B NH1 1 
ATOM   5892 N  NH2 . ARG B 1 224 ? 1.634   23.312  -46.066 1.00 47.72  ? 224  ARG B NH2 1 
ATOM   5893 N  N   . ALA B 1 225 ? 6.405   18.265  -42.300 1.00 28.55  ? 225  ALA B N   1 
ATOM   5894 C  CA  . ALA B 1 225 ? 6.709   16.881  -41.980 1.00 29.66  ? 225  ALA B CA  1 
ATOM   5895 C  C   . ALA B 1 225 ? 6.009   16.397  -40.714 1.00 37.57  ? 225  ALA B C   1 
ATOM   5896 O  O   . ALA B 1 225 ? 5.779   17.159  -39.773 1.00 36.39  ? 225  ALA B O   1 
ATOM   5897 C  CB  . ALA B 1 225 ? 8.211   16.696  -41.852 1.00 25.31  ? 225  ALA B CB  1 
ATOM   5898 N  N   . VAL B 1 226 ? 5.677   15.115  -40.706 1.00 30.05  ? 226  VAL B N   1 
ATOM   5899 C  CA  . VAL B 1 226 ? 5.146   14.458  -39.526 1.00 28.90  ? 226  VAL B CA  1 
ATOM   5900 C  C   . VAL B 1 226 ? 5.948   13.186  -39.332 1.00 34.10  ? 226  VAL B C   1 
ATOM   5901 O  O   . VAL B 1 226 ? 6.035   12.358  -40.239 1.00 33.82  ? 226  VAL B O   1 
ATOM   5902 C  CB  . VAL B 1 226 ? 3.670   14.078  -39.701 1.00 25.72  ? 226  VAL B CB  1 
ATOM   5903 C  CG1 . VAL B 1 226 ? 3.091   13.547  -38.387 1.00 28.69  ? 226  VAL B CG1 1 
ATOM   5904 C  CG2 . VAL B 1 226 ? 2.871   15.262  -40.221 1.00 27.09  ? 226  VAL B CG2 1 
ATOM   5905 N  N   . LEU B 1 227 ? 6.555   13.040  -38.162 1.00 29.13  ? 227  LEU B N   1 
ATOM   5906 C  CA  . LEU B 1 227 ? 7.276   11.823  -37.842 1.00 27.57  ? 227  LEU B CA  1 
ATOM   5907 C  C   . LEU B 1 227 ? 6.575   11.123  -36.696 1.00 33.32  ? 227  LEU B C   1 
ATOM   5908 O  O   . LEU B 1 227 ? 6.590   11.602  -35.563 1.00 28.63  ? 227  LEU B O   1 
ATOM   5909 C  CB  . LEU B 1 227 ? 8.719   12.126  -37.454 1.00 27.85  ? 227  LEU B CB  1 
ATOM   5910 C  CG  . LEU B 1 227 ? 9.622   12.762  -38.510 1.00 34.97  ? 227  LEU B CG  1 
ATOM   5911 C  CD1 . LEU B 1 227 ? 9.297   14.237  -38.677 1.00 27.37  ? 227  LEU B CD1 1 
ATOM   5912 C  CD2 . LEU B 1 227 ? 11.082  12.578  -38.120 1.00 25.29  ? 227  LEU B CD2 1 
ATOM   5913 N  N   . GLN B 1 228 ? 5.948   9.992   -36.995 1.00 29.49  ? 228  GLN B N   1 
ATOM   5914 C  CA  . GLN B 1 228 ? 5.287   9.206   -35.967 1.00 32.23  ? 228  GLN B CA  1 
ATOM   5915 C  C   . GLN B 1 228 ? 6.173   8.039   -35.541 1.00 31.91  ? 228  GLN B C   1 
ATOM   5916 O  O   . GLN B 1 228 ? 6.477   7.160   -36.342 1.00 32.20  ? 228  GLN B O   1 
ATOM   5917 C  CB  . GLN B 1 228 ? 3.938   8.699   -36.477 1.00 27.64  ? 228  GLN B CB  1 
ATOM   5918 C  CG  . GLN B 1 228 ? 3.128   9.763   -37.207 1.00 31.94  ? 228  GLN B CG  1 
ATOM   5919 C  CD  . GLN B 1 228 ? 1.932   9.189   -37.954 1.00 33.94  ? 228  GLN B CD  1 
ATOM   5920 O  OE1 . GLN B 1 228 ? 1.351   9.844   -38.821 1.00 26.32  ? 228  GLN B OE1 1 
ATOM   5921 N  NE2 . GLN B 1 228 ? 1.564   7.959   -37.622 1.00 25.06  ? 228  GLN B NE2 1 
ATOM   5922 N  N   . SER B 1 229 ? 6.608   8.058   -34.285 1.00 25.04  ? 229  SER B N   1 
ATOM   5923 C  CA  . SER B 1 229 ? 7.306   6.923   -33.689 1.00 35.47  ? 229  SER B CA  1 
ATOM   5924 C  C   . SER B 1 229 ? 8.592   6.530   -34.409 1.00 36.32  ? 229  SER B C   1 
ATOM   5925 O  O   . SER B 1 229 ? 8.896   5.344   -34.522 1.00 31.57  ? 229  SER B O   1 
ATOM   5926 C  CB  . SER B 1 229 ? 6.381   5.704   -33.615 1.00 31.55  ? 229  SER B CB  1 
ATOM   5927 O  OG  . SER B 1 229 ? 5.285   5.949   -32.758 1.00 28.77  ? 229  SER B OG  1 
ATOM   5928 N  N   . GLY B 1 230 ? 9.345   7.517   -34.886 1.00 25.77  ? 230  GLY B N   1 
ATOM   5929 C  CA  . GLY B 1 230 ? 10.598  7.247   -35.563 1.00 25.35  ? 230  GLY B CA  1 
ATOM   5930 C  C   . GLY B 1 230 ? 11.355  8.516   -35.890 1.00 32.99  ? 230  GLY B C   1 
ATOM   5931 O  O   . GLY B 1 230 ? 10.749  9.568   -36.089 1.00 30.55  ? 230  GLY B O   1 
ATOM   5932 N  N   . THR B 1 231 ? 12.682  8.414   -35.946 1.00 29.09  ? 231  THR B N   1 
ATOM   5933 C  CA  . THR B 1 231 ? 13.549  9.569   -36.167 1.00 27.68  ? 231  THR B CA  1 
ATOM   5934 C  C   . THR B 1 231 ? 14.788  9.178   -36.964 1.00 28.30  ? 231  THR B C   1 
ATOM   5935 O  O   . THR B 1 231 ? 15.165  8.008   -36.979 1.00 30.41  ? 231  THR B O   1 
ATOM   5936 C  CB  . THR B 1 231 ? 14.023  10.168  -34.829 1.00 35.29  ? 231  THR B CB  1 
ATOM   5937 O  OG1 . THR B 1 231 ? 14.740  9.174   -34.088 1.00 31.97  ? 231  THR B OG1 1 
ATOM   5938 C  CG2 . THR B 1 231 ? 12.842  10.662  -34.005 1.00 30.96  ? 231  THR B CG2 1 
ATOM   5939 N  N   . PRO B 1 232 ? 15.433  10.159  -37.624 1.00 28.89  ? 232  PRO B N   1 
ATOM   5940 C  CA  . PRO B 1 232 ? 16.669  9.877   -38.363 1.00 29.35  ? 232  PRO B CA  1 
ATOM   5941 C  C   . PRO B 1 232 ? 17.810  9.659   -37.377 1.00 35.06  ? 232  PRO B C   1 
ATOM   5942 O  O   . PRO B 1 232 ? 18.711  8.860   -37.623 1.00 36.61  ? 232  PRO B O   1 
ATOM   5943 C  CB  . PRO B 1 232 ? 16.923  11.166  -39.157 1.00 31.88  ? 232  PRO B CB  1 
ATOM   5944 C  CG  . PRO B 1 232 ? 15.812  12.116  -38.808 1.00 25.14  ? 232  PRO B CG  1 
ATOM   5945 C  CD  . PRO B 1 232 ? 15.124  11.597  -37.595 1.00 28.69  ? 232  PRO B CD  1 
ATOM   5946 N  N   . ASN B 1 233 ? 17.767  10.388  -36.269 1.00 36.89  ? 233  ASN B N   1 
ATOM   5947 C  CA  . ASN B 1 233 ? 18.725  10.192  -35.196 1.00 37.80  ? 233  ASN B CA  1 
ATOM   5948 C  C   . ASN B 1 233 ? 18.340  8.939   -34.429 1.00 36.61  ? 233  ASN B C   1 
ATOM   5949 O  O   . ASN B 1 233 ? 17.289  8.352   -34.690 1.00 31.06  ? 233  ASN B O   1 
ATOM   5950 C  CB  . ASN B 1 233 ? 18.759  11.412  -34.268 1.00 30.17  ? 233  ASN B CB  1 
ATOM   5951 C  CG  . ASN B 1 233 ? 17.396  11.739  -33.674 1.00 32.82  ? 233  ASN B CG  1 
ATOM   5952 O  OD1 . ASN B 1 233 ? 16.477  12.150  -34.383 1.00 34.00  ? 233  ASN B OD1 1 
ATOM   5953 N  ND2 . ASN B 1 233 ? 17.267  11.569  -32.363 1.00 30.53  ? 233  ASN B ND2 1 
ATOM   5954 N  N   . GLY B 1 234 ? 19.187  8.523   -33.493 1.00 30.46  ? 234  GLY B N   1 
ATOM   5955 C  CA  . GLY B 1 234 ? 18.902  7.348   -32.686 1.00 29.41  ? 234  GLY B CA  1 
ATOM   5956 C  C   . GLY B 1 234 ? 19.689  6.116   -33.100 1.00 27.10  ? 234  GLY B C   1 
ATOM   5957 O  O   . GLY B 1 234 ? 20.438  6.154   -34.071 1.00 30.16  ? 234  GLY B O   1 
ATOM   5958 N  N   . PRO B 1 235 ? 19.497  5.005   -32.377 1.00 27.21  ? 235  PRO B N   1 
ATOM   5959 C  CA  . PRO B 1 235 ? 20.343  3.806   -32.464 1.00 40.52  ? 235  PRO B CA  1 
ATOM   5960 C  C   . PRO B 1 235 ? 20.125  2.903   -33.687 1.00 41.54  ? 235  PRO B C   1 
ATOM   5961 O  O   . PRO B 1 235 ? 21.028  2.135   -34.013 1.00 40.45  ? 235  PRO B O   1 
ATOM   5962 C  CB  . PRO B 1 235 ? 19.972  3.018   -31.196 1.00 39.83  ? 235  PRO B CB  1 
ATOM   5963 C  CG  . PRO B 1 235 ? 18.975  3.856   -30.445 1.00 33.33  ? 235  PRO B CG  1 
ATOM   5964 C  CD  . PRO B 1 235 ? 18.397  4.824   -31.420 1.00 30.99  ? 235  PRO B CD  1 
ATOM   5965 N  N   . TRP B 1 236 ? 18.970  2.974   -34.342 1.00 32.79  ? 236  TRP B N   1 
ATOM   5966 C  CA  . TRP B 1 236 ? 18.615  1.963   -35.342 1.00 26.02  ? 236  TRP B CA  1 
ATOM   5967 C  C   . TRP B 1 236 ? 18.437  2.460   -36.782 1.00 34.15  ? 236  TRP B C   1 
ATOM   5968 O  O   . TRP B 1 236 ? 18.450  1.660   -37.718 1.00 37.54  ? 236  TRP B O   1 
ATOM   5969 C  CB  . TRP B 1 236 ? 17.343  1.235   -34.906 1.00 27.55  ? 236  TRP B CB  1 
ATOM   5970 C  CG  . TRP B 1 236 ? 16.197  2.162   -34.669 1.00 32.21  ? 236  TRP B CG  1 
ATOM   5971 C  CD1 . TRP B 1 236 ? 15.822  2.718   -33.479 1.00 34.43  ? 236  TRP B CD1 1 
ATOM   5972 C  CD2 . TRP B 1 236 ? 15.280  2.657   -35.649 1.00 37.90  ? 236  TRP B CD2 1 
ATOM   5973 N  NE1 . TRP B 1 236 ? 14.724  3.524   -33.656 1.00 32.82  ? 236  TRP B NE1 1 
ATOM   5974 C  CE2 . TRP B 1 236 ? 14.371  3.505   -34.980 1.00 36.29  ? 236  TRP B CE2 1 
ATOM   5975 C  CE3 . TRP B 1 236 ? 15.131  2.462   -37.025 1.00 36.29  ? 236  TRP B CE3 1 
ATOM   5976 C  CZ2 . TRP B 1 236 ? 13.333  4.157   -35.641 1.00 32.22  ? 236  TRP B CZ2 1 
ATOM   5977 C  CZ3 . TRP B 1 236 ? 14.098  3.113   -37.682 1.00 31.08  ? 236  TRP B CZ3 1 
ATOM   5978 C  CH2 . TRP B 1 236 ? 13.213  3.949   -36.989 1.00 29.90  ? 236  TRP B CH2 1 
ATOM   5979 N  N   . ALA B 1 237 ? 18.271  3.767   -36.963 1.00 36.03  ? 237  ALA B N   1 
ATOM   5980 C  CA  . ALA B 1 237 ? 17.875  4.312   -38.265 1.00 35.90  ? 237  ALA B CA  1 
ATOM   5981 C  C   . ALA B 1 237 ? 19.013  4.455   -39.282 1.00 32.81  ? 237  ALA B C   1 
ATOM   5982 O  O   . ALA B 1 237 ? 18.775  4.478   -40.491 1.00 36.71  ? 237  ALA B O   1 
ATOM   5983 C  CB  . ALA B 1 237 ? 17.140  5.643   -38.088 1.00 28.70  ? 237  ALA B CB  1 
ATOM   5984 N  N   . THR B 1 238 ? 20.244  4.561   -38.804 1.00 33.78  ? 238  THR B N   1 
ATOM   5985 C  CA  . THR B 1 238 ? 21.380  4.665   -39.712 1.00 33.55  ? 238  THR B CA  1 
ATOM   5986 C  C   . THR B 1 238 ? 22.506  3.733   -39.301 1.00 31.50  ? 238  THR B C   1 
ATOM   5987 O  O   . THR B 1 238 ? 22.480  3.153   -38.222 1.00 32.39  ? 238  THR B O   1 
ATOM   5988 C  CB  . THR B 1 238 ? 21.938  6.109   -39.781 1.00 31.09  ? 238  THR B CB  1 
ATOM   5989 O  OG1 . THR B 1 238 ? 22.348  6.532   -38.476 1.00 36.09  ? 238  THR B OG1 1 
ATOM   5990 C  CG2 . THR B 1 238 ? 20.889  7.069   -40.316 1.00 30.06  ? 238  THR B CG2 1 
ATOM   5991 N  N   . VAL B 1 239 ? 23.486  3.585   -40.181 1.00 33.31  ? 239  VAL B N   1 
ATOM   5992 C  CA  . VAL B 1 239 ? 24.735  2.922   -39.841 1.00 32.32  ? 239  VAL B CA  1 
ATOM   5993 C  C   . VAL B 1 239 ? 25.862  3.667   -40.523 1.00 39.99  ? 239  VAL B C   1 
ATOM   5994 O  O   . VAL B 1 239 ? 25.634  4.419   -41.476 1.00 39.19  ? 239  VAL B O   1 
ATOM   5995 C  CB  . VAL B 1 239 ? 24.773  1.446   -40.288 1.00 35.24  ? 239  VAL B CB  1 
ATOM   5996 C  CG1 . VAL B 1 239 ? 23.913  0.578   -39.373 1.00 27.89  ? 239  VAL B CG1 1 
ATOM   5997 C  CG2 . VAL B 1 239 ? 24.355  1.315   -41.751 1.00 36.46  ? 239  VAL B CG2 1 
ATOM   5998 N  N   . SER B 1 240 ? 27.074  3.461   -40.023 1.00 43.33  ? 240  SER B N   1 
ATOM   5999 C  CA  . SER B 1 240 ? 28.262  4.063   -40.603 1.00 38.99  ? 240  SER B CA  1 
ATOM   6000 C  C   . SER B 1 240 ? 28.590  3.371   -41.914 1.00 40.39  ? 240  SER B C   1 
ATOM   6001 O  O   . SER B 1 240 ? 28.131  2.256   -42.169 1.00 35.53  ? 240  SER B O   1 
ATOM   6002 C  CB  . SER B 1 240 ? 29.440  3.897   -39.648 1.00 36.11  ? 240  SER B CB  1 
ATOM   6003 O  OG  . SER B 1 240 ? 29.641  2.522   -39.353 1.00 41.51  ? 240  SER B OG  1 
ATOM   6004 N  N   . ALA B 1 241 ? 29.398  4.027   -42.737 1.00 38.22  ? 241  ALA B N   1 
ATOM   6005 C  CA  . ALA B 1 241 ? 29.863  3.426   -43.977 1.00 33.45  ? 241  ALA B CA  1 
ATOM   6006 C  C   . ALA B 1 241 ? 30.552  2.104   -43.685 1.00 40.22  ? 241  ALA B C   1 
ATOM   6007 O  O   . ALA B 1 241 ? 30.372  1.123   -44.409 1.00 43.21  ? 241  ALA B O   1 
ATOM   6008 C  CB  . ALA B 1 241 ? 30.804  4.363   -44.697 1.00 33.98  ? 241  ALA B CB  1 
ATOM   6009 N  N   . GLY B 1 242 ? 31.332  2.083   -42.609 1.00 39.06  ? 242  GLY B N   1 
ATOM   6010 C  CA  . GLY B 1 242 ? 32.079  0.900   -42.226 1.00 30.12  ? 242  GLY B CA  1 
ATOM   6011 C  C   . GLY B 1 242 ? 31.193  -0.281  -41.894 1.00 36.12  ? 242  GLY B C   1 
ATOM   6012 O  O   . GLY B 1 242 ? 31.431  -1.400  -42.353 1.00 43.44  ? 242  GLY B O   1 
ATOM   6013 N  N   . GLU B 1 243 ? 30.163  -0.034  -41.093 1.00 37.75  ? 243  GLU B N   1 
ATOM   6014 C  CA  . GLU B 1 243 ? 29.251  -1.094  -40.684 1.00 38.34  ? 243  GLU B CA  1 
ATOM   6015 C  C   . GLU B 1 243 ? 28.412  -1.594  -41.860 1.00 36.50  ? 243  GLU B C   1 
ATOM   6016 O  O   . GLU B 1 243 ? 28.063  -2.771  -41.930 1.00 38.12  ? 243  GLU B O   1 
ATOM   6017 C  CB  . GLU B 1 243 ? 28.361  -0.618  -39.529 1.00 42.15  ? 243  GLU B CB  1 
ATOM   6018 C  CG  . GLU B 1 243 ? 27.374  -1.654  -39.016 1.00 33.61  ? 243  GLU B CG  1 
ATOM   6019 C  CD  . GLU B 1 243 ? 28.049  -2.912  -38.503 1.00 40.62  ? 243  GLU B CD  1 
ATOM   6020 O  OE1 . GLU B 1 243 ? 27.328  -3.851  -38.102 1.00 37.58  ? 243  GLU B OE1 1 
ATOM   6021 O  OE2 . GLU B 1 243 ? 29.296  -2.965  -38.501 1.00 45.67  ? 243  GLU B OE2 1 
ATOM   6022 N  N   . ALA B 1 244 ? 28.100  -0.694  -42.788 1.00 33.90  ? 244  ALA B N   1 
ATOM   6023 C  CA  . ALA B 1 244 ? 27.357  -1.060  -43.992 1.00 39.18  ? 244  ALA B CA  1 
ATOM   6024 C  C   . ALA B 1 244 ? 28.201  -1.971  -44.871 1.00 41.66  ? 244  ALA B C   1 
ATOM   6025 O  O   . ALA B 1 244 ? 27.767  -3.050  -45.269 1.00 37.96  ? 244  ALA B O   1 
ATOM   6026 C  CB  . ALA B 1 244 ? 26.950  0.182   -44.768 1.00 34.41  ? 244  ALA B CB  1 
ATOM   6027 N  N   . ARG B 1 245 ? 29.412  -1.521  -45.175 1.00 41.94  ? 245  ARG B N   1 
ATOM   6028 C  CA  . ARG B 1 245 ? 30.357  -2.323  -45.932 1.00 41.92  ? 245  ARG B CA  1 
ATOM   6029 C  C   . ARG B 1 245 ? 30.535  -3.687  -45.274 1.00 50.25  ? 245  ARG B C   1 
ATOM   6030 O  O   . ARG B 1 245 ? 30.606  -4.720  -45.948 1.00 45.20  ? 245  ARG B O   1 
ATOM   6031 C  CB  . ARG B 1 245 ? 31.695  -1.598  -46.019 1.00 45.25  ? 245  ARG B CB  1 
ATOM   6032 C  CG  . ARG B 1 245 ? 32.797  -2.397  -46.678 1.00 35.78  ? 245  ARG B CG  1 
ATOM   6033 C  CD  . ARG B 1 245 ? 33.937  -1.484  -47.079 1.00 26.03  ? 245  ARG B CD  1 
ATOM   6034 N  NE  . ARG B 1 245 ? 33.580  -0.616  -48.201 1.00 39.57  ? 245  ARG B NE  1 
ATOM   6035 C  CZ  . ARG B 1 245 ? 33.531  -1.027  -49.465 1.00 50.16  ? 245  ARG B CZ  1 
ATOM   6036 N  NH1 . ARG B 1 245 ? 33.203  -0.184  -50.437 1.00 39.69  ? 245  ARG B NH1 1 
ATOM   6037 N  NH2 . ARG B 1 245 ? 33.810  -2.292  -49.758 1.00 43.09  ? 245  ARG B NH2 1 
ATOM   6038 N  N   . ARG B 1 246 ? 30.587  -3.684  -43.948 1.00 40.97  ? 246  ARG B N   1 
ATOM   6039 C  CA  . ARG B 1 246 ? 30.803  -4.909  -43.197 1.00 39.62  ? 246  ARG B CA  1 
ATOM   6040 C  C   . ARG B 1 246 ? 29.659  -5.896  -43.406 1.00 44.76  ? 246  ARG B C   1 
ATOM   6041 O  O   . ARG B 1 246 ? 29.884  -7.084  -43.640 1.00 43.13  ? 246  ARG B O   1 
ATOM   6042 C  CB  . ARG B 1 246 ? 30.969  -4.597  -41.710 1.00 43.15  ? 246  ARG B CB  1 
ATOM   6043 C  CG  . ARG B 1 246 ? 31.321  -5.811  -40.884 1.00 37.34  ? 246  ARG B CG  1 
ATOM   6044 C  CD  . ARG B 1 246 ? 30.699  -5.753  -39.499 1.00 35.57  ? 246  ARG B CD  1 
ATOM   6045 N  NE  . ARG B 1 246 ? 30.206  -7.074  -39.138 1.00 47.45  ? 246  ARG B NE  1 
ATOM   6046 C  CZ  . ARG B 1 246 ? 28.948  -7.343  -38.807 1.00 45.79  ? 246  ARG B CZ  1 
ATOM   6047 N  NH1 . ARG B 1 246 ? 28.053  -6.369  -38.746 1.00 34.93  ? 246  ARG B NH1 1 
ATOM   6048 N  NH2 . ARG B 1 246 ? 28.595  -8.587  -38.508 1.00 55.32  ? 246  ARG B NH2 1 
ATOM   6049 N  N   . ARG B 1 247 ? 28.431  -5.396  -43.318 1.00 47.38  ? 247  ARG B N   1 
ATOM   6050 C  CA  . ARG B 1 247 ? 27.247  -6.246  -43.440 1.00 53.51  ? 247  ARG B CA  1 
ATOM   6051 C  C   . ARG B 1 247 ? 27.041  -6.738  -44.871 1.00 42.69  ? 247  ARG B C   1 
ATOM   6052 O  O   . ARG B 1 247 ? 26.611  -7.870  -45.096 1.00 39.82  ? 247  ARG B O   1 
ATOM   6053 C  CB  . ARG B 1 247 ? 26.002  -5.506  -42.946 1.00 39.18  ? 247  ARG B CB  1 
ATOM   6054 C  CG  . ARG B 1 247 ? 26.044  -5.157  -41.466 1.00 39.03  ? 247  ARG B CG  1 
ATOM   6055 C  CD  . ARG B 1 247 ? 24.855  -4.303  -41.066 1.00 31.97  ? 247  ARG B CD  1 
ATOM   6056 N  NE  . ARG B 1 247 ? 24.957  -3.832  -39.692 1.00 34.20  ? 247  ARG B NE  1 
ATOM   6057 C  CZ  . ARG B 1 247 ? 23.941  -3.324  -38.999 1.00 49.59  ? 247  ARG B CZ  1 
ATOM   6058 N  NH1 . ARG B 1 247 ? 22.739  -3.231  -39.556 1.00 34.96  ? 247  ARG B NH1 1 
ATOM   6059 N  NH2 . ARG B 1 247 ? 24.125  -2.917  -37.747 1.00 28.90  ? 247  ARG B NH2 1 
ATOM   6060 N  N   . ALA B 1 248 ? 27.350  -5.876  -45.833 1.00 40.82  ? 248  ALA B N   1 
ATOM   6061 C  CA  . ALA B 1 248 ? 27.209  -6.212  -47.244 1.00 46.39  ? 248  ALA B CA  1 
ATOM   6062 C  C   . ALA B 1 248 ? 28.160  -7.344  -47.618 1.00 51.54  ? 248  ALA B C   1 
ATOM   6063 O  O   . ALA B 1 248 ? 27.753  -8.338  -48.220 1.00 44.37  ? 248  ALA B O   1 
ATOM   6064 C  CB  . ALA B 1 248 ? 27.469  -4.984  -48.108 1.00 43.02  ? 248  ALA B CB  1 
ATOM   6065 N  N   . THR B 1 249 ? 29.429  -7.187  -47.253 1.00 50.60  ? 249  THR B N   1 
ATOM   6066 C  CA  . THR B 1 249 ? 30.430  -8.213  -47.512 1.00 43.56  ? 249  THR B CA  1 
ATOM   6067 C  C   . THR B 1 249 ? 30.037  -9.528  -46.844 1.00 39.45  ? 249  THR B C   1 
ATOM   6068 O  O   . THR B 1 249 ? 30.157  -10.600 -47.436 1.00 52.30  ? 249  THR B O   1 
ATOM   6069 C  CB  . THR B 1 249 ? 31.822  -7.777  -47.028 1.00 38.44  ? 249  THR B CB  1 
ATOM   6070 O  OG1 . THR B 1 249 ? 31.795  -7.593  -45.609 1.00 73.03  ? 249  THR B OG1 1 
ATOM   6071 C  CG2 . THR B 1 249 ? 32.228  -6.468  -47.691 1.00 39.66  ? 249  THR B CG2 1 
ATOM   6072 N  N   . LEU B 1 250 ? 29.554  -9.440  -45.611 1.00 43.57  ? 250  LEU B N   1 
ATOM   6073 C  CA  . LEU B 1 250 ? 29.156  -10.634 -44.881 1.00 52.30  ? 250  LEU B CA  1 
ATOM   6074 C  C   . LEU B 1 250 ? 27.983  -11.333 -45.562 1.00 50.86  ? 250  LEU B C   1 
ATOM   6075 O  O   . LEU B 1 250 ? 27.979  -12.558 -45.707 1.00 48.78  ? 250  LEU B O   1 
ATOM   6076 C  CB  . LEU B 1 250 ? 28.810  -10.306 -43.426 1.00 41.27  ? 250  LEU B CB  1 
ATOM   6077 C  CG  . LEU B 1 250 ? 28.276  -11.512 -42.651 1.00 44.56  ? 250  LEU B CG  1 
ATOM   6078 C  CD1 . LEU B 1 250 ? 29.244  -12.686 -42.763 1.00 37.80  ? 250  LEU B CD1 1 
ATOM   6079 C  CD2 . LEU B 1 250 ? 28.003  -11.167 -41.197 1.00 33.23  ? 250  LEU B CD2 1 
ATOM   6080 N  N   . LEU B 1 251 ? 26.988  -10.555 -45.978 1.00 50.31  ? 251  LEU B N   1 
ATOM   6081 C  CA  . LEU B 1 251 ? 25.840  -11.126 -46.670 1.00 46.67  ? 251  LEU B CA  1 
ATOM   6082 C  C   . LEU B 1 251 ? 26.289  -11.768 -47.978 1.00 47.50  ? 251  LEU B C   1 
ATOM   6083 O  O   . LEU B 1 251 ? 25.754  -12.796 -48.392 1.00 39.75  ? 251  LEU B O   1 
ATOM   6084 C  CB  . LEU B 1 251 ? 24.778  -10.067 -46.962 1.00 35.61  ? 251  LEU B CB  1 
ATOM   6085 C  CG  . LEU B 1 251 ? 23.661  -10.667 -47.815 1.00 43.51  ? 251  LEU B CG  1 
ATOM   6086 C  CD1 . LEU B 1 251 ? 22.477  -11.106 -46.956 1.00 40.83  ? 251  LEU B CD1 1 
ATOM   6087 C  CD2 . LEU B 1 251 ? 23.226  -9.707  -48.906 1.00 40.40  ? 251  LEU B CD2 1 
ATOM   6088 N  N   . ALA B 1 252 ? 27.271  -11.149 -48.628 1.00 42.19  ? 252  ALA B N   1 
ATOM   6089 C  CA  . ALA B 1 252 ? 27.790  -11.665 -49.886 1.00 45.39  ? 252  ALA B CA  1 
ATOM   6090 C  C   . ALA B 1 252 ? 28.452  -13.007 -49.632 1.00 55.18  ? 252  ALA B C   1 
ATOM   6091 O  O   . ALA B 1 252 ? 28.159  -13.998 -50.302 1.00 58.91  ? 252  ALA B O   1 
ATOM   6092 C  CB  . ALA B 1 252 ? 28.775  -10.691 -50.498 1.00 41.37  ? 252  ALA B CB  1 
ATOM   6093 N  N   . ARG B 1 253 ? 29.340  -13.035 -48.647 1.00 46.70  ? 253  ARG B N   1 
ATOM   6094 C  CA  . ARG B 1 253 ? 29.980  -14.277 -48.249 1.00 52.24  ? 253  ARG B CA  1 
ATOM   6095 C  C   . ARG B 1 253 ? 28.931  -15.351 -47.983 1.00 47.18  ? 253  ARG B C   1 
ATOM   6096 O  O   . ARG B 1 253 ? 29.086  -16.499 -48.398 1.00 54.07  ? 253  ARG B O   1 
ATOM   6097 C  CB  . ARG B 1 253 ? 30.866  -14.052 -47.018 1.00 55.61  ? 253  ARG B CB  1 
ATOM   6098 C  CG  . ARG B 1 253 ? 31.002  -15.258 -46.101 1.00 61.36  ? 253  ARG B CG  1 
ATOM   6099 C  CD  . ARG B 1 253 ? 32.179  -15.098 -45.143 1.00 66.39  ? 253  ARG B CD  1 
ATOM   6100 N  NE  . ARG B 1 253 ? 31.945  -15.645 -43.801 1.00 82.58  ? 253  ARG B NE  1 
ATOM   6101 C  CZ  . ARG B 1 253 ? 31.197  -16.711 -43.514 1.00 80.43  ? 253  ARG B CZ  1 
ATOM   6102 N  NH1 . ARG B 1 253 ? 30.594  -17.404 -44.470 1.00 78.67  ? 253  ARG B NH1 1 
ATOM   6103 N  NH2 . ARG B 1 253 ? 31.063  -17.096 -42.252 1.00 70.90  ? 253  ARG B NH2 1 
ATOM   6104 N  N   . LEU B 1 254 ? 27.852  -14.964 -47.312 1.00 45.85  ? 254  LEU B N   1 
ATOM   6105 C  CA  . LEU B 1 254 ? 26.812  -15.908 -46.916 1.00 49.22  ? 254  LEU B CA  1 
ATOM   6106 C  C   . LEU B 1 254 ? 26.055  -16.521 -48.095 1.00 54.74  ? 254  LEU B C   1 
ATOM   6107 O  O   . LEU B 1 254 ? 25.367  -17.534 -47.937 1.00 47.82  ? 254  LEU B O   1 
ATOM   6108 C  CB  . LEU B 1 254 ? 25.822  -15.242 -45.960 1.00 54.92  ? 254  LEU B CB  1 
ATOM   6109 C  CG  . LEU B 1 254 ? 26.300  -15.031 -44.528 1.00 56.82  ? 254  LEU B CG  1 
ATOM   6110 C  CD1 . LEU B 1 254 ? 25.296  -14.194 -43.749 1.00 51.49  ? 254  LEU B CD1 1 
ATOM   6111 C  CD2 . LEU B 1 254 ? 26.516  -16.380 -43.864 1.00 50.13  ? 254  LEU B CD2 1 
ATOM   6112 N  N   . VAL B 1 255 ? 26.167  -15.903 -49.266 1.00 50.29  ? 255  VAL B N   1 
ATOM   6113 C  CA  . VAL B 1 255 ? 25.480  -16.411 -50.451 1.00 49.90  ? 255  VAL B CA  1 
ATOM   6114 C  C   . VAL B 1 255 ? 26.462  -16.753 -51.567 1.00 53.87  ? 255  VAL B C   1 
ATOM   6115 O  O   . VAL B 1 255 ? 26.068  -16.909 -52.723 1.00 57.53  ? 255  VAL B O   1 
ATOM   6116 C  CB  . VAL B 1 255 ? 24.393  -15.431 -50.966 1.00 44.63  ? 255  VAL B CB  1 
ATOM   6117 C  CG1 . VAL B 1 255 ? 23.390  -15.129 -49.862 1.00 39.24  ? 255  VAL B CG1 1 
ATOM   6118 C  CG2 . VAL B 1 255 ? 25.019  -14.147 -51.495 1.00 38.29  ? 255  VAL B CG2 1 
ATOM   6119 N  N   . GLY B 1 256 ? 27.741  -16.860 -51.209 1.00 52.49  ? 256  GLY B N   1 
ATOM   6120 C  CA  . GLY B 1 256 ? 28.764  -17.351 -52.117 1.00 38.86  ? 256  GLY B CA  1 
ATOM   6121 C  C   . GLY B 1 256 ? 29.452  -16.309 -52.981 1.00 52.74  ? 256  GLY B C   1 
ATOM   6122 O  O   . GLY B 1 256 ? 30.025  -16.640 -54.019 1.00 58.96  ? 256  GLY B O   1 
ATOM   6123 N  N   . CYS B 1 257 ? 29.417  -15.053 -52.556 1.00 50.55  ? 257  CYS B N   1 
ATOM   6124 C  CA  . CYS B 1 257 ? 29.986  -13.980 -53.362 1.00 51.11  ? 257  CYS B CA  1 
ATOM   6125 C  C   . CYS B 1 257 ? 31.111  -13.246 -52.642 1.00 59.20  ? 257  CYS B C   1 
ATOM   6126 O  O   . CYS B 1 257 ? 31.611  -13.712 -51.621 1.00 74.37  ? 257  CYS B O   1 
ATOM   6127 C  CB  . CYS B 1 257 ? 28.886  -13.001 -53.785 1.00 50.08  ? 257  CYS B CB  1 
ATOM   6128 S  SG  . CYS B 1 257 ? 27.477  -13.785 -54.628 1.00 59.97  ? 257  CYS B SG  1 
ATOM   6129 N  N   . ASN B 1 265 ? 37.173  -6.513  -54.295 1.00 73.85  ? 265  ASN B N   1 
ATOM   6130 C  CA  . ASN B 1 265 ? 36.738  -5.620  -55.364 1.00 79.93  ? 265  ASN B CA  1 
ATOM   6131 C  C   . ASN B 1 265 ? 35.218  -5.497  -55.429 1.00 69.83  ? 265  ASN B C   1 
ATOM   6132 O  O   . ASN B 1 265 ? 34.521  -6.477  -55.704 1.00 60.81  ? 265  ASN B O   1 
ATOM   6133 C  CB  . ASN B 1 265 ? 37.278  -6.099  -56.711 1.00 80.93  ? 265  ASN B CB  1 
ATOM   6134 C  CG  . ASN B 1 265 ? 36.706  -5.319  -57.879 1.00 82.65  ? 265  ASN B CG  1 
ATOM   6135 O  OD1 . ASN B 1 265 ? 35.810  -5.796  -58.578 1.00 77.11  ? 265  ASN B OD1 1 
ATOM   6136 N  ND2 . ASN B 1 265 ? 37.215  -4.110  -58.093 1.00 81.30  ? 265  ASN B ND2 1 
ATOM   6137 N  N   . ASP B 1 266 ? 34.711  -4.291  -55.185 1.00 56.20  ? 266  ASP B N   1 
ATOM   6138 C  CA  . ASP B 1 266 ? 33.268  -4.058  -55.141 1.00 52.96  ? 266  ASP B CA  1 
ATOM   6139 C  C   . ASP B 1 266 ? 32.548  -4.606  -56.369 1.00 58.99  ? 266  ASP B C   1 
ATOM   6140 O  O   . ASP B 1 266 ? 31.639  -5.431  -56.251 1.00 46.01  ? 266  ASP B O   1 
ATOM   6141 C  CB  . ASP B 1 266 ? 32.970  -2.565  -54.996 1.00 45.65  ? 266  ASP B CB  1 
ATOM   6142 C  CG  . ASP B 1 266 ? 33.368  -2.017  -53.638 1.00 60.44  ? 266  ASP B CG  1 
ATOM   6143 O  OD1 . ASP B 1 266 ? 33.459  -2.814  -52.680 1.00 47.78  ? 266  ASP B OD1 1 
ATOM   6144 O  OD2 . ASP B 1 266 ? 33.582  -0.788  -53.531 1.00 61.20  ? 266  ASP B OD2 1 
ATOM   6145 N  N   . THR B 1 267 ? 32.964  -4.141  -57.544 1.00 56.56  ? 267  THR B N   1 
ATOM   6146 C  CA  . THR B 1 267 ? 32.295  -4.468  -58.798 1.00 47.00  ? 267  THR B CA  1 
ATOM   6147 C  C   . THR B 1 267 ? 31.971  -5.950  -58.944 1.00 55.28  ? 267  THR B C   1 
ATOM   6148 O  O   . THR B 1 267 ? 30.852  -6.326  -59.301 1.00 55.17  ? 267  THR B O   1 
ATOM   6149 C  CB  . THR B 1 267 ? 33.133  -4.020  -59.998 1.00 52.28  ? 267  THR B CB  1 
ATOM   6150 O  OG1 . THR B 1 267 ? 33.186  -2.588  -60.032 1.00 51.96  ? 267  THR B OG1 1 
ATOM   6151 C  CG2 . THR B 1 267 ? 32.518  -4.530  -61.293 1.00 48.64  ? 267  THR B CG2 1 
ATOM   6152 N  N   . GLU B 1 268 ? 32.953  -6.792  -58.662 1.00 54.04  ? 268  GLU B N   1 
ATOM   6153 C  CA  . GLU B 1 268 ? 32.775  -8.226  -58.823 1.00 55.53  ? 268  GLU B CA  1 
ATOM   6154 C  C   . GLU B 1 268 ? 31.854  -8.788  -57.749 1.00 51.34  ? 268  GLU B C   1 
ATOM   6155 O  O   . GLU B 1 268 ? 31.063  -9.697  -58.003 1.00 56.11  ? 268  GLU B O   1 
ATOM   6156 C  CB  . GLU B 1 268 ? 34.135  -8.934  -58.821 1.00 63.06  ? 268  GLU B CB  1 
ATOM   6157 C  CG  . GLU B 1 268 ? 35.007  -8.547  -60.016 1.00 88.57  ? 268  GLU B CG  1 
ATOM   6158 C  CD  . GLU B 1 268 ? 36.495  -8.687  -59.742 1.00 120.04 ? 268  GLU B CD  1 
ATOM   6159 O  OE1 . GLU B 1 268 ? 36.874  -9.558  -58.932 1.00 128.65 ? 268  GLU B OE1 1 
ATOM   6160 O  OE2 . GLU B 1 268 ? 37.284  -7.922  -60.341 1.00 114.23 ? 268  GLU B OE2 1 
ATOM   6161 N  N   . LEU B 1 269 ? 31.946  -8.235  -56.548 1.00 53.32  ? 269  LEU B N   1 
ATOM   6162 C  CA  . LEU B 1 269 ? 31.094  -8.684  -55.461 1.00 46.73  ? 269  LEU B CA  1 
ATOM   6163 C  C   . LEU B 1 269 ? 29.634  -8.347  -55.754 1.00 47.98  ? 269  LEU B C   1 
ATOM   6164 O  O   . LEU B 1 269 ? 28.740  -9.175  -55.566 1.00 44.75  ? 269  LEU B O   1 
ATOM   6165 C  CB  . LEU B 1 269 ? 31.541  -8.069  -54.135 1.00 48.31  ? 269  LEU B CB  1 
ATOM   6166 C  CG  . LEU B 1 269 ? 30.724  -8.511  -52.921 1.00 54.40  ? 269  LEU B CG  1 
ATOM   6167 C  CD1 . LEU B 1 269 ? 31.617  -8.766  -51.724 1.00 52.23  ? 269  LEU B CD1 1 
ATOM   6168 C  CD2 . LEU B 1 269 ? 29.644  -7.487  -52.597 1.00 51.32  ? 269  LEU B CD2 1 
ATOM   6169 N  N   . ILE B 1 270 ? 29.398  -7.133  -56.233 1.00 44.41  ? 270  ILE B N   1 
ATOM   6170 C  CA  . ILE B 1 270 ? 28.040  -6.689  -56.518 1.00 51.68  ? 270  ILE B CA  1 
ATOM   6171 C  C   . ILE B 1 270 ? 27.452  -7.428  -57.717 1.00 53.30  ? 270  ILE B C   1 
ATOM   6172 O  O   . ILE B 1 270 ? 26.265  -7.769  -57.728 1.00 48.02  ? 270  ILE B O   1 
ATOM   6173 C  CB  . ILE B 1 270 ? 27.987  -5.167  -56.726 1.00 50.82  ? 270  ILE B CB  1 
ATOM   6174 C  CG1 . ILE B 1 270 ? 28.164  -4.467  -55.380 1.00 47.08  ? 270  ILE B CG1 1 
ATOM   6175 C  CG2 . ILE B 1 270 ? 26.670  -4.760  -57.355 1.00 45.62  ? 270  ILE B CG2 1 
ATOM   6176 C  CD1 . ILE B 1 270 ? 28.988  -3.204  -55.448 1.00 57.49  ? 270  ILE B CD1 1 
ATOM   6177 N  N   . ALA B 1 271 ? 28.288  -7.690  -58.717 1.00 46.36  ? 271  ALA B N   1 
ATOM   6178 C  CA  . ALA B 1 271 ? 27.861  -8.470  -59.871 1.00 43.13  ? 271  ALA B CA  1 
ATOM   6179 C  C   . ALA B 1 271 ? 27.354  -9.838  -59.435 1.00 42.50  ? 271  ALA B C   1 
ATOM   6180 O  O   . ALA B 1 271 ? 26.275  -10.270 -59.843 1.00 44.79  ? 271  ALA B O   1 
ATOM   6181 C  CB  . ALA B 1 271 ? 28.989  -8.614  -60.858 1.00 42.17  ? 271  ALA B CB  1 
ATOM   6182 N  N   . CYS B 1 272 ? 28.130  -10.510 -58.593 1.00 38.48  ? 272  CYS B N   1 
ATOM   6183 C  CA  . CYS B 1 272 ? 27.730  -11.814 -58.076 1.00 42.07  ? 272  CYS B CA  1 
ATOM   6184 C  C   . CYS B 1 272 ? 26.409  -11.727 -57.308 1.00 43.91  ? 272  CYS B C   1 
ATOM   6185 O  O   . CYS B 1 272 ? 25.561  -12.618 -57.412 1.00 44.91  ? 272  CYS B O   1 
ATOM   6186 C  CB  . CYS B 1 272 ? 28.835  -12.420 -57.200 1.00 32.83  ? 272  CYS B CB  1 
ATOM   6187 S  SG  . CYS B 1 272 ? 28.417  -14.012 -56.436 1.00 56.57  ? 272  CYS B SG  1 
ATOM   6188 N  N   . LEU B 1 273 ? 26.236  -10.653 -56.539 1.00 45.82  ? 273  LEU B N   1 
ATOM   6189 C  CA  . LEU B 1 273 ? 24.995  -10.442 -55.794 1.00 43.57  ? 273  LEU B CA  1 
ATOM   6190 C  C   . LEU B 1 273 ? 23.817  -10.229 -56.742 1.00 43.83  ? 273  LEU B C   1 
ATOM   6191 O  O   . LEU B 1 273 ? 22.698  -10.661 -56.461 1.00 41.50  ? 273  LEU B O   1 
ATOM   6192 C  CB  . LEU B 1 273 ? 25.117  -9.254  -54.833 1.00 41.91  ? 273  LEU B CB  1 
ATOM   6193 C  CG  . LEU B 1 273 ? 25.894  -9.465  -53.530 1.00 40.80  ? 273  LEU B CG  1 
ATOM   6194 C  CD1 . LEU B 1 273 ? 26.013  -8.157  -52.765 1.00 39.83  ? 273  LEU B CD1 1 
ATOM   6195 C  CD2 . LEU B 1 273 ? 25.249  -10.537 -52.663 1.00 37.44  ? 273  LEU B CD2 1 
ATOM   6196 N  N   . ARG B 1 274 ? 24.077  -9.572  -57.868 1.00 40.95  ? 274  ARG B N   1 
ATOM   6197 C  CA  . ARG B 1 274 ? 23.037  -9.318  -58.862 1.00 44.48  ? 274  ARG B CA  1 
ATOM   6198 C  C   . ARG B 1 274 ? 22.515  -10.591 -59.538 1.00 43.39  ? 274  ARG B C   1 
ATOM   6199 O  O   . ARG B 1 274 ? 21.521  -10.548 -60.261 1.00 50.00  ? 274  ARG B O   1 
ATOM   6200 C  CB  . ARG B 1 274 ? 23.526  -8.314  -59.916 1.00 42.28  ? 274  ARG B CB  1 
ATOM   6201 C  CG  . ARG B 1 274 ? 23.431  -6.854  -59.482 1.00 37.41  ? 274  ARG B CG  1 
ATOM   6202 C  CD  . ARG B 1 274 ? 23.505  -5.913  -60.673 1.00 40.96  ? 274  ARG B CD  1 
ATOM   6203 N  NE  . ARG B 1 274 ? 24.868  -5.469  -60.946 1.00 50.61  ? 274  ARG B NE  1 
ATOM   6204 C  CZ  . ARG B 1 274 ? 25.349  -4.288  -60.567 1.00 74.57  ? 274  ARG B CZ  1 
ATOM   6205 N  NH1 . ARG B 1 274 ? 24.576  -3.430  -59.904 1.00 47.54  ? 274  ARG B NH1 1 
ATOM   6206 N  NH2 . ARG B 1 274 ? 26.602  -3.960  -60.851 1.00 89.50  ? 274  ARG B NH2 1 
ATOM   6207 N  N   . THR B 1 275 ? 23.173  -11.721 -59.292 1.00 36.43  ? 275  THR B N   1 
ATOM   6208 C  CA  . THR B 1 275 ? 22.797  -12.976 -59.940 1.00 36.30  ? 275  THR B CA  1 
ATOM   6209 C  C   . THR B 1 275 ? 21.962  -13.868 -59.026 1.00 43.00  ? 275  THR B C   1 
ATOM   6210 O  O   . THR B 1 275 ? 21.441  -14.896 -59.452 1.00 43.92  ? 275  THR B O   1 
ATOM   6211 C  CB  . THR B 1 275 ? 24.035  -13.787 -60.380 1.00 33.92  ? 275  THR B CB  1 
ATOM   6212 O  OG1 . THR B 1 275 ? 24.576  -14.485 -59.249 1.00 36.30  ? 275  THR B OG1 1 
ATOM   6213 C  CG2 . THR B 1 275 ? 25.102  -12.877 -60.979 1.00 28.53  ? 275  THR B CG2 1 
ATOM   6214 N  N   . ARG B 1 276 ? 21.843  -13.489 -57.763 1.00 41.73  ? 276  ARG B N   1 
ATOM   6215 C  CA  . ARG B 1 276 ? 21.129  -14.330 -56.813 1.00 43.20  ? 276  ARG B CA  1 
ATOM   6216 C  C   . ARG B 1 276 ? 19.625  -14.066 -56.817 1.00 40.36  ? 276  ARG B C   1 
ATOM   6217 O  O   . ARG B 1 276 ? 19.193  -12.917 -56.803 1.00 44.14  ? 276  ARG B O   1 
ATOM   6218 C  CB  . ARG B 1 276 ? 21.702  -14.141 -55.408 1.00 44.47  ? 276  ARG B CB  1 
ATOM   6219 C  CG  . ARG B 1 276 ? 23.161  -14.551 -55.284 1.00 45.07  ? 276  ARG B CG  1 
ATOM   6220 C  CD  . ARG B 1 276 ? 23.322  -16.067 -55.366 1.00 49.02  ? 276  ARG B CD  1 
ATOM   6221 N  NE  . ARG B 1 276 ? 24.710  -16.471 -55.166 1.00 53.53  ? 276  ARG B NE  1 
ATOM   6222 C  CZ  . ARG B 1 276 ? 25.589  -16.625 -56.150 1.00 54.40  ? 276  ARG B CZ  1 
ATOM   6223 N  NH1 . ARG B 1 276 ? 25.219  -16.412 -57.404 1.00 61.58  ? 276  ARG B NH1 1 
ATOM   6224 N  NH2 . ARG B 1 276 ? 26.836  -16.989 -55.882 1.00 48.25  ? 276  ARG B NH2 1 
ATOM   6225 N  N   . PRO B 1 277 ? 18.819  -15.136 -56.836 1.00 44.02  ? 277  PRO B N   1 
ATOM   6226 C  CA  . PRO B 1 277 ? 17.375  -14.945 -56.685 1.00 43.25  ? 277  PRO B CA  1 
ATOM   6227 C  C   . PRO B 1 277 ? 17.094  -14.074 -55.464 1.00 52.15  ? 277  PRO B C   1 
ATOM   6228 O  O   . PRO B 1 277 ? 17.800  -14.180 -54.456 1.00 41.15  ? 277  PRO B O   1 
ATOM   6229 C  CB  . PRO B 1 277 ? 16.853  -16.369 -56.452 1.00 44.59  ? 277  PRO B CB  1 
ATOM   6230 C  CG  . PRO B 1 277 ? 17.871  -17.255 -57.088 1.00 43.27  ? 277  PRO B CG  1 
ATOM   6231 C  CD  . PRO B 1 277 ? 19.192  -16.561 -56.901 1.00 42.00  ? 277  PRO B CD  1 
ATOM   6232 N  N   . ALA B 1 278 ? 16.078  -13.222 -55.557 1.00 48.35  ? 278  ALA B N   1 
ATOM   6233 C  CA  . ALA B 1 278 ? 15.766  -12.281 -54.487 1.00 44.26  ? 278  ALA B CA  1 
ATOM   6234 C  C   . ALA B 1 278 ? 15.728  -12.951 -53.116 1.00 49.14  ? 278  ALA B C   1 
ATOM   6235 O  O   . ALA B 1 278 ? 16.306  -12.442 -52.151 1.00 41.01  ? 278  ALA B O   1 
ATOM   6236 C  CB  . ALA B 1 278 ? 14.449  -11.582 -54.766 1.00 36.57  ? 278  ALA B CB  1 
ATOM   6237 N  N   . GLN B 1 279 ? 15.060  -14.099 -53.044 1.00 48.43  ? 279  GLN B N   1 
ATOM   6238 C  CA  . GLN B 1 279 ? 14.808  -14.769 -51.771 1.00 43.19  ? 279  GLN B CA  1 
ATOM   6239 C  C   . GLN B 1 279 ? 16.069  -15.348 -51.131 1.00 45.39  ? 279  GLN B C   1 
ATOM   6240 O  O   . GLN B 1 279 ? 16.067  -15.681 -49.949 1.00 41.38  ? 279  GLN B O   1 
ATOM   6241 C  CB  . GLN B 1 279 ? 13.749  -15.859 -51.935 1.00 40.60  ? 279  GLN B CB  1 
ATOM   6242 C  CG  . GLN B 1 279 ? 13.353  -16.537 -50.634 1.00 41.37  ? 279  GLN B CG  1 
ATOM   6243 C  CD  . GLN B 1 279 ? 12.540  -15.638 -49.724 1.00 45.87  ? 279  GLN B CD  1 
ATOM   6244 O  OE1 . GLN B 1 279 ? 11.611  -14.963 -50.168 1.00 42.68  ? 279  GLN B OE1 1 
ATOM   6245 N  NE2 . GLN B 1 279 ? 12.877  -15.634 -48.439 1.00 42.41  ? 279  GLN B NE2 1 
ATOM   6246 N  N   . ASP B 1 280 ? 17.141  -15.475 -51.906 1.00 41.23  ? 280  ASP B N   1 
ATOM   6247 C  CA  . ASP B 1 280 ? 18.419  -15.891 -51.339 1.00 41.36  ? 280  ASP B CA  1 
ATOM   6248 C  C   . ASP B 1 280 ? 18.923  -14.787 -50.419 1.00 45.69  ? 280  ASP B C   1 
ATOM   6249 O  O   . ASP B 1 280 ? 19.271  -15.033 -49.263 1.00 51.13  ? 280  ASP B O   1 
ATOM   6250 C  CB  . ASP B 1 280 ? 19.454  -16.166 -52.435 1.00 41.20  ? 280  ASP B CB  1 
ATOM   6251 C  CG  . ASP B 1 280 ? 19.181  -17.456 -53.195 1.00 59.51  ? 280  ASP B CG  1 
ATOM   6252 O  OD1 . ASP B 1 280 ? 18.125  -18.090 -52.958 1.00 55.64  ? 280  ASP B OD1 1 
ATOM   6253 O  OD2 . ASP B 1 280 ? 20.029  -17.836 -54.033 1.00 56.11  ? 280  ASP B OD2 1 
ATOM   6254 N  N   . LEU B 1 281 ? 18.959  -13.568 -50.949 1.00 42.06  ? 281  LEU B N   1 
ATOM   6255 C  CA  . LEU B 1 281 ? 19.362  -12.390 -50.190 1.00 40.04  ? 281  LEU B CA  1 
ATOM   6256 C  C   . LEU B 1 281 ? 18.508  -12.213 -48.932 1.00 39.03  ? 281  LEU B C   1 
ATOM   6257 O  O   . LEU B 1 281 ? 19.033  -12.058 -47.834 1.00 35.36  ? 281  LEU B O   1 
ATOM   6258 C  CB  . LEU B 1 281 ? 19.293  -11.144 -51.077 1.00 36.36  ? 281  LEU B CB  1 
ATOM   6259 C  CG  . LEU B 1 281 ? 20.522  -10.817 -51.938 1.00 34.59  ? 281  LEU B CG  1 
ATOM   6260 C  CD1 . LEU B 1 281 ? 21.376  -12.041 -52.211 1.00 31.92  ? 281  LEU B CD1 1 
ATOM   6261 C  CD2 . LEU B 1 281 ? 20.121  -10.131 -53.236 1.00 32.67  ? 281  LEU B CD2 1 
ATOM   6262 N  N   . VAL B 1 282 ? 17.191  -12.254 -49.088 1.00 36.84  ? 282  VAL B N   1 
ATOM   6263 C  CA  . VAL B 1 282 ? 16.305  -12.143 -47.936 1.00 36.08  ? 282  VAL B CA  1 
ATOM   6264 C  C   . VAL B 1 282 ? 16.619  -13.206 -46.877 1.00 45.38  ? 282  VAL B C   1 
ATOM   6265 O  O   . VAL B 1 282 ? 16.603  -12.926 -45.678 1.00 46.49  ? 282  VAL B O   1 
ATOM   6266 C  CB  . VAL B 1 282 ? 14.832  -12.237 -48.361 1.00 35.88  ? 282  VAL B CB  1 
ATOM   6267 C  CG1 . VAL B 1 282 ? 13.925  -12.400 -47.146 1.00 37.77  ? 282  VAL B CG1 1 
ATOM   6268 C  CG2 . VAL B 1 282 ? 14.445  -11.011 -49.171 1.00 35.57  ? 282  VAL B CG2 1 
ATOM   6269 N  N   . ASP B 1 283 ? 16.917  -14.419 -47.331 1.00 44.49  ? 283  ASP B N   1 
ATOM   6270 C  CA  . ASP B 1 283 ? 17.203  -15.543 -46.441 1.00 41.39  ? 283  ASP B CA  1 
ATOM   6271 C  C   . ASP B 1 283 ? 18.343  -15.282 -45.457 1.00 48.97  ? 283  ASP B C   1 
ATOM   6272 O  O   . ASP B 1 283 ? 18.341  -15.819 -44.352 1.00 47.55  ? 283  ASP B O   1 
ATOM   6273 C  CB  . ASP B 1 283 ? 17.527  -16.802 -47.257 1.00 44.24  ? 283  ASP B CB  1 
ATOM   6274 C  CG  . ASP B 1 283 ? 16.283  -17.544 -47.716 1.00 45.75  ? 283  ASP B CG  1 
ATOM   6275 O  OD1 . ASP B 1 283 ? 15.173  -17.184 -47.269 1.00 49.34  ? 283  ASP B OD1 1 
ATOM   6276 O  OD2 . ASP B 1 283 ? 16.420  -18.491 -48.523 1.00 50.43  ? 283  ASP B OD2 1 
ATOM   6277 N  N   . HIS B 1 284 ? 19.319  -14.472 -45.860 1.00 47.20  ? 284  HIS B N   1 
ATOM   6278 C  CA  . HIS B 1 284 ? 20.506  -14.237 -45.035 1.00 52.03  ? 284  HIS B CA  1 
ATOM   6279 C  C   . HIS B 1 284 ? 20.588  -12.821 -44.477 1.00 46.69  ? 284  HIS B C   1 
ATOM   6280 O  O   . HIS B 1 284 ? 21.456  -12.508 -43.664 1.00 46.44  ? 284  HIS B O   1 
ATOM   6281 C  CB  . HIS B 1 284 ? 21.772  -14.562 -45.825 1.00 53.93  ? 284  HIS B CB  1 
ATOM   6282 C  CG  . HIS B 1 284 ? 22.068  -16.025 -45.898 1.00 63.77  ? 284  HIS B CG  1 
ATOM   6283 N  ND1 . HIS B 1 284 ? 21.724  -16.801 -46.984 1.00 54.10  ? 284  HIS B ND1 1 
ATOM   6284 C  CD2 . HIS B 1 284 ? 22.654  -16.860 -45.008 1.00 64.41  ? 284  HIS B CD2 1 
ATOM   6285 C  CE1 . HIS B 1 284 ? 22.096  -18.049 -46.764 1.00 60.93  ? 284  HIS B CE1 1 
ATOM   6286 N  NE2 . HIS B 1 284 ? 22.662  -18.112 -45.572 1.00 70.12  ? 284  HIS B NE2 1 
ATOM   6287 N  N   . GLU B 1 285 ? 19.672  -11.982 -44.938 1.00 49.17  ? 285  GLU B N   1 
ATOM   6288 C  CA  . GLU B 1 285 ? 19.537  -10.591 -44.529 1.00 47.22  ? 285  GLU B CA  1 
ATOM   6289 C  C   . GLU B 1 285 ? 19.763  -10.368 -43.034 1.00 46.55  ? 285  GLU B C   1 
ATOM   6290 O  O   . GLU B 1 285 ? 20.601  -9.565  -42.620 1.00 37.27  ? 285  GLU B O   1 
ATOM   6291 C  CB  . GLU B 1 285 ? 18.114  -10.167 -44.861 1.00 41.00  ? 285  GLU B CB  1 
ATOM   6292 C  CG  . GLU B 1 285 ? 17.931  -8.731  -45.231 1.00 42.39  ? 285  GLU B CG  1 
ATOM   6293 C  CD  . GLU B 1 285 ? 16.474  -8.412  -45.471 1.00 48.54  ? 285  GLU B CD  1 
ATOM   6294 O  OE1 . GLU B 1 285 ? 15.605  -9.148  -44.947 1.00 39.62  ? 285  GLU B OE1 1 
ATOM   6295 O  OE2 . GLU B 1 285 ? 16.199  -7.428  -46.184 1.00 56.49  ? 285  GLU B OE2 1 
ATOM   6296 N  N   . TRP B 1 286 ? 18.995  -11.100 -42.239 1.00 30.14  ? 286  TRP B N   1 
ATOM   6297 C  CA  . TRP B 1 286 ? 18.877  -10.881 -40.809 1.00 32.62  ? 286  TRP B CA  1 
ATOM   6298 C  C   . TRP B 1 286 ? 20.068  -11.438 -40.033 1.00 51.07  ? 286  TRP B C   1 
ATOM   6299 O  O   . TRP B 1 286 ? 20.222  -11.175 -38.841 1.00 54.81  ? 286  TRP B O   1 
ATOM   6300 C  CB  . TRP B 1 286 ? 17.594  -11.557 -40.342 1.00 36.86  ? 286  TRP B CB  1 
ATOM   6301 C  CG  . TRP B 1 286 ? 17.053  -11.108 -39.028 1.00 53.13  ? 286  TRP B CG  1 
ATOM   6302 C  CD1 . TRP B 1 286 ? 17.682  -10.348 -38.085 1.00 42.10  ? 286  TRP B CD1 1 
ATOM   6303 C  CD2 . TRP B 1 286 ? 15.767  -11.434 -38.491 1.00 49.04  ? 286  TRP B CD2 1 
ATOM   6304 N  NE1 . TRP B 1 286 ? 16.857  -10.169 -37.001 1.00 37.11  ? 286  TRP B NE1 1 
ATOM   6305 C  CE2 . TRP B 1 286 ? 15.679  -10.829 -37.225 1.00 37.49  ? 286  TRP B CE2 1 
ATOM   6306 C  CE3 . TRP B 1 286 ? 14.678  -12.173 -38.967 1.00 40.53  ? 286  TRP B CE3 1 
ATOM   6307 C  CZ2 . TRP B 1 286 ? 14.546  -10.948 -36.421 1.00 48.89  ? 286  TRP B CZ2 1 
ATOM   6308 C  CZ3 . TRP B 1 286 ? 13.552  -12.285 -38.171 1.00 44.83  ? 286  TRP B CZ3 1 
ATOM   6309 C  CH2 . TRP B 1 286 ? 13.495  -11.675 -36.912 1.00 48.08  ? 286  TRP B CH2 1 
ATOM   6310 N  N   . HIS B 1 287 ? 20.918  -12.204 -40.704 1.00 46.15  ? 287  HIS B N   1 
ATOM   6311 C  CA  . HIS B 1 287 ? 22.008  -12.864 -40.002 1.00 44.25  ? 287  HIS B CA  1 
ATOM   6312 C  C   . HIS B 1 287 ? 23.296  -12.046 -39.954 1.00 48.13  ? 287  HIS B C   1 
ATOM   6313 O  O   . HIS B 1 287 ? 24.308  -12.526 -39.447 1.00 43.31  ? 287  HIS B O   1 
ATOM   6314 C  CB  . HIS B 1 287 ? 22.277  -14.250 -40.594 1.00 56.62  ? 287  HIS B CB  1 
ATOM   6315 C  CG  . HIS B 1 287 ? 21.106  -15.178 -40.511 1.00 62.19  ? 287  HIS B CG  1 
ATOM   6316 N  ND1 . HIS B 1 287 ? 20.854  -16.146 -41.459 1.00 62.29  ? 287  HIS B ND1 1 
ATOM   6317 C  CD2 . HIS B 1 287 ? 20.111  -15.278 -39.597 1.00 63.44  ? 287  HIS B CD2 1 
ATOM   6318 C  CE1 . HIS B 1 287 ? 19.758  -16.807 -41.128 1.00 82.02  ? 287  HIS B CE1 1 
ATOM   6319 N  NE2 . HIS B 1 287 ? 19.287  -16.298 -40.003 1.00 74.92  ? 287  HIS B NE2 1 
ATOM   6320 N  N   . VAL B 1 288 ? 23.264  -10.817 -40.469 1.00 43.97  ? 288  VAL B N   1 
ATOM   6321 C  CA  . VAL B 1 288 ? 24.459  -9.969  -40.460 1.00 41.81  ? 288  VAL B CA  1 
ATOM   6322 C  C   . VAL B 1 288 ? 24.542  -9.011  -39.269 1.00 43.10  ? 288  VAL B C   1 
ATOM   6323 O  O   . VAL B 1 288 ? 25.522  -8.279  -39.135 1.00 47.30  ? 288  VAL B O   1 
ATOM   6324 C  CB  . VAL B 1 288 ? 24.623  -9.149  -41.764 1.00 42.46  ? 288  VAL B CB  1 
ATOM   6325 C  CG1 . VAL B 1 288 ? 24.779  -10.072 -42.966 1.00 37.82  ? 288  VAL B CG1 1 
ATOM   6326 C  CG2 . VAL B 1 288 ? 23.459  -8.179  -41.945 1.00 38.85  ? 288  VAL B CG2 1 
ATOM   6327 N  N   . LEU B 1 289 ? 23.524  -9.009  -38.413 1.00 38.52  ? 289  LEU B N   1 
ATOM   6328 C  CA  . LEU B 1 289 ? 23.539  -8.151  -37.229 1.00 40.77  ? 289  LEU B CA  1 
ATOM   6329 C  C   . LEU B 1 289 ? 24.695  -8.512  -36.293 1.00 43.73  ? 289  LEU B C   1 
ATOM   6330 O  O   . LEU B 1 289 ? 24.930  -9.686  -36.013 1.00 48.45  ? 289  LEU B O   1 
ATOM   6331 C  CB  . LEU B 1 289 ? 22.200  -8.216  -36.486 1.00 38.93  ? 289  LEU B CB  1 
ATOM   6332 C  CG  . LEU B 1 289 ? 21.011  -7.542  -37.181 1.00 43.26  ? 289  LEU B CG  1 
ATOM   6333 C  CD1 . LEU B 1 289 ? 19.714  -7.812  -36.434 1.00 30.12  ? 289  LEU B CD1 1 
ATOM   6334 C  CD2 . LEU B 1 289 ? 21.238  -6.044  -37.350 1.00 31.22  ? 289  LEU B CD2 1 
ATOM   6335 N  N   . PRO B 1 290 ? 25.413  -7.491  -35.800 1.00 48.72  ? 290  PRO B N   1 
ATOM   6336 C  CA  . PRO B 1 290 ? 26.601  -7.639  -34.948 1.00 47.31  ? 290  PRO B CA  1 
ATOM   6337 C  C   . PRO B 1 290 ? 26.311  -8.325  -33.614 1.00 51.22  ? 290  PRO B C   1 
ATOM   6338 O  O   . PRO B 1 290 ? 27.203  -8.962  -33.057 1.00 53.33  ? 290  PRO B O   1 
ATOM   6339 C  CB  . PRO B 1 290 ? 27.025  -6.190  -34.682 1.00 46.39  ? 290  PRO B CB  1 
ATOM   6340 C  CG  . PRO B 1 290 ? 26.340  -5.378  -35.723 1.00 46.11  ? 290  PRO B CG  1 
ATOM   6341 C  CD  . PRO B 1 290 ? 25.055  -6.078  -35.994 1.00 48.60  ? 290  PRO B CD  1 
ATOM   6342 N  N   . GLN B 1 291 ? 25.093  -8.185  -33.102 1.00 38.71  ? 291  GLN B N   1 
ATOM   6343 C  CA  . GLN B 1 291 ? 24.756  -8.737  -31.797 1.00 40.82  ? 291  GLN B CA  1 
ATOM   6344 C  C   . GLN B 1 291 ? 23.367  -9.344  -31.810 1.00 39.35  ? 291  GLN B C   1 
ATOM   6345 O  O   . GLN B 1 291 ? 22.597  -9.130  -32.742 1.00 45.87  ? 291  GLN B O   1 
ATOM   6346 C  CB  . GLN B 1 291 ? 24.808  -7.653  -30.707 1.00 44.23  ? 291  GLN B CB  1 
ATOM   6347 C  CG  . GLN B 1 291 ? 26.147  -6.937  -30.550 1.00 39.17  ? 291  GLN B CG  1 
ATOM   6348 C  CD  . GLN B 1 291 ? 26.172  -5.570  -31.219 1.00 60.44  ? 291  GLN B CD  1 
ATOM   6349 O  OE1 . GLN B 1 291 ? 27.216  -4.915  -31.281 1.00 46.12  ? 291  GLN B OE1 1 
ATOM   6350 N  NE2 . GLN B 1 291 ? 25.018  -5.130  -31.715 1.00 68.39  ? 291  GLN B NE2 1 
ATOM   6351 N  N   . GLU B 1 292 ? 23.051  -10.108 -30.771 1.00 39.45  ? 292  GLU B N   1 
ATOM   6352 C  CA  . GLU B 1 292 ? 21.682  -10.531 -30.560 1.00 49.28  ? 292  GLU B CA  1 
ATOM   6353 C  C   . GLU B 1 292 ? 20.956  -9.297  -30.066 1.00 50.65  ? 292  GLU B C   1 
ATOM   6354 O  O   . GLU B 1 292 ? 21.315  -8.724  -29.036 1.00 50.06  ? 292  GLU B O   1 
ATOM   6355 C  CB  . GLU B 1 292 ? 21.580  -11.656 -29.526 1.00 38.16  ? 292  GLU B CB  1 
ATOM   6356 C  CG  . GLU B 1 292 ? 20.308  -12.483 -29.695 1.00 67.79  ? 292  GLU B CG  1 
ATOM   6357 C  CD  . GLU B 1 292 ? 19.774  -13.056 -28.392 1.00 96.45  ? 292  GLU B CD  1 
ATOM   6358 O  OE1 . GLU B 1 292 ? 20.578  -13.326 -27.471 1.00 79.68  ? 292  GLU B OE1 1 
ATOM   6359 O  OE2 . GLU B 1 292 ? 18.539  -13.242 -28.298 1.00 83.20  ? 292  GLU B OE2 1 
ATOM   6360 N  N   . SER B 1 293 ? 19.949  -8.870  -30.813 1.00 43.22  ? 293  SER B N   1 
ATOM   6361 C  CA  . SER B 1 293 ? 19.287  -7.619  -30.504 1.00 34.02  ? 293  SER B CA  1 
ATOM   6362 C  C   . SER B 1 293 ? 17.807  -7.663  -30.820 1.00 39.39  ? 293  SER B C   1 
ATOM   6363 O  O   . SER B 1 293 ? 17.312  -8.623  -31.401 1.00 45.42  ? 293  SER B O   1 
ATOM   6364 C  CB  . SER B 1 293 ? 19.960  -6.475  -31.263 1.00 36.98  ? 293  SER B CB  1 
ATOM   6365 O  OG  . SER B 1 293 ? 20.495  -6.918  -32.495 1.00 38.52  ? 293  SER B OG  1 
ATOM   6366 N  N   . ILE B 1 294 ? 17.098  -6.631  -30.385 1.00 44.07  ? 294  ILE B N   1 
ATOM   6367 C  CA  . ILE B 1 294 ? 15.781  -6.335  -30.913 1.00 35.06  ? 294  ILE B CA  1 
ATOM   6368 C  C   . ILE B 1 294 ? 15.820  -4.874  -31.310 1.00 36.94  ? 294  ILE B C   1 
ATOM   6369 O  O   . ILE B 1 294 ? 16.783  -4.174  -30.999 1.00 41.78  ? 294  ILE B O   1 
ATOM   6370 C  CB  . ILE B 1 294 ? 14.659  -6.600  -29.902 1.00 35.91  ? 294  ILE B CB  1 
ATOM   6371 C  CG1 . ILE B 1 294 ? 14.985  -5.962  -28.551 1.00 38.20  ? 294  ILE B CG1 1 
ATOM   6372 C  CG2 . ILE B 1 294 ? 14.432  -8.098  -29.742 1.00 36.94  ? 294  ILE B CG2 1 
ATOM   6373 C  CD1 . ILE B 1 294 ? 13.792  -5.897  -27.606 1.00 24.64  ? 294  ILE B CD1 1 
ATOM   6374 N  N   . PHE B 1 295 ? 14.783  -4.422  -32.002 1.00 34.52  ? 295  PHE B N   1 
ATOM   6375 C  CA  . PHE B 1 295 ? 14.737  -3.071  -32.555 1.00 30.29  ? 295  PHE B CA  1 
ATOM   6376 C  C   . PHE B 1 295 ? 16.030  -2.691  -33.263 1.00 34.16  ? 295  PHE B C   1 
ATOM   6377 O  O   . PHE B 1 295 ? 16.557  -1.587  -33.085 1.00 33.48  ? 295  PHE B O   1 
ATOM   6378 C  CB  . PHE B 1 295 ? 14.400  -2.028  -31.489 1.00 27.74  ? 295  PHE B CB  1 
ATOM   6379 C  CG  . PHE B 1 295 ? 13.499  -0.941  -31.993 1.00 34.70  ? 295  PHE B CG  1 
ATOM   6380 C  CD1 . PHE B 1 295 ? 13.788  -0.281  -33.174 1.00 28.66  ? 295  PHE B CD1 1 
ATOM   6381 C  CD2 . PHE B 1 295 ? 12.349  -0.598  -31.302 1.00 29.50  ? 295  PHE B CD2 1 
ATOM   6382 C  CE1 . PHE B 1 295 ? 12.955  0.706   -33.651 1.00 33.18  ? 295  PHE B CE1 1 
ATOM   6383 C  CE2 . PHE B 1 295 ? 11.518  0.392   -31.770 1.00 30.46  ? 295  PHE B CE2 1 
ATOM   6384 C  CZ  . PHE B 1 295 ? 11.820  1.044   -32.952 1.00 31.52  ? 295  PHE B CZ  1 
ATOM   6385 N  N   . ARG B 1 296 ? 16.531  -3.614  -34.072 1.00 33.11  ? 296  ARG B N   1 
ATOM   6386 C  CA  . ARG B 1 296 ? 17.748  -3.379  -34.827 1.00 31.84  ? 296  ARG B CA  1 
ATOM   6387 C  C   . ARG B 1 296 ? 17.659  -4.101  -36.177 1.00 29.45  ? 296  ARG B C   1 
ATOM   6388 O  O   . ARG B 1 296 ? 17.232  -5.250  -36.250 1.00 35.37  ? 296  ARG B O   1 
ATOM   6389 C  CB  . ARG B 1 296 ? 18.968  -3.833  -34.023 1.00 28.85  ? 296  ARG B CB  1 
ATOM   6390 C  CG  . ARG B 1 296 ? 20.214  -3.011  -34.302 1.00 47.86  ? 296  ARG B CG  1 
ATOM   6391 C  CD  . ARG B 1 296 ? 20.638  -2.166  -33.109 1.00 39.97  ? 296  ARG B CD  1 
ATOM   6392 N  NE  . ARG B 1 296 ? 19.515  -1.562  -32.408 1.00 41.30  ? 296  ARG B NE  1 
ATOM   6393 C  CZ  . ARG B 1 296 ? 19.639  -0.755  -31.358 1.00 45.99  ? 296  ARG B CZ  1 
ATOM   6394 N  NH1 . ARG B 1 296 ? 20.841  -0.445  -30.886 1.00 41.29  ? 296  ARG B NH1 1 
ATOM   6395 N  NH2 . ARG B 1 296 ? 18.559  -0.260  -30.780 1.00 35.02  ? 296  ARG B NH2 1 
ATOM   6396 N  N   . PHE B 1 297 ? 18.051  -3.416  -37.244 1.00 28.95  ? 297  PHE B N   1 
ATOM   6397 C  CA  . PHE B 1 297 ? 17.773  -3.891  -38.593 1.00 29.44  ? 297  PHE B CA  1 
ATOM   6398 C  C   . PHE B 1 297 ? 19.016  -3.880  -39.472 1.00 38.86  ? 297  PHE B C   1 
ATOM   6399 O  O   . PHE B 1 297 ? 19.869  -3.002  -39.349 1.00 36.73  ? 297  PHE B O   1 
ATOM   6400 C  CB  . PHE B 1 297 ? 16.645  -3.058  -39.203 1.00 28.70  ? 297  PHE B CB  1 
ATOM   6401 C  CG  . PHE B 1 297 ? 15.546  -2.758  -38.229 1.00 34.62  ? 297  PHE B CG  1 
ATOM   6402 C  CD1 . PHE B 1 297 ? 14.677  -3.756  -37.822 1.00 29.13  ? 297  PHE B CD1 1 
ATOM   6403 C  CD2 . PHE B 1 297 ? 15.403  -1.489  -37.690 1.00 34.13  ? 297  PHE B CD2 1 
ATOM   6404 C  CE1 . PHE B 1 297 ? 13.676  -3.492  -36.912 1.00 35.25  ? 297  PHE B CE1 1 
ATOM   6405 C  CE2 . PHE B 1 297 ? 14.403  -1.219  -36.778 1.00 33.21  ? 297  PHE B CE2 1 
ATOM   6406 C  CZ  . PHE B 1 297 ? 13.537  -2.220  -36.389 1.00 30.01  ? 297  PHE B CZ  1 
ATOM   6407 N  N   . SER B 1 298 ? 19.105  -4.863  -40.362 1.00 32.77  ? 298  SER B N   1 
ATOM   6408 C  CA  . SER B 1 298 ? 20.352  -5.155  -41.060 1.00 33.60  ? 298  SER B CA  1 
ATOM   6409 C  C   . SER B 1 298 ? 20.730  -4.152  -42.139 1.00 32.58  ? 298  SER B C   1 
ATOM   6410 O  O   . SER B 1 298 ? 21.901  -3.799  -42.276 1.00 37.76  ? 298  SER B O   1 
ATOM   6411 C  CB  . SER B 1 298 ? 20.316  -6.565  -41.645 1.00 38.14  ? 298  SER B CB  1 
ATOM   6412 O  OG  . SER B 1 298 ? 20.310  -7.533  -40.611 1.00 43.96  ? 298  SER B OG  1 
ATOM   6413 N  N   . PHE B 1 299 ? 19.751  -3.701  -42.911 1.00 34.88  ? 299  PHE B N   1 
ATOM   6414 C  CA  . PHE B 1 299 ? 20.042  -2.797  -44.017 1.00 34.21  ? 299  PHE B CA  1 
ATOM   6415 C  C   . PHE B 1 299 ? 19.167  -1.563  -43.977 1.00 36.61  ? 299  PHE B C   1 
ATOM   6416 O  O   . PHE B 1 299 ? 17.987  -1.602  -44.320 1.00 36.56  ? 299  PHE B O   1 
ATOM   6417 C  CB  . PHE B 1 299 ? 19.941  -3.527  -45.353 1.00 33.05  ? 299  PHE B CB  1 
ATOM   6418 C  CG  . PHE B 1 299 ? 20.896  -4.667  -45.465 1.00 35.95  ? 299  PHE B CG  1 
ATOM   6419 C  CD1 . PHE B 1 299 ? 22.188  -4.461  -45.916 1.00 33.39  ? 299  PHE B CD1 1 
ATOM   6420 C  CD2 . PHE B 1 299 ? 20.517  -5.943  -45.070 1.00 38.41  ? 299  PHE B CD2 1 
ATOM   6421 C  CE1 . PHE B 1 299 ? 23.080  -5.515  -45.997 1.00 37.24  ? 299  PHE B CE1 1 
ATOM   6422 C  CE2 . PHE B 1 299 ? 21.399  -6.998  -45.143 1.00 34.76  ? 299  PHE B CE2 1 
ATOM   6423 C  CZ  . PHE B 1 299 ? 22.686  -6.785  -45.606 1.00 34.58  ? 299  PHE B CZ  1 
ATOM   6424 N  N   . VAL B 1 300 ? 19.782  -0.470  -43.546 1.00 29.32  ? 300  VAL B N   1 
ATOM   6425 C  CA  . VAL B 1 300 ? 19.100  0.781   -43.286 1.00 29.49  ? 300  VAL B CA  1 
ATOM   6426 C  C   . VAL B 1 300 ? 19.920  1.869   -43.946 1.00 29.57  ? 300  VAL B C   1 
ATOM   6427 O  O   . VAL B 1 300 ? 21.003  1.595   -44.448 1.00 31.30  ? 300  VAL B O   1 
ATOM   6428 C  CB  . VAL B 1 300 ? 19.007  1.038   -41.769 1.00 28.73  ? 300  VAL B CB  1 
ATOM   6429 C  CG1 . VAL B 1 300 ? 18.296  -0.117  -41.083 1.00 25.08  ? 300  VAL B CG1 1 
ATOM   6430 C  CG2 . VAL B 1 300 ? 20.394  1.233   -41.179 1.00 31.55  ? 300  VAL B CG2 1 
ATOM   6431 N  N   . PRO B 1 301 ? 19.406  3.106   -43.970 1.00 30.78  ? 301  PRO B N   1 
ATOM   6432 C  CA  . PRO B 1 301 ? 20.182  4.177   -44.600 1.00 30.74  ? 301  PRO B CA  1 
ATOM   6433 C  C   . PRO B 1 301 ? 21.598  4.232   -44.038 1.00 37.59  ? 301  PRO B C   1 
ATOM   6434 O  O   . PRO B 1 301 ? 21.818  3.920   -42.867 1.00 37.51  ? 301  PRO B O   1 
ATOM   6435 C  CB  . PRO B 1 301 ? 19.402  5.437   -44.219 1.00 27.44  ? 301  PRO B CB  1 
ATOM   6436 C  CG  . PRO B 1 301 ? 18.001  4.968   -44.078 1.00 34.11  ? 301  PRO B CG  1 
ATOM   6437 C  CD  . PRO B 1 301 ? 18.089  3.573   -43.511 1.00 34.11  ? 301  PRO B CD  1 
ATOM   6438 N  N   . VAL B 1 302 ? 22.552  4.619   -44.872 1.00 36.86  ? 302  VAL B N   1 
ATOM   6439 C  CA  . VAL B 1 302 ? 23.946  4.656   -44.466 1.00 36.73  ? 302  VAL B CA  1 
ATOM   6440 C  C   . VAL B 1 302 ? 24.476  6.084   -44.524 1.00 37.65  ? 302  VAL B C   1 
ATOM   6441 O  O   . VAL B 1 302 ? 24.184  6.826   -45.462 1.00 35.33  ? 302  VAL B O   1 
ATOM   6442 C  CB  . VAL B 1 302 ? 24.806  3.759   -45.373 1.00 33.67  ? 302  VAL B CB  1 
ATOM   6443 C  CG1 . VAL B 1 302 ? 24.707  4.228   -46.823 1.00 29.71  ? 302  VAL B CG1 1 
ATOM   6444 C  CG2 . VAL B 1 302 ? 26.256  3.754   -44.900 1.00 36.25  ? 302  VAL B CG2 1 
ATOM   6445 N  N   . VAL B 1 303 ? 25.245  6.477   -43.518 1.00 34.64  ? 303  VAL B N   1 
ATOM   6446 C  CA  . VAL B 1 303 ? 25.862  7.791   -43.547 1.00 43.84  ? 303  VAL B CA  1 
ATOM   6447 C  C   . VAL B 1 303 ? 26.925  7.762   -44.632 1.00 39.57  ? 303  VAL B C   1 
ATOM   6448 O  O   . VAL B 1 303 ? 28.037  7.292   -44.408 1.00 43.07  ? 303  VAL B O   1 
ATOM   6449 C  CB  . VAL B 1 303 ? 26.480  8.171   -42.194 1.00 37.20  ? 303  VAL B CB  1 
ATOM   6450 C  CG1 . VAL B 1 303 ? 27.094  9.561   -42.265 1.00 37.15  ? 303  VAL B CG1 1 
ATOM   6451 C  CG2 . VAL B 1 303 ? 25.425  8.114   -41.105 1.00 31.78  ? 303  VAL B CG2 1 
ATOM   6452 N  N   . ASP B 1 304 ? 26.564  8.258   -45.811 1.00 42.67  ? 304  ASP B N   1 
ATOM   6453 C  CA  . ASP B 1 304 ? 27.395  8.136   -47.006 1.00 33.18  ? 304  ASP B CA  1 
ATOM   6454 C  C   . ASP B 1 304 ? 28.162  9.408   -47.338 1.00 37.30  ? 304  ASP B C   1 
ATOM   6455 O  O   . ASP B 1 304 ? 28.950  9.435   -48.278 1.00 44.55  ? 304  ASP B O   1 
ATOM   6456 C  CB  . ASP B 1 304 ? 26.525  7.749   -48.204 1.00 39.43  ? 304  ASP B CB  1 
ATOM   6457 C  CG  . ASP B 1 304 ? 25.415  8.763   -48.483 1.00 47.76  ? 304  ASP B CG  1 
ATOM   6458 O  OD1 . ASP B 1 304 ? 25.171  9.653   -47.631 1.00 34.30  ? 304  ASP B OD1 1 
ATOM   6459 O  OD2 . ASP B 1 304 ? 24.781  8.663   -49.559 1.00 42.20  ? 304  ASP B OD2 1 
ATOM   6460 N  N   . GLY B 1 305 ? 27.927  10.465  -46.572 1.00 45.20  ? 305  GLY B N   1 
ATOM   6461 C  CA  . GLY B 1 305 ? 28.491  11.756  -46.904 1.00 36.63  ? 305  GLY B CA  1 
ATOM   6462 C  C   . GLY B 1 305 ? 27.880  12.300  -48.181 1.00 44.82  ? 305  GLY B C   1 
ATOM   6463 O  O   . GLY B 1 305 ? 28.337  13.304  -48.722 1.00 48.47  ? 305  GLY B O   1 
ATOM   6464 N  N   . ASP B 1 306 ? 26.841  11.632  -48.669 1.00 51.39  ? 306  ASP B N   1 
ATOM   6465 C  CA  . ASP B 1 306 ? 26.139  12.093  -49.859 1.00 40.86  ? 306  ASP B CA  1 
ATOM   6466 C  C   . ASP B 1 306 ? 24.688  12.422  -49.533 1.00 45.21  ? 306  ASP B C   1 
ATOM   6467 O  O   . ASP B 1 306 ? 24.361  13.579  -49.266 1.00 37.55  ? 306  ASP B O   1 
ATOM   6468 C  CB  . ASP B 1 306 ? 26.214  11.057  -50.978 1.00 41.76  ? 306  ASP B CB  1 
ATOM   6469 C  CG  . ASP B 1 306 ? 25.658  11.579  -52.284 1.00 46.69  ? 306  ASP B CG  1 
ATOM   6470 O  OD1 . ASP B 1 306 ? 25.281  12.768  -52.326 1.00 51.52  ? 306  ASP B OD1 1 
ATOM   6471 O  OD2 . ASP B 1 306 ? 25.600  10.808  -53.265 1.00 53.12  ? 306  ASP B OD2 1 
ATOM   6472 N  N   . PHE B 1 307 ? 23.812  11.420  -49.557 1.00 39.44  ? 307  PHE B N   1 
ATOM   6473 C  CA  . PHE B 1 307 ? 22.425  11.673  -49.185 1.00 42.30  ? 307  PHE B CA  1 
ATOM   6474 C  C   . PHE B 1 307 ? 22.423  12.291  -47.794 1.00 36.84  ? 307  PHE B C   1 
ATOM   6475 O  O   . PHE B 1 307 ? 21.755  13.292  -47.553 1.00 34.75  ? 307  PHE B O   1 
ATOM   6476 C  CB  . PHE B 1 307 ? 21.580  10.395  -49.212 1.00 35.19  ? 307  PHE B CB  1 
ATOM   6477 C  CG  . PHE B 1 307 ? 20.095  10.652  -49.128 1.00 36.99  ? 307  PHE B CG  1 
ATOM   6478 C  CD1 . PHE B 1 307 ? 19.503  11.010  -47.925 1.00 35.03  ? 307  PHE B CD1 1 
ATOM   6479 C  CD2 . PHE B 1 307 ? 19.294  10.546  -50.253 1.00 38.22  ? 307  PHE B CD2 1 
ATOM   6480 C  CE1 . PHE B 1 307 ? 18.142  11.254  -47.845 1.00 29.90  ? 307  PHE B CE1 1 
ATOM   6481 C  CE2 . PHE B 1 307 ? 17.929  10.784  -50.178 1.00 33.38  ? 307  PHE B CE2 1 
ATOM   6482 C  CZ  . PHE B 1 307 ? 17.356  11.138  -48.972 1.00 37.01  ? 307  PHE B CZ  1 
ATOM   6483 N  N   . LEU B 1 308 ? 23.189  11.681  -46.891 1.00 38.99  ? 308  LEU B N   1 
ATOM   6484 C  CA  . LEU B 1 308 ? 23.447  12.232  -45.566 1.00 35.23  ? 308  LEU B CA  1 
ATOM   6485 C  C   . LEU B 1 308 ? 24.894  12.719  -45.484 1.00 45.56  ? 308  LEU B C   1 
ATOM   6486 O  O   . LEU B 1 308 ? 25.822  11.916  -45.356 1.00 39.01  ? 308  LEU B O   1 
ATOM   6487 C  CB  . LEU B 1 308 ? 23.211  11.175  -44.490 1.00 26.42  ? 308  LEU B CB  1 
ATOM   6488 C  CG  . LEU B 1 308 ? 21.820  10.562  -44.376 1.00 40.83  ? 308  LEU B CG  1 
ATOM   6489 C  CD1 . LEU B 1 308 ? 21.834  9.421   -43.374 1.00 35.61  ? 308  LEU B CD1 1 
ATOM   6490 C  CD2 . LEU B 1 308 ? 20.788  11.618  -43.993 1.00 33.28  ? 308  LEU B CD2 1 
ATOM   6491 N  N   . SER B 1 309 ? 25.074  14.035  -45.553 1.00 38.06  ? 309  SER B N   1 
ATOM   6492 C  CA  . SER B 1 309 ? 26.400  14.650  -45.554 1.00 43.11  ? 309  SER B CA  1 
ATOM   6493 C  C   . SER B 1 309 ? 27.188  14.379  -44.271 1.00 47.75  ? 309  SER B C   1 
ATOM   6494 O  O   . SER B 1 309 ? 28.419  14.388  -44.270 1.00 49.86  ? 309  SER B O   1 
ATOM   6495 C  CB  . SER B 1 309 ? 26.283  16.158  -45.793 1.00 34.49  ? 309  SER B CB  1 
ATOM   6496 O  OG  . SER B 1 309 ? 25.568  16.788  -44.745 1.00 46.28  ? 309  SER B OG  1 
ATOM   6497 N  N   . ASP B 1 310 ? 26.469  14.143  -43.181 1.00 45.20  ? 310  ASP B N   1 
ATOM   6498 C  CA  . ASP B 1 310 ? 27.082  13.782  -41.911 1.00 43.21  ? 310  ASP B CA  1 
ATOM   6499 C  C   . ASP B 1 310 ? 26.075  12.916  -41.165 1.00 45.02  ? 310  ASP B C   1 
ATOM   6500 O  O   . ASP B 1 310 ? 25.015  12.602  -41.705 1.00 46.66  ? 310  ASP B O   1 
ATOM   6501 C  CB  . ASP B 1 310 ? 27.416  15.040  -41.109 1.00 45.30  ? 310  ASP B CB  1 
ATOM   6502 C  CG  . ASP B 1 310 ? 28.548  14.827  -40.115 1.00 50.23  ? 310  ASP B CG  1 
ATOM   6503 O  OD1 . ASP B 1 310 ? 28.659  13.723  -39.544 1.00 59.53  ? 310  ASP B OD1 1 
ATOM   6504 O  OD2 . ASP B 1 310 ? 29.326  15.777  -39.896 1.00 50.85  ? 310  ASP B OD2 1 
ATOM   6505 N  N   . THR B 1 311 ? 26.396  12.520  -39.938 1.00 41.67  ? 311  THR B N   1 
ATOM   6506 C  CA  . THR B 1 311 ? 25.439  11.778  -39.124 1.00 44.03  ? 311  THR B CA  1 
ATOM   6507 C  C   . THR B 1 311 ? 24.212  12.633  -38.856 1.00 40.44  ? 311  THR B C   1 
ATOM   6508 O  O   . THR B 1 311 ? 24.294  13.860  -38.861 1.00 45.28  ? 311  THR B O   1 
ATOM   6509 C  CB  . THR B 1 311 ? 26.032  11.365  -37.774 1.00 43.56  ? 311  THR B CB  1 
ATOM   6510 O  OG1 . THR B 1 311 ? 26.320  12.539  -37.006 1.00 45.35  ? 311  THR B OG1 1 
ATOM   6511 C  CG2 . THR B 1 311 ? 27.298  10.561  -37.979 1.00 35.27  ? 311  THR B CG2 1 
ATOM   6512 N  N   . PRO B 1 312 ? 23.062  11.983  -38.634 1.00 42.99  ? 312  PRO B N   1 
ATOM   6513 C  CA  . PRO B 1 312 ? 21.836  12.709  -38.297 1.00 38.49  ? 312  PRO B CA  1 
ATOM   6514 C  C   . PRO B 1 312 ? 22.034  13.588  -37.070 1.00 38.05  ? 312  PRO B C   1 
ATOM   6515 O  O   . PRO B 1 312 ? 21.639  14.754  -37.077 1.00 40.45  ? 312  PRO B O   1 
ATOM   6516 C  CB  . PRO B 1 312 ? 20.842  11.588  -37.998 1.00 38.66  ? 312  PRO B CB  1 
ATOM   6517 C  CG  . PRO B 1 312 ? 21.328  10.438  -38.812 1.00 42.99  ? 312  PRO B CG  1 
ATOM   6518 C  CD  . PRO B 1 312 ? 22.826  10.540  -38.813 1.00 40.80  ? 312  PRO B CD  1 
ATOM   6519 N  N   . GLU B 1 313 ? 22.645  13.037  -36.028 1.00 37.79  ? 313  GLU B N   1 
ATOM   6520 C  CA  . GLU B 1 313 ? 22.895  13.815  -34.818 1.00 48.88  ? 313  GLU B CA  1 
ATOM   6521 C  C   . GLU B 1 313 ? 23.683  15.081  -35.140 1.00 46.95  ? 313  GLU B C   1 
ATOM   6522 O  O   . GLU B 1 313 ? 23.306  16.176  -34.728 1.00 48.11  ? 313  GLU B O   1 
ATOM   6523 C  CB  . GLU B 1 313 ? 23.595  12.971  -33.753 1.00 42.68  ? 313  GLU B CB  1 
ATOM   6524 C  CG  . GLU B 1 313 ? 24.147  11.648  -34.280 1.00 67.83  ? 313  GLU B CG  1 
ATOM   6525 C  CD  . GLU B 1 313 ? 23.067  10.585  -34.486 1.00 60.00  ? 313  GLU B CD  1 
ATOM   6526 O  OE1 . GLU B 1 313 ? 22.241  10.368  -33.567 1.00 45.66  ? 313  GLU B OE1 1 
ATOM   6527 O  OE2 . GLU B 1 313 ? 23.054  9.958   -35.568 1.00 54.41  ? 313  GLU B OE2 1 
ATOM   6528 N  N   . ALA B 1 314 ? 24.763  14.933  -35.897 1.00 37.92  ? 314  ALA B N   1 
ATOM   6529 C  CA  . ALA B 1 314 ? 25.515  16.094  -36.356 1.00 39.80  ? 314  ALA B CA  1 
ATOM   6530 C  C   . ALA B 1 314 ? 24.597  17.082  -37.073 1.00 49.07  ? 314  ALA B C   1 
ATOM   6531 O  O   . ALA B 1 314 ? 24.578  18.272  -36.756 1.00 55.37  ? 314  ALA B O   1 
ATOM   6532 C  CB  . ALA B 1 314 ? 26.659  15.663  -37.281 1.00 34.25  ? 314  ALA B CB  1 
ATOM   6533 N  N   . LEU B 1 315 ? 23.835  16.575  -38.038 1.00 45.99  ? 315  LEU B N   1 
ATOM   6534 C  CA  . LEU B 1 315 ? 23.002  17.415  -38.892 1.00 43.15  ? 315  LEU B CA  1 
ATOM   6535 C  C   . LEU B 1 315 ? 21.864  18.132  -38.155 1.00 42.09  ? 315  LEU B C   1 
ATOM   6536 O  O   . LEU B 1 315 ? 21.531  19.265  -38.489 1.00 40.74  ? 315  LEU B O   1 
ATOM   6537 C  CB  . LEU B 1 315 ? 22.452  16.601  -40.061 1.00 42.06  ? 315  LEU B CB  1 
ATOM   6538 C  CG  . LEU B 1 315 ? 23.494  16.029  -41.017 1.00 44.94  ? 315  LEU B CG  1 
ATOM   6539 C  CD1 . LEU B 1 315 ? 22.814  15.255  -42.133 1.00 41.66  ? 315  LEU B CD1 1 
ATOM   6540 C  CD2 . LEU B 1 315 ? 24.347  17.142  -41.587 1.00 40.40  ? 315  LEU B CD2 1 
ATOM   6541 N  N   . ILE B 1 316 ? 21.262  17.488  -37.162 1.00 39.49  ? 316  ILE B N   1 
ATOM   6542 C  CA  . ILE B 1 316 ? 20.204  18.158  -36.405 1.00 52.99  ? 316  ILE B CA  1 
ATOM   6543 C  C   . ILE B 1 316 ? 20.787  19.139  -35.389 1.00 53.40  ? 316  ILE B C   1 
ATOM   6544 O  O   . ILE B 1 316 ? 20.141  20.117  -35.020 1.00 53.79  ? 316  ILE B O   1 
ATOM   6545 C  CB  . ILE B 1 316 ? 19.229  17.173  -35.703 1.00 41.51  ? 316  ILE B CB  1 
ATOM   6546 C  CG1 . ILE B 1 316 ? 19.873  16.546  -34.469 1.00 48.51  ? 316  ILE B CG1 1 
ATOM   6547 C  CG2 . ILE B 1 316 ? 18.758  16.095  -36.670 1.00 45.51  ? 316  ILE B CG2 1 
ATOM   6548 C  CD1 . ILE B 1 316 ? 18.972  15.546  -33.759 1.00 46.97  ? 316  ILE B CD1 1 
ATOM   6549 N  N   . ASN B 1 317 ? 22.013  18.882  -34.946 1.00 56.08  ? 317  ASN B N   1 
ATOM   6550 C  CA  . ASN B 1 317 ? 22.677  19.783  -34.009 1.00 54.57  ? 317  ASN B CA  1 
ATOM   6551 C  C   . ASN B 1 317 ? 23.076  21.108  -34.646 1.00 53.85  ? 317  ASN B C   1 
ATOM   6552 O  O   . ASN B 1 317 ? 23.145  22.131  -33.971 1.00 53.25  ? 317  ASN B O   1 
ATOM   6553 C  CB  . ASN B 1 317 ? 23.909  19.119  -33.391 1.00 45.89  ? 317  ASN B CB  1 
ATOM   6554 C  CG  . ASN B 1 317 ? 23.552  18.130  -32.305 1.00 48.24  ? 317  ASN B CG  1 
ATOM   6555 O  OD1 . ASN B 1 317 ? 22.386  17.991  -31.938 1.00 67.69  ? 317  ASN B OD1 1 
ATOM   6556 N  ND2 . ASN B 1 317 ? 24.554  17.433  -31.785 1.00 40.57  ? 317  ASN B ND2 1 
ATOM   6557 N  N   . THR B 1 318 ? 23.330  21.087  -35.949 1.00 53.81  ? 318  THR B N   1 
ATOM   6558 C  CA  . THR B 1 318 ? 23.881  22.251  -36.633 1.00 50.75  ? 318  THR B CA  1 
ATOM   6559 C  C   . THR B 1 318 ? 22.951  22.799  -37.710 1.00 56.11  ? 318  THR B C   1 
ATOM   6560 O  O   . THR B 1 318 ? 23.234  23.829  -38.319 1.00 59.93  ? 318  THR B O   1 
ATOM   6561 C  CB  . THR B 1 318 ? 25.212  21.898  -37.305 1.00 59.13  ? 318  THR B CB  1 
ATOM   6562 O  OG1 . THR B 1 318 ? 24.957  21.143  -38.497 1.00 61.80  ? 318  THR B OG1 1 
ATOM   6563 C  CG2 . THR B 1 318 ? 26.077  21.077  -36.362 1.00 58.05  ? 318  THR B CG2 1 
ATOM   6564 N  N   . GLY B 1 319 ? 21.847  22.108  -37.953 1.00 54.28  ? 319  GLY B N   1 
ATOM   6565 C  CA  . GLY B 1 319 ? 20.940  22.511  -39.008 1.00 44.20  ? 319  GLY B CA  1 
ATOM   6566 C  C   . GLY B 1 319 ? 20.211  23.803  -38.704 1.00 47.83  ? 319  GLY B C   1 
ATOM   6567 O  O   . GLY B 1 319 ? 20.000  24.152  -37.541 1.00 42.06  ? 319  GLY B O   1 
ATOM   6568 N  N   . ASP B 1 320 ? 19.841  24.524  -39.757 1.00 45.13  ? 320  ASP B N   1 
ATOM   6569 C  CA  . ASP B 1 320 ? 18.926  25.648  -39.627 1.00 54.31  ? 320  ASP B CA  1 
ATOM   6570 C  C   . ASP B 1 320 ? 17.550  25.228  -40.134 1.00 56.51  ? 320  ASP B C   1 
ATOM   6571 O  O   . ASP B 1 320 ? 17.378  24.900  -41.311 1.00 44.47  ? 320  ASP B O   1 
ATOM   6572 C  CB  . ASP B 1 320 ? 19.426  26.868  -40.401 1.00 59.66  ? 320  ASP B CB  1 
ATOM   6573 C  CG  . ASP B 1 320 ? 18.477  28.046  -40.299 1.00 66.20  ? 320  ASP B CG  1 
ATOM   6574 O  OD1 . ASP B 1 320 ? 17.532  27.972  -39.486 1.00 68.39  ? 320  ASP B OD1 1 
ATOM   6575 O  OD2 . ASP B 1 320 ? 18.672  29.041  -41.027 1.00 77.00  ? 320  ASP B OD2 1 
ATOM   6576 N  N   . PHE B 1 321 ? 16.570  25.243  -39.240 1.00 46.64  ? 321  PHE B N   1 
ATOM   6577 C  CA  . PHE B 1 321 ? 15.259  24.707  -39.558 1.00 40.59  ? 321  PHE B CA  1 
ATOM   6578 C  C   . PHE B 1 321 ? 14.188  25.781  -39.520 1.00 47.88  ? 321  PHE B C   1 
ATOM   6579 O  O   . PHE B 1 321 ? 13.034  25.518  -39.180 1.00 47.23  ? 321  PHE B O   1 
ATOM   6580 C  CB  . PHE B 1 321 ? 14.938  23.546  -38.621 1.00 41.29  ? 321  PHE B CB  1 
ATOM   6581 C  CG  . PHE B 1 321 ? 15.950  22.437  -38.687 1.00 43.68  ? 321  PHE B CG  1 
ATOM   6582 C  CD1 . PHE B 1 321 ? 16.057  21.652  -39.824 1.00 39.95  ? 321  PHE B CD1 1 
ATOM   6583 C  CD2 . PHE B 1 321 ? 16.808  22.193  -37.629 1.00 38.77  ? 321  PHE B CD2 1 
ATOM   6584 C  CE1 . PHE B 1 321 ? 16.987  20.637  -39.898 1.00 35.83  ? 321  PHE B CE1 1 
ATOM   6585 C  CE2 . PHE B 1 321 ? 17.740  21.176  -37.699 1.00 43.73  ? 321  PHE B CE2 1 
ATOM   6586 C  CZ  . PHE B 1 321 ? 17.829  20.399  -38.837 1.00 39.00  ? 321  PHE B CZ  1 
ATOM   6587 N  N   . GLN B 1 322 ? 14.593  26.989  -39.905 1.00 60.79  ? 322  GLN B N   1 
ATOM   6588 C  CA  . GLN B 1 322 ? 13.725  28.160  -39.924 1.00 59.06  ? 322  GLN B CA  1 
ATOM   6589 C  C   . GLN B 1 322 ? 12.422  27.933  -40.680 1.00 63.95  ? 322  GLN B C   1 
ATOM   6590 O  O   . GLN B 1 322 ? 11.341  28.251  -40.182 1.00 72.94  ? 322  GLN B O   1 
ATOM   6591 C  CB  . GLN B 1 322 ? 14.459  29.342  -40.564 1.00 73.78  ? 322  GLN B CB  1 
ATOM   6592 C  CG  . GLN B 1 322 ? 15.546  29.966  -39.707 1.00 84.07  ? 322  GLN B CG  1 
ATOM   6593 C  CD  . GLN B 1 322 ? 14.992  30.793  -38.564 1.00 97.75  ? 322  GLN B CD  1 
ATOM   6594 O  OE1 . GLN B 1 322 ? 13.830  30.648  -38.180 1.00 102.74 ? 322  GLN B OE1 1 
ATOM   6595 N  NE2 . GLN B 1 322 ? 15.825  31.668  -38.013 1.00 100.84 ? 322  GLN B NE2 1 
ATOM   6596 N  N   . ASP B 1 323 ? 12.531  27.386  -41.885 1.00 53.99  ? 323  ASP B N   1 
ATOM   6597 C  CA  . ASP B 1 323 ? 11.406  27.351  -42.817 1.00 64.27  ? 323  ASP B CA  1 
ATOM   6598 C  C   . ASP B 1 323 ? 10.429  26.207  -42.543 1.00 53.69  ? 323  ASP B C   1 
ATOM   6599 O  O   . ASP B 1 323 ? 9.534   25.942  -43.342 1.00 53.47  ? 323  ASP B O   1 
ATOM   6600 C  CB  . ASP B 1 323 ? 11.947  27.231  -44.246 1.00 90.85  ? 323  ASP B CB  1 
ATOM   6601 C  CG  . ASP B 1 323 ? 10.860  27.333  -45.298 1.00 99.59  ? 323  ASP B CG  1 
ATOM   6602 O  OD1 . ASP B 1 323 ? 10.091  28.319  -45.275 1.00 72.01  ? 323  ASP B OD1 1 
ATOM   6603 O  OD2 . ASP B 1 323 ? 10.784  26.426  -46.155 1.00 103.29 ? 323  ASP B OD2 1 
ATOM   6604 N  N   . LEU B 1 324 ? 10.590  25.542  -41.407 1.00 53.98  ? 324  LEU B N   1 
ATOM   6605 C  CA  . LEU B 1 324 ? 10.009  24.219  -41.234 1.00 43.66  ? 324  LEU B CA  1 
ATOM   6606 C  C   . LEU B 1 324 ? 8.961   24.105  -40.126 1.00 41.27  ? 324  LEU B C   1 
ATOM   6607 O  O   . LEU B 1 324 ? 9.110   24.687  -39.052 1.00 46.50  ? 324  LEU B O   1 
ATOM   6608 C  CB  . LEU B 1 324 ? 11.139  23.221  -40.975 1.00 43.36  ? 324  LEU B CB  1 
ATOM   6609 C  CG  . LEU B 1 324 ? 10.790  21.738  -41.007 1.00 48.88  ? 324  LEU B CG  1 
ATOM   6610 C  CD1 . LEU B 1 324 ? 10.227  21.355  -42.374 1.00 44.90  ? 324  LEU B CD1 1 
ATOM   6611 C  CD2 . LEU B 1 324 ? 12.021  20.917  -40.667 1.00 37.13  ? 324  LEU B CD2 1 
ATOM   6612 N  N   . GLN B 1 325 ? 7.901   23.349  -40.395 1.00 32.43  ? 325  GLN B N   1 
ATOM   6613 C  CA  . GLN B 1 325 ? 6.983   22.928  -39.339 1.00 35.37  ? 325  GLN B CA  1 
ATOM   6614 C  C   . GLN B 1 325 ? 6.973   21.409  -39.242 1.00 31.38  ? 325  GLN B C   1 
ATOM   6615 O  O   . GLN B 1 325 ? 6.949   20.710  -40.253 1.00 35.37  ? 325  GLN B O   1 
ATOM   6616 C  CB  . GLN B 1 325 ? 5.560   23.449  -39.560 1.00 31.37  ? 325  GLN B CB  1 
ATOM   6617 C  CG  . GLN B 1 325 ? 5.462   24.935  -39.839 1.00 38.46  ? 325  GLN B CG  1 
ATOM   6618 C  CD  . GLN B 1 325 ? 5.415   25.239  -41.322 1.00 45.99  ? 325  GLN B CD  1 
ATOM   6619 O  OE1 . GLN B 1 325 ? 4.600   24.677  -42.052 1.00 46.95  ? 325  GLN B OE1 1 
ATOM   6620 N  NE2 . GLN B 1 325 ? 6.285   26.136  -41.775 1.00 43.27  ? 325  GLN B NE2 1 
ATOM   6621 N  N   . VAL B 1 326 ? 6.993   20.905  -38.015 1.00 34.26  ? 326  VAL B N   1 
ATOM   6622 C  CA  . VAL B 1 326 ? 7.077   19.475  -37.783 1.00 37.90  ? 326  VAL B CA  1 
ATOM   6623 C  C   . VAL B 1 326 ? 6.101   19.022  -36.705 1.00 30.83  ? 326  VAL B C   1 
ATOM   6624 O  O   . VAL B 1 326 ? 5.930   19.687  -35.688 1.00 31.63  ? 326  VAL B O   1 
ATOM   6625 C  CB  . VAL B 1 326 ? 8.505   19.060  -37.372 1.00 37.49  ? 326  VAL B CB  1 
ATOM   6626 C  CG1 . VAL B 1 326 ? 8.569   17.568  -37.156 1.00 40.77  ? 326  VAL B CG1 1 
ATOM   6627 C  CG2 . VAL B 1 326 ? 9.509   19.480  -38.432 1.00 35.85  ? 326  VAL B CG2 1 
ATOM   6628 N  N   . LEU B 1 327 ? 5.457   17.887  -36.951 1.00 36.02  ? 327  LEU B N   1 
ATOM   6629 C  CA  . LEU B 1 327 ? 4.611   17.235  -35.962 1.00 33.51  ? 327  LEU B CA  1 
ATOM   6630 C  C   . LEU B 1 327 ? 5.250   15.895  -35.601 1.00 33.76  ? 327  LEU B C   1 
ATOM   6631 O  O   . LEU B 1 327 ? 5.496   15.062  -36.474 1.00 33.44  ? 327  LEU B O   1 
ATOM   6632 C  CB  . LEU B 1 327 ? 3.196   17.034  -36.516 1.00 35.02  ? 327  LEU B CB  1 
ATOM   6633 C  CG  . LEU B 1 327 ? 2.233   16.191  -35.672 1.00 38.76  ? 327  LEU B CG  1 
ATOM   6634 C  CD1 . LEU B 1 327 ? 1.996   16.834  -34.323 1.00 39.12  ? 327  LEU B CD1 1 
ATOM   6635 C  CD2 . LEU B 1 327 ? 0.914   15.979  -36.398 1.00 39.91  ? 327  LEU B CD2 1 
ATOM   6636 N  N   . VAL B 1 328 ? 5.541   15.700  -34.319 1.00 29.97  ? 328  VAL B N   1 
ATOM   6637 C  CA  . VAL B 1 328 ? 6.190   14.477  -33.865 1.00 28.87  ? 328  VAL B CA  1 
ATOM   6638 C  C   . VAL B 1 328 ? 5.488   13.920  -32.645 1.00 33.65  ? 328  VAL B C   1 
ATOM   6639 O  O   . VAL B 1 328 ? 4.894   14.667  -31.861 1.00 32.63  ? 328  VAL B O   1 
ATOM   6640 C  CB  . VAL B 1 328 ? 7.667   14.708  -33.500 1.00 30.13  ? 328  VAL B CB  1 
ATOM   6641 C  CG1 . VAL B 1 328 ? 8.403   15.356  -34.650 1.00 36.70  ? 328  VAL B CG1 1 
ATOM   6642 C  CG2 . VAL B 1 328 ? 7.773   15.564  -32.253 1.00 34.61  ? 328  VAL B CG2 1 
ATOM   6643 N  N   . GLY B 1 329 ? 5.567   12.606  -32.473 1.00 25.25  ? 329  GLY B N   1 
ATOM   6644 C  CA  . GLY B 1 329 ? 4.890   11.970  -31.364 1.00 25.79  ? 329  GLY B CA  1 
ATOM   6645 C  C   . GLY B 1 329 ? 5.179   10.492  -31.261 1.00 30.19  ? 329  GLY B C   1 
ATOM   6646 O  O   . GLY B 1 329 ? 5.838   9.908   -32.122 1.00 30.52  ? 329  GLY B O   1 
ATOM   6647 N  N   . VAL B 1 330 ? 4.671   9.888   -30.195 1.00 27.95  ? 330  VAL B N   1 
ATOM   6648 C  CA  . VAL B 1 330 ? 4.943   8.499   -29.891 1.00 28.30  ? 330  VAL B CA  1 
ATOM   6649 C  C   . VAL B 1 330 ? 3.672   7.869   -29.367 1.00 30.06  ? 330  VAL B C   1 
ATOM   6650 O  O   . VAL B 1 330 ? 2.718   8.573   -29.040 1.00 32.44  ? 330  VAL B O   1 
ATOM   6651 C  CB  . VAL B 1 330 ? 6.040   8.366   -28.803 1.00 28.91  ? 330  VAL B CB  1 
ATOM   6652 C  CG1 . VAL B 1 330 ? 7.359   8.958   -29.282 1.00 27.83  ? 330  VAL B CG1 1 
ATOM   6653 C  CG2 . VAL B 1 330 ? 5.589   9.026   -27.509 1.00 20.01  ? 330  VAL B CG2 1 
ATOM   6654 N  N   . VAL B 1 331 ? 3.661   6.542   -29.293 1.00 31.48  ? 331  VAL B N   1 
ATOM   6655 C  CA  . VAL B 1 331 ? 2.561   5.822   -28.668 1.00 28.00  ? 331  VAL B CA  1 
ATOM   6656 C  C   . VAL B 1 331 ? 2.957   5.466   -27.245 1.00 36.11  ? 331  VAL B C   1 
ATOM   6657 O  O   . VAL B 1 331 ? 4.127   5.563   -26.879 1.00 32.02  ? 331  VAL B O   1 
ATOM   6658 C  CB  . VAL B 1 331 ? 2.182   4.547   -29.449 1.00 31.81  ? 331  VAL B CB  1 
ATOM   6659 C  CG1 . VAL B 1 331 ? 1.772   4.905   -30.871 1.00 26.09  ? 331  VAL B CG1 1 
ATOM   6660 C  CG2 . VAL B 1 331 ? 3.337   3.543   -29.446 1.00 25.54  ? 331  VAL B CG2 1 
ATOM   6661 N  N   . LYS B 1 332 ? 1.981   5.051   -26.446 1.00 33.36  ? 332  LYS B N   1 
ATOM   6662 C  CA  . LYS B 1 332 ? 2.202   4.856   -25.021 1.00 31.24  ? 332  LYS B CA  1 
ATOM   6663 C  C   . LYS B 1 332 ? 3.180   3.725   -24.709 1.00 33.48  ? 332  LYS B C   1 
ATOM   6664 O  O   . LYS B 1 332 ? 3.877   3.768   -23.703 1.00 38.47  ? 332  LYS B O   1 
ATOM   6665 C  CB  . LYS B 1 332 ? 0.865   4.636   -24.308 1.00 40.83  ? 332  LYS B CB  1 
ATOM   6666 C  CG  . LYS B 1 332 ? 0.966   4.461   -22.800 1.00 35.14  ? 332  LYS B CG  1 
ATOM   6667 C  CD  . LYS B 1 332 ? -0.422  4.262   -22.187 1.00 47.81  ? 332  LYS B CD  1 
ATOM   6668 C  CE  . LYS B 1 332 ? -0.405  3.232   -21.056 1.00 66.99  ? 332  LYS B CE  1 
ATOM   6669 N  NZ  . LYS B 1 332 ? -0.398  1.817   -21.563 1.00 61.60  ? 332  LYS B NZ  1 
ATOM   6670 N  N   . ASP B 1 333 ? 3.242   2.723   -25.578 1.00 36.00  ? 333  ASP B N   1 
ATOM   6671 C  CA  . ASP B 1 333 ? 4.051   1.535   -25.309 1.00 35.65  ? 333  ASP B CA  1 
ATOM   6672 C  C   . ASP B 1 333 ? 4.911   1.142   -26.501 1.00 32.42  ? 333  ASP B C   1 
ATOM   6673 O  O   . ASP B 1 333 ? 4.791   0.039   -27.028 1.00 37.50  ? 333  ASP B O   1 
ATOM   6674 C  CB  . ASP B 1 333 ? 3.149   0.368   -24.909 1.00 34.18  ? 333  ASP B CB  1 
ATOM   6675 C  CG  . ASP B 1 333 ? 2.322   0.672   -23.677 1.00 37.67  ? 333  ASP B CG  1 
ATOM   6676 O  OD1 . ASP B 1 333 ? 1.135   1.024   -23.829 1.00 37.81  ? 333  ASP B OD1 1 
ATOM   6677 O  OD2 . ASP B 1 333 ? 2.864   0.580   -22.557 1.00 40.77  ? 333  ASP B OD2 1 
ATOM   6678 N  N   . GLU B 1 334 ? 5.783   2.054   -26.913 1.00 37.87  ? 334  GLU B N   1 
ATOM   6679 C  CA  . GLU B 1 334 ? 6.623   1.859   -28.089 1.00 27.95  ? 334  GLU B CA  1 
ATOM   6680 C  C   . GLU B 1 334 ? 7.379   0.531   -28.095 1.00 33.44  ? 334  GLU B C   1 
ATOM   6681 O  O   . GLU B 1 334 ? 7.663   -0.012  -29.157 1.00 34.61  ? 334  GLU B O   1 
ATOM   6682 C  CB  . GLU B 1 334 ? 7.623   3.013   -28.215 1.00 34.61  ? 334  GLU B CB  1 
ATOM   6683 C  CG  . GLU B 1 334 ? 6.999   4.354   -28.572 1.00 31.38  ? 334  GLU B CG  1 
ATOM   6684 C  CD  . GLU B 1 334 ? 6.565   4.422   -30.021 1.00 34.15  ? 334  GLU B CD  1 
ATOM   6685 O  OE1 . GLU B 1 334 ? 6.866   3.475   -30.773 1.00 29.86  ? 334  GLU B OE1 1 
ATOM   6686 O  OE2 . GLU B 1 334 ? 5.922   5.420   -30.408 1.00 32.70  ? 334  GLU B OE2 1 
ATOM   6687 N  N   . GLY B 1 335 ? 7.703   0.008   -26.916 1.00 30.50  ? 335  GLY B N   1 
ATOM   6688 C  CA  . GLY B 1 335 ? 8.618   -1.115  -26.824 1.00 27.34  ? 335  GLY B CA  1 
ATOM   6689 C  C   . GLY B 1 335 ? 8.040   -2.522  -26.801 1.00 35.51  ? 335  GLY B C   1 
ATOM   6690 O  O   . GLY B 1 335 ? 8.728   -3.480  -27.154 1.00 36.92  ? 335  GLY B O   1 
ATOM   6691 N  N   . SER B 1 336 ? 6.785   -2.660  -26.389 1.00 33.41  ? 336  SER B N   1 
ATOM   6692 C  CA  . SER B 1 336 ? 6.213   -3.983  -26.148 1.00 35.24  ? 336  SER B CA  1 
ATOM   6693 C  C   . SER B 1 336 ? 6.347   -4.932  -27.348 1.00 42.61  ? 336  SER B C   1 
ATOM   6694 O  O   . SER B 1 336 ? 6.909   -6.022  -27.229 1.00 40.36  ? 336  SER B O   1 
ATOM   6695 C  CB  . SER B 1 336 ? 4.752   -3.863  -25.708 1.00 37.23  ? 336  SER B CB  1 
ATOM   6696 O  OG  . SER B 1 336 ? 3.937   -3.373  -26.756 1.00 37.43  ? 336  SER B OG  1 
ATOM   6697 N  N   . TYR B 1 337 ? 5.833   -4.504  -28.496 1.00 39.24  ? 337  TYR B N   1 
ATOM   6698 C  CA  . TYR B 1 337 ? 5.847   -5.300  -29.720 1.00 35.65  ? 337  TYR B CA  1 
ATOM   6699 C  C   . TYR B 1 337 ? 7.172   -6.034  -29.948 1.00 39.34  ? 337  TYR B C   1 
ATOM   6700 O  O   . TYR B 1 337 ? 7.187   -7.203  -30.333 1.00 44.46  ? 337  TYR B O   1 
ATOM   6701 C  CB  . TYR B 1 337 ? 5.554   -4.389  -30.914 1.00 39.11  ? 337  TYR B CB  1 
ATOM   6702 C  CG  . TYR B 1 337 ? 5.027   -5.089  -32.148 1.00 40.43  ? 337  TYR B CG  1 
ATOM   6703 C  CD1 . TYR B 1 337 ? 3.792   -4.748  -32.681 1.00 42.10  ? 337  TYR B CD1 1 
ATOM   6704 C  CD2 . TYR B 1 337 ? 5.766   -6.082  -32.787 1.00 49.40  ? 337  TYR B CD2 1 
ATOM   6705 C  CE1 . TYR B 1 337 ? 3.301   -5.374  -33.811 1.00 45.94  ? 337  TYR B CE1 1 
ATOM   6706 C  CE2 . TYR B 1 337 ? 5.280   -6.719  -33.920 1.00 45.99  ? 337  TYR B CE2 1 
ATOM   6707 C  CZ  . TYR B 1 337 ? 4.045   -6.357  -34.428 1.00 41.07  ? 337  TYR B CZ  1 
ATOM   6708 O  OH  . TYR B 1 337 ? 3.539   -6.971  -35.552 1.00 38.49  ? 337  TYR B OH  1 
ATOM   6709 N  N   . PHE B 1 338 ? 8.278   -5.340  -29.701 1.00 32.97  ? 338  PHE B N   1 
ATOM   6710 C  CA  . PHE B 1 338 ? 9.605   -5.842  -30.039 1.00 33.43  ? 338  PHE B CA  1 
ATOM   6711 C  C   . PHE B 1 338 ? 10.108  -6.931  -29.094 1.00 42.56  ? 338  PHE B C   1 
ATOM   6712 O  O   . PHE B 1 338 ? 11.008  -7.699  -29.441 1.00 36.82  ? 338  PHE B O   1 
ATOM   6713 C  CB  . PHE B 1 338 ? 10.603  -4.680  -30.085 1.00 35.28  ? 338  PHE B CB  1 
ATOM   6714 C  CG  . PHE B 1 338 ? 10.327  -3.699  -31.185 1.00 38.36  ? 338  PHE B CG  1 
ATOM   6715 C  CD1 . PHE B 1 338 ? 9.443   -2.648  -30.991 1.00 37.15  ? 338  PHE B CD1 1 
ATOM   6716 C  CD2 . PHE B 1 338 ? 10.934  -3.838  -32.421 1.00 31.67  ? 338  PHE B CD2 1 
ATOM   6717 C  CE1 . PHE B 1 338 ? 9.173   -1.750  -32.011 1.00 32.41  ? 338  PHE B CE1 1 
ATOM   6718 C  CE2 . PHE B 1 338 ? 10.671  -2.944  -33.443 1.00 35.88  ? 338  PHE B CE2 1 
ATOM   6719 C  CZ  . PHE B 1 338 ? 9.786   -1.900  -33.238 1.00 34.17  ? 338  PHE B CZ  1 
ATOM   6720 N  N   . LEU B 1 339 ? 9.520   -7.000  -27.904 1.00 34.79  ? 339  LEU B N   1 
ATOM   6721 C  CA  . LEU B 1 339 ? 10.017  -7.901  -26.870 1.00 44.38  ? 339  LEU B CA  1 
ATOM   6722 C  C   . LEU B 1 339 ? 9.796   -9.371  -27.223 1.00 45.49  ? 339  LEU B C   1 
ATOM   6723 O  O   . LEU B 1 339 ? 10.630  -10.221 -26.912 1.00 43.96  ? 339  LEU B O   1 
ATOM   6724 C  CB  . LEU B 1 339 ? 9.386   -7.571  -25.514 1.00 37.90  ? 339  LEU B CB  1 
ATOM   6725 C  CG  . LEU B 1 339 ? 9.623   -6.157  -24.981 1.00 33.56  ? 339  LEU B CG  1 
ATOM   6726 C  CD1 . LEU B 1 339 ? 9.005   -5.981  -23.595 1.00 31.81  ? 339  LEU B CD1 1 
ATOM   6727 C  CD2 . LEU B 1 339 ? 11.110  -5.839  -24.960 1.00 31.00  ? 339  LEU B CD2 1 
ATOM   6728 N  N   . VAL B 1 340 ? 8.674   -9.665  -27.875 1.00 39.63  ? 340  VAL B N   1 
ATOM   6729 C  CA  . VAL B 1 340 ? 8.337   -11.043 -28.232 1.00 45.85  ? 340  VAL B CA  1 
ATOM   6730 C  C   . VAL B 1 340 ? 9.231   -11.594 -29.343 1.00 41.63  ? 340  VAL B C   1 
ATOM   6731 O  O   . VAL B 1 340 ? 9.180   -12.780 -29.656 1.00 53.56  ? 340  VAL B O   1 
ATOM   6732 C  CB  . VAL B 1 340 ? 6.862   -11.179 -28.667 1.00 43.26  ? 340  VAL B CB  1 
ATOM   6733 C  CG1 . VAL B 1 340 ? 5.944   -10.510 -27.658 1.00 37.24  ? 340  VAL B CG1 1 
ATOM   6734 C  CG2 . VAL B 1 340 ? 6.660   -10.577 -30.046 1.00 43.84  ? 340  VAL B CG2 1 
ATOM   6735 N  N   . TYR B 1 341 ? 10.052  -10.732 -29.932 1.00 38.29  ? 341  TYR B N   1 
ATOM   6736 C  CA  . TYR B 1 341 ? 10.907  -11.136 -31.042 1.00 43.82  ? 341  TYR B CA  1 
ATOM   6737 C  C   . TYR B 1 341 ? 12.367  -11.360 -30.642 1.00 51.40  ? 341  TYR B C   1 
ATOM   6738 O  O   . TYR B 1 341 ? 13.262  -11.257 -31.482 1.00 56.58  ? 341  TYR B O   1 
ATOM   6739 C  CB  . TYR B 1 341 ? 10.850  -10.105 -32.171 1.00 36.69  ? 341  TYR B CB  1 
ATOM   6740 C  CG  . TYR B 1 341 ? 9.620   -10.192 -33.045 1.00 49.36  ? 341  TYR B CG  1 
ATOM   6741 C  CD1 . TYR B 1 341 ? 8.480   -9.447  -32.755 1.00 38.03  ? 341  TYR B CD1 1 
ATOM   6742 C  CD2 . TYR B 1 341 ? 9.603   -11.006 -34.172 1.00 48.71  ? 341  TYR B CD2 1 
ATOM   6743 C  CE1 . TYR B 1 341 ? 7.359   -9.518  -33.557 1.00 46.59  ? 341  TYR B CE1 1 
ATOM   6744 C  CE2 . TYR B 1 341 ? 8.487   -11.083 -34.980 1.00 50.31  ? 341  TYR B CE2 1 
ATOM   6745 C  CZ  . TYR B 1 341 ? 7.368   -10.339 -34.667 1.00 50.86  ? 341  TYR B CZ  1 
ATOM   6746 O  OH  . TYR B 1 341 ? 6.256   -10.420 -35.470 1.00 45.32  ? 341  TYR B OH  1 
ATOM   6747 N  N   . GLY B 1 342 ? 12.623  -11.664 -29.374 1.00 43.27  ? 342  GLY B N   1 
ATOM   6748 C  CA  . GLY B 1 342 ? 13.991  -11.932 -28.971 1.00 52.80  ? 342  GLY B CA  1 
ATOM   6749 C  C   . GLY B 1 342 ? 14.280  -11.963 -27.486 1.00 54.11  ? 342  GLY B C   1 
ATOM   6750 O  O   . GLY B 1 342 ? 15.317  -12.481 -27.071 1.00 51.79  ? 342  GLY B O   1 
ATOM   6751 N  N   . VAL B 1 343 ? 13.384  -11.402 -26.680 1.00 42.88  ? 343  VAL B N   1 
ATOM   6752 C  CA  . VAL B 1 343 ? 13.602  -11.375 -25.242 1.00 40.97  ? 343  VAL B CA  1 
ATOM   6753 C  C   . VAL B 1 343 ? 12.916  -12.550 -24.546 1.00 42.14  ? 343  VAL B C   1 
ATOM   6754 O  O   . VAL B 1 343 ? 11.685  -12.610 -24.473 1.00 48.65  ? 343  VAL B O   1 
ATOM   6755 C  CB  . VAL B 1 343 ? 13.155  -10.038 -24.608 1.00 47.55  ? 343  VAL B CB  1 
ATOM   6756 C  CG1 . VAL B 1 343 ? 13.560  -9.990  -23.138 1.00 36.14  ? 343  VAL B CG1 1 
ATOM   6757 C  CG2 . VAL B 1 343 ? 13.757  -8.859  -25.365 1.00 40.44  ? 343  VAL B CG2 1 
ATOM   6758 N  N   . PRO B 1 344 ? 13.722  -13.495 -24.039 1.00 34.07  ? 344  PRO B N   1 
ATOM   6759 C  CA  . PRO B 1 344 ? 13.234  -14.667 -23.306 1.00 40.36  ? 344  PRO B CA  1 
ATOM   6760 C  C   . PRO B 1 344 ? 12.305  -14.253 -22.174 1.00 36.97  ? 344  PRO B C   1 
ATOM   6761 O  O   . PRO B 1 344 ? 12.669  -13.386 -21.382 1.00 36.81  ? 344  PRO B O   1 
ATOM   6762 C  CB  . PRO B 1 344 ? 14.516  -15.276 -22.735 1.00 29.28  ? 344  PRO B CB  1 
ATOM   6763 C  CG  . PRO B 1 344 ? 15.580  -14.860 -23.684 1.00 37.64  ? 344  PRO B CG  1 
ATOM   6764 C  CD  . PRO B 1 344 ? 15.191  -13.483 -24.150 1.00 37.07  ? 344  PRO B CD  1 
ATOM   6765 N  N   . GLY B 1 345 ? 11.124  -14.861 -22.109 1.00 43.64  ? 345  GLY B N   1 
ATOM   6766 C  CA  . GLY B 1 345 ? 10.138  -14.515 -21.101 1.00 30.86  ? 345  GLY B CA  1 
ATOM   6767 C  C   . GLY B 1 345 ? 8.937   -13.803 -21.695 1.00 46.80  ? 345  GLY B C   1 
ATOM   6768 O  O   . GLY B 1 345 ? 7.871   -13.737 -21.082 1.00 56.52  ? 345  GLY B O   1 
ATOM   6769 N  N   . PHE B 1 346 ? 9.099   -13.274 -22.902 1.00 42.39  ? 346  PHE B N   1 
ATOM   6770 C  CA  . PHE B 1 346 ? 8.032   -12.489 -23.511 1.00 42.38  ? 346  PHE B CA  1 
ATOM   6771 C  C   . PHE B 1 346 ? 7.291   -13.231 -24.614 1.00 47.22  ? 346  PHE B C   1 
ATOM   6772 O  O   . PHE B 1 346 ? 7.897   -13.832 -25.499 1.00 46.75  ? 346  PHE B O   1 
ATOM   6773 C  CB  . PHE B 1 346 ? 8.566   -11.141 -24.000 1.00 43.84  ? 346  PHE B CB  1 
ATOM   6774 C  CG  . PHE B 1 346 ? 9.016   -10.243 -22.885 1.00 43.23  ? 346  PHE B CG  1 
ATOM   6775 C  CD1 . PHE B 1 346 ? 10.309  -10.326 -22.390 1.00 42.15  ? 346  PHE B CD1 1 
ATOM   6776 C  CD2 . PHE B 1 346 ? 8.139   -9.341  -22.309 1.00 35.46  ? 346  PHE B CD2 1 
ATOM   6777 C  CE1 . PHE B 1 346 ? 10.722  -9.516  -21.353 1.00 32.16  ? 346  PHE B CE1 1 
ATOM   6778 C  CE2 . PHE B 1 346 ? 8.546   -8.528  -21.274 1.00 41.66  ? 346  PHE B CE2 1 
ATOM   6779 C  CZ  . PHE B 1 346 ? 9.843   -8.614  -20.797 1.00 39.74  ? 346  PHE B CZ  1 
ATOM   6780 N  N   . SER B 1 347 ? 5.966   -13.183 -24.534 1.00 53.30  ? 347  SER B N   1 
ATOM   6781 C  CA  . SER B 1 347 ? 5.093   -13.867 -25.473 1.00 50.36  ? 347  SER B CA  1 
ATOM   6782 C  C   . SER B 1 347 ? 3.774   -13.124 -25.524 1.00 48.90  ? 347  SER B C   1 
ATOM   6783 O  O   . SER B 1 347 ? 3.346   -12.546 -24.526 1.00 48.37  ? 347  SER B O   1 
ATOM   6784 C  CB  . SER B 1 347 ? 4.849   -15.312 -25.027 1.00 57.70  ? 347  SER B CB  1 
ATOM   6785 O  OG  . SER B 1 347 ? 3.704   -15.866 -25.662 1.00 47.72  ? 347  SER B OG  1 
ATOM   6786 N  N   . LYS B 1 348 ? 3.133   -13.139 -26.687 1.00 43.30  ? 348  LYS B N   1 
ATOM   6787 C  CA  . LYS B 1 348 ? 1.825   -12.525 -26.832 1.00 45.78  ? 348  LYS B CA  1 
ATOM   6788 C  C   . LYS B 1 348 ? 0.763   -13.396 -26.168 1.00 56.70  ? 348  LYS B C   1 
ATOM   6789 O  O   . LYS B 1 348 ? -0.387  -12.991 -26.023 1.00 51.67  ? 348  LYS B O   1 
ATOM   6790 C  CB  . LYS B 1 348 ? 1.486   -12.335 -28.312 1.00 51.99  ? 348  LYS B CB  1 
ATOM   6791 C  CG  . LYS B 1 348 ? 1.068   -13.610 -29.022 1.00 49.68  ? 348  LYS B CG  1 
ATOM   6792 C  CD  . LYS B 1 348 ? 0.630   -13.330 -30.452 1.00 57.90  ? 348  LYS B CD  1 
ATOM   6793 C  CE  . LYS B 1 348 ? -0.089  -14.528 -31.059 1.00 52.80  ? 348  LYS B CE  1 
ATOM   6794 N  NZ  . LYS B 1 348 ? -1.399  -14.780 -30.388 1.00 56.81  ? 348  LYS B NZ  1 
ATOM   6795 N  N   . ASP B 1 349 ? 1.146   -14.599 -25.759 1.00 48.97  ? 349  ASP B N   1 
ATOM   6796 C  CA  . ASP B 1 349 ? 0.154   -15.545 -25.265 1.00 53.13  ? 349  ASP B CA  1 
ATOM   6797 C  C   . ASP B 1 349 ? 0.034   -15.602 -23.736 1.00 60.82  ? 349  ASP B C   1 
ATOM   6798 O  O   . ASP B 1 349 ? -1.075  -15.669 -23.207 1.00 67.80  ? 349  ASP B O   1 
ATOM   6799 C  CB  . ASP B 1 349 ? 0.355   -16.920 -25.908 1.00 45.52  ? 349  ASP B CB  1 
ATOM   6800 C  CG  . ASP B 1 349 ? 0.115   -16.890 -27.414 1.00 57.62  ? 349  ASP B CG  1 
ATOM   6801 O  OD1 . ASP B 1 349 ? -0.913  -16.311 -27.839 1.00 46.29  ? 349  ASP B OD1 1 
ATOM   6802 O  OD2 . ASP B 1 349 ? 0.954   -17.429 -28.172 1.00 51.63  ? 349  ASP B OD2 1 
ATOM   6803 N  N   . ASN B 1 350 ? 1.154   -15.554 -23.022 1.00 52.70  ? 350  ASN B N   1 
ATOM   6804 C  CA  . ASN B 1 350 ? 1.076   -15.371 -21.574 1.00 55.96  ? 350  ASN B CA  1 
ATOM   6805 C  C   . ASN B 1 350 ? 1.192   -13.895 -21.178 1.00 61.82  ? 350  ASN B C   1 
ATOM   6806 O  O   . ASN B 1 350 ? 1.338   -13.024 -22.036 1.00 57.33  ? 350  ASN B O   1 
ATOM   6807 C  CB  . ASN B 1 350 ? 2.090   -16.250 -20.828 1.00 46.81  ? 350  ASN B CB  1 
ATOM   6808 C  CG  . ASN B 1 350 ? 3.505   -16.078 -21.331 1.00 56.80  ? 350  ASN B CG  1 
ATOM   6809 O  OD1 . ASN B 1 350 ? 3.916   -14.979 -21.696 1.00 65.96  ? 350  ASN B OD1 1 
ATOM   6810 N  ND2 . ASN B 1 350 ? 4.267   -17.167 -21.340 1.00 52.54  ? 350  ASN B ND2 1 
ATOM   6811 N  N   . GLU B 1 351 ? 1.109   -13.615 -19.882 1.00 56.03  ? 351  GLU B N   1 
ATOM   6812 C  CA  . GLU B 1 351 ? 1.195   -12.238 -19.404 1.00 51.67  ? 351  GLU B CA  1 
ATOM   6813 C  C   . GLU B 1 351 ? 2.638   -11.745 -19.317 1.00 51.56  ? 351  GLU B C   1 
ATOM   6814 O  O   . GLU B 1 351 ? 2.900   -10.646 -18.833 1.00 48.65  ? 351  GLU B O   1 
ATOM   6815 C  CB  . GLU B 1 351 ? 0.489   -12.085 -18.055 1.00 43.52  ? 351  GLU B CB  1 
ATOM   6816 C  CG  . GLU B 1 351 ? -1.005  -11.851 -18.180 1.00 54.31  ? 351  GLU B CG  1 
ATOM   6817 C  CD  . GLU B 1 351 ? -1.692  -11.737 -16.836 1.00 82.35  ? 351  GLU B CD  1 
ATOM   6818 O  OE1 . GLU B 1 351 ? -0.983  -11.739 -15.806 1.00 73.12  ? 351  GLU B OE1 1 
ATOM   6819 O  OE2 . GLU B 1 351 ? -2.940  -11.645 -16.813 1.00 93.10  ? 351  GLU B OE2 1 
ATOM   6820 N  N   . SER B 1 352 ? 3.569   -12.565 -19.790 1.00 43.40  ? 352  SER B N   1 
ATOM   6821 C  CA  . SER B 1 352 ? 4.968   -12.167 -19.871 1.00 51.50  ? 352  SER B CA  1 
ATOM   6822 C  C   . SER B 1 352 ? 5.500   -11.590 -18.562 1.00 49.06  ? 352  SER B C   1 
ATOM   6823 O  O   . SER B 1 352 ? 6.253   -10.618 -18.569 1.00 50.08  ? 352  SER B O   1 
ATOM   6824 C  CB  . SER B 1 352 ? 5.170   -11.154 -21.003 1.00 49.79  ? 352  SER B CB  1 
ATOM   6825 O  OG  . SER B 1 352 ? 5.012   -11.757 -22.272 1.00 52.91  ? 352  SER B OG  1 
ATOM   6826 N  N   . LEU B 1 353 ? 5.107   -12.179 -17.439 1.00 53.42  ? 353  LEU B N   1 
ATOM   6827 C  CA  . LEU B 1 353 ? 5.687   -11.785 -16.162 1.00 44.77  ? 353  LEU B CA  1 
ATOM   6828 C  C   . LEU B 1 353 ? 7.087   -12.366 -16.094 1.00 44.00  ? 353  LEU B C   1 
ATOM   6829 O  O   . LEU B 1 353 ? 7.286   -13.551 -16.347 1.00 60.96  ? 353  LEU B O   1 
ATOM   6830 C  CB  . LEU B 1 353 ? 4.827   -12.267 -14.998 1.00 39.41  ? 353  LEU B CB  1 
ATOM   6831 C  CG  . LEU B 1 353 ? 3.420   -11.665 -15.032 1.00 55.38  ? 353  LEU B CG  1 
ATOM   6832 C  CD1 . LEU B 1 353 ? 2.615   -12.032 -13.794 1.00 35.65  ? 353  LEU B CD1 1 
ATOM   6833 C  CD2 . LEU B 1 353 ? 3.506   -10.157 -15.187 1.00 49.27  ? 353  LEU B CD2 1 
ATOM   6834 N  N   . ILE B 1 354 ? 8.065   -11.526 -15.782 1.00 46.70  ? 354  ILE B N   1 
ATOM   6835 C  CA  . ILE B 1 354 ? 9.454   -11.956 -15.848 1.00 41.65  ? 354  ILE B CA  1 
ATOM   6836 C  C   . ILE B 1 354 ? 10.185  -11.827 -14.518 1.00 42.54  ? 354  ILE B C   1 
ATOM   6837 O  O   . ILE B 1 354 ? 9.675   -11.248 -13.560 1.00 47.80  ? 354  ILE B O   1 
ATOM   6838 C  CB  . ILE B 1 354 ? 10.232  -11.197 -16.939 1.00 42.33  ? 354  ILE B CB  1 
ATOM   6839 C  CG1 . ILE B 1 354 ? 10.210  -9.690  -16.662 1.00 38.80  ? 354  ILE B CG1 1 
ATOM   6840 C  CG2 . ILE B 1 354 ? 9.648   -11.509 -18.312 1.00 44.40  ? 354  ILE B CG2 1 
ATOM   6841 C  CD1 . ILE B 1 354 ? 11.198  -8.902  -17.485 1.00 33.60  ? 354  ILE B CD1 1 
ATOM   6842 N  N   . SER B 1 355 ? 11.389  -12.379 -14.478 1.00 44.54  ? 355  SER B N   1 
ATOM   6843 C  CA  . SER B 1 355 ? 12.206  -12.367 -13.282 1.00 43.04  ? 355  SER B CA  1 
ATOM   6844 C  C   . SER B 1 355 ? 13.266  -11.294 -13.431 1.00 54.70  ? 355  SER B C   1 
ATOM   6845 O  O   . SER B 1 355 ? 13.516  -10.803 -14.531 1.00 54.16  ? 355  SER B O   1 
ATOM   6846 C  CB  . SER B 1 355 ? 12.889  -13.719 -13.115 1.00 45.26  ? 355  SER B CB  1 
ATOM   6847 O  OG  . SER B 1 355 ? 13.874  -13.900 -14.119 1.00 54.25  ? 355  SER B OG  1 
ATOM   6848 N  N   . ARG B 1 356 ? 13.902  -10.942 -12.323 1.00 57.90  ? 356  ARG B N   1 
ATOM   6849 C  CA  . ARG B 1 356 ? 14.957  -9.946  -12.361 1.00 53.73  ? 356  ARG B CA  1 
ATOM   6850 C  C   . ARG B 1 356 ? 16.099  -10.415 -13.260 1.00 51.92  ? 356  ARG B C   1 
ATOM   6851 O  O   . ARG B 1 356 ? 16.733  -9.614  -13.949 1.00 55.00  ? 356  ARG B O   1 
ATOM   6852 C  CB  . ARG B 1 356 ? 15.455  -9.641  -10.947 1.00 52.18  ? 356  ARG B CB  1 
ATOM   6853 C  CG  . ARG B 1 356 ? 16.502  -8.549  -10.893 1.00 59.92  ? 356  ARG B CG  1 
ATOM   6854 C  CD  . ARG B 1 356 ? 16.400  -7.731  -9.620  1.00 52.60  ? 356  ARG B CD  1 
ATOM   6855 N  NE  . ARG B 1 356 ? 17.388  -6.657  -9.616  1.00 67.65  ? 356  ARG B NE  1 
ATOM   6856 C  CZ  . ARG B 1 356 ? 17.211  -5.478  -10.204 1.00 52.35  ? 356  ARG B CZ  1 
ATOM   6857 N  NH1 . ARG B 1 356 ? 16.077  -5.215  -10.837 1.00 48.69  ? 356  ARG B NH1 1 
ATOM   6858 N  NH2 . ARG B 1 356 ? 18.165  -4.559  -10.154 1.00 49.50  ? 356  ARG B NH2 1 
ATOM   6859 N  N   . ALA B 1 357 ? 16.350  -11.719 -13.266 1.00 50.75  ? 357  ALA B N   1 
ATOM   6860 C  CA  . ALA B 1 357 ? 17.431  -12.272 -14.075 1.00 56.26  ? 357  ALA B CA  1 
ATOM   6861 C  C   . ALA B 1 357 ? 17.115  -12.126 -15.551 1.00 49.40  ? 357  ALA B C   1 
ATOM   6862 O  O   . ALA B 1 357 ? 17.987  -11.809 -16.357 1.00 39.83  ? 357  ALA B O   1 
ATOM   6863 C  CB  . ALA B 1 357 ? 17.664  -13.727 -13.730 1.00 50.71  ? 357  ALA B CB  1 
ATOM   6864 N  N   . GLN B 1 358 ? 15.856  -12.368 -15.898 1.00 43.04  ? 358  GLN B N   1 
ATOM   6865 C  CA  . GLN B 1 358 ? 15.407  -12.224 -17.271 1.00 46.07  ? 358  GLN B CA  1 
ATOM   6866 C  C   . GLN B 1 358 ? 15.434  -10.763 -17.687 1.00 54.37  ? 358  GLN B C   1 
ATOM   6867 O  O   . GLN B 1 358 ? 15.723  -10.441 -18.845 1.00 41.06  ? 358  GLN B O   1 
ATOM   6868 C  CB  . GLN B 1 358 ? 14.000  -12.785 -17.423 1.00 47.92  ? 358  GLN B CB  1 
ATOM   6869 C  CG  . GLN B 1 358 ? 13.958  -14.293 -17.419 1.00 45.60  ? 358  GLN B CG  1 
ATOM   6870 C  CD  . GLN B 1 358 ? 12.551  -14.822 -17.350 1.00 49.43  ? 358  GLN B CD  1 
ATOM   6871 O  OE1 . GLN B 1 358 ? 11.763  -14.394 -16.507 1.00 51.27  ? 358  GLN B OE1 1 
ATOM   6872 N  NE2 . GLN B 1 358 ? 12.222  -15.759 -18.236 1.00 39.50  ? 358  GLN B NE2 1 
ATOM   6873 N  N   . PHE B 1 359 ? 15.133  -9.882  -16.735 1.00 50.80  ? 359  PHE B N   1 
ATOM   6874 C  CA  . PHE B 1 359 ? 15.168  -8.449  -16.994 1.00 45.53  ? 359  PHE B CA  1 
ATOM   6875 C  C   . PHE B 1 359 ? 16.575  -7.989  -17.350 1.00 40.13  ? 359  PHE B C   1 
ATOM   6876 O  O   . PHE B 1 359 ? 16.758  -7.210  -18.286 1.00 44.63  ? 359  PHE B O   1 
ATOM   6877 C  CB  . PHE B 1 359 ? 14.629  -7.648  -15.808 1.00 52.34  ? 359  PHE B CB  1 
ATOM   6878 C  CG  . PHE B 1 359 ? 14.821  -6.164  -15.950 1.00 53.18  ? 359  PHE B CG  1 
ATOM   6879 C  CD1 . PHE B 1 359 ? 15.610  -5.461  -15.054 1.00 52.15  ? 359  PHE B CD1 1 
ATOM   6880 C  CD2 . PHE B 1 359 ? 14.230  -5.475  -16.996 1.00 49.40  ? 359  PHE B CD2 1 
ATOM   6881 C  CE1 . PHE B 1 359 ? 15.792  -4.095  -15.190 1.00 47.13  ? 359  PHE B CE1 1 
ATOM   6882 C  CE2 . PHE B 1 359 ? 14.411  -4.113  -17.141 1.00 48.70  ? 359  PHE B CE2 1 
ATOM   6883 C  CZ  . PHE B 1 359 ? 15.193  -3.421  -16.235 1.00 47.59  ? 359  PHE B CZ  1 
ATOM   6884 N  N   . LEU B 1 360 ? 17.570  -8.478  -16.617 1.00 41.43  ? 360  LEU B N   1 
ATOM   6885 C  CA  . LEU B 1 360 ? 18.955  -8.126  -16.919 1.00 45.71  ? 360  LEU B CA  1 
ATOM   6886 C  C   . LEU B 1 360 ? 19.338  -8.693  -18.280 1.00 46.07  ? 360  LEU B C   1 
ATOM   6887 O  O   . LEU B 1 360 ? 19.981  -8.023  -19.091 1.00 44.99  ? 360  LEU B O   1 
ATOM   6888 C  CB  . LEU B 1 360 ? 19.914  -8.634  -15.840 1.00 45.98  ? 360  LEU B CB  1 
ATOM   6889 C  CG  . LEU B 1 360 ? 19.633  -8.275  -14.374 1.00 63.80  ? 360  LEU B CG  1 
ATOM   6890 C  CD1 . LEU B 1 360 ? 20.939  -8.141  -13.610 1.00 46.28  ? 360  LEU B CD1 1 
ATOM   6891 C  CD2 . LEU B 1 360 ? 18.828  -6.995  -14.243 1.00 60.10  ? 360  LEU B CD2 1 
ATOM   6892 N  N   . ALA B 1 361 ? 18.930  -9.932  -18.524 1.00 44.80  ? 361  ALA B N   1 
ATOM   6893 C  CA  . ALA B 1 361 ? 19.142  -10.564 -19.816 1.00 48.90  ? 361  ALA B CA  1 
ATOM   6894 C  C   . ALA B 1 361 ? 18.491  -9.732  -20.920 1.00 37.06  ? 361  ALA B C   1 
ATOM   6895 O  O   . ALA B 1 361 ? 19.116  -9.437  -21.940 1.00 39.36  ? 361  ALA B O   1 
ATOM   6896 C  CB  . ALA B 1 361 ? 18.583  -11.980 -19.811 1.00 41.15  ? 361  ALA B CB  1 
ATOM   6897 N  N   . GLY B 1 362 ? 17.235  -9.354  -20.707 1.00 34.33  ? 362  GLY B N   1 
ATOM   6898 C  CA  . GLY B 1 362 ? 16.514  -8.532  -21.662 1.00 33.24  ? 362  GLY B CA  1 
ATOM   6899 C  C   . GLY B 1 362 ? 17.260  -7.262  -22.027 1.00 45.42  ? 362  GLY B C   1 
ATOM   6900 O  O   . GLY B 1 362 ? 17.337  -6.890  -23.199 1.00 44.85  ? 362  GLY B O   1 
ATOM   6901 N  N   . VAL B 1 363 ? 17.824  -6.599  -21.023 1.00 43.12  ? 363  VAL B N   1 
ATOM   6902 C  CA  . VAL B 1 363 ? 18.511  -5.329  -21.238 1.00 43.06  ? 363  VAL B CA  1 
ATOM   6903 C  C   . VAL B 1 363 ? 19.712  -5.425  -22.193 1.00 39.61  ? 363  VAL B C   1 
ATOM   6904 O  O   . VAL B 1 363 ? 19.970  -4.497  -22.960 1.00 36.76  ? 363  VAL B O   1 
ATOM   6905 C  CB  . VAL B 1 363 ? 18.926  -4.675  -19.897 1.00 41.93  ? 363  VAL B CB  1 
ATOM   6906 C  CG1 . VAL B 1 363 ? 19.953  -3.565  -20.120 1.00 26.15  ? 363  VAL B CG1 1 
ATOM   6907 C  CG2 . VAL B 1 363 ? 17.697  -4.145  -19.171 1.00 35.33  ? 363  VAL B CG2 1 
ATOM   6908 N  N   . ARG B 1 364 ? 20.436  -6.541  -22.157 1.00 37.08  ? 364  ARG B N   1 
ATOM   6909 C  CA  . ARG B 1 364 ? 21.602  -6.705  -23.024 1.00 38.28  ? 364  ARG B CA  1 
ATOM   6910 C  C   . ARG B 1 364 ? 21.153  -6.879  -24.463 1.00 42.89  ? 364  ARG B C   1 
ATOM   6911 O  O   . ARG B 1 364 ? 21.894  -6.582  -25.398 1.00 36.65  ? 364  ARG B O   1 
ATOM   6912 C  CB  . ARG B 1 364 ? 22.446  -7.912  -22.606 1.00 38.66  ? 364  ARG B CB  1 
ATOM   6913 C  CG  . ARG B 1 364 ? 22.679  -8.048  -21.109 1.00 45.79  ? 364  ARG B CG  1 
ATOM   6914 C  CD  . ARG B 1 364 ? 23.277  -6.782  -20.528 1.00 49.34  ? 364  ARG B CD  1 
ATOM   6915 N  NE  . ARG B 1 364 ? 24.383  -6.278  -21.336 1.00 52.96  ? 364  ARG B NE  1 
ATOM   6916 C  CZ  . ARG B 1 364 ? 25.667  -6.428  -21.024 1.00 53.19  ? 364  ARG B CZ  1 
ATOM   6917 N  NH1 . ARG B 1 364 ? 26.009  -7.074  -19.917 1.00 42.99  ? 364  ARG B NH1 1 
ATOM   6918 N  NH2 . ARG B 1 364 ? 26.608  -5.929  -21.818 1.00 41.51  ? 364  ARG B NH2 1 
ATOM   6919 N  N   . ILE B 1 365 ? 19.931  -7.371  -24.632 1.00 45.64  ? 365  ILE B N   1 
ATOM   6920 C  CA  . ILE B 1 365 ? 19.370  -7.576  -25.960 1.00 43.75  ? 365  ILE B CA  1 
ATOM   6921 C  C   . ILE B 1 365 ? 18.725  -6.294  -26.468 1.00 42.18  ? 365  ILE B C   1 
ATOM   6922 O  O   . ILE B 1 365 ? 18.930  -5.905  -27.616 1.00 43.77  ? 365  ILE B O   1 
ATOM   6923 C  CB  . ILE B 1 365 ? 18.351  -8.734  -25.966 1.00 44.95  ? 365  ILE B CB  1 
ATOM   6924 C  CG1 . ILE B 1 365 ? 19.076  -10.066 -25.770 1.00 39.88  ? 365  ILE B CG1 1 
ATOM   6925 C  CG2 . ILE B 1 365 ? 17.549  -8.752  -27.268 1.00 37.36  ? 365  ILE B CG2 1 
ATOM   6926 C  CD1 . ILE B 1 365 ? 18.188  -11.158 -25.246 1.00 39.44  ? 365  ILE B CD1 1 
ATOM   6927 N  N   . GLY B 1 366 ? 17.954  -5.639  -25.603 1.00 37.92  ? 366  GLY B N   1 
ATOM   6928 C  CA  . GLY B 1 366 ? 17.316  -4.377  -25.937 1.00 41.43  ? 366  GLY B CA  1 
ATOM   6929 C  C   . GLY B 1 366 ? 18.296  -3.229  -26.128 1.00 44.47  ? 366  GLY B C   1 
ATOM   6930 O  O   . GLY B 1 366 ? 18.045  -2.312  -26.906 1.00 42.68  ? 366  GLY B O   1 
ATOM   6931 N  N   . VAL B 1 367 ? 19.413  -3.273  -25.412 1.00 36.38  ? 367  VAL B N   1 
ATOM   6932 C  CA  . VAL B 1 367 ? 20.468  -2.283  -25.582 1.00 37.87  ? 367  VAL B CA  1 
ATOM   6933 C  C   . VAL B 1 367 ? 21.755  -2.992  -25.987 1.00 40.21  ? 367  VAL B C   1 
ATOM   6934 O  O   . VAL B 1 367 ? 22.742  -2.985  -25.250 1.00 39.05  ? 367  VAL B O   1 
ATOM   6935 C  CB  . VAL B 1 367 ? 20.704  -1.478  -24.290 1.00 38.08  ? 367  VAL B CB  1 
ATOM   6936 C  CG1 . VAL B 1 367 ? 21.536  -0.241  -24.586 1.00 27.44  ? 367  VAL B CG1 1 
ATOM   6937 C  CG2 . VAL B 1 367 ? 19.378  -1.088  -23.662 1.00 32.71  ? 367  VAL B CG2 1 
ATOM   6938 N  N   . PRO B 1 368 ? 21.743  -3.607  -27.174 1.00 46.03  ? 368  PRO B N   1 
ATOM   6939 C  CA  . PRO B 1 368 ? 22.797  -4.515  -27.635 1.00 40.81  ? 368  PRO B CA  1 
ATOM   6940 C  C   . PRO B 1 368 ? 24.176  -3.868  -27.703 1.00 40.12  ? 368  PRO B C   1 
ATOM   6941 O  O   . PRO B 1 368 ? 25.175  -4.582  -27.763 1.00 52.93  ? 368  PRO B O   1 
ATOM   6942 C  CB  . PRO B 1 368 ? 22.325  -4.883  -29.046 1.00 41.53  ? 368  PRO B CB  1 
ATOM   6943 C  CG  . PRO B 1 368 ? 21.459  -3.735  -29.449 1.00 42.88  ? 368  PRO B CG  1 
ATOM   6944 C  CD  . PRO B 1 368 ? 20.699  -3.450  -28.198 1.00 40.24  ? 368  PRO B CD  1 
ATOM   6945 N  N   . GLN B 1 369 ? 24.234  -2.543  -27.702 1.00 37.89  ? 369  GLN B N   1 
ATOM   6946 C  CA  . GLN B 1 369 ? 25.510  -1.851  -27.832 1.00 43.23  ? 369  GLN B CA  1 
ATOM   6947 C  C   . GLN B 1 369 ? 26.091  -1.557  -26.462 1.00 51.18  ? 369  GLN B C   1 
ATOM   6948 O  O   . GLN B 1 369 ? 27.249  -1.162  -26.340 1.00 54.85  ? 369  GLN B O   1 
ATOM   6949 C  CB  . GLN B 1 369 ? 25.332  -0.533  -28.581 1.00 39.24  ? 369  GLN B CB  1 
ATOM   6950 C  CG  . GLN B 1 369 ? 23.950  -0.346  -29.163 1.00 57.55  ? 369  GLN B CG  1 
ATOM   6951 C  CD  . GLN B 1 369 ? 22.953  0.160   -28.144 1.00 50.56  ? 369  GLN B CD  1 
ATOM   6952 O  OE1 . GLN B 1 369 ? 23.095  1.261   -27.616 1.00 53.69  ? 369  GLN B OE1 1 
ATOM   6953 N  NE2 . GLN B 1 369 ? 21.927  -0.638  -27.872 1.00 50.83  ? 369  GLN B NE2 1 
ATOM   6954 N  N   . ALA B 1 370 ? 25.275  -1.741  -25.433 1.00 36.58  ? 370  ALA B N   1 
ATOM   6955 C  CA  . ALA B 1 370 ? 25.662  -1.365  -24.082 1.00 46.77  ? 370  ALA B CA  1 
ATOM   6956 C  C   . ALA B 1 370 ? 26.842  -2.177  -23.569 1.00 51.61  ? 370  ALA B C   1 
ATOM   6957 O  O   . ALA B 1 370 ? 26.851  -3.405  -23.679 1.00 46.22  ? 370  ALA B O   1 
ATOM   6958 C  CB  . ALA B 1 370 ? 24.479  -1.516  -23.138 1.00 43.33  ? 370  ALA B CB  1 
ATOM   6959 N  N   . SER B 1 371 ? 27.831  -1.484  -23.010 1.00 37.76  ? 371  SER B N   1 
ATOM   6960 C  CA  . SER B 1 371 ? 28.869  -2.136  -22.219 1.00 38.78  ? 371  SER B CA  1 
ATOM   6961 C  C   . SER B 1 371 ? 28.230  -2.640  -20.936 1.00 45.16  ? 371  SER B C   1 
ATOM   6962 O  O   . SER B 1 371 ? 27.063  -2.355  -20.664 1.00 54.10  ? 371  SER B O   1 
ATOM   6963 C  CB  . SER B 1 371 ? 29.994  -1.159  -21.882 1.00 39.66  ? 371  SER B CB  1 
ATOM   6964 O  OG  . SER B 1 371 ? 29.554  -0.173  -20.966 1.00 51.36  ? 371  SER B OG  1 
ATOM   6965 N  N   . ASP B 1 372 ? 28.985  -3.392  -20.145 1.00 41.95  ? 372  ASP B N   1 
ATOM   6966 C  CA  . ASP B 1 372 ? 28.442  -3.938  -18.907 1.00 49.88  ? 372  ASP B CA  1 
ATOM   6967 C  C   . ASP B 1 372 ? 27.965  -2.825  -17.984 1.00 56.39  ? 372  ASP B C   1 
ATOM   6968 O  O   . ASP B 1 372 ? 26.859  -2.883  -17.434 1.00 49.71  ? 372  ASP B O   1 
ATOM   6969 C  CB  . ASP B 1 372 ? 29.483  -4.799  -18.193 1.00 56.56  ? 372  ASP B CB  1 
ATOM   6970 C  CG  . ASP B 1 372 ? 29.753  -6.104  -18.912 1.00 68.15  ? 372  ASP B CG  1 
ATOM   6971 O  OD1 . ASP B 1 372 ? 29.017  -6.422  -19.873 1.00 65.78  ? 372  ASP B OD1 1 
ATOM   6972 O  OD2 . ASP B 1 372 ? 30.702  -6.810  -18.513 1.00 66.37  ? 372  ASP B OD2 1 
ATOM   6973 N  N   . LEU B 1 373 ? 28.809  -1.811  -17.819 1.00 42.47  ? 373  LEU B N   1 
ATOM   6974 C  CA  . LEU B 1 373 ? 28.514  -0.722  -16.902 1.00 42.53  ? 373  LEU B CA  1 
ATOM   6975 C  C   . LEU B 1 373 ? 27.302  0.057   -17.378 1.00 48.47  ? 373  LEU B C   1 
ATOM   6976 O  O   . LEU B 1 373 ? 26.487  0.503   -16.571 1.00 42.57  ? 373  LEU B O   1 
ATOM   6977 C  CB  . LEU B 1 373 ? 29.719  0.209   -16.756 1.00 47.60  ? 373  LEU B CB  1 
ATOM   6978 C  CG  . LEU B 1 373 ? 29.534  1.373   -15.780 1.00 46.82  ? 373  LEU B CG  1 
ATOM   6979 C  CD1 . LEU B 1 373 ? 28.963  0.888   -14.455 1.00 47.39  ? 373  LEU B CD1 1 
ATOM   6980 C  CD2 . LEU B 1 373 ? 30.844  2.096   -15.562 1.00 46.57  ? 373  LEU B CD2 1 
ATOM   6981 N  N   . ALA B 1 374 ? 27.189  0.215   -18.695 1.00 46.25  ? 374  ALA B N   1 
ATOM   6982 C  CA  . ALA B 1 374 ? 26.051  0.911   -19.282 1.00 43.72  ? 374  ALA B CA  1 
ATOM   6983 C  C   . ALA B 1 374 ? 24.761  0.127   -19.060 1.00 42.80  ? 374  ALA B C   1 
ATOM   6984 O  O   . ALA B 1 374 ? 23.718  0.708   -18.746 1.00 41.16  ? 374  ALA B O   1 
ATOM   6985 C  CB  . ALA B 1 374 ? 26.281  1.164   -20.762 1.00 40.22  ? 374  ALA B CB  1 
ATOM   6986 N  N   . ALA B 1 375 ? 24.837  -1.191  -19.216 1.00 39.07  ? 375  ALA B N   1 
ATOM   6987 C  CA  . ALA B 1 375 ? 23.677  -2.050  -18.995 1.00 36.57  ? 375  ALA B CA  1 
ATOM   6988 C  C   . ALA B 1 375 ? 23.281  -2.031  -17.529 1.00 40.37  ? 375  ALA B C   1 
ATOM   6989 O  O   . ALA B 1 375 ? 22.100  -2.082  -17.189 1.00 44.63  ? 375  ALA B O   1 
ATOM   6990 C  CB  . ALA B 1 375 ? 23.967  -3.465  -19.444 1.00 35.45  ? 375  ALA B CB  1 
ATOM   6991 N  N   . GLU B 1 376 ? 24.275  -1.946  -16.656 1.00 45.45  ? 376  GLU B N   1 
ATOM   6992 C  CA  . GLU B 1 376 ? 24.008  -1.867  -15.230 1.00 48.16  ? 376  GLU B CA  1 
ATOM   6993 C  C   . GLU B 1 376 ? 23.334  -0.532  -14.929 1.00 44.89  ? 376  GLU B C   1 
ATOM   6994 O  O   . GLU B 1 376 ? 22.346  -0.469  -14.197 1.00 37.83  ? 376  GLU B O   1 
ATOM   6995 C  CB  . GLU B 1 376 ? 25.309  -2.006  -14.446 1.00 44.74  ? 376  GLU B CB  1 
ATOM   6996 C  CG  . GLU B 1 376 ? 25.191  -2.820  -13.177 1.00 64.23  ? 376  GLU B CG  1 
ATOM   6997 C  CD  . GLU B 1 376 ? 26.502  -3.495  -12.811 1.00 97.25  ? 376  GLU B CD  1 
ATOM   6998 O  OE1 . GLU B 1 376 ? 27.387  -3.602  -13.691 1.00 82.05  ? 376  GLU B OE1 1 
ATOM   6999 O  OE2 . GLU B 1 376 ? 26.646  -3.922  -11.646 1.00 106.16 ? 376  GLU B OE2 1 
ATOM   7000 N  N   . ALA B 1 377 ? 23.868  0.534   -15.515 1.00 34.67  ? 377  ALA B N   1 
ATOM   7001 C  CA  . ALA B 1 377 ? 23.271  1.853   -15.374 1.00 42.17  ? 377  ALA B CA  1 
ATOM   7002 C  C   . ALA B 1 377 ? 21.798  1.817   -15.775 1.00 37.65  ? 377  ALA B C   1 
ATOM   7003 O  O   . ALA B 1 377 ? 20.952  2.399   -15.100 1.00 38.32  ? 377  ALA B O   1 
ATOM   7004 C  CB  . ALA B 1 377 ? 24.033  2.879   -16.210 1.00 32.48  ? 377  ALA B CB  1 
ATOM   7005 N  N   . VAL B 1 378 ? 21.499  1.128   -16.873 1.00 41.95  ? 378  VAL B N   1 
ATOM   7006 C  CA  . VAL B 1 378 ? 20.127  1.031   -17.361 1.00 34.42  ? 378  VAL B CA  1 
ATOM   7007 C  C   . VAL B 1 378 ? 19.253  0.311   -16.344 1.00 39.20  ? 378  VAL B C   1 
ATOM   7008 O  O   . VAL B 1 378 ? 18.209  0.820   -15.931 1.00 38.56  ? 378  VAL B O   1 
ATOM   7009 C  CB  . VAL B 1 378 ? 20.046  0.283   -18.709 1.00 35.85  ? 378  VAL B CB  1 
ATOM   7010 C  CG1 . VAL B 1 378 ? 18.599  -0.019  -19.063 1.00 34.12  ? 378  VAL B CG1 1 
ATOM   7011 C  CG2 . VAL B 1 378 ? 20.713  1.093   -19.813 1.00 32.25  ? 378  VAL B CG2 1 
ATOM   7012 N  N   . VAL B 1 379 ? 19.691  -0.877  -15.943 1.00 31.00  ? 379  VAL B N   1 
ATOM   7013 C  CA  . VAL B 1 379 ? 18.941  -1.696  -15.005 1.00 36.65  ? 379  VAL B CA  1 
ATOM   7014 C  C   . VAL B 1 379 ? 18.637  -0.946  -13.718 1.00 38.60  ? 379  VAL B C   1 
ATOM   7015 O  O   . VAL B 1 379 ? 17.510  -0.974  -13.220 1.00 31.35  ? 379  VAL B O   1 
ATOM   7016 C  CB  . VAL B 1 379 ? 19.705  -2.979  -14.649 1.00 45.42  ? 379  VAL B CB  1 
ATOM   7017 C  CG1 . VAL B 1 379 ? 18.985  -3.726  -13.540 1.00 34.52  ? 379  VAL B CG1 1 
ATOM   7018 C  CG2 . VAL B 1 379 ? 19.863  -3.855  -15.882 1.00 39.38  ? 379  VAL B CG2 1 
ATOM   7019 N  N   . LEU B 1 380 ? 19.649  -0.278  -13.179 1.00 34.97  ? 380  LEU B N   1 
ATOM   7020 C  CA  . LEU B 1 380 ? 19.492  0.434   -11.918 1.00 41.63  ? 380  LEU B CA  1 
ATOM   7021 C  C   . LEU B 1 380 ? 18.511  1.588   -12.073 1.00 45.39  ? 380  LEU B C   1 
ATOM   7022 O  O   . LEU B 1 380 ? 17.711  1.868   -11.178 1.00 43.06  ? 380  LEU B O   1 
ATOM   7023 C  CB  . LEU B 1 380 ? 20.849  0.913   -11.393 1.00 42.70  ? 380  LEU B CB  1 
ATOM   7024 C  CG  . LEU B 1 380 ? 21.839  -0.233  -11.132 1.00 57.71  ? 380  LEU B CG  1 
ATOM   7025 C  CD1 . LEU B 1 380 ? 23.127  0.261   -10.490 1.00 52.13  ? 380  LEU B CD1 1 
ATOM   7026 C  CD2 . LEU B 1 380 ? 21.207  -1.331  -10.280 1.00 55.63  ? 380  LEU B CD2 1 
ATOM   7027 N  N   . HIS B 1 381 ? 18.555  2.242   -13.226 1.00 37.97  ? 381  HIS B N   1 
ATOM   7028 C  CA  . HIS B 1 381 ? 17.646  3.346   -13.492 1.00 32.47  ? 381  HIS B CA  1 
ATOM   7029 C  C   . HIS B 1 381 ? 16.199  2.883   -13.640 1.00 33.80  ? 381  HIS B C   1 
ATOM   7030 O  O   . HIS B 1 381 ? 15.276  3.544   -13.168 1.00 39.65  ? 381  HIS B O   1 
ATOM   7031 C  CB  . HIS B 1 381 ? 18.075  4.100   -14.749 1.00 35.20  ? 381  HIS B CB  1 
ATOM   7032 C  CG  . HIS B 1 381 ? 17.212  5.284   -15.056 1.00 47.04  ? 381  HIS B CG  1 
ATOM   7033 N  ND1 . HIS B 1 381 ? 17.527  6.560   -14.641 1.00 52.36  ? 381  HIS B ND1 1 
ATOM   7034 C  CD2 . HIS B 1 381 ? 16.037  5.381   -15.719 1.00 38.35  ? 381  HIS B CD2 1 
ATOM   7035 C  CE1 . HIS B 1 381 ? 16.586  7.395   -15.045 1.00 55.13  ? 381  HIS B CE1 1 
ATOM   7036 N  NE2 . HIS B 1 381 ? 15.667  6.704   -15.699 1.00 45.37  ? 381  HIS B NE2 1 
ATOM   7037 N  N   . TYR B 1 382 ? 16.002  1.744   -14.299 1.00 40.40  ? 382  TYR B N   1 
ATOM   7038 C  CA  . TYR B 1 382 ? 14.653  1.270   -14.600 1.00 43.20  ? 382  TYR B CA  1 
ATOM   7039 C  C   . TYR B 1 382 ? 14.044  0.382   -13.520 1.00 42.40  ? 382  TYR B C   1 
ATOM   7040 O  O   . TYR B 1 382 ? 12.829  0.183   -13.484 1.00 42.38  ? 382  TYR B O   1 
ATOM   7041 C  CB  . TYR B 1 382 ? 14.612  0.575   -15.959 1.00 35.64  ? 382  TYR B CB  1 
ATOM   7042 C  CG  . TYR B 1 382 ? 14.501  1.547   -17.106 1.00 36.48  ? 382  TYR B CG  1 
ATOM   7043 C  CD1 . TYR B 1 382 ? 15.639  2.100   -17.682 1.00 31.31  ? 382  TYR B CD1 1 
ATOM   7044 C  CD2 . TYR B 1 382 ? 13.258  1.926   -17.605 1.00 31.01  ? 382  TYR B CD2 1 
ATOM   7045 C  CE1 . TYR B 1 382 ? 15.547  2.991   -18.734 1.00 32.40  ? 382  TYR B CE1 1 
ATOM   7046 C  CE2 . TYR B 1 382 ? 13.153  2.819   -18.660 1.00 26.25  ? 382  TYR B CE2 1 
ATOM   7047 C  CZ  . TYR B 1 382 ? 14.303  3.347   -19.219 1.00 36.94  ? 382  TYR B CZ  1 
ATOM   7048 O  OH  . TYR B 1 382 ? 14.221  4.238   -20.261 1.00 39.36  ? 382  TYR B OH  1 
ATOM   7049 N  N   . THR B 1 383 ? 14.889  -0.144  -12.641 1.00 37.54  ? 383  THR B N   1 
ATOM   7050 C  CA  . THR B 1 383 ? 14.416  -0.915  -11.504 1.00 34.21  ? 383  THR B CA  1 
ATOM   7051 C  C   . THR B 1 383 ? 13.583  -0.033  -10.585 1.00 38.81  ? 383  THR B C   1 
ATOM   7052 O  O   . THR B 1 383 ? 13.908  1.134   -10.368 1.00 37.37  ? 383  THR B O   1 
ATOM   7053 C  CB  . THR B 1 383 ? 15.591  -1.493  -10.709 1.00 38.15  ? 383  THR B CB  1 
ATOM   7054 O  OG1 . THR B 1 383 ? 16.301  -2.430  -11.525 1.00 39.27  ? 383  THR B OG1 1 
ATOM   7055 C  CG2 . THR B 1 383 ? 15.101  -2.189  -9.448  1.00 34.22  ? 383  THR B CG2 1 
ATOM   7056 N  N   . ASP B 1 384 ? 12.490  -0.583  -10.069 1.00 42.36  ? 384  ASP B N   1 
ATOM   7057 C  CA  . ASP B 1 384 ? 11.744  0.085   -9.016  1.00 44.31  ? 384  ASP B CA  1 
ATOM   7058 C  C   . ASP B 1 384 ? 12.226  -0.490  -7.691  1.00 49.50  ? 384  ASP B C   1 
ATOM   7059 O  O   . ASP B 1 384 ? 11.945  -1.640  -7.367  1.00 43.23  ? 384  ASP B O   1 
ATOM   7060 C  CB  . ASP B 1 384 ? 10.240  -0.116  -9.184  1.00 37.43  ? 384  ASP B CB  1 
ATOM   7061 C  CG  . ASP B 1 384 ? 9.440   0.513   -8.057  1.00 54.20  ? 384  ASP B CG  1 
ATOM   7062 O  OD1 . ASP B 1 384 ? 10.021  0.765   -6.980  1.00 53.64  ? 384  ASP B OD1 1 
ATOM   7063 O  OD2 . ASP B 1 384 ? 8.229   0.755   -8.243  1.00 58.60  ? 384  ASP B OD2 1 
ATOM   7064 N  N   . TRP B 1 385 ? 12.962  0.314   -6.933  1.00 48.53  ? 385  TRP B N   1 
ATOM   7065 C  CA  . TRP B 1 385 ? 13.655  -0.190  -5.755  1.00 54.59  ? 385  TRP B CA  1 
ATOM   7066 C  C   . TRP B 1 385 ? 12.745  -0.448  -4.562  1.00 46.04  ? 385  TRP B C   1 
ATOM   7067 O  O   . TRP B 1 385 ? 13.168  -1.027  -3.566  1.00 51.08  ? 385  TRP B O   1 
ATOM   7068 C  CB  . TRP B 1 385 ? 14.847  0.706   -5.418  1.00 42.14  ? 385  TRP B CB  1 
ATOM   7069 C  CG  . TRP B 1 385 ? 15.825  0.637   -6.522  1.00 46.17  ? 385  TRP B CG  1 
ATOM   7070 C  CD1 . TRP B 1 385 ? 16.007  1.552   -7.518  1.00 47.52  ? 385  TRP B CD1 1 
ATOM   7071 C  CD2 . TRP B 1 385 ? 16.710  -0.449  -6.804  1.00 43.44  ? 385  TRP B CD2 1 
ATOM   7072 N  NE1 . TRP B 1 385 ? 16.976  1.113   -8.389  1.00 36.63  ? 385  TRP B NE1 1 
ATOM   7073 C  CE2 . TRP B 1 385 ? 17.423  -0.112  -7.972  1.00 37.07  ? 385  TRP B CE2 1 
ATOM   7074 C  CE3 . TRP B 1 385 ? 16.978  -1.667  -6.174  1.00 35.61  ? 385  TRP B CE3 1 
ATOM   7075 C  CZ2 . TRP B 1 385 ? 18.391  -0.952  -8.522  1.00 46.95  ? 385  TRP B CZ2 1 
ATOM   7076 C  CZ3 . TRP B 1 385 ? 17.941  -2.500  -6.724  1.00 42.84  ? 385  TRP B CZ3 1 
ATOM   7077 C  CH2 . TRP B 1 385 ? 18.633  -2.139  -7.884  1.00 44.87  ? 385  TRP B CH2 1 
ATOM   7078 N  N   . LEU B 1 386 ? 11.487  -0.044  -4.684  1.00 46.75  ? 386  LEU B N   1 
ATOM   7079 C  CA  . LEU B 1 386 ? 10.471  -0.460  -3.729  1.00 56.79  ? 386  LEU B CA  1 
ATOM   7080 C  C   . LEU B 1 386 ? 10.031  -1.890  -4.025  1.00 52.49  ? 386  LEU B C   1 
ATOM   7081 O  O   . LEU B 1 386 ? 9.736   -2.656  -3.110  1.00 59.01  ? 386  LEU B O   1 
ATOM   7082 C  CB  . LEU B 1 386 ? 9.278   0.488   -3.772  1.00 56.01  ? 386  LEU B CB  1 
ATOM   7083 C  CG  . LEU B 1 386 ? 9.610   1.867   -3.202  1.00 65.25  ? 386  LEU B CG  1 
ATOM   7084 C  CD1 . LEU B 1 386 ? 8.694   2.954   -3.761  1.00 54.70  ? 386  LEU B CD1 1 
ATOM   7085 C  CD2 . LEU B 1 386 ? 9.563   1.822   -1.679  1.00 64.37  ? 386  LEU B CD2 1 
ATOM   7086 N  N   . HIS B 1 387 ? 10.003  -2.242  -5.310  1.00 54.70  ? 387  HIS B N   1 
ATOM   7087 C  CA  . HIS B 1 387 ? 9.638   -3.589  -5.743  1.00 54.52  ? 387  HIS B CA  1 
ATOM   7088 C  C   . HIS B 1 387 ? 10.606  -4.105  -6.804  1.00 49.03  ? 387  HIS B C   1 
ATOM   7089 O  O   . HIS B 1 387 ? 10.208  -4.347  -7.942  1.00 58.22  ? 387  HIS B O   1 
ATOM   7090 C  CB  . HIS B 1 387 ? 8.222   -3.596  -6.320  1.00 47.26  ? 387  HIS B CB  1 
ATOM   7091 C  CG  . HIS B 1 387 ? 7.337   -2.525  -5.768  1.00 51.71  ? 387  HIS B CG  1 
ATOM   7092 N  ND1 . HIS B 1 387 ? 7.093   -1.345  -6.439  1.00 69.69  ? 387  HIS B ND1 1 
ATOM   7093 C  CD2 . HIS B 1 387 ? 6.642   -2.449  -4.608  1.00 57.94  ? 387  HIS B CD2 1 
ATOM   7094 C  CE1 . HIS B 1 387 ? 6.283   -0.591  -5.718  1.00 64.74  ? 387  HIS B CE1 1 
ATOM   7095 N  NE2 . HIS B 1 387 ? 5.994   -1.237  -4.603  1.00 64.07  ? 387  HIS B NE2 1 
ATOM   7096 N  N   . PRO B 1 388 ? 11.882  -4.274  -6.434  1.00 53.53  ? 388  PRO B N   1 
ATOM   7097 C  CA  . PRO B 1 388 ? 12.943  -4.618  -7.391  1.00 52.33  ? 388  PRO B CA  1 
ATOM   7098 C  C   . PRO B 1 388 ? 12.761  -5.980  -8.049  1.00 51.48  ? 388  PRO B C   1 
ATOM   7099 O  O   . PRO B 1 388 ? 13.524  -6.309  -8.963  1.00 51.19  ? 388  PRO B O   1 
ATOM   7100 C  CB  . PRO B 1 388 ? 14.202  -4.643  -6.513  1.00 52.17  ? 388  PRO B CB  1 
ATOM   7101 C  CG  . PRO B 1 388 ? 13.676  -4.880  -5.127  1.00 47.87  ? 388  PRO B CG  1 
ATOM   7102 C  CD  . PRO B 1 388 ? 12.433  -4.051  -5.088  1.00 43.61  ? 388  PRO B CD  1 
ATOM   7103 N  N   . GLU B 1 389 ? 11.782  -6.758  -7.593  1.00 49.17  ? 389  GLU B N   1 
ATOM   7104 C  CA  . GLU B 1 389 ? 11.595  -8.118  -8.102  1.00 56.25  ? 389  GLU B CA  1 
ATOM   7105 C  C   . GLU B 1 389 ? 10.167  -8.407  -8.560  1.00 56.68  ? 389  GLU B C   1 
ATOM   7106 O  O   . GLU B 1 389 ? 9.880   -9.497  -9.053  1.00 60.35  ? 389  GLU B O   1 
ATOM   7107 C  CB  . GLU B 1 389 ? 12.035  -9.158  -7.065  1.00 47.65  ? 389  GLU B CB  1 
ATOM   7108 C  CG  . GLU B 1 389 ? 13.352  -8.821  -6.383  1.00 73.47  ? 389  GLU B CG  1 
ATOM   7109 C  CD  . GLU B 1 389 ? 14.134  -10.051 -5.966  1.00 77.61  ? 389  GLU B CD  1 
ATOM   7110 O  OE1 . GLU B 1 389 ? 14.695  -10.726 -6.855  1.00 72.46  ? 389  GLU B OE1 1 
ATOM   7111 O  OE2 . GLU B 1 389 ? 14.200  -10.335 -4.750  1.00 92.25  ? 389  GLU B OE2 1 
ATOM   7112 N  N   . ASP B 1 390 ? 9.274   -7.438  -8.393  1.00 41.33  ? 390  ASP B N   1 
ATOM   7113 C  CA  . ASP B 1 390 ? 7.922   -7.569  -8.915  1.00 50.06  ? 390  ASP B CA  1 
ATOM   7114 C  C   . ASP B 1 390 ? 7.951   -7.774  -10.425 1.00 51.68  ? 390  ASP B C   1 
ATOM   7115 O  O   . ASP B 1 390 ? 8.325   -6.873  -11.169 1.00 49.90  ? 390  ASP B O   1 
ATOM   7116 C  CB  . ASP B 1 390 ? 7.102   -6.327  -8.599  1.00 44.81  ? 390  ASP B CB  1 
ATOM   7117 C  CG  . ASP B 1 390 ? 5.765   -6.337  -9.296  1.00 52.00  ? 390  ASP B CG  1 
ATOM   7118 O  OD1 . ASP B 1 390 ? 5.007   -7.312  -9.109  1.00 72.96  ? 390  ASP B OD1 1 
ATOM   7119 O  OD2 . ASP B 1 390 ? 5.473   -5.381  -10.040 1.00 57.63  ? 390  ASP B OD2 1 
ATOM   7120 N  N   . PRO B 1 391 ? 7.545   -8.965  -10.882 1.00 61.47  ? 391  PRO B N   1 
ATOM   7121 C  CA  . PRO B 1 391 ? 7.612   -9.326  -12.303 1.00 54.68  ? 391  PRO B CA  1 
ATOM   7122 C  C   . PRO B 1 391 ? 6.773   -8.423  -13.207 1.00 43.86  ? 391  PRO B C   1 
ATOM   7123 O  O   . PRO B 1 391 ? 7.092   -8.292  -14.387 1.00 51.96  ? 391  PRO B O   1 
ATOM   7124 C  CB  . PRO B 1 391 ? 7.074   -10.762 -12.325 1.00 49.10  ? 391  PRO B CB  1 
ATOM   7125 C  CG  . PRO B 1 391 ? 7.311   -11.271 -10.940 1.00 47.38  ? 391  PRO B CG  1 
ATOM   7126 C  CD  . PRO B 1 391 ? 7.069   -10.084 -10.055 1.00 49.36  ? 391  PRO B CD  1 
ATOM   7127 N  N   . THR B 1 392 ? 5.724   -7.811  -12.673 1.00 41.42  ? 392  THR B N   1 
ATOM   7128 C  CA  . THR B 1 392 ? 4.913   -6.895  -13.471 1.00 44.58  ? 392  THR B CA  1 
ATOM   7129 C  C   . THR B 1 392 ? 5.685   -5.621  -13.824 1.00 51.89  ? 392  THR B C   1 
ATOM   7130 O  O   . THR B 1 392 ? 5.709   -5.207  -14.983 1.00 47.00  ? 392  THR B O   1 
ATOM   7131 C  CB  . THR B 1 392 ? 3.598   -6.523  -12.769 1.00 45.41  ? 392  THR B CB  1 
ATOM   7132 O  OG1 . THR B 1 392 ? 2.748   -7.674  -12.712 1.00 51.62  ? 392  THR B OG1 1 
ATOM   7133 C  CG2 . THR B 1 392 ? 2.888   -5.426  -13.534 1.00 36.18  ? 392  THR B CG2 1 
ATOM   7134 N  N   A HIS B 1 393 ? 6.317   -4.992  -12.840 0.50 48.55  ? 393  HIS B N   1 
ATOM   7135 N  N   B HIS B 1 393 ? 6.300   -5.013  -12.812 0.50 48.57  ? 393  HIS B N   1 
ATOM   7136 C  CA  A HIS B 1 393 ? 7.090   -3.799  -13.152 0.50 47.27  ? 393  HIS B CA  1 
ATOM   7137 C  CA  B HIS B 1 393 ? 7.136   -3.832  -12.993 0.50 47.19  ? 393  HIS B CA  1 
ATOM   7138 C  C   A HIS B 1 393 ? 8.310   -4.153  -13.990 0.50 44.28  ? 393  HIS B C   1 
ATOM   7139 C  C   B HIS B 1 393 ? 8.296   -4.147  -13.929 0.50 44.29  ? 393  HIS B C   1 
ATOM   7140 O  O   A HIS B 1 393 ? 8.691   -3.404  -14.890 0.50 39.94  ? 393  HIS B O   1 
ATOM   7141 O  O   B HIS B 1 393 ? 8.617   -3.374  -14.833 0.50 39.96  ? 393  HIS B O   1 
ATOM   7142 C  CB  A HIS B 1 393 ? 7.524   -3.029  -11.905 0.50 44.01  ? 393  HIS B CB  1 
ATOM   7143 C  CB  B HIS B 1 393 ? 7.693   -3.357  -11.645 0.50 43.13  ? 393  HIS B CB  1 
ATOM   7144 C  CG  A HIS B 1 393 ? 8.328   -1.807  -12.223 0.50 43.81  ? 393  HIS B CG  1 
ATOM   7145 C  CG  B HIS B 1 393 ? 6.725   -2.562  -10.824 0.50 46.76  ? 393  HIS B CG  1 
ATOM   7146 N  ND1 A HIS B 1 393 ? 9.704   -1.779  -12.147 0.50 42.16  ? 393  HIS B ND1 1 
ATOM   7147 N  ND1 B HIS B 1 393 ? 6.370   -1.268  -11.137 0.50 54.44  ? 393  HIS B ND1 1 
ATOM   7148 C  CD2 A HIS B 1 393 ? 7.952   -0.583  -12.665 0.50 45.92  ? 393  HIS B CD2 1 
ATOM   7149 C  CD2 B HIS B 1 393 ? 6.059   -2.868  -9.684  0.50 45.92  ? 393  HIS B CD2 1 
ATOM   7150 C  CE1 A HIS B 1 393 ? 10.139  -0.583  -12.505 0.50 46.18  ? 393  HIS B CE1 1 
ATOM   7151 C  CE1 B HIS B 1 393 ? 5.515   -0.816  -10.236 0.50 48.64  ? 393  HIS B CE1 1 
ATOM   7152 N  NE2 A HIS B 1 393 ? 9.096   0.161   -12.824 0.50 47.80  ? 393  HIS B NE2 1 
ATOM   7153 N  NE2 B HIS B 1 393 ? 5.310   -1.768  -9.343  0.50 42.81  ? 393  HIS B NE2 1 
ATOM   7154 N  N   . LEU B 1 394 ? 8.923   -5.294  -13.692 1.00 40.91  ? 394  LEU B N   1 
ATOM   7155 C  CA  . LEU B 1 394 ? 10.094  -5.718  -14.441 1.00 43.30  ? 394  LEU B CA  1 
ATOM   7156 C  C   . LEU B 1 394 ? 9.757   -5.870  -15.916 1.00 46.94  ? 394  LEU B C   1 
ATOM   7157 O  O   . LEU B 1 394 ? 10.544  -5.497  -16.788 1.00 39.05  ? 394  LEU B O   1 
ATOM   7158 C  CB  . LEU B 1 394 ? 10.641  -7.026  -13.874 1.00 40.53  ? 394  LEU B CB  1 
ATOM   7159 C  CG  . LEU B 1 394 ? 11.408  -6.830  -12.570 1.00 47.90  ? 394  LEU B CG  1 
ATOM   7160 C  CD1 . LEU B 1 394 ? 11.681  -8.161  -11.886 1.00 48.57  ? 394  LEU B CD1 1 
ATOM   7161 C  CD2 . LEU B 1 394 ? 12.701  -6.074  -12.843 1.00 47.05  ? 394  LEU B CD2 1 
ATOM   7162 N  N   . ARG B 1 395 ? 8.575   -6.411  -16.188 1.00 39.78  ? 395  ARG B N   1 
ATOM   7163 C  CA  . ARG B 1 395 ? 8.122   -6.582  -17.557 1.00 42.61  ? 395  ARG B CA  1 
ATOM   7164 C  C   . ARG B 1 395 ? 7.886   -5.216  -18.211 1.00 43.68  ? 395  ARG B C   1 
ATOM   7165 O  O   . ARG B 1 395 ? 8.447   -4.922  -19.267 1.00 38.81  ? 395  ARG B O   1 
ATOM   7166 C  CB  . ARG B 1 395 ? 6.875   -7.473  -17.597 1.00 41.64  ? 395  ARG B CB  1 
ATOM   7167 C  CG  . ARG B 1 395 ? 6.195   -7.557  -18.948 1.00 44.47  ? 395  ARG B CG  1 
ATOM   7168 C  CD  . ARG B 1 395 ? 4.857   -6.842  -18.908 1.00 44.05  ? 395  ARG B CD  1 
ATOM   7169 N  NE  . ARG B 1 395 ? 3.786   -7.743  -18.506 1.00 40.61  ? 395  ARG B NE  1 
ATOM   7170 C  CZ  . ARG B 1 395 ? 2.661   -7.360  -17.910 1.00 52.77  ? 395  ARG B CZ  1 
ATOM   7171 N  NH1 . ARG B 1 395 ? 2.452   -6.080  -17.623 1.00 32.00  ? 395  ARG B NH1 1 
ATOM   7172 N  NH2 . ARG B 1 395 ? 1.748   -8.267  -17.587 1.00 46.93  ? 395  ARG B NH2 1 
ATOM   7173 N  N   . ASP B 1 396 ? 7.083   -4.374  -17.567 1.00 39.33  ? 396  ASP B N   1 
ATOM   7174 C  CA  . ASP B 1 396 ? 6.818   -3.035  -18.080 1.00 37.15  ? 396  ASP B CA  1 
ATOM   7175 C  C   . ASP B 1 396 ? 8.103   -2.215  -18.234 1.00 43.94  ? 396  ASP B C   1 
ATOM   7176 O  O   . ASP B 1 396 ? 8.215   -1.387  -19.139 1.00 37.62  ? 396  ASP B O   1 
ATOM   7177 C  CB  . ASP B 1 396 ? 5.817   -2.302  -17.185 1.00 36.05  ? 396  ASP B CB  1 
ATOM   7178 C  CG  . ASP B 1 396 ? 4.443   -2.943  -17.205 1.00 50.31  ? 396  ASP B CG  1 
ATOM   7179 O  OD1 . ASP B 1 396 ? 4.234   -3.862  -18.025 1.00 46.24  ? 396  ASP B OD1 1 
ATOM   7180 O  OD2 . ASP B 1 396 ? 3.573   -2.527  -16.408 1.00 47.61  ? 396  ASP B OD2 1 
ATOM   7181 N  N   . ALA B 1 397 ? 9.071   -2.450  -17.353 1.00 34.68  ? 397  ALA B N   1 
ATOM   7182 C  CA  . ALA B 1 397 ? 10.339  -1.735  -17.422 1.00 36.72  ? 397  ALA B CA  1 
ATOM   7183 C  C   . ALA B 1 397 ? 11.100  -2.134  -18.678 1.00 39.09  ? 397  ALA B C   1 
ATOM   7184 O  O   . ALA B 1 397 ? 11.669  -1.286  -19.365 1.00 37.25  ? 397  ALA B O   1 
ATOM   7185 C  CB  . ALA B 1 397 ? 11.182  -2.006  -16.182 1.00 33.86  ? 397  ALA B CB  1 
ATOM   7186 N  N   . MET B 1 398 ? 11.109  -3.432  -18.966 1.00 37.94  ? 398  MET B N   1 
ATOM   7187 C  CA  . MET B 1 398 ? 11.788  -3.958  -20.146 1.00 37.76  ? 398  MET B CA  1 
ATOM   7188 C  C   . MET B 1 398 ? 11.230  -3.292  -21.397 1.00 36.85  ? 398  MET B C   1 
ATOM   7189 O  O   . MET B 1 398 ? 11.975  -2.921  -22.303 1.00 36.30  ? 398  MET B O   1 
ATOM   7190 C  CB  . MET B 1 398 ? 11.611  -5.476  -20.230 1.00 37.48  ? 398  MET B CB  1 
ATOM   7191 C  CG  . MET B 1 398 ? 12.448  -6.153  -21.299 1.00 31.45  ? 398  MET B CG  1 
ATOM   7192 S  SD  . MET B 1 398 ? 14.221  -5.909  -21.071 1.00 44.50  ? 398  MET B SD  1 
ATOM   7193 C  CE  . MET B 1 398 ? 14.558  -4.608  -22.254 1.00 43.55  ? 398  MET B CE  1 
ATOM   7194 N  N   . SER B 1 399 ? 9.911   -3.140  -21.433 1.00 28.59  ? 399  SER B N   1 
ATOM   7195 C  CA  . SER B 1 399 ? 9.250   -2.444  -22.525 1.00 34.17  ? 399  SER B CA  1 
ATOM   7196 C  C   . SER B 1 399 ? 9.732   -0.995  -22.606 1.00 41.72  ? 399  SER B C   1 
ATOM   7197 O  O   . SER B 1 399 ? 10.215  -0.539  -23.648 1.00 38.83  ? 399  SER B O   1 
ATOM   7198 C  CB  . SER B 1 399 ? 7.738   -2.476  -22.316 1.00 34.03  ? 399  SER B CB  1 
ATOM   7199 O  OG  . SER B 1 399 ? 7.075   -1.730  -23.315 1.00 34.23  ? 399  SER B OG  1 
ATOM   7200 N  N   . ALA B 1 400 ? 9.594   -0.281  -21.492 1.00 34.39  ? 400  ALA B N   1 
ATOM   7201 C  CA  . ALA B 1 400 ? 10.023  1.110   -21.390 1.00 32.66  ? 400  ALA B CA  1 
ATOM   7202 C  C   . ALA B 1 400 ? 11.465  1.317   -21.855 1.00 35.94  ? 400  ALA B C   1 
ATOM   7203 O  O   . ALA B 1 400 ? 11.759  2.272   -22.575 1.00 36.95  ? 400  ALA B O   1 
ATOM   7204 C  CB  . ALA B 1 400 ? 9.849   1.612   -19.963 1.00 27.90  ? 400  ALA B CB  1 
ATOM   7205 N  N   . VAL B 1 401 ? 12.360  0.429   -21.436 1.00 26.45  ? 401  VAL B N   1 
ATOM   7206 C  CA  . VAL B 1 401 ? 13.757  0.515   -21.838 1.00 31.69  ? 401  VAL B CA  1 
ATOM   7207 C  C   . VAL B 1 401 ? 13.851  0.548   -23.356 1.00 37.16  ? 401  VAL B C   1 
ATOM   7208 O  O   . VAL B 1 401 ? 14.465  1.446   -23.940 1.00 27.92  ? 401  VAL B O   1 
ATOM   7209 C  CB  . VAL B 1 401 ? 14.580  -0.681  -21.301 1.00 39.97  ? 401  VAL B CB  1 
ATOM   7210 C  CG1 . VAL B 1 401 ? 15.898  -0.814  -22.051 1.00 23.65  ? 401  VAL B CG1 1 
ATOM   7211 C  CG2 . VAL B 1 401 ? 14.821  -0.531  -19.809 1.00 32.68  ? 401  VAL B CG2 1 
ATOM   7212 N  N   . VAL B 1 402 ? 13.219  -0.432  -23.991 1.00 31.24  ? 402  VAL B N   1 
ATOM   7213 C  CA  . VAL B 1 402 ? 13.270  -0.553  -25.437 1.00 29.78  ? 402  VAL B CA  1 
ATOM   7214 C  C   . VAL B 1 402 ? 12.611  0.640   -26.118 1.00 34.35  ? 402  VAL B C   1 
ATOM   7215 O  O   . VAL B 1 402 ? 13.183  1.231   -27.033 1.00 27.56  ? 402  VAL B O   1 
ATOM   7216 C  CB  . VAL B 1 402 ? 12.616  -1.864  -25.915 1.00 33.88  ? 402  VAL B CB  1 
ATOM   7217 C  CG1 . VAL B 1 402 ? 12.540  -1.891  -27.435 1.00 28.52  ? 402  VAL B CG1 1 
ATOM   7218 C  CG2 . VAL B 1 402 ? 13.398  -3.058  -25.392 1.00 29.17  ? 402  VAL B CG2 1 
ATOM   7219 N  N   . GLY B 1 403 ? 11.409  0.989   -25.665 1.00 28.27  ? 403  GLY B N   1 
ATOM   7220 C  CA  . GLY B 1 403 ? 10.671  2.102   -26.237 1.00 34.01  ? 403  GLY B CA  1 
ATOM   7221 C  C   . GLY B 1 403 ? 11.375  3.441   -26.091 1.00 41.26  ? 403  GLY B C   1 
ATOM   7222 O  O   . GLY B 1 403 ? 11.420  4.239   -27.029 1.00 37.93  ? 403  GLY B O   1 
ATOM   7223 N  N   . ASP B 1 404 ? 11.931  3.683   -24.908 1.00 33.40  ? 404  ASP B N   1 
ATOM   7224 C  CA  . ASP B 1 404 ? 12.620  4.934   -24.616 1.00 30.93  ? 404  ASP B CA  1 
ATOM   7225 C  C   . ASP B 1 404 ? 13.912  5.041   -25.407 1.00 31.12  ? 404  ASP B C   1 
ATOM   7226 O  O   . ASP B 1 404 ? 14.183  6.049   -26.061 1.00 35.63  ? 404  ASP B O   1 
ATOM   7227 C  CB  . ASP B 1 404 ? 12.936  5.023   -23.123 1.00 32.04  ? 404  ASP B CB  1 
ATOM   7228 C  CG  . ASP B 1 404 ? 11.697  5.199   -22.273 1.00 33.26  ? 404  ASP B CG  1 
ATOM   7229 O  OD1 . ASP B 1 404 ? 10.617  5.498   -22.831 1.00 39.87  ? 404  ASP B OD1 1 
ATOM   7230 O  OD2 . ASP B 1 404 ? 11.805  5.039   -21.040 1.00 33.93  ? 404  ASP B OD2 1 
ATOM   7231 N  N   . HIS B 1 405 ? 14.711  3.988   -25.337 1.00 30.86  ? 405  HIS B N   1 
ATOM   7232 C  CA  . HIS B 1 405 ? 15.990  3.950   -26.026 1.00 35.08  ? 405  HIS B CA  1 
ATOM   7233 C  C   . HIS B 1 405 ? 15.823  4.190   -27.527 1.00 35.04  ? 405  HIS B C   1 
ATOM   7234 O  O   . HIS B 1 405 ? 16.606  4.915   -28.142 1.00 38.96  ? 405  HIS B O   1 
ATOM   7235 C  CB  . HIS B 1 405 ? 16.663  2.603   -25.759 1.00 24.81  ? 405  HIS B CB  1 
ATOM   7236 C  CG  . HIS B 1 405 ? 17.917  2.377   -26.544 1.00 33.12  ? 405  HIS B CG  1 
ATOM   7237 N  ND1 . HIS B 1 405 ? 18.928  3.311   -26.621 1.00 32.03  ? 405  HIS B ND1 1 
ATOM   7238 C  CD2 . HIS B 1 405 ? 18.339  1.305   -27.257 1.00 35.22  ? 405  HIS B CD2 1 
ATOM   7239 C  CE1 . HIS B 1 405 ? 19.912  2.830   -27.360 1.00 34.66  ? 405  HIS B CE1 1 
ATOM   7240 N  NE2 . HIS B 1 405 ? 19.580  1.614   -27.758 1.00 46.19  ? 405  HIS B NE2 1 
ATOM   7241 N  N   . ASN B 1 406 ? 14.784  3.601   -28.106 1.00 28.39  ? 406  ASN B N   1 
ATOM   7242 C  CA  . ASN B 1 406 ? 14.651  3.562   -29.559 1.00 36.50  ? 406  ASN B CA  1 
ATOM   7243 C  C   . ASN B 1 406 ? 13.740  4.612   -30.181 1.00 35.08  ? 406  ASN B C   1 
ATOM   7244 O  O   . ASN B 1 406 ? 13.986  5.050   -31.300 1.00 33.80  ? 406  ASN B O   1 
ATOM   7245 C  CB  . ASN B 1 406 ? 14.221  2.164   -30.011 1.00 39.46  ? 406  ASN B CB  1 
ATOM   7246 C  CG  . ASN B 1 406 ? 15.334  1.154   -29.875 1.00 30.44  ? 406  ASN B CG  1 
ATOM   7247 O  OD1 . ASN B 1 406 ? 16.400  1.317   -30.462 1.00 31.54  ? 406  ASN B OD1 1 
ATOM   7248 N  ND2 . ASN B 1 406 ? 15.101  0.113   -29.081 1.00 32.62  ? 406  ASN B ND2 1 
ATOM   7249 N  N   . VAL B 1 407 ? 12.691  5.012   -29.469 1.00 29.56  ? 407  VAL B N   1 
ATOM   7250 C  CA  . VAL B 1 407 ? 11.756  5.985   -30.020 1.00 33.22  ? 407  VAL B CA  1 
ATOM   7251 C  C   . VAL B 1 407 ? 11.612  7.265   -29.191 1.00 32.07  ? 407  VAL B C   1 
ATOM   7252 O  O   . VAL B 1 407 ? 11.941  8.354   -29.658 1.00 34.75  ? 407  VAL B O   1 
ATOM   7253 C  CB  . VAL B 1 407 ? 10.364  5.361   -30.245 1.00 36.50  ? 407  VAL B CB  1 
ATOM   7254 C  CG1 . VAL B 1 407 ? 9.435   6.367   -30.909 1.00 31.94  ? 407  VAL B CG1 1 
ATOM   7255 C  CG2 . VAL B 1 407 ? 10.480  4.102   -31.086 1.00 32.20  ? 407  VAL B CG2 1 
ATOM   7256 N  N   . VAL B 1 408 ? 11.127  7.126   -27.964 1.00 27.10  ? 408  VAL B N   1 
ATOM   7257 C  CA  . VAL B 1 408 ? 10.753  8.276   -27.143 1.00 29.04  ? 408  VAL B CA  1 
ATOM   7258 C  C   . VAL B 1 408 ? 11.865  9.297   -26.926 1.00 32.90  ? 408  VAL B C   1 
ATOM   7259 O  O   . VAL B 1 408 ? 11.659  10.498  -27.085 1.00 30.06  ? 408  VAL B O   1 
ATOM   7260 C  CB  . VAL B 1 408 ? 10.232  7.834   -25.771 1.00 31.95  ? 408  VAL B CB  1 
ATOM   7261 C  CG1 . VAL B 1 408 ? 9.818   9.046   -24.960 1.00 24.30  ? 408  VAL B CG1 1 
ATOM   7262 C  CG2 . VAL B 1 408 ? 9.072   6.866   -25.940 1.00 25.85  ? 408  VAL B CG2 1 
ATOM   7263 N  N   . CYS B 1 409 ? 13.045  8.830   -26.553 1.00 28.16  ? 409  CYS B N   1 
ATOM   7264 C  CA  . CYS B 1 409 ? 14.127  9.758   -26.276 1.00 28.09  ? 409  CYS B CA  1 
ATOM   7265 C  C   . CYS B 1 409 ? 14.770  10.317  -27.548 1.00 29.72  ? 409  CYS B C   1 
ATOM   7266 O  O   . CYS B 1 409 ? 15.138  11.491  -27.588 1.00 36.54  ? 409  CYS B O   1 
ATOM   7267 C  CB  . CYS B 1 409 ? 15.144  9.139   -25.315 1.00 22.47  ? 409  CYS B CB  1 
ATOM   7268 S  SG  . CYS B 1 409 ? 14.404  8.781   -23.695 1.00 34.53  ? 409  CYS B SG  1 
ATOM   7269 N  N   . PRO B 1 410 ? 14.902  9.484   -28.594 1.00 32.02  ? 410  PRO B N   1 
ATOM   7270 C  CA  . PRO B 1 410 ? 15.323  10.024  -29.894 1.00 34.72  ? 410  PRO B CA  1 
ATOM   7271 C  C   . PRO B 1 410 ? 14.344  11.074  -30.417 1.00 31.00  ? 410  PRO B C   1 
ATOM   7272 O  O   . PRO B 1 410 ? 14.775  12.070  -31.002 1.00 32.55  ? 410  PRO B O   1 
ATOM   7273 C  CB  . PRO B 1 410 ? 15.329  8.792   -30.800 1.00 29.72  ? 410  PRO B CB  1 
ATOM   7274 C  CG  . PRO B 1 410 ? 15.604  7.662   -29.875 1.00 35.61  ? 410  PRO B CG  1 
ATOM   7275 C  CD  . PRO B 1 410 ? 14.909  8.010   -28.583 1.00 32.33  ? 410  PRO B CD  1 
ATOM   7276 N  N   . VAL B 1 411 ? 13.050  10.863  -30.194 1.00 28.92  ? 411  VAL B N   1 
ATOM   7277 C  CA  . VAL B 1 411 ? 12.041  11.861  -30.550 1.00 32.66  ? 411  VAL B CA  1 
ATOM   7278 C  C   . VAL B 1 411 ? 12.160  13.133  -29.697 1.00 30.77  ? 411  VAL B C   1 
ATOM   7279 O  O   . VAL B 1 411 ? 12.040  14.252  -30.207 1.00 28.63  ? 411  VAL B O   1 
ATOM   7280 C  CB  . VAL B 1 411 ? 10.609  11.291  -30.443 1.00 27.40  ? 411  VAL B CB  1 
ATOM   7281 C  CG1 . VAL B 1 411 ? 9.592   12.407  -30.397 1.00 25.08  ? 411  VAL B CG1 1 
ATOM   7282 C  CG2 . VAL B 1 411 ? 10.321  10.369  -31.612 1.00 27.21  ? 411  VAL B CG2 1 
ATOM   7283 N  N   . ALA B 1 412 ? 12.397  12.954  -28.401 1.00 29.47  ? 412  ALA B N   1 
ATOM   7284 C  CA  . ALA B 1 412 ? 12.531  14.080  -27.483 1.00 29.00  ? 412  ALA B CA  1 
ATOM   7285 C  C   . ALA B 1 412 ? 13.719  14.933  -27.904 1.00 36.78  ? 412  ALA B C   1 
ATOM   7286 O  O   . ALA B 1 412 ? 13.659  16.166  -27.908 1.00 32.89  ? 412  ALA B O   1 
ATOM   7287 C  CB  . ALA B 1 412 ? 12.711  13.586  -26.058 1.00 37.45  ? 412  ALA B CB  1 
ATOM   7288 N  N   . GLN B 1 413 ? 14.798  14.261  -28.278 1.00 29.22  ? 413  GLN B N   1 
ATOM   7289 C  CA  . GLN B 1 413 ? 15.983  14.949  -28.758 1.00 32.54  ? 413  GLN B CA  1 
ATOM   7290 C  C   . GLN B 1 413 ? 15.714  15.741  -30.034 1.00 33.98  ? 413  GLN B C   1 
ATOM   7291 O  O   . GLN B 1 413 ? 16.030  16.927  -30.123 1.00 35.57  ? 413  GLN B O   1 
ATOM   7292 C  CB  . GLN B 1 413 ? 17.106  13.949  -28.998 1.00 32.84  ? 413  GLN B CB  1 
ATOM   7293 C  CG  . GLN B 1 413 ? 18.293  14.549  -29.699 1.00 43.03  ? 413  GLN B CG  1 
ATOM   7294 C  CD  . GLN B 1 413 ? 19.590  14.109  -29.078 1.00 60.31  ? 413  GLN B CD  1 
ATOM   7295 O  OE1 . GLN B 1 413 ? 20.141  14.801  -28.220 1.00 77.09  ? 413  GLN B OE1 1 
ATOM   7296 N  NE2 . GLN B 1 413 ? 20.074  12.937  -29.477 1.00 50.68  ? 413  GLN B NE2 1 
ATOM   7297 N  N   . LEU B 1 414 ? 15.140  15.076  -31.028 1.00 36.59  ? 414  LEU B N   1 
ATOM   7298 C  CA  . LEU B 1 414 ? 14.843  15.734  -32.288 1.00 38.39  ? 414  LEU B CA  1 
ATOM   7299 C  C   . LEU B 1 414 ? 13.943  16.952  -32.058 1.00 38.64  ? 414  LEU B C   1 
ATOM   7300 O  O   . LEU B 1 414 ? 14.207  18.038  -32.573 1.00 30.44  ? 414  LEU B O   1 
ATOM   7301 C  CB  . LEU B 1 414 ? 14.184  14.753  -33.254 1.00 37.75  ? 414  LEU B CB  1 
ATOM   7302 C  CG  . LEU B 1 414 ? 13.881  15.314  -34.642 1.00 36.09  ? 414  LEU B CG  1 
ATOM   7303 C  CD1 . LEU B 1 414 ? 15.171  15.559  -35.402 1.00 32.38  ? 414  LEU B CD1 1 
ATOM   7304 C  CD2 . LEU B 1 414 ? 12.978  14.371  -35.407 1.00 37.48  ? 414  LEU B CD2 1 
ATOM   7305 N  N   . ALA B 1 415 ? 12.885  16.764  -31.274 1.00 31.54  ? 415  ALA B N   1 
ATOM   7306 C  CA  . ALA B 1 415 ? 11.953  17.842  -30.979 1.00 32.49  ? 415  ALA B CA  1 
ATOM   7307 C  C   . ALA B 1 415 ? 12.712  19.046  -30.442 1.00 39.59  ? 415  ALA B C   1 
ATOM   7308 O  O   . ALA B 1 415 ? 12.581  20.157  -30.953 1.00 40.24  ? 415  ALA B O   1 
ATOM   7309 C  CB  . ALA B 1 415 ? 10.911  17.380  -29.976 1.00 27.74  ? 415  ALA B CB  1 
ATOM   7310 N  N   . GLY B 1 416 ? 13.514  18.806  -29.412 1.00 29.61  ? 416  GLY B N   1 
ATOM   7311 C  CA  . GLY B 1 416 ? 14.320  19.846  -28.804 1.00 35.43  ? 416  GLY B CA  1 
ATOM   7312 C  C   . GLY B 1 416 ? 15.242  20.562  -29.771 1.00 41.99  ? 416  GLY B C   1 
ATOM   7313 O  O   . GLY B 1 416 ? 15.260  21.792  -29.807 1.00 39.70  ? 416  GLY B O   1 
ATOM   7314 N  N   . ARG B 1 417 ? 16.011  19.803  -30.551 1.00 32.73  ? 417  ARG B N   1 
ATOM   7315 C  CA  . ARG B 1 417 ? 16.928  20.399  -31.524 1.00 28.15  ? 417  ARG B CA  1 
ATOM   7316 C  C   . ARG B 1 417 ? 16.197  21.220  -32.587 1.00 37.96  ? 417  ARG B C   1 
ATOM   7317 O  O   . ARG B 1 417 ? 16.634  22.313  -32.949 1.00 41.09  ? 417  ARG B O   1 
ATOM   7318 C  CB  . ARG B 1 417 ? 17.810  19.338  -32.192 1.00 40.79  ? 417  ARG B CB  1 
ATOM   7319 C  CG  . ARG B 1 417 ? 18.770  18.630  -31.248 1.00 39.09  ? 417  ARG B CG  1 
ATOM   7320 C  CD  . ARG B 1 417 ? 19.265  19.568  -30.163 1.00 45.03  ? 417  ARG B CD  1 
ATOM   7321 N  NE  . ARG B 1 417 ? 20.097  20.639  -30.700 1.00 56.49  ? 417  ARG B NE  1 
ATOM   7322 C  CZ  . ARG B 1 417 ? 21.370  20.832  -30.369 1.00 72.35  ? 417  ARG B CZ  1 
ATOM   7323 N  NH1 . ARG B 1 417 ? 21.958  20.032  -29.487 1.00 56.91  ? 417  ARG B NH1 1 
ATOM   7324 N  NH2 . ARG B 1 417 ? 22.053  21.832  -30.914 1.00 65.87  ? 417  ARG B NH2 1 
ATOM   7325 N  N   . LEU B 1 418 ? 15.080  20.698  -33.082 1.00 33.96  ? 418  LEU B N   1 
ATOM   7326 C  CA  . LEU B 1 418 ? 14.324  21.397  -34.114 1.00 35.77  ? 418  LEU B CA  1 
ATOM   7327 C  C   . LEU B 1 418 ? 13.733  22.696  -33.572 1.00 41.18  ? 418  LEU B C   1 
ATOM   7328 O  O   . LEU B 1 418 ? 13.830  23.750  -34.203 1.00 38.07  ? 418  LEU B O   1 
ATOM   7329 C  CB  . LEU B 1 418 ? 13.215  20.505  -34.675 1.00 37.89  ? 418  LEU B CB  1 
ATOM   7330 C  CG  . LEU B 1 418 ? 13.633  19.270  -35.476 1.00 39.02  ? 418  LEU B CG  1 
ATOM   7331 C  CD1 . LEU B 1 418 ? 12.416  18.431  -35.836 1.00 35.57  ? 418  LEU B CD1 1 
ATOM   7332 C  CD2 . LEU B 1 418 ? 14.382  19.681  -36.723 1.00 35.33  ? 418  LEU B CD2 1 
ATOM   7333 N  N   . ALA B 1 419 ? 13.120  22.615  -32.397 1.00 35.39  ? 419  ALA B N   1 
ATOM   7334 C  CA  . ALA B 1 419 ? 12.511  23.787  -31.790 1.00 36.76  ? 419  ALA B CA  1 
ATOM   7335 C  C   . ALA B 1 419 ? 13.585  24.839  -31.537 1.00 43.54  ? 419  ALA B C   1 
ATOM   7336 O  O   . ALA B 1 419 ? 13.392  26.022  -31.812 1.00 44.27  ? 419  ALA B O   1 
ATOM   7337 C  CB  . ALA B 1 419 ? 11.798  23.411  -30.488 1.00 26.22  ? 419  ALA B CB  1 
ATOM   7338 N  N   . ALA B 1 420 ? 14.729  24.388  -31.033 1.00 41.37  ? 420  ALA B N   1 
ATOM   7339 C  CA  . ALA B 1 420 ? 15.827  25.281  -30.683 1.00 35.29  ? 420  ALA B CA  1 
ATOM   7340 C  C   . ALA B 1 420 ? 16.459  25.938  -31.906 1.00 45.88  ? 420  ALA B C   1 
ATOM   7341 O  O   . ALA B 1 420 ? 17.103  26.979  -31.797 1.00 45.31  ? 420  ALA B O   1 
ATOM   7342 C  CB  . ALA B 1 420 ? 16.882  24.525  -29.892 1.00 32.08  ? 420  ALA B CB  1 
ATOM   7343 N  N   . GLN B 1 421 ? 16.281  25.336  -33.073 1.00 37.40  ? 421  GLN B N   1 
ATOM   7344 C  CA  . GLN B 1 421 ? 16.938  25.854  -34.261 1.00 35.18  ? 421  GLN B CA  1 
ATOM   7345 C  C   . GLN B 1 421 ? 15.972  26.312  -35.349 1.00 35.73  ? 421  GLN B C   1 
ATOM   7346 O  O   . GLN B 1 421 ? 16.209  26.098  -36.537 1.00 38.74  ? 421  GLN B O   1 
ATOM   7347 C  CB  . GLN B 1 421 ? 17.965  24.844  -34.781 1.00 39.70  ? 421  GLN B CB  1 
ATOM   7348 C  CG  . GLN B 1 421 ? 19.154  24.710  -33.835 1.00 38.82  ? 421  GLN B CG  1 
ATOM   7349 C  CD  . GLN B 1 421 ? 19.816  23.355  -33.891 1.00 51.41  ? 421  GLN B CD  1 
ATOM   7350 O  OE1 . GLN B 1 421 ? 20.017  22.706  -32.861 1.00 53.83  ? 421  GLN B OE1 1 
ATOM   7351 N  NE2 . GLN B 1 421 ? 20.159  22.914  -35.093 1.00 64.68  ? 421  GLN B NE2 1 
ATOM   7352 N  N   . GLY B 1 422 ? 14.881  26.948  -34.931 1.00 37.15  ? 422  GLY B N   1 
ATOM   7353 C  CA  . GLY B 1 422 ? 14.022  27.660  -35.859 1.00 43.93  ? 422  GLY B CA  1 
ATOM   7354 C  C   . GLY B 1 422 ? 12.735  26.979  -36.280 1.00 43.27  ? 422  GLY B C   1 
ATOM   7355 O  O   . GLY B 1 422 ? 11.834  27.631  -36.799 1.00 48.34  ? 422  GLY B O   1 
ATOM   7356 N  N   . ALA B 1 423 ? 12.639  25.673  -36.064 1.00 35.20  ? 423  ALA B N   1 
ATOM   7357 C  CA  . ALA B 1 423 ? 11.475  24.931  -36.527 1.00 36.19  ? 423  ALA B CA  1 
ATOM   7358 C  C   . ALA B 1 423 ? 10.264  25.144  -35.632 1.00 36.47  ? 423  ALA B C   1 
ATOM   7359 O  O   . ALA B 1 423 ? 10.389  25.259  -34.414 1.00 36.86  ? 423  ALA B O   1 
ATOM   7360 C  CB  . ALA B 1 423 ? 11.792  23.446  -36.634 1.00 31.15  ? 423  ALA B CB  1 
ATOM   7361 N  N   . ARG B 1 424 ? 9.091   25.188  -36.252 1.00 35.47  ? 424  ARG B N   1 
ATOM   7362 C  CA  . ARG B 1 424 ? 7.833   25.118  -35.528 1.00 37.04  ? 424  ARG B CA  1 
ATOM   7363 C  C   . ARG B 1 424 ? 7.525   23.648  -35.262 1.00 37.34  ? 424  ARG B C   1 
ATOM   7364 O  O   . ARG B 1 424 ? 7.426   22.855  -36.192 1.00 38.91  ? 424  ARG B O   1 
ATOM   7365 C  CB  . ARG B 1 424 ? 6.725   25.745  -36.364 1.00 43.47  ? 424  ARG B CB  1 
ATOM   7366 C  CG  . ARG B 1 424 ? 5.389   25.838  -35.661 1.00 52.40  ? 424  ARG B CG  1 
ATOM   7367 C  CD  . ARG B 1 424 ? 4.459   26.775  -36.422 1.00 54.14  ? 424  ARG B CD  1 
ATOM   7368 N  NE  . ARG B 1 424 ? 3.500   27.407  -35.529 1.00 67.61  ? 424  ARG B NE  1 
ATOM   7369 C  CZ  . ARG B 1 424 ? 3.829   28.270  -34.574 1.00 45.46  ? 424  ARG B CZ  1 
ATOM   7370 N  NH1 . ARG B 1 424 ? 5.097   28.599  -34.370 1.00 50.67  ? 424  ARG B NH1 1 
ATOM   7371 N  NH2 . ARG B 1 424 ? 2.890   28.788  -33.810 1.00 50.49  ? 424  ARG B NH2 1 
ATOM   7372 N  N   . VAL B 1 425 ? 7.385   23.280  -33.995 1.00 36.23  ? 425  VAL B N   1 
ATOM   7373 C  CA  . VAL B 1 425 ? 7.236   21.878  -33.636 1.00 34.87  ? 425  VAL B CA  1 
ATOM   7374 C  C   . VAL B 1 425 ? 6.001   21.643  -32.791 1.00 31.75  ? 425  VAL B C   1 
ATOM   7375 O  O   . VAL B 1 425 ? 5.729   22.408  -31.873 1.00 33.13  ? 425  VAL B O   1 
ATOM   7376 C  CB  . VAL B 1 425 ? 8.461   21.388  -32.839 1.00 37.73  ? 425  VAL B CB  1 
ATOM   7377 C  CG1 . VAL B 1 425 ? 8.340   19.895  -32.525 1.00 27.52  ? 425  VAL B CG1 1 
ATOM   7378 C  CG2 . VAL B 1 425 ? 9.735   21.689  -33.601 1.00 26.42  ? 425  VAL B CG2 1 
ATOM   7379 N  N   . TYR B 1 426 ? 5.260   20.584  -33.112 1.00 32.49  ? 426  TYR B N   1 
ATOM   7380 C  CA  . TYR B 1 426 ? 4.151   20.114  -32.284 1.00 30.60  ? 426  TYR B CA  1 
ATOM   7381 C  C   . TYR B 1 426 ? 4.392   18.666  -31.877 1.00 37.82  ? 426  TYR B C   1 
ATOM   7382 O  O   . TYR B 1 426 ? 4.857   17.862  -32.683 1.00 37.08  ? 426  TYR B O   1 
ATOM   7383 C  CB  . TYR B 1 426 ? 2.825   20.227  -33.033 1.00 35.19  ? 426  TYR B CB  1 
ATOM   7384 C  CG  . TYR B 1 426 ? 2.410   21.648  -33.314 1.00 34.03  ? 426  TYR B CG  1 
ATOM   7385 C  CD1 . TYR B 1 426 ? 2.723   22.250  -34.522 1.00 26.85  ? 426  TYR B CD1 1 
ATOM   7386 C  CD2 . TYR B 1 426 ? 1.716   22.394  -32.363 1.00 31.45  ? 426  TYR B CD2 1 
ATOM   7387 C  CE1 . TYR B 1 426 ? 2.355   23.552  -34.783 1.00 39.34  ? 426  TYR B CE1 1 
ATOM   7388 C  CE2 . TYR B 1 426 ? 1.343   23.697  -32.614 1.00 29.91  ? 426  TYR B CE2 1 
ATOM   7389 C  CZ  . TYR B 1 426 ? 1.664   24.271  -33.831 1.00 35.48  ? 426  TYR B CZ  1 
ATOM   7390 O  OH  . TYR B 1 426 ? 1.305   25.568  -34.108 1.00 34.00  ? 426  TYR B OH  1 
ATOM   7391 N  N   . ALA B 1 427 ? 4.069   18.332  -30.631 1.00 32.50  ? 427  ALA B N   1 
ATOM   7392 C  CA  . ALA B 1 427 ? 4.372   17.009  -30.102 1.00 33.53  ? 427  ALA B CA  1 
ATOM   7393 C  C   . ALA B 1 427 ? 3.184   16.359  -29.400 1.00 36.67  ? 427  ALA B C   1 
ATOM   7394 O  O   . ALA B 1 427 ? 2.408   17.027  -28.716 1.00 32.36  ? 427  ALA B O   1 
ATOM   7395 C  CB  . ALA B 1 427 ? 5.562   17.082  -29.164 1.00 27.63  ? 427  ALA B CB  1 
ATOM   7396 N  N   . TYR B 1 428 ? 3.060   15.047  -29.562 1.00 26.47  ? 428  TYR B N   1 
ATOM   7397 C  CA  . TYR B 1 428 ? 1.971   14.307  -28.941 1.00 23.49  ? 428  TYR B CA  1 
ATOM   7398 C  C   . TYR B 1 428 ? 2.451   12.993  -28.352 1.00 32.24  ? 428  TYR B C   1 
ATOM   7399 O  O   . TYR B 1 428 ? 3.514   12.480  -28.706 1.00 24.93  ? 428  TYR B O   1 
ATOM   7400 C  CB  . TYR B 1 428 ? 0.879   13.991  -29.970 1.00 31.41  ? 428  TYR B CB  1 
ATOM   7401 C  CG  . TYR B 1 428 ? 1.332   13.013  -31.032 1.00 30.64  ? 428  TYR B CG  1 
ATOM   7402 C  CD1 . TYR B 1 428 ? 1.336   11.643  -30.790 1.00 31.97  ? 428  TYR B CD1 1 
ATOM   7403 C  CD2 . TYR B 1 428 ? 1.774   13.460  -32.270 1.00 23.87  ? 428  TYR B CD2 1 
ATOM   7404 C  CE1 . TYR B 1 428 ? 1.765   10.746  -31.757 1.00 29.76  ? 428  TYR B CE1 1 
ATOM   7405 C  CE2 . TYR B 1 428 ? 2.198   12.575  -33.241 1.00 25.74  ? 428  TYR B CE2 1 
ATOM   7406 C  CZ  . TYR B 1 428 ? 2.193   11.221  -32.981 1.00 32.80  ? 428  TYR B CZ  1 
ATOM   7407 O  OH  . TYR B 1 428 ? 2.620   10.342  -33.952 1.00 36.91  ? 428  TYR B OH  1 
ATOM   7408 N  N   . ILE B 1 429 ? 1.649   12.456  -27.443 1.00 32.43  ? 429  ILE B N   1 
ATOM   7409 C  CA  . ILE B 1 429 ? 1.741   11.059  -27.074 1.00 28.11  ? 429  ILE B CA  1 
ATOM   7410 C  C   . ILE B 1 429 ? 0.362   10.457  -27.318 1.00 35.62  ? 429  ILE B C   1 
ATOM   7411 O  O   . ILE B 1 429 ? -0.664  11.037  -26.949 1.00 31.04  ? 429  ILE B O   1 
ATOM   7412 C  CB  . ILE B 1 429 ? 2.175   10.859  -25.615 1.00 31.01  ? 429  ILE B CB  1 
ATOM   7413 C  CG1 . ILE B 1 429 ? 2.350   9.367   -25.318 1.00 36.08  ? 429  ILE B CG1 1 
ATOM   7414 C  CG2 . ILE B 1 429 ? 1.162   11.483  -24.653 1.00 30.22  ? 429  ILE B CG2 1 
ATOM   7415 C  CD1 . ILE B 1 429 ? 2.953   9.077   -23.950 1.00 35.82  ? 429  ILE B CD1 1 
ATOM   7416 N  N   . PHE B 1 430 ? 0.345   9.304   -27.971 1.00 28.93  ? 430  PHE B N   1 
ATOM   7417 C  CA  . PHE B 1 430 ? -0.892  8.645   -28.350 1.00 29.47  ? 430  PHE B CA  1 
ATOM   7418 C  C   . PHE B 1 430 ? -1.184  7.524   -27.360 1.00 33.32  ? 430  PHE B C   1 
ATOM   7419 O  O   . PHE B 1 430 ? -0.393  6.594   -27.219 1.00 32.81  ? 430  PHE B O   1 
ATOM   7420 C  CB  . PHE B 1 430 ? -0.742  8.090   -29.761 1.00 34.22  ? 430  PHE B CB  1 
ATOM   7421 C  CG  . PHE B 1 430 ? -2.001  7.524   -30.335 1.00 35.59  ? 430  PHE B CG  1 
ATOM   7422 C  CD1 . PHE B 1 430 ? -2.354  6.207   -30.098 1.00 33.64  ? 430  PHE B CD1 1 
ATOM   7423 C  CD2 . PHE B 1 430 ? -2.815  8.299   -31.142 1.00 30.27  ? 430  PHE B CD2 1 
ATOM   7424 C  CE1 . PHE B 1 430 ? -3.505  5.676   -30.642 1.00 37.64  ? 430  PHE B CE1 1 
ATOM   7425 C  CE2 . PHE B 1 430 ? -3.968  7.777   -31.689 1.00 33.05  ? 430  PHE B CE2 1 
ATOM   7426 C  CZ  . PHE B 1 430 ? -4.313  6.460   -31.439 1.00 36.65  ? 430  PHE B CZ  1 
ATOM   7427 N  N   . GLU B 1 431 ? -2.322  7.612   -26.679 1.00 33.24  ? 431  GLU B N   1 
ATOM   7428 C  CA  . GLU B 1 431 ? -2.579  6.740   -25.536 1.00 38.58  ? 431  GLU B CA  1 
ATOM   7429 C  C   . GLU B 1 431 ? -3.836  5.884   -25.640 1.00 32.30  ? 431  GLU B C   1 
ATOM   7430 O  O   . GLU B 1 431 ? -4.184  5.197   -24.684 1.00 37.31  ? 431  GLU B O   1 
ATOM   7431 C  CB  . GLU B 1 431 ? -2.655  7.560   -24.245 1.00 35.99  ? 431  GLU B CB  1 
ATOM   7432 C  CG  . GLU B 1 431 ? -1.373  8.264   -23.855 1.00 39.71  ? 431  GLU B CG  1 
ATOM   7433 C  CD  . GLU B 1 431 ? -1.522  9.051   -22.565 1.00 46.04  ? 431  GLU B CD  1 
ATOM   7434 O  OE1 . GLU B 1 431 ? -2.629  9.566   -22.299 1.00 50.56  ? 431  GLU B OE1 1 
ATOM   7435 O  OE2 . GLU B 1 431 ? -0.533  9.154   -21.815 1.00 48.76  ? 431  GLU B OE2 1 
ATOM   7436 N  N   . HIS B 1 432 ? -4.528  5.926   -26.772 1.00 37.05  ? 432  HIS B N   1 
ATOM   7437 C  CA  . HIS B 1 432 ? -5.699  5.065   -26.933 1.00 37.99  ? 432  HIS B CA  1 
ATOM   7438 C  C   . HIS B 1 432 ? -5.349  3.688   -27.495 1.00 39.92  ? 432  HIS B C   1 
ATOM   7439 O  O   . HIS B 1 432 ? -4.656  3.572   -28.508 1.00 43.94  ? 432  HIS B O   1 
ATOM   7440 C  CB  . HIS B 1 432 ? -6.760  5.721   -27.805 1.00 35.96  ? 432  HIS B CB  1 
ATOM   7441 C  CG  . HIS B 1 432 ? -7.924  4.828   -28.091 1.00 48.57  ? 432  HIS B CG  1 
ATOM   7442 N  ND1 . HIS B 1 432 ? -8.889  4.540   -27.150 1.00 49.54  ? 432  HIS B ND1 1 
ATOM   7443 C  CD2 . HIS B 1 432 ? -8.271  4.145   -29.208 1.00 52.79  ? 432  HIS B CD2 1 
ATOM   7444 C  CE1 . HIS B 1 432 ? -9.784  3.726   -27.678 1.00 54.12  ? 432  HIS B CE1 1 
ATOM   7445 N  NE2 . HIS B 1 432 ? -9.434  3.472   -28.927 1.00 52.22  ? 432  HIS B NE2 1 
ATOM   7446 N  N   . ARG B 1 433 ? -5.830  2.648   -26.826 1.00 40.94  ? 433  ARG B N   1 
ATOM   7447 C  CA  . ARG B 1 433 ? -5.662  1.282   -27.310 1.00 44.17  ? 433  ARG B CA  1 
ATOM   7448 C  C   . ARG B 1 433 ? -6.915  0.848   -28.064 1.00 42.54  ? 433  ARG B C   1 
ATOM   7449 O  O   . ARG B 1 433 ? -8.009  0.828   -27.504 1.00 46.83  ? 433  ARG B O   1 
ATOM   7450 C  CB  . ARG B 1 433 ? -5.387  0.330   -26.147 1.00 36.58  ? 433  ARG B CB  1 
ATOM   7451 C  CG  . ARG B 1 433 ? -5.203  -1.114  -26.559 1.00 45.99  ? 433  ARG B CG  1 
ATOM   7452 C  CD  . ARG B 1 433 ? -5.025  -1.997  -25.340 1.00 46.94  ? 433  ARG B CD  1 
ATOM   7453 N  NE  . ARG B 1 433 ? -5.390  -3.384  -25.606 1.00 34.81  ? 433  ARG B NE  1 
ATOM   7454 C  CZ  . ARG B 1 433 ? -4.520  -4.373  -25.770 1.00 45.24  ? 433  ARG B CZ  1 
ATOM   7455 N  NH1 . ARG B 1 433 ? -3.215  -4.138  -25.688 1.00 43.29  ? 433  ARG B NH1 1 
ATOM   7456 N  NH2 . ARG B 1 433 ? -4.958  -5.600  -26.009 1.00 48.41  ? 433  ARG B NH2 1 
ATOM   7457 N  N   . ALA B 1 434 ? -6.751  0.516   -29.338 1.00 47.94  ? 434  ALA B N   1 
ATOM   7458 C  CA  . ALA B 1 434 ? -7.873  0.124   -30.186 1.00 43.31  ? 434  ALA B CA  1 
ATOM   7459 C  C   . ALA B 1 434 ? -8.742  -0.948  -29.532 1.00 48.71  ? 434  ALA B C   1 
ATOM   7460 O  O   . ALA B 1 434 ? -8.239  -1.961  -29.043 1.00 40.86  ? 434  ALA B O   1 
ATOM   7461 C  CB  . ALA B 1 434 ? -7.365  -0.363  -31.534 1.00 41.51  ? 434  ALA B CB  1 
ATOM   7462 N  N   . SER B 1 435 ? -10.051 -0.721  -29.526 1.00 51.97  ? 435  SER B N   1 
ATOM   7463 C  CA  . SER B 1 435 ? -10.990 -1.710  -29.013 1.00 46.80  ? 435  SER B CA  1 
ATOM   7464 C  C   . SER B 1 435 ? -10.822 -3.035  -29.749 1.00 47.98  ? 435  SER B C   1 
ATOM   7465 O  O   . SER B 1 435 ? -11.084 -4.100  -29.197 1.00 53.65  ? 435  SER B O   1 
ATOM   7466 C  CB  . SER B 1 435 ? -12.428 -1.206  -29.158 1.00 51.49  ? 435  SER B CB  1 
ATOM   7467 O  OG  . SER B 1 435 ? -12.749 -0.965  -30.519 1.00 57.35  ? 435  SER B OG  1 
ATOM   7468 N  N   . THR B 1 436 ? -10.361 -2.960  -30.993 1.00 48.32  ? 436  THR B N   1 
ATOM   7469 C  CA  . THR B 1 436 ? -10.237 -4.139  -31.842 1.00 41.16  ? 436  THR B CA  1 
ATOM   7470 C  C   . THR B 1 436 ? -8.838  -4.762  -31.863 1.00 48.57  ? 436  THR B C   1 
ATOM   7471 O  O   . THR B 1 436 ? -8.551  -5.607  -32.711 1.00 49.61  ? 436  THR B O   1 
ATOM   7472 C  CB  . THR B 1 436 ? -10.627 -3.803  -33.286 1.00 51.14  ? 436  THR B CB  1 
ATOM   7473 O  OG1 . THR B 1 436 ? -9.828  -2.706  -33.754 1.00 50.74  ? 436  THR B OG1 1 
ATOM   7474 C  CG2 . THR B 1 436 ? -12.095 -3.420  -33.360 1.00 53.03  ? 436  THR B CG2 1 
ATOM   7475 N  N   . LEU B 1 437 ? -7.971  -4.357  -30.941 1.00 51.93  ? 437  LEU B N   1 
ATOM   7476 C  CA  . LEU B 1 437 ? -6.595  -4.859  -30.933 1.00 48.20  ? 437  LEU B CA  1 
ATOM   7477 C  C   . LEU B 1 437 ? -6.551  -6.354  -30.629 1.00 47.32  ? 437  LEU B C   1 
ATOM   7478 O  O   . LEU B 1 437 ? -7.258  -6.831  -29.748 1.00 51.78  ? 437  LEU B O   1 
ATOM   7479 C  CB  . LEU B 1 437 ? -5.749  -4.101  -29.913 1.00 46.86  ? 437  LEU B CB  1 
ATOM   7480 C  CG  . LEU B 1 437 ? -4.279  -3.906  -30.282 1.00 46.49  ? 437  LEU B CG  1 
ATOM   7481 C  CD1 . LEU B 1 437 ? -4.134  -2.675  -31.152 1.00 50.11  ? 437  LEU B CD1 1 
ATOM   7482 C  CD2 . LEU B 1 437 ? -3.430  -3.767  -29.034 1.00 49.86  ? 437  LEU B CD2 1 
ATOM   7483 N  N   . THR B 1 438 ? -5.711  -7.086  -31.353 1.00 50.40  ? 438  THR B N   1 
ATOM   7484 C  CA  . THR B 1 438 ? -5.607  -8.531  -31.176 1.00 44.63  ? 438  THR B CA  1 
ATOM   7485 C  C   . THR B 1 438 ? -4.454  -8.938  -30.256 1.00 52.13  ? 438  THR B C   1 
ATOM   7486 O  O   . THR B 1 438 ? -4.370  -10.093 -29.834 1.00 48.56  ? 438  THR B O   1 
ATOM   7487 C  CB  . THR B 1 438 ? -5.438  -9.250  -32.529 1.00 54.12  ? 438  THR B CB  1 
ATOM   7488 O  OG1 . THR B 1 438 ? -4.253  -8.773  -33.183 1.00 56.50  ? 438  THR B OG1 1 
ATOM   7489 C  CG2 . THR B 1 438 ? -6.637  -8.990  -33.421 1.00 43.87  ? 438  THR B CG2 1 
ATOM   7490 N  N   . TRP B 1 439 ? -3.557  -7.999  -29.963 1.00 48.81  ? 439  TRP B N   1 
ATOM   7491 C  CA  . TRP B 1 439 ? -2.448  -8.267  -29.047 1.00 40.40  ? 439  TRP B CA  1 
ATOM   7492 C  C   . TRP B 1 439 ? -2.926  -8.235  -27.589 1.00 46.53  ? 439  TRP B C   1 
ATOM   7493 O  O   . TRP B 1 439 ? -3.959  -7.634  -27.281 1.00 36.00  ? 439  TRP B O   1 
ATOM   7494 C  CB  . TRP B 1 439 ? -1.317  -7.255  -29.248 1.00 43.23  ? 439  TRP B CB  1 
ATOM   7495 C  CG  . TRP B 1 439 ? -0.644  -7.310  -30.595 1.00 36.29  ? 439  TRP B CG  1 
ATOM   7496 C  CD1 . TRP B 1 439 ? -0.934  -6.546  -31.684 1.00 33.95  ? 439  TRP B CD1 1 
ATOM   7497 C  CD2 . TRP B 1 439 ? 0.447   -8.159  -30.982 1.00 28.08  ? 439  TRP B CD2 1 
ATOM   7498 N  NE1 . TRP B 1 439 ? -0.101  -6.869  -32.726 1.00 29.87  ? 439  TRP B NE1 1 
ATOM   7499 C  CE2 . TRP B 1 439 ? 0.756   -7.856  -32.321 1.00 31.56  ? 439  TRP B CE2 1 
ATOM   7500 C  CE3 . TRP B 1 439 ? 1.190   -9.143  -30.325 1.00 36.32  ? 439  TRP B CE3 1 
ATOM   7501 C  CZ2 . TRP B 1 439 ? 1.774   -8.504  -33.019 1.00 37.10  ? 439  TRP B CZ2 1 
ATOM   7502 C  CZ3 . TRP B 1 439 ? 2.200   -9.784  -31.017 1.00 41.35  ? 439  TRP B CZ3 1 
ATOM   7503 C  CH2 . TRP B 1 439 ? 2.484   -9.461  -32.352 1.00 42.23  ? 439  TRP B CH2 1 
ATOM   7504 N  N   . PRO B 1 440 ? -2.168  -8.877  -26.686 1.00 36.21  ? 440  PRO B N   1 
ATOM   7505 C  CA  . PRO B 1 440 ? -2.530  -8.964  -25.266 1.00 35.88  ? 440  PRO B CA  1 
ATOM   7506 C  C   . PRO B 1 440 ? -2.560  -7.597  -24.587 1.00 44.04  ? 440  PRO B C   1 
ATOM   7507 O  O   . PRO B 1 440 ? -1.906  -6.654  -25.035 1.00 42.53  ? 440  PRO B O   1 
ATOM   7508 C  CB  . PRO B 1 440 ? -1.398  -9.795  -24.654 1.00 31.79  ? 440  PRO B CB  1 
ATOM   7509 C  CG  . PRO B 1 440 ? -0.628  -10.338 -25.787 1.00 38.99  ? 440  PRO B CG  1 
ATOM   7510 C  CD  . PRO B 1 440 ? -0.850  -9.465  -26.962 1.00 36.51  ? 440  PRO B CD  1 
ATOM   7511 N  N   . LEU B 1 441 ? -3.301  -7.509  -23.491 1.00 40.75  ? 441  LEU B N   1 
ATOM   7512 C  CA  . LEU B 1 441 ? -3.413  -6.270  -22.740 1.00 46.71  ? 441  LEU B CA  1 
ATOM   7513 C  C   . LEU B 1 441 ? -2.062  -5.751  -22.249 1.00 46.21  ? 441  LEU B C   1 
ATOM   7514 O  O   . LEU B 1 441 ? -1.835  -4.543  -22.199 1.00 47.43  ? 441  LEU B O   1 
ATOM   7515 C  CB  . LEU B 1 441 ? -4.371  -6.454  -21.563 1.00 44.89  ? 441  LEU B CB  1 
ATOM   7516 C  CG  . LEU B 1 441 ? -5.851  -6.527  -21.939 1.00 57.99  ? 441  LEU B CG  1 
ATOM   7517 C  CD1 . LEU B 1 441 ? -6.687  -7.027  -20.773 1.00 59.25  ? 441  LEU B CD1 1 
ATOM   7518 C  CD2 . LEU B 1 441 ? -6.345  -5.167  -22.419 1.00 45.22  ? 441  LEU B CD2 1 
ATOM   7519 N  N   . TRP B 1 442 ? -1.160  -6.656  -21.891 1.00 38.18  ? 442  TRP B N   1 
ATOM   7520 C  CA  . TRP B 1 442 ? 0.102   -6.231  -21.294 1.00 46.38  ? 442  TRP B CA  1 
ATOM   7521 C  C   . TRP B 1 442 ? 0.958   -5.407  -22.257 1.00 47.42  ? 442  TRP B C   1 
ATOM   7522 O  O   . TRP B 1 442 ? 1.906   -4.743  -21.840 1.00 46.31  ? 442  TRP B O   1 
ATOM   7523 C  CB  . TRP B 1 442 ? 0.892   -7.421  -20.723 1.00 39.16  ? 442  TRP B CB  1 
ATOM   7524 C  CG  . TRP B 1 442 ? 1.570   -8.295  -21.744 1.00 44.51  ? 442  TRP B CG  1 
ATOM   7525 C  CD1 . TRP B 1 442 ? 1.137   -9.505  -22.202 1.00 43.73  ? 442  TRP B CD1 1 
ATOM   7526 C  CD2 . TRP B 1 442 ? 2.811   -8.033  -22.416 1.00 45.24  ? 442  TRP B CD2 1 
ATOM   7527 N  NE1 . TRP B 1 442 ? 2.025   -10.008 -23.122 1.00 48.30  ? 442  TRP B NE1 1 
ATOM   7528 C  CE2 . TRP B 1 442 ? 3.061   -9.124  -23.272 1.00 41.02  ? 442  TRP B CE2 1 
ATOM   7529 C  CE3 . TRP B 1 442 ? 3.730   -6.978  -22.381 1.00 41.84  ? 442  TRP B CE3 1 
ATOM   7530 C  CZ2 . TRP B 1 442 ? 4.195   -9.195  -24.084 1.00 39.16  ? 442  TRP B CZ2 1 
ATOM   7531 C  CZ3 . TRP B 1 442 ? 4.855   -7.048  -23.188 1.00 44.11  ? 442  TRP B CZ3 1 
ATOM   7532 C  CH2 . TRP B 1 442 ? 5.079   -8.152  -24.027 1.00 38.08  ? 442  TRP B CH2 1 
ATOM   7533 N  N   . MET B 1 443 ? 0.617   -5.444  -23.540 1.00 39.72  ? 443  MET B N   1 
ATOM   7534 C  CA  . MET B 1 443 ? 1.375   -4.699  -24.538 1.00 37.41  ? 443  MET B CA  1 
ATOM   7535 C  C   . MET B 1 443 ? 0.869   -3.268  -24.678 1.00 39.08  ? 443  MET B C   1 
ATOM   7536 O  O   . MET B 1 443 ? 1.491   -2.451  -25.360 1.00 35.93  ? 443  MET B O   1 
ATOM   7537 C  CB  . MET B 1 443 ? 1.332   -5.406  -25.891 1.00 36.62  ? 443  MET B CB  1 
ATOM   7538 C  CG  . MET B 1 443 ? 2.056   -6.740  -25.926 1.00 42.90  ? 443  MET B CG  1 
ATOM   7539 S  SD  . MET B 1 443 ? 2.227   -7.345  -27.616 1.00 45.54  ? 443  MET B SD  1 
ATOM   7540 C  CE  . MET B 1 443 ? 3.024   -8.914  -27.317 1.00 49.70  ? 443  MET B CE  1 
ATOM   7541 N  N   . GLY B 1 444 ? -0.263  -2.980  -24.039 1.00 35.87  ? 444  GLY B N   1 
ATOM   7542 C  CA  . GLY B 1 444 ? -0.861  -1.654  -24.063 1.00 33.38  ? 444  GLY B CA  1 
ATOM   7543 C  C   . GLY B 1 444 ? -1.143  -1.098  -25.451 1.00 43.15  ? 444  GLY B C   1 
ATOM   7544 O  O   . GLY B 1 444 ? -1.855  -1.713  -26.242 1.00 39.75  ? 444  GLY B O   1 
ATOM   7545 N  N   . VAL B 1 445 ? -0.598  0.083   -25.736 1.00 37.50  ? 445  VAL B N   1 
ATOM   7546 C  CA  . VAL B 1 445 ? -0.691  0.684   -27.063 1.00 31.76  ? 445  VAL B CA  1 
ATOM   7547 C  C   . VAL B 1 445 ? 0.634   0.507   -27.792 1.00 37.51  ? 445  VAL B C   1 
ATOM   7548 O  O   . VAL B 1 445 ? 1.568   1.276   -27.578 1.00 41.49  ? 445  VAL B O   1 
ATOM   7549 C  CB  . VAL B 1 445 ? -1.003  2.184   -26.982 1.00 36.38  ? 445  VAL B CB  1 
ATOM   7550 C  CG1 . VAL B 1 445 ? -1.211  2.759   -28.381 1.00 27.17  ? 445  VAL B CG1 1 
ATOM   7551 C  CG2 . VAL B 1 445 ? -2.217  2.426   -26.099 1.00 33.50  ? 445  VAL B CG2 1 
ATOM   7552 N  N   . PRO B 1 446 ? 0.725   -0.519  -28.649 1.00 35.95  ? 446  PRO B N   1 
ATOM   7553 C  CA  . PRO B 1 446 ? 2.013   -0.879  -29.255 1.00 35.61  ? 446  PRO B CA  1 
ATOM   7554 C  C   . PRO B 1 446 ? 2.400   -0.049  -30.477 1.00 35.24  ? 446  PRO B C   1 
ATOM   7555 O  O   . PRO B 1 446 ? 1.557   0.550   -31.147 1.00 26.71  ? 446  PRO B O   1 
ATOM   7556 C  CB  . PRO B 1 446 ? 1.819   -2.351  -29.662 1.00 32.90  ? 446  PRO B CB  1 
ATOM   7557 C  CG  . PRO B 1 446 ? 0.518   -2.787  -29.004 1.00 36.29  ? 446  PRO B CG  1 
ATOM   7558 C  CD  . PRO B 1 446 ? -0.299  -1.545  -28.895 1.00 36.86  ? 446  PRO B CD  1 
ATOM   7559 N  N   . HIS B 1 447 ? 3.703   -0.031  -30.737 1.00 30.97  ? 447  HIS B N   1 
ATOM   7560 C  CA  . HIS B 1 447 ? 4.297   0.569   -31.922 1.00 25.38  ? 447  HIS B CA  1 
ATOM   7561 C  C   . HIS B 1 447 ? 3.467   0.272   -33.167 1.00 27.80  ? 447  HIS B C   1 
ATOM   7562 O  O   . HIS B 1 447 ? 3.335   -0.881  -33.569 1.00 35.56  ? 447  HIS B O   1 
ATOM   7563 C  CB  . HIS B 1 447 ? 5.709   -0.002  -32.076 1.00 26.47  ? 447  HIS B CB  1 
ATOM   7564 C  CG  . HIS B 1 447 ? 6.537   0.659   -33.134 1.00 35.45  ? 447  HIS B CG  1 
ATOM   7565 N  ND1 . HIS B 1 447 ? 6.911   1.984   -33.072 1.00 35.37  ? 447  HIS B ND1 1 
ATOM   7566 C  CD2 . HIS B 1 447 ? 7.103   0.161   -34.258 1.00 34.23  ? 447  HIS B CD2 1 
ATOM   7567 C  CE1 . HIS B 1 447 ? 7.655   2.279   -34.123 1.00 36.03  ? 447  HIS B CE1 1 
ATOM   7568 N  NE2 . HIS B 1 447 ? 7.788   1.189   -34.859 1.00 32.85  ? 447  HIS B NE2 1 
ATOM   7569 N  N   . GLY B 1 448 ? 2.892   1.311   -33.766 1.00 31.84  ? 448  GLY B N   1 
ATOM   7570 C  CA  . GLY B 1 448 ? 2.174   1.161   -35.020 1.00 26.70  ? 448  GLY B CA  1 
ATOM   7571 C  C   . GLY B 1 448 ? 0.661   1.284   -34.940 1.00 35.71  ? 448  GLY B C   1 
ATOM   7572 O  O   . GLY B 1 448 ? -0.002  1.408   -35.968 1.00 37.74  ? 448  GLY B O   1 
ATOM   7573 N  N   . TYR B 1 449 ? 0.104   1.275   -33.732 1.00 30.77  ? 449  TYR B N   1 
ATOM   7574 C  CA  . TYR B 1 449 ? -1.353  1.205   -33.587 1.00 32.50  ? 449  TYR B CA  1 
ATOM   7575 C  C   . TYR B 1 449 ? -2.100  2.531   -33.424 1.00 35.19  ? 449  TYR B C   1 
ATOM   7576 O  O   . TYR B 1 449 ? -3.248  2.562   -32.986 1.00 37.49  ? 449  TYR B O   1 
ATOM   7577 C  CB  . TYR B 1 449 ? -1.739  0.160   -32.538 1.00 29.70  ? 449  TYR B CB  1 
ATOM   7578 C  CG  . TYR B 1 449 ? -1.411  -1.198  -33.083 1.00 35.49  ? 449  TYR B CG  1 
ATOM   7579 C  CD1 . TYR B 1 449 ? -0.168  -1.773  -32.864 1.00 27.94  ? 449  TYR B CD1 1 
ATOM   7580 C  CD2 . TYR B 1 449 ? -2.310  -1.865  -33.905 1.00 34.76  ? 449  TYR B CD2 1 
ATOM   7581 C  CE1 . TYR B 1 449 ? 0.150   -3.003  -33.408 1.00 38.05  ? 449  TYR B CE1 1 
ATOM   7582 C  CE2 . TYR B 1 449 ? -2.006  -3.094  -34.446 1.00 37.98  ? 449  TYR B CE2 1 
ATOM   7583 C  CZ  . TYR B 1 449 ? -0.776  -3.657  -34.200 1.00 39.67  ? 449  TYR B CZ  1 
ATOM   7584 O  OH  . TYR B 1 449 ? -0.474  -4.880  -34.748 1.00 41.75  ? 449  TYR B OH  1 
ATOM   7585 N  N   . GLU B 1 450 ? -1.445  3.614   -33.822 1.00 31.15  ? 450  GLU B N   1 
ATOM   7586 C  CA  . GLU B 1 450 ? -2.104  4.899   -33.973 1.00 29.93  ? 450  GLU B CA  1 
ATOM   7587 C  C   . GLU B 1 450 ? -2.461  5.097   -35.450 1.00 32.45  ? 450  GLU B C   1 
ATOM   7588 O  O   . GLU B 1 450 ? -3.351  5.879   -35.790 1.00 31.18  ? 450  GLU B O   1 
ATOM   7589 C  CB  . GLU B 1 450 ? -1.192  6.033   -33.485 1.00 23.97  ? 450  GLU B CB  1 
ATOM   7590 C  CG  . GLU B 1 450 ? -0.240  6.605   -34.547 1.00 23.30  ? 450  GLU B CG  1 
ATOM   7591 C  CD  . GLU B 1 450 ? 1.014   5.760   -34.774 1.00 33.05  ? 450  GLU B CD  1 
ATOM   7592 O  OE1 . GLU B 1 450 ? 1.050   4.583   -34.358 1.00 32.32  ? 450  GLU B OE1 1 
ATOM   7593 O  OE2 . GLU B 1 450 ? 1.973   6.280   -35.375 1.00 32.48  ? 450  GLU B OE2 1 
ATOM   7594 N  N   . ILE B 1 451 ? -1.768  4.370   -36.322 1.00 29.19  ? 451  ILE B N   1 
ATOM   7595 C  CA  . ILE B 1 451 ? -1.905  4.567   -37.764 1.00 29.57  ? 451  ILE B CA  1 
ATOM   7596 C  C   . ILE B 1 451 ? -3.341  4.407   -38.265 1.00 34.52  ? 451  ILE B C   1 
ATOM   7597 O  O   . ILE B 1 451 ? -3.837  5.235   -39.029 1.00 38.53  ? 451  ILE B O   1 
ATOM   7598 C  CB  . ILE B 1 451 ? -0.969  3.628   -38.561 1.00 34.95  ? 451  ILE B CB  1 
ATOM   7599 C  CG1 . ILE B 1 451 ? 0.496   3.900   -38.209 1.00 29.25  ? 451  ILE B CG1 1 
ATOM   7600 C  CG2 . ILE B 1 451 ? -1.179  3.800   -40.056 1.00 27.81  ? 451  ILE B CG2 1 
ATOM   7601 C  CD1 . ILE B 1 451 ? 1.461   2.963   -38.894 1.00 32.82  ? 451  ILE B CD1 1 
ATOM   7602 N  N   . GLU B 1 452 ? -4.004  3.342   -37.832 1.00 34.11  ? 452  GLU B N   1 
ATOM   7603 C  CA  . GLU B 1 452 ? -5.364  3.055   -38.277 1.00 39.95  ? 452  GLU B CA  1 
ATOM   7604 C  C   . GLU B 1 452 ? -6.324  4.186   -37.909 1.00 39.23  ? 452  GLU B C   1 
ATOM   7605 O  O   . GLU B 1 452 ? -7.327  4.401   -38.581 1.00 38.81  ? 452  GLU B O   1 
ATOM   7606 C  CB  . GLU B 1 452 ? -5.847  1.722   -37.698 1.00 39.29  ? 452  GLU B CB  1 
ATOM   7607 C  CG  . GLU B 1 452 ? -5.734  1.631   -36.188 1.00 42.04  ? 452  GLU B CG  1 
ATOM   7608 C  CD  . GLU B 1 452 ? -5.877  0.211   -35.671 1.00 49.07  ? 452  GLU B CD  1 
ATOM   7609 O  OE1 . GLU B 1 452 ? -6.952  -0.119  -35.125 1.00 49.93  ? 452  GLU B OE1 1 
ATOM   7610 O  OE2 . GLU B 1 452 ? -4.919  -0.576  -35.812 1.00 43.66  ? 452  GLU B OE2 1 
ATOM   7611 N  N   . PHE B 1 453 ? -6.004  4.914   -36.845 1.00 38.12  ? 453  PHE B N   1 
ATOM   7612 C  CA  . PHE B 1 453 ? -6.831  6.038   -36.421 1.00 31.04  ? 453  PHE B CA  1 
ATOM   7613 C  C   . PHE B 1 453 ? -6.563  7.308   -37.227 1.00 34.54  ? 453  PHE B C   1 
ATOM   7614 O  O   . PHE B 1 453 ? -7.498  8.002   -37.619 1.00 40.50  ? 453  PHE B O   1 
ATOM   7615 C  CB  . PHE B 1 453 ? -6.666  6.289   -34.923 1.00 28.43  ? 453  PHE B CB  1 
ATOM   7616 C  CG  . PHE B 1 453 ? -7.238  5.196   -34.069 1.00 34.73  ? 453  PHE B CG  1 
ATOM   7617 C  CD1 . PHE B 1 453 ? -8.586  5.191   -33.740 1.00 36.34  ? 453  PHE B CD1 1 
ATOM   7618 C  CD2 . PHE B 1 453 ? -6.437  4.163   -33.612 1.00 34.43  ? 453  PHE B CD2 1 
ATOM   7619 C  CE1 . PHE B 1 453 ? -9.120  4.185   -32.955 1.00 33.49  ? 453  PHE B CE1 1 
ATOM   7620 C  CE2 . PHE B 1 453 ? -6.964  3.152   -32.830 1.00 38.36  ? 453  PHE B CE2 1 
ATOM   7621 C  CZ  . PHE B 1 453 ? -8.309  3.165   -32.501 1.00 46.39  ? 453  PHE B CZ  1 
ATOM   7622 N  N   . ILE B 1 454 ? -5.291  7.606   -37.476 1.00 37.27  ? 454  ILE B N   1 
ATOM   7623 C  CA  . ILE B 1 454 ? -4.917  8.744   -38.314 1.00 28.82  ? 454  ILE B CA  1 
ATOM   7624 C  C   . ILE B 1 454 ? -5.477  8.598   -39.724 1.00 35.42  ? 454  ILE B C   1 
ATOM   7625 O  O   . ILE B 1 454 ? -5.897  9.578   -40.336 1.00 36.97  ? 454  ILE B O   1 
ATOM   7626 C  CB  . ILE B 1 454 ? -3.385  8.882   -38.440 1.00 39.08  ? 454  ILE B CB  1 
ATOM   7627 C  CG1 . ILE B 1 454 ? -2.729  9.027   -37.059 1.00 35.94  ? 454  ILE B CG1 1 
ATOM   7628 C  CG2 . ILE B 1 454 ? -3.035  10.042  -39.358 1.00 24.84  ? 454  ILE B CG2 1 
ATOM   7629 C  CD1 . ILE B 1 454 ? -3.246  10.200  -36.254 1.00 45.47  ? 454  ILE B CD1 1 
ATOM   7630 N  N   . PHE B 1 455 ? -5.471  7.373   -40.244 1.00 33.24  ? 455  PHE B N   1 
ATOM   7631 C  CA  . PHE B 1 455 ? -5.949  7.124   -41.602 1.00 38.28  ? 455  PHE B CA  1 
ATOM   7632 C  C   . PHE B 1 455 ? -7.474  7.039   -41.675 1.00 42.46  ? 455  PHE B C   1 
ATOM   7633 O  O   . PHE B 1 455 ? -8.042  6.962   -42.761 1.00 33.57  ? 455  PHE B O   1 
ATOM   7634 C  CB  . PHE B 1 455 ? -5.299  5.873   -42.203 1.00 35.59  ? 455  PHE B CB  1 
ATOM   7635 C  CG  . PHE B 1 455 ? -4.033  6.158   -42.966 1.00 40.39  ? 455  PHE B CG  1 
ATOM   7636 C  CD1 . PHE B 1 455 ? -2.813  6.236   -42.311 1.00 34.20  ? 455  PHE B CD1 1 
ATOM   7637 C  CD2 . PHE B 1 455 ? -4.064  6.351   -44.338 1.00 31.47  ? 455  PHE B CD2 1 
ATOM   7638 C  CE1 . PHE B 1 455 ? -1.649  6.501   -43.011 1.00 32.28  ? 455  PHE B CE1 1 
ATOM   7639 C  CE2 . PHE B 1 455 ? -2.903  6.618   -45.044 1.00 38.78  ? 455  PHE B CE2 1 
ATOM   7640 C  CZ  . PHE B 1 455 ? -1.693  6.695   -44.379 1.00 32.10  ? 455  PHE B CZ  1 
ATOM   7641 N  N   . GLY B 1 456 ? -8.123  7.049   -40.511 1.00 40.27  ? 456  GLY B N   1 
ATOM   7642 C  CA  . GLY B 1 456 ? -9.569  7.169   -40.431 1.00 45.32  ? 456  GLY B CA  1 
ATOM   7643 C  C   . GLY B 1 456 ? -10.372 5.893   -40.610 1.00 46.22  ? 456  GLY B C   1 
ATOM   7644 O  O   . GLY B 1 456 ? -11.555 5.946   -40.943 1.00 41.42  ? 456  GLY B O   1 
ATOM   7645 N  N   . LEU B 1 457 ? -9.739  4.748   -40.376 1.00 45.10  ? 457  LEU B N   1 
ATOM   7646 C  CA  . LEU B 1 457 ? -10.390 3.453   -40.582 1.00 44.48  ? 457  LEU B CA  1 
ATOM   7647 C  C   . LEU B 1 457 ? -11.668 3.234   -39.763 1.00 49.30  ? 457  LEU B C   1 
ATOM   7648 O  O   . LEU B 1 457 ? -12.590 2.567   -40.228 1.00 53.49  ? 457  LEU B O   1 
ATOM   7649 C  CB  . LEU B 1 457 ? -9.406  2.301   -40.343 1.00 41.86  ? 457  LEU B CB  1 
ATOM   7650 C  CG  . LEU B 1 457 ? -8.667  1.768   -41.573 1.00 41.22  ? 457  LEU B CG  1 
ATOM   7651 C  CD1 . LEU B 1 457 ? -7.736  2.819   -42.187 1.00 26.70  ? 457  LEU B CD1 1 
ATOM   7652 C  CD2 . LEU B 1 457 ? -7.897  0.519   -41.210 1.00 32.90  ? 457  LEU B CD2 1 
ATOM   7653 N  N   . PRO B 1 458 ? -11.724 3.768   -38.535 1.00 47.75  ? 458  PRO B N   1 
ATOM   7654 C  CA  . PRO B 1 458 ? -12.949 3.554   -37.758 1.00 48.32  ? 458  PRO B CA  1 
ATOM   7655 C  C   . PRO B 1 458 ? -14.207 4.136   -38.409 1.00 53.67  ? 458  PRO B C   1 
ATOM   7656 O  O   . PRO B 1 458 ? -15.314 3.779   -38.011 1.00 53.09  ? 458  PRO B O   1 
ATOM   7657 C  CB  . PRO B 1 458 ? -12.641 4.253   -36.433 1.00 47.91  ? 458  PRO B CB  1 
ATOM   7658 C  CG  . PRO B 1 458 ? -11.158 4.124   -36.302 1.00 41.16  ? 458  PRO B CG  1 
ATOM   7659 C  CD  . PRO B 1 458 ? -10.637 4.310   -37.701 1.00 40.32  ? 458  PRO B CD  1 
ATOM   7660 N  N   . LEU B 1 459 ? -14.045 5.004   -39.401 1.00 48.26  ? 459  LEU B N   1 
ATOM   7661 C  CA  . LEU B 1 459 ? -15.199 5.553   -40.106 1.00 50.80  ? 459  LEU B CA  1 
ATOM   7662 C  C   . LEU B 1 459 ? -15.886 4.490   -40.965 1.00 55.15  ? 459  LEU B C   1 
ATOM   7663 O  O   . LEU B 1 459 ? -17.010 4.682   -41.432 1.00 54.67  ? 459  LEU B O   1 
ATOM   7664 C  CB  . LEU B 1 459 ? -14.804 6.762   -40.954 1.00 45.37  ? 459  LEU B CB  1 
ATOM   7665 C  CG  . LEU B 1 459 ? -14.702 8.089   -40.203 1.00 47.12  ? 459  LEU B CG  1 
ATOM   7666 C  CD1 . LEU B 1 459 ? -13.741 7.974   -39.030 1.00 52.92  ? 459  LEU B CD1 1 
ATOM   7667 C  CD2 . LEU B 1 459 ? -14.269 9.200   -41.146 1.00 47.58  ? 459  LEU B CD2 1 
ATOM   7668 N  N   . ASP B 1 460 ? -15.201 3.371   -41.172 1.00 52.21  ? 460  ASP B N   1 
ATOM   7669 C  CA  . ASP B 1 460 ? -15.786 2.238   -41.874 1.00 60.62  ? 460  ASP B CA  1 
ATOM   7670 C  C   . ASP B 1 460 ? -16.542 1.369   -40.882 1.00 59.36  ? 460  ASP B C   1 
ATOM   7671 O  O   . ASP B 1 460 ? -15.936 0.663   -40.076 1.00 57.61  ? 460  ASP B O   1 
ATOM   7672 C  CB  . ASP B 1 460 ? -14.706 1.417   -42.574 1.00 58.64  ? 460  ASP B CB  1 
ATOM   7673 C  CG  . ASP B 1 460 ? -15.265 0.189   -43.262 1.00 64.24  ? 460  ASP B CG  1 
ATOM   7674 O  OD1 . ASP B 1 460 ? -16.505 0.030   -43.294 1.00 65.40  ? 460  ASP B OD1 1 
ATOM   7675 O  OD2 . ASP B 1 460 ? -14.462 -0.619  -43.770 1.00 76.45  ? 460  ASP B OD2 1 
ATOM   7676 N  N   . PRO B 1 461 ? -17.878 1.406   -40.955 1.00 72.49  ? 461  PRO B N   1 
ATOM   7677 C  CA  . PRO B 1 461 ? -18.763 0.768   -39.974 1.00 67.76  ? 461  PRO B CA  1 
ATOM   7678 C  C   . PRO B 1 461 ? -18.451 -0.713  -39.822 1.00 62.60  ? 461  PRO B C   1 
ATOM   7679 O  O   . PRO B 1 461 ? -18.502 -1.252  -38.716 1.00 71.51  ? 461  PRO B O   1 
ATOM   7680 C  CB  . PRO B 1 461 ? -20.155 0.946   -40.589 1.00 66.58  ? 461  PRO B CB  1 
ATOM   7681 C  CG  . PRO B 1 461 ? -20.011 2.064   -41.571 1.00 75.11  ? 461  PRO B CG  1 
ATOM   7682 C  CD  . PRO B 1 461 ? -18.620 1.955   -42.101 1.00 63.84  ? 461  PRO B CD  1 
ATOM   7683 N  N   . SER B 1 462 ? -18.116 -1.356  -40.934 1.00 53.91  ? 462  SER B N   1 
ATOM   7684 C  CA  . SER B 1 462 ? -17.864 -2.791  -40.949 1.00 58.29  ? 462  SER B CA  1 
ATOM   7685 C  C   . SER B 1 462 ? -16.639 -3.202  -40.140 1.00 61.41  ? 462  SER B C   1 
ATOM   7686 O  O   . SER B 1 462 ? -16.329 -4.387  -40.038 1.00 64.82  ? 462  SER B O   1 
ATOM   7687 C  CB  . SER B 1 462 ? -17.704 -3.277  -42.389 1.00 61.97  ? 462  SER B CB  1 
ATOM   7688 O  OG  . SER B 1 462 ? -16.590 -2.660  -43.009 1.00 62.52  ? 462  SER B OG  1 
ATOM   7689 N  N   . LEU B 1 463 ? -15.937 -2.232  -39.566 1.00 60.93  ? 463  LEU B N   1 
ATOM   7690 C  CA  . LEU B 1 463 ? -14.705 -2.544  -38.855 1.00 52.68  ? 463  LEU B CA  1 
ATOM   7691 C  C   . LEU B 1 463 ? -14.922 -2.765  -37.359 1.00 64.70  ? 463  LEU B C   1 
ATOM   7692 O  O   . LEU B 1 463 ? -14.064 -3.330  -36.672 1.00 65.40  ? 463  LEU B O   1 
ATOM   7693 C  CB  . LEU B 1 463 ? -13.631 -1.491  -39.136 1.00 59.95  ? 463  LEU B CB  1 
ATOM   7694 C  CG  . LEU B 1 463 ? -13.132 -1.555  -40.582 1.00 64.26  ? 463  LEU B CG  1 
ATOM   7695 C  CD1 . LEU B 1 463 ? -11.969 -0.606  -40.822 1.00 48.75  ? 463  LEU B CD1 1 
ATOM   7696 C  CD2 . LEU B 1 463 ? -12.739 -2.981  -40.925 1.00 50.17  ? 463  LEU B CD2 1 
ATOM   7697 N  N   . ASN B 1 464 ? -16.076 -2.333  -36.863 1.00 52.84  ? 464  ASN B N   1 
ATOM   7698 C  CA  . ASN B 1 464 ? -16.491 -2.667  -35.503 1.00 62.81  ? 464  ASN B CA  1 
ATOM   7699 C  C   . ASN B 1 464 ? -15.733 -1.903  -34.425 1.00 57.91  ? 464  ASN B C   1 
ATOM   7700 O  O   . ASN B 1 464 ? -15.593 -2.380  -33.299 1.00 66.97  ? 464  ASN B O   1 
ATOM   7701 C  CB  . ASN B 1 464 ? -16.383 -4.178  -35.255 1.00 63.81  ? 464  ASN B CB  1 
ATOM   7702 C  CG  . ASN B 1 464 ? -17.120 -4.997  -36.305 1.00 73.03  ? 464  ASN B CG  1 
ATOM   7703 O  OD1 . ASN B 1 464 ? -18.087 -4.532  -36.911 1.00 84.00  ? 464  ASN B OD1 1 
ATOM   7704 N  ND2 . ASN B 1 464 ? -16.662 -6.224  -36.526 1.00 68.19  ? 464  ASN B ND2 1 
ATOM   7705 N  N   . TYR B 1 465 ? -15.235 -0.724  -34.773 1.00 56.06  ? 465  TYR B N   1 
ATOM   7706 C  CA  . TYR B 1 465 ? -14.725 0.195   -33.769 1.00 53.04  ? 465  TYR B CA  1 
ATOM   7707 C  C   . TYR B 1 465 ? -15.926 0.807   -33.061 1.00 48.32  ? 465  TYR B C   1 
ATOM   7708 O  O   . TYR B 1 465 ? -17.022 0.842   -33.618 1.00 57.88  ? 465  TYR B O   1 
ATOM   7709 C  CB  . TYR B 1 465 ? -13.920 1.317   -34.423 1.00 50.16  ? 465  TYR B CB  1 
ATOM   7710 C  CG  . TYR B 1 465 ? -12.607 0.903   -35.043 1.00 50.81  ? 465  TYR B CG  1 
ATOM   7711 C  CD1 . TYR B 1 465 ? -11.460 0.773   -34.265 1.00 53.33  ? 465  TYR B CD1 1 
ATOM   7712 C  CD2 . TYR B 1 465 ? -12.505 0.675   -36.411 1.00 47.51  ? 465  TYR B CD2 1 
ATOM   7713 C  CE1 . TYR B 1 465 ? -10.251 0.410   -34.830 1.00 48.23  ? 465  TYR B CE1 1 
ATOM   7714 C  CE2 . TYR B 1 465 ? -11.303 0.314   -36.987 1.00 41.45  ? 465  TYR B CE2 1 
ATOM   7715 C  CZ  . TYR B 1 465 ? -10.178 0.185   -36.193 1.00 49.48  ? 465  TYR B CZ  1 
ATOM   7716 O  OH  . TYR B 1 465 ? -8.978  -0.171  -36.764 1.00 41.70  ? 465  TYR B OH  1 
ATOM   7717 N  N   . THR B 1 466 ? -15.726 1.297   -31.844 1.00 51.33  ? 466  THR B N   1 
ATOM   7718 C  CA  . THR B 1 466 ? -16.781 2.014   -31.139 1.00 44.18  ? 466  THR B CA  1 
ATOM   7719 C  C   . THR B 1 466 ? -17.002 3.360   -31.816 1.00 55.69  ? 466  THR B C   1 
ATOM   7720 O  O   . THR B 1 466 ? -16.198 3.776   -32.648 1.00 62.81  ? 466  THR B O   1 
ATOM   7721 C  CB  . THR B 1 466 ? -16.410 2.259   -29.675 1.00 50.78  ? 466  THR B CB  1 
ATOM   7722 O  OG1 . THR B 1 466 ? -15.437 3.309   -29.602 1.00 49.71  ? 466  THR B OG1 1 
ATOM   7723 C  CG2 . THR B 1 466 ? -15.847 0.991   -29.052 1.00 34.18  ? 466  THR B CG2 1 
ATOM   7724 N  N   . THR B 1 467 ? -18.082 4.048   -31.464 1.00 44.11  ? 467  THR B N   1 
ATOM   7725 C  CA  . THR B 1 467 ? -18.357 5.336   -32.086 1.00 63.14  ? 467  THR B CA  1 
ATOM   7726 C  C   . THR B 1 467 ? -17.522 6.430   -31.440 1.00 59.00  ? 467  THR B C   1 
ATOM   7727 O  O   . THR B 1 467 ? -17.268 7.471   -32.051 1.00 58.14  ? 467  THR B O   1 
ATOM   7728 C  CB  . THR B 1 467 ? -19.855 5.708   -32.050 1.00 69.56  ? 467  THR B CB  1 
ATOM   7729 O  OG1 . THR B 1 467 ? -20.342 5.606   -30.710 1.00 56.19  ? 467  THR B OG1 1 
ATOM   7730 C  CG2 . THR B 1 467 ? -20.660 4.779   -32.956 1.00 76.92  ? 467  THR B CG2 1 
ATOM   7731 N  N   . GLU B 1 468 ? -17.091 6.195   -30.204 1.00 50.50  ? 468  GLU B N   1 
ATOM   7732 C  CA  . GLU B 1 468 ? -16.182 7.130   -29.555 1.00 54.62  ? 468  GLU B CA  1 
ATOM   7733 C  C   . GLU B 1 468 ? -14.892 7.132   -30.363 1.00 53.32  ? 468  GLU B C   1 
ATOM   7734 O  O   . GLU B 1 468 ? -14.265 8.172   -30.561 1.00 54.00  ? 468  GLU B O   1 
ATOM   7735 C  CB  . GLU B 1 468 ? -15.894 6.727   -28.106 1.00 58.60  ? 468  GLU B CB  1 
ATOM   7736 C  CG  . GLU B 1 468 ? -17.124 6.463   -27.245 1.00 70.05  ? 468  GLU B CG  1 
ATOM   7737 C  CD  . GLU B 1 468 ? -17.628 5.032   -27.367 1.00 80.19  ? 468  GLU B CD  1 
ATOM   7738 O  OE1 . GLU B 1 468 ? -18.366 4.733   -28.330 1.00 74.08  ? 468  GLU B OE1 1 
ATOM   7739 O  OE2 . GLU B 1 468 ? -17.293 4.206   -26.490 1.00 90.88  ? 468  GLU B OE2 1 
ATOM   7740 N  N   . GLU B 1 469 ? -14.512 5.951   -30.837 1.00 47.26  ? 469  GLU B N   1 
ATOM   7741 C  CA  . GLU B 1 469 ? -13.329 5.794   -31.666 1.00 44.88  ? 469  GLU B CA  1 
ATOM   7742 C  C   . GLU B 1 469 ? -13.519 6.442   -33.031 1.00 48.27  ? 469  GLU B C   1 
ATOM   7743 O  O   . GLU B 1 469 ? -12.588 7.018   -33.592 1.00 50.50  ? 469  GLU B O   1 
ATOM   7744 C  CB  . GLU B 1 469 ? -12.991 4.313   -31.825 1.00 40.43  ? 469  GLU B CB  1 
ATOM   7745 C  CG  . GLU B 1 469 ? -12.392 3.687   -30.583 1.00 41.11  ? 469  GLU B CG  1 
ATOM   7746 C  CD  . GLU B 1 469 ? -12.144 2.207   -30.751 1.00 49.42  ? 469  GLU B CD  1 
ATOM   7747 O  OE1 . GLU B 1 469 ? -12.942 1.556   -31.452 1.00 52.26  ? 469  GLU B OE1 1 
ATOM   7748 O  OE2 . GLU B 1 469 ? -11.160 1.692   -30.180 1.00 49.40  ? 469  GLU B OE2 1 
ATOM   7749 N  N   . ARG B 1 470 ? -14.729 6.344   -33.567 1.00 45.98  ? 470  ARG B N   1 
ATOM   7750 C  CA  . ARG B 1 470 ? -15.027 6.952   -34.852 1.00 42.81  ? 470  ARG B CA  1 
ATOM   7751 C  C   . ARG B 1 470 ? -14.911 8.465   -34.712 1.00 43.85  ? 470  ARG B C   1 
ATOM   7752 O  O   . ARG B 1 470 ? -14.389 9.143   -35.592 1.00 47.35  ? 470  ARG B O   1 
ATOM   7753 C  CB  . ARG B 1 470 ? -16.416 6.525   -35.329 1.00 60.67  ? 470  ARG B CB  1 
ATOM   7754 C  CG  . ARG B 1 470 ? -16.737 6.877   -36.773 1.00 66.93  ? 470  ARG B CG  1 
ATOM   7755 C  CD  . ARG B 1 470 ? -17.728 8.025   -36.841 1.00 67.36  ? 470  ARG B CD  1 
ATOM   7756 N  NE  . ARG B 1 470 ? -18.913 7.745   -36.033 1.00 90.60  ? 470  ARG B NE  1 
ATOM   7757 C  CZ  . ARG B 1 470 ? -19.795 8.662   -35.647 1.00 91.59  ? 470  ARG B CZ  1 
ATOM   7758 N  NH1 . ARG B 1 470 ? -19.630 9.933   -35.993 1.00 71.62  ? 470  ARG B NH1 1 
ATOM   7759 N  NH2 . ARG B 1 470 ? -20.841 8.308   -34.910 1.00 83.97  ? 470  ARG B NH2 1 
ATOM   7760 N  N   . ILE B 1 471 ? -15.374 8.984   -33.581 1.00 51.16  ? 471  ILE B N   1 
ATOM   7761 C  CA  . ILE B 1 471 ? -15.258 10.407  -33.272 1.00 45.99  ? 471  ILE B CA  1 
ATOM   7762 C  C   . ILE B 1 471 ? -13.794 10.782  -33.049 1.00 43.04  ? 471  ILE B C   1 
ATOM   7763 O  O   . ILE B 1 471 ? -13.340 11.846  -33.471 1.00 44.69  ? 471  ILE B O   1 
ATOM   7764 C  CB  . ILE B 1 471 ? -16.087 10.757  -32.016 1.00 52.86  ? 471  ILE B CB  1 
ATOM   7765 C  CG1 . ILE B 1 471 ? -17.579 10.596  -32.302 1.00 47.95  ? 471  ILE B CG1 1 
ATOM   7766 C  CG2 . ILE B 1 471 ? -15.790 12.165  -31.528 1.00 28.41  ? 471  ILE B CG2 1 
ATOM   7767 C  CD1 . ILE B 1 471 ? -18.416 10.528  -31.053 1.00 50.96  ? 471  ILE B CD1 1 
ATOM   7768 N  N   . PHE B 1 472 ? -13.062 9.890   -32.387 1.00 40.88  ? 472  PHE B N   1 
ATOM   7769 C  CA  . PHE B 1 472 ? -11.637 10.068  -32.126 1.00 35.25  ? 472  PHE B CA  1 
ATOM   7770 C  C   . PHE B 1 472 ? -10.851 10.150  -33.435 1.00 44.51  ? 472  PHE B C   1 
ATOM   7771 O  O   . PHE B 1 472 ? -10.037 11.056  -33.628 1.00 40.18  ? 472  PHE B O   1 
ATOM   7772 C  CB  . PHE B 1 472 ? -11.125 8.915   -31.258 1.00 43.73  ? 472  PHE B CB  1 
ATOM   7773 C  CG  . PHE B 1 472 ? -9.686  9.048   -30.846 1.00 44.95  ? 472  PHE B CG  1 
ATOM   7774 C  CD1 . PHE B 1 472 ? -9.171  10.272  -30.458 1.00 37.08  ? 472  PHE B CD1 1 
ATOM   7775 C  CD2 . PHE B 1 472 ? -8.857  7.940   -30.819 1.00 38.30  ? 472  PHE B CD2 1 
ATOM   7776 C  CE1 . PHE B 1 472 ? -7.853  10.393  -30.068 1.00 33.46  ? 472  PHE B CE1 1 
ATOM   7777 C  CE2 . PHE B 1 472 ? -7.539  8.053   -30.429 1.00 42.17  ? 472  PHE B CE2 1 
ATOM   7778 C  CZ  . PHE B 1 472 ? -7.036  9.284   -30.050 1.00 41.94  ? 472  PHE B CZ  1 
ATOM   7779 N  N   . ALA B 1 473 ? -11.109 9.206   -34.336 1.00 42.96  ? 473  ALA B N   1 
ATOM   7780 C  CA  . ALA B 1 473 ? -10.460 9.198   -35.641 1.00 45.56  ? 473  ALA B CA  1 
ATOM   7781 C  C   . ALA B 1 473 ? -10.738 10.507  -36.363 1.00 46.22  ? 473  ALA B C   1 
ATOM   7782 O  O   . ALA B 1 473 ? -9.857  11.071  -37.015 1.00 40.84  ? 473  ALA B O   1 
ATOM   7783 C  CB  . ALA B 1 473 ? -10.939 8.016   -36.477 1.00 34.25  ? 473  ALA B CB  1 
ATOM   7784 N  N   . GLN B 1 474 ? -11.966 10.997  -36.235 1.00 42.41  ? 474  GLN B N   1 
ATOM   7785 C  CA  . GLN B 1 474 ? -12.341 12.241  -36.894 1.00 41.91  ? 474  GLN B CA  1 
ATOM   7786 C  C   . GLN B 1 474 ? -11.522 13.407  -36.349 1.00 41.48  ? 474  GLN B C   1 
ATOM   7787 O  O   . GLN B 1 474 ? -11.101 14.290  -37.102 1.00 46.63  ? 474  GLN B O   1 
ATOM   7788 C  CB  . GLN B 1 474 ? -13.843 12.498  -36.761 1.00 50.96  ? 474  GLN B CB  1 
ATOM   7789 C  CG  . GLN B 1 474 ? -14.704 11.393  -37.372 1.00 61.97  ? 474  GLN B CG  1 
ATOM   7790 C  CD  . GLN B 1 474 ? -16.194 11.695  -37.315 1.00 61.13  ? 474  GLN B CD  1 
ATOM   7791 O  OE1 . GLN B 1 474 ? -16.917 11.162  -36.472 1.00 67.20  ? 474  GLN B OE1 1 
ATOM   7792 N  NE2 . GLN B 1 474 ? -16.657 12.557  -38.211 1.00 49.90  ? 474  GLN B NE2 1 
ATOM   7793 N  N   . ARG B 1 475 ? -11.276 13.398  -35.043 1.00 42.57  ? 475  ARG B N   1 
ATOM   7794 C  CA  . ARG B 1 475 ? -10.435 14.420  -34.434 1.00 42.79  ? 475  ARG B CA  1 
ATOM   7795 C  C   . ARG B 1 475 ? -9.018  14.357  -34.989 1.00 41.31  ? 475  ARG B C   1 
ATOM   7796 O  O   . ARG B 1 475 ? -8.433  15.384  -35.332 1.00 38.98  ? 475  ARG B O   1 
ATOM   7797 C  CB  . ARG B 1 475 ? -10.398 14.260  -32.918 1.00 42.47  ? 475  ARG B CB  1 
ATOM   7798 C  CG  . ARG B 1 475 ? -11.570 14.878  -32.187 1.00 56.20  ? 475  ARG B CG  1 
ATOM   7799 C  CD  . ARG B 1 475 ? -11.429 14.646  -30.692 1.00 46.94  ? 475  ARG B CD  1 
ATOM   7800 N  NE  . ARG B 1 475 ? -10.161 15.173  -30.204 1.00 47.79  ? 475  ARG B NE  1 
ATOM   7801 C  CZ  . ARG B 1 475 ? -9.444  14.612  -29.236 1.00 47.01  ? 475  ARG B CZ  1 
ATOM   7802 N  NH1 . ARG B 1 475 ? -9.865  13.493  -28.657 1.00 32.02  ? 475  ARG B NH1 1 
ATOM   7803 N  NH2 . ARG B 1 475 ? -8.298  15.163  -28.859 1.00 38.65  ? 475  ARG B NH2 1 
ATOM   7804 N  N   . LEU B 1 476 ? -8.475  13.146  -35.078 1.00 31.39  ? 476  LEU B N   1 
ATOM   7805 C  CA  . LEU B 1 476 ? -7.096  12.953  -35.517 1.00 34.82  ? 476  LEU B CA  1 
ATOM   7806 C  C   . LEU B 1 476 ? -6.885  13.369  -36.965 1.00 32.41  ? 476  LEU B C   1 
ATOM   7807 O  O   . LEU B 1 476 ? -5.904  14.039  -37.286 1.00 36.50  ? 476  LEU B O   1 
ATOM   7808 C  CB  . LEU B 1 476 ? -6.663  11.502  -35.309 1.00 33.08  ? 476  LEU B CB  1 
ATOM   7809 C  CG  . LEU B 1 476 ? -6.743  11.029  -33.855 1.00 35.56  ? 476  LEU B CG  1 
ATOM   7810 C  CD1 . LEU B 1 476 ? -6.412  9.552   -33.740 1.00 35.13  ? 476  LEU B CD1 1 
ATOM   7811 C  CD2 . LEU B 1 476 ? -5.838  11.865  -32.958 1.00 30.19  ? 476  LEU B CD2 1 
ATOM   7812 N  N   . MET B 1 477 ? -7.808  12.973  -37.834 1.00 30.32  ? 477  MET B N   1 
ATOM   7813 C  CA  . MET B 1 477 ? -7.734  13.348  -39.240 1.00 30.02  ? 477  MET B CA  1 
ATOM   7814 C  C   . MET B 1 477 ? -7.758  14.858  -39.367 1.00 31.18  ? 477  MET B C   1 
ATOM   7815 O  O   . MET B 1 477 ? -7.162  15.419  -40.281 1.00 39.67  ? 477  MET B O   1 
ATOM   7816 C  CB  . MET B 1 477 ? -8.896  12.744  -40.032 1.00 42.83  ? 477  MET B CB  1 
ATOM   7817 C  CG  . MET B 1 477 ? -8.955  11.227  -39.988 1.00 46.67  ? 477  MET B CG  1 
ATOM   7818 S  SD  . MET B 1 477 ? -10.441 10.569  -40.766 1.00 47.38  ? 477  MET B SD  1 
ATOM   7819 C  CE  . MET B 1 477 ? -10.086 10.892  -42.484 1.00 38.87  ? 477  MET B CE  1 
ATOM   7820 N  N   . LYS B 1 478 ? -8.456  15.511  -38.443 1.00 39.77  ? 478  LYS B N   1 
ATOM   7821 C  CA  . LYS B 1 478 ? -8.520  16.968  -38.421 1.00 41.72  ? 478  LYS B CA  1 
ATOM   7822 C  C   . LYS B 1 478 ? -7.175  17.576  -38.055 1.00 34.17  ? 478  LYS B C   1 
ATOM   7823 O  O   . LYS B 1 478 ? -6.703  18.493  -38.723 1.00 31.24  ? 478  LYS B O   1 
ATOM   7824 C  CB  . LYS B 1 478 ? -9.595  17.452  -37.449 1.00 47.14  ? 478  LYS B CB  1 
ATOM   7825 C  CG  . LYS B 1 478 ? -10.855 17.971  -38.118 1.00 54.10  ? 478  LYS B CG  1 
ATOM   7826 C  CD  . LYS B 1 478 ? -10.577 19.253  -38.884 1.00 60.41  ? 478  LYS B CD  1 
ATOM   7827 C  CE  . LYS B 1 478 ? -11.848 19.823  -39.494 1.00 75.89  ? 478  LYS B CE  1 
ATOM   7828 N  NZ  . LYS B 1 478 ? -12.562 18.834  -40.352 1.00 60.25  ? 478  LYS B NZ  1 
ATOM   7829 N  N   . TYR B 1 479 ? -6.564  17.065  -36.989 1.00 34.04  ? 479  TYR B N   1 
ATOM   7830 C  CA  . TYR B 1 479 ? -5.257  17.544  -36.562 1.00 31.31  ? 479  TYR B CA  1 
ATOM   7831 C  C   . TYR B 1 479 ? -4.265  17.416  -37.703 1.00 32.65  ? 479  TYR B C   1 
ATOM   7832 O  O   . TYR B 1 479 ? -3.614  18.391  -38.096 1.00 31.16  ? 479  TYR B O   1 
ATOM   7833 C  CB  . TYR B 1 479 ? -4.741  16.731  -35.381 1.00 35.56  ? 479  TYR B CB  1 
ATOM   7834 C  CG  . TYR B 1 479 ? -5.503  16.933  -34.100 1.00 30.80  ? 479  TYR B CG  1 
ATOM   7835 C  CD1 . TYR B 1 479 ? -5.918  18.195  -33.707 1.00 33.47  ? 479  TYR B CD1 1 
ATOM   7836 C  CD2 . TYR B 1 479 ? -5.781  15.863  -33.266 1.00 32.91  ? 479  TYR B CD2 1 
ATOM   7837 C  CE1 . TYR B 1 479 ? -6.612  18.378  -32.527 1.00 31.44  ? 479  TYR B CE1 1 
ATOM   7838 C  CE2 . TYR B 1 479 ? -6.468  16.038  -32.086 1.00 30.95  ? 479  TYR B CE2 1 
ATOM   7839 C  CZ  . TYR B 1 479 ? -6.882  17.297  -31.719 1.00 33.70  ? 479  TYR B CZ  1 
ATOM   7840 O  OH  . TYR B 1 479 ? -7.571  17.474  -30.539 1.00 45.27  ? 479  TYR B OH  1 
ATOM   7841 N  N   . TRP B 1 480 ? -4.159  16.200  -38.231 1.00 28.10  ? 480  TRP B N   1 
ATOM   7842 C  CA  . TRP B 1 480 ? -3.199  15.906  -39.289 1.00 34.93  ? 480  TRP B CA  1 
ATOM   7843 C  C   . TRP B 1 480 ? -3.395  16.781  -40.522 1.00 36.95  ? 480  TRP B C   1 
ATOM   7844 O  O   . TRP B 1 480 ? -2.436  17.376  -41.024 1.00 31.97  ? 480  TRP B O   1 
ATOM   7845 C  CB  . TRP B 1 480 ? -3.229  14.418  -39.657 1.00 29.62  ? 480  TRP B CB  1 
ATOM   7846 C  CG  . TRP B 1 480 ? -2.143  13.619  -38.996 1.00 28.51  ? 480  TRP B CG  1 
ATOM   7847 C  CD1 . TRP B 1 480 ? -1.155  12.910  -39.617 1.00 34.50  ? 480  TRP B CD1 1 
ATOM   7848 C  CD2 . TRP B 1 480 ? -1.924  13.458  -37.588 1.00 33.76  ? 480  TRP B CD2 1 
ATOM   7849 N  NE1 . TRP B 1 480 ? -0.337  12.314  -38.685 1.00 30.54  ? 480  TRP B NE1 1 
ATOM   7850 C  CE2 . TRP B 1 480 ? -0.786  12.635  -37.433 1.00 31.58  ? 480  TRP B CE2 1 
ATOM   7851 C  CE3 . TRP B 1 480 ? -2.576  13.929  -36.446 1.00 34.03  ? 480  TRP B CE3 1 
ATOM   7852 C  CZ2 . TRP B 1 480 ? -0.289  12.276  -36.181 1.00 29.09  ? 480  TRP B CZ2 1 
ATOM   7853 C  CZ3 . TRP B 1 480 ? -2.083  13.568  -35.203 1.00 37.66  ? 480  TRP B CZ3 1 
ATOM   7854 C  CH2 . TRP B 1 480 ? -0.949  12.751  -35.082 1.00 32.83  ? 480  TRP B CH2 1 
ATOM   7855 N  N   . THR B 1 481 ? -4.635  16.872  -40.999 1.00 29.13  ? 481  THR B N   1 
ATOM   7856 C  CA  . THR B 1 481 ? -4.917  17.638  -42.209 1.00 31.62  ? 481  THR B CA  1 
ATOM   7857 C  C   . THR B 1 481 ? -4.812  19.142  -41.969 1.00 36.46  ? 481  THR B C   1 
ATOM   7858 O  O   . THR B 1 481 ? -4.336  19.884  -42.829 1.00 39.94  ? 481  THR B O   1 
ATOM   7859 C  CB  . THR B 1 481 ? -6.286  17.281  -42.820 1.00 34.69  ? 481  THR B CB  1 
ATOM   7860 O  OG1 . THR B 1 481 ? -7.289  17.301  -41.799 1.00 42.53  ? 481  THR B OG1 1 
ATOM   7861 C  CG2 . THR B 1 481 ? -6.242  15.897  -43.444 1.00 31.58  ? 481  THR B CG2 1 
ATOM   7862 N  N   . ASN B 1 482 ? -5.249  19.595  -40.799 1.00 36.19  ? 482  ASN B N   1 
ATOM   7863 C  CA  . ASN B 1 482 ? -5.047  20.994  -40.445 1.00 37.63  ? 482  ASN B CA  1 
ATOM   7864 C  C   . ASN B 1 482 ? -3.564  21.319  -40.425 1.00 35.17  ? 482  ASN B C   1 
ATOM   7865 O  O   . ASN B 1 482 ? -3.139  22.373  -40.910 1.00 30.16  ? 482  ASN B O   1 
ATOM   7866 C  CB  . ASN B 1 482 ? -5.708  21.339  -39.111 1.00 41.71  ? 482  ASN B CB  1 
ATOM   7867 C  CG  . ASN B 1 482 ? -7.182  21.653  -39.266 1.00 43.44  ? 482  ASN B CG  1 
ATOM   7868 O  OD1 . ASN B 1 482 ? -7.593  22.274  -40.247 1.00 47.69  ? 482  ASN B OD1 1 
ATOM   7869 N  ND2 . ASN B 1 482 ? -7.986  21.219  -38.304 1.00 41.32  ? 482  ASN B ND2 1 
ATOM   7870 N  N   . PHE B 1 483 ? -2.770  20.402  -39.883 1.00 31.51  ? 483  PHE B N   1 
ATOM   7871 C  CA  . PHE B 1 483 ? -1.331  20.587  -39.913 1.00 38.20  ? 483  PHE B CA  1 
ATOM   7872 C  C   . PHE B 1 483 ? -0.840  20.686  -41.359 1.00 42.13  ? 483  PHE B C   1 
ATOM   7873 O  O   . PHE B 1 483 ? -0.036  21.559  -41.693 1.00 35.06  ? 483  PHE B O   1 
ATOM   7874 C  CB  . PHE B 1 483 ? -0.603  19.469  -39.166 1.00 33.67  ? 483  PHE B CB  1 
ATOM   7875 C  CG  . PHE B 1 483 ? 0.896   19.588  -39.225 1.00 31.32  ? 483  PHE B CG  1 
ATOM   7876 C  CD1 . PHE B 1 483 ? 1.561   20.529  -38.453 1.00 30.68  ? 483  PHE B CD1 1 
ATOM   7877 C  CD2 . PHE B 1 483 ? 1.639   18.769  -40.065 1.00 30.09  ? 483  PHE B CD2 1 
ATOM   7878 C  CE1 . PHE B 1 483 ? 2.936   20.645  -38.507 1.00 35.70  ? 483  PHE B CE1 1 
ATOM   7879 C  CE2 . PHE B 1 483 ? 3.015   18.879  -40.128 1.00 33.62  ? 483  PHE B CE2 1 
ATOM   7880 C  CZ  . PHE B 1 483 ? 3.667   19.819  -39.345 1.00 41.68  ? 483  PHE B CZ  1 
ATOM   7881 N  N   . ALA B 1 484 ? -1.334  19.798  -42.217 1.00 30.91  ? 484  ALA B N   1 
ATOM   7882 C  CA  . ALA B 1 484 ? -0.928  19.797  -43.622 1.00 34.43  ? 484  ALA B CA  1 
ATOM   7883 C  C   . ALA B 1 484 ? -1.297  21.108  -44.310 1.00 34.38  ? 484  ALA B C   1 
ATOM   7884 O  O   . ALA B 1 484 ? -0.517  21.652  -45.093 1.00 36.87  ? 484  ALA B O   1 
ATOM   7885 C  CB  . ALA B 1 484 ? -1.551  18.614  -44.362 1.00 29.71  ? 484  ALA B CB  1 
ATOM   7886 N  N   . ARG B 1 485 ? -2.490  21.610  -44.010 1.00 30.58  ? 485  ARG B N   1 
ATOM   7887 C  CA  . ARG B 1 485 ? -2.966  22.853  -44.602 1.00 40.63  ? 485  ARG B CA  1 
ATOM   7888 C  C   . ARG B 1 485 ? -2.190  24.071  -44.110 1.00 37.32  ? 485  ARG B C   1 
ATOM   7889 O  O   . ARG B 1 485 ? -1.958  25.007  -44.871 1.00 38.24  ? 485  ARG B O   1 
ATOM   7890 C  CB  . ARG B 1 485 ? -4.465  23.049  -44.328 1.00 35.90  ? 485  ARG B CB  1 
ATOM   7891 C  CG  . ARG B 1 485 ? -5.377  22.115  -45.117 1.00 47.93  ? 485  ARG B CG  1 
ATOM   7892 C  CD  . ARG B 1 485 ? -6.854  22.346  -44.792 1.00 42.35  ? 485  ARG B CD  1 
ATOM   7893 N  NE  . ARG B 1 485 ? -7.294  21.567  -43.640 1.00 42.80  ? 485  ARG B NE  1 
ATOM   7894 C  CZ  . ARG B 1 485 ? -8.102  20.513  -43.713 1.00 52.72  ? 485  ARG B CZ  1 
ATOM   7895 N  NH1 . ARG B 1 485 ? -8.576  20.113  -44.888 1.00 42.81  ? 485  ARG B NH1 1 
ATOM   7896 N  NH2 . ARG B 1 485 ? -8.444  19.862  -42.608 1.00 46.72  ? 485  ARG B NH2 1 
ATOM   7897 N  N   . THR B 1 486 ? -1.781  24.056  -42.845 1.00 40.15  ? 486  THR B N   1 
ATOM   7898 C  CA  . THR B 1 486 ? -1.316  25.284  -42.206 1.00 36.34  ? 486  THR B CA  1 
ATOM   7899 C  C   . THR B 1 486 ? -0.005  25.180  -41.437 1.00 41.14  ? 486  THR B C   1 
ATOM   7900 O  O   . THR B 1 486 ? 0.613   26.195  -41.130 1.00 46.19  ? 486  THR B O   1 
ATOM   7901 C  CB  . THR B 1 486 ? -2.372  25.814  -41.219 1.00 39.13  ? 486  THR B CB  1 
ATOM   7902 O  OG1 . THR B 1 486 ? -2.658  24.808  -40.239 1.00 37.42  ? 486  THR B OG1 1 
ATOM   7903 C  CG2 . THR B 1 486 ? -3.653  26.194  -41.948 1.00 21.78  ? 486  THR B CG2 1 
ATOM   7904 N  N   . GLY B 1 487 ? 0.414   23.966  -41.106 1.00 38.16  ? 487  GLY B N   1 
ATOM   7905 C  CA  . GLY B 1 487 ? 1.562   23.796  -40.232 1.00 35.00  ? 487  GLY B CA  1 
ATOM   7906 C  C   . GLY B 1 487 ? 1.150   23.958  -38.780 1.00 39.34  ? 487  GLY B C   1 
ATOM   7907 O  O   . GLY B 1 487 ? 1.991   24.088  -37.891 1.00 37.22  ? 487  GLY B O   1 
ATOM   7908 N  N   . ASP B 1 488 ? -0.161  23.948  -38.550 1.00 36.31  ? 488  ASP B N   1 
ATOM   7909 C  CA  . ASP B 1 488 ? -0.726  24.070  -37.216 1.00 34.08  ? 488  ASP B CA  1 
ATOM   7910 C  C   . ASP B 1 488 ? -1.931  23.144  -37.095 1.00 30.82  ? 488  ASP B C   1 
ATOM   7911 O  O   . ASP B 1 488 ? -2.951  23.355  -37.745 1.00 36.51  ? 488  ASP B O   1 
ATOM   7912 C  CB  . ASP B 1 488 ? -1.132  25.518  -36.946 1.00 33.51  ? 488  ASP B CB  1 
ATOM   7913 C  CG  . ASP B 1 488 ? -1.656  25.730  -35.536 1.00 39.31  ? 488  ASP B CG  1 
ATOM   7914 O  OD1 . ASP B 1 488 ? -2.105  24.752  -34.899 1.00 41.07  ? 488  ASP B OD1 1 
ATOM   7915 O  OD2 . ASP B 1 488 ? -1.623  26.885  -35.064 1.00 39.94  ? 488  ASP B OD2 1 
ATOM   7916 N  N   . PRO B 1 489 ? -1.814  22.117  -36.246 1.00 30.89  ? 489  PRO B N   1 
ATOM   7917 C  CA  . PRO B 1 489 ? -2.808  21.051  -36.082 1.00 32.47  ? 489  PRO B CA  1 
ATOM   7918 C  C   . PRO B 1 489 ? -4.121  21.564  -35.502 1.00 34.20  ? 489  PRO B C   1 
ATOM   7919 O  O   . PRO B 1 489 ? -5.124  20.851  -35.532 1.00 50.42  ? 489  PRO B O   1 
ATOM   7920 C  CB  . PRO B 1 489 ? -2.135  20.120  -35.065 1.00 27.32  ? 489  PRO B CB  1 
ATOM   7921 C  CG  . PRO B 1 489 ? -1.262  21.051  -34.268 1.00 32.92  ? 489  PRO B CG  1 
ATOM   7922 C  CD  . PRO B 1 489 ? -0.674  21.929  -35.332 1.00 33.72  ? 489  PRO B CD  1 
ATOM   7923 N  N   . ASN B 1 490 ? -4.108  22.785  -34.977 1.00 33.29  ? 490  ASN B N   1 
ATOM   7924 C  CA  . ASN B 1 490 ? -5.275  23.349  -34.307 1.00 40.43  ? 490  ASN B CA  1 
ATOM   7925 C  C   . ASN B 1 490 ? -6.428  23.716  -35.242 1.00 40.75  ? 490  ASN B C   1 
ATOM   7926 O  O   . ASN B 1 490 ? -6.231  24.351  -36.281 1.00 50.49  ? 490  ASN B O   1 
ATOM   7927 C  CB  . ASN B 1 490 ? -4.871  24.566  -33.476 1.00 34.45  ? 490  ASN B CB  1 
ATOM   7928 C  CG  . ASN B 1 490 ? -4.140  24.189  -32.209 1.00 38.27  ? 490  ASN B CG  1 
ATOM   7929 O  OD1 . ASN B 1 490 ? -4.708  23.561  -31.313 1.00 40.59  ? 490  ASN B OD1 1 
ATOM   7930 N  ND2 . ASN B 1 490 ? -2.874  24.579  -32.119 1.00 40.12  ? 490  ASN B ND2 1 
ATOM   7931 N  N   . ASP B 1 491 ? -7.634  23.315  -34.854 1.00 48.68  ? 491  ASP B N   1 
ATOM   7932 C  CA  . ASP B 1 491 ? -8.843  23.632  -35.610 1.00 65.72  ? 491  ASP B CA  1 
ATOM   7933 C  C   . ASP B 1 491 ? -9.138  25.131  -35.545 1.00 55.66  ? 491  ASP B C   1 
ATOM   7934 O  O   . ASP B 1 491 ? -9.341  25.678  -34.460 1.00 60.98  ? 491  ASP B O   1 
ATOM   7935 C  CB  . ASP B 1 491 ? -10.030 22.835  -35.057 1.00 68.95  ? 491  ASP B CB  1 
ATOM   7936 C  CG  . ASP B 1 491 ? -11.072 22.527  -36.114 1.00 68.72  ? 491  ASP B CG  1 
ATOM   7937 O  OD1 . ASP B 1 491 ? -11.113 23.239  -37.141 1.00 65.19  ? 491  ASP B OD1 1 
ATOM   7938 O  OD2 . ASP B 1 491 ? -11.848 21.568  -35.917 1.00 69.12  ? 491  ASP B OD2 1 
ATOM   7939 N  N   . PRO B 1 492 ? -9.166  25.797  -36.712 1.00 64.03  ? 492  PRO B N   1 
ATOM   7940 C  CA  . PRO B 1 492 ? -9.318  27.255  -36.816 1.00 69.89  ? 492  PRO B CA  1 
ATOM   7941 C  C   . PRO B 1 492 ? -10.734 27.723  -36.491 1.00 77.77  ? 492  PRO B C   1 
ATOM   7942 O  O   . PRO B 1 492 ? -10.967 28.926  -36.357 1.00 81.90  ? 492  PRO B O   1 
ATOM   7943 C  CB  . PRO B 1 492 ? -9.007  27.542  -38.293 1.00 73.15  ? 492  PRO B CB  1 
ATOM   7944 C  CG  . PRO B 1 492 ? -8.492  26.245  -38.872 1.00 63.56  ? 492  PRO B CG  1 
ATOM   7945 C  CD  . PRO B 1 492 ? -9.084  25.164  -38.037 1.00 69.33  ? 492  PRO B CD  1 
ATOM   7946 N  N   . ARG B 1 493 ? -11.665 26.781  -36.382 1.00 73.64  ? 493  ARG B N   1 
ATOM   7947 C  CA  . ARG B 1 493 ? -13.041 27.099  -36.025 1.00 77.70  ? 493  ARG B CA  1 
ATOM   7948 C  C   . ARG B 1 493 ? -13.272 26.823  -34.547 1.00 83.85  ? 493  ARG B C   1 
ATOM   7949 O  O   . ARG B 1 493 ? -14.000 27.552  -33.874 1.00 98.08  ? 493  ARG B O   1 
ATOM   7950 C  CB  . ARG B 1 493 ? -14.022 26.282  -36.870 1.00 68.72  ? 493  ARG B CB  1 
ATOM   7951 N  N   . ASP B 1 494 ? -12.640 25.768  -34.044 1.00 70.48  ? 494  ASP B N   1 
ATOM   7952 C  CA  . ASP B 1 494 ? -12.772 25.407  -32.643 1.00 70.12  ? 494  ASP B CA  1 
ATOM   7953 C  C   . ASP B 1 494 ? -12.051 26.388  -31.720 1.00 82.26  ? 494  ASP B C   1 
ATOM   7954 O  O   . ASP B 1 494 ? -10.820 26.457  -31.708 1.00 81.15  ? 494  ASP B O   1 
ATOM   7955 C  CB  . ASP B 1 494 ? -12.245 23.996  -32.398 1.00 75.93  ? 494  ASP B CB  1 
ATOM   7956 C  CG  . ASP B 1 494 ? -12.536 23.506  -30.993 1.00 97.20  ? 494  ASP B CG  1 
ATOM   7957 O  OD1 . ASP B 1 494 ? -13.728 23.334  -30.656 1.00 101.90 ? 494  ASP B OD1 1 
ATOM   7958 O  OD2 . ASP B 1 494 ? -11.574 23.291  -30.225 1.00 84.50  ? 494  ASP B OD2 1 
ATOM   7959 N  N   . SER B 1 495 ? -12.830 27.151  -30.960 1.00 77.63  ? 495  SER B N   1 
ATOM   7960 C  CA  . SER B 1 495 ? -12.310 27.904  -29.825 1.00 70.23  ? 495  SER B CA  1 
ATOM   7961 C  C   . SER B 1 495 ? -12.652 27.133  -28.555 1.00 77.12  ? 495  SER B C   1 
ATOM   7962 O  O   . SER B 1 495 ? -13.721 26.530  -28.465 1.00 95.29  ? 495  SER B O   1 
ATOM   7963 C  CB  . SER B 1 495 ? -12.906 29.307  -29.789 1.00 64.26  ? 495  SER B CB  1 
ATOM   7964 O  OG  . SER B 1 495 ? -14.160 29.334  -30.443 1.00 63.09  ? 495  SER B OG  1 
ATOM   7965 N  N   . LYS B 1 496 ? -11.742 27.139  -27.586 1.00 80.30  ? 496  LYS B N   1 
ATOM   7966 C  CA  . LYS B 1 496 ? -11.850 26.256  -26.429 1.00 84.52  ? 496  LYS B CA  1 
ATOM   7967 C  C   . LYS B 1 496 ? -11.613 24.823  -26.885 1.00 106.46 ? 496  LYS B C   1 
ATOM   7968 O  O   . LYS B 1 496 ? -12.294 24.340  -27.792 1.00 98.31  ? 496  LYS B O   1 
ATOM   7969 C  CB  . LYS B 1 496 ? -13.233 26.361  -25.791 1.00 82.02  ? 496  LYS B CB  1 
ATOM   7970 C  CG  . LYS B 1 496 ? -13.349 25.692  -24.433 1.00 89.30  ? 496  LYS B CG  1 
ATOM   7971 C  CD  . LYS B 1 496 ? -12.730 26.566  -23.362 1.00 74.18  ? 496  LYS B CD  1 
ATOM   7972 C  CE  . LYS B 1 496 ? -13.119 28.020  -23.581 1.00 65.20  ? 496  LYS B CE  1 
ATOM   7973 N  NZ  . LYS B 1 496 ? -14.605 28.178  -23.670 1.00 79.00  ? 496  LYS B NZ  1 
ATOM   7974 N  N   . SER B 1 497 ? -10.655 24.140  -26.263 1.00 132.36 ? 497  SER B N   1 
ATOM   7975 C  CA  . SER B 1 497 ? -10.361 22.760  -26.655 1.00 99.00  ? 497  SER B CA  1 
ATOM   7976 C  C   . SER B 1 497 ? -9.621  21.871  -25.636 1.00 92.99  ? 497  SER B C   1 
ATOM   7977 O  O   . SER B 1 497 ? -10.049 20.741  -25.396 1.00 90.87  ? 497  SER B O   1 
ATOM   7978 C  CB  . SER B 1 497 ? -9.691  22.719  -28.033 1.00 100.15 ? 497  SER B CB  1 
ATOM   7979 O  OG  . SER B 1 497 ? -9.076  23.959  -28.335 1.00 100.14 ? 497  SER B OG  1 
ATOM   7980 N  N   . PRO B 1 498 ? -8.506  22.350  -25.047 1.00 82.87  ? 498  PRO B N   1 
ATOM   7981 C  CA  . PRO B 1 498 ? -7.786  23.612  -25.234 1.00 70.52  ? 498  PRO B CA  1 
ATOM   7982 C  C   . PRO B 1 498 ? -6.933  23.529  -26.485 1.00 56.53  ? 498  PRO B C   1 
ATOM   7983 O  O   . PRO B 1 498 ? -7.048  22.564  -27.236 1.00 65.15  ? 498  PRO B O   1 
ATOM   7984 C  CB  . PRO B 1 498 ? -6.859  23.680  -24.011 1.00 63.86  ? 498  PRO B CB  1 
ATOM   7985 C  CG  . PRO B 1 498 ? -7.200  22.483  -23.153 1.00 61.41  ? 498  PRO B CG  1 
ATOM   7986 C  CD  . PRO B 1 498 ? -7.824  21.493  -24.065 1.00 69.07  ? 498  PRO B CD  1 
ATOM   7987 N  N   . GLN B 1 499 ? -6.073  24.513  -26.705 1.00 51.20  ? 499  GLN B N   1 
ATOM   7988 C  CA  . GLN B 1 499 ? -5.256  24.507  -27.906 1.00 40.97  ? 499  GLN B CA  1 
ATOM   7989 C  C   . GLN B 1 499 ? -4.031  23.612  -27.738 1.00 39.02  ? 499  GLN B C   1 
ATOM   7990 O  O   . GLN B 1 499 ? -3.506  23.441  -26.632 1.00 31.87  ? 499  GLN B O   1 
ATOM   7991 C  CB  . GLN B 1 499 ? -4.838  25.933  -28.284 1.00 48.19  ? 499  GLN B CB  1 
ATOM   7992 C  CG  . GLN B 1 499 ? -6.001  26.881  -28.557 1.00 40.30  ? 499  GLN B CG  1 
ATOM   7993 C  CD  . GLN B 1 499 ? -6.710  26.606  -29.878 1.00 42.19  ? 499  GLN B CD  1 
ATOM   7994 O  OE1 . GLN B 1 499 ? -6.146  26.808  -30.952 1.00 43.24  ? 499  GLN B OE1 1 
ATOM   7995 N  NE2 . GLN B 1 499 ? -7.966  26.177  -29.799 1.00 46.52  ? 499  GLN B NE2 1 
ATOM   7996 N  N   . TRP B 1 500 ? -3.595  23.033  -28.850 1.00 34.67  ? 500  TRP B N   1 
ATOM   7997 C  CA  . TRP B 1 500 ? -2.340  22.298  -28.915 1.00 29.57  ? 500  TRP B CA  1 
ATOM   7998 C  C   . TRP B 1 500 ? -1.193  23.299  -29.043 1.00 33.74  ? 500  TRP B C   1 
ATOM   7999 O  O   . TRP B 1 500 ? -1.034  23.937  -30.085 1.00 31.08  ? 500  TRP B O   1 
ATOM   8000 C  CB  . TRP B 1 500 ? -2.362  21.377  -30.134 1.00 31.82  ? 500  TRP B CB  1 
ATOM   8001 C  CG  . TRP B 1 500 ? -1.252  20.382  -30.204 1.00 33.46  ? 500  TRP B CG  1 
ATOM   8002 C  CD1 . TRP B 1 500 ? -0.026  20.464  -29.603 1.00 27.21  ? 500  TRP B CD1 1 
ATOM   8003 C  CD2 . TRP B 1 500 ? -1.248  19.170  -30.960 1.00 32.90  ? 500  TRP B CD2 1 
ATOM   8004 N  NE1 . TRP B 1 500 ? 0.729   19.368  -29.924 1.00 32.96  ? 500  TRP B NE1 1 
ATOM   8005 C  CE2 . TRP B 1 500 ? 0.006   18.558  -30.759 1.00 36.81  ? 500  TRP B CE2 1 
ATOM   8006 C  CE3 . TRP B 1 500 ? -2.185  18.537  -31.784 1.00 36.61  ? 500  TRP B CE3 1 
ATOM   8007 C  CZ2 . TRP B 1 500 ? 0.346   17.339  -31.347 1.00 42.14  ? 500  TRP B CZ2 1 
ATOM   8008 C  CZ3 . TRP B 1 500 ? -1.846  17.330  -32.372 1.00 35.72  ? 500  TRP B CZ3 1 
ATOM   8009 C  CH2 . TRP B 1 500 ? -0.592  16.741  -32.148 1.00 35.16  ? 500  TRP B CH2 1 
ATOM   8010 N  N   . PRO B 1 501 ? -0.389  23.446  -27.981 1.00 29.26  ? 501  PRO B N   1 
ATOM   8011 C  CA  . PRO B 1 501 ? 0.708   24.418  -27.998 1.00 34.89  ? 501  PRO B CA  1 
ATOM   8012 C  C   . PRO B 1 501 ? 1.909   23.866  -28.753 1.00 33.59  ? 501  PRO B C   1 
ATOM   8013 O  O   . PRO B 1 501 ? 2.073   22.653  -28.819 1.00 32.41  ? 501  PRO B O   1 
ATOM   8014 C  CB  . PRO B 1 501 ? 1.073   24.571  -26.512 1.00 22.01  ? 501  PRO B CB  1 
ATOM   8015 C  CG  . PRO B 1 501 ? 0.193   23.604  -25.754 1.00 27.07  ? 501  PRO B CG  1 
ATOM   8016 C  CD  . PRO B 1 501 ? -0.393  22.655  -26.744 1.00 31.54  ? 501  PRO B CD  1 
ATOM   8017 N  N   . PRO B 1 502 ? 2.740   24.747  -29.325 1.00 31.75  ? 502  PRO B N   1 
ATOM   8018 C  CA  . PRO B 1 502 ? 3.980   24.291  -29.951 1.00 35.37  ? 502  PRO B CA  1 
ATOM   8019 C  C   . PRO B 1 502 ? 4.958   23.749  -28.911 1.00 39.69  ? 502  PRO B C   1 
ATOM   8020 O  O   . PRO B 1 502 ? 5.049   24.274  -27.800 1.00 41.09  ? 502  PRO B O   1 
ATOM   8021 C  CB  . PRO B 1 502 ? 4.547   25.571  -30.574 1.00 30.48  ? 502  PRO B CB  1 
ATOM   8022 C  CG  . PRO B 1 502 ? 3.374   26.472  -30.737 1.00 36.13  ? 502  PRO B CG  1 
ATOM   8023 C  CD  . PRO B 1 502 ? 2.504   26.179  -29.558 1.00 30.76  ? 502  PRO B CD  1 
ATOM   8024 N  N   . TYR B 1 503 ? 5.683   22.700  -29.270 1.00 33.57  ? 503  TYR B N   1 
ATOM   8025 C  CA  . TYR B 1 503 ? 6.755   22.212  -28.427 1.00 35.46  ? 503  TYR B CA  1 
ATOM   8026 C  C   . TYR B 1 503 ? 7.924   23.188  -28.483 1.00 36.60  ? 503  TYR B C   1 
ATOM   8027 O  O   . TYR B 1 503 ? 8.365   23.590  -29.563 1.00 32.88  ? 503  TYR B O   1 
ATOM   8028 C  CB  . TYR B 1 503 ? 7.205   20.816  -28.866 1.00 33.45  ? 503  TYR B CB  1 
ATOM   8029 C  CG  . TYR B 1 503 ? 8.267   20.227  -27.970 1.00 32.40  ? 503  TYR B CG  1 
ATOM   8030 C  CD1 . TYR B 1 503 ? 9.617   20.453  -28.213 1.00 27.99  ? 503  TYR B CD1 1 
ATOM   8031 C  CD2 . TYR B 1 503 ? 7.919   19.458  -26.868 1.00 31.36  ? 503  TYR B CD2 1 
ATOM   8032 C  CE1 . TYR B 1 503 ? 10.581  19.923  -27.389 1.00 29.48  ? 503  TYR B CE1 1 
ATOM   8033 C  CE2 . TYR B 1 503 ? 8.879   18.921  -26.037 1.00 28.07  ? 503  TYR B CE2 1 
ATOM   8034 C  CZ  . TYR B 1 503 ? 10.205  19.156  -26.300 1.00 28.81  ? 503  TYR B CZ  1 
ATOM   8035 O  OH  . TYR B 1 503 ? 11.160  18.617  -25.471 1.00 34.97  ? 503  TYR B OH  1 
ATOM   8036 N  N   . THR B 1 504 ? 8.414   23.572  -27.310 1.00 30.86  ? 504  THR B N   1 
ATOM   8037 C  CA  . THR B 1 504 ? 9.549   24.475  -27.205 1.00 38.11  ? 504  THR B CA  1 
ATOM   8038 C  C   . THR B 1 504 ? 10.500  23.930  -26.161 1.00 37.11  ? 504  THR B C   1 
ATOM   8039 O  O   . THR B 1 504 ? 10.095  23.172  -25.280 1.00 36.48  ? 504  THR B O   1 
ATOM   8040 C  CB  . THR B 1 504 ? 9.116   25.873  -26.742 1.00 44.88  ? 504  THR B CB  1 
ATOM   8041 O  OG1 . THR B 1 504 ? 8.595   25.791  -25.407 1.00 35.09  ? 504  THR B OG1 1 
ATOM   8042 C  CG2 . THR B 1 504 ? 8.056   26.449  -27.669 1.00 22.10  ? 504  THR B CG2 1 
ATOM   8043 N  N   . THR B 1 505 ? 11.765  24.319  -26.250 1.00 41.33  ? 505  THR B N   1 
ATOM   8044 C  CA  . THR B 1 505 ? 12.748  23.851  -25.282 1.00 45.77  ? 505  THR B CA  1 
ATOM   8045 C  C   . THR B 1 505 ? 12.470  24.437  -23.901 1.00 38.07  ? 505  THR B C   1 
ATOM   8046 O  O   . THR B 1 505 ? 12.834  23.852  -22.888 1.00 43.57  ? 505  THR B O   1 
ATOM   8047 C  CB  . THR B 1 505 ? 14.184  24.172  -25.734 1.00 51.98  ? 505  THR B CB  1 
ATOM   8048 O  OG1 . THR B 1 505 ? 14.218  25.480  -26.318 1.00 53.42  ? 505  THR B OG1 1 
ATOM   8049 C  CG2 . THR B 1 505 ? 14.641  23.161  -26.777 1.00 42.32  ? 505  THR B CG2 1 
ATOM   8050 N  N   . ALA B 1 506 ? 11.790  25.579  -23.871 1.00 43.80  ? 506  ALA B N   1 
ATOM   8051 C  CA  . ALA B 1 506 ? 11.437  26.235  -22.616 1.00 39.91  ? 506  ALA B CA  1 
ATOM   8052 C  C   . ALA B 1 506 ? 10.368  25.462  -21.843 1.00 54.18  ? 506  ALA B C   1 
ATOM   8053 O  O   . ALA B 1 506 ? 10.652  24.879  -20.795 1.00 55.71  ? 506  ALA B O   1 
ATOM   8054 C  CB  . ALA B 1 506 ? 10.977  27.666  -22.872 1.00 34.20  ? 506  ALA B CB  1 
ATOM   8055 N  N   . ALA B 1 507 ? 9.140   25.464  -22.360 1.00 36.87  ? 507  ALA B N   1 
ATOM   8056 C  CA  . ALA B 1 507 ? 8.019   24.827  -21.676 1.00 39.16  ? 507  ALA B CA  1 
ATOM   8057 C  C   . ALA B 1 507 ? 7.918   23.315  -21.919 1.00 36.52  ? 507  ALA B C   1 
ATOM   8058 O  O   . ALA B 1 507 ? 7.317   22.600  -21.122 1.00 38.70  ? 507  ALA B O   1 
ATOM   8059 C  CB  . ALA B 1 507 ? 6.709   25.518  -22.051 1.00 37.54  ? 507  ALA B CB  1 
ATOM   8060 N  N   . GLN B 1 508 ? 8.497   22.838  -23.016 1.00 29.57  ? 508  GLN B N   1 
ATOM   8061 C  CA  . GLN B 1 508 ? 8.459   21.413  -23.353 1.00 40.83  ? 508  GLN B CA  1 
ATOM   8062 C  C   . GLN B 1 508 ? 7.046   20.829  -23.338 1.00 40.88  ? 508  GLN B C   1 
ATOM   8063 O  O   . GLN B 1 508 ? 6.819   19.723  -22.837 1.00 34.84  ? 508  GLN B O   1 
ATOM   8064 C  CB  . GLN B 1 508 ? 9.361   20.610  -22.415 1.00 36.84  ? 508  GLN B CB  1 
ATOM   8065 C  CG  . GLN B 1 508 ? 10.804  21.069  -22.412 1.00 42.77  ? 508  GLN B CG  1 
ATOM   8066 C  CD  . GLN B 1 508 ? 11.667  20.249  -21.478 1.00 49.13  ? 508  GLN B CD  1 
ATOM   8067 O  OE1 . GLN B 1 508 ? 11.716  19.022  -21.575 1.00 40.35  ? 508  GLN B OE1 1 
ATOM   8068 N  NE2 . GLN B 1 508 ? 12.360  20.925  -20.570 1.00 43.86  ? 508  GLN B NE2 1 
ATOM   8069 N  N   . GLN B 1 509 ? 6.096   21.571  -23.892 1.00 34.58  ? 509  GLN B N   1 
ATOM   8070 C  CA  . GLN B 1 509 ? 4.709   21.125  -23.904 1.00 31.75  ? 509  GLN B CA  1 
ATOM   8071 C  C   . GLN B 1 509 ? 4.380   20.189  -25.071 1.00 36.46  ? 509  GLN B C   1 
ATOM   8072 O  O   . GLN B 1 509 ? 4.887   20.340  -26.185 1.00 26.19  ? 509  GLN B O   1 
ATOM   8073 C  CB  . GLN B 1 509 ? 3.772   22.326  -23.916 1.00 34.04  ? 509  GLN B CB  1 
ATOM   8074 C  CG  . GLN B 1 509 ? 3.806   23.133  -22.638 1.00 40.78  ? 509  GLN B CG  1 
ATOM   8075 C  CD  . GLN B 1 509 ? 3.068   24.439  -22.783 1.00 40.65  ? 509  GLN B CD  1 
ATOM   8076 O  OE1 . GLN B 1 509 ? 3.372   25.236  -23.668 1.00 34.02  ? 509  GLN B OE1 1 
ATOM   8077 N  NE2 . GLN B 1 509 ? 2.092   24.669  -21.916 1.00 39.24  ? 509  GLN B NE2 1 
ATOM   8078 N  N   . TYR B 1 510 ? 3.528   19.213  -24.786 1.00 30.73  ? 510  TYR B N   1 
ATOM   8079 C  CA  . TYR B 1 510 ? 3.015   18.290  -25.782 1.00 32.90  ? 510  TYR B CA  1 
ATOM   8080 C  C   . TYR B 1 510 ? 1.630   17.863  -25.309 1.00 30.09  ? 510  TYR B C   1 
ATOM   8081 O  O   . TYR B 1 510 ? 1.225   18.192  -24.199 1.00 37.06  ? 510  TYR B O   1 
ATOM   8082 C  CB  . TYR B 1 510 ? 3.943   17.081  -25.923 1.00 29.00  ? 510  TYR B CB  1 
ATOM   8083 C  CG  . TYR B 1 510 ? 4.009   16.233  -24.680 1.00 33.87  ? 510  TYR B CG  1 
ATOM   8084 C  CD1 . TYR B 1 510 ? 4.795   16.617  -23.596 1.00 34.18  ? 510  TYR B CD1 1 
ATOM   8085 C  CD2 . TYR B 1 510 ? 3.277   15.049  -24.582 1.00 34.03  ? 510  TYR B CD2 1 
ATOM   8086 C  CE1 . TYR B 1 510 ? 4.855   15.846  -22.447 1.00 34.99  ? 510  TYR B CE1 1 
ATOM   8087 C  CE2 . TYR B 1 510 ? 3.332   14.265  -23.439 1.00 29.88  ? 510  TYR B CE2 1 
ATOM   8088 C  CZ  . TYR B 1 510 ? 4.124   14.671  -22.376 1.00 40.84  ? 510  TYR B CZ  1 
ATOM   8089 O  OH  . TYR B 1 510 ? 4.179   13.905  -21.238 1.00 38.39  ? 510  TYR B OH  1 
ATOM   8090 N  N   . VAL B 1 511 ? 0.891   17.145  -26.140 1.00 32.95  ? 511  VAL B N   1 
ATOM   8091 C  CA  . VAL B 1 511 ? -0.472  16.796  -25.768 1.00 28.08  ? 511  VAL B CA  1 
ATOM   8092 C  C   . VAL B 1 511 ? -0.697  15.295  -25.800 1.00 32.41  ? 511  VAL B C   1 
ATOM   8093 O  O   . VAL B 1 511 ? 0.005   14.560  -26.492 1.00 37.43  ? 511  VAL B O   1 
ATOM   8094 C  CB  . VAL B 1 511 ? -1.497  17.479  -26.681 1.00 33.00  ? 511  VAL B CB  1 
ATOM   8095 C  CG1 . VAL B 1 511 ? -1.279  18.989  -26.680 1.00 24.40  ? 511  VAL B CG1 1 
ATOM   8096 C  CG2 . VAL B 1 511 ? -1.406  16.913  -28.099 1.00 31.25  ? 511  VAL B CG2 1 
ATOM   8097 N  N   . SER B 1 512 ? -1.675  14.843  -25.027 1.00 27.50  ? 512  SER B N   1 
ATOM   8098 C  CA  . SER B 1 512 ? -2.080  13.450  -25.063 1.00 40.49  ? 512  SER B CA  1 
ATOM   8099 C  C   . SER B 1 512 ? -3.196  13.294  -26.083 1.00 38.03  ? 512  SER B C   1 
ATOM   8100 O  O   . SER B 1 512 ? -4.116  14.108  -26.141 1.00 31.66  ? 512  SER B O   1 
ATOM   8101 C  CB  . SER B 1 512 ? -2.549  12.982  -23.682 1.00 33.29  ? 512  SER B CB  1 
ATOM   8102 O  OG  . SER B 1 512 ? -3.500  13.880  -23.140 1.00 43.81  ? 512  SER B OG  1 
ATOM   8103 N  N   . LEU B 1 513 ? -3.090  12.256  -26.902 1.00 36.66  ? 513  LEU B N   1 
ATOM   8104 C  CA  . LEU B 1 513 ? -4.142  11.907  -27.839 1.00 33.80  ? 513  LEU B CA  1 
ATOM   8105 C  C   . LEU B 1 513 ? -4.851  10.671  -27.325 1.00 39.11  ? 513  LEU B C   1 
ATOM   8106 O  O   . LEU B 1 513 ? -4.266  9.585   -27.255 1.00 33.54  ? 513  LEU B O   1 
ATOM   8107 C  CB  . LEU B 1 513 ? -3.555  11.647  -29.225 1.00 33.47  ? 513  LEU B CB  1 
ATOM   8108 C  CG  . LEU B 1 513 ? -2.826  12.856  -29.806 1.00 31.95  ? 513  LEU B CG  1 
ATOM   8109 C  CD1 . LEU B 1 513 ? -2.260  12.549  -31.180 1.00 28.97  ? 513  LEU B CD1 1 
ATOM   8110 C  CD2 . LEU B 1 513 ? -3.769  14.048  -29.861 1.00 27.37  ? 513  LEU B CD2 1 
ATOM   8111 N  N   . ASN B 1 514 ? -6.106  10.855  -26.938 1.00 35.38  ? 514  ASN B N   1 
ATOM   8112 C  CA  . ASN B 1 514 ? -6.948  9.760   -26.474 1.00 38.69  ? 514  ASN B CA  1 
ATOM   8113 C  C   . ASN B 1 514 ? -8.413  10.182  -26.528 1.00 43.56  ? 514  ASN B C   1 
ATOM   8114 O  O   . ASN B 1 514 ? -8.746  11.221  -27.104 1.00 34.59  ? 514  ASN B O   1 
ATOM   8115 C  CB  . ASN B 1 514 ? -6.551  9.327   -25.060 1.00 35.53  ? 514  ASN B CB  1 
ATOM   8116 C  CG  . ASN B 1 514 ? -6.554  10.482  -24.075 1.00 42.44  ? 514  ASN B CG  1 
ATOM   8117 O  OD1 . ASN B 1 514 ? -7.461  11.313  -24.083 1.00 43.59  ? 514  ASN B OD1 1 
ATOM   8118 N  ND2 . ASN B 1 514 ? -5.535  10.541  -23.224 1.00 38.31  ? 514  ASN B ND2 1 
ATOM   8119 N  N   . LEU B 1 515 ? -9.290  9.384   -25.929 1.00 37.72  ? 515  LEU B N   1 
ATOM   8120 C  CA  . LEU B 1 515 ? -10.720 9.665   -26.002 1.00 39.12  ? 515  LEU B CA  1 
ATOM   8121 C  C   . LEU B 1 515 ? -11.128 10.926  -25.232 1.00 45.62  ? 515  LEU B C   1 
ATOM   8122 O  O   . LEU B 1 515 ? -12.104 11.580  -25.586 1.00 50.80  ? 515  LEU B O   1 
ATOM   8123 C  CB  . LEU B 1 515 ? -11.530 8.451   -25.553 1.00 33.89  ? 515  LEU B CB  1 
ATOM   8124 C  CG  . LEU B 1 515 ? -11.244 7.212   -26.405 1.00 50.06  ? 515  LEU B CG  1 
ATOM   8125 C  CD1 . LEU B 1 515 ? -12.207 6.099   -26.068 1.00 42.48  ? 515  LEU B CD1 1 
ATOM   8126 C  CD2 . LEU B 1 515 ? -11.314 7.550   -27.887 1.00 45.23  ? 515  LEU B CD2 1 
ATOM   8127 N  N   . LYS B 1 516 ? -10.378 11.270  -24.191 1.00 42.92  ? 516  LYS B N   1 
ATOM   8128 C  CA  . LYS B 1 516 ? -10.608 12.523  -23.479 1.00 44.89  ? 516  LYS B CA  1 
ATOM   8129 C  C   . LYS B 1 516 ? -10.063 13.676  -24.318 1.00 44.57  ? 516  LYS B C   1 
ATOM   8130 O  O   . LYS B 1 516 ? -9.281  13.456  -25.239 1.00 50.13  ? 516  LYS B O   1 
ATOM   8131 C  CB  . LYS B 1 516 ? -9.945  12.492  -22.100 1.00 50.59  ? 516  LYS B CB  1 
ATOM   8132 C  CG  . LYS B 1 516 ? -10.245 11.221  -21.317 1.00 47.98  ? 516  LYS B CG  1 
ATOM   8133 C  CD  . LYS B 1 516 ? -10.012 11.401  -19.828 1.00 62.79  ? 516  LYS B CD  1 
ATOM   8134 C  CE  . LYS B 1 516 ? -10.491 10.181  -19.052 1.00 88.90  ? 516  LYS B CE  1 
ATOM   8135 N  NZ  . LYS B 1 516 ? -10.538 10.419  -17.579 1.00 100.11 ? 516  LYS B NZ  1 
ATOM   8136 N  N   . PRO B 1 517 ? -10.489 14.910  -24.016 1.00 49.79  ? 517  PRO B N   1 
ATOM   8137 C  CA  . PRO B 1 517 ? -10.043 16.079  -24.786 1.00 41.77  ? 517  PRO B CA  1 
ATOM   8138 C  C   . PRO B 1 517 ? -8.553  16.353  -24.610 1.00 44.59  ? 517  PRO B C   1 
ATOM   8139 O  O   . PRO B 1 517 ? -7.950  15.864  -23.655 1.00 46.79  ? 517  PRO B O   1 
ATOM   8140 C  CB  . PRO B 1 517 ? -10.856 17.230  -24.177 1.00 46.92  ? 517  PRO B CB  1 
ATOM   8141 C  CG  . PRO B 1 517 ? -12.023 16.573  -23.507 1.00 29.35  ? 517  PRO B CG  1 
ATOM   8142 C  CD  . PRO B 1 517 ? -11.497 15.264  -23.004 1.00 37.94  ? 517  PRO B CD  1 
ATOM   8143 N  N   . LEU B 1 518 ? -7.970  17.130  -25.518 1.00 46.77  ? 518  LEU B N   1 
ATOM   8144 C  CA  . LEU B 1 518 ? -6.550  17.454  -25.431 1.00 41.95  ? 518  LEU B CA  1 
ATOM   8145 C  C   . LEU B 1 518 ? -6.156  17.871  -24.024 1.00 40.23  ? 518  LEU B C   1 
ATOM   8146 O  O   . LEU B 1 518 ? -6.800  18.714  -23.399 1.00 36.63  ? 518  LEU B O   1 
ATOM   8147 C  CB  . LEU B 1 518 ? -6.168  18.570  -26.403 1.00 35.31  ? 518  LEU B CB  1 
ATOM   8148 C  CG  . LEU B 1 518 ? -5.886  18.194  -27.852 1.00 38.68  ? 518  LEU B CG  1 
ATOM   8149 C  CD1 . LEU B 1 518 ? -5.254  19.377  -28.573 1.00 35.32  ? 518  LEU B CD1 1 
ATOM   8150 C  CD2 . LEU B 1 518 ? -4.976  16.988  -27.905 1.00 36.25  ? 518  LEU B CD2 1 
ATOM   8151 N  N   . GLU B 1 519 ? -5.083  17.270  -23.537 1.00 38.91  ? 519  GLU B N   1 
ATOM   8152 C  CA  . GLU B 1 519 ? -4.512  17.646  -22.262 1.00 39.60  ? 519  GLU B CA  1 
ATOM   8153 C  C   . GLU B 1 519 ? -3.059  18.027  -22.516 1.00 39.65  ? 519  GLU B C   1 
ATOM   8154 O  O   . GLU B 1 519 ? -2.339  17.320  -23.219 1.00 39.43  ? 519  GLU B O   1 
ATOM   8155 C  CB  . GLU B 1 519 ? -4.627  16.476  -21.293 1.00 44.18  ? 519  GLU B CB  1 
ATOM   8156 C  CG  . GLU B 1 519 ? -3.840  16.603  -20.016 1.00 43.05  ? 519  GLU B CG  1 
ATOM   8157 C  CD  . GLU B 1 519 ? -4.001  15.371  -19.141 1.00 65.29  ? 519  GLU B CD  1 
ATOM   8158 O  OE1 . GLU B 1 519 ? -5.164  14.993  -18.860 1.00 59.60  ? 519  GLU B OE1 1 
ATOM   8159 O  OE2 . GLU B 1 519 ? -2.971  14.780  -18.744 1.00 55.37  ? 519  GLU B OE2 1 
ATOM   8160 N  N   . VAL B 1 520 ? -2.641  19.165  -21.976 1.00 35.93  ? 520  VAL B N   1 
ATOM   8161 C  CA  . VAL B 1 520 ? -1.279  19.636  -22.176 1.00 34.12  ? 520  VAL B CA  1 
ATOM   8162 C  C   . VAL B 1 520 ? -0.347  19.160  -21.066 1.00 31.25  ? 520  VAL B C   1 
ATOM   8163 O  O   . VAL B 1 520 ? -0.582  19.426  -19.896 1.00 40.32  ? 520  VAL B O   1 
ATOM   8164 C  CB  . VAL B 1 520 ? -1.230  21.174  -22.289 1.00 31.74  ? 520  VAL B CB  1 
ATOM   8165 C  CG1 . VAL B 1 520 ? 0.209   21.653  -22.340 1.00 32.08  ? 520  VAL B CG1 1 
ATOM   8166 C  CG2 . VAL B 1 520 ? -1.988  21.633  -23.531 1.00 29.09  ? 520  VAL B CG2 1 
ATOM   8167 N  N   . ARG B 1 521 ? 0.709   18.450  -21.439 1.00 37.60  ? 521  ARG B N   1 
ATOM   8168 C  CA  . ARG B 1 521 ? 1.696   17.995  -20.470 1.00 31.16  ? 521  ARG B CA  1 
ATOM   8169 C  C   . ARG B 1 521 ? 3.038   18.651  -20.734 1.00 32.90  ? 521  ARG B C   1 
ATOM   8170 O  O   . ARG B 1 521 ? 3.294   19.149  -21.831 1.00 39.65  ? 521  ARG B O   1 
ATOM   8171 C  CB  . ARG B 1 521 ? 1.820   16.474  -20.505 1.00 32.50  ? 521  ARG B CB  1 
ATOM   8172 C  CG  . ARG B 1 521 ? 0.504   15.788  -20.216 1.00 35.37  ? 521  ARG B CG  1 
ATOM   8173 C  CD  . ARG B 1 521 ? 0.591   14.279  -20.247 1.00 34.68  ? 521  ARG B CD  1 
ATOM   8174 N  NE  . ARG B 1 521 ? -0.751  13.710  -20.199 1.00 39.33  ? 521  ARG B NE  1 
ATOM   8175 C  CZ  . ARG B 1 521 ? -1.049  12.453  -20.502 1.00 42.13  ? 521  ARG B CZ  1 
ATOM   8176 N  NH1 . ARG B 1 521 ? -0.095  11.614  -20.876 1.00 32.79  ? 521  ARG B NH1 1 
ATOM   8177 N  NH2 . ARG B 1 521 ? -2.305  12.038  -20.434 1.00 37.66  ? 521  ARG B NH2 1 
ATOM   8178 N  N   . ARG B 1 522 ? 3.892   18.674  -19.722 1.00 33.69  ? 522  ARG B N   1 
ATOM   8179 C  CA  . ARG B 1 522 ? 5.210   19.266  -19.896 1.00 41.78  ? 522  ARG B CA  1 
ATOM   8180 C  C   . ARG B 1 522 ? 6.285   18.229  -19.636 1.00 34.56  ? 522  ARG B C   1 
ATOM   8181 O  O   . ARG B 1 522 ? 6.199   17.464  -18.680 1.00 37.00  ? 522  ARG B O   1 
ATOM   8182 C  CB  . ARG B 1 522 ? 5.392   20.493  -18.996 1.00 30.17  ? 522  ARG B CB  1 
ATOM   8183 C  CG  . ARG B 1 522 ? 4.547   21.687  -19.424 1.00 39.98  ? 522  ARG B CG  1 
ATOM   8184 C  CD  . ARG B 1 522 ? 4.639   22.854  -18.447 1.00 47.52  ? 522  ARG B CD  1 
ATOM   8185 N  NE  . ARG B 1 522 ? 5.977   23.438  -18.395 1.00 54.30  ? 522  ARG B NE  1 
ATOM   8186 C  CZ  . ARG B 1 522 ? 6.264   24.612  -17.839 1.00 42.53  ? 522  ARG B CZ  1 
ATOM   8187 N  NH1 . ARG B 1 522 ? 5.304   25.341  -17.289 1.00 47.98  ? 522  ARG B NH1 1 
ATOM   8188 N  NH2 . ARG B 1 522 ? 7.511   25.059  -17.838 1.00 35.56  ? 522  ARG B NH2 1 
ATOM   8189 N  N   . GLY B 1 523 ? 7.280   18.196  -20.515 1.00 33.97  ? 523  GLY B N   1 
ATOM   8190 C  CA  . GLY B 1 523 ? 8.404   17.291  -20.372 1.00 42.47  ? 523  GLY B CA  1 
ATOM   8191 C  C   . GLY B 1 523 ? 8.100   15.912  -20.909 1.00 37.27  ? 523  GLY B C   1 
ATOM   8192 O  O   . GLY B 1 523 ? 7.277   15.187  -20.355 1.00 39.24  ? 523  GLY B O   1 
ATOM   8193 N  N   . LEU B 1 524 ? 8.771   15.546  -21.993 1.00 42.15  ? 524  LEU B N   1 
ATOM   8194 C  CA  . LEU B 1 524 ? 8.569   14.240  -22.599 1.00 37.21  ? 524  LEU B CA  1 
ATOM   8195 C  C   . LEU B 1 524 ? 9.563   13.247  -22.013 1.00 33.74  ? 524  LEU B C   1 
ATOM   8196 O  O   . LEU B 1 524 ? 10.681  13.129  -22.505 1.00 44.57  ? 524  LEU B O   1 
ATOM   8197 C  CB  . LEU B 1 524 ? 8.745   14.333  -24.115 1.00 35.92  ? 524  LEU B CB  1 
ATOM   8198 C  CG  . LEU B 1 524 ? 8.131   13.185  -24.915 1.00 53.15  ? 524  LEU B CG  1 
ATOM   8199 C  CD1 . LEU B 1 524 ? 6.654   13.034  -24.567 1.00 46.19  ? 524  LEU B CD1 1 
ATOM   8200 C  CD2 . LEU B 1 524 ? 8.323   13.403  -26.409 1.00 47.48  ? 524  LEU B CD2 1 
ATOM   8201 N  N   . ARG B 1 525 ? 9.147   12.530  -20.971 1.00 33.73  ? 525  ARG B N   1 
ATOM   8202 C  CA  . ARG B 1 525 ? 10.060  11.695  -20.192 1.00 36.94  ? 525  ARG B CA  1 
ATOM   8203 C  C   . ARG B 1 525 ? 11.384  12.415  -19.947 1.00 37.32  ? 525  ARG B C   1 
ATOM   8204 O  O   . ARG B 1 525 ? 12.457  11.874  -20.224 1.00 41.22  ? 525  ARG B O   1 
ATOM   8205 C  CB  . ARG B 1 525 ? 10.313  10.353  -20.884 1.00 40.52  ? 525  ARG B CB  1 
ATOM   8206 C  CG  . ARG B 1 525 ? 9.117   9.420   -20.877 1.00 46.57  ? 525  ARG B CG  1 
ATOM   8207 C  CD  . ARG B 1 525 ? 9.553   7.963   -20.830 1.00 50.85  ? 525  ARG B CD  1 
ATOM   8208 N  NE  . ARG B 1 525 ? 8.575   7.009   -21.369 1.00 55.71  ? 525  ARG B NE  1 
ATOM   8209 C  CZ  . ARG B 1 525 ? 7.261   7.214   -21.471 1.00 65.71  ? 525  ARG B CZ  1 
ATOM   8210 N  NH1 . ARG B 1 525 ? 6.706   8.348   -21.059 1.00 80.21  ? 525  ARG B NH1 1 
ATOM   8211 N  NH2 . ARG B 1 525 ? 6.489   6.262   -21.984 1.00 56.81  ? 525  ARG B NH2 1 
ATOM   8212 N  N   . ALA B 1 526 ? 11.301  13.633  -19.419 1.00 33.01  ? 526  ALA B N   1 
ATOM   8213 C  CA  . ALA B 1 526 ? 12.463  14.522  -19.345 1.00 37.54  ? 526  ALA B CA  1 
ATOM   8214 C  C   . ALA B 1 526 ? 13.644  13.963  -18.553 1.00 30.27  ? 526  ALA B C   1 
ATOM   8215 O  O   . ALA B 1 526 ? 14.784  14.051  -19.004 1.00 35.25  ? 526  ALA B O   1 
ATOM   8216 C  CB  . ALA B 1 526 ? 12.056  15.890  -18.807 1.00 37.51  ? 526  ALA B CB  1 
ATOM   8217 N  N   . GLN B 1 527 ? 13.376  13.396  -17.378 1.00 30.76  ? 527  GLN B N   1 
ATOM   8218 C  CA  . GLN B 1 527 ? 14.444  12.845  -16.542 1.00 33.22  ? 527  GLN B CA  1 
ATOM   8219 C  C   . GLN B 1 527 ? 15.107  11.634  -17.186 1.00 35.63  ? 527  GLN B C   1 
ATOM   8220 O  O   . GLN B 1 527 ? 16.332  11.556  -17.264 1.00 37.45  ? 527  GLN B O   1 
ATOM   8221 C  CB  . GLN B 1 527 ? 13.923  12.466  -15.150 1.00 36.44  ? 527  GLN B CB  1 
ATOM   8222 C  CG  . GLN B 1 527 ? 13.588  13.655  -14.270 1.00 39.97  ? 527  GLN B CG  1 
ATOM   8223 C  CD  . GLN B 1 527 ? 14.777  14.576  -14.072 1.00 50.88  ? 527  GLN B CD  1 
ATOM   8224 O  OE1 . GLN B 1 527 ? 14.845  15.650  -14.670 1.00 40.68  ? 527  GLN B OE1 1 
ATOM   8225 N  NE2 . GLN B 1 527 ? 15.732  14.151  -13.242 1.00 41.74  ? 527  GLN B NE2 1 
ATOM   8226 N  N   . THR B 1 528 ? 14.291  10.690  -17.644 1.00 33.29  ? 528  THR B N   1 
ATOM   8227 C  CA  . THR B 1 528 ? 14.805  9.451   -18.217 1.00 33.94  ? 528  THR B CA  1 
ATOM   8228 C  C   . THR B 1 528 ? 15.504  9.674   -19.559 1.00 38.21  ? 528  THR B C   1 
ATOM   8229 O  O   . THR B 1 528 ? 16.534  9.060   -19.843 1.00 32.64  ? 528  THR B O   1 
ATOM   8230 C  CB  . THR B 1 528 ? 13.694  8.395   -18.364 1.00 37.61  ? 528  THR B CB  1 
ATOM   8231 O  OG1 . THR B 1 528 ? 13.249  7.995   -17.063 1.00 41.51  ? 528  THR B OG1 1 
ATOM   8232 C  CG2 . THR B 1 528 ? 14.211  7.171   -19.113 1.00 35.39  ? 528  THR B CG2 1 
ATOM   8233 N  N   . CYS B 1 529 ? 14.957  10.554  -20.386 1.00 25.91  ? 529  CYS B N   1 
ATOM   8234 C  CA  . CYS B 1 529 ? 15.602  10.818  -21.665 1.00 30.87  ? 529  CYS B CA  1 
ATOM   8235 C  C   . CYS B 1 529 ? 16.925  11.545  -21.460 1.00 34.42  ? 529  CYS B C   1 
ATOM   8236 O  O   . CYS B 1 529 ? 17.857  11.385  -22.246 1.00 31.94  ? 529  CYS B O   1 
ATOM   8237 C  CB  . CYS B 1 529 ? 14.670  11.556  -22.630 1.00 25.16  ? 529  CYS B CB  1 
ATOM   8238 S  SG  . CYS B 1 529 ? 13.351  10.479  -23.275 1.00 34.52  ? 529  CYS B SG  1 
ATOM   8239 N  N   . ALA B 1 530 ? 17.011  12.323  -20.385 1.00 31.58  ? 530  ALA B N   1 
ATOM   8240 C  CA  . ALA B 1 530 ? 18.281  12.930  -19.997 1.00 37.72  ? 530  ALA B CA  1 
ATOM   8241 C  C   . ALA B 1 530 ? 19.334  11.850  -19.722 1.00 32.50  ? 530  ALA B C   1 
ATOM   8242 O  O   . ALA B 1 530 ? 20.493  11.987  -20.110 1.00 28.97  ? 530  ALA B O   1 
ATOM   8243 C  CB  . ALA B 1 530 ? 18.100  13.830  -18.785 1.00 34.46  ? 530  ALA B CB  1 
ATOM   8244 N  N   . PHE B 1 531 ? 18.929  10.777  -19.052 1.00 28.88  ? 531  PHE B N   1 
ATOM   8245 C  CA  . PHE B 1 531 ? 19.816  9.635   -18.867 1.00 36.66  ? 531  PHE B CA  1 
ATOM   8246 C  C   . PHE B 1 531 ? 20.295  9.081   -20.210 1.00 38.60  ? 531  PHE B C   1 
ATOM   8247 O  O   . PHE B 1 531 ? 21.488  8.824   -20.397 1.00 35.94  ? 531  PHE B O   1 
ATOM   8248 C  CB  . PHE B 1 531 ? 19.126  8.533   -18.067 1.00 32.46  ? 531  PHE B CB  1 
ATOM   8249 C  CG  . PHE B 1 531 ? 19.805  7.199   -18.169 1.00 35.98  ? 531  PHE B CG  1 
ATOM   8250 C  CD1 . PHE B 1 531 ? 20.957  6.934   -17.445 1.00 38.93  ? 531  PHE B CD1 1 
ATOM   8251 C  CD2 . PHE B 1 531 ? 19.293  6.207   -18.991 1.00 41.11  ? 531  PHE B CD2 1 
ATOM   8252 C  CE1 . PHE B 1 531 ? 21.585  5.703   -17.536 1.00 43.87  ? 531  PHE B CE1 1 
ATOM   8253 C  CE2 . PHE B 1 531 ? 19.915  4.973   -19.087 1.00 41.31  ? 531  PHE B CE2 1 
ATOM   8254 C  CZ  . PHE B 1 531 ? 21.060  4.719   -18.357 1.00 42.91  ? 531  PHE B CZ  1 
ATOM   8255 N  N   . TRP B 1 532 ? 19.359  8.908   -21.139 1.00 32.23  ? 532  TRP B N   1 
ATOM   8256 C  CA  . TRP B 1 532 ? 19.655  8.332   -22.449 1.00 32.18  ? 532  TRP B CA  1 
ATOM   8257 C  C   . TRP B 1 532 ? 20.403  9.288   -23.365 1.00 35.44  ? 532  TRP B C   1 
ATOM   8258 O  O   . TRP B 1 532 ? 21.327  8.891   -24.068 1.00 38.67  ? 532  TRP B O   1 
ATOM   8259 C  CB  . TRP B 1 532 ? 18.367  7.904   -23.147 1.00 34.13  ? 532  TRP B CB  1 
ATOM   8260 C  CG  . TRP B 1 532 ? 17.757  6.654   -22.604 1.00 33.37  ? 532  TRP B CG  1 
ATOM   8261 C  CD1 . TRP B 1 532 ? 16.627  6.552   -21.845 1.00 32.83  ? 532  TRP B CD1 1 
ATOM   8262 C  CD2 . TRP B 1 532 ? 18.240  5.322   -22.787 1.00 30.12  ? 532  TRP B CD2 1 
ATOM   8263 N  NE1 . TRP B 1 532 ? 16.378  5.237   -21.546 1.00 36.23  ? 532  TRP B NE1 1 
ATOM   8264 C  CE2 . TRP B 1 532 ? 17.354  4.461   -22.114 1.00 32.44  ? 532  TRP B CE2 1 
ATOM   8265 C  CE3 . TRP B 1 532 ? 19.338  4.774   -23.452 1.00 33.45  ? 532  TRP B CE3 1 
ATOM   8266 C  CZ2 . TRP B 1 532 ? 17.533  3.083   -22.086 1.00 29.95  ? 532  TRP B CZ2 1 
ATOM   8267 C  CZ3 . TRP B 1 532 ? 19.513  3.406   -23.428 1.00 31.27  ? 532  TRP B CZ3 1 
ATOM   8268 C  CH2 . TRP B 1 532 ? 18.615  2.575   -22.750 1.00 32.42  ? 532  TRP B CH2 1 
ATOM   8269 N  N   . ASN B 1 533 ? 19.996  10.550  -23.364 1.00 29.25  ? 533  ASN B N   1 
ATOM   8270 C  CA  . ASN B 1 533 ? 20.518  11.501  -24.337 1.00 34.97  ? 533  ASN B CA  1 
ATOM   8271 C  C   . ASN B 1 533 ? 21.787  12.211  -23.891 1.00 41.17  ? 533  ASN B C   1 
ATOM   8272 O  O   . ASN B 1 533 ? 22.602  12.614  -24.720 1.00 36.56  ? 533  ASN B O   1 
ATOM   8273 C  CB  . ASN B 1 533 ? 19.447  12.527  -24.719 1.00 36.71  ? 533  ASN B CB  1 
ATOM   8274 C  CG  . ASN B 1 533 ? 18.241  11.887  -25.396 1.00 38.81  ? 533  ASN B CG  1 
ATOM   8275 O  OD1 . ASN B 1 533 ? 18.281  10.720  -25.789 1.00 36.09  ? 533  ASN B OD1 1 
ATOM   8276 N  ND2 . ASN B 1 533 ? 17.165  12.649  -25.528 1.00 22.71  ? 533  ASN B ND2 1 
ATOM   8277 N  N   . ARG B 1 534 ? 21.958  12.357  -22.582 1.00 35.54  ? 534  ARG B N   1 
ATOM   8278 C  CA  . ARG B 1 534 ? 23.067  13.143  -22.060 1.00 38.24  ? 534  ARG B CA  1 
ATOM   8279 C  C   . ARG B 1 534 ? 24.130  12.294  -21.361 1.00 40.65  ? 534  ARG B C   1 
ATOM   8280 O  O   . ARG B 1 534 ? 25.320  12.453  -21.613 1.00 46.05  ? 534  ARG B O   1 
ATOM   8281 C  CB  . ARG B 1 534 ? 22.551  14.246  -21.128 1.00 38.71  ? 534  ARG B CB  1 
ATOM   8282 C  CG  . ARG B 1 534 ? 21.583  15.220  -21.789 1.00 39.71  ? 534  ARG B CG  1 
ATOM   8283 C  CD  . ARG B 1 534 ? 21.060  16.246  -20.791 1.00 35.30  ? 534  ARG B CD  1 
ATOM   8284 N  NE  . ARG B 1 534 ? 19.918  16.987  -21.318 1.00 51.72  ? 534  ARG B NE  1 
ATOM   8285 C  CZ  . ARG B 1 534 ? 19.982  18.222  -21.810 1.00 61.24  ? 534  ARG B CZ  1 
ATOM   8286 N  NH1 . ARG B 1 534 ? 21.142  18.872  -21.839 1.00 38.73  ? 534  ARG B NH1 1 
ATOM   8287 N  NH2 . ARG B 1 534 ? 18.882  18.811  -22.268 1.00 43.86  ? 534  ARG B NH2 1 
ATOM   8288 N  N   . PHE B 1 535 ? 23.709  11.389  -20.489 1.00 37.66  ? 535  PHE B N   1 
ATOM   8289 C  CA  . PHE B 1 535 ? 24.678  10.638  -19.704 1.00 39.75  ? 535  PHE B CA  1 
ATOM   8290 C  C   . PHE B 1 535 ? 25.181  9.369   -20.390 1.00 36.85  ? 535  PHE B C   1 
ATOM   8291 O  O   . PHE B 1 535 ? 26.376  9.082   -20.387 1.00 44.88  ? 535  PHE B O   1 
ATOM   8292 C  CB  . PHE B 1 535 ? 24.123  10.301  -18.321 1.00 35.33  ? 535  PHE B CB  1 
ATOM   8293 C  CG  . PHE B 1 535 ? 25.068  9.499   -17.484 1.00 37.63  ? 535  PHE B CG  1 
ATOM   8294 C  CD1 . PHE B 1 535 ? 26.255  10.057  -17.037 1.00 37.86  ? 535  PHE B CD1 1 
ATOM   8295 C  CD2 . PHE B 1 535 ? 24.784  8.183   -17.160 1.00 30.83  ? 535  PHE B CD2 1 
ATOM   8296 C  CE1 . PHE B 1 535 ? 27.136  9.320   -16.277 1.00 32.36  ? 535  PHE B CE1 1 
ATOM   8297 C  CE2 . PHE B 1 535 ? 25.659  7.444   -16.399 1.00 45.70  ? 535  PHE B CE2 1 
ATOM   8298 C  CZ  . PHE B 1 535 ? 26.838  8.015   -15.955 1.00 39.37  ? 535  PHE B CZ  1 
ATOM   8299 N  N   . LEU B 1 536 ? 24.264  8.611   -20.972 1.00 40.97  ? 536  LEU B N   1 
ATOM   8300 C  CA  . LEU B 1 536 ? 24.601  7.312   -21.542 1.00 42.82  ? 536  LEU B CA  1 
ATOM   8301 C  C   . LEU B 1 536 ? 25.766  7.376   -22.538 1.00 42.75  ? 536  LEU B C   1 
ATOM   8302 O  O   . LEU B 1 536 ? 26.661  6.531   -22.501 1.00 49.41  ? 536  LEU B O   1 
ATOM   8303 C  CB  . LEU B 1 536 ? 23.364  6.681   -22.183 1.00 40.72  ? 536  LEU B CB  1 
ATOM   8304 C  CG  . LEU B 1 536 ? 23.190  5.193   -21.907 1.00 48.11  ? 536  LEU B CG  1 
ATOM   8305 C  CD1 . LEU B 1 536 ? 24.054  4.373   -22.845 1.00 56.46  ? 536  LEU B CD1 1 
ATOM   8306 C  CD2 . LEU B 1 536 ? 23.536  4.902   -20.457 1.00 51.10  ? 536  LEU B CD2 1 
ATOM   8307 N  N   . PRO B 1 537 ? 25.754  8.374   -23.437 1.00 39.81  ? 537  PRO B N   1 
ATOM   8308 C  CA  . PRO B 1 537 ? 26.864  8.525   -24.384 1.00 44.18  ? 537  PRO B CA  1 
ATOM   8309 C  C   . PRO B 1 537 ? 28.200  8.717   -23.675 1.00 56.56  ? 537  PRO B C   1 
ATOM   8310 O  O   . PRO B 1 537 ? 29.173  8.042   -24.014 1.00 61.35  ? 537  PRO B O   1 
ATOM   8311 C  CB  . PRO B 1 537 ? 26.490  9.792   -25.160 1.00 41.61  ? 537  PRO B CB  1 
ATOM   8312 C  CG  . PRO B 1 537 ? 25.004  9.843   -25.083 1.00 34.63  ? 537  PRO B CG  1 
ATOM   8313 C  CD  . PRO B 1 537 ? 24.664  9.325   -23.716 1.00 40.63  ? 537  PRO B CD  1 
ATOM   8314 N  N   . LYS B 1 538 ? 28.247  9.627   -22.707 1.00 57.54  ? 538  LYS B N   1 
ATOM   8315 C  CA  . LYS B 1 538 ? 29.457  9.826   -21.921 1.00 49.31  ? 538  LYS B CA  1 
ATOM   8316 C  C   . LYS B 1 538 ? 29.895  8.507   -21.298 1.00 49.62  ? 538  LYS B C   1 
ATOM   8317 O  O   . LYS B 1 538 ? 31.081  8.195   -21.249 1.00 60.20  ? 538  LYS B O   1 
ATOM   8318 C  CB  . LYS B 1 538 ? 29.225  10.866  -20.828 1.00 46.69  ? 538  LYS B CB  1 
ATOM   8319 C  CG  . LYS B 1 538 ? 28.935  12.265  -21.338 1.00 50.92  ? 538  LYS B CG  1 
ATOM   8320 C  CD  . LYS B 1 538 ? 28.486  13.177  -20.198 1.00 64.36  ? 538  LYS B CD  1 
ATOM   8321 C  CE  . LYS B 1 538 ? 28.124  14.565  -20.704 1.00 79.45  ? 538  LYS B CE  1 
ATOM   8322 N  NZ  . LYS B 1 538 ? 29.292  15.244  -21.337 1.00 93.45  ? 538  LYS B NZ  1 
ATOM   8323 N  N   . LEU B 1 539 ? 28.929  7.726   -20.833 1.00 47.68  ? 539  LEU B N   1 
ATOM   8324 C  CA  . LEU B 1 539 ? 29.238  6.472   -20.161 1.00 57.13  ? 539  LEU B CA  1 
ATOM   8325 C  C   . LEU B 1 539 ? 29.881  5.461   -21.097 1.00 63.86  ? 539  LEU B C   1 
ATOM   8326 O  O   . LEU B 1 539 ? 30.740  4.685   -20.688 1.00 76.18  ? 539  LEU B O   1 
ATOM   8327 C  CB  . LEU B 1 539 ? 27.985  5.868   -19.535 1.00 46.69  ? 539  LEU B CB  1 
ATOM   8328 C  CG  . LEU B 1 539 ? 28.273  4.598   -18.747 1.00 46.99  ? 539  LEU B CG  1 
ATOM   8329 C  CD1 . LEU B 1 539 ? 29.423  4.859   -17.794 1.00 60.60  ? 539  LEU B CD1 1 
ATOM   8330 C  CD2 . LEU B 1 539 ? 27.043  4.120   -17.996 1.00 49.73  ? 539  LEU B CD2 1 
ATOM   8331 N  N   . LEU B 1 540 ? 29.458  5.466   -22.355 1.00 71.36  ? 540  LEU B N   1 
ATOM   8332 C  CA  . LEU B 1 540 ? 29.984  4.517   -23.328 1.00 71.95  ? 540  LEU B CA  1 
ATOM   8333 C  C   . LEU B 1 540 ? 31.276  5.021   -23.959 1.00 76.74  ? 540  LEU B C   1 
ATOM   8334 O  O   . LEU B 1 540 ? 32.137  4.228   -24.333 1.00 79.75  ? 540  LEU B O   1 
ATOM   8335 C  CB  . LEU B 1 540 ? 28.946  4.225   -24.411 1.00 69.23  ? 540  LEU B CB  1 
ATOM   8336 C  CG  . LEU B 1 540 ? 27.735  3.403   -23.971 1.00 68.94  ? 540  LEU B CG  1 
ATOM   8337 C  CD1 . LEU B 1 540 ? 26.604  3.542   -24.978 1.00 49.43  ? 540  LEU B CD1 1 
ATOM   8338 C  CD2 . LEU B 1 540 ? 28.121  1.943   -23.777 1.00 59.05  ? 540  LEU B CD2 1 
ATOM   8339 N  N   . SER B 1 541 ? 31.411  6.339   -24.079 1.00 69.09  ? 541  SER B N   1 
ATOM   8340 C  CA  . SER B 1 541 ? 32.627  6.921   -24.634 1.00 63.77  ? 541  SER B CA  1 
ATOM   8341 C  C   . SER B 1 541 ? 33.802  6.626   -23.711 1.00 93.54  ? 541  SER B C   1 
ATOM   8342 O  O   . SER B 1 541 ? 34.961  6.684   -24.121 1.00 115.30 ? 541  SER B O   1 
ATOM   8343 C  CB  . SER B 1 541 ? 32.474  8.429   -24.848 1.00 61.90  ? 541  SER B CB  1 
ATOM   8344 O  OG  . SER B 1 541 ? 32.374  9.119   -23.617 1.00 86.74  ? 541  SER B OG  1 
ATOM   8345 N  N   . ALA B 1 542 ? 33.489  6.314   -22.458 1.00 90.65  ? 542  ALA B N   1 
ATOM   8346 C  CA  . ALA B 1 542 ? 34.488  5.845   -21.511 1.00 86.36  ? 542  ALA B CA  1 
ATOM   8347 C  C   . ALA B 1 542 ? 34.289  4.350   -21.306 1.00 87.02  ? 542  ALA B C   1 
ATOM   8348 O  O   . ALA B 1 542 ? 34.778  3.771   -20.337 1.00 83.11  ? 542  ALA B O   1 
ATOM   8349 C  CB  . ALA B 1 542 ? 34.364  6.588   -20.198 1.00 82.42  ? 542  ALA B CB  1 
ATOM   8350 N  N   . THR B 1 543 ? 33.559  3.741   -22.238 1.00 96.07  ? 543  THR B N   1 
ATOM   8351 C  CA  . THR B 1 543 ? 33.267  2.307   -22.231 1.00 98.80  ? 543  THR B CA  1 
ATOM   8352 C  C   . THR B 1 543 ? 32.840  1.787   -20.857 1.00 100.11 ? 543  THR B C   1 
ATOM   8353 O  O   . THR B 1 543 ? 31.647  1.698   -20.555 1.00 73.73  ? 543  THR B O   1 
ATOM   8354 C  CB  . THR B 1 543 ? 34.463  1.479   -22.754 1.00 97.09  ? 543  THR B CB  1 
ATOM   8355 O  OG1 . THR B 1 543 ? 34.861  1.967   -24.042 1.00 91.96  ? 543  THR B OG1 1 
ATOM   8356 C  CG2 . THR B 1 543 ? 34.083  0.012   -22.870 1.00 85.03  ? 543  THR B CG2 1 
ATOM   8357 N  N   . ALA B 1 544 ? 33.674  1.444   -20.017 1.00 107.63 ? 544  ALA B N   1 
HETATM 8358 C  C1  . K27 C 2 .   ? 31.266  23.328  9.721   1.00 33.97  ? 1543 K27 A C1  1 
HETATM 8359 C  C5A . K27 C 2 .   ? 27.845  21.478  11.380  1.00 44.96  ? 1543 K27 A C5A 1 
HETATM 8360 O  O10 . K27 C 2 .   ? 24.808  20.598  13.286  1.00 38.53  ? 1543 K27 A O10 1 
HETATM 8361 N  N9  . K27 C 2 .   ? 25.939  21.282  12.840  1.00 48.43  ? 1543 K27 A N9  1 
HETATM 8362 C  C8  . K27 C 2 .   ? 26.632  20.799  11.901  1.00 46.44  ? 1543 K27 A C8  1 
HETATM 8363 C  C4  . K27 C 2 .   ? 28.168  21.334  10.037  1.00 45.65  ? 1543 K27 A C4  1 
HETATM 8364 C  C3  . K27 C 2 .   ? 29.298  21.964  9.529   1.00 42.94  ? 1543 K27 A C3  1 
HETATM 8365 N  N2  . K27 C 2 .   ? 30.096  22.687  10.326  1.00 42.02  ? 1543 K27 A N2  1 
HETATM 8366 C  C7  . K27 C 2 .   ? 29.811  22.846  11.631  1.00 35.47  ? 1543 K27 A C7  1 
HETATM 8367 C  C6  . K27 C 2 .   ? 28.683  22.243  12.191  1.00 42.06  ? 1543 K27 A C6  1 
HETATM 8368 C  C2  . K27 C 2 .   ? 32.491  22.448  9.877   1.00 31.52  ? 1543 K27 A C2  1 
HETATM 8369 C  C5  . K27 C 2 .   ? 33.685  23.028  9.136   1.00 37.42  ? 1543 K27 A C5  1 
HETATM 8370 N  N8  . K27 C 2 .   ? 34.814  22.152  9.435   1.00 32.56  ? 1543 K27 A N8  1 
HETATM 8371 C  C9  . K27 C 2 .   ? 35.067  21.129  8.607   1.00 29.32  ? 1543 K27 A C9  1 
HETATM 8372 C  C10 . K27 C 2 .   ? 36.131  20.268  8.854   1.00 33.98  ? 1543 K27 A C10 1 
HETATM 8373 C  C11 . K27 C 2 .   ? 36.927  20.469  9.974   1.00 32.91  ? 1543 K27 A C11 1 
HETATM 8374 C  C12 . K27 C 2 .   ? 36.653  21.544  10.815  1.00 34.25  ? 1543 K27 A C12 1 
HETATM 8375 C  C13 . K27 C 2 .   ? 35.575  22.379  10.519  1.00 29.64  ? 1543 K27 A C13 1 
HETATM 8376 C  C14 . K27 C 2 .   ? 38.071  19.539  10.245  1.00 34.85  ? 1543 K27 A C14 1 
HETATM 8377 N  N15 . K27 C 2 .   ? 39.196  19.998  10.795  1.00 37.06  ? 1543 K27 A N15 1 
HETATM 8378 O  O3  . K27 C 2 .   ? 37.918  18.355  10.000  1.00 35.58  ? 1543 K27 A O3  1 
HETATM 8379 C  C1  . NAG D 3 .   ? 24.326  35.448  -0.241  1.00 67.32  ? 1544 NAG A C1  1 
HETATM 8380 C  C2  . NAG D 3 .   ? 24.519  35.834  -1.707  1.00 78.25  ? 1544 NAG A C2  1 
HETATM 8381 C  C3  . NAG D 3 .   ? 25.690  35.100  -2.347  1.00 82.53  ? 1544 NAG A C3  1 
HETATM 8382 C  C4  . NAG D 3 .   ? 26.931  35.240  -1.482  1.00 89.19  ? 1544 NAG A C4  1 
HETATM 8383 C  C5  . NAG D 3 .   ? 26.626  34.792  -0.060  1.00 81.95  ? 1544 NAG A C5  1 
HETATM 8384 C  C6  . NAG D 3 .   ? 27.849  34.968  0.834   1.00 104.31 ? 1544 NAG A C6  1 
HETATM 8385 C  C7  . NAG D 3 .   ? 22.626  36.566  -3.028  1.00 78.41  ? 1544 NAG A C7  1 
HETATM 8386 C  C8  . NAG D 3 .   ? 23.163  37.954  -2.832  1.00 82.14  ? 1544 NAG A C8  1 
HETATM 8387 N  N2  . NAG D 3 .   ? 23.306  35.577  -2.458  1.00 74.84  ? 1544 NAG A N2  1 
HETATM 8388 O  O3  . NAG D 3 .   ? 25.946  35.635  -3.626  1.00 82.96  ? 1544 NAG A O3  1 
HETATM 8389 O  O4  . NAG D 3 .   ? 27.973  34.451  -2.010  1.00 82.22  ? 1544 NAG A O4  1 
HETATM 8390 O  O5  . NAG D 3 .   ? 25.544  35.527  0.478   1.00 77.38  ? 1544 NAG A O5  1 
HETATM 8391 O  O6  . NAG D 3 .   ? 28.261  36.316  0.807   1.00 105.17 ? 1544 NAG A O6  1 
HETATM 8392 O  O7  . NAG D 3 .   ? 21.605  36.379  -3.688  1.00 79.05  ? 1544 NAG A O7  1 
HETATM 8393 C  C1  . NAG E 3 .   ? 11.496  34.127  24.973  1.00 106.08 ? 1545 NAG A C1  1 
HETATM 8394 C  C2  . NAG E 3 .   ? 12.953  34.569  25.108  1.00 113.58 ? 1545 NAG A C2  1 
HETATM 8395 C  C3  . NAG E 3 .   ? 13.101  35.827  25.955  1.00 121.61 ? 1545 NAG A C3  1 
HETATM 8396 C  C4  . NAG E 3 .   ? 12.111  36.891  25.509  1.00 125.81 ? 1545 NAG A C4  1 
HETATM 8397 C  C5  . NAG E 3 .   ? 10.703  36.316  25.465  1.00 130.49 ? 1545 NAG A C5  1 
HETATM 8398 C  C6  . NAG E 3 .   ? 9.707   37.368  24.991  1.00 134.20 ? 1545 NAG A C6  1 
HETATM 8399 C  C7  . NAG E 3 .   ? 14.621  32.820  24.956  1.00 88.06  ? 1545 NAG A C7  1 
HETATM 8400 C  C8  . NAG E 3 .   ? 15.521  31.876  25.698  1.00 71.35  ? 1545 NAG A C8  1 
HETATM 8401 N  N2  . NAG E 3 .   ? 13.738  33.495  25.685  1.00 103.06 ? 1545 NAG A N2  1 
HETATM 8402 O  O3  . NAG E 3 .   ? 14.414  36.330  25.834  1.00 113.07 ? 1545 NAG A O3  1 
HETATM 8403 O  O4  . NAG E 3 .   ? 12.152  37.983  26.401  1.00 114.92 ? 1545 NAG A O4  1 
HETATM 8404 O  O5  . NAG E 3 .   ? 10.652  35.199  24.601  1.00 117.45 ? 1545 NAG A O5  1 
HETATM 8405 O  O6  . NAG E 3 .   ? 10.106  37.856  23.730  1.00 101.92 ? 1545 NAG A O6  1 
HETATM 8406 O  O7  . NAG E 3 .   ? 14.712  32.946  23.736  1.00 79.61  ? 1545 NAG A O7  1 
HETATM 8407 BR BR  . BR  F 4 .   ? 32.082  21.045  6.535   1.00 38.29  ? 1546 BR  A BR  1 
HETATM 8408 C  C8  . P4G G 5 .   ? 25.689  -9.536  26.298  1.00 54.67  ? 1547 P4G A C8  1 
HETATM 8409 C  C7  . P4G G 5 .   ? 25.371  -9.377  24.813  1.00 73.04  ? 1547 P4G A C7  1 
HETATM 8410 O  O4  . P4G G 5 .   ? 24.843  -8.073  24.567  1.00 64.91  ? 1547 P4G A O4  1 
HETATM 8411 C  C6  . P4G G 5 .   ? 23.972  -8.021  23.428  1.00 67.10  ? 1547 P4G A C6  1 
HETATM 8412 C  C5  . P4G G 5 .   ? 24.726  -7.747  22.124  1.00 68.88  ? 1547 P4G A C5  1 
HETATM 8413 O  O3  . P4G G 5 .   ? 24.856  -6.331  21.980  1.00 64.51  ? 1547 P4G A O3  1 
HETATM 8414 C  C4  . P4G G 5 .   ? 25.615  -5.877  20.858  1.00 51.45  ? 1547 P4G A C4  1 
HETATM 8415 C  C3  . P4G G 5 .   ? 25.545  -6.815  19.656  1.00 66.20  ? 1547 P4G A C3  1 
HETATM 8416 O  O2  . P4G G 5 .   ? 26.025  -6.090  18.518  1.00 68.42  ? 1547 P4G A O2  1 
HETATM 8417 C  C2  . P4G G 5 .   ? 26.141  -6.893  17.347  1.00 59.74  ? 1547 P4G A C2  1 
HETATM 8418 C  C1  . P4G G 5 .   ? 27.505  -6.669  16.713  1.00 66.84  ? 1547 P4G A C1  1 
HETATM 8419 C  C   . CO3 H 6 .   ? 39.638  25.177  5.299   1.00 64.99  ? 1548 CO3 A C   1 
HETATM 8420 O  O1  . CO3 H 6 .   ? 38.911  24.518  4.438   1.00 50.14  ? 1548 CO3 A O1  1 
HETATM 8421 O  O2  . CO3 H 6 .   ? 40.902  24.890  5.424   1.00 66.65  ? 1548 CO3 A O2  1 
HETATM 8422 O  O3  . CO3 H 6 .   ? 39.107  26.117  6.034   1.00 51.10  ? 1548 CO3 A O3  1 
HETATM 8423 C  C1  . K27 I 2 .   ? 9.936   -8.008  -35.597 1.00 42.68  ? 1545 K27 B C1  1 
HETATM 8424 C  C5A . K27 I 2 .   ? 7.240   -4.754  -35.540 1.00 53.33  ? 1545 K27 B C5A 1 
HETATM 8425 O  O10 . K27 I 2 .   ? 4.320   -2.495  -35.652 1.00 36.03  ? 1545 K27 B O10 1 
HETATM 8426 N  N9  . K27 I 2 .   ? 5.115   -3.636  -35.754 1.00 60.25  ? 1545 K27 B N9  1 
HETATM 8427 C  C8  . K27 I 2 .   ? 6.339   -3.577  -35.456 1.00 48.08  ? 1545 K27 B C8  1 
HETATM 8428 C  C4  . K27 I 2 .   ? 8.328   -4.814  -34.684 1.00 49.17  ? 1545 K27 B C4  1 
HETATM 8429 C  C3  . K27 I 2 .   ? 9.183   -5.904  -34.735 1.00 56.26  ? 1545 K27 B C3  1 
HETATM 8430 N  N2  . K27 I 2 .   ? 8.988   -6.892  -35.612 1.00 56.13  ? 1545 K27 B N2  1 
HETATM 8431 C  C7  . K27 I 2 .   ? 7.940   -6.868  -36.453 1.00 47.06  ? 1545 K27 B C7  1 
HETATM 8432 C  C6  . K27 I 2 .   ? 7.043   -5.797  -36.443 1.00 49.06  ? 1545 K27 B C6  1 
HETATM 8433 C  C2  . K27 I 2 .   ? 10.917  -7.881  -36.750 1.00 41.50  ? 1545 K27 B C2  1 
HETATM 8434 C  C5  . K27 I 2 .   ? 12.097  -8.825  -36.556 1.00 38.12  ? 1545 K27 B C5  1 
HETATM 8435 N  N8  . K27 I 2 .   ? 13.107  -8.522  -37.571 1.00 44.65  ? 1545 K27 B N8  1 
HETATM 8436 C  C9  . K27 I 2 .   ? 14.213  -7.864  -37.188 1.00 42.28  ? 1545 K27 B C9  1 
HETATM 8437 C  C10 . K27 I 2 .   ? 15.206  -7.547  -38.110 1.00 39.57  ? 1545 K27 B C10 1 
HETATM 8438 C  C11 . K27 I 2 .   ? 15.039  -7.910  -39.440 1.00 35.60  ? 1545 K27 B C11 1 
HETATM 8439 C  C12 . K27 I 2 .   ? 13.895  -8.610  -39.814 1.00 36.50  ? 1545 K27 B C12 1 
HETATM 8440 C  C13 . K27 I 2 .   ? 12.929  -8.904  -38.850 1.00 29.64  ? 1545 K27 B C13 1 
HETATM 8441 C  C14 . K27 I 2 .   ? 16.116  -7.572  -40.428 1.00 47.67  ? 1545 K27 B C14 1 
HETATM 8442 N  N15 . K27 I 2 .   ? 16.312  -8.351  -41.494 1.00 42.50  ? 1545 K27 B N15 1 
HETATM 8443 O  O3  . K27 I 2 .   ? 16.765  -6.553  -40.245 1.00 47.54  ? 1545 K27 B O3  1 
HETATM 8444 BR BR  . BR  J 4 .   ? 13.117  -6.667  -33.745 1.00 46.38  ? 1546 BR  B BR  1 
HETATM 8445 C  C1  . PEG K 7 .   ? 31.835  9.627   -45.677 1.00 55.35  ? 1547 PEG B C1  1 
HETATM 8446 O  O1  . PEG K 7 .   ? 32.263  8.278   -45.903 1.00 58.29  ? 1547 PEG B O1  1 
HETATM 8447 C  C2  . PEG K 7 .   ? 31.230  9.720   -44.282 1.00 54.81  ? 1547 PEG B C2  1 
HETATM 8448 O  O2  . PEG K 7 .   ? 30.661  11.015  -44.105 1.00 72.41  ? 1547 PEG B O2  1 
HETATM 8449 C  C3  . PEG K 7 .   ? 31.061  11.623  -42.877 1.00 68.73  ? 1547 PEG B C3  1 
HETATM 8450 C  C4  . PEG K 7 .   ? 31.976  12.807  -43.177 1.00 90.91  ? 1547 PEG B C4  1 
HETATM 8451 O  O4  . PEG K 7 .   ? 31.954  13.734  -42.084 1.00 80.71  ? 1547 PEG B O4  1 
HETATM 8452 O  O1  . PE4 L 8 .   ? 11.477  9.348   -13.326 1.00 61.45  ? 1548 PE4 B O1  1 
HETATM 8453 C  C1  . PE4 L 8 .   ? 12.900  9.225   -13.433 1.00 58.53  ? 1548 PE4 B C1  1 
HETATM 8454 C  C2  . PE4 L 8 .   ? 13.317  7.813   -13.040 1.00 69.90  ? 1548 PE4 B C2  1 
HETATM 8455 O  O2  . PE4 L 8 .   ? 14.646  7.847   -12.521 1.00 79.64  ? 1548 PE4 B O2  1 
HETATM 8456 C  C3  . PE4 L 8 .   ? 15.016  6.611   -11.906 1.00 60.04  ? 1548 PE4 B C3  1 
HETATM 8457 C  C4  . PE4 L 8 .   ? 16.052  6.891   -10.820 1.00 59.35  ? 1548 PE4 B C4  1 
HETATM 8458 O  O3  . PE4 L 8 .   ? 17.340  6.463   -11.239 1.00 54.47  ? 1548 PE4 B O3  1 
HETATM 8459 C  C5  . PE4 L 8 .   ? 18.156  6.093   -10.131 1.00 46.75  ? 1548 PE4 B C5  1 
HETATM 8460 C  C6  . PE4 L 8 .   ? 18.762  4.729   -10.441 1.00 49.41  ? 1548 PE4 B C6  1 
HETATM 8461 O  O4  . PE4 L 8 .   ? 20.175  4.792   -10.288 1.00 59.93  ? 1548 PE4 B O4  1 
HETATM 8462 C  C7  . PE4 L 8 .   ? 20.845  4.309   -11.450 1.00 47.04  ? 1548 PE4 B C7  1 
HETATM 8463 C  C8  . PE4 L 8 .   ? 21.116  5.541   -12.299 1.00 49.65  ? 1548 PE4 B C8  1 
HETATM 8464 O  O5  . PE4 L 8 .   ? 22.287  5.416   -13.095 1.00 49.35  ? 1548 PE4 B O5  1 
HETATM 8465 C  C9  . PE4 L 8 .   ? 23.023  6.626   -13.009 1.00 32.77  ? 1548 PE4 B C9  1 
HETATM 8466 C  C10 . PE4 L 8 .   ? 22.963  7.358   -14.331 1.00 33.57  ? 1548 PE4 B C10 1 
HETATM 8467 O  O6  . PE4 L 8 .   ? 22.730  8.741   -14.052 1.00 47.76  ? 1548 PE4 B O6  1 
HETATM 8468 C  C11 . PE4 L 8 .   ? 22.161  9.416   -15.175 1.00 48.61  ? 1548 PE4 B C11 1 
HETATM 8469 C  C12 . PE4 L 8 .   ? 21.498  10.703  -14.705 1.00 52.82  ? 1548 PE4 B C12 1 
HETATM 8470 O  O7  . PE4 L 8 .   ? 20.209  10.822  -15.309 1.00 63.03  ? 1548 PE4 B O7  1 
HETATM 8471 C  C13 . PE4 L 8 .   ? 19.242  10.142  -14.503 1.00 62.40  ? 1548 PE4 B C13 1 
HETATM 8472 C  C14 . PE4 L 8 .   ? 18.074  11.034  -14.098 1.00 54.77  ? 1548 PE4 B C14 1 
HETATM 8473 O  O8  . PE4 L 8 .   ? 17.429  10.428  -12.971 1.00 64.84  ? 1548 PE4 B O8  1 
HETATM 8474 C  C15 . PE4 L 8 .   ? 16.790  11.376  -12.110 1.00 51.21  ? 1548 PE4 B C15 1 
HETATM 8475 C  C8  . P4G M 5 .   ? 9.047   4.941   -9.733  1.00 49.76  ? 1549 P4G B C8  1 
HETATM 8476 C  C7  . P4G M 5 .   ? 10.169  5.081   -10.762 1.00 71.37  ? 1549 P4G B C7  1 
HETATM 8477 O  O4  . P4G M 5 .   ? 10.793  3.812   -10.972 1.00 50.05  ? 1549 P4G B O4  1 
HETATM 8478 C  C6  . P4G M 5 .   ? 11.826  3.848   -11.959 1.00 53.65  ? 1549 P4G B C6  1 
HETATM 8479 C  C5  . P4G M 5 .   ? 11.249  4.143   -13.340 1.00 58.86  ? 1549 P4G B C5  1 
HETATM 8480 O  O3  . P4G M 5 .   ? 10.843  2.911   -13.942 1.00 82.72  ? 1549 P4G B O3  1 
HETATM 8481 C  C4  . P4G M 5 .   ? 10.635  3.015   -15.352 1.00 70.38  ? 1549 P4G B C4  1 
HETATM 8482 C  C3  . P4G M 5 .   ? 9.162   3.263   -15.668 1.00 76.32  ? 1549 P4G B C3  1 
HETATM 8483 O  O2  . P4G M 5 .   ? 8.506   2.048   -16.042 1.00 60.33  ? 1549 P4G B O2  1 
HETATM 8484 C  C2  . P4G M 5 .   ? 7.086   2.224   -16.103 1.00 73.61  ? 1549 P4G B C2  1 
HETATM 8485 C  C1  . P4G M 5 .   ? 6.359   1.280   -15.148 1.00 54.02  ? 1549 P4G B C1  1 
HETATM 8486 C  C8  . P4G N 5 .   ? 11.322  25.800  -52.264 1.00 53.74  ? 1550 P4G B C8  1 
HETATM 8487 C  C7  . P4G N 5 .   ? 11.545  25.526  -50.779 1.00 76.87  ? 1550 P4G B C7  1 
HETATM 8488 O  O4  . P4G N 5 .   ? 10.370  24.965  -50.188 1.00 68.86  ? 1550 P4G B O4  1 
HETATM 8489 C  C6  . P4G N 5 .   ? 10.391  25.051  -48.757 1.00 63.73  ? 1550 P4G B C6  1 
HETATM 8490 C  C5  . P4G N 5 .   ? 10.731  23.697  -48.132 1.00 71.65  ? 1550 P4G B C5  1 
HETATM 8491 O  O3  . P4G N 5 .   ? 11.645  23.798  -47.034 1.00 73.41  ? 1550 P4G B O3  1 
HETATM 8492 C  C4  . P4G N 5 .   ? 11.963  22.492  -46.548 1.00 49.88  ? 1550 P4G B C4  1 
HETATM 8493 C  C3  . P4G N 5 .   ? 12.576  22.527  -45.149 1.00 62.37  ? 1550 P4G B C3  1 
HETATM 8494 O  O2  . P4G N 5 .   ? 13.749  21.705  -45.171 1.00 68.95  ? 1550 P4G B O2  1 
HETATM 8495 C  C2  . P4G N 5 .   ? 14.380  21.585  -43.896 1.00 47.36  ? 1550 P4G B C2  1 
HETATM 8496 C  C1  . P4G N 5 .   ? 15.042  22.909  -43.533 1.00 59.19  ? 1550 P4G B C1  1 
HETATM 8497 C  C   . CO3 O 6 .   ? 17.743  -13.262 -35.585 1.00 81.83  ? 1551 CO3 B C   1 
HETATM 8498 O  O1  . CO3 O 6 .   ? 16.910  -14.059 -36.197 1.00 58.62  ? 1551 CO3 B O1  1 
HETATM 8499 O  O2  . CO3 O 6 .   ? 18.931  -13.047 -36.078 1.00 64.41  ? 1551 CO3 B O2  1 
HETATM 8500 O  O3  . CO3 O 6 .   ? 17.390  -12.674 -34.476 1.00 64.95  ? 1551 CO3 B O3  1 
HETATM 8501 O  O   . HOH P 9 .   ? 25.909  10.731  54.860  1.00 40.46  ? 2001 HOH A O   1 
HETATM 8502 O  O   . HOH P 9 .   ? 20.025  18.780  52.747  1.00 37.83  ? 2002 HOH A O   1 
HETATM 8503 O  O   . HOH P 9 .   ? 17.994  18.323  51.541  1.00 42.32  ? 2003 HOH A O   1 
HETATM 8504 O  O   . HOH P 9 .   ? 29.584  18.037  55.883  1.00 49.68  ? 2004 HOH A O   1 
HETATM 8505 O  O   . HOH P 9 .   ? 21.832  20.436  52.803  1.00 52.02  ? 2005 HOH A O   1 
HETATM 8506 O  O   . HOH P 9 .   ? 12.273  15.273  46.539  1.00 49.91  ? 2006 HOH A O   1 
HETATM 8507 O  O   . HOH P 9 .   ? 43.918  2.091   37.953  1.00 53.70  ? 2007 HOH A O   1 
HETATM 8508 O  O   . HOH P 9 .   ? 23.168  19.876  50.556  1.00 47.77  ? 2008 HOH A O   1 
HETATM 8509 O  O   . HOH P 9 .   ? 20.683  19.142  47.931  1.00 41.23  ? 2009 HOH A O   1 
HETATM 8510 O  O   . HOH P 9 .   ? 25.269  22.491  35.347  1.00 39.22  ? 2010 HOH A O   1 
HETATM 8511 O  O   . HOH P 9 .   ? 21.383  11.234  43.782  1.00 52.92  ? 2011 HOH A O   1 
HETATM 8512 O  O   . HOH P 9 .   ? 18.676  9.334   46.498  1.00 48.60  ? 2012 HOH A O   1 
HETATM 8513 O  O   . HOH P 9 .   ? 13.818  13.552  48.574  1.00 48.76  ? 2013 HOH A O   1 
HETATM 8514 O  O   . HOH P 9 .   ? 37.669  29.491  7.890   1.00 61.36  ? 2014 HOH A O   1 
HETATM 8515 O  O   . HOH P 9 .   ? 7.851   18.345  32.747  1.00 39.83  ? 2015 HOH A O   1 
HETATM 8516 O  O   . HOH P 9 .   ? 23.269  8.713   48.217  1.00 32.12  ? 2016 HOH A O   1 
HETATM 8517 O  O   . HOH P 9 .   ? 27.376  4.222   46.783  1.00 33.01  ? 2017 HOH A O   1 
HETATM 8518 O  O   . HOH P 9 .   ? 38.402  4.887   48.890  1.00 45.91  ? 2018 HOH A O   1 
HETATM 8519 O  O   . HOH P 9 .   ? 28.761  2.222   45.732  1.00 31.56  ? 2019 HOH A O   1 
HETATM 8520 O  O   . HOH P 9 .   ? 39.239  15.023  39.010  1.00 38.85  ? 2020 HOH A O   1 
HETATM 8521 O  O   . HOH P 9 .   ? 35.809  2.561   45.622  1.00 45.83  ? 2021 HOH A O   1 
HETATM 8522 O  O   . HOH P 9 .   ? 41.028  1.298   39.501  1.00 45.61  ? 2022 HOH A O   1 
HETATM 8523 O  O   . HOH P 9 .   ? 38.575  3.450   45.265  1.00 39.57  ? 2023 HOH A O   1 
HETATM 8524 O  O   . HOH P 9 .   ? 32.368  1.149   43.994  1.00 40.35  ? 2024 HOH A O   1 
HETATM 8525 O  O   . HOH P 9 .   ? 41.599  0.730   44.943  1.00 38.52  ? 2025 HOH A O   1 
HETATM 8526 O  O   . HOH P 9 .   ? 37.118  4.038   38.104  1.00 38.71  ? 2026 HOH A O   1 
HETATM 8527 O  O   . HOH P 9 .   ? 35.308  31.124  -6.278  1.00 50.27  ? 2027 HOH A O   1 
HETATM 8528 O  O   . HOH P 9 .   ? 36.974  7.273   50.117  1.00 49.34  ? 2028 HOH A O   1 
HETATM 8529 O  O   . HOH P 9 .   ? 25.492  19.400  46.156  1.00 42.64  ? 2029 HOH A O   1 
HETATM 8530 O  O   . HOH P 9 .   ? 13.788  20.978  42.939  1.00 56.72  ? 2030 HOH A O   1 
HETATM 8531 O  O   . HOH P 9 .   ? 22.375  19.744  45.870  1.00 33.88  ? 2031 HOH A O   1 
HETATM 8532 O  O   . HOH P 9 .   ? 25.239  23.352  37.841  1.00 39.35  ? 2032 HOH A O   1 
HETATM 8533 O  O   . HOH P 9 .   ? 33.527  -5.861  37.671  1.00 49.01  ? 2033 HOH A O   1 
HETATM 8534 O  O   . HOH P 9 .   ? 19.036  23.843  38.666  1.00 26.01  ? 2034 HOH A O   1 
HETATM 8535 O  O   . HOH P 9 .   ? 34.773  28.819  8.345   1.00 39.77  ? 2035 HOH A O   1 
HETATM 8536 O  O   . HOH P 9 .   ? 12.905  24.006  35.374  1.00 50.90  ? 2036 HOH A O   1 
HETATM 8537 O  O   . HOH P 9 .   ? 10.520  18.064  34.063  1.00 42.80  ? 2037 HOH A O   1 
HETATM 8538 O  O   . HOH P 9 .   ? 40.456  9.622   -3.655  1.00 49.83  ? 2038 HOH A O   1 
HETATM 8539 O  O   . HOH P 9 .   ? 38.029  28.548  27.326  1.00 37.04  ? 2039 HOH A O   1 
HETATM 8540 O  O   . HOH P 9 .   ? 36.271  16.329  38.506  1.00 40.65  ? 2040 HOH A O   1 
HETATM 8541 O  O   . HOH P 9 .   ? 44.799  7.897   29.865  1.00 38.77  ? 2041 HOH A O   1 
HETATM 8542 O  O   . HOH P 9 .   ? 44.683  10.480  38.286  1.00 40.73  ? 2042 HOH A O   1 
HETATM 8543 O  O   . HOH P 9 .   ? 45.751  14.542  24.458  1.00 32.44  ? 2043 HOH A O   1 
HETATM 8544 O  O   . HOH P 9 .   ? 51.030  11.941  31.689  1.00 52.86  ? 2044 HOH A O   1 
HETATM 8545 O  O   . HOH P 9 .   ? 18.454  -13.285 9.295   1.00 46.43  ? 2045 HOH A O   1 
HETATM 8546 O  O   . HOH P 9 .   ? 53.953  7.402   24.513  1.00 58.49  ? 2046 HOH A O   1 
HETATM 8547 O  O   . HOH P 9 .   ? 53.696  12.720  30.383  1.00 51.38  ? 2047 HOH A O   1 
HETATM 8548 O  O   . HOH P 9 .   ? 33.659  28.352  -8.149  1.00 44.45  ? 2048 HOH A O   1 
HETATM 8549 O  O   . HOH P 9 .   ? 48.278  3.810   27.104  1.00 45.81  ? 2049 HOH A O   1 
HETATM 8550 O  O   . HOH P 9 .   ? 46.333  8.021   27.254  1.00 46.35  ? 2050 HOH A O   1 
HETATM 8551 O  O   . HOH P 9 .   ? 49.524  5.928   27.964  1.00 50.21  ? 2051 HOH A O   1 
HETATM 8552 O  O   . HOH P 9 .   ? 8.544   9.560   36.519  1.00 47.58  ? 2052 HOH A O   1 
HETATM 8553 O  O   . HOH P 9 .   ? 5.477   12.927  29.252  1.00 51.29  ? 2053 HOH A O   1 
HETATM 8554 O  O   . HOH P 9 .   ? 41.279  13.087  35.764  1.00 38.46  ? 2054 HOH A O   1 
HETATM 8555 O  O   . HOH P 9 .   ? 41.269  13.422  40.415  1.00 51.60  ? 2055 HOH A O   1 
HETATM 8556 O  O   . HOH P 9 .   ? 39.463  4.005   39.480  1.00 55.63  ? 2056 HOH A O   1 
HETATM 8557 O  O   . HOH P 9 .   ? 39.072  5.934   46.547  1.00 34.80  ? 2057 HOH A O   1 
HETATM 8558 O  O   . HOH P 9 .   ? 39.278  14.559  45.320  1.00 51.07  ? 2058 HOH A O   1 
HETATM 8559 O  O   . HOH P 9 .   ? 37.518  8.374   47.446  1.00 43.07  ? 2059 HOH A O   1 
HETATM 8560 O  O   . HOH P 9 .   ? 37.026  14.967  51.013  1.00 48.40  ? 2060 HOH A O   1 
HETATM 8561 O  O   . HOH P 9 .   ? 38.735  16.184  47.153  1.00 51.31  ? 2061 HOH A O   1 
HETATM 8562 O  O   . HOH P 9 .   ? 36.884  17.472  44.177  1.00 52.62  ? 2062 HOH A O   1 
HETATM 8563 O  O   . HOH P 9 .   ? 47.394  0.210   20.661  1.00 46.53  ? 2063 HOH A O   1 
HETATM 8564 O  O   . HOH P 9 .   ? 26.662  24.107  39.811  1.00 64.29  ? 2064 HOH A O   1 
HETATM 8565 O  O   . HOH P 9 .   ? 32.619  19.237  29.165  1.00 30.97  ? 2065 HOH A O   1 
HETATM 8566 O  O   . HOH P 9 .   ? 31.973  16.947  32.587  1.00 22.67  ? 2066 HOH A O   1 
HETATM 8567 O  O   . HOH P 9 .   ? 37.912  -0.942  33.106  1.00 57.91  ? 2067 HOH A O   1 
HETATM 8568 O  O   . HOH P 9 .   ? 37.758  23.046  37.004  1.00 50.98  ? 2068 HOH A O   1 
HETATM 8569 O  O   . HOH P 9 .   ? 42.204  22.746  33.682  1.00 51.15  ? 2069 HOH A O   1 
HETATM 8570 O  O   . HOH P 9 .   ? 26.498  -6.900  35.317  1.00 46.72  ? 2070 HOH A O   1 
HETATM 8571 O  O   . HOH P 9 .   ? 31.857  -5.377  35.455  1.00 47.42  ? 2071 HOH A O   1 
HETATM 8572 O  O   . HOH P 9 .   ? 34.960  17.335  24.556  1.00 28.15  ? 2072 HOH A O   1 
HETATM 8573 O  O   . HOH P 9 .   ? 40.535  16.598  21.803  1.00 35.04  ? 2073 HOH A O   1 
HETATM 8574 O  O   . HOH P 9 .   ? 41.206  19.000  18.296  1.00 27.28  ? 2074 HOH A O   1 
HETATM 8575 O  O   . HOH P 9 .   ? 41.867  17.130  24.042  1.00 40.46  ? 2075 HOH A O   1 
HETATM 8576 O  O   . HOH P 9 .   ? 24.227  -6.848  36.889  1.00 46.49  ? 2076 HOH A O   1 
HETATM 8577 O  O   . HOH P 9 .   ? 31.843  21.762  21.806  1.00 32.55  ? 2077 HOH A O   1 
HETATM 8578 O  O   . HOH P 9 .   ? 40.662  26.225  19.580  1.00 31.65  ? 2078 HOH A O   1 
HETATM 8579 O  O   . HOH P 9 .   ? 34.799  27.840  11.038  1.00 36.64  ? 2079 HOH A O   1 
HETATM 8580 O  O   . HOH P 9 .   ? 34.002  23.430  18.682  1.00 35.46  ? 2080 HOH A O   1 
HETATM 8581 O  O   . HOH P 9 .   ? 38.630  29.631  16.081  1.00 50.01  ? 2081 HOH A O   1 
HETATM 8582 O  O   . HOH P 9 .   ? 40.089  27.326  17.203  1.00 27.66  ? 2082 HOH A O   1 
HETATM 8583 O  O   . HOH P 9 .   ? 33.989  24.761  11.767  1.00 46.63  ? 2083 HOH A O   1 
HETATM 8584 O  O   . HOH P 9 .   ? 30.302  30.511  14.235  1.00 54.01  ? 2084 HOH A O   1 
HETATM 8585 O  O   . HOH P 9 .   ? 21.177  34.480  17.255  1.00 40.63  ? 2085 HOH A O   1 
HETATM 8586 O  O   . HOH P 9 .   ? 29.724  25.719  15.757  1.00 43.69  ? 2086 HOH A O   1 
HETATM 8587 O  O   . HOH P 9 .   ? 23.751  23.957  23.423  1.00 37.35  ? 2087 HOH A O   1 
HETATM 8588 O  O   . HOH P 9 .   ? 33.464  4.184   1.392   1.00 51.67  ? 2088 HOH A O   1 
HETATM 8589 O  O   . HOH P 9 .   ? 36.979  7.624   0.615   1.00 43.46  ? 2089 HOH A O   1 
HETATM 8590 O  O   . HOH P 9 .   ? 38.416  8.900   2.688   1.00 34.44  ? 2090 HOH A O   1 
HETATM 8591 O  O   . HOH P 9 .   ? 29.211  20.547  19.216  1.00 25.94  ? 2091 HOH A O   1 
HETATM 8592 O  O   . HOH P 9 .   ? 35.546  5.385   2.737   1.00 48.34  ? 2092 HOH A O   1 
HETATM 8593 O  O   . HOH P 9 .   ? 39.160  2.147   3.688   1.00 48.46  ? 2093 HOH A O   1 
HETATM 8594 O  O   . HOH P 9 .   ? 31.738  24.182  16.862  1.00 47.92  ? 2094 HOH A O   1 
HETATM 8595 O  O   . HOH P 9 .   ? 41.088  0.467   4.521   1.00 39.96  ? 2095 HOH A O   1 
HETATM 8596 O  O   . HOH P 9 .   ? 44.899  -0.801  4.489   1.00 47.16  ? 2096 HOH A O   1 
HETATM 8597 O  O   . HOH P 9 .   ? 52.472  9.111   3.956   1.00 41.84  ? 2097 HOH A O   1 
HETATM 8598 O  O   . HOH P 9 .   ? 52.559  6.370   -0.496  1.00 59.28  ? 2098 HOH A O   1 
HETATM 8599 O  O   . HOH P 9 .   ? 43.044  10.645  -3.979  1.00 51.17  ? 2099 HOH A O   1 
HETATM 8600 O  O   . HOH P 9 .   ? 44.526  8.708   -2.976  1.00 59.07  ? 2100 HOH A O   1 
HETATM 8601 O  O   . HOH P 9 .   ? 46.738  9.218   -0.929  1.00 44.89  ? 2101 HOH A O   1 
HETATM 8602 O  O   . HOH P 9 .   ? 35.808  27.280  25.962  1.00 35.31  ? 2102 HOH A O   1 
HETATM 8603 O  O   . HOH P 9 .   ? 29.113  23.347  35.434  1.00 44.77  ? 2103 HOH A O   1 
HETATM 8604 O  O   . HOH P 9 .   ? 35.762  25.116  32.839  1.00 54.79  ? 2104 HOH A O   1 
HETATM 8605 O  O   . HOH P 9 .   ? 38.842  28.625  32.425  1.00 37.40  ? 2105 HOH A O   1 
HETATM 8606 O  O   . HOH P 9 .   ? 40.084  27.064  26.989  1.00 39.81  ? 2106 HOH A O   1 
HETATM 8607 O  O   . HOH P 9 .   ? 45.593  20.922  28.109  1.00 43.70  ? 2107 HOH A O   1 
HETATM 8608 O  O   . HOH P 9 .   ? 50.005  17.088  26.103  0.50 23.83  ? 2108 HOH A O   1 
HETATM 8609 O  O   . HOH P 9 .   ? 43.060  15.241  25.108  1.00 31.17  ? 2109 HOH A O   1 
HETATM 8610 O  O   . HOH P 9 .   ? 41.248  13.656  31.562  1.00 32.66  ? 2110 HOH A O   1 
HETATM 8611 O  O   . HOH P 9 .   ? 40.008  12.402  33.501  1.00 34.42  ? 2111 HOH A O   1 
HETATM 8612 O  O   . HOH P 9 .   ? 40.712  16.823  37.472  1.00 52.89  ? 2112 HOH A O   1 
HETATM 8613 O  O   . HOH P 9 .   ? 22.014  19.255  33.502  1.00 49.83  ? 2113 HOH A O   1 
HETATM 8614 O  O   . HOH P 9 .   ? 11.893  9.936   42.035  1.00 48.67  ? 2114 HOH A O   1 
HETATM 8615 O  O   . HOH P 9 .   ? 11.136  13.882  44.191  1.00 45.40  ? 2115 HOH A O   1 
HETATM 8616 O  O   . HOH P 9 .   ? 13.256  12.225  39.793  1.00 51.63  ? 2116 HOH A O   1 
HETATM 8617 O  O   . HOH P 9 .   ? 21.772  4.546   43.936  1.00 46.17  ? 2117 HOH A O   1 
HETATM 8618 O  O   . HOH P 9 .   ? 42.887  -3.584  7.340   1.00 43.50  ? 2118 HOH A O   1 
HETATM 8619 O  O   . HOH P 9 .   ? 15.161  -4.087  43.295  1.00 55.26  ? 2119 HOH A O   1 
HETATM 8620 O  O   . HOH P 9 .   ? 32.792  3.276   -3.121  1.00 49.18  ? 2120 HOH A O   1 
HETATM 8621 O  O   . HOH P 9 .   ? 16.037  -2.159  34.127  1.00 47.20  ? 2121 HOH A O   1 
HETATM 8622 O  O   . HOH P 9 .   ? 21.252  -13.486 9.184   1.00 53.96  ? 2122 HOH A O   1 
HETATM 8623 O  O   . HOH P 9 .   ? 28.767  12.287  24.653  1.00 26.55  ? 2123 HOH A O   1 
HETATM 8624 O  O   . HOH P 9 .   ? 30.902  28.793  -7.609  1.00 39.39  ? 2124 HOH A O   1 
HETATM 8625 O  O   . HOH P 9 .   ? 30.114  19.207  12.199  1.00 43.83  ? 2125 HOH A O   1 
HETATM 8626 O  O   . HOH P 9 .   ? 32.619  23.771  13.953  1.00 41.48  ? 2126 HOH A O   1 
HETATM 8627 O  O   . HOH P 9 .   ? 32.963  14.643  17.166  1.00 25.86  ? 2127 HOH A O   1 
HETATM 8628 O  O   . HOH P 9 .   ? 30.704  21.486  16.747  1.00 39.12  ? 2128 HOH A O   1 
HETATM 8629 O  O   . HOH P 9 .   ? 11.702  27.914  1.786   1.00 61.69  ? 2129 HOH A O   1 
HETATM 8630 O  O   . HOH P 9 .   ? 10.302  32.523  0.194   1.00 55.33  ? 2130 HOH A O   1 
HETATM 8631 O  O   . HOH P 9 .   ? 24.962  22.600  29.911  1.00 35.77  ? 2131 HOH A O   1 
HETATM 8632 O  O   . HOH P 9 .   ? 29.265  25.681  -15.418 1.00 53.34  ? 2132 HOH A O   1 
HETATM 8633 O  O   . HOH P 9 .   ? 24.667  18.833  28.807  1.00 30.95  ? 2133 HOH A O   1 
HETATM 8634 O  O   . HOH P 9 .   ? 34.334  24.002  -10.201 1.00 42.42  ? 2134 HOH A O   1 
HETATM 8635 O  O   . HOH P 9 .   ? 25.512  24.877  25.729  1.00 41.94  ? 2135 HOH A O   1 
HETATM 8636 O  O   . HOH P 9 .   ? 25.670  15.550  18.467  1.00 24.68  ? 2136 HOH A O   1 
HETATM 8637 O  O   . HOH P 9 .   ? 28.501  18.063  19.925  1.00 29.60  ? 2137 HOH A O   1 
HETATM 8638 O  O   . HOH P 9 .   ? 39.553  11.310  -8.356  1.00 52.07  ? 2138 HOH A O   1 
HETATM 8639 O  O   . HOH P 9 .   ? 41.003  11.897  -6.278  1.00 48.03  ? 2139 HOH A O   1 
HETATM 8640 O  O   . HOH P 9 .   ? 19.491  23.096  28.995  1.00 45.98  ? 2140 HOH A O   1 
HETATM 8641 O  O   . HOH P 9 .   ? 23.318  20.416  30.878  1.00 41.82  ? 2141 HOH A O   1 
HETATM 8642 O  O   . HOH P 9 .   ? 16.927  15.329  28.965  1.00 34.50  ? 2142 HOH A O   1 
HETATM 8643 O  O   . HOH P 9 .   ? 20.747  24.154  36.691  1.00 37.76  ? 2143 HOH A O   1 
HETATM 8644 O  O   . HOH P 9 .   ? 14.723  15.935  -9.896  1.00 36.79  ? 2144 HOH A O   1 
HETATM 8645 O  O   . HOH P 9 .   ? 15.574  17.826  -5.013  0.50 18.61  ? 2145 HOH A O   1 
HETATM 8646 O  O   . HOH P 9 .   ? 6.013   22.321  -14.520 1.00 53.93  ? 2146 HOH A O   1 
HETATM 8647 O  O   . HOH P 9 .   ? 8.586   26.431  -11.422 1.00 60.18  ? 2147 HOH A O   1 
HETATM 8648 O  O   . HOH P 9 .   ? 8.251   11.599  38.180  1.00 56.16  ? 2148 HOH A O   1 
HETATM 8649 O  O   . HOH P 9 .   ? 7.840   12.089  27.747  1.00 50.11  ? 2149 HOH A O   1 
HETATM 8650 O  O   . HOH P 9 .   ? 13.389  5.296   37.241  1.00 47.92  ? 2150 HOH A O   1 
HETATM 8651 O  O   . HOH P 9 .   ? 25.202  15.125  27.817  1.00 37.46  ? 2151 HOH A O   1 
HETATM 8652 O  O   . HOH P 9 .   ? 31.371  16.804  29.790  1.00 28.64  ? 2152 HOH A O   1 
HETATM 8653 O  O   . HOH P 9 .   ? 6.028   -5.844  14.684  1.00 56.07  ? 2153 HOH A O   1 
HETATM 8654 O  O   . HOH P 9 .   ? 45.584  12.359  22.795  1.00 31.56  ? 2154 HOH A O   1 
HETATM 8655 O  O   . HOH P 9 .   ? 42.161  7.377   14.155  1.00 29.92  ? 2155 HOH A O   1 
HETATM 8656 O  O   . HOH P 9 .   ? 45.919  10.342  11.119  1.00 32.01  ? 2156 HOH A O   1 
HETATM 8657 O  O   . HOH P 9 .   ? 47.571  0.888   14.357  1.00 41.75  ? 2157 HOH A O   1 
HETATM 8658 O  O   . HOH P 9 .   ? 49.293  0.094   16.191  1.00 35.47  ? 2158 HOH A O   1 
HETATM 8659 O  O   . HOH P 9 .   ? 52.322  -1.727  18.714  1.00 56.39  ? 2159 HOH A O   1 
HETATM 8660 O  O   . HOH P 9 .   ? 49.476  1.767   21.565  1.00 41.08  ? 2160 HOH A O   1 
HETATM 8661 O  O   . HOH P 9 .   ? 46.560  7.337   18.026  1.00 31.91  ? 2161 HOH A O   1 
HETATM 8662 O  O   . HOH P 9 .   ? 43.844  1.422   18.526  1.00 46.11  ? 2162 HOH A O   1 
HETATM 8663 O  O   . HOH P 9 .   ? 20.257  25.398  23.542  1.00 55.74  ? 2163 HOH A O   1 
HETATM 8664 O  O   . HOH P 9 .   ? 39.649  1.625   26.096  1.00 37.57  ? 2164 HOH A O   1 
HETATM 8665 O  O   . HOH P 9 .   ? 39.337  -1.671  23.647  1.00 33.29  ? 2165 HOH A O   1 
HETATM 8666 O  O   . HOH P 9 .   ? 14.561  -6.531  25.985  1.00 51.86  ? 2166 HOH A O   1 
HETATM 8667 O  O   . HOH P 9 .   ? 28.111  -0.206  29.453  1.00 31.44  ? 2167 HOH A O   1 
HETATM 8668 O  O   . HOH P 9 .   ? 34.618  -2.542  33.298  1.00 51.28  ? 2168 HOH A O   1 
HETATM 8669 O  O   . HOH P 9 .   ? 35.011  -5.506  28.894  1.00 61.04  ? 2169 HOH A O   1 
HETATM 8670 O  O   . HOH P 9 .   ? 35.868  6.243   38.397  1.00 44.96  ? 2170 HOH A O   1 
HETATM 8671 O  O   . HOH P 9 .   ? 36.232  1.319   34.078  1.00 41.28  ? 2171 HOH A O   1 
HETATM 8672 O  O   . HOH P 9 .   ? 11.927  -7.160  12.490  1.00 53.15  ? 2172 HOH A O   1 
HETATM 8673 O  O   . HOH P 9 .   ? 27.133  -1.284  37.311  1.00 34.87  ? 2173 HOH A O   1 
HETATM 8674 O  O   . HOH P 9 .   ? 28.347  -5.228  36.423  1.00 44.45  ? 2174 HOH A O   1 
HETATM 8675 O  O   . HOH P 9 .   ? 0.130   1.933   7.758   1.00 51.89  ? 2175 HOH A O   1 
HETATM 8676 O  O   . HOH P 9 .   ? 33.387  -1.437  41.281  1.00 36.06  ? 2176 HOH A O   1 
HETATM 8677 O  O   . HOH P 9 .   ? 30.191  -4.486  38.466  1.00 44.24  ? 2177 HOH A O   1 
HETATM 8678 O  O   . HOH P 9 .   ? 35.759  1.920   36.856  1.00 32.36  ? 2178 HOH A O   1 
HETATM 8679 O  O   . HOH P 9 .   ? 31.385  0.575   41.403  1.00 35.54  ? 2179 HOH A O   1 
HETATM 8680 O  O   . HOH P 9 .   ? -0.064  11.172  18.349  1.00 52.56  ? 2180 HOH A O   1 
HETATM 8681 O  O   . HOH P 9 .   ? 24.745  4.324   46.005  1.00 30.91  ? 2181 HOH A O   1 
HETATM 8682 O  O   . HOH P 9 .   ? 12.784  11.800  -2.427  1.00 62.68  ? 2182 HOH A O   1 
HETATM 8683 O  O   . HOH P 9 .   ? 20.752  -2.019  39.176  1.00 43.28  ? 2183 HOH A O   1 
HETATM 8684 O  O   . HOH P 9 .   ? 21.626  -5.873  36.744  1.00 53.34  ? 2184 HOH A O   1 
HETATM 8685 O  O   . HOH P 9 .   ? 16.166  -6.057  36.547  1.00 52.86  ? 2185 HOH A O   1 
HETATM 8686 O  O   . HOH P 9 .   ? 18.373  -5.445  28.243  1.00 43.29  ? 2186 HOH A O   1 
HETATM 8687 O  O   . HOH P 9 .   ? 18.716  0.835   27.850  1.00 38.25  ? 2187 HOH A O   1 
HETATM 8688 O  O   . HOH P 9 .   ? 29.517  -5.360  19.090  1.00 52.49  ? 2188 HOH A O   1 
HETATM 8689 O  O   . HOH P 9 .   ? 31.406  -7.227  13.871  1.00 48.03  ? 2189 HOH A O   1 
HETATM 8690 O  O   . HOH P 9 .   ? 36.316  -5.962  16.217  1.00 41.24  ? 2190 HOH A O   1 
HETATM 8691 O  O   . HOH P 9 .   ? 28.863  -10.245 24.289  1.00 30.62  ? 2191 HOH A O   1 
HETATM 8692 O  O   . HOH P 9 .   ? 18.324  12.345  13.163  1.00 28.67  ? 2192 HOH A O   1 
HETATM 8693 O  O   . HOH P 9 .   ? 27.413  3.727   2.398   1.00 30.27  ? 2193 HOH A O   1 
HETATM 8694 O  O   . HOH P 9 .   ? 31.206  2.351   3.374   1.00 34.89  ? 2194 HOH A O   1 
HETATM 8695 O  O   . HOH P 9 .   ? 35.215  9.559   0.726   1.00 38.98  ? 2195 HOH A O   1 
HETATM 8696 O  O   . HOH P 9 .   ? 31.100  6.365   0.640   1.00 37.56  ? 2196 HOH A O   1 
HETATM 8697 O  O   . HOH P 9 .   ? 36.500  9.751   4.432   1.00 28.49  ? 2197 HOH A O   1 
HETATM 8698 O  O   . HOH P 9 .   ? 30.341  8.440   6.689   1.00 32.16  ? 2198 HOH A O   1 
HETATM 8699 O  O   . HOH P 9 .   ? 37.196  4.027   4.510   1.00 48.18  ? 2199 HOH A O   1 
HETATM 8700 O  O   . HOH P 9 .   ? 33.210  4.842   6.255   1.00 42.47  ? 2200 HOH A O   1 
HETATM 8701 O  O   . HOH P 9 .   ? 42.220  6.455   0.224   1.00 37.44  ? 2201 HOH A O   1 
HETATM 8702 O  O   . HOH P 9 .   ? 40.387  7.003   3.006   1.00 31.34  ? 2202 HOH A O   1 
HETATM 8703 O  O   . HOH P 9 .   ? 43.138  0.664   6.040   1.00 42.09  ? 2203 HOH A O   1 
HETATM 8704 O  O   . HOH P 9 .   ? 45.514  1.812   3.289   1.00 40.38  ? 2204 HOH A O   1 
HETATM 8705 O  O   . HOH P 9 .   ? 50.348  7.174   3.143   1.00 36.20  ? 2205 HOH A O   1 
HETATM 8706 O  O   . HOH P 9 .   ? 44.151  11.043  -1.149  1.00 43.29  ? 2206 HOH A O   1 
HETATM 8707 O  O   . HOH P 9 .   ? 49.950  2.913   6.893   1.00 29.11  ? 2207 HOH A O   1 
HETATM 8708 O  O   . HOH P 9 .   ? 50.458  14.645  1.344   1.00 35.39  ? 2208 HOH A O   1 
HETATM 8709 O  O   . HOH P 9 .   ? 37.786  12.102  4.686   1.00 22.81  ? 2209 HOH A O   1 
HETATM 8710 O  O   . HOH P 9 .   ? 38.063  13.219  2.186   1.00 28.96  ? 2210 HOH A O   1 
HETATM 8711 O  O   . HOH P 9 .   ? 39.963  11.147  1.735   1.00 39.90  ? 2211 HOH A O   1 
HETATM 8712 O  O   . HOH P 9 .   ? 53.157  11.425  2.847   1.00 41.82  ? 2212 HOH A O   1 
HETATM 8713 O  O   . HOH P 9 .   ? 51.807  13.598  3.673   1.00 37.22  ? 2213 HOH A O   1 
HETATM 8714 O  O   . HOH P 9 .   ? 54.071  15.239  3.892   1.00 41.36  ? 2214 HOH A O   1 
HETATM 8715 O  O   . HOH P 9 .   ? 58.494  20.718  2.961   1.00 32.51  ? 2215 HOH A O   1 
HETATM 8716 O  O   . HOH P 9 .   ? 58.354  21.048  8.451   1.00 39.01  ? 2216 HOH A O   1 
HETATM 8717 O  O   . HOH P 9 .   ? 57.520  18.715  1.228   1.00 46.55  ? 2217 HOH A O   1 
HETATM 8718 O  O   . HOH P 9 .   ? 52.961  25.529  8.703   1.00 29.82  ? 2218 HOH A O   1 
HETATM 8719 O  O   . HOH P 9 .   ? 55.468  24.656  14.890  1.00 33.05  ? 2219 HOH A O   1 
HETATM 8720 O  O   . HOH P 9 .   ? 60.371  18.513  9.486   1.00 49.54  ? 2220 HOH A O   1 
HETATM 8721 O  O   . HOH P 9 .   ? 59.258  3.697   14.312  1.00 59.30  ? 2221 HOH A O   1 
HETATM 8722 O  O   . HOH P 9 .   ? 58.744  3.925   11.642  1.00 56.98  ? 2222 HOH A O   1 
HETATM 8723 O  O   . HOH P 9 .   ? 57.315  8.453   20.295  1.00 51.53  ? 2223 HOH A O   1 
HETATM 8724 O  O   . HOH P 9 .   ? 56.071  13.953  25.889  1.00 50.75  ? 2224 HOH A O   1 
HETATM 8725 O  O   . HOH P 9 .   ? 51.780  16.000  24.663  0.50 19.36  ? 2225 HOH A O   1 
HETATM 8726 O  O   . HOH P 9 .   ? 52.193  9.107   22.178  1.00 41.68  ? 2226 HOH A O   1 
HETATM 8727 O  O   . HOH P 9 .   ? 53.148  19.892  25.692  1.00 45.81  ? 2227 HOH A O   1 
HETATM 8728 O  O   . HOH P 9 .   ? 53.662  22.435  25.190  1.00 47.95  ? 2228 HOH A O   1 
HETATM 8729 O  O   . HOH P 9 .   ? 59.928  23.865  17.469  1.00 48.19  ? 2229 HOH A O   1 
HETATM 8730 O  O   . HOH P 9 .   ? 61.256  20.265  17.249  1.00 50.25  ? 2230 HOH A O   1 
HETATM 8731 O  O   . HOH P 9 .   ? 58.241  24.158  15.440  1.00 36.02  ? 2231 HOH A O   1 
HETATM 8732 O  O   . HOH P 9 .   ? 57.521  24.755  17.623  1.00 48.42  ? 2232 HOH A O   1 
HETATM 8733 O  O   . HOH P 9 .   ? 49.408  22.418  25.107  1.00 31.37  ? 2233 HOH A O   1 
HETATM 8734 O  O   . HOH P 9 .   ? 41.116  27.663  21.617  1.00 48.90  ? 2234 HOH A O   1 
HETATM 8735 O  O   . HOH P 9 .   ? 47.937  25.046  23.583  1.00 39.87  ? 2235 HOH A O   1 
HETATM 8736 O  O   . HOH P 9 .   ? 53.260  26.187  14.071  1.00 47.68  ? 2236 HOH A O   1 
HETATM 8737 O  O   . HOH P 9 .   ? 41.930  23.869  11.749  1.00 40.36  ? 2237 HOH A O   1 
HETATM 8738 O  O   . HOH P 9 .   ? 42.046  27.621  15.142  1.00 43.36  ? 2238 HOH A O   1 
HETATM 8739 O  O   . HOH P 9 .   ? 49.421  27.809  16.017  1.00 49.27  ? 2239 HOH A O   1 
HETATM 8740 O  O   . HOH P 9 .   ? 40.155  17.266  12.516  1.00 29.21  ? 2240 HOH A O   1 
HETATM 8741 O  O   . HOH P 9 .   ? 39.566  22.330  12.536  1.00 27.99  ? 2241 HOH A O   1 
HETATM 8742 O  O   . HOH P 9 .   ? 39.568  20.228  16.702  1.00 24.58  ? 2242 HOH A O   1 
HETATM 8743 O  O   . HOH P 9 .   ? 43.377  18.717  16.482  1.00 26.04  ? 2243 HOH A O   1 
HETATM 8744 O  O   . HOH P 9 .   ? 43.783  23.820  10.101  1.00 55.48  ? 2244 HOH A O   1 
HETATM 8745 O  O   . HOH P 9 .   ? 36.394  21.877  4.632   1.00 37.65  ? 2245 HOH A O   1 
HETATM 8746 O  O   . HOH P 9 .   ? 43.880  24.084  2.990   1.00 53.29  ? 2246 HOH A O   1 
HETATM 8747 O  O   . HOH P 9 .   ? 45.876  19.290  1.842   1.00 54.62  ? 2247 HOH A O   1 
HETATM 8748 O  O   . HOH P 9 .   ? 42.955  21.239  -0.254  1.00 50.72  ? 2248 HOH A O   1 
HETATM 8749 O  O   . HOH P 9 .   ? 38.316  15.891  1.117   1.00 13.18  ? 2249 HOH A O   1 
HETATM 8750 O  O   . HOH P 9 .   ? 40.366  20.282  -4.542  1.00 39.22  ? 2250 HOH A O   1 
HETATM 8751 O  O   . HOH P 9 .   ? 36.638  19.337  -4.714  1.00 36.30  ? 2251 HOH A O   1 
HETATM 8752 O  O   . HOH P 9 .   ? 38.043  21.680  2.354   1.00 37.49  ? 2252 HOH A O   1 
HETATM 8753 O  O   . HOH P 9 .   ? 35.120  19.643  4.964   1.00 40.45  ? 2253 HOH A O   1 
HETATM 8754 O  O   . HOH P 9 .   ? 36.756  12.298  -0.584  1.00 39.41  ? 2254 HOH A O   1 
HETATM 8755 O  O   . HOH P 9 .   ? 35.836  12.881  6.919   1.00 34.69  ? 2255 HOH A O   1 
HETATM 8756 O  O   . HOH P 9 .   ? 43.697  11.275  9.519   1.00 30.78  ? 2256 HOH A O   1 
HETATM 8757 O  O   . HOH P 9 .   ? 37.997  15.393  12.548  1.00 24.84  ? 2257 HOH A O   1 
HETATM 8758 O  O   . HOH P 9 .   ? 42.414  9.664   11.343  1.00 32.60  ? 2258 HOH A O   1 
HETATM 8759 O  O   . HOH P 9 .   ? 44.411  1.139   16.101  1.00 35.48  ? 2259 HOH A O   1 
HETATM 8760 O  O   . HOH P 9 .   ? 44.937  -2.539  8.273   1.00 45.43  ? 2260 HOH A O   1 
HETATM 8761 O  O   . HOH P 9 .   ? 40.240  -7.511  14.941  1.00 51.20  ? 2261 HOH A O   1 
HETATM 8762 O  O   . HOH P 9 .   ? 41.833  -0.789  19.124  1.00 43.45  ? 2262 HOH A O   1 
HETATM 8763 O  O   . HOH P 9 .   ? 46.089  -1.153  17.061  1.00 42.11  ? 2263 HOH A O   1 
HETATM 8764 O  O   . HOH P 9 .   ? 35.952  -4.765  13.826  1.00 38.36  ? 2264 HOH A O   1 
HETATM 8765 O  O   . HOH P 9 .   ? 33.368  1.891   4.400   1.00 46.25  ? 2265 HOH A O   1 
HETATM 8766 O  O   . HOH P 9 .   ? 32.169  0.954   -2.001  1.00 49.40  ? 2266 HOH A O   1 
HETATM 8767 O  O   . HOH P 9 .   ? 31.751  -6.322  1.240   1.00 59.55  ? 2267 HOH A O   1 
HETATM 8768 O  O   . HOH P 9 .   ? 24.935  -11.732 3.949   1.00 48.84  ? 2268 HOH A O   1 
HETATM 8769 O  O   . HOH P 9 .   ? 25.178  -12.030 6.695   1.00 59.51  ? 2269 HOH A O   1 
HETATM 8770 O  O   . HOH P 9 .   ? 23.843  -12.927 8.826   1.00 61.66  ? 2270 HOH A O   1 
HETATM 8771 O  O   . HOH P 9 .   ? 23.382  -10.008 17.109  1.00 62.42  ? 2271 HOH A O   1 
HETATM 8772 O  O   . HOH P 9 .   ? 17.879  15.093  4.356   1.00 32.15  ? 2272 HOH A O   1 
HETATM 8773 O  O   . HOH P 9 .   ? 11.003  23.194  6.699   1.00 25.31  ? 2273 HOH A O   1 
HETATM 8774 O  O   . HOH P 9 .   ? 21.743  20.546  7.330   1.00 30.58  ? 2274 HOH A O   1 
HETATM 8775 O  O   . HOH P 9 .   ? 19.507  18.030  2.693   1.00 32.31  ? 2275 HOH A O   1 
HETATM 8776 O  O   . HOH P 9 .   ? 28.783  25.528  13.390  1.00 38.62  ? 2276 HOH A O   1 
HETATM 8777 O  O   . HOH P 9 .   ? 33.953  23.269  5.127   1.00 39.48  ? 2277 HOH A O   1 
HETATM 8778 O  O   . HOH P 9 .   ? 30.198  29.158  1.226   1.00 46.28  ? 2278 HOH A O   1 
HETATM 8779 O  O   . HOH P 9 .   ? 29.228  27.359  -6.031  1.00 30.99  ? 2279 HOH A O   1 
HETATM 8780 O  O   . HOH P 9 .   ? 27.024  36.181  5.970   1.00 53.03  ? 2280 HOH A O   1 
HETATM 8781 O  O   . HOH P 9 .   ? 12.896  30.516  1.362   1.00 59.77  ? 2281 HOH A O   1 
HETATM 8782 O  O   . HOH P 9 .   ? 14.928  31.670  3.407   1.00 39.34  ? 2282 HOH A O   1 
HETATM 8783 O  O   . HOH P 9 .   ? 17.147  34.883  4.436   1.00 61.27  ? 2283 HOH A O   1 
HETATM 8784 O  O   . HOH P 9 .   ? 20.816  31.498  -12.213 1.00 47.89  ? 2284 HOH A O   1 
HETATM 8785 O  O   . HOH P 9 .   ? 27.198  32.123  -11.636 1.00 38.26  ? 2285 HOH A O   1 
HETATM 8786 O  O   . HOH P 9 .   ? 21.925  22.526  -19.829 1.00 45.33  ? 2286 HOH A O   1 
HETATM 8787 O  O   . HOH P 9 .   ? 25.141  29.250  -14.827 1.00 40.23  ? 2287 HOH A O   1 
HETATM 8788 O  O   . HOH P 9 .   ? 31.080  25.750  -12.705 1.00 36.03  ? 2288 HOH A O   1 
HETATM 8789 O  O   . HOH P 9 .   ? 30.554  28.753  -10.235 1.00 45.15  ? 2289 HOH A O   1 
HETATM 8790 O  O   . HOH P 9 .   ? 30.225  31.657  -7.073  1.00 40.78  ? 2290 HOH A O   1 
HETATM 8791 O  O   . HOH P 9 .   ? 34.186  23.572  -7.433  1.00 41.40  ? 2291 HOH A O   1 
HETATM 8792 O  O   . HOH P 9 .   ? 32.080  23.427  -11.719 1.00 40.90  ? 2292 HOH A O   1 
HETATM 8793 O  O   . HOH P 9 .   ? 34.664  16.103  -7.424  1.00 38.65  ? 2293 HOH A O   1 
HETATM 8794 O  O   . HOH P 9 .   ? 30.076  16.388  1.277   1.00 32.59  ? 2294 HOH A O   1 
HETATM 8795 O  O   . HOH P 9 .   ? 38.794  13.727  -7.294  1.00 52.74  ? 2295 HOH A O   1 
HETATM 8796 O  O   . HOH P 9 .   ? 38.461  12.757  -13.197 1.00 52.77  ? 2296 HOH A O   1 
HETATM 8797 O  O   . HOH P 9 .   ? 35.870  10.711  -15.317 1.00 45.90  ? 2297 HOH A O   1 
HETATM 8798 O  O   . HOH P 9 .   ? 15.795  14.292  -8.352  1.00 45.79  ? 2298 HOH A O   1 
HETATM 8799 O  O   . HOH P 9 .   ? 16.405  16.790  -7.158  0.50 27.93  ? 2299 HOH A O   1 
HETATM 8800 O  O   . HOH P 9 .   ? 11.970  22.758  -9.661  1.00 47.63  ? 2300 HOH A O   1 
HETATM 8801 O  O   . HOH P 9 .   ? 17.567  21.723  -12.086 1.00 42.65  ? 2301 HOH A O   1 
HETATM 8802 O  O   . HOH P 9 .   ? 16.020  20.569  -20.421 1.00 48.75  ? 2302 HOH A O   1 
HETATM 8803 O  O   . HOH P 9 .   ? 6.428   25.277  -13.392 1.00 55.76  ? 2303 HOH A O   1 
HETATM 8804 O  O   . HOH P 9 .   ? 15.278  26.558  -16.233 1.00 40.16  ? 2304 HOH A O   1 
HETATM 8805 O  O   . HOH P 9 .   ? 10.642  27.173  -7.819  1.00 54.63  ? 2305 HOH A O   1 
HETATM 8806 O  O   . HOH P 9 .   ? 16.855  19.863  -0.438  1.00 41.37  ? 2306 HOH A O   1 
HETATM 8807 O  O   . HOH P 9 .   ? 17.283  23.996  0.623   1.00 37.24  ? 2307 HOH A O   1 
HETATM 8808 O  O   . HOH P 9 .   ? 17.358  21.590  1.979   1.00 37.02  ? 2308 HOH A O   1 
HETATM 8809 O  O   . HOH P 9 .   ? 19.173  15.061  1.926   1.00 29.34  ? 2309 HOH A O   1 
HETATM 8810 O  O   . HOH P 9 .   ? 26.913  8.112   -0.347  1.00 33.51  ? 2310 HOH A O   1 
HETATM 8811 O  O   . HOH P 9 .   ? 26.262  9.006   7.800   1.00 33.68  ? 2311 HOH A O   1 
HETATM 8812 O  O   . HOH P 9 .   ? 23.608  -2.909  -0.920  1.00 68.00  ? 2312 HOH A O   1 
HETATM 8813 O  O   . HOH P 9 .   ? 19.968  -5.256  1.455   1.00 50.81  ? 2313 HOH A O   1 
HETATM 8814 O  O   . HOH P 9 .   ? 14.112  -9.388  14.475  1.00 62.97  ? 2314 HOH A O   1 
HETATM 8815 O  O   . HOH P 9 .   ? 7.145   -3.079  16.398  1.00 45.80  ? 2315 HOH A O   1 
HETATM 8816 O  O   . HOH P 9 .   ? 10.693  14.867  3.935   1.00 54.20  ? 2316 HOH A O   1 
HETATM 8817 O  O   . HOH P 9 .   ? 6.310   20.740  11.857  1.00 57.14  ? 2317 HOH A O   1 
HETATM 8818 O  O   . HOH P 9 .   ? 13.790  21.563  14.248  1.00 36.30  ? 2318 HOH A O   1 
HETATM 8819 O  O   . HOH P 9 .   ? 8.302   22.128  10.410  1.00 40.07  ? 2319 HOH A O   1 
HETATM 8820 O  O   . HOH P 9 .   ? 11.347  28.163  12.044  1.00 49.49  ? 2320 HOH A O   1 
HETATM 8821 O  O   . HOH P 9 .   ? 20.379  33.311  10.274  1.00 41.54  ? 2321 HOH A O   1 
HETATM 8822 O  O   . HOH P 9 .   ? 18.930  28.001  16.391  1.00 38.22  ? 2322 HOH A O   1 
HETATM 8823 O  O   . HOH P 9 .   ? 14.546  33.164  6.374   1.00 53.02  ? 2323 HOH A O   1 
HETATM 8824 O  O   . HOH P 9 .   ? 13.045  24.175  2.106   1.00 46.39  ? 2324 HOH A O   1 
HETATM 8825 O  O   . HOH P 9 .   ? 20.646  15.416  13.051  1.00 28.03  ? 2325 HOH A O   1 
HETATM 8826 O  O   . HOH P 9 .   ? 16.657  25.886  18.028  1.00 42.70  ? 2326 HOH A O   1 
HETATM 8827 O  O   . HOH P 9 .   ? 18.885  20.467  18.412  1.00 35.00  ? 2327 HOH A O   1 
HETATM 8828 O  O   . HOH P 9 .   ? 18.899  25.510  19.938  1.00 60.08  ? 2328 HOH A O   1 
HETATM 8829 O  O   . HOH P 9 .   ? 9.765   25.730  25.988  1.00 40.35  ? 2329 HOH A O   1 
HETATM 8830 O  O   . HOH P 9 .   ? 15.009  23.591  33.644  1.00 45.54  ? 2330 HOH A O   1 
HETATM 8831 O  O   . HOH P 9 .   ? 17.520  25.727  22.166  1.00 48.33  ? 2331 HOH A O   1 
HETATM 8832 O  O   . HOH P 9 .   ? 4.556   24.625  17.010  1.00 47.00  ? 2332 HOH A O   1 
HETATM 8833 O  O   . HOH P 9 .   ? 1.684   27.727  22.186  1.00 58.70  ? 2333 HOH A O   1 
HETATM 8834 O  O   . HOH P 9 .   ? 2.307   18.148  18.985  1.00 39.02  ? 2334 HOH A O   1 
HETATM 8835 O  O   . HOH P 9 .   ? 2.567   13.349  24.627  1.00 58.75  ? 2335 HOH A O   1 
HETATM 8836 O  O   . HOH P 9 .   ? 5.277   8.409   22.088  1.00 46.85  ? 2336 HOH A O   1 
HETATM 8837 O  O   . HOH P 9 .   ? 2.728   15.709  18.569  1.00 48.73  ? 2337 HOH A O   1 
HETATM 8838 O  O   . HOH P 9 .   ? 2.484   7.105   17.888  1.00 46.58  ? 2338 HOH A O   1 
HETATM 8839 O  O   . HOH P 9 .   ? 12.944  4.048   32.699  1.00 46.14  ? 2339 HOH A O   1 
HETATM 8840 O  O   . HOH P 9 .   ? 8.011   -0.650  24.293  1.00 56.16  ? 2340 HOH A O   1 
HETATM 8841 O  O   . HOH P 9 .   ? 14.371  -7.264  23.489  1.00 43.09  ? 2341 HOH A O   1 
HETATM 8842 O  O   . HOH P 9 .   ? 13.483  -4.902  11.441  1.00 45.13  ? 2342 HOH A O   1 
HETATM 8843 O  O   . HOH P 9 .   ? 15.134  3.176   4.344   1.00 63.67  ? 2343 HOH A O   1 
HETATM 8844 O  O   . HOH P 9 .   ? 14.369  -7.297  6.350   1.00 44.63  ? 2344 HOH A O   1 
HETATM 8845 O  O   . HOH P 9 .   ? 14.449  2.211   1.687   1.00 34.23  ? 2345 HOH A O   1 
HETATM 8846 O  O   . HOH P 9 .   ? 10.855  1.764   10.594  1.00 34.17  ? 2346 HOH A O   1 
HETATM 8847 O  O   . HOH P 9 .   ? 2.931   1.187   4.712   1.00 54.26  ? 2347 HOH A O   1 
HETATM 8848 O  O   . HOH P 9 .   ? 8.829   -2.313  6.743   1.00 37.96  ? 2348 HOH A O   1 
HETATM 8849 O  O   . HOH P 9 .   ? 9.406   10.892  3.409   1.00 38.81  ? 2349 HOH A O   1 
HETATM 8850 O  O   . HOH P 9 .   ? 3.514   12.607  10.916  1.00 44.68  ? 2350 HOH A O   1 
HETATM 8851 O  O   . HOH P 9 .   ? 4.569   19.034  11.781  1.00 50.33  ? 2351 HOH A O   1 
HETATM 8852 O  O   . HOH P 9 .   ? 4.843   12.017  14.119  1.00 42.33  ? 2352 HOH A O   1 
HETATM 8853 O  O   . HOH P 9 .   ? 1.360   9.620   16.809  1.00 46.68  ? 2353 HOH A O   1 
HETATM 8854 O  O   . HOH P 9 .   ? 3.208   13.702  8.214   1.00 50.68  ? 2354 HOH A O   1 
HETATM 8855 O  O   . HOH P 9 .   ? 0.186   6.292   7.967   1.00 51.46  ? 2355 HOH A O   1 
HETATM 8856 O  O   . HOH P 9 .   ? 5.304   6.853   1.151   1.00 44.12  ? 2356 HOH A O   1 
HETATM 8857 O  O   . HOH P 9 .   ? 8.913   7.283   0.943   1.00 43.02  ? 2357 HOH A O   1 
HETATM 8858 O  O   . HOH P 9 .   ? 11.611  6.214   -1.611  1.00 47.54  ? 2358 HOH A O   1 
HETATM 8859 O  O   . HOH P 9 .   ? 16.529  3.198   0.226   1.00 38.24  ? 2359 HOH A O   1 
HETATM 8860 O  O   . HOH P 9 .   ? 11.643  12.723  2.309   1.00 38.30  ? 2360 HOH A O   1 
HETATM 8861 O  O   . HOH P 9 .   ? 11.816  9.603   0.074   1.00 47.53  ? 2361 HOH A O   1 
HETATM 8862 O  O   . HOH P 9 .   ? 13.072  10.252  2.316   1.00 55.46  ? 2362 HOH A O   1 
HETATM 8863 O  O   . HOH P 9 .   ? 13.823  14.281  2.687   1.00 48.41  ? 2363 HOH A O   1 
HETATM 8864 O  O   . HOH P 9 .   ? 17.281  2.147   -2.443  1.00 51.69  ? 2364 HOH A O   1 
HETATM 8865 O  O   . HOH P 9 .   ? 12.615  6.719   -4.312  1.00 54.04  ? 2365 HOH A O   1 
HETATM 8866 O  O   . HOH P 9 .   ? 14.294  8.683   -4.301  1.00 36.19  ? 2366 HOH A O   1 
HETATM 8867 O  O   . HOH P 9 .   ? 21.296  0.373   -0.324  1.00 34.83  ? 2367 HOH A O   1 
HETATM 8868 O  O   . HOH P 9 .   ? 25.903  5.706   0.981   1.00 43.19  ? 2368 HOH A O   1 
HETATM 8869 O  O   . HOH P 9 .   ? 22.747  -3.762  -7.140  1.00 40.43  ? 2369 HOH A O   1 
HETATM 8870 O  O   . HOH P 9 .   ? 19.959  0.994   -2.690  1.00 39.41  ? 2370 HOH A O   1 
HETATM 8871 O  O   . HOH P 9 .   ? 31.011  5.160   -4.309  1.00 51.72  ? 2371 HOH A O   1 
HETATM 8872 O  O   . HOH P 9 .   ? 32.908  -2.103  -8.359  1.00 63.99  ? 2372 HOH A O   1 
HETATM 8873 O  O   . HOH P 9 .   ? 35.179  7.398   -13.720 1.00 56.32  ? 2373 HOH A O   1 
HETATM 8874 O  O   . HOH P 9 .   ? 26.053  18.215  14.891  1.00 46.47  ? 2374 HOH A O   1 
HETATM 8875 O  O   . HOH P 9 .   ? 23.676  33.164  -4.233  1.00 41.03  ? 2375 HOH A O   1 
HETATM 8876 O  O   . HOH P 9 .   ? 30.496  34.209  -4.500  1.00 49.63  ? 2376 HOH A O   1 
HETATM 8877 O  O   . HOH Q 9 .   ? -17.490 6.467   -72.176 1.00 71.82  ? 2001 HOH B O   1 
HETATM 8878 O  O   . HOH Q 9 .   ? -17.519 9.234   -42.980 1.00 39.78  ? 2002 HOH B O   1 
HETATM 8879 O  O   . HOH Q 9 .   ? 1.257   17.077  -66.262 1.00 50.94  ? 2003 HOH B O   1 
HETATM 8880 O  O   . HOH Q 9 .   ? 1.470   12.836  -71.621 1.00 52.79  ? 2004 HOH B O   1 
HETATM 8881 O  O   . HOH Q 9 .   ? 1.474   16.892  -69.000 1.00 56.08  ? 2005 HOH B O   1 
HETATM 8882 O  O   . HOH Q 9 .   ? 8.215   -0.646  -66.939 1.00 34.91  ? 2006 HOH B O   1 
HETATM 8883 O  O   . HOH Q 9 .   ? 16.305  0.042   -66.123 1.00 53.68  ? 2007 HOH B O   1 
HETATM 8884 O  O   . HOH Q 9 .   ? 4.719   10.910  -65.346 1.00 35.39  ? 2008 HOH B O   1 
HETATM 8885 O  O   . HOH Q 9 .   ? 23.811  -15.446 -23.456 1.00 54.75  ? 2009 HOH B O   1 
HETATM 8886 O  O   . HOH Q 9 .   ? -8.318  8.451   -74.274 1.00 61.39  ? 2010 HOH B O   1 
HETATM 8887 O  O   . HOH Q 9 .   ? 4.107   -0.009  -65.751 1.00 40.01  ? 2011 HOH B O   1 
HETATM 8888 O  O   . HOH Q 9 .   ? -7.960  1.629   -72.940 1.00 48.57  ? 2012 HOH B O   1 
HETATM 8889 O  O   . HOH Q 9 .   ? 14.589  5.062   -74.274 1.00 46.43  ? 2013 HOH B O   1 
HETATM 8890 O  O   . HOH Q 9 .   ? 12.254  7.608   -72.814 1.00 50.12  ? 2014 HOH B O   1 
HETATM 8891 O  O   . HOH Q 9 .   ? -14.385 2.954   -61.618 1.00 48.89  ? 2015 HOH B O   1 
HETATM 8892 O  O   . HOH Q 9 .   ? 10.778  -14.961 -35.831 1.00 48.73  ? 2016 HOH B O   1 
HETATM 8893 O  O   . HOH Q 9 .   ? -16.337 8.517   -45.357 1.00 52.22  ? 2017 HOH B O   1 
HETATM 8894 O  O   . HOH Q 9 .   ? -8.411  -1.818  -55.013 1.00 52.28  ? 2018 HOH B O   1 
HETATM 8895 O  O   . HOH Q 9 .   ? 5.189   8.366   -64.246 1.00 26.46  ? 2019 HOH B O   1 
HETATM 8896 O  O   . HOH Q 9 .   ? 9.122   9.538   -62.849 1.00 44.43  ? 2020 HOH B O   1 
HETATM 8897 O  O   . HOH Q 9 .   ? 7.950   0.942   -62.022 1.00 36.52  ? 2021 HOH B O   1 
HETATM 8898 O  O   . HOH Q 9 .   ? 15.005  2.461   -61.941 1.00 38.63  ? 2022 HOH B O   1 
HETATM 8899 O  O   . HOH Q 9 .   ? 9.533   1.324   -68.335 1.00 34.59  ? 2023 HOH B O   1 
HETATM 8900 O  O   . HOH Q 9 .   ? 12.595  -0.712  -68.273 1.00 37.55  ? 2024 HOH B O   1 
HETATM 8901 O  O   . HOH Q 9 .   ? 14.208  -1.508  -65.956 1.00 43.54  ? 2025 HOH B O   1 
HETATM 8902 O  O   . HOH Q 9 .   ? 17.252  -3.726  -66.096 1.00 40.44  ? 2026 HOH B O   1 
HETATM 8903 O  O   . HOH Q 9 .   ? 19.379  -8.619  -60.574 1.00 45.97  ? 2027 HOH B O   1 
HETATM 8904 O  O   . HOH Q 9 .   ? 20.078  -6.033  -66.649 1.00 51.64  ? 2028 HOH B O   1 
HETATM 8905 O  O   . HOH Q 9 .   ? 22.915  0.558   -53.073 1.00 40.19  ? 2029 HOH B O   1 
HETATM 8906 O  O   . HOH Q 9 .   ? 22.275  -12.568 -20.416 1.00 44.91  ? 2030 HOH B O   1 
HETATM 8907 O  O   . HOH Q 9 .   ? 24.618  -14.135 -16.795 1.00 52.19  ? 2031 HOH B O   1 
HETATM 8908 O  O   . HOH Q 9 .   ? 17.412  1.242   -60.381 1.00 41.43  ? 2032 HOH B O   1 
HETATM 8909 O  O   . HOH Q 9 .   ? 19.434  9.235   -58.339 1.00 51.84  ? 2033 HOH B O   1 
HETATM 8910 O  O   . HOH Q 9 .   ? 7.544   9.617   -65.221 1.00 33.28  ? 2034 HOH B O   1 
HETATM 8911 O  O   . HOH Q 9 .   ? 4.487   1.109   -69.073 1.00 9.01   ? 2035 HOH B O   1 
HETATM 8912 O  O   . HOH Q 9 .   ? 12.172  4.096   -74.852 1.00 39.80  ? 2036 HOH B O   1 
HETATM 8913 O  O   . HOH Q 9 .   ? 3.211   9.135   -73.608 1.00 47.21  ? 2037 HOH B O   1 
HETATM 8914 O  O   . HOH Q 9 .   ? -0.173  7.456   -72.910 1.00 36.74  ? 2038 HOH B O   1 
HETATM 8915 O  O   . HOH Q 9 .   ? -4.905  1.702   -73.674 1.00 49.96  ? 2039 HOH B O   1 
HETATM 8916 O  O   . HOH Q 9 .   ? -2.674  -0.683  -61.405 1.00 50.24  ? 2040 HOH B O   1 
HETATM 8917 O  O   . HOH Q 9 .   ? -1.360  -3.999  -60.745 1.00 56.87  ? 2041 HOH B O   1 
HETATM 8918 O  O   . HOH Q 9 .   ? 1.749   -2.493  -53.123 1.00 34.23  ? 2042 HOH B O   1 
HETATM 8919 O  O   . HOH Q 9 .   ? 1.175   -0.534  -64.330 1.00 52.31  ? 2043 HOH B O   1 
HETATM 8920 O  O   . HOH Q 9 .   ? 5.254   -5.569  -60.768 1.00 46.55  ? 2044 HOH B O   1 
HETATM 8921 O  O   . HOH Q 9 .   ? 2.338   21.449  -61.609 1.00 49.78  ? 2045 HOH B O   1 
HETATM 8922 O  O   . HOH Q 9 .   ? 14.366  -7.245  -48.774 1.00 32.09  ? 2046 HOH B O   1 
HETATM 8923 O  O   . HOH Q 9 .   ? 12.359  -5.126  -54.182 1.00 43.86  ? 2047 HOH B O   1 
HETATM 8924 O  O   . HOH Q 9 .   ? 12.593  -4.497  -51.571 1.00 32.86  ? 2048 HOH B O   1 
HETATM 8925 O  O   . HOH Q 9 .   ? 4.421   -5.382  -46.215 1.00 32.69  ? 2049 HOH B O   1 
HETATM 8926 O  O   . HOH Q 9 .   ? 9.395   -13.227 -38.167 1.00 52.08  ? 2050 HOH B O   1 
HETATM 8927 O  O   . HOH Q 9 .   ? 13.267  -8.104  -46.416 1.00 32.87  ? 2051 HOH B O   1 
HETATM 8928 O  O   . HOH Q 9 .   ? 6.574   -8.127  -44.364 1.00 45.22  ? 2052 HOH B O   1 
HETATM 8929 O  O   . HOH Q 9 .   ? 10.697  -14.420 -46.147 1.00 43.36  ? 2053 HOH B O   1 
HETATM 8930 O  O   . HOH Q 9 .   ? 10.095  -10.083 -38.602 1.00 54.35  ? 2054 HOH B O   1 
HETATM 8931 O  O   . HOH Q 9 .   ? 3.833   -13.754 -37.544 1.00 47.87  ? 2055 HOH B O   1 
HETATM 8932 O  O   . HOH Q 9 .   ? -6.310  -12.690 -34.794 1.00 52.42  ? 2056 HOH B O   1 
HETATM 8933 O  O   . HOH Q 9 .   ? 4.550   -8.820  -39.782 1.00 44.41  ? 2057 HOH B O   1 
HETATM 8934 O  O   . HOH Q 9 .   ? -1.353  -9.815  -45.455 1.00 51.12  ? 2058 HOH B O   1 
HETATM 8935 O  O   . HOH Q 9 .   ? -0.595  -12.187 -45.013 1.00 62.48  ? 2059 HOH B O   1 
HETATM 8936 O  O   . HOH Q 9 .   ? 2.609   -14.524 -39.649 1.00 61.94  ? 2060 HOH B O   1 
HETATM 8937 O  O   . HOH Q 9 .   ? -3.113  -3.493  -43.045 1.00 40.88  ? 2061 HOH B O   1 
HETATM 8938 O  O   . HOH Q 9 .   ? 25.065  3.426   -33.669 1.00 41.05  ? 2062 HOH B O   1 
HETATM 8939 O  O   . HOH Q 9 .   ? 4.781   -3.472  -42.801 1.00 30.75  ? 2063 HOH B O   1 
HETATM 8940 O  O   . HOH Q 9 .   ? 24.411  5.796   -35.214 1.00 48.28  ? 2064 HOH B O   1 
HETATM 8941 O  O   . HOH Q 9 .   ? 6.235   -7.797  -41.565 1.00 39.68  ? 2065 HOH B O   1 
HETATM 8942 O  O   . HOH Q 9 .   ? -1.636  -7.098  -44.901 1.00 44.53  ? 2066 HOH B O   1 
HETATM 8943 O  O   . HOH Q 9 .   ? 28.370  7.282   -39.067 1.00 52.38  ? 2067 HOH B O   1 
HETATM 8944 O  O   . HOH Q 9 .   ? 2.356   -12.015 -46.835 1.00 40.83  ? 2068 HOH B O   1 
HETATM 8945 O  O   . HOH Q 9 .   ? -0.313  -11.906 -50.630 1.00 57.39  ? 2069 HOH B O   1 
HETATM 8946 O  O   . HOH Q 9 .   ? 31.590  -12.240 -39.538 1.00 52.10  ? 2070 HOH B O   1 
HETATM 8947 O  O   . HOH Q 9 .   ? 34.471  -7.647  -39.594 1.00 52.15  ? 2071 HOH B O   1 
HETATM 8948 O  O   . HOH Q 9 .   ? 2.693   -11.875 -50.911 1.00 48.00  ? 2072 HOH B O   1 
HETATM 8949 O  O   . HOH Q 9 .   ? -6.167  -3.405  -55.724 1.00 39.11  ? 2073 HOH B O   1 
HETATM 8950 O  O   . HOH Q 9 .   ? -3.701  -5.349  -56.681 1.00 41.10  ? 2074 HOH B O   1 
HETATM 8951 O  O   . HOH Q 9 .   ? 32.330  -11.475 -44.010 1.00 58.33  ? 2075 HOH B O   1 
HETATM 8952 O  O   . HOH Q 9 .   ? 4.582   -13.497 -53.511 1.00 40.89  ? 2076 HOH B O   1 
HETATM 8953 O  O   . HOH Q 9 .   ? 16.788  -7.892  -59.961 1.00 45.95  ? 2077 HOH B O   1 
HETATM 8954 O  O   . HOH Q 9 .   ? 15.952  -4.644  -56.931 1.00 38.32  ? 2078 HOH B O   1 
HETATM 8955 O  O   . HOH Q 9 .   ? 13.560  -4.066  -55.927 1.00 34.16  ? 2079 HOH B O   1 
HETATM 8956 O  O   . HOH Q 9 .   ? 10.365  -5.881  -64.277 1.00 40.33  ? 2080 HOH B O   1 
HETATM 8957 O  O   . HOH Q 9 .   ? 9.429   -0.964  -60.784 1.00 32.00  ? 2081 HOH B O   1 
HETATM 8958 O  O   . HOH Q 9 .   ? 6.715   -0.100  -64.602 1.00 35.87  ? 2082 HOH B O   1 
HETATM 8959 O  O   . HOH Q 9 .   ? 21.002  -19.728 -57.126 1.00 48.72  ? 2083 HOH B O   1 
HETATM 8960 O  O   . HOH Q 9 .   ? 1.577   0.133   -53.268 1.00 32.74  ? 2084 HOH B O   1 
HETATM 8961 O  O   . HOH Q 9 .   ? 0.667   0.360   -56.088 1.00 32.71  ? 2085 HOH B O   1 
HETATM 8962 O  O   . HOH Q 9 .   ? -9.559  13.320  -59.743 1.00 55.67  ? 2086 HOH B O   1 
HETATM 8963 O  O   . HOH Q 9 .   ? 4.506   4.680   -48.368 1.00 29.34  ? 2087 HOH B O   1 
HETATM 8964 O  O   . HOH Q 9 .   ? -0.443  -2.145  -19.488 1.00 43.81  ? 2088 HOH B O   1 
HETATM 8965 O  O   . HOH Q 9 .   ? 9.519   -3.268  -37.456 1.00 42.43  ? 2089 HOH B O   1 
HETATM 8966 O  O   . HOH Q 9 .   ? 18.141  -15.405 -21.372 1.00 45.40  ? 2090 HOH B O   1 
HETATM 8967 O  O   . HOH Q 9 .   ? 8.088   -8.447  -39.890 1.00 45.00  ? 2091 HOH B O   1 
HETATM 8968 O  O   . HOH Q 9 .   ? 6.367   -5.134  -41.415 1.00 40.07  ? 2092 HOH B O   1 
HETATM 8969 O  O   . HOH Q 9 .   ? -3.975  -18.950 -29.665 1.00 57.57  ? 2093 HOH B O   1 
HETATM 8970 O  O   . HOH Q 9 .   ? 6.629   -2.514  -50.680 1.00 37.86  ? 2094 HOH B O   1 
HETATM 8971 O  O   . HOH Q 9 .   ? -5.370  -2.413  -49.046 1.00 44.42  ? 2095 HOH B O   1 
HETATM 8972 O  O   . HOH Q 9 .   ? 22.516  -10.664 -18.040 1.00 49.12  ? 2096 HOH B O   1 
HETATM 8973 O  O   . HOH Q 9 .   ? 18.617  -18.876 -19.034 1.00 53.16  ? 2097 HOH B O   1 
HETATM 8974 O  O   . HOH Q 9 .   ? -5.721  0.445   -49.121 1.00 51.60  ? 2098 HOH B O   1 
HETATM 8975 O  O   . HOH Q 9 .   ? -3.140  1.234   -48.670 1.00 45.52  ? 2099 HOH B O   1 
HETATM 8976 O  O   . HOH Q 9 .   ? -3.300  -4.983  -45.342 1.00 42.52  ? 2100 HOH B O   1 
HETATM 8977 O  O   . HOH Q 9 .   ? -5.379  -6.190  -47.377 1.00 49.08  ? 2101 HOH B O   1 
HETATM 8978 O  O   . HOH Q 9 .   ? -10.290 -2.455  -48.300 1.00 52.07  ? 2102 HOH B O   1 
HETATM 8979 O  O   . HOH Q 9 .   ? 4.499   -0.789  -43.688 1.00 33.16  ? 2103 HOH B O   1 
HETATM 8980 O  O   . HOH Q 9 .   ? 4.199   2.311   -40.952 1.00 30.67  ? 2104 HOH B O   1 
HETATM 8981 O  O   . HOH Q 9 .   ? -9.534  -0.605  -45.012 1.00 48.44  ? 2105 HOH B O   1 
HETATM 8982 O  O   . HOH Q 9 .   ? -8.709  2.400   -51.062 1.00 56.79  ? 2106 HOH B O   1 
HETATM 8983 O  O   . HOH Q 9 .   ? -12.855 -1.302  -52.330 1.00 49.29  ? 2107 HOH B O   1 
HETATM 8984 O  O   . HOH Q 9 .   ? -15.097 0.243   -53.225 1.00 41.17  ? 2108 HOH B O   1 
HETATM 8985 O  O   . HOH Q 9 .   ? -14.048 18.384  -48.163 1.00 47.87  ? 2109 HOH B O   1 
HETATM 8986 O  O   . HOH Q 9 .   ? -1.190  4.070   -48.803 1.00 34.97  ? 2110 HOH B O   1 
HETATM 8987 O  O   . HOH Q 9 .   ? 17.817  21.016  -26.537 1.00 49.30  ? 2111 HOH B O   1 
HETATM 8988 O  O   . HOH Q 9 .   ? 25.723  10.289  -29.474 1.00 49.61  ? 2112 HOH B O   1 
HETATM 8989 O  O   . HOH Q 9 .   ? 10.484  0.049   -43.878 1.00 30.68  ? 2113 HOH B O   1 
HETATM 8990 O  O   . HOH Q 9 .   ? 17.662  -2.786  -55.860 1.00 30.31  ? 2114 HOH B O   1 
HETATM 8991 O  O   . HOH Q 9 .   ? 20.933  1.146   -51.010 1.00 49.86  ? 2115 HOH B O   1 
HETATM 8992 O  O   . HOH Q 9 .   ? 25.054  -2.801  -46.573 1.00 34.16  ? 2116 HOH B O   1 
HETATM 8993 O  O   . HOH Q 9 .   ? 28.522  5.421   -51.666 1.00 40.68  ? 2117 HOH B O   1 
HETATM 8994 O  O   . HOH Q 9 .   ? 29.300  5.602   -54.215 1.00 48.12  ? 2118 HOH B O   1 
HETATM 8995 O  O   . HOH Q 9 .   ? 33.125  1.766   -58.033 1.00 50.83  ? 2119 HOH B O   1 
HETATM 8996 O  O   . HOH Q 9 .   ? 25.574  4.780   -58.485 1.00 54.28  ? 2120 HOH B O   1 
HETATM 8997 O  O   . HOH Q 9 .   ? 25.409  6.743   -51.507 1.00 36.85  ? 2121 HOH B O   1 
HETATM 8998 O  O   . HOH Q 9 .   ? 22.988  6.924   -52.881 1.00 36.69  ? 2122 HOH B O   1 
HETATM 8999 O  O   . HOH Q 9 .   ? 21.846  2.227   -47.545 1.00 35.95  ? 2123 HOH B O   1 
HETATM 9000 O  O   . HOH Q 9 .   ? 16.063  9.949   -56.666 1.00 36.05  ? 2124 HOH B O   1 
HETATM 9001 O  O   . HOH Q 9 .   ? 18.522  12.553  -55.231 1.00 47.19  ? 2125 HOH B O   1 
HETATM 9002 O  O   . HOH Q 9 .   ? 16.329  16.728  -56.333 1.00 51.24  ? 2126 HOH B O   1 
HETATM 9003 O  O   . HOH Q 9 .   ? 14.234  18.302  -57.507 1.00 50.81  ? 2127 HOH B O   1 
HETATM 9004 O  O   . HOH Q 9 .   ? 2.204   19.079  -60.050 1.00 35.20  ? 2128 HOH B O   1 
HETATM 9005 O  O   . HOH Q 9 .   ? 9.255   21.084  -57.496 1.00 50.30  ? 2129 HOH B O   1 
HETATM 9006 O  O   . HOH Q 9 .   ? 6.447   16.813  -53.647 1.00 29.24  ? 2130 HOH B O   1 
HETATM 9007 O  O   . HOH Q 9 .   ? -1.283  24.444  -20.151 1.00 54.07  ? 2131 HOH B O   1 
HETATM 9008 O  O   . HOH Q 9 .   ? 7.256   12.569  -64.453 1.00 50.09  ? 2132 HOH B O   1 
HETATM 9009 O  O   . HOH Q 9 .   ? 9.251   12.508  -61.862 1.00 60.52  ? 2133 HOH B O   1 
HETATM 9010 O  O   . HOH Q 9 .   ? 0.854   19.172  -64.680 1.00 46.84  ? 2134 HOH B O   1 
HETATM 9011 O  O   . HOH Q 9 .   ? -3.493  24.396  -51.538 1.00 45.75  ? 2135 HOH B O   1 
HETATM 9012 O  O   . HOH Q 9 .   ? 2.628   25.417  -48.170 1.00 44.21  ? 2136 HOH B O   1 
HETATM 9013 O  O   . HOH Q 9 .   ? 0.365   19.734  -47.394 1.00 31.09  ? 2137 HOH B O   1 
HETATM 9014 O  O   . HOH Q 9 .   ? 3.740   4.153   -34.013 1.00 28.69  ? 2138 HOH B O   1 
HETATM 9015 O  O   . HOH Q 9 .   ? 15.645  19.437  -46.820 1.00 43.40  ? 2139 HOH B O   1 
HETATM 9016 O  O   . HOH Q 9 .   ? 22.739  15.574  -45.763 1.00 35.24  ? 2140 HOH B O   1 
HETATM 9017 O  O   . HOH Q 9 .   ? 22.331  17.197  -47.851 1.00 39.97  ? 2141 HOH B O   1 
HETATM 9018 O  O   . HOH Q 9 .   ? 14.340  24.820  -51.402 1.00 38.69  ? 2142 HOH B O   1 
HETATM 9019 O  O   . HOH Q 9 .   ? 17.015  5.503   -34.730 1.00 31.64  ? 2143 HOH B O   1 
HETATM 9020 O  O   . HOH Q 9 .   ? 20.631  7.124   -36.470 1.00 39.04  ? 2144 HOH B O   1 
HETATM 9021 O  O   . HOH Q 9 .   ? 22.403  1.394   -36.139 1.00 27.58  ? 2145 HOH B O   1 
HETATM 9022 O  O   . HOH Q 9 .   ? 24.018  1.434   -32.293 1.00 37.65  ? 2146 HOH B O   1 
HETATM 9023 O  O   . HOH Q 9 .   ? 22.207  6.180   -30.424 1.00 32.15  ? 2147 HOH B O   1 
HETATM 9024 O  O   . HOH Q 9 .   ? 25.175  5.983   -37.673 1.00 43.63  ? 2148 HOH B O   1 
HETATM 9025 O  O   . HOH Q 9 .   ? 27.051  1.916   -37.275 1.00 35.71  ? 2149 HOH B O   1 
HETATM 9026 O  O   . HOH Q 9 .   ? 30.392  1.140   -36.087 1.00 43.69  ? 2150 HOH B O   1 
HETATM 9027 O  O   . HOH Q 9 .   ? 32.371  2.280   -37.783 1.00 59.10  ? 2151 HOH B O   1 
HETATM 9028 O  O   . HOH Q 9 .   ? 29.888  6.740   -42.238 1.00 53.12  ? 2152 HOH B O   1 
HETATM 9029 O  O   . HOH Q 9 .   ? 32.622  4.120   -40.936 1.00 49.20  ? 2153 HOH B O   1 
HETATM 9030 O  O   . HOH Q 9 .   ? 33.360  1.898   -46.510 1.00 31.94  ? 2154 HOH B O   1 
HETATM 9031 O  O   . HOH Q 9 .   ? 31.975  -9.254  -40.495 1.00 48.22  ? 2155 HOH B O   1 
HETATM 9032 O  O   . HOH Q 9 .   ? 30.839  -7.477  -35.953 1.00 48.62  ? 2156 HOH B O   1 
HETATM 9033 O  O   . HOH Q 9 .   ? 21.809  -1.161  -36.632 1.00 32.38  ? 2157 HOH B O   1 
HETATM 9034 O  O   . HOH Q 9 .   ? 32.644  -8.547  -43.056 1.00 42.25  ? 2158 HOH B O   1 
HETATM 9035 O  O   . HOH Q 9 .   ? 38.401  -4.437  -60.695 1.00 73.05  ? 2159 HOH B O   1 
HETATM 9036 O  O   . HOH Q 9 .   ? 25.650  -9.812  -62.833 1.00 48.26  ? 2160 HOH B O   1 
HETATM 9037 O  O   . HOH Q 9 .   ? 14.617  -13.613 -57.850 1.00 46.15  ? 2161 HOH B O   1 
HETATM 9038 O  O   . HOH Q 9 .   ? 9.908   -13.452 -48.638 1.00 39.44  ? 2162 HOH B O   1 
HETATM 9039 O  O   . HOH Q 9 .   ? 9.607   -17.886 -48.685 1.00 56.35  ? 2163 HOH B O   1 
HETATM 9040 O  O   . HOH Q 9 .   ? 18.133  -20.202 -55.258 1.00 53.60  ? 2164 HOH B O   1 
HETATM 9041 O  O   . HOH Q 9 .   ? 25.033  -19.948 -45.863 1.00 54.04  ? 2165 HOH B O   1 
HETATM 9042 O  O   . HOH Q 9 .   ? 16.989  -8.189  -48.498 1.00 36.97  ? 2166 HOH B O   1 
HETATM 9043 O  O   . HOH Q 9 .   ? 17.437  -6.084  -43.583 1.00 35.52  ? 2167 HOH B O   1 
HETATM 9044 O  O   . HOH Q 9 .   ? 14.744  -10.388 -42.629 1.00 50.63  ? 2168 HOH B O   1 
HETATM 9045 O  O   . HOH Q 9 .   ? 17.968  -13.574 -42.586 1.00 61.23  ? 2169 HOH B O   1 
HETATM 9046 O  O   . HOH Q 9 .   ? 16.699  -9.325  -34.278 0.50 26.30  ? 2170 HOH B O   1 
HETATM 9047 O  O   . HOH Q 9 .   ? 24.304  -12.403 -34.104 1.00 56.58  ? 2171 HOH B O   1 
HETATM 9048 O  O   . HOH Q 9 .   ? 21.484  -11.403 -34.706 1.00 54.46  ? 2172 HOH B O   1 
HETATM 9049 O  O   . HOH Q 9 .   ? 23.203  -8.442  -27.051 1.00 49.86  ? 2173 HOH B O   1 
HETATM 9050 O  O   . HOH Q 9 .   ? 22.548  -5.414  -33.293 1.00 22.65  ? 2174 HOH B O   1 
HETATM 9051 O  O   . HOH Q 9 .   ? 16.781  -11.545 -31.375 1.00 54.07  ? 2175 HOH B O   1 
HETATM 9052 O  O   . HOH Q 9 .   ? 23.826  -1.530  -31.588 1.00 39.05  ? 2176 HOH B O   1 
HETATM 9053 O  O   . HOH Q 9 .   ? 16.834  -6.633  -34.066 0.50 27.84  ? 2177 HOH B O   1 
HETATM 9054 O  O   . HOH Q 9 .   ? 19.123  -1.000  -37.217 1.00 36.70  ? 2178 HOH B O   1 
HETATM 9055 O  O   . HOH Q 9 .   ? 24.195  -2.486  -43.808 1.00 40.50  ? 2179 HOH B O   1 
HETATM 9056 O  O   . HOH Q 9 .   ? 16.542  -3.609  -42.814 1.00 30.85  ? 2180 HOH B O   1 
HETATM 9057 O  O   . HOH Q 9 .   ? 22.784  -0.393  -44.930 1.00 36.55  ? 2181 HOH B O   1 
HETATM 9058 O  O   . HOH Q 9 .   ? 30.687  10.839  -50.637 1.00 49.57  ? 2182 HOH B O   1 
HETATM 9059 O  O   . HOH Q 9 .   ? 22.540  9.723   -52.839 1.00 38.19  ? 2183 HOH B O   1 
HETATM 9060 O  O   . HOH Q 9 .   ? 22.729  15.630  -49.979 1.00 53.09  ? 2184 HOH B O   1 
HETATM 9061 O  O   . HOH Q 9 .   ? 26.598  8.468   -52.936 1.00 45.56  ? 2185 HOH B O   1 
HETATM 9062 O  O   . HOH Q 9 .   ? 27.457  18.952  -43.574 1.00 50.74  ? 2186 HOH B O   1 
HETATM 9063 O  O   . HOH Q 9 .   ? 19.915  23.681  -42.437 1.00 56.36  ? 2187 HOH B O   1 
HETATM 9064 O  O   . HOH Q 9 .   ? 7.879   27.901  -39.594 1.00 48.64  ? 2188 HOH B O   1 
HETATM 9065 O  O   . HOH Q 9 .   ? 6.442   4.571   -25.165 1.00 26.27  ? 2189 HOH B O   1 
HETATM 9066 O  O   . HOH Q 9 .   ? -3.343  0.418   -22.500 1.00 31.41  ? 2190 HOH B O   1 
HETATM 9067 O  O   . HOH Q 9 .   ? 5.351   -1.634  -29.159 1.00 38.51  ? 2191 HOH B O   1 
HETATM 9068 O  O   . HOH Q 9 .   ? 1.542   -0.705  -19.620 1.00 54.84  ? 2192 HOH B O   1 
HETATM 9069 O  O   . HOH Q 9 .   ? 7.687   0.902   -24.352 1.00 38.47  ? 2193 HOH B O   1 
HETATM 9070 O  O   . HOH Q 9 .   ? 14.293  -9.639  -33.400 0.50 29.02  ? 2194 HOH B O   1 
HETATM 9071 O  O   . HOH Q 9 .   ? 5.108   -8.664  -37.151 1.00 47.43  ? 2195 HOH B O   1 
HETATM 9072 O  O   . HOH Q 9 .   ? 11.490  -13.690 -27.319 1.00 48.59  ? 2196 HOH B O   1 
HETATM 9073 O  O   . HOH Q 9 .   ? 15.225  -12.466 -20.889 1.00 41.64  ? 2197 HOH B O   1 
HETATM 9074 O  O   . HOH Q 9 .   ? 10.895  -17.089 -24.302 1.00 60.06  ? 2198 HOH B O   1 
HETATM 9075 O  O   . HOH Q 9 .   ? 4.828   -19.563 -24.886 1.00 59.71  ? 2199 HOH B O   1 
HETATM 9076 O  O   . HOH Q 9 .   ? -2.305  -12.336 -28.892 1.00 53.02  ? 2200 HOH B O   1 
HETATM 9077 O  O   . HOH Q 9 .   ? -0.187  -18.116 -30.453 1.00 53.64  ? 2201 HOH B O   1 
HETATM 9078 O  O   . HOH Q 9 .   ? 6.716   -17.810 -21.839 1.00 54.12  ? 2202 HOH B O   1 
HETATM 9079 O  O   . HOH Q 9 .   ? 2.859   -15.042 -17.435 1.00 38.13  ? 2203 HOH B O   1 
HETATM 9080 O  O   . HOH Q 9 .   ? 7.010   -14.869 -12.606 1.00 48.80  ? 2204 HOH B O   1 
HETATM 9081 O  O   . HOH Q 9 .   ? 14.285  -16.582 -14.460 1.00 56.42  ? 2205 HOH B O   1 
HETATM 9082 O  O   . HOH Q 9 .   ? 20.662  -5.309  -10.367 1.00 45.16  ? 2206 HOH B O   1 
HETATM 9083 O  O   . HOH Q 9 .   ? 18.016  -6.811  -5.904  1.00 45.31  ? 2207 HOH B O   1 
HETATM 9084 O  O   . HOH Q 9 .   ? 19.523  -14.612 -16.977 1.00 51.21  ? 2208 HOH B O   1 
HETATM 9085 O  O   . HOH Q 9 .   ? 20.617  -12.083 -16.740 1.00 46.41  ? 2209 HOH B O   1 
HETATM 9086 O  O   . HOH Q 9 .   ? 24.393  -5.296  -23.990 1.00 46.90  ? 2210 HOH B O   1 
HETATM 9087 O  O   . HOH Q 9 .   ? 24.805  -9.174  -18.591 1.00 48.03  ? 2211 HOH B O   1 
HETATM 9088 O  O   . HOH Q 9 .   ? 16.431  -2.351  -28.792 1.00 40.12  ? 2212 HOH B O   1 
HETATM 9089 O  O   . HOH Q 9 .   ? 31.330  -4.822  -21.479 1.00 54.16  ? 2213 HOH B O   1 
HETATM 9090 O  O   . HOH Q 9 .   ? 9.979   -7.033  -5.160  1.00 42.22  ? 2214 HOH B O   1 
HETATM 9091 O  O   . HOH Q 9 .   ? 9.206   -12.753 -6.911  1.00 51.39  ? 2215 HOH B O   1 
HETATM 9092 O  O   . HOH Q 9 .   ? 11.459  -3.402  -10.637 1.00 52.02  ? 2216 HOH B O   1 
HETATM 9093 O  O   . HOH Q 9 .   ? 6.155   -0.090  -19.832 1.00 39.31  ? 2217 HOH B O   1 
HETATM 9094 O  O   . HOH Q 9 .   ? 4.760   -1.370  -22.100 1.00 42.51  ? 2218 HOH B O   1 
HETATM 9095 O  O   . HOH Q 9 .   ? 8.705   3.788   -24.251 1.00 41.38  ? 2219 HOH B O   1 
HETATM 9096 O  O   . HOH Q 9 .   ? 18.758  6.709   -27.032 1.00 36.43  ? 2220 HOH B O   1 
HETATM 9097 O  O   . HOH Q 9 .   ? 13.225  6.793   -33.418 1.00 35.92  ? 2221 HOH B O   1 
HETATM 9098 O  O   . HOH Q 9 .   ? 19.243  10.270  -30.369 1.00 30.63  ? 2222 HOH B O   1 
HETATM 9099 O  O   . HOH Q 9 .   ? 22.496  11.872  -27.890 1.00 51.17  ? 2223 HOH B O   1 
HETATM 9100 O  O   . HOH Q 9 .   ? 20.002  16.512  -25.827 1.00 52.99  ? 2224 HOH B O   1 
HETATM 9101 O  O   . HOH Q 9 .   ? 17.886  18.424  -27.418 1.00 51.40  ? 2225 HOH B O   1 
HETATM 9102 O  O   . HOH Q 9 .   ? 7.072   28.453  -32.362 1.00 47.84  ? 2226 HOH B O   1 
HETATM 9103 O  O   . HOH Q 9 .   ? 8.273   29.153  -34.765 1.00 54.97  ? 2227 HOH B O   1 
HETATM 9104 O  O   . HOH Q 9 .   ? 3.358   7.849   -33.301 1.00 30.03  ? 2228 HOH B O   1 
HETATM 9105 O  O   . HOH Q 9 .   ? 1.307   7.520   -21.016 1.00 51.70  ? 2229 HOH B O   1 
HETATM 9106 O  O   . HOH Q 9 .   ? -7.783  -3.434  -26.770 1.00 51.62  ? 2230 HOH B O   1 
HETATM 9107 O  O   . HOH Q 9 .   ? -4.308  1.463   -30.455 1.00 41.71  ? 2231 HOH B O   1 
HETATM 9108 O  O   . HOH Q 9 .   ? -7.040  -3.073  -34.230 1.00 48.57  ? 2232 HOH B O   1 
HETATM 9109 O  O   . HOH Q 9 .   ? -4.607  -6.257  -34.165 1.00 46.92  ? 2233 HOH B O   1 
HETATM 9110 O  O   . HOH Q 9 .   ? -4.750  -10.072 -22.778 1.00 46.98  ? 2234 HOH B O   1 
HETATM 9111 O  O   . HOH Q 9 .   ? -2.015  -9.501  -20.825 1.00 42.91  ? 2235 HOH B O   1 
HETATM 9112 O  O   . HOH Q 9 .   ? 4.152   -3.595  -20.861 1.00 44.96  ? 2236 HOH B O   1 
HETATM 9113 O  O   . HOH Q 9 .   ? -2.845  1.051   -36.974 1.00 36.23  ? 2237 HOH B O   1 
HETATM 9114 O  O   . HOH Q 9 .   ? -7.693  7.653   -45.276 1.00 40.56  ? 2238 HOH B O   1 
HETATM 9115 O  O   . HOH Q 9 .   ? -15.336 1.075   -37.423 1.00 57.39  ? 2239 HOH B O   1 
HETATM 9116 O  O   . HOH Q 9 .   ? -12.403 1.428   -26.438 1.00 58.50  ? 2240 HOH B O   1 
HETATM 9117 O  O   . HOH Q 9 .   ? -1.494  24.836  -47.685 1.00 41.48  ? 2241 HOH B O   1 
HETATM 9118 O  O   . HOH Q 9 .   ? -8.077  20.103  -47.960 1.00 44.09  ? 2242 HOH B O   1 
HETATM 9119 O  O   . HOH Q 9 .   ? -10.271 21.674  -46.867 1.00 47.97  ? 2243 HOH B O   1 
HETATM 9120 O  O   . HOH Q 9 .   ? -2.972  28.410  -46.035 1.00 53.27  ? 2244 HOH B O   1 
HETATM 9121 O  O   . HOH Q 9 .   ? 2.831   28.389  -43.435 1.00 43.09  ? 2245 HOH B O   1 
HETATM 9122 O  O   . HOH Q 9 .   ? -7.655  22.502  -32.312 1.00 50.59  ? 2246 HOH B O   1 
HETATM 9123 O  O   . HOH Q 9 .   ? -15.846 25.827  -26.937 1.00 48.04  ? 2247 HOH B O   1 
HETATM 9124 O  O   . HOH Q 9 .   ? -9.644  25.881  -24.076 1.00 69.88  ? 2248 HOH B O   1 
HETATM 9125 O  O   . HOH Q 9 .   ? -3.754  27.603  -31.124 1.00 31.36  ? 2249 HOH B O   1 
HETATM 9126 O  O   . HOH Q 9 .   ? -1.840  26.792  -29.874 1.00 25.89  ? 2250 HOH B O   1 
HETATM 9127 O  O   . HOH Q 9 .   ? 3.463   20.300  -28.688 1.00 25.65  ? 2251 HOH B O   1 
HETATM 9128 O  O   . HOH Q 9 .   ? 8.105   24.954  -31.892 1.00 34.95  ? 2252 HOH B O   1 
HETATM 9129 O  O   . HOH Q 9 .   ? 6.222   24.264  -25.114 1.00 27.92  ? 2253 HOH B O   1 
HETATM 9130 O  O   . HOH Q 9 .   ? 12.414  26.606  -28.435 1.00 32.53  ? 2254 HOH B O   1 
HETATM 9131 O  O   . HOH Q 9 .   ? 12.179  27.800  -25.801 1.00 42.66  ? 2255 HOH B O   1 
HETATM 9132 O  O   . HOH Q 9 .   ? 10.786  17.027  -23.203 1.00 34.70  ? 2256 HOH B O   1 
HETATM 9133 O  O   . HOH Q 9 .   ? 14.808  18.388  -21.374 1.00 46.28  ? 2257 HOH B O   1 
HETATM 9134 O  O   . HOH Q 9 .   ? 1.385   23.458  -19.752 1.00 44.98  ? 2258 HOH B O   1 
HETATM 9135 O  O   . HOH Q 9 .   ? -8.822  7.179   -24.072 1.00 53.48  ? 2259 HOH B O   1 
HETATM 9136 O  O   . HOH Q 9 .   ? -6.944  13.782  -26.715 1.00 32.91  ? 2260 HOH B O   1 
HETATM 9137 O  O   . HOH Q 9 .   ? -6.348  13.767  -23.654 1.00 41.74  ? 2261 HOH B O   1 
HETATM 9138 O  O   . HOH Q 9 .   ? -8.509  15.513  -20.885 1.00 51.91  ? 2262 HOH B O   1 
HETATM 9139 O  O   . HOH Q 9 .   ? -9.772  18.278  -27.588 1.00 48.21  ? 2263 HOH B O   1 
HETATM 9140 O  O   . HOH Q 9 .   ? -5.607  12.837  -20.961 1.00 45.88  ? 2264 HOH B O   1 
HETATM 9141 O  O   . HOH Q 9 .   ? -4.307  21.260  -20.739 1.00 42.32  ? 2265 HOH B O   1 
HETATM 9142 O  O   . HOH Q 9 .   ? 2.580   11.776  -20.653 1.00 37.22  ? 2266 HOH B O   1 
HETATM 9143 O  O   . HOH Q 9 .   ? 2.855   17.290  -16.945 1.00 45.09  ? 2267 HOH B O   1 
HETATM 9144 O  O   . HOH Q 9 .   ? 9.411   23.625  -18.772 1.00 45.82  ? 2268 HOH B O   1 
HETATM 9145 O  O   . HOH Q 9 .   ? 8.436   14.215  -18.004 1.00 43.72  ? 2269 HOH B O   1 
HETATM 9146 O  O   . HOH Q 9 .   ? 5.126   14.818  -18.787 1.00 39.64  ? 2270 HOH B O   1 
HETATM 9147 O  O   . HOH Q 9 .   ? 12.557  15.049  -22.743 1.00 30.08  ? 2271 HOH B O   1 
HETATM 9148 O  O   . HOH Q 9 .   ? 4.173   9.052   -20.467 1.00 51.02  ? 2272 HOH B O   1 
HETATM 9149 O  O   . HOH Q 9 .   ? 6.569   11.929  -19.615 1.00 53.18  ? 2273 HOH B O   1 
HETATM 9150 O  O   . HOH Q 9 .   ? 15.218  15.595  -21.133 1.00 34.62  ? 2274 HOH B O   1 
HETATM 9151 O  O   . HOH Q 9 .   ? 12.496  16.706  -14.307 1.00 43.62  ? 2275 HOH B O   1 
HETATM 9152 O  O   . HOH Q 9 .   ? 11.202  10.956  -16.982 0.50 16.05  ? 2276 HOH B O   1 
HETATM 9153 O  O   . HOH Q 9 .   ? 18.291  9.139   -28.047 1.00 40.40  ? 2277 HOH B O   1 
HETATM 9154 O  O   . HOH Q 9 .   ? 17.260  15.677  -25.137 1.00 28.29  ? 2278 HOH B O   1 
HETATM 9155 O  O   . HOH Q 9 .   ? 24.286  17.901  -20.551 1.00 42.67  ? 2279 HOH B O   1 
HETATM 9156 O  O   . HOH Q 9 .   ? 17.780  15.423  -22.198 1.00 47.62  ? 2280 HOH B O   1 
HETATM 9157 O  O   . HOH Q 9 .   ? 20.202  8.030   -12.875 1.00 53.14  ? 2281 HOH B O   1 
HETATM 9158 O  O   . HOH Q 9 .   ? 9.697   9.751   -11.074 1.00 61.24  ? 2282 HOH B O   1 
HETATM 9159 O  O   . HOH Q 9 .   ? 14.735  -13.549 -33.658 1.00 58.84  ? 2283 HOH B O   1 
HETATM 9160 O  O   . HOH Q 9 .   ? 19.177  -10.452 -33.401 1.00 50.23  ? 2284 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
A 1 544 ALA 544 544 ?   ?   ?   A . n 
A 1 545 THR 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 ALA 547 547 ?   ?   ?   A . n 
A 1 548 PRO 548 548 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
B 1 544 ALA 544 544 544 ALA ALA B . n 
B 1 545 THR 545 545 ?   ?   ?   B . n 
B 1 546 GLU 546 546 ?   ?   ?   B . n 
B 1 547 ALA 547 547 ?   ?   ?   B . n 
B 1 548 PRO 548 548 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 K27 1   1543 1543 K27 K27 A . 
D 3 NAG 1   1544 1544 NAG NAG A . 
E 3 NAG 1   1545 1545 NAG NAG A . 
F 4 BR  1   1546 1546 BR  BR  A . 
G 5 P4G 1   1547 1547 P4G P4G A . 
H 6 CO3 1   1548 1548 CO3 CO3 A . 
I 2 K27 1   1545 1545 K27 K27 B . 
J 4 BR  1   1546 1546 BR  BR  B . 
K 7 PEG 1   1547 1547 PEG PEG B . 
L 8 PE4 1   1548 1548 PE4 PE4 B . 
M 5 P4G 1   1549 1549 P4G P4G B . 
N 5 P4G 1   1550 1550 P4G P4G B . 
O 6 CO3 1   1551 1551 CO3 CO3 B . 
P 9 HOH 1   2001 2001 HOH HOH A . 
P 9 HOH 2   2002 2002 HOH HOH A . 
P 9 HOH 3   2003 2003 HOH HOH A . 
P 9 HOH 4   2004 2004 HOH HOH A . 
P 9 HOH 5   2005 2005 HOH HOH A . 
P 9 HOH 6   2006 2006 HOH HOH A . 
P 9 HOH 7   2007 2007 HOH HOH A . 
P 9 HOH 8   2008 2008 HOH HOH A . 
P 9 HOH 9   2009 2009 HOH HOH A . 
P 9 HOH 10  2010 2010 HOH HOH A . 
P 9 HOH 11  2011 2011 HOH HOH A . 
P 9 HOH 12  2012 2012 HOH HOH A . 
P 9 HOH 13  2013 2013 HOH HOH A . 
P 9 HOH 14  2014 2014 HOH HOH A . 
P 9 HOH 15  2015 2015 HOH HOH A . 
P 9 HOH 16  2016 2016 HOH HOH A . 
P 9 HOH 17  2017 2017 HOH HOH A . 
P 9 HOH 18  2018 2018 HOH HOH A . 
P 9 HOH 19  2019 2019 HOH HOH A . 
P 9 HOH 20  2020 2020 HOH HOH A . 
P 9 HOH 21  2021 2021 HOH HOH A . 
P 9 HOH 22  2022 2022 HOH HOH A . 
P 9 HOH 23  2023 2023 HOH HOH A . 
P 9 HOH 24  2024 2024 HOH HOH A . 
P 9 HOH 25  2025 2025 HOH HOH A . 
P 9 HOH 26  2026 2026 HOH HOH A . 
P 9 HOH 27  2027 2027 HOH HOH A . 
P 9 HOH 28  2028 2028 HOH HOH A . 
P 9 HOH 29  2029 2029 HOH HOH A . 
P 9 HOH 30  2030 2030 HOH HOH A . 
P 9 HOH 31  2031 2031 HOH HOH A . 
P 9 HOH 32  2032 2032 HOH HOH A . 
P 9 HOH 33  2033 2033 HOH HOH A . 
P 9 HOH 34  2034 2034 HOH HOH A . 
P 9 HOH 35  2035 2035 HOH HOH A . 
P 9 HOH 36  2036 2036 HOH HOH A . 
P 9 HOH 37  2037 2037 HOH HOH A . 
P 9 HOH 38  2038 2038 HOH HOH A . 
P 9 HOH 39  2039 2039 HOH HOH A . 
P 9 HOH 40  2040 2040 HOH HOH A . 
P 9 HOH 41  2041 2041 HOH HOH A . 
P 9 HOH 42  2042 2042 HOH HOH A . 
P 9 HOH 43  2043 2043 HOH HOH A . 
P 9 HOH 44  2044 2044 HOH HOH A . 
P 9 HOH 45  2045 2045 HOH HOH A . 
P 9 HOH 46  2046 2046 HOH HOH A . 
P 9 HOH 47  2047 2047 HOH HOH A . 
P 9 HOH 48  2048 2048 HOH HOH A . 
P 9 HOH 49  2049 2049 HOH HOH A . 
P 9 HOH 50  2050 2050 HOH HOH A . 
P 9 HOH 51  2051 2051 HOH HOH A . 
P 9 HOH 52  2052 2052 HOH HOH A . 
P 9 HOH 53  2053 2053 HOH HOH A . 
P 9 HOH 54  2054 2054 HOH HOH A . 
P 9 HOH 55  2055 2055 HOH HOH A . 
P 9 HOH 56  2056 2056 HOH HOH A . 
P 9 HOH 57  2057 2057 HOH HOH A . 
P 9 HOH 58  2058 2058 HOH HOH A . 
P 9 HOH 59  2059 2059 HOH HOH A . 
P 9 HOH 60  2060 2060 HOH HOH A . 
P 9 HOH 61  2061 2061 HOH HOH A . 
P 9 HOH 62  2062 2062 HOH HOH A . 
P 9 HOH 63  2063 2063 HOH HOH A . 
P 9 HOH 64  2064 2064 HOH HOH A . 
P 9 HOH 65  2065 2065 HOH HOH A . 
P 9 HOH 66  2066 2066 HOH HOH A . 
P 9 HOH 67  2067 2067 HOH HOH A . 
P 9 HOH 68  2068 2068 HOH HOH A . 
P 9 HOH 69  2069 2069 HOH HOH A . 
P 9 HOH 70  2070 2070 HOH HOH A . 
P 9 HOH 71  2071 2071 HOH HOH A . 
P 9 HOH 72  2072 2072 HOH HOH A . 
P 9 HOH 73  2073 2073 HOH HOH A . 
P 9 HOH 74  2074 2074 HOH HOH A . 
P 9 HOH 75  2075 2075 HOH HOH A . 
P 9 HOH 76  2076 2076 HOH HOH A . 
P 9 HOH 77  2077 2077 HOH HOH A . 
P 9 HOH 78  2078 2078 HOH HOH A . 
P 9 HOH 79  2079 2079 HOH HOH A . 
P 9 HOH 80  2080 2080 HOH HOH A . 
P 9 HOH 81  2081 2081 HOH HOH A . 
P 9 HOH 82  2082 2082 HOH HOH A . 
P 9 HOH 83  2083 2083 HOH HOH A . 
P 9 HOH 84  2084 2084 HOH HOH A . 
P 9 HOH 85  2085 2085 HOH HOH A . 
P 9 HOH 86  2086 2086 HOH HOH A . 
P 9 HOH 87  2087 2087 HOH HOH A . 
P 9 HOH 88  2088 2088 HOH HOH A . 
P 9 HOH 89  2089 2089 HOH HOH A . 
P 9 HOH 90  2090 2090 HOH HOH A . 
P 9 HOH 91  2091 2091 HOH HOH A . 
P 9 HOH 92  2092 2092 HOH HOH A . 
P 9 HOH 93  2093 2093 HOH HOH A . 
P 9 HOH 94  2094 2094 HOH HOH A . 
P 9 HOH 95  2095 2095 HOH HOH A . 
P 9 HOH 96  2096 2096 HOH HOH A . 
P 9 HOH 97  2097 2097 HOH HOH A . 
P 9 HOH 98  2098 2098 HOH HOH A . 
P 9 HOH 99  2099 2099 HOH HOH A . 
P 9 HOH 100 2100 2100 HOH HOH A . 
P 9 HOH 101 2101 2101 HOH HOH A . 
P 9 HOH 102 2102 2102 HOH HOH A . 
P 9 HOH 103 2103 2103 HOH HOH A . 
P 9 HOH 104 2104 2104 HOH HOH A . 
P 9 HOH 105 2105 2105 HOH HOH A . 
P 9 HOH 106 2106 2106 HOH HOH A . 
P 9 HOH 107 2107 2107 HOH HOH A . 
P 9 HOH 108 2108 2108 HOH HOH A . 
P 9 HOH 109 2109 2109 HOH HOH A . 
P 9 HOH 110 2110 2110 HOH HOH A . 
P 9 HOH 111 2111 2111 HOH HOH A . 
P 9 HOH 112 2112 2112 HOH HOH A . 
P 9 HOH 113 2113 2113 HOH HOH A . 
P 9 HOH 114 2114 2114 HOH HOH A . 
P 9 HOH 115 2115 2115 HOH HOH A . 
P 9 HOH 116 2116 2116 HOH HOH A . 
P 9 HOH 117 2117 2117 HOH HOH A . 
P 9 HOH 118 2118 2118 HOH HOH A . 
P 9 HOH 119 2119 2119 HOH HOH A . 
P 9 HOH 120 2120 2120 HOH HOH A . 
P 9 HOH 121 2121 2121 HOH HOH A . 
P 9 HOH 122 2122 2122 HOH HOH A . 
P 9 HOH 123 2123 2123 HOH HOH A . 
P 9 HOH 124 2124 2124 HOH HOH A . 
P 9 HOH 125 2125 2125 HOH HOH A . 
P 9 HOH 126 2126 2126 HOH HOH A . 
P 9 HOH 127 2127 2127 HOH HOH A . 
P 9 HOH 128 2128 2128 HOH HOH A . 
P 9 HOH 129 2129 2129 HOH HOH A . 
P 9 HOH 130 2130 2130 HOH HOH A . 
P 9 HOH 131 2131 2131 HOH HOH A . 
P 9 HOH 132 2132 2132 HOH HOH A . 
P 9 HOH 133 2133 2133 HOH HOH A . 
P 9 HOH 134 2134 2134 HOH HOH A . 
P 9 HOH 135 2135 2135 HOH HOH A . 
P 9 HOH 136 2136 2136 HOH HOH A . 
P 9 HOH 137 2137 2137 HOH HOH A . 
P 9 HOH 138 2138 2138 HOH HOH A . 
P 9 HOH 139 2139 2139 HOH HOH A . 
P 9 HOH 140 2140 2140 HOH HOH A . 
P 9 HOH 141 2141 2141 HOH HOH A . 
P 9 HOH 142 2142 2142 HOH HOH A . 
P 9 HOH 143 2143 2143 HOH HOH A . 
P 9 HOH 144 2144 2144 HOH HOH A . 
P 9 HOH 145 2145 2145 HOH HOH A . 
P 9 HOH 146 2146 2146 HOH HOH A . 
P 9 HOH 147 2147 2147 HOH HOH A . 
P 9 HOH 148 2148 2148 HOH HOH A . 
P 9 HOH 149 2149 2149 HOH HOH A . 
P 9 HOH 150 2150 2150 HOH HOH A . 
P 9 HOH 151 2151 2151 HOH HOH A . 
P 9 HOH 152 2152 2152 HOH HOH A . 
P 9 HOH 153 2153 2153 HOH HOH A . 
P 9 HOH 154 2154 2154 HOH HOH A . 
P 9 HOH 155 2155 2155 HOH HOH A . 
P 9 HOH 156 2156 2156 HOH HOH A . 
P 9 HOH 157 2157 2157 HOH HOH A . 
P 9 HOH 158 2158 2158 HOH HOH A . 
P 9 HOH 159 2159 2159 HOH HOH A . 
P 9 HOH 160 2160 2160 HOH HOH A . 
P 9 HOH 161 2161 2161 HOH HOH A . 
P 9 HOH 162 2162 2162 HOH HOH A . 
P 9 HOH 163 2163 2163 HOH HOH A . 
P 9 HOH 164 2164 2164 HOH HOH A . 
P 9 HOH 165 2165 2165 HOH HOH A . 
P 9 HOH 166 2166 2166 HOH HOH A . 
P 9 HOH 167 2167 2167 HOH HOH A . 
P 9 HOH 168 2168 2168 HOH HOH A . 
P 9 HOH 169 2169 2169 HOH HOH A . 
P 9 HOH 170 2170 2170 HOH HOH A . 
P 9 HOH 171 2171 2171 HOH HOH A . 
P 9 HOH 172 2172 2172 HOH HOH A . 
P 9 HOH 173 2173 2173 HOH HOH A . 
P 9 HOH 174 2174 2174 HOH HOH A . 
P 9 HOH 175 2175 2175 HOH HOH A . 
P 9 HOH 176 2176 2176 HOH HOH A . 
P 9 HOH 177 2177 2177 HOH HOH A . 
P 9 HOH 178 2178 2178 HOH HOH A . 
P 9 HOH 179 2179 2179 HOH HOH A . 
P 9 HOH 180 2180 2180 HOH HOH A . 
P 9 HOH 181 2181 2181 HOH HOH A . 
P 9 HOH 182 2182 2182 HOH HOH A . 
P 9 HOH 183 2183 2183 HOH HOH A . 
P 9 HOH 184 2184 2184 HOH HOH A . 
P 9 HOH 185 2185 2185 HOH HOH A . 
P 9 HOH 186 2186 2186 HOH HOH A . 
P 9 HOH 187 2187 2187 HOH HOH A . 
P 9 HOH 188 2188 2188 HOH HOH A . 
P 9 HOH 189 2189 2189 HOH HOH A . 
P 9 HOH 190 2190 2190 HOH HOH A . 
P 9 HOH 191 2191 2191 HOH HOH A . 
P 9 HOH 192 2192 2192 HOH HOH A . 
P 9 HOH 193 2193 2193 HOH HOH A . 
P 9 HOH 194 2194 2194 HOH HOH A . 
P 9 HOH 195 2195 2195 HOH HOH A . 
P 9 HOH 196 2196 2196 HOH HOH A . 
P 9 HOH 197 2197 2197 HOH HOH A . 
P 9 HOH 198 2198 2198 HOH HOH A . 
P 9 HOH 199 2199 2199 HOH HOH A . 
P 9 HOH 200 2200 2200 HOH HOH A . 
P 9 HOH 201 2201 2201 HOH HOH A . 
P 9 HOH 202 2202 2202 HOH HOH A . 
P 9 HOH 203 2203 2203 HOH HOH A . 
P 9 HOH 204 2204 2204 HOH HOH A . 
P 9 HOH 205 2205 2205 HOH HOH A . 
P 9 HOH 206 2206 2206 HOH HOH A . 
P 9 HOH 207 2207 2207 HOH HOH A . 
P 9 HOH 208 2208 2208 HOH HOH A . 
P 9 HOH 209 2209 2209 HOH HOH A . 
P 9 HOH 210 2210 2210 HOH HOH A . 
P 9 HOH 211 2211 2211 HOH HOH A . 
P 9 HOH 212 2212 2212 HOH HOH A . 
P 9 HOH 213 2213 2213 HOH HOH A . 
P 9 HOH 214 2214 2214 HOH HOH A . 
P 9 HOH 215 2215 2215 HOH HOH A . 
P 9 HOH 216 2216 2216 HOH HOH A . 
P 9 HOH 217 2217 2217 HOH HOH A . 
P 9 HOH 218 2218 2218 HOH HOH A . 
P 9 HOH 219 2219 2219 HOH HOH A . 
P 9 HOH 220 2220 2220 HOH HOH A . 
P 9 HOH 221 2221 2221 HOH HOH A . 
P 9 HOH 222 2222 2222 HOH HOH A . 
P 9 HOH 223 2223 2223 HOH HOH A . 
P 9 HOH 224 2224 2224 HOH HOH A . 
P 9 HOH 225 2225 2225 HOH HOH A . 
P 9 HOH 226 2226 2226 HOH HOH A . 
P 9 HOH 227 2227 2227 HOH HOH A . 
P 9 HOH 228 2228 2228 HOH HOH A . 
P 9 HOH 229 2229 2229 HOH HOH A . 
P 9 HOH 230 2230 2230 HOH HOH A . 
P 9 HOH 231 2231 2231 HOH HOH A . 
P 9 HOH 232 2232 2232 HOH HOH A . 
P 9 HOH 233 2233 2233 HOH HOH A . 
P 9 HOH 234 2234 2234 HOH HOH A . 
P 9 HOH 235 2235 2235 HOH HOH A . 
P 9 HOH 236 2236 2236 HOH HOH A . 
P 9 HOH 237 2237 2237 HOH HOH A . 
P 9 HOH 238 2238 2238 HOH HOH A . 
P 9 HOH 239 2239 2239 HOH HOH A . 
P 9 HOH 240 2240 2240 HOH HOH A . 
P 9 HOH 241 2241 2241 HOH HOH A . 
P 9 HOH 242 2242 2242 HOH HOH A . 
P 9 HOH 243 2243 2243 HOH HOH A . 
P 9 HOH 244 2244 2244 HOH HOH A . 
P 9 HOH 245 2245 2245 HOH HOH A . 
P 9 HOH 246 2246 2246 HOH HOH A . 
P 9 HOH 247 2247 2247 HOH HOH A . 
P 9 HOH 248 2248 2248 HOH HOH A . 
P 9 HOH 249 2249 2249 HOH HOH A . 
P 9 HOH 250 2250 2250 HOH HOH A . 
P 9 HOH 251 2251 2251 HOH HOH A . 
P 9 HOH 252 2252 2252 HOH HOH A . 
P 9 HOH 253 2253 2253 HOH HOH A . 
P 9 HOH 254 2254 2254 HOH HOH A . 
P 9 HOH 255 2255 2255 HOH HOH A . 
P 9 HOH 256 2256 2256 HOH HOH A . 
P 9 HOH 257 2257 2257 HOH HOH A . 
P 9 HOH 258 2258 2258 HOH HOH A . 
P 9 HOH 259 2259 2259 HOH HOH A . 
P 9 HOH 260 2260 2260 HOH HOH A . 
P 9 HOH 261 2261 2261 HOH HOH A . 
P 9 HOH 262 2262 2262 HOH HOH A . 
P 9 HOH 263 2263 2263 HOH HOH A . 
P 9 HOH 264 2264 2264 HOH HOH A . 
P 9 HOH 265 2265 2265 HOH HOH A . 
P 9 HOH 266 2266 2266 HOH HOH A . 
P 9 HOH 267 2267 2267 HOH HOH A . 
P 9 HOH 268 2268 2268 HOH HOH A . 
P 9 HOH 269 2269 2269 HOH HOH A . 
P 9 HOH 270 2270 2270 HOH HOH A . 
P 9 HOH 271 2271 2271 HOH HOH A . 
P 9 HOH 272 2272 2272 HOH HOH A . 
P 9 HOH 273 2273 2273 HOH HOH A . 
P 9 HOH 274 2274 2274 HOH HOH A . 
P 9 HOH 275 2275 2275 HOH HOH A . 
P 9 HOH 276 2276 2276 HOH HOH A . 
P 9 HOH 277 2277 2277 HOH HOH A . 
P 9 HOH 278 2278 2278 HOH HOH A . 
P 9 HOH 279 2279 2279 HOH HOH A . 
P 9 HOH 280 2280 2280 HOH HOH A . 
P 9 HOH 281 2281 2281 HOH HOH A . 
P 9 HOH 282 2282 2282 HOH HOH A . 
P 9 HOH 283 2283 2283 HOH HOH A . 
P 9 HOH 284 2284 2284 HOH HOH A . 
P 9 HOH 285 2285 2285 HOH HOH A . 
P 9 HOH 286 2286 2286 HOH HOH A . 
P 9 HOH 287 2287 2287 HOH HOH A . 
P 9 HOH 288 2288 2288 HOH HOH A . 
P 9 HOH 289 2289 2289 HOH HOH A . 
P 9 HOH 290 2290 2290 HOH HOH A . 
P 9 HOH 291 2291 2291 HOH HOH A . 
P 9 HOH 292 2292 2292 HOH HOH A . 
P 9 HOH 293 2293 2293 HOH HOH A . 
P 9 HOH 294 2294 2294 HOH HOH A . 
P 9 HOH 295 2295 2295 HOH HOH A . 
P 9 HOH 296 2296 2296 HOH HOH A . 
P 9 HOH 297 2297 2297 HOH HOH A . 
P 9 HOH 298 2298 2298 HOH HOH A . 
P 9 HOH 299 2299 2299 HOH HOH A . 
P 9 HOH 300 2300 2300 HOH HOH A . 
P 9 HOH 301 2301 2301 HOH HOH A . 
P 9 HOH 302 2302 2302 HOH HOH A . 
P 9 HOH 303 2303 2303 HOH HOH A . 
P 9 HOH 304 2304 2304 HOH HOH A . 
P 9 HOH 305 2305 2305 HOH HOH A . 
P 9 HOH 306 2306 2306 HOH HOH A . 
P 9 HOH 307 2307 2307 HOH HOH A . 
P 9 HOH 308 2308 2308 HOH HOH A . 
P 9 HOH 309 2309 2309 HOH HOH A . 
P 9 HOH 310 2310 2310 HOH HOH A . 
P 9 HOH 311 2311 2311 HOH HOH A . 
P 9 HOH 312 2312 2312 HOH HOH A . 
P 9 HOH 313 2313 2313 HOH HOH A . 
P 9 HOH 314 2314 2314 HOH HOH A . 
P 9 HOH 315 2315 2315 HOH HOH A . 
P 9 HOH 316 2316 2316 HOH HOH A . 
P 9 HOH 317 2317 2317 HOH HOH A . 
P 9 HOH 318 2318 2318 HOH HOH A . 
P 9 HOH 319 2319 2319 HOH HOH A . 
P 9 HOH 320 2320 2320 HOH HOH A . 
P 9 HOH 321 2321 2321 HOH HOH A . 
P 9 HOH 322 2322 2322 HOH HOH A . 
P 9 HOH 323 2323 2323 HOH HOH A . 
P 9 HOH 324 2324 2324 HOH HOH A . 
P 9 HOH 325 2325 2325 HOH HOH A . 
P 9 HOH 326 2326 2326 HOH HOH A . 
P 9 HOH 327 2327 2327 HOH HOH A . 
P 9 HOH 328 2328 2328 HOH HOH A . 
P 9 HOH 329 2329 2329 HOH HOH A . 
P 9 HOH 330 2330 2330 HOH HOH A . 
P 9 HOH 331 2331 2331 HOH HOH A . 
P 9 HOH 332 2332 2332 HOH HOH A . 
P 9 HOH 333 2333 2333 HOH HOH A . 
P 9 HOH 334 2334 2334 HOH HOH A . 
P 9 HOH 335 2335 2335 HOH HOH A . 
P 9 HOH 336 2336 2336 HOH HOH A . 
P 9 HOH 337 2337 2337 HOH HOH A . 
P 9 HOH 338 2338 2338 HOH HOH A . 
P 9 HOH 339 2339 2339 HOH HOH A . 
P 9 HOH 340 2340 2340 HOH HOH A . 
P 9 HOH 341 2341 2341 HOH HOH A . 
P 9 HOH 342 2342 2342 HOH HOH A . 
P 9 HOH 343 2343 2343 HOH HOH A . 
P 9 HOH 344 2344 2344 HOH HOH A . 
P 9 HOH 345 2345 2345 HOH HOH A . 
P 9 HOH 346 2346 2346 HOH HOH A . 
P 9 HOH 347 2347 2347 HOH HOH A . 
P 9 HOH 348 2348 2348 HOH HOH A . 
P 9 HOH 349 2349 2349 HOH HOH A . 
P 9 HOH 350 2350 2350 HOH HOH A . 
P 9 HOH 351 2351 2351 HOH HOH A . 
P 9 HOH 352 2352 2352 HOH HOH A . 
P 9 HOH 353 2353 2353 HOH HOH A . 
P 9 HOH 354 2354 2354 HOH HOH A . 
P 9 HOH 355 2355 2355 HOH HOH A . 
P 9 HOH 356 2356 2356 HOH HOH A . 
P 9 HOH 357 2357 2357 HOH HOH A . 
P 9 HOH 358 2358 2358 HOH HOH A . 
P 9 HOH 359 2359 2359 HOH HOH A . 
P 9 HOH 360 2360 2360 HOH HOH A . 
P 9 HOH 361 2361 2361 HOH HOH A . 
P 9 HOH 362 2362 2362 HOH HOH A . 
P 9 HOH 363 2363 2363 HOH HOH A . 
P 9 HOH 364 2364 2364 HOH HOH A . 
P 9 HOH 365 2365 2365 HOH HOH A . 
P 9 HOH 366 2366 2366 HOH HOH A . 
P 9 HOH 367 2367 2367 HOH HOH A . 
P 9 HOH 368 2368 2368 HOH HOH A . 
P 9 HOH 369 2369 2369 HOH HOH A . 
P 9 HOH 370 2370 2370 HOH HOH A . 
P 9 HOH 371 2371 2371 HOH HOH A . 
P 9 HOH 372 2372 2372 HOH HOH A . 
P 9 HOH 373 2373 2373 HOH HOH A . 
P 9 HOH 374 2374 2374 HOH HOH A . 
P 9 HOH 375 2375 2375 HOH HOH A . 
P 9 HOH 376 2376 2376 HOH HOH A . 
Q 9 HOH 1   2001 2001 HOH HOH B . 
Q 9 HOH 2   2002 2002 HOH HOH B . 
Q 9 HOH 3   2003 2003 HOH HOH B . 
Q 9 HOH 4   2004 2004 HOH HOH B . 
Q 9 HOH 5   2005 2005 HOH HOH B . 
Q 9 HOH 6   2006 2006 HOH HOH B . 
Q 9 HOH 7   2007 2007 HOH HOH B . 
Q 9 HOH 8   2008 2008 HOH HOH B . 
Q 9 HOH 9   2009 2009 HOH HOH B . 
Q 9 HOH 10  2010 2010 HOH HOH B . 
Q 9 HOH 11  2011 2011 HOH HOH B . 
Q 9 HOH 12  2012 2012 HOH HOH B . 
Q 9 HOH 13  2013 2013 HOH HOH B . 
Q 9 HOH 14  2014 2014 HOH HOH B . 
Q 9 HOH 15  2015 2015 HOH HOH B . 
Q 9 HOH 16  2016 2016 HOH HOH B . 
Q 9 HOH 17  2017 2017 HOH HOH B . 
Q 9 HOH 18  2018 2018 HOH HOH B . 
Q 9 HOH 19  2019 2019 HOH HOH B . 
Q 9 HOH 20  2020 2020 HOH HOH B . 
Q 9 HOH 21  2021 2021 HOH HOH B . 
Q 9 HOH 22  2022 2022 HOH HOH B . 
Q 9 HOH 23  2023 2023 HOH HOH B . 
Q 9 HOH 24  2024 2024 HOH HOH B . 
Q 9 HOH 25  2025 2025 HOH HOH B . 
Q 9 HOH 26  2026 2026 HOH HOH B . 
Q 9 HOH 27  2027 2027 HOH HOH B . 
Q 9 HOH 28  2028 2028 HOH HOH B . 
Q 9 HOH 29  2029 2029 HOH HOH B . 
Q 9 HOH 30  2030 2030 HOH HOH B . 
Q 9 HOH 31  2031 2031 HOH HOH B . 
Q 9 HOH 32  2032 2032 HOH HOH B . 
Q 9 HOH 33  2033 2033 HOH HOH B . 
Q 9 HOH 34  2034 2034 HOH HOH B . 
Q 9 HOH 35  2035 2035 HOH HOH B . 
Q 9 HOH 36  2036 2036 HOH HOH B . 
Q 9 HOH 37  2037 2037 HOH HOH B . 
Q 9 HOH 38  2038 2038 HOH HOH B . 
Q 9 HOH 39  2039 2039 HOH HOH B . 
Q 9 HOH 40  2040 2040 HOH HOH B . 
Q 9 HOH 41  2041 2041 HOH HOH B . 
Q 9 HOH 42  2042 2042 HOH HOH B . 
Q 9 HOH 43  2043 2043 HOH HOH B . 
Q 9 HOH 44  2044 2044 HOH HOH B . 
Q 9 HOH 45  2045 2045 HOH HOH B . 
Q 9 HOH 46  2046 2046 HOH HOH B . 
Q 9 HOH 47  2047 2047 HOH HOH B . 
Q 9 HOH 48  2048 2048 HOH HOH B . 
Q 9 HOH 49  2049 2049 HOH HOH B . 
Q 9 HOH 50  2050 2050 HOH HOH B . 
Q 9 HOH 51  2051 2051 HOH HOH B . 
Q 9 HOH 52  2052 2052 HOH HOH B . 
Q 9 HOH 53  2053 2053 HOH HOH B . 
Q 9 HOH 54  2054 2054 HOH HOH B . 
Q 9 HOH 55  2055 2055 HOH HOH B . 
Q 9 HOH 56  2056 2056 HOH HOH B . 
Q 9 HOH 57  2057 2057 HOH HOH B . 
Q 9 HOH 58  2058 2058 HOH HOH B . 
Q 9 HOH 59  2059 2059 HOH HOH B . 
Q 9 HOH 60  2060 2060 HOH HOH B . 
Q 9 HOH 61  2061 2061 HOH HOH B . 
Q 9 HOH 62  2062 2062 HOH HOH B . 
Q 9 HOH 63  2063 2063 HOH HOH B . 
Q 9 HOH 64  2064 2064 HOH HOH B . 
Q 9 HOH 65  2065 2065 HOH HOH B . 
Q 9 HOH 66  2066 2066 HOH HOH B . 
Q 9 HOH 67  2067 2067 HOH HOH B . 
Q 9 HOH 68  2068 2068 HOH HOH B . 
Q 9 HOH 69  2069 2069 HOH HOH B . 
Q 9 HOH 70  2070 2070 HOH HOH B . 
Q 9 HOH 71  2071 2071 HOH HOH B . 
Q 9 HOH 72  2072 2072 HOH HOH B . 
Q 9 HOH 73  2073 2073 HOH HOH B . 
Q 9 HOH 74  2074 2074 HOH HOH B . 
Q 9 HOH 75  2075 2075 HOH HOH B . 
Q 9 HOH 76  2076 2076 HOH HOH B . 
Q 9 HOH 77  2077 2077 HOH HOH B . 
Q 9 HOH 78  2078 2078 HOH HOH B . 
Q 9 HOH 79  2079 2079 HOH HOH B . 
Q 9 HOH 80  2080 2080 HOH HOH B . 
Q 9 HOH 81  2081 2081 HOH HOH B . 
Q 9 HOH 82  2082 2082 HOH HOH B . 
Q 9 HOH 83  2083 2083 HOH HOH B . 
Q 9 HOH 84  2084 2084 HOH HOH B . 
Q 9 HOH 85  2085 2085 HOH HOH B . 
Q 9 HOH 86  2086 2086 HOH HOH B . 
Q 9 HOH 87  2087 2087 HOH HOH B . 
Q 9 HOH 88  2088 2088 HOH HOH B . 
Q 9 HOH 89  2089 2089 HOH HOH B . 
Q 9 HOH 90  2090 2090 HOH HOH B . 
Q 9 HOH 91  2091 2091 HOH HOH B . 
Q 9 HOH 92  2092 2092 HOH HOH B . 
Q 9 HOH 93  2093 2093 HOH HOH B . 
Q 9 HOH 94  2094 2094 HOH HOH B . 
Q 9 HOH 95  2095 2095 HOH HOH B . 
Q 9 HOH 96  2096 2096 HOH HOH B . 
Q 9 HOH 97  2097 2097 HOH HOH B . 
Q 9 HOH 98  2098 2098 HOH HOH B . 
Q 9 HOH 99  2099 2099 HOH HOH B . 
Q 9 HOH 100 2100 2100 HOH HOH B . 
Q 9 HOH 101 2101 2101 HOH HOH B . 
Q 9 HOH 102 2102 2102 HOH HOH B . 
Q 9 HOH 103 2103 2103 HOH HOH B . 
Q 9 HOH 104 2104 2104 HOH HOH B . 
Q 9 HOH 105 2105 2105 HOH HOH B . 
Q 9 HOH 106 2106 2106 HOH HOH B . 
Q 9 HOH 107 2107 2107 HOH HOH B . 
Q 9 HOH 108 2108 2108 HOH HOH B . 
Q 9 HOH 109 2109 2109 HOH HOH B . 
Q 9 HOH 110 2110 2110 HOH HOH B . 
Q 9 HOH 111 2111 2111 HOH HOH B . 
Q 9 HOH 112 2112 2112 HOH HOH B . 
Q 9 HOH 113 2113 2113 HOH HOH B . 
Q 9 HOH 114 2114 2114 HOH HOH B . 
Q 9 HOH 115 2115 2115 HOH HOH B . 
Q 9 HOH 116 2116 2116 HOH HOH B . 
Q 9 HOH 117 2117 2117 HOH HOH B . 
Q 9 HOH 118 2118 2118 HOH HOH B . 
Q 9 HOH 119 2119 2119 HOH HOH B . 
Q 9 HOH 120 2120 2120 HOH HOH B . 
Q 9 HOH 121 2121 2121 HOH HOH B . 
Q 9 HOH 122 2122 2122 HOH HOH B . 
Q 9 HOH 123 2123 2123 HOH HOH B . 
Q 9 HOH 124 2124 2124 HOH HOH B . 
Q 9 HOH 125 2125 2125 HOH HOH B . 
Q 9 HOH 126 2126 2126 HOH HOH B . 
Q 9 HOH 127 2127 2127 HOH HOH B . 
Q 9 HOH 128 2128 2128 HOH HOH B . 
Q 9 HOH 129 2129 2129 HOH HOH B . 
Q 9 HOH 130 2130 2130 HOH HOH B . 
Q 9 HOH 131 2131 2131 HOH HOH B . 
Q 9 HOH 132 2132 2132 HOH HOH B . 
Q 9 HOH 133 2133 2133 HOH HOH B . 
Q 9 HOH 134 2134 2134 HOH HOH B . 
Q 9 HOH 135 2135 2135 HOH HOH B . 
Q 9 HOH 136 2136 2136 HOH HOH B . 
Q 9 HOH 137 2137 2137 HOH HOH B . 
Q 9 HOH 138 2138 2138 HOH HOH B . 
Q 9 HOH 139 2139 2139 HOH HOH B . 
Q 9 HOH 140 2140 2140 HOH HOH B . 
Q 9 HOH 141 2141 2141 HOH HOH B . 
Q 9 HOH 142 2142 2142 HOH HOH B . 
Q 9 HOH 143 2143 2143 HOH HOH B . 
Q 9 HOH 144 2144 2144 HOH HOH B . 
Q 9 HOH 145 2145 2145 HOH HOH B . 
Q 9 HOH 146 2146 2146 HOH HOH B . 
Q 9 HOH 147 2147 2147 HOH HOH B . 
Q 9 HOH 148 2148 2148 HOH HOH B . 
Q 9 HOH 149 2149 2149 HOH HOH B . 
Q 9 HOH 150 2150 2150 HOH HOH B . 
Q 9 HOH 151 2151 2151 HOH HOH B . 
Q 9 HOH 152 2152 2152 HOH HOH B . 
Q 9 HOH 153 2153 2153 HOH HOH B . 
Q 9 HOH 154 2154 2154 HOH HOH B . 
Q 9 HOH 155 2155 2155 HOH HOH B . 
Q 9 HOH 156 2156 2156 HOH HOH B . 
Q 9 HOH 157 2157 2157 HOH HOH B . 
Q 9 HOH 158 2158 2158 HOH HOH B . 
Q 9 HOH 159 2159 2159 HOH HOH B . 
Q 9 HOH 160 2160 2160 HOH HOH B . 
Q 9 HOH 161 2161 2161 HOH HOH B . 
Q 9 HOH 162 2162 2162 HOH HOH B . 
Q 9 HOH 163 2163 2163 HOH HOH B . 
Q 9 HOH 164 2164 2164 HOH HOH B . 
Q 9 HOH 165 2165 2165 HOH HOH B . 
Q 9 HOH 166 2166 2166 HOH HOH B . 
Q 9 HOH 167 2167 2167 HOH HOH B . 
Q 9 HOH 168 2168 2168 HOH HOH B . 
Q 9 HOH 169 2169 2169 HOH HOH B . 
Q 9 HOH 170 2170 2170 HOH HOH B . 
Q 9 HOH 171 2171 2171 HOH HOH B . 
Q 9 HOH 172 2172 2172 HOH HOH B . 
Q 9 HOH 173 2173 2173 HOH HOH B . 
Q 9 HOH 174 2174 2174 HOH HOH B . 
Q 9 HOH 175 2175 2175 HOH HOH B . 
Q 9 HOH 176 2176 2176 HOH HOH B . 
Q 9 HOH 177 2177 2177 HOH HOH B . 
Q 9 HOH 178 2178 2178 HOH HOH B . 
Q 9 HOH 179 2179 2179 HOH HOH B . 
Q 9 HOH 180 2180 2180 HOH HOH B . 
Q 9 HOH 181 2181 2181 HOH HOH B . 
Q 9 HOH 182 2182 2182 HOH HOH B . 
Q 9 HOH 183 2183 2183 HOH HOH B . 
Q 9 HOH 184 2184 2184 HOH HOH B . 
Q 9 HOH 185 2185 2185 HOH HOH B . 
Q 9 HOH 186 2186 2186 HOH HOH B . 
Q 9 HOH 187 2187 2187 HOH HOH B . 
Q 9 HOH 188 2188 2188 HOH HOH B . 
Q 9 HOH 189 2189 2189 HOH HOH B . 
Q 9 HOH 190 2190 2190 HOH HOH B . 
Q 9 HOH 191 2191 2191 HOH HOH B . 
Q 9 HOH 192 2192 2192 HOH HOH B . 
Q 9 HOH 193 2193 2193 HOH HOH B . 
Q 9 HOH 194 2194 2194 HOH HOH B . 
Q 9 HOH 195 2195 2195 HOH HOH B . 
Q 9 HOH 196 2196 2196 HOH HOH B . 
Q 9 HOH 197 2197 2197 HOH HOH B . 
Q 9 HOH 198 2198 2198 HOH HOH B . 
Q 9 HOH 199 2199 2199 HOH HOH B . 
Q 9 HOH 200 2200 2200 HOH HOH B . 
Q 9 HOH 201 2201 2201 HOH HOH B . 
Q 9 HOH 202 2202 2202 HOH HOH B . 
Q 9 HOH 203 2203 2203 HOH HOH B . 
Q 9 HOH 204 2204 2204 HOH HOH B . 
Q 9 HOH 205 2205 2205 HOH HOH B . 
Q 9 HOH 206 2206 2206 HOH HOH B . 
Q 9 HOH 207 2207 2207 HOH HOH B . 
Q 9 HOH 208 2208 2208 HOH HOH B . 
Q 9 HOH 209 2209 2209 HOH HOH B . 
Q 9 HOH 210 2210 2210 HOH HOH B . 
Q 9 HOH 211 2211 2211 HOH HOH B . 
Q 9 HOH 212 2212 2212 HOH HOH B . 
Q 9 HOH 213 2213 2213 HOH HOH B . 
Q 9 HOH 214 2214 2214 HOH HOH B . 
Q 9 HOH 215 2215 2215 HOH HOH B . 
Q 9 HOH 216 2216 2216 HOH HOH B . 
Q 9 HOH 217 2217 2217 HOH HOH B . 
Q 9 HOH 218 2218 2218 HOH HOH B . 
Q 9 HOH 219 2219 2219 HOH HOH B . 
Q 9 HOH 220 2220 2220 HOH HOH B . 
Q 9 HOH 221 2221 2221 HOH HOH B . 
Q 9 HOH 222 2222 2222 HOH HOH B . 
Q 9 HOH 223 2223 2223 HOH HOH B . 
Q 9 HOH 224 2224 2224 HOH HOH B . 
Q 9 HOH 225 2225 2225 HOH HOH B . 
Q 9 HOH 226 2226 2226 HOH HOH B . 
Q 9 HOH 227 2227 2227 HOH HOH B . 
Q 9 HOH 228 2228 2228 HOH HOH B . 
Q 9 HOH 229 2229 2229 HOH HOH B . 
Q 9 HOH 230 2230 2230 HOH HOH B . 
Q 9 HOH 231 2231 2231 HOH HOH B . 
Q 9 HOH 232 2232 2232 HOH HOH B . 
Q 9 HOH 233 2233 2233 HOH HOH B . 
Q 9 HOH 234 2234 2234 HOH HOH B . 
Q 9 HOH 235 2235 2235 HOH HOH B . 
Q 9 HOH 236 2236 2236 HOH HOH B . 
Q 9 HOH 237 2237 2237 HOH HOH B . 
Q 9 HOH 238 2238 2238 HOH HOH B . 
Q 9 HOH 239 2239 2239 HOH HOH B . 
Q 9 HOH 240 2240 2240 HOH HOH B . 
Q 9 HOH 241 2241 2241 HOH HOH B . 
Q 9 HOH 242 2242 2242 HOH HOH B . 
Q 9 HOH 243 2243 2243 HOH HOH B . 
Q 9 HOH 244 2244 2244 HOH HOH B . 
Q 9 HOH 245 2245 2245 HOH HOH B . 
Q 9 HOH 246 2246 2246 HOH HOH B . 
Q 9 HOH 247 2247 2247 HOH HOH B . 
Q 9 HOH 248 2248 2248 HOH HOH B . 
Q 9 HOH 249 2249 2249 HOH HOH B . 
Q 9 HOH 250 2250 2250 HOH HOH B . 
Q 9 HOH 251 2251 2251 HOH HOH B . 
Q 9 HOH 252 2252 2252 HOH HOH B . 
Q 9 HOH 253 2253 2253 HOH HOH B . 
Q 9 HOH 254 2254 2254 HOH HOH B . 
Q 9 HOH 255 2255 2255 HOH HOH B . 
Q 9 HOH 256 2256 2256 HOH HOH B . 
Q 9 HOH 257 2257 2257 HOH HOH B . 
Q 9 HOH 258 2258 2258 HOH HOH B . 
Q 9 HOH 259 2259 2259 HOH HOH B . 
Q 9 HOH 260 2260 2260 HOH HOH B . 
Q 9 HOH 261 2261 2261 HOH HOH B . 
Q 9 HOH 262 2262 2262 HOH HOH B . 
Q 9 HOH 263 2263 2263 HOH HOH B . 
Q 9 HOH 264 2264 2264 HOH HOH B . 
Q 9 HOH 265 2265 2265 HOH HOH B . 
Q 9 HOH 266 2266 2266 HOH HOH B . 
Q 9 HOH 267 2267 2267 HOH HOH B . 
Q 9 HOH 268 2268 2268 HOH HOH B . 
Q 9 HOH 269 2269 2269 HOH HOH B . 
Q 9 HOH 270 2270 2270 HOH HOH B . 
Q 9 HOH 271 2271 2271 HOH HOH B . 
Q 9 HOH 272 2272 2272 HOH HOH B . 
Q 9 HOH 273 2273 2273 HOH HOH B . 
Q 9 HOH 274 2274 2274 HOH HOH B . 
Q 9 HOH 275 2275 2275 HOH HOH B . 
Q 9 HOH 276 2276 2276 HOH HOH B . 
Q 9 HOH 277 2277 2277 HOH HOH B . 
Q 9 HOH 278 2278 2278 HOH HOH B . 
Q 9 HOH 279 2279 2279 HOH HOH B . 
Q 9 HOH 280 2280 2280 HOH HOH B . 
Q 9 HOH 281 2281 2281 HOH HOH B . 
Q 9 HOH 282 2282 2282 HOH HOH B . 
Q 9 HOH 283 2283 2283 HOH HOH B . 
Q 9 HOH 284 2284 2284 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5530  ? 
1 MORE         30    ? 
1 'SSA (A^2)'  37180 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-05-26 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-17 
5 'Structure model' 1 4 2020-07-29 
6 'Structure model' 1 5 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' Other                       
7 5 'Structure model' 'Structure summary'         
8 6 'Structure model' 'Derived calculations'      
9 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' diffrn_source             
2  5 'Structure model' chem_comp                 
3  5 'Structure model' entity                    
4  5 'Structure model' pdbx_chem_comp_identifier 
5  5 'Structure model' pdbx_database_status      
6  5 'Structure model' pdbx_entity_nonpoly       
7  5 'Structure model' struct_conn               
8  5 'Structure model' struct_site               
9  5 'Structure model' struct_site_gen           
10 6 'Structure model' chem_comp                 
11 6 'Structure model' pdbx_struct_assembly      
12 6 'Structure model' pdbx_struct_assembly_gen  
13 6 'Structure model' pdbx_struct_assembly_prop 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
2 5 'Structure model' '_chem_comp.name'                      
3 5 'Structure model' '_chem_comp.type'                      
4 5 'Structure model' '_entity.pdbx_description'             
5 5 'Structure model' '_pdbx_database_status.status_code_sf' 
6 5 'Structure model' '_pdbx_entity_nonpoly.name'            
7 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
8 5 'Structure model' '_struct_conn.pdbx_role'               
9 6 'Structure model' '_chem_comp.pdbx_synonyms'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
REFMAC phasing          .                 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 72.70   -7.28   
2  1 ALA A 167 ? ? -159.33 66.26   
3  1 ASN A 170 ? ? 58.99   13.41   
4  1 SER A 203 ? ? 57.31   -118.54 
5  1 ASP A 306 ? ? -129.61 -83.70  
6  1 HIS A 387 ? ? -147.80 58.94   
7  1 VAL A 407 ? ? -122.23 -63.04  
8  1 ASP A 494 ? ? -58.46  82.78   
9  1 PHE B 47  ? ? 73.87   -1.76   
10 1 ALA B 62  ? ? -115.80 50.74   
11 1 ALA B 167 ? ? -156.12 66.25   
12 1 SER B 203 ? ? 61.54   -123.57 
13 1 VAL B 303 ? ? -69.59  97.46   
14 1 ASP B 306 ? ? -117.96 -85.25  
15 1 VAL B 407 ? ? -121.16 -62.97  
16 1 LYS B 496 ? ? 69.37   124.84  
17 1 SER B 497 ? ? -159.51 -49.19  
18 1 ALA B 506 ? ? -70.33  -70.35  
19 1 ASN B 514 ? ? -162.11 -168.96 
20 1 THR B 543 ? ? 45.33   -85.44  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2027 ? 6.70 . 
2 1 O ? A HOH 2048 ? 6.18 . 
3 1 O ? A HOH 2098 ? 6.88 . 
4 1 O ? B HOH 2031 ? 7.04 . 
5 1 O ? B HOH 2097 ? 7.16 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 496  ? CG  ? A LYS 496 CG  
2  1 Y 1 A LYS 496  ? CD  ? A LYS 496 CD  
3  1 Y 1 A LYS 496  ? CE  ? A LYS 496 CE  
4  1 Y 1 A LYS 496  ? NZ  ? A LYS 496 NZ  
5  1 Y 1 B ARG 493  ? CG  ? B ARG 493 CG  
6  1 Y 1 B ARG 493  ? CD  ? B ARG 493 CD  
7  1 Y 1 B ARG 493  ? NE  ? B ARG 493 NE  
8  1 Y 1 B ARG 493  ? CZ  ? B ARG 493 CZ  
9  1 Y 1 B ARG 493  ? NH1 ? B ARG 493 NH1 
10 1 Y 1 B ARG 493  ? NH2 ? B ARG 493 NH2 
11 1 Y 1 B ALA 544  ? CA  ? B ALA 544 CA  
12 1 Y 1 B ALA 544  ? C   ? B ALA 544 C   
13 1 Y 1 B ALA 544  ? O   ? B ALA 544 O   
14 1 Y 1 B ALA 544  ? CB  ? B ALA 544 CB  
15 1 N 1 B PE4 1548 ? C16 ? L PE4 1   C16 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 A ALA 544 ? A ALA 544 
10 1 Y 1 A THR 545 ? A THR 545 
11 1 Y 1 A GLU 546 ? A GLU 546 
12 1 Y 1 A ALA 547 ? A ALA 547 
13 1 Y 1 A PRO 548 ? A PRO 548 
14 1 Y 1 B GLU 1   ? B GLU 1   
15 1 Y 1 B GLY 2   ? B GLY 2   
16 1 Y 1 B ARG 3   ? B ARG 3   
17 1 Y 1 B PRO 258 ? B PRO 258 
18 1 Y 1 B PRO 259 ? B PRO 259 
19 1 Y 1 B GLY 260 ? B GLY 260 
20 1 Y 1 B GLY 261 ? B GLY 261 
21 1 Y 1 B ALA 262 ? B ALA 262 
22 1 Y 1 B GLY 263 ? B GLY 263 
23 1 Y 1 B GLY 264 ? B GLY 264 
24 1 Y 1 B THR 545 ? B THR 545 
25 1 Y 1 B GLU 546 ? B GLU 546 
26 1 Y 1 B ALA 547 ? B ALA 547 
27 1 Y 1 B PRO 548 ? B PRO 548 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-carbamoyl-1-(3-{4-[(E)-(hydroxyimino)methyl]pyridinium-1-yl}propyl)pyridinium'    K27 
3 2-acetamido-2-deoxy-beta-D-glucopyranose                                             NAG 
4 'BROMIDE ION'                                                                        BR  
5 '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE'                                                  P4G 
6 'CARBONATE ION'                                                                      CO3 
7 'DI(HYDROXYETHYL)ETHER'                                                              PEG 
8 '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' PE4 
9 water                                                                                HOH 
#