data_2WJ7
# 
_entry.id   2WJ7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WJ7         
PDBE  EBI-39897    
WWPDB D_1290039897 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2WJ5 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'RAT ALPHA CRYSTALLIN DOMAIN' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WJ7 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Naylor, C.E.'  1 ? 
'Bagneris, C.'  2 ? 
'Bateman, O.A.' 3 ? 
'Cronin, N.'    4 ? 
'Keep, N.H.'    5 ? 
'Slingsby, C.'  6 ? 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structures of Alpha-Crystallin Domain Dimers of Alphab-Crystallin and Hsp20.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            392 
_citation.page_first                1242 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19646995 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2009.07.069 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bagneris, C.'  1 ? 
primary 'Bateman, O.A.' 2 ? 
primary 'Naylor, C.E.'  3 ? 
primary 'Cronin, N.'    4 ? 
primary 'Boelens, W.C.' 5 ? 
primary 'Keep, N.H.'    6 ? 
primary 'Slingsby, C.'  7 ? 
# 
_cell.entry_id           2WJ7 
_cell.length_a           49.460 
_cell.length_b           66.070 
_cell.length_c           190.970 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.68 
_cell.angle_gamma        90.00 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WJ7 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'ALPHA-CRYSTALLIN B CHAIN' 10729.104 5  ? ? 'ALPHA-CRYSTALLIN DOMAIN, RESIDUES 67-157' ? 
2 water   nat water                      18.015    85 ? ? ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'ALPHA(B)-CRYSTALLIN, ROSENTHAL FIBER COMPONENT, HEAT SHOCK PROTEIN BETA-5, HSPB5, RENAL CARCINOMA ANTIGEN NY-REN-27, HUMAN ALPHAB' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVL
TVNGPRKQVSGPER
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVL
TVNGPRKQVSGPER
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ALA n 
1 3  MET n 
1 4  GLU n 
1 5  MET n 
1 6  ARG n 
1 7  LEU n 
1 8  GLU n 
1 9  LYS n 
1 10 ASP n 
1 11 ARG n 
1 12 PHE n 
1 13 SER n 
1 14 VAL n 
1 15 ASN n 
1 16 LEU n 
1 17 ASP n 
1 18 VAL n 
1 19 LYS n 
1 20 HIS n 
1 21 PHE n 
1 22 SER n 
1 23 PRO n 
1 24 GLU n 
1 25 GLU n 
1 26 LEU n 
1 27 LYS n 
1 28 VAL n 
1 29 LYS n 
1 30 VAL n 
1 31 LEU n 
1 32 GLY n 
1 33 ASP n 
1 34 VAL n 
1 35 ILE n 
1 36 GLU n 
1 37 VAL n 
1 38 HIS n 
1 39 GLY n 
1 40 LYS n 
1 41 HIS n 
1 42 GLU n 
1 43 GLU n 
1 44 ARG n 
1 45 GLN n 
1 46 ASP n 
1 47 GLU n 
1 48 HIS n 
1 49 GLY n 
1 50 PHE n 
1 51 ILE n 
1 52 SER n 
1 53 ARG n 
1 54 GLU n 
1 55 PHE n 
1 56 HIS n 
1 57 ARG n 
1 58 LYS n 
1 59 TYR n 
1 60 ARG n 
1 61 ILE n 
1 62 PRO n 
1 63 ALA n 
1 64 ASP n 
1 65 VAL n 
1 66 ASP n 
1 67 PRO n 
1 68 LEU n 
1 69 THR n 
1 70 ILE n 
1 71 THR n 
1 72 SER n 
1 73 SER n 
1 74 LEU n 
1 75 SER n 
1 76 SER n 
1 77 ASP n 
1 78 GLY n 
1 79 VAL n 
1 80 LEU n 
1 81 THR n 
1 82 VAL n 
1 83 ASN n 
1 84 GLY n 
1 85 PRO n 
1 86 ARG n 
1 87 LYS n 
1 88 GLN n 
1 89 VAL n 
1 90 SER n 
1 91 GLY n 
1 92 PRO n 
1 93 GLU n 
1 94 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2WJ7        1 ? ? 2WJ7   ? 
2 UNP CRYAB_HUMAN 1 ? ? P02511 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2WJ7 A 1 ? 3  ? 2WJ7   1  ? 3   ? 1 3  
2  2 2WJ7 A 4 ? 94 ? P02511 67 ? 157 ? 4 94 
3  1 2WJ7 B 1 ? 3  ? 2WJ7   1  ? 3   ? 1 3  
4  2 2WJ7 B 4 ? 94 ? P02511 67 ? 157 ? 4 94 
5  1 2WJ7 C 1 ? 3  ? 2WJ7   1  ? 3   ? 1 3  
6  2 2WJ7 C 4 ? 94 ? P02511 67 ? 157 ? 4 94 
7  1 2WJ7 D 1 ? 3  ? 2WJ7   1  ? 3   ? 1 3  
8  2 2WJ7 D 4 ? 94 ? P02511 67 ? 157 ? 4 94 
9  1 2WJ7 E 1 ? 3  ? 2WJ7   1  ? 3   ? 1 3  
10 2 2WJ7 E 4 ? 94 ? P02511 67 ? 157 ? 4 94 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2WJ7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.9 
_exptl_crystal.density_percent_sol   57.7 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;4 DAYS AT 16 DEGREESC IN 100 MM BICINE PH 9.0, 55% 2-METHYL-2,4-PENTANDIOL, AT A PROTEIN CONCENTRATION OF 20 MG/ML USING 1 UL PROTEIN SOLUTION AND 2 UL RESERVOIR SOLUTION.
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-11-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0066 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             1.0066 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WJ7 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             190.00 
_reflns.d_resolution_high            2.63 
_reflns.number_obs                   17862 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.22 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.60 
_reflns.B_iso_Wilson_estimate        68.8 
_reflns.pdbx_redundancy              3.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.63 
_reflns_shell.d_res_low              2.77 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           0.63 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.90 
_reflns_shell.pdbx_redundancy        3.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WJ7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     17813 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.034 
_refine.ls_d_res_high                            2.631 
_refine.ls_percent_reflns_obs                    96.51 
_refine.ls_R_factor_obs                          0.2553 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2516 
_refine.ls_R_factor_R_free                       0.3200 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  912 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               61.2 
_refine.aniso_B[1][1]                            4.0900 
_refine.aniso_B[2][2]                            6.8857 
_refine.aniso_B[3][3]                            -10.9757 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            1.4850 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.350 
_refine.solvent_model_param_bsol                 66.900 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2WJ5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.56 
_refine.pdbx_overall_phase_error                 36.70 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2953 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             85 
_refine_hist.number_atoms_total               3038 
_refine_hist.d_res_high                       2.631 
_refine_hist.d_res_low                        39.034 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.022  ? ? 3013 'X-RAY DIFFRACTION' ? 
f_angle_d          2.071  ? ? 4086 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.906 ? ? 1076 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.119  ? ? 470  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.008  ? ? 538  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 370 ?     ? POSITIONAL 1 1  'X-RAY DIFFRACTION' ? ? ? 
2 B 370 0.146 ? POSITIONAL 1 2  'X-RAY DIFFRACTION' ? ? ? 
3 C 373 0.125 ? POSITIONAL 1 3  'X-RAY DIFFRACTION' ? ? ? 
4 D 352 0.140 ? POSITIONAL 1 4  'X-RAY DIFFRACTION' ? ? ? 
5 E 376 0.135 ? POSITIONAL 1 5  'X-RAY DIFFRACTION' ? ? ? 
1 A 62  ?     ? POSITIONAL 2 6  'X-RAY DIFFRACTION' ? ? ? 
2 C 62  0.134 ? POSITIONAL 2 7  'X-RAY DIFFRACTION' ? ? ? 
1 A 114 ?     ? POSITIONAL 3 8  'X-RAY DIFFRACTION' ? ? ? 
2 C 114 0.137 ? POSITIONAL 3 9  'X-RAY DIFFRACTION' ? ? ? 
3 E 120 0.148 ? POSITIONAL 3 10 'X-RAY DIFFRACTION' ? ? ? 
1 B 117 ?     ? POSITIONAL 4 11 'X-RAY DIFFRACTION' ? ? ? 
2 D 117 0.085 ? POSITIONAL 4 12 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.6311 2.7698  2192 0.2636 87.00 0.3686 . . 118 . . 
'X-RAY DIFFRACTION' . 2.7698 2.9432  2391 0.2786 96.00 0.3823 . . 116 . . 
'X-RAY DIFFRACTION' . 2.9432 3.1704  2451 0.2925 98.00 0.4213 . . 119 . . 
'X-RAY DIFFRACTION' . 3.1704 3.4893  2456 0.2387 99.00 0.3016 . . 137 . . 
'X-RAY DIFFRACTION' . 3.4893 3.9937  2452 0.2015 99.00 0.3133 . . 123 . . 
'X-RAY DIFFRACTION' . 3.9937 5.0300  2466 0.1948 98.00 0.2586 . . 159 . . 
'X-RAY DIFFRACTION' . 5.0300 39.0383 2493 0.2851 98.00 0.3123 . . 140 . . 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.531000 0.834000 0.149000 0.836000  0.486000  0.257000  0.142000  0.261000  -0.955000 24.54846 -19.67877 34.96871 
2 given ? 0.284270  0.948820 0.137590 -0.951030 0.297240  -0.084830 -0.121390 -0.106740 0.986850  4.76706  23.91140  40.89516 
3 given ? 0.672050  0.717580 0.182850 0.729430  -0.684040 0.003490  0.127580  0.131030  -0.983130 -2.80537 -7.61084  74.04976 
4 given ? -0.876690 0.479500 0.038640 -0.476440 -0.854400 -0.207370 -0.066410 -0.200210 0.977500  35.02455 21.46771  78.21479 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
3 ? 1 
4 ? 1 
5 ? 1 
1 ? 2 
2 ? 2 
1 ? 3 
2 ? 3 
3 ? 3 
1 ? 4 
2 ? 4 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'CHAIN A AND (RESSEQ 12:32 OR RESSEQ 34:39 OR RESSEQ 41:44 OR RESSEQ 49:50 OR RESSEQ 52:60 OR RESSEQ 78:83 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'CHAIN B AND (RESSEQ 12:32 OR RESSEQ 34:39 OR RESSEQ 41:44 OR RESSEQ 49:50 OR RESSEQ 52:60 OR RESSEQ 78:83 )' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'CHAIN C AND (RESSEQ 12:32 OR RESSEQ 34:39 OR RESSEQ 41:44 OR RESSEQ 49:50 OR RESSEQ 52:60 OR RESSEQ 78:83 )' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'CHAIN D AND (RESSEQ 14:32 OR RESSEQ 34:39 OR RESSEQ 41:44 OR RESSEQ 49:50 OR RESSEQ 52:60 OR RESSEQ 78:83 )' 
5 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
'CHAIN E AND (RESSEQ 12:32 OR RESSEQ 34:39 OR RESSEQ 41:44 OR RESSEQ 49:50 OR RESSEQ 52:60 OR RESSEQ 78:83 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'CHAIN A AND (RESSEQ 3:11 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'CHAIN C AND (RESSEQ 3:11 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'CHAIN A AND (RESSEQ 61:77 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'CHAIN C AND (RESSEQ 61:77 )' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'CHAIN E AND (RESSEQ 61:77 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4 'CHAIN B AND (RESSEQ 61:77 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4 'CHAIN D AND (RESSEQ 61:77 )' 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
# 
_struct.entry_id                  2WJ7 
_struct.title                     'human alphaB crystallin' 
_struct.pdbx_descriptor           'ALPHA-CRYSTALLIN B CHAIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WJ7 
_struct_keywords.pdbx_keywords   CHAPERONE 
_struct_keywords.text            
;DESMIN-RELATED MYOPATHY, PHOSPHOPROTEIN, DISEASE MUTATION, EYE LENS PROTEIN, METHYLATION, POLYMORPHISM, GLYCOPROTEIN, CATARACT, OXIDATION, CHAPERONE, ACETYLATION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 22 ? GLU A 24 ? SER A 22 GLU A 24 5 ? 3 
HELX_P HELX_P2 2 ASP A 66 ? ILE A 70 ? ASP A 66 ILE A 70 5 ? 5 
HELX_P HELX_P3 3 SER B 22 ? GLU B 24 ? SER B 22 GLU B 24 5 ? 3 
HELX_P HELX_P4 4 SER C 22 ? GLU C 24 ? SER C 22 GLU C 24 5 ? 3 
HELX_P HELX_P5 5 ASP C 66 ? ILE C 70 ? ASP C 66 ILE C 70 5 ? 5 
HELX_P HELX_P6 6 SER D 22 ? GLU D 24 ? SER D 22 GLU D 24 5 ? 3 
HELX_P HELX_P7 7 SER E 22 ? GLU E 24 ? SER E 22 GLU E 24 5 ? 3 
HELX_P HELX_P8 8 ASP E 66 ? ILE E 70 ? ASP E 66 ILE E 70 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 65 B . ? VAL 65 B ASP 66 B ? ASP 66 B 1 -9.76 
2 VAL 65 D . ? VAL 65 D ASP 66 D ? ASP 66 D 1 -6.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 6 ? 
BA ? 7 ? 
CA ? 6 ? 
DA ? 6 ? 
EA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CA 5 6 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DA 5 6 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 MET A 5  ? LEU A 7  ? MET A 5  LEU A 7  
AA 2 ARG A 11 ? ASP A 17 ? ARG A 11 ASP A 17 
AA 3 VAL A 79 ? PRO A 85 ? VAL A 79 PRO A 85 
AA 4 THR A 71 ? LEU A 74 ? THR A 71 LEU A 74 
AB 1 LEU A 26 ? LEU A 31 ? LEU A 26 LEU A 31 
AB 2 VAL A 34 ? HIS A 41 ? VAL A 34 HIS A 41 
AB 3 PHE A 50 ? ARG A 60 ? PHE A 50 ARG A 60 
AB 4 PHE B 50 ? ARG B 60 ? PHE B 50 ARG B 60 
AB 5 VAL B 34 ? HIS B 41 ? VAL B 34 HIS B 41 
AB 6 LEU B 26 ? LEU B 31 ? LEU B 26 LEU B 31 
BA 1 VAL B 14 ? ASP B 17 ? VAL B 14 ASP B 17 
BA 2 VAL B 79 ? ASN B 83 ? VAL B 79 ASN B 83 
BA 3 THR B 71 ? SER B 75 ? THR B 71 SER B 75 
BA 4 THR C 71 ? SER C 75 ? THR C 71 SER C 75 
BA 5 VAL C 79 ? PRO C 85 ? VAL C 79 PRO C 85 
BA 6 ARG C 11 ? ASP C 17 ? ARG C 11 ASP C 17 
BA 7 MET C 5  ? LEU C 7  ? MET C 5  LEU C 7  
CA 1 LEU C 26 ? VAL C 30 ? LEU C 26 VAL C 30 
CA 2 VAL C 34 ? GLN C 45 ? VAL C 34 GLN C 45 
CA 3 PHE C 50 ? ARG C 60 ? PHE C 50 ARG C 60 
CA 4 PHE D 50 ? ARG D 60 ? PHE D 50 ARG D 60 
CA 5 VAL D 34 ? GLN D 45 ? VAL D 34 GLN D 45 
CA 6 LEU D 26 ? LEU D 31 ? LEU D 26 LEU D 31 
DA 1 ASN D 15 ? ASP D 17 ? ASN D 15 ASP D 17 
DA 2 VAL D 79 ? ASN D 83 ? VAL D 79 ASN D 83 
DA 3 THR D 71 ? SER D 75 ? THR D 71 SER D 75 
DA 4 THR E 71 ? SER E 75 ? THR E 71 SER E 75 
DA 5 VAL E 79 ? ASN E 83 ? VAL E 79 ASN E 83 
DA 6 SER E 13 ? ASP E 17 ? SER E 13 ASP E 17 
EA 1 LEU E 26 ? LEU E 31 ? LEU E 26 LEU E 31 
EA 2 VAL E 34 ? GLN E 45 ? VAL E 34 GLN E 45 
EA 3 PHE E 50 ? ARG E 60 ? PHE E 50 ARG E 60 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ARG A 6  ? N ARG A 6  O SER A 13 ? O SER A 13 
AA 2 3 N LEU A 16 ? N LEU A 16 O LEU A 80 ? O LEU A 80 
AA 3 4 N ASN A 83 ? N ASN A 83 O THR A 71 ? O THR A 71 
AB 1 2 N LEU A 31 ? N LEU A 31 O VAL A 34 ? O VAL A 34 
AB 2 3 N HIS A 41 ? N HIS A 41 O ARG A 53 ? O ARG A 53 
AB 3 4 N LYS A 58 ? N LYS A 58 O PHE B 50 ? O PHE B 50 
AB 4 5 N TYR B 59 ? N TYR B 59 O ILE B 35 ? O ILE B 35 
AB 5 6 N HIS B 38 ? N HIS B 38 O LYS B 27 ? O LYS B 27 
BA 1 2 N LEU B 16 ? N LEU B 16 O LEU B 80 ? O LEU B 80 
BA 2 3 N ASN B 83 ? N ASN B 83 O THR B 71 ? O THR B 71 
BA 3 4 N LEU B 74 ? N LEU B 74 O LEU C 74 ? O LEU C 74 
BA 4 5 N SER C 75 ? N SER C 75 O VAL C 79 ? O VAL C 79 
BA 5 6 N GLY C 84 ? N GLY C 84 O PHE C 12 ? O PHE C 12 
BA 6 7 N SER C 13 ? N SER C 13 O ARG C 6  ? O ARG C 6  
CA 1 2 N LYS C 29 ? N LYS C 29 O GLU C 36 ? O GLU C 36 
CA 2 3 N ARG C 44 ? N ARG C 44 O ILE C 51 ? O ILE C 51 
CA 3 4 N LYS C 58 ? N LYS C 58 O PHE D 50 ? O PHE D 50 
CA 4 5 N TYR D 59 ? N TYR D 59 O ILE D 35 ? O ILE D 35 
CA 5 6 N HIS D 38 ? N HIS D 38 O LYS D 27 ? O LYS D 27 
DA 1 2 N LEU D 16 ? N LEU D 16 O LEU D 80 ? O LEU D 80 
DA 2 3 N ASN D 83 ? N ASN D 83 O THR D 71 ? O THR D 71 
DA 3 4 N LEU D 74 ? N LEU D 74 O LEU E 74 ? O LEU E 74 
DA 4 5 N SER E 75 ? N SER E 75 O VAL E 79 ? O VAL E 79 
DA 5 6 N VAL E 82 ? N VAL E 82 O VAL E 14 ? O VAL E 14 
EA 1 2 N LEU E 31 ? N LEU E 31 O VAL E 34 ? O VAL E 34 
EA 2 3 N ARG E 44 ? N ARG E 44 O ILE E 51 ? O ILE E 51 
# 
_database_PDB_matrix.entry_id          2WJ7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WJ7 
_atom_sites.fract_transf_matrix[1][1]   0.020218 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000946 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015135 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005242 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 3  ? 23.981  -7.754  15.338 1.00 40.49  ? 3    MET A N   1 
ATOM   2    C CA  . MET A 1 3  ? 23.218  -8.749  14.574 1.00 119.83 ? 3    MET A CA  1 
ATOM   3    C C   . MET A 1 3  ? 24.149  -9.916  14.119 1.00 98.08  ? 3    MET A C   1 
ATOM   4    O O   . MET A 1 3  ? 25.254  -10.069 14.670 1.00 80.95  ? 3    MET A O   1 
ATOM   5    C CB  . MET A 1 3  ? 22.414  -8.092  13.403 1.00 45.41  ? 3    MET A CB  1 
ATOM   6    N N   . GLU A 1 4  ? 23.686  -10.723 13.149 1.00 63.18  ? 4    GLU A N   1 
ATOM   7    C CA  . GLU A 1 4  ? 24.418  -11.846 12.545 1.00 46.19  ? 4    GLU A CA  1 
ATOM   8    C C   . GLU A 1 4  ? 25.920  -11.668 12.409 1.00 83.92  ? 4    GLU A C   1 
ATOM   9    O O   . GLU A 1 4  ? 26.425  -10.547 12.237 1.00 48.25  ? 4    GLU A O   1 
ATOM   10   C CB  . GLU A 1 4  ? 23.895  -12.164 11.147 1.00 37.69  ? 4    GLU A CB  1 
ATOM   11   C CG  . GLU A 1 4  ? 24.844  -13.184 10.250 1.00 95.40  ? 4    GLU A CG  1 
ATOM   12   C CD  . GLU A 1 4  ? 25.982  -12.580 9.254  1.00 125.93 ? 4    GLU A CD  1 
ATOM   13   O OE1 . GLU A 1 4  ? 26.166  -11.344 9.039  1.00 77.38  ? 4    GLU A OE1 1 
ATOM   14   O OE2 . GLU A 1 4  ? 26.731  -13.391 8.642  1.00 87.82  ? 4    GLU A OE2 1 
ATOM   15   N N   . MET A 1 5  ? 26.659  -12.773 12.451 1.00 36.27  ? 5    MET A N   1 
ATOM   16   C CA  . MET A 1 5  ? 28.054  -12.609 12.120 1.00 59.07  ? 5    MET A CA  1 
ATOM   17   C C   . MET A 1 5  ? 28.601  -13.893 11.567 1.00 59.32  ? 5    MET A C   1 
ATOM   18   O O   . MET A 1 5  ? 28.242  -14.968 12.023 1.00 71.80  ? 5    MET A O   1 
ATOM   19   C CB  . MET A 1 5  ? 28.824  -12.132 13.315 1.00 36.78  ? 5    MET A CB  1 
ATOM   20   C CG  . MET A 1 5  ? 29.407  -13.300 14.062 1.00 67.14  ? 5    MET A CG  1 
ATOM   21   S SD  . MET A 1 5  ? 30.524  -12.801 15.348 1.00 72.56  ? 5    MET A SD  1 
ATOM   22   C CE  . MET A 1 5  ? 31.963  -12.205 14.383 1.00 32.52  ? 5    MET A CE  1 
ATOM   23   N N   . ARG A 1 6  ? 29.394  -13.795 10.520 1.00 43.89  ? 6    ARG A N   1 
ATOM   24   C CA  . ARG A 1 6  ? 30.000  -14.997 10.008 1.00 47.16  ? 6    ARG A CA  1 
ATOM   25   C C   . ARG A 1 6  ? 31.471  -14.782 10.325 1.00 61.18  ? 6    ARG A C   1 
ATOM   26   O O   . ARG A 1 6  ? 31.977  -13.679 10.245 1.00 37.15  ? 6    ARG A O   1 
ATOM   27   C CB  . ARG A 1 6  ? 29.689  -15.305 8.494  1.00 11.48  ? 6    ARG A CB  1 
ATOM   28   N N   . LEU A 1 7  ? 32.137  -15.844 10.757 1.00 51.91  ? 7    LEU A N   1 
ATOM   29   C CA  . LEU A 1 7  ? 33.585  -15.841 10.851 1.00 47.57  ? 7    LEU A CA  1 
ATOM   30   C C   . LEU A 1 7  ? 34.183  -17.211 10.369 1.00 56.17  ? 7    LEU A C   1 
ATOM   31   O O   . LEU A 1 7  ? 34.193  -18.209 11.076 1.00 51.17  ? 7    LEU A O   1 
ATOM   32   C CB  . LEU A 1 7  ? 33.929  -15.512 12.259 1.00 23.80  ? 7    LEU A CB  1 
ATOM   33   C CG  . LEU A 1 7  ? 35.325  -15.242 12.743 1.00 44.82  ? 7    LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 7  ? 35.616  -13.854 12.566 1.00 36.18  ? 7    LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 7  ? 35.408  -15.603 14.255 1.00 32.42  ? 7    LEU A CD2 1 
ATOM   36   N N   . GLU A 1 8  ? 34.658  -17.259 9.137  1.00 34.82  ? 8    GLU A N   1 
ATOM   37   C CA  . GLU A 1 8  ? 35.143  -18.499 8.565  1.00 45.08  ? 8    GLU A CA  1 
ATOM   38   C C   . GLU A 1 8  ? 36.658  -18.426 8.448  1.00 43.62  ? 8    GLU A C   1 
ATOM   39   O O   . GLU A 1 8  ? 37.239  -17.393 8.759  1.00 45.82  ? 8    GLU A O   1 
ATOM   40   C CB  . GLU A 1 8  ? 34.555  -18.610 7.177  1.00 56.20  ? 8    GLU A CB  1 
ATOM   41   C CG  . GLU A 1 8  ? 33.549  -17.554 6.890  1.00 51.22  ? 8    GLU A CG  1 
ATOM   42   C CD  . GLU A 1 8  ? 32.150  -18.105 6.857  1.00 69.90  ? 8    GLU A CD  1 
ATOM   43   O OE1 . GLU A 1 8  ? 31.816  -18.832 5.904  1.00 65.87  ? 8    GLU A OE1 1 
ATOM   44   O OE2 . GLU A 1 8  ? 31.373  -17.812 7.779  1.00 91.41  ? 8    GLU A OE2 1 
ATOM   45   N N   . LYS A 1 9  ? 37.313  -19.469 7.960  1.00 25.27  ? 9    LYS A N   1 
ATOM   46   C CA  . LYS A 1 9  ? 38.754  -19.317 7.701  1.00 51.39  ? 9    LYS A CA  1 
ATOM   47   C C   . LYS A 1 9  ? 39.166  -18.141 6.855  1.00 60.02  ? 9    LYS A C   1 
ATOM   48   O O   . LYS A 1 9  ? 40.212  -17.580 7.120  1.00 60.52  ? 9    LYS A O   1 
ATOM   49   C CB  . LYS A 1 9  ? 39.402  -20.554 7.092  1.00 32.68  ? 9    LYS A CB  1 
ATOM   50   C CG  . LYS A 1 9  ? 38.466  -21.671 6.743  1.00 66.69  ? 9    LYS A CG  1 
ATOM   51   C CD  . LYS A 1 9  ? 39.276  -22.993 6.565  1.00 85.46  ? 9    LYS A CD  1 
ATOM   52   C CE  . LYS A 1 9  ? 40.536  -22.814 5.721  1.00 57.33  ? 9    LYS A CE  1 
ATOM   53   N NZ  . LYS A 1 9  ? 41.566  -21.725 6.199  1.00 58.93  ? 9    LYS A NZ  1 
ATOM   54   N N   . ASP A 1 10 ? 38.343  -17.780 5.861  1.00 34.39  ? 10   ASP A N   1 
ATOM   55   C CA  . ASP A 1 10 ? 38.730  -16.864 4.777  1.00 41.39  ? 10   ASP A CA  1 
ATOM   56   C C   . ASP A 1 10 ? 38.076  -15.512 4.776  1.00 53.50  ? 10   ASP A C   1 
ATOM   57   O O   . ASP A 1 10 ? 38.573  -14.608 4.118  1.00 56.09  ? 10   ASP A O   1 
ATOM   58   C CB  . ASP A 1 10 ? 38.404  -17.464 3.420  1.00 36.55  ? 10   ASP A CB  1 
ATOM   59   C CG  . ASP A 1 10 ? 39.134  -18.793 3.154  1.00 92.84  ? 10   ASP A CG  1 
ATOM   60   O OD1 . ASP A 1 10 ? 40.351  -18.908 3.493  1.00 48.48  ? 10   ASP A OD1 1 
ATOM   61   O OD2 . ASP A 1 10 ? 38.469  -19.708 2.580  1.00 48.76  ? 10   ASP A OD2 1 
ATOM   62   N N   . ARG A 1 11 ? 36.956  -15.362 5.462  1.00 46.65  ? 11   ARG A N   1 
ATOM   63   C CA  . ARG A 1 11 ? 36.246  -14.101 5.401  1.00 42.42  ? 11   ARG A CA  1 
ATOM   64   C C   . ARG A 1 11 ? 35.588  -13.925 6.722  1.00 46.04  ? 11   ARG A C   1 
ATOM   65   O O   . ARG A 1 11 ? 35.372  -14.858 7.480  1.00 42.48  ? 11   ARG A O   1 
ATOM   66   C CB  . ARG A 1 11 ? 35.209  -14.074 4.252  1.00 30.96  ? 11   ARG A CB  1 
ATOM   67   N N   . PHE A 1 12 ? 35.254  -12.696 6.978  1.00 30.82  ? 12   PHE A N   1 
ATOM   68   C CA  . PHE A 1 12 ? 34.424  -12.360 8.125  1.00 50.72  ? 12   PHE A CA  1 
ATOM   69   C C   . PHE A 1 12 ? 33.336  -11.383 7.683  1.00 51.47  ? 12   PHE A C   1 
ATOM   70   O O   . PHE A 1 12 ? 33.399  -10.776 6.625  1.00 46.94  ? 12   PHE A O   1 
ATOM   71   C CB  . PHE A 1 12 ? 35.261  -11.743 9.286  1.00 59.84  ? 12   PHE A CB  1 
ATOM   72   C CG  . PHE A 1 12 ? 35.642  -10.297 9.066  1.00 49.81  ? 12   PHE A CG  1 
ATOM   73   C CD1 . PHE A 1 12 ? 34.745  -9.280  9.369  1.00 52.76  ? 12   PHE A CD1 1 
ATOM   74   C CD2 . PHE A 1 12 ? 36.852  -9.967  8.464  1.00 81.24  ? 12   PHE A CD2 1 
ATOM   75   C CE1 . PHE A 1 12 ? 35.062  -7.982  9.142  1.00 51.53  ? 12   PHE A CE1 1 
ATOM   76   C CE2 . PHE A 1 12 ? 37.188  -8.651  8.212  1.00 69.14  ? 12   PHE A CE2 1 
ATOM   77   C CZ  . PHE A 1 12 ? 36.299  -7.652  8.562  1.00 95.72  ? 12   PHE A CZ  1 
ATOM   78   N N   . SER A 1 13 ? 32.339  -11.233 8.518  1.00 41.88  ? 13   SER A N   1 
ATOM   79   C CA  . SER A 1 13 ? 31.133  -10.573 8.131  1.00 61.59  ? 13   SER A CA  1 
ATOM   80   C C   . SER A 1 13 ? 30.450  -10.158 9.427  1.00 49.82  ? 13   SER A C   1 
ATOM   81   O O   . SER A 1 13 ? 30.360  -10.913 10.373 1.00 42.44  ? 13   SER A O   1 
ATOM   82   C CB  . SER A 1 13 ? 30.252  -11.514 7.265  1.00 44.37  ? 13   SER A CB  1 
ATOM   83   O OG  . SER A 1 13 ? 29.087  -10.861 6.778  1.00 84.76  ? 13   SER A OG  1 
ATOM   84   N N   . VAL A 1 14 ? 29.975  -8.930  9.429  1.00 56.62  ? 14   VAL A N   1 
ATOM   85   C CA  . VAL A 1 14 ? 29.219  -8.379  10.527 1.00 47.58  ? 14   VAL A CA  1 
ATOM   86   C C   . VAL A 1 14 ? 28.038  -7.557  9.973  1.00 50.48  ? 14   VAL A C   1 
ATOM   87   O O   . VAL A 1 14 ? 28.131  -6.694  9.129  1.00 46.15  ? 14   VAL A O   1 
ATOM   88   C CB  . VAL A 1 14 ? 30.116  -7.538  11.437 1.00 46.94  ? 14   VAL A CB  1 
ATOM   89   C CG1 . VAL A 1 14 ? 29.320  -6.888  12.436 1.00 54.20  ? 14   VAL A CG1 1 
ATOM   90   C CG2 . VAL A 1 14 ? 31.143  -8.413  12.119 1.00 74.86  ? 14   VAL A CG2 1 
ATOM   91   N N   . ASN A 1 15 ? 26.875  -7.887  10.420 1.00 47.73  ? 15   ASN A N   1 
ATOM   92   C CA  . ASN A 1 15 ? 25.710  -7.209  9.976  1.00 47.73  ? 15   ASN A CA  1 
ATOM   93   C C   . ASN A 1 15 ? 25.082  -6.366  11.109 1.00 73.94  ? 15   ASN A C   1 
ATOM   94   O O   . ASN A 1 15 ? 25.212  -6.779  12.237 1.00 34.70  ? 15   ASN A O   1 
ATOM   95   C CB  . ASN A 1 15 ? 24.763  -8.253  9.485  1.00 38.65  ? 15   ASN A CB  1 
ATOM   96   C CG  . ASN A 1 15 ? 25.158  -8.756  8.158  1.00 60.31  ? 15   ASN A CG  1 
ATOM   97   O OD1 . ASN A 1 15 ? 24.336  -8.964  7.281  1.00 50.79  ? 15   ASN A OD1 1 
ATOM   98   N ND2 . ASN A 1 15 ? 26.443  -8.941  7.981  1.00 79.81  ? 15   ASN A ND2 1 
ATOM   99   N N   . LEU A 1 16 ? 24.455  -5.199  10.810 1.00 15.04  ? 16   LEU A N   1 
ATOM   100  C CA  . LEU A 1 16 ? 23.815  -4.398  11.780 1.00 25.35  ? 16   LEU A CA  1 
ATOM   101  C C   . LEU A 1 16 ? 22.503  -3.965  11.245 1.00 55.06  ? 16   LEU A C   1 
ATOM   102  O O   . LEU A 1 16 ? 22.419  -3.593  10.039 1.00 25.33  ? 16   LEU A O   1 
ATOM   103  C CB  . LEU A 1 16 ? 24.568  -3.135  12.060 1.00 32.78  ? 16   LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16 ? 25.867  -3.115  12.815 1.00 55.10  ? 16   LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16 ? 26.904  -3.791  11.932 1.00 53.34  ? 16   LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16 ? 26.225  -1.624  13.173 1.00 26.30  ? 16   LEU A CD2 1 
ATOM   107  N N   . ASP A 1 17 ? 21.508  -3.951  12.169 1.00 35.64  ? 17   ASP A N   1 
ATOM   108  C CA  . ASP A 1 17 ? 20.205  -3.336  11.920 1.00 39.70  ? 17   ASP A CA  1 
ATOM   109  C C   . ASP A 1 17 ? 20.224  -1.796  12.113 1.00 77.04  ? 17   ASP A C   1 
ATOM   110  O O   . ASP A 1 17 ? 20.286  -1.270  13.253 1.00 48.47  ? 17   ASP A O   1 
ATOM   111  C CB  . ASP A 1 17 ? 19.164  -3.966  12.754 1.00 32.47  ? 17   ASP A CB  1 
ATOM   112  C CG  . ASP A 1 17 ? 17.810  -3.366  12.502 1.00 87.55  ? 17   ASP A CG  1 
ATOM   113  O OD1 . ASP A 1 17 ? 17.374  -3.331  11.332 1.00 56.60  ? 17   ASP A OD1 1 
ATOM   114  O OD2 . ASP A 1 17 ? 17.169  -2.928  13.487 1.00 102.48 ? 17   ASP A OD2 1 
ATOM   115  N N   . VAL A 1 18 ? 20.239  -1.085  10.984 1.00 39.95  ? 18   VAL A N   1 
ATOM   116  C CA  . VAL A 1 18 ? 20.421  0.332   10.985 1.00 27.89  ? 18   VAL A CA  1 
ATOM   117  C C   . VAL A 1 18 ? 19.200  0.963   10.320 1.00 32.74  ? 18   VAL A C   1 
ATOM   118  O O   . VAL A 1 18 ? 19.297  1.948   9.737  1.00 38.45  ? 18   VAL A O   1 
ATOM   119  C CB  . VAL A 1 18 ? 21.704  0.705   10.340 1.00 41.91  ? 18   VAL A CB  1 
ATOM   120  C CG1 . VAL A 1 18 ? 22.783  0.331   11.194 1.00 25.99  ? 18   VAL A CG1 1 
ATOM   121  C CG2 . VAL A 1 18 ? 21.826  0.056   8.925  1.00 33.97  ? 18   VAL A CG2 1 
ATOM   122  N N   . LYS A 1 19 ? 18.061  0.318   10.439 1.00 33.98  ? 19   LYS A N   1 
ATOM   123  C CA  . LYS A 1 19 ? 16.896  0.656   9.681  1.00 40.45  ? 19   LYS A CA  1 
ATOM   124  C C   . LYS A 1 19 ? 16.336  2.042   10.013 1.00 55.72  ? 19   LYS A C   1 
ATOM   125  O O   . LYS A 1 19 ? 15.580  2.577   9.230  1.00 60.00  ? 19   LYS A O   1 
ATOM   126  C CB  . LYS A 1 19 ? 15.823  -0.402  9.860  1.00 30.03  ? 19   LYS A CB  1 
ATOM   127  C CG  . LYS A 1 19 ? 15.218  -0.475  11.218 1.00 30.03  ? 19   LYS A CG  1 
ATOM   128  C CD  . LYS A 1 19 ? 14.389  -1.786  11.439 1.00 63.01  ? 19   LYS A CD  1 
ATOM   129  C CE  . LYS A 1 19 ? 13.816  -1.894  12.903 1.00 53.20  ? 19   LYS A CE  1 
ATOM   130  N NZ  . LYS A 1 19 ? 14.859  -1.414  13.925 1.00 79.59  ? 19   LYS A NZ  1 
ATOM   131  N N   . HIS A 1 20 ? 16.729  2.633   11.133 1.00 39.12  ? 20   HIS A N   1 
ATOM   132  C CA  . HIS A 1 20 ? 16.172  3.914   11.545 1.00 42.00  ? 20   HIS A CA  1 
ATOM   133  C C   . HIS A 1 20 ? 16.953  5.080   10.996 1.00 51.10  ? 20   HIS A C   1 
ATOM   134  O O   . HIS A 1 20 ? 16.586  6.255   11.170 1.00 41.37  ? 20   HIS A O   1 
ATOM   135  C CB  . HIS A 1 20 ? 16.262  3.999   13.066 1.00 44.37  ? 20   HIS A CB  1 
ATOM   136  C CG  . HIS A 1 20 ? 15.270  3.153   13.770 1.00 60.67  ? 20   HIS A CG  1 
ATOM   137  N ND1 . HIS A 1 20 ? 15.649  2.185   14.669 1.00 52.85  ? 20   HIS A ND1 1 
ATOM   138  C CD2 . HIS A 1 20 ? 13.915  3.100   13.695 1.00 30.79  ? 20   HIS A CD2 1 
ATOM   139  C CE1 . HIS A 1 20 ? 14.579  1.564   15.114 1.00 46.87  ? 20   HIS A CE1 1 
ATOM   140  N NE2 . HIS A 1 20 ? 13.516  2.097   14.536 1.00 61.64  ? 20   HIS A NE2 1 
ATOM   141  N N   . PHE A 1 21 ? 18.072  4.711   10.390 1.00 19.70  ? 21   PHE A N   1 
ATOM   142  C CA  . PHE A 1 21 ? 19.019  5.593   9.767  1.00 34.67  ? 21   PHE A CA  1 
ATOM   143  C C   . PHE A 1 21 ? 18.986  5.513   8.223  1.00 45.97  ? 21   PHE A C   1 
ATOM   144  O O   . PHE A 1 21 ? 18.897  4.439   7.605  1.00 42.07  ? 21   PHE A O   1 
ATOM   145  C CB  . PHE A 1 21 ? 20.449  5.354   10.316 1.00 49.64  ? 21   PHE A CB  1 
ATOM   146  C CG  . PHE A 1 21 ? 20.524  5.381   11.816 1.00 39.03  ? 21   PHE A CG  1 
ATOM   147  C CD1 . PHE A 1 21 ? 20.734  6.565   12.501 1.00 26.15  ? 21   PHE A CD1 1 
ATOM   148  C CD2 . PHE A 1 21 ? 20.335  4.251   12.539 1.00 45.85  ? 21   PHE A CD2 1 
ATOM   149  C CE1 . PHE A 1 21 ? 20.794  6.620   13.848 1.00 26.55  ? 21   PHE A CE1 1 
ATOM   150  C CE2 . PHE A 1 21 ? 20.372  4.316   13.907 1.00 32.21  ? 21   PHE A CE2 1 
ATOM   151  C CZ  . PHE A 1 21 ? 20.619  5.503   14.558 1.00 30.31  ? 21   PHE A CZ  1 
ATOM   152  N N   . SER A 1 22 ? 19.013  6.696   7.622  1.00 38.14  ? 22   SER A N   1 
ATOM   153  C CA  . SER A 1 22 ? 19.104  6.823   6.220  1.00 60.11  ? 22   SER A CA  1 
ATOM   154  C C   . SER A 1 22 ? 20.580  6.802   5.931  1.00 38.49  ? 22   SER A C   1 
ATOM   155  O O   . SER A 1 22 ? 21.338  7.001   6.819  1.00 36.44  ? 22   SER A O   1 
ATOM   156  C CB  . SER A 1 22 ? 18.409  8.104   5.828  1.00 33.13  ? 22   SER A CB  1 
ATOM   157  O OG  . SER A 1 22 ? 19.121  9.219   6.200  1.00 52.70  ? 22   SER A OG  1 
ATOM   158  N N   . PRO A 1 23 ? 20.980  6.527   4.680  1.00 51.39  ? 23   PRO A N   1 
ATOM   159  C CA  . PRO A 1 23 ? 22.384  6.402   4.259  1.00 42.63  ? 23   PRO A CA  1 
ATOM   160  C C   . PRO A 1 23 ? 23.347  7.597   4.476  1.00 46.07  ? 23   PRO A C   1 
ATOM   161  O O   . PRO A 1 23 ? 24.509  7.378   4.800  1.00 33.90  ? 23   PRO A O   1 
ATOM   162  C CB  . PRO A 1 23 ? 22.249  6.047   2.788  1.00 42.20  ? 23   PRO A CB  1 
ATOM   163  C CG  . PRO A 1 23 ? 20.914  5.422   2.644  1.00 14.55  ? 23   PRO A CG  1 
ATOM   164  C CD  . PRO A 1 23 ? 20.056  6.184   3.579  1.00 47.41  ? 23   PRO A CD  1 
ATOM   165  N N   . GLU A 1 24 ? 22.893  8.826   4.311  1.00 35.83  ? 24   GLU A N   1 
ATOM   166  C CA  . GLU A 1 24 ? 23.661  9.996   4.733  1.00 45.33  ? 24   GLU A CA  1 
ATOM   167  C C   . GLU A 1 24 ? 23.894  10.103  6.264  1.00 52.82  ? 24   GLU A C   1 
ATOM   168  O O   . GLU A 1 24 ? 24.797  10.807  6.695  1.00 50.41  ? 24   GLU A O   1 
ATOM   169  C CB  . GLU A 1 24 ? 22.971  11.269  4.271  1.00 48.84  ? 24   GLU A CB  1 
ATOM   170  C CG  . GLU A 1 24 ? 21.488  11.332  4.538  1.00 39.85  ? 24   GLU A CG  1 
ATOM   171  C CD  . GLU A 1 24 ? 20.710  10.477  3.571  1.00 90.83  ? 24   GLU A CD  1 
ATOM   172  O OE1 . GLU A 1 24 ? 21.239  10.324  2.444  1.00 68.41  ? 24   GLU A OE1 1 
ATOM   173  O OE2 . GLU A 1 24 ? 19.596  9.970   3.912  1.00 73.35  ? 24   GLU A OE2 1 
ATOM   174  N N   . GLU A 1 25 ? 23.063  9.429   7.074  1.00 45.94  ? 25   GLU A N   1 
ATOM   175  C CA  . GLU A 1 25 ? 23.208  9.331   8.550  1.00 22.42  ? 25   GLU A CA  1 
ATOM   176  C C   . GLU A 1 25 ? 24.173  8.276   9.166  1.00 25.61  ? 25   GLU A C   1 
ATOM   177  O O   . GLU A 1 25 ? 24.368  8.235   10.346 1.00 37.25  ? 25   GLU A O   1 
ATOM   178  C CB  . GLU A 1 25 ? 21.839  9.250   9.227  1.00 32.58  ? 25   GLU A CB  1 
ATOM   179  C CG  . GLU A 1 25 ? 20.983  10.478  8.951  1.00 21.37  ? 25   GLU A CG  1 
ATOM   180  C CD  . GLU A 1 25 ? 19.463  10.265  9.044  1.00 62.72  ? 25   GLU A CD  1 
ATOM   181  O OE1 . GLU A 1 25 ? 19.006  9.117   9.062  1.00 53.70  ? 25   GLU A OE1 1 
ATOM   182  O OE2 . GLU A 1 25 ? 18.689  11.259  9.071  1.00 33.61  ? 25   GLU A OE2 1 
ATOM   183  N N   . LEU A 1 26 ? 24.840  7.516   8.336  1.00 38.97  ? 26   LEU A N   1 
ATOM   184  C CA  . LEU A 1 26 ? 25.747  6.465   8.726  1.00 46.21  ? 26   LEU A CA  1 
ATOM   185  C C   . LEU A 1 26 ? 27.132  6.765   8.170  1.00 37.42  ? 26   LEU A C   1 
ATOM   186  O O   . LEU A 1 26 ? 27.243  7.398   7.131  1.00 58.15  ? 26   LEU A O   1 
ATOM   187  C CB  . LEU A 1 26 ? 25.219  5.135   8.145  1.00 20.28  ? 26   LEU A CB  1 
ATOM   188  C CG  . LEU A 1 26 ? 23.885  4.775   8.714  1.00 32.72  ? 26   LEU A CG  1 
ATOM   189  C CD1 . LEU A 1 26 ? 23.148  3.650   7.890  1.00 36.93  ? 26   LEU A CD1 1 
ATOM   190  C CD2 . LEU A 1 26 ? 24.233  4.394   10.095 1.00 16.28  ? 26   LEU A CD2 1 
ATOM   191  N N   . LYS A 1 27 ? 28.170  6.291   8.855  1.00 23.64  ? 27   LYS A N   1 
ATOM   192  C CA  . LYS A 1 27 ? 29.567  6.466   8.420  1.00 56.06  ? 27   LYS A CA  1 
ATOM   193  C C   . LYS A 1 27 ? 30.370  5.304   8.911  1.00 39.49  ? 27   LYS A C   1 
ATOM   194  O O   . LYS A 1 27 ? 30.300  5.004   10.074 1.00 23.40  ? 27   LYS A O   1 
ATOM   195  C CB  . LYS A 1 27 ? 30.199  7.778   8.928  1.00 28.82  ? 27   LYS A CB  1 
ATOM   196  N N   . VAL A 1 28 ? 31.069  4.634   8.000  1.00 21.06  ? 28   VAL A N   1 
ATOM   197  C CA  . VAL A 1 28 ? 32.043  3.565   8.299  1.00 39.89  ? 28   VAL A CA  1 
ATOM   198  C C   . VAL A 1 28 ? 33.482  4.051   8.078  1.00 42.40  ? 28   VAL A C   1 
ATOM   199  O O   . VAL A 1 28 ? 33.786  4.671   7.047  1.00 58.16  ? 28   VAL A O   1 
ATOM   200  C CB  . VAL A 1 28 ? 31.740  2.236   7.486  1.00 25.31  ? 28   VAL A CB  1 
ATOM   201  C CG1 . VAL A 1 28 ? 32.617  1.058   7.931  1.00 29.10  ? 28   VAL A CG1 1 
ATOM   202  C CG2 . VAL A 1 28 ? 30.324  1.854   7.663  1.00 18.68  ? 28   VAL A CG2 1 
ATOM   203  N N   . LYS A 1 29 ? 34.349  3.873   9.069  1.00 51.80  ? 29   LYS A N   1 
ATOM   204  C CA  . LYS A 1 29 ? 35.776  4.229   8.951  1.00 44.34  ? 29   LYS A CA  1 
ATOM   205  C C   . LYS A 1 29 ? 36.545  3.019   9.442  1.00 56.48  ? 29   LYS A C   1 
ATOM   206  O O   . LYS A 1 29 ? 36.243  2.456   10.492 1.00 51.93  ? 29   LYS A O   1 
ATOM   207  C CB  . LYS A 1 29 ? 36.198  5.447   9.801  1.00 43.69  ? 29   LYS A CB  1 
ATOM   208  C CG  . LYS A 1 29 ? 35.846  6.777   9.266  1.00 62.08  ? 29   LYS A CG  1 
ATOM   209  N N   . VAL A 1 30 ? 37.551  2.605   8.695  1.00 51.62  ? 30   VAL A N   1 
ATOM   210  C CA  . VAL A 1 30 ? 38.625  1.828   9.302  1.00 60.40  ? 30   VAL A CA  1 
ATOM   211  C C   . VAL A 1 30 ? 39.716  2.777   9.806  1.00 83.19  ? 30   VAL A C   1 
ATOM   212  O O   . VAL A 1 30 ? 40.340  3.480   9.015  1.00 38.74  ? 30   VAL A O   1 
ATOM   213  C CB  . VAL A 1 30 ? 39.229  0.845   8.353  1.00 44.06  ? 30   VAL A CB  1 
ATOM   214  C CG1 . VAL A 1 30 ? 40.336  0.055   9.062  1.00 52.37  ? 30   VAL A CG1 1 
ATOM   215  C CG2 . VAL A 1 30 ? 38.128  -0.086  7.808  1.00 33.66  ? 30   VAL A CG2 1 
ATOM   216  N N   . LEU A 1 31 ? 39.868  2.843   11.132 1.00 78.56  ? 31   LEU A N   1 
ATOM   217  C CA  . LEU A 1 31 ? 40.928  3.597   11.774 1.00 63.44  ? 31   LEU A CA  1 
ATOM   218  C C   . LEU A 1 31 ? 41.862  2.583   12.432 1.00 80.38  ? 31   LEU A C   1 
ATOM   219  O O   . LEU A 1 31 ? 41.646  2.161   13.571 1.00 72.21  ? 31   LEU A O   1 
ATOM   220  C CB  . LEU A 1 31 ? 40.358  4.597   12.792 1.00 70.67  ? 31   LEU A CB  1 
ATOM   221  C CG  . LEU A 1 31 ? 39.527  5.779   12.226 1.00 102.31 ? 31   LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 31 ? 39.082  6.756   13.307 1.00 84.47  ? 31   LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 31 ? 40.238  6.554   11.132 1.00 95.32  ? 31   LEU A CD2 1 
ATOM   224  N N   . GLY A 1 32 ? 42.878  2.150   11.688 1.00 93.76  ? 32   GLY A N   1 
ATOM   225  C CA  . GLY A 1 32 ? 43.862  1.191   12.190 1.00 76.57  ? 32   GLY A CA  1 
ATOM   226  C C   . GLY A 1 32 ? 43.391  -0.252  12.189 1.00 84.29  ? 32   GLY A C   1 
ATOM   227  O O   . GLY A 1 32 ? 43.071  -0.784  11.125 1.00 76.23  ? 32   GLY A O   1 
ATOM   228  N N   . ASP A 1 33 ? 43.354  -0.874  13.379 1.00 97.78  ? 33   ASP A N   1 
ATOM   229  C CA  . ASP A 1 33 ? 42.770  -2.220  13.569 1.00 100.55 ? 33   ASP A CA  1 
ATOM   230  C C   . ASP A 1 33 ? 41.344  -2.197  14.162 1.00 81.98  ? 33   ASP A C   1 
ATOM   231  O O   . ASP A 1 33 ? 40.903  -3.147  14.834 1.00 53.80  ? 33   ASP A O   1 
ATOM   232  C CB  . ASP A 1 33 ? 43.687  -3.115  14.410 1.00 85.31  ? 33   ASP A CB  1 
ATOM   233  N N   . VAL A 1 34 ? 40.625  -1.114  13.886 1.00 50.05  ? 34   VAL A N   1 
ATOM   234  C CA  . VAL A 1 34 ? 39.281  -0.962  14.360 1.00 54.41  ? 34   VAL A CA  1 
ATOM   235  C C   . VAL A 1 34 ? 38.335  -0.486  13.281 1.00 63.17  ? 34   VAL A C   1 
ATOM   236  O O   . VAL A 1 34 ? 38.565  0.544   12.657 1.00 62.40  ? 34   VAL A O   1 
ATOM   237  C CB  . VAL A 1 34 ? 39.236  0.065   15.482 1.00 49.34  ? 34   VAL A CB  1 
ATOM   238  C CG1 . VAL A 1 34 ? 37.880  0.109   16.111 1.00 50.60  ? 34   VAL A CG1 1 
ATOM   239  C CG2 . VAL A 1 34 ? 40.263  -0.253  16.537 1.00 47.04  ? 34   VAL A CG2 1 
ATOM   240  N N   . ILE A 1 35 ? 37.252  -1.232  13.089 1.00 53.52  ? 35   ILE A N   1 
ATOM   241  C CA  . ILE A 1 35 ? 36.068  -0.693  12.432 1.00 46.02  ? 35   ILE A CA  1 
ATOM   242  C C   . ILE A 1 35 ? 35.188  0.215   13.342 1.00 40.34  ? 35   ILE A C   1 
ATOM   243  O O   . ILE A 1 35 ? 34.595  -0.217  14.354 1.00 40.68  ? 35   ILE A O   1 
ATOM   244  C CB  . ILE A 1 35 ? 35.250  -1.841  11.848 1.00 52.66  ? 35   ILE A CB  1 
ATOM   245  C CG1 . ILE A 1 35 ? 36.118  -2.658  10.892 1.00 55.73  ? 35   ILE A CG1 1 
ATOM   246  C CG2 . ILE A 1 35 ? 33.984  -1.337  11.186 1.00 40.74  ? 35   ILE A CG2 1 
ATOM   247  C CD1 . ILE A 1 35 ? 35.775  -4.180  10.842 1.00 33.78  ? 35   ILE A CD1 1 
ATOM   248  N N   . GLU A 1 36 ? 35.067  1.470   12.944 1.00 42.34  ? 36   GLU A N   1 
ATOM   249  C CA  . GLU A 1 36 ? 34.060  2.356   13.535 1.00 51.16  ? 36   GLU A CA  1 
ATOM   250  C C   . GLU A 1 36 ? 32.777  2.541   12.704 1.00 49.34  ? 36   GLU A C   1 
ATOM   251  O O   . GLU A 1 36 ? 32.829  2.881   11.551 1.00 41.69  ? 36   GLU A O   1 
ATOM   252  C CB  . GLU A 1 36 ? 34.658  3.712   13.781 1.00 36.30  ? 36   GLU A CB  1 
ATOM   253  C CG  . GLU A 1 36 ? 35.898  3.693   14.580 1.00 53.25  ? 36   GLU A CG  1 
ATOM   254  C CD  . GLU A 1 36 ? 36.402  5.098   14.831 1.00 106.05 ? 36   GLU A CD  1 
ATOM   255  O OE1 . GLU A 1 36 ? 35.645  6.063   14.536 1.00 93.61  ? 36   GLU A OE1 1 
ATOM   256  O OE2 . GLU A 1 36 ? 37.549  5.237   15.320 1.00 126.20 ? 36   GLU A OE2 1 
ATOM   257  N N   . VAL A 1 37 ? 31.628  2.265   13.303 1.00 44.67  ? 37   VAL A N   1 
ATOM   258  C CA  . VAL A 1 37 ? 30.354  2.590   12.697 1.00 28.75  ? 37   VAL A CA  1 
ATOM   259  C C   . VAL A 1 37 ? 29.694  3.705   13.496 1.00 50.17  ? 37   VAL A C   1 
ATOM   260  O O   . VAL A 1 37 ? 29.578  3.635   14.721 1.00 30.64  ? 37   VAL A O   1 
ATOM   261  C CB  . VAL A 1 37 ? 29.390  1.393   12.636 1.00 22.69  ? 37   VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 37 ? 28.147  1.789   11.880 1.00 37.53  ? 37   VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 37 ? 30.017  0.223   11.960 1.00 19.64  ? 37   VAL A CG2 1 
ATOM   264  N N   . HIS A 1 38 ? 29.298  4.761   12.816 1.00 27.74  ? 38   HIS A N   1 
ATOM   265  C CA  . HIS A 1 38 ? 28.650  5.834   13.522 1.00 43.69  ? 38   HIS A CA  1 
ATOM   266  C C   . HIS A 1 38 ? 27.290  6.104   12.867 1.00 45.36  ? 38   HIS A C   1 
ATOM   267  O O   . HIS A 1 38 ? 27.143  6.077   11.671 1.00 35.37  ? 38   HIS A O   1 
ATOM   268  C CB  . HIS A 1 38 ? 29.515  7.094   13.567 1.00 22.42  ? 38   HIS A CB  1 
ATOM   269  C CG  . HIS A 1 38 ? 28.838  8.244   14.249 1.00 61.53  ? 38   HIS A CG  1 
ATOM   270  N ND1 . HIS A 1 38 ? 28.621  8.273   15.615 1.00 64.81  ? 38   HIS A ND1 1 
ATOM   271  C CD2 . HIS A 1 38 ? 28.315  9.389   13.753 1.00 60.41  ? 38   HIS A CD2 1 
ATOM   272  C CE1 . HIS A 1 38 ? 28.016  9.402   15.926 1.00 57.40  ? 38   HIS A CE1 1 
ATOM   273  N NE2 . HIS A 1 38 ? 27.814  10.087  14.820 1.00 50.67  ? 38   HIS A NE2 1 
ATOM   274  N N   . GLY A 1 39 ? 26.279  6.340   13.656 1.00 34.75  ? 39   GLY A N   1 
ATOM   275  C CA  . GLY A 1 39 ? 24.985  6.726   13.142 1.00 38.75  ? 39   GLY A CA  1 
ATOM   276  C C   . GLY A 1 39 ? 24.370  7.830   14.001 1.00 62.99  ? 39   GLY A C   1 
ATOM   277  O O   . GLY A 1 39 ? 24.413  7.709   15.247 1.00 36.43  ? 39   GLY A O   1 
ATOM   278  N N   . LYS A 1 40 ? 23.860  8.908   13.350 1.00 36.36  ? 40   LYS A N   1 
ATOM   279  C CA  . LYS A 1 40 ? 23.281  10.102  14.059 1.00 54.30  ? 40   LYS A CA  1 
ATOM   280  C C   . LYS A 1 40 ? 22.126  10.568  13.223 1.00 41.77  ? 40   LYS A C   1 
ATOM   281  O O   . LYS A 1 40 ? 22.244  10.714  12.010 1.00 43.21  ? 40   LYS A O   1 
ATOM   282  C CB  . LYS A 1 40 ? 24.261  11.329  14.400 1.00 19.76  ? 40   LYS A CB  1 
ATOM   283  C CG  . LYS A 1 40 ? 23.526  12.494  15.174 1.00 23.39  ? 40   LYS A CG  1 
ATOM   284  N N   . HIS A 1 41 ? 21.021  10.833  13.903 1.00 47.71  ? 41   HIS A N   1 
ATOM   285  C CA  . HIS A 1 41 ? 19.823  11.375  13.287 1.00 49.91  ? 41   HIS A CA  1 
ATOM   286  C C   . HIS A 1 41 ? 19.072  12.313  14.253 1.00 50.30  ? 41   HIS A C   1 
ATOM   287  O O   . HIS A 1 41 ? 18.733  11.946  15.406 1.00 52.92  ? 41   HIS A O   1 
ATOM   288  C CB  . HIS A 1 41 ? 18.922  10.252  12.674 1.00 32.49  ? 41   HIS A CB  1 
ATOM   289  C CG  . HIS A 1 41 ? 17.764  9.834   13.515 1.00 32.99  ? 41   HIS A CG  1 
ATOM   290  N ND1 . HIS A 1 41 ? 17.535  8.516   13.834 1.00 38.23  ? 41   HIS A ND1 1 
ATOM   291  C CD2 . HIS A 1 41 ? 16.764  10.542  14.079 1.00 28.61  ? 41   HIS A CD2 1 
ATOM   292  C CE1 . HIS A 1 41 ? 16.421  8.422   14.533 1.00 30.10  ? 41   HIS A CE1 1 
ATOM   293  N NE2 . HIS A 1 41 ? 15.927  9.637   14.681 1.00 38.65  ? 41   HIS A NE2 1 
ATOM   294  N N   . GLU A 1 42 ? 18.841  13.515  13.732 1.00 29.92  ? 42   GLU A N   1 
ATOM   295  C CA  . GLU A 1 42 ? 18.242  14.638  14.378 1.00 48.93  ? 42   GLU A CA  1 
ATOM   296  C C   . GLU A 1 42 ? 16.745  14.353  14.645 1.00 38.89  ? 42   GLU A C   1 
ATOM   297  O O   . GLU A 1 42 ? 16.216  13.371  14.164 1.00 38.46  ? 42   GLU A O   1 
ATOM   298  C CB  . GLU A 1 42 ? 18.617  15.948  13.601 1.00 46.91  ? 42   GLU A CB  1 
ATOM   299  N N   . GLU A 1 43 ? 16.107  15.140  15.507 1.00 40.30  ? 43   GLU A N   1 
ATOM   300  C CA  . GLU A 1 43 ? 14.745  14.876  15.948 1.00 55.82  ? 43   GLU A CA  1 
ATOM   301  C C   . GLU A 1 43 ? 13.796  14.764  14.752 1.00 52.09  ? 43   GLU A C   1 
ATOM   302  O O   . GLU A 1 43 ? 13.900  15.521  13.801 1.00 46.05  ? 43   GLU A O   1 
ATOM   303  C CB  . GLU A 1 43 ? 14.284  15.994  16.918 1.00 37.61  ? 43   GLU A CB  1 
ATOM   304  C CG  . GLU A 1 43 ? 13.000  15.662  17.642 1.00 80.62  ? 43   GLU A CG  1 
ATOM   305  C CD  . GLU A 1 43 ? 12.666  16.675  18.678 1.00 84.39  ? 43   GLU A CD  1 
ATOM   306  O OE1 . GLU A 1 43 ? 13.191  17.791  18.573 1.00 58.95  ? 43   GLU A OE1 1 
ATOM   307  O OE2 . GLU A 1 43 ? 11.881  16.343  19.593 1.00 112.88 ? 43   GLU A OE2 1 
ATOM   308  N N   . ARG A 1 44 ? 12.820  13.872  14.810 1.00 40.02  ? 44   ARG A N   1 
ATOM   309  C CA  . ARG A 1 44 ? 12.026  13.606  13.612 1.00 43.24  ? 44   ARG A CA  1 
ATOM   310  C C   . ARG A 1 44 ? 10.795  12.889  14.075 1.00 25.62  ? 44   ARG A C   1 
ATOM   311  O O   . ARG A 1 44 ? 10.843  12.102  14.981 1.00 49.31  ? 44   ARG A O   1 
ATOM   312  C CB  . ARG A 1 44 ? 12.878  12.770  12.591 1.00 34.36  ? 44   ARG A CB  1 
ATOM   313  C CG  . ARG A 1 44 ? 12.097  11.735  11.868 1.00 52.21  ? 44   ARG A CG  1 
ATOM   314  C CD  . ARG A 1 44 ? 12.809  10.406  11.768 1.00 56.46  ? 44   ARG A CD  1 
ATOM   315  N NE  . ARG A 1 44 ? 14.081  10.537  11.101 1.00 38.42  ? 44   ARG A NE  1 
ATOM   316  C CZ  . ARG A 1 44 ? 14.909  9.533   10.872 1.00 87.16  ? 44   ARG A CZ  1 
ATOM   317  N NH1 . ARG A 1 44 ? 14.615  8.254   11.232 1.00 55.10  ? 44   ARG A NH1 1 
ATOM   318  N NH2 . ARG A 1 44 ? 16.036  9.855   10.278 1.00 25.77  ? 44   ARG A NH2 1 
ATOM   319  N N   . GLN A 1 45 ? 9.662   13.187  13.492 1.00 52.75  ? 45   GLN A N   1 
ATOM   320  C CA  . GLN A 1 45 ? 8.407   12.523  13.850 1.00 35.25  ? 45   GLN A CA  1 
ATOM   321  C C   . GLN A 1 45 ? 8.435   11.037  13.490 1.00 26.10  ? 45   GLN A C   1 
ATOM   322  O O   . GLN A 1 45 ? 8.981   10.661  12.469 1.00 34.13  ? 45   GLN A O   1 
ATOM   323  C CB  . GLN A 1 45 ? 7.291   13.149  13.025 1.00 27.53  ? 45   GLN A CB  1 
ATOM   324  C CG  . GLN A 1 45 ? 6.094   13.729  13.705 1.00 74.18  ? 45   GLN A CG  1 
ATOM   325  C CD  . GLN A 1 45 ? 5.340   14.738  12.793 1.00 83.58  ? 45   GLN A CD  1 
ATOM   326  O OE1 . GLN A 1 45 ? 5.788   15.099  11.687 1.00 47.10  ? 45   GLN A OE1 1 
ATOM   327  N NE2 . GLN A 1 45 ? 4.193   15.196  13.269 1.00 37.85  ? 45   GLN A NE2 1 
ATOM   328  N N   . ASP A 1 46 ? 7.796   10.186  14.291 1.00 40.06  ? 46   ASP A N   1 
ATOM   329  C CA  . ASP A 1 46 ? 7.562   8.790   13.883 1.00 26.83  ? 46   ASP A CA  1 
ATOM   330  C C   . ASP A 1 46 ? 6.182   8.217   14.307 1.00 38.29  ? 46   ASP A C   1 
ATOM   331  O O   . ASP A 1 46 ? 5.237   8.967   14.609 1.00 55.98  ? 46   ASP A O   1 
ATOM   332  C CB  . ASP A 1 46 ? 8.760   7.869   14.285 1.00 20.08  ? 46   ASP A CB  1 
ATOM   333  C CG  . ASP A 1 46 ? 8.718   7.397   15.751 1.00 49.01  ? 46   ASP A CG  1 
ATOM   334  O OD1 . ASP A 1 46 ? 7.722   7.697   16.482 1.00 35.33  ? 46   ASP A OD1 1 
ATOM   335  O OD2 . ASP A 1 46 ? 9.705   6.713   16.171 1.00 61.86  ? 46   ASP A OD2 1 
ATOM   336  N N   . GLU A 1 47 ? 6.036   6.894   14.294 1.00 45.05  ? 47   GLU A N   1 
ATOM   337  C CA  . GLU A 1 47 ? 4.770   6.329   14.732 1.00 57.45  ? 47   GLU A CA  1 
ATOM   338  C C   . GLU A 1 47 ? 4.282   6.893   16.123 1.00 46.74  ? 47   GLU A C   1 
ATOM   339  O O   . GLU A 1 47 ? 3.134   7.241   16.222 1.00 58.56  ? 47   GLU A O   1 
ATOM   340  C CB  . GLU A 1 47 ? 4.716   4.780   14.542 1.00 50.89  ? 47   GLU A CB  1 
ATOM   341  C CG  . GLU A 1 47 ? 4.383   3.970   15.834 1.00 146.68 ? 47   GLU A CG  1 
ATOM   342  C CD  . GLU A 1 47 ? 2.887   3.628   16.012 1.00 147.83 ? 47   GLU A CD  1 
ATOM   343  O OE1 . GLU A 1 47 ? 2.206   3.366   14.997 1.00 116.49 ? 47   GLU A OE1 1 
ATOM   344  O OE2 . GLU A 1 47 ? 2.393   3.599   17.170 1.00 125.25 ? 47   GLU A OE2 1 
ATOM   345  N N   . HIS A 1 48 ? 5.128   7.074   17.144 1.00 50.19  ? 48   HIS A N   1 
ATOM   346  C CA  . HIS A 1 48 ? 4.592   7.528   18.429 1.00 58.63  ? 48   HIS A CA  1 
ATOM   347  C C   . HIS A 1 48 ? 4.909   8.949   18.930 1.00 61.49  ? 48   HIS A C   1 
ATOM   348  O O   . HIS A 1 48 ? 4.398   9.366   19.974 1.00 58.91  ? 48   HIS A O   1 
ATOM   349  C CB  . HIS A 1 48 ? 4.848   6.493   19.537 1.00 104.04 ? 48   HIS A CB  1 
ATOM   350  C CG  . HIS A 1 48 ? 3.658   6.282   20.443 1.00 156.12 ? 48   HIS A CG  1 
ATOM   351  N ND1 . HIS A 1 48 ? 3.111   7.289   21.219 1.00 87.13  ? 48   HIS A ND1 1 
ATOM   352  C CD2 . HIS A 1 48 ? 2.899   5.182   20.676 1.00 144.81 ? 48   HIS A CD2 1 
ATOM   353  C CE1 . HIS A 1 48 ? 2.081   6.814   21.897 1.00 72.54  ? 48   HIS A CE1 1 
ATOM   354  N NE2 . HIS A 1 48 ? 1.927   5.538   21.583 1.00 75.76  ? 48   HIS A NE2 1 
ATOM   355  N N   . GLY A 1 49 ? 5.679   9.727   18.189 1.00 43.59  ? 49   GLY A N   1 
ATOM   356  C CA  . GLY A 1 49 ? 6.067   10.998  18.742 1.00 48.53  ? 49   GLY A CA  1 
ATOM   357  C C   . GLY A 1 49 ? 7.262   11.458  18.013 1.00 41.10  ? 49   GLY A C   1 
ATOM   358  O O   . GLY A 1 49 ? 7.317   11.291  16.805 1.00 65.00  ? 49   GLY A O   1 
ATOM   359  N N   . PHE A 1 50 ? 8.227   12.012  18.733 1.00 44.37  ? 50   PHE A N   1 
ATOM   360  C CA  . PHE A 1 50 ? 9.451   12.610  18.131 1.00 45.30  ? 50   PHE A CA  1 
ATOM   361  C C   . PHE A 1 50 ? 10.654  11.967  18.731 1.00 54.65  ? 50   PHE A C   1 
ATOM   362  O O   . PHE A 1 50 ? 10.663  11.706  19.923 1.00 48.15  ? 50   PHE A O   1 
ATOM   363  C CB  . PHE A 1 50 ? 9.554   14.106  18.382 1.00 30.24  ? 50   PHE A CB  1 
ATOM   364  C CG  . PHE A 1 50 ? 8.493   14.889  17.701 1.00 63.48  ? 50   PHE A CG  1 
ATOM   365  C CD1 . PHE A 1 50 ? 8.727   15.479  16.482 1.00 62.70  ? 50   PHE A CD1 1 
ATOM   366  C CD2 . PHE A 1 50 ? 7.228   14.993  18.268 1.00 73.26  ? 50   PHE A CD2 1 
ATOM   367  C CE1 . PHE A 1 50 ? 7.734   16.172  15.853 1.00 62.61  ? 50   PHE A CE1 1 
ATOM   368  C CE2 . PHE A 1 50 ? 6.236   15.689  17.647 1.00 67.40  ? 50   PHE A CE2 1 
ATOM   369  C CZ  . PHE A 1 50 ? 6.500   16.286  16.433 1.00 64.07  ? 50   PHE A CZ  1 
ATOM   370  N N   . ILE A 1 51 ? 11.683  11.727  17.928 1.00 41.23  ? 51   ILE A N   1 
ATOM   371  C CA  . ILE A 1 51 ? 12.738  10.829  18.378 1.00 36.81  ? 51   ILE A CA  1 
ATOM   372  C C   . ILE A 1 51 ? 14.057  11.143  17.682 1.00 62.09  ? 51   ILE A C   1 
ATOM   373  O O   . ILE A 1 51 ? 14.044  11.081  16.481 1.00 26.71  ? 51   ILE A O   1 
ATOM   374  C CB  . ILE A 1 51 ? 12.288  9.327   18.238 1.00 41.67  ? 51   ILE A CB  1 
ATOM   375  C CG1 . ILE A 1 51 ? 13.442  8.314   18.304 1.00 42.89  ? 51   ILE A CG1 1 
ATOM   376  C CG2 . ILE A 1 51 ? 11.386  9.114   17.008 1.00 25.40  ? 51   ILE A CG2 1 
ATOM   377  C CD1 . ILE A 1 51 ? 14.205  8.214   19.568 1.00 11.83  ? 51   ILE A CD1 1 
ATOM   378  N N   . SER A 1 52 ? 15.137  11.543  18.420 1.00 38.86  ? 52   SER A N   1 
ATOM   379  C CA  . SER A 1 52 ? 16.508  11.584  17.877 1.00 56.25  ? 52   SER A CA  1 
ATOM   380  C C   . SER A 1 52 ? 17.314  10.392  18.398 1.00 36.41  ? 52   SER A C   1 
ATOM   381  O O   . SER A 1 52 ? 16.956  9.863   19.440 1.00 46.75  ? 52   SER A O   1 
ATOM   382  C CB  . SER A 1 52 ? 17.241  12.907  18.149 1.00 27.12  ? 52   SER A CB  1 
ATOM   383  O OG  . SER A 1 52 ? 17.185  13.263  19.479 1.00 49.80  ? 52   SER A OG  1 
ATOM   384  N N   . ARG A 1 53 ? 18.368  9.978   17.655 1.00 37.11  ? 53   ARG A N   1 
ATOM   385  C CA  . ARG A 1 53 ? 19.190  8.758   17.963 1.00 26.28  ? 53   ARG A CA  1 
ATOM   386  C C   . ARG A 1 53 ? 20.609  8.925   17.578 1.00 24.98  ? 53   ARG A C   1 
ATOM   387  O O   . ARG A 1 53 ? 20.872  9.494   16.545 1.00 34.15  ? 53   ARG A O   1 
ATOM   388  C CB  . ARG A 1 53 ? 18.711  7.473   17.285 1.00 19.34  ? 53   ARG A CB  1 
ATOM   389  C CG  . ARG A 1 53 ? 17.283  6.995   17.606 1.00 12.28  ? 53   ARG A CG  1 
ATOM   390  C CD  . ARG A 1 53 ? 17.029  5.826   16.785 1.00 27.16  ? 53   ARG A CD  1 
ATOM   391  N NE  . ARG A 1 53 ? 15.759  5.219   16.974 1.00 32.44  ? 53   ARG A NE  1 
ATOM   392  C CZ  . ARG A 1 53 ? 14.681  5.606   16.332 1.00 36.58  ? 53   ARG A CZ  1 
ATOM   393  N NH1 . ARG A 1 53 ? 14.704  6.609   15.466 1.00 37.85  ? 53   ARG A NH1 1 
ATOM   394  N NH2 . ARG A 1 53 ? 13.603  4.977   16.560 1.00 20.00  ? 53   ARG A NH2 1 
ATOM   395  N N   . GLU A 1 54 ? 21.533  8.461   18.422 1.00 27.76  ? 54   GLU A N   1 
ATOM   396  C CA  . GLU A 1 54 ? 22.948  8.424   18.095 1.00 22.17  ? 54   GLU A CA  1 
ATOM   397  C C   . GLU A 1 54 ? 23.596  7.197   18.654 1.00 28.21  ? 54   GLU A C   1 
ATOM   398  O O   . GLU A 1 54 ? 23.174  6.700   19.668 1.00 38.77  ? 54   GLU A O   1 
ATOM   399  C CB  . GLU A 1 54 ? 23.694  9.690   18.493 1.00 17.41  ? 54   GLU A CB  1 
ATOM   400  C CG  . GLU A 1 54 ? 25.004  9.771   17.884 1.00 35.14  ? 54   GLU A CG  1 
ATOM   401  C CD  . GLU A 1 54 ? 25.765  11.050  18.187 1.00 70.96  ? 54   GLU A CD  1 
ATOM   402  O OE1 . GLU A 1 54 ? 25.183  11.957  18.802 1.00 44.59  ? 54   GLU A OE1 1 
ATOM   403  O OE2 . GLU A 1 54 ? 26.960  11.152  17.818 1.00 54.15  ? 54   GLU A OE2 1 
ATOM   404  N N   . PHE A 1 55 ? 24.586  6.655   17.944 1.00 36.16  ? 55   PHE A N   1 
ATOM   405  C CA  . PHE A 1 55 ? 25.264  5.440   18.374 1.00 32.63  ? 55   PHE A CA  1 
ATOM   406  C C   . PHE A 1 55 ? 26.613  5.403   17.744 1.00 35.45  ? 55   PHE A C   1 
ATOM   407  O O   . PHE A 1 55 ? 26.813  5.961   16.697 1.00 24.94  ? 55   PHE A O   1 
ATOM   408  C CB  . PHE A 1 55 ? 24.449  4.152   18.091 1.00 26.81  ? 55   PHE A CB  1 
ATOM   409  C CG  . PHE A 1 55 ? 24.643  3.592   16.738 1.00 41.09  ? 55   PHE A CG  1 
ATOM   410  C CD1 . PHE A 1 55 ? 25.784  2.815   16.468 1.00 22.28  ? 55   PHE A CD1 1 
ATOM   411  C CD2 . PHE A 1 55 ? 23.684  3.821   15.700 1.00 25.57  ? 55   PHE A CD2 1 
ATOM   412  C CE1 . PHE A 1 55 ? 26.011  2.343   15.148 1.00 23.50  ? 55   PHE A CE1 1 
ATOM   413  C CE2 . PHE A 1 55 ? 23.894  3.321   14.418 1.00 27.03  ? 55   PHE A CE2 1 
ATOM   414  C CZ  . PHE A 1 55 ? 25.039  2.570   14.160 1.00 28.79  ? 55   PHE A CZ  1 
ATOM   415  N N   . HIS A 1 56 ? 27.556  4.776   18.436 1.00 42.10  ? 56   HIS A N   1 
ATOM   416  C CA  . HIS A 1 56 ? 28.922  4.724   17.994 1.00 29.06  ? 56   HIS A CA  1 
ATOM   417  C C   . HIS A 1 56 ? 29.476  3.386   18.406 1.00 27.51  ? 56   HIS A C   1 
ATOM   418  O O   . HIS A 1 56 ? 29.555  3.084   19.551 1.00 52.96  ? 56   HIS A O   1 
ATOM   419  C CB  . HIS A 1 56 ? 29.756  5.956   18.439 1.00 33.57  ? 56   HIS A CB  1 
ATOM   420  C CG  . HIS A 1 56 ? 31.114  6.039   17.796 1.00 73.40  ? 56   HIS A CG  1 
ATOM   421  N ND1 . HIS A 1 56 ? 31.500  5.235   16.734 1.00 50.45  ? 56   HIS A ND1 1 
ATOM   422  C CD2 . HIS A 1 56 ? 32.176  6.845   18.061 1.00 57.86  ? 56   HIS A CD2 1 
ATOM   423  C CE1 . HIS A 1 56 ? 32.729  5.555   16.372 1.00 67.55  ? 56   HIS A CE1 1 
ATOM   424  N NE2 . HIS A 1 56 ? 33.163  6.522   17.165 1.00 68.43  ? 56   HIS A NE2 1 
ATOM   425  N N   . ARG A 1 57 ? 29.838  2.584   17.414 1.00 43.72  ? 57   ARG A N   1 
ATOM   426  C CA  . ARG A 1 57 ? 30.266  1.227   17.572 1.00 34.52  ? 57   ARG A CA  1 
ATOM   427  C C   . ARG A 1 57 ? 31.713  0.998   17.076 1.00 54.47  ? 57   ARG A C   1 
ATOM   428  O O   . ARG A 1 57 ? 32.138  1.587   16.075 1.00 38.75  ? 57   ARG A O   1 
ATOM   429  C CB  . ARG A 1 57 ? 29.350  0.364   16.755 1.00 29.77  ? 57   ARG A CB  1 
ATOM   430  C CG  . ARG A 1 57 ? 29.902  -1.032  16.586 1.00 43.97  ? 57   ARG A CG  1 
ATOM   431  C CD  . ARG A 1 57 ? 29.044  -1.980  17.359 1.00 41.51  ? 57   ARG A CD  1 
ATOM   432  N NE  . ARG A 1 57 ? 29.766  -2.406  18.501 1.00 69.35  ? 57   ARG A NE  1 
ATOM   433  C CZ  . ARG A 1 57 ? 29.205  -3.013  19.511 1.00 70.97  ? 57   ARG A CZ  1 
ATOM   434  N NH1 . ARG A 1 57 ? 27.916  -3.231  19.470 1.00 37.06  ? 57   ARG A NH1 1 
ATOM   435  N NH2 . ARG A 1 57 ? 29.947  -3.397  20.534 1.00 68.67  ? 57   ARG A NH2 1 
ATOM   436  N N   . LYS A 1 58 ? 32.451  0.133   17.775 1.00 30.49  ? 58   LYS A N   1 
ATOM   437  C CA  . LYS A 1 58 ? 33.811  -0.233  17.393 1.00 42.60  ? 58   LYS A CA  1 
ATOM   438  C C   . LYS A 1 58 ? 34.029  -1.724  17.444 1.00 45.85  ? 58   LYS A C   1 
ATOM   439  O O   . LYS A 1 58 ? 33.592  -2.368  18.361 1.00 39.59  ? 58   LYS A O   1 
ATOM   440  C CB  . LYS A 1 58 ? 34.805  0.421   18.285 1.00 34.56  ? 58   LYS A CB  1 
ATOM   441  C CG  . LYS A 1 58 ? 34.710  1.941   18.249 1.00 31.68  ? 58   LYS A CG  1 
ATOM   442  C CD  . LYS A 1 58 ? 35.889  2.541   19.051 1.00 25.71  ? 58   LYS A CD  1 
ATOM   443  C CE  . LYS A 1 58 ? 35.715  4.057   19.328 1.00 56.59  ? 58   LYS A CE  1 
ATOM   444  N NZ  . LYS A 1 58 ? 34.891  4.790   18.339 1.00 79.48  ? 58   LYS A NZ  1 
ATOM   445  N N   . TYR A 1 59 ? 34.636  -2.276  16.396 1.00 38.41  ? 59   TYR A N   1 
ATOM   446  C CA  . TYR A 1 59 ? 34.980  -3.684  16.374 1.00 48.74  ? 59   TYR A CA  1 
ATOM   447  C C   . TYR A 1 59 ? 36.448  -3.816  16.204 1.00 36.99  ? 59   TYR A C   1 
ATOM   448  O O   . TYR A 1 59 ? 37.073  -3.028  15.544 1.00 55.24  ? 59   TYR A O   1 
ATOM   449  C CB  . TYR A 1 59 ? 34.306  -4.432  15.246 1.00 41.71  ? 59   TYR A CB  1 
ATOM   450  C CG  . TYR A 1 59 ? 32.794  -4.346  15.152 1.00 58.36  ? 59   TYR A CG  1 
ATOM   451  C CD1 . TYR A 1 59 ? 31.956  -5.239  15.854 1.00 50.45  ? 59   TYR A CD1 1 
ATOM   452  C CD2 . TYR A 1 59 ? 32.199  -3.417  14.286 1.00 49.70  ? 59   TYR A CD2 1 
ATOM   453  C CE1 . TYR A 1 59 ? 30.563  -5.202  15.704 1.00 44.32  ? 59   TYR A CE1 1 
ATOM   454  C CE2 . TYR A 1 59 ? 30.834  -3.362  14.153 1.00 43.02  ? 59   TYR A CE2 1 
ATOM   455  C CZ  . TYR A 1 59 ? 30.023  -4.261  14.840 1.00 57.50  ? 59   TYR A CZ  1 
ATOM   456  O OH  . TYR A 1 59 ? 28.691  -4.163  14.611 1.00 33.35  ? 59   TYR A OH  1 
ATOM   457  N N   . ARG A 1 60 ? 37.016  -4.814  16.832 1.00 64.30  ? 60   ARG A N   1 
ATOM   458  C CA  . ARG A 1 60 ? 38.407  -5.124  16.560 1.00 75.67  ? 60   ARG A CA  1 
ATOM   459  C C   . ARG A 1 60 ? 38.398  -5.964  15.326 1.00 58.18  ? 60   ARG A C   1 
ATOM   460  O O   . ARG A 1 60 ? 37.553  -6.855  15.132 1.00 65.58  ? 60   ARG A O   1 
ATOM   461  C CB  . ARG A 1 60 ? 39.082  -5.890  17.703 1.00 67.32  ? 60   ARG A CB  1 
ATOM   462  C CG  . ARG A 1 60 ? 39.206  -5.108  19.006 1.00 68.13  ? 60   ARG A CG  1 
ATOM   463  N N   . ILE A 1 61 ? 39.319  -5.614  14.470 1.00 49.51  ? 61   ILE A N   1 
ATOM   464  C CA  . ILE A 1 61 ? 39.591  -6.369  13.257 1.00 62.23  ? 61   ILE A CA  1 
ATOM   465  C C   . ILE A 1 61 ? 40.344  -7.663  13.660 1.00 64.38  ? 61   ILE A C   1 
ATOM   466  O O   . ILE A 1 61 ? 41.336  -7.618  14.411 1.00 73.39  ? 61   ILE A O   1 
ATOM   467  C CB  . ILE A 1 61 ? 40.421  -5.444  12.273 1.00 71.07  ? 61   ILE A CB  1 
ATOM   468  C CG1 . ILE A 1 61 ? 39.547  -4.295  11.792 1.00 80.75  ? 61   ILE A CG1 1 
ATOM   469  C CG2 . ILE A 1 61 ? 40.894  -6.128  11.072 1.00 44.43  ? 61   ILE A CG2 1 
ATOM   470  C CD1 . ILE A 1 61 ? 40.302  -3.270  11.029 1.00 67.16  ? 61   ILE A CD1 1 
ATOM   471  N N   . PRO A 1 62 ? 39.851  -8.831  13.217 1.00 64.30  ? 62   PRO A N   1 
ATOM   472  C CA  . PRO A 1 62 ? 40.619  -10.074 13.441 1.00 49.62  ? 62   PRO A CA  1 
ATOM   473  C C   . PRO A 1 62 ? 42.102  -9.947  13.024 1.00 68.47  ? 62   PRO A C   1 
ATOM   474  O O   . PRO A 1 62 ? 42.433  -9.237  12.056 1.00 54.34  ? 62   PRO A O   1 
ATOM   475  C CB  . PRO A 1 62 ? 39.874  -11.128 12.578 1.00 46.87  ? 62   PRO A CB  1 
ATOM   476  C CG  . PRO A 1 62 ? 38.436  -10.594 12.446 1.00 37.27  ? 62   PRO A CG  1 
ATOM   477  C CD  . PRO A 1 62 ? 38.533  -9.066  12.583 1.00 73.36  ? 62   PRO A CD  1 
ATOM   478  N N   . ALA A 1 63 ? 42.984  -10.630 13.748 1.00 88.89  ? 63   ALA A N   1 
ATOM   479  C CA  . ALA A 1 63 ? 44.429  -10.489 13.561 1.00 51.77  ? 63   ALA A CA  1 
ATOM   480  C C   . ALA A 1 63 ? 44.930  -10.683 12.130 1.00 82.81  ? 63   ALA A C   1 
ATOM   481  O O   . ALA A 1 63 ? 45.879  -9.997  11.685 1.00 46.85  ? 63   ALA A O   1 
ATOM   482  C CB  . ALA A 1 63 ? 45.128  -11.450 14.483 1.00 109.84 ? 63   ALA A CB  1 
ATOM   483  N N   . ASP A 1 64 ? 44.306  -11.628 11.425 1.00 59.12  ? 64   ASP A N   1 
ATOM   484  C CA  . ASP A 1 64 ? 44.664  -11.966 10.045 1.00 45.77  ? 64   ASP A CA  1 
ATOM   485  C C   . ASP A 1 64 ? 43.772  -11.307 8.985  1.00 67.59  ? 64   ASP A C   1 
ATOM   486  O O   . ASP A 1 64 ? 43.412  -11.972 7.977  1.00 55.16  ? 64   ASP A O   1 
ATOM   487  C CB  . ASP A 1 64 ? 44.626  -13.489 9.861  1.00 28.81  ? 64   ASP A CB  1 
ATOM   488  C CG  . ASP A 1 64 ? 43.239  -14.112 10.234 1.00 107.17 ? 64   ASP A CG  1 
ATOM   489  O OD1 . ASP A 1 64 ? 42.423  -13.434 10.935 1.00 65.33  ? 64   ASP A OD1 1 
ATOM   490  O OD2 . ASP A 1 64 ? 42.974  -15.298 9.852  1.00 72.74  ? 64   ASP A OD2 1 
ATOM   491  N N   . VAL A 1 65 ? 43.377  -10.043 9.238  1.00 50.52  ? 65   VAL A N   1 
ATOM   492  C CA  . VAL A 1 65 ? 42.575  -9.216  8.314  1.00 31.24  ? 65   VAL A CA  1 
ATOM   493  C C   . VAL A 1 65 ? 43.387  -7.946  7.997  1.00 86.97  ? 65   VAL A C   1 
ATOM   494  O O   . VAL A 1 65 ? 43.651  -7.137  8.884  1.00 70.75  ? 65   VAL A O   1 
ATOM   495  C CB  . VAL A 1 65 ? 41.117  -8.917  8.827  1.00 45.87  ? 65   VAL A CB  1 
ATOM   496  C CG1 . VAL A 1 65 ? 40.386  -7.843  7.985  1.00 24.52  ? 65   VAL A CG1 1 
ATOM   497  C CG2 . VAL A 1 65 ? 40.293  -10.176 8.827  1.00 38.59  ? 65   VAL A CG2 1 
ATOM   498  N N   . ASP A 1 66 ? 43.851  -7.801  6.755  1.00 54.41  ? 66   ASP A N   1 
ATOM   499  C CA  . ASP A 1 66 ? 44.391  -6.517  6.338  1.00 59.48  ? 66   ASP A CA  1 
ATOM   500  C C   . ASP A 1 66 ? 43.249  -5.461  6.305  1.00 62.72  ? 66   ASP A C   1 
ATOM   501  O O   . ASP A 1 66 ? 42.288  -5.613  5.552  1.00 51.85  ? 66   ASP A O   1 
ATOM   502  C CB  . ASP A 1 66 ? 45.037  -6.672  4.945  1.00 70.57  ? 66   ASP A CB  1 
ATOM   503  C CG  . ASP A 1 66 ? 45.654  -5.351  4.383  1.00 101.28 ? 66   ASP A CG  1 
ATOM   504  O OD1 . ASP A 1 66 ? 45.999  -4.399  5.118  1.00 85.83  ? 66   ASP A OD1 1 
ATOM   505  O OD2 . ASP A 1 66 ? 45.832  -5.278  3.159  1.00 100.53 ? 66   ASP A OD2 1 
ATOM   506  N N   . PRO A 1 67 ? 43.361  -4.391  7.111  1.00 50.52  ? 67   PRO A N   1 
ATOM   507  C CA  . PRO A 1 67 ? 42.350  -3.316  7.227  1.00 65.12  ? 67   PRO A CA  1 
ATOM   508  C C   . PRO A 1 67 ? 42.035  -2.641  5.906  1.00 58.43  ? 67   PRO A C   1 
ATOM   509  O O   . PRO A 1 67 ? 40.938  -2.064  5.788  1.00 71.56  ? 67   PRO A O   1 
ATOM   510  C CB  . PRO A 1 67 ? 42.998  -2.286  8.184  1.00 50.24  ? 67   PRO A CB  1 
ATOM   511  C CG  . PRO A 1 67 ? 44.032  -3.071  8.928  1.00 54.61  ? 67   PRO A CG  1 
ATOM   512  C CD  . PRO A 1 67 ? 44.515  -4.162  8.001  1.00 50.44  ? 67   PRO A CD  1 
ATOM   513  N N   . LEU A 1 68 ? 42.988  -2.691  4.959  1.00 81.44  ? 68   LEU A N   1 
ATOM   514  C CA  . LEU A 1 68 ? 42.856  -2.086  3.618  1.00 64.87  ? 68   LEU A CA  1 
ATOM   515  C C   . LEU A 1 68 ? 42.017  -2.921  2.634  1.00 79.63  ? 68   LEU A C   1 
ATOM   516  O O   . LEU A 1 68 ? 41.690  -2.422  1.564  1.00 43.73  ? 68   LEU A O   1 
ATOM   517  C CB  . LEU A 1 68 ? 44.220  -1.803  2.979  1.00 50.96  ? 68   LEU A CB  1 
ATOM   518  C CG  . LEU A 1 68 ? 45.364  -1.155  3.773  1.00 128.04 ? 68   LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 68 ? 46.723  -1.442  3.099  1.00 113.16 ? 68   LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 68 ? 45.138  0.355   3.973  1.00 64.79  ? 68   LEU A CD2 1 
ATOM   521  N N   . THR A 1 69 ? 41.683  -4.171  2.981  1.00 51.60  ? 69   THR A N   1 
ATOM   522  C CA  . THR A 1 69 ? 40.820  -5.005  2.153  1.00 58.00  ? 69   THR A CA  1 
ATOM   523  C C   . THR A 1 69 ? 39.392  -5.130  2.626  1.00 44.94  ? 69   THR A C   1 
ATOM   524  O O   . THR A 1 69 ? 38.686  -5.950  2.086  1.00 45.06  ? 69   THR A O   1 
ATOM   525  C CB  . THR A 1 69 ? 41.334  -6.457  2.060  1.00 63.35  ? 69   THR A CB  1 
ATOM   526  O OG1 . THR A 1 69 ? 41.138  -7.147  3.319  1.00 51.00  ? 69   THR A OG1 1 
ATOM   527  C CG2 . THR A 1 69 ? 42.768  -6.433  1.687  1.00 49.94  ? 69   THR A CG2 1 
ATOM   528  N N   . ILE A 1 70 ? 39.010  -4.386  3.659  1.00 30.53  ? 70   ILE A N   1 
ATOM   529  C CA  . ILE A 1 70 ? 37.696  -4.433  4.284  1.00 61.62  ? 70   ILE A CA  1 
ATOM   530  C C   . ILE A 1 70 ? 36.720  -3.606  3.413  1.00 77.29  ? 70   ILE A C   1 
ATOM   531  O O   . ILE A 1 70 ? 37.038  -2.465  3.002  1.00 39.90  ? 70   ILE A O   1 
ATOM   532  C CB  . ILE A 1 70 ? 37.725  -3.891  5.773  1.00 49.48  ? 70   ILE A CB  1 
ATOM   533  C CG1 . ILE A 1 70 ? 38.511  -4.818  6.676  1.00 46.67  ? 70   ILE A CG1 1 
ATOM   534  C CG2 . ILE A 1 70 ? 36.297  -3.648  6.350  1.00 31.66  ? 70   ILE A CG2 1 
ATOM   535  C CD1 . ILE A 1 70 ? 38.608  -4.329  8.110  1.00 47.34  ? 70   ILE A CD1 1 
ATOM   536  N N   . THR A 1 71 ? 35.551  -4.200  3.116  1.00 70.33  ? 71   THR A N   1 
ATOM   537  C CA  . THR A 1 71 ? 34.471  -3.534  2.381  1.00 41.34  ? 71   THR A CA  1 
ATOM   538  C C   . THR A 1 71 ? 33.153  -3.349  3.165  1.00 44.78  ? 71   THR A C   1 
ATOM   539  O O   . THR A 1 71 ? 32.970  -3.905  4.215  1.00 33.92  ? 71   THR A O   1 
ATOM   540  C CB  . THR A 1 71 ? 34.200  -4.158  1.022  1.00 53.85  ? 71   THR A CB  1 
ATOM   541  O OG1 . THR A 1 71 ? 33.678  -5.458  1.211  1.00 58.05  ? 71   THR A OG1 1 
ATOM   542  C CG2 . THR A 1 71 ? 35.496  -4.184  0.191  1.00 45.16  ? 71   THR A CG2 1 
ATOM   543  N N   . SER A 1 72 ? 32.291  -2.462  2.683  1.00 35.38  ? 72   SER A N   1 
ATOM   544  C CA  . SER A 1 72 ? 31.114  -2.090  3.380  1.00 31.93  ? 72   SER A CA  1 
ATOM   545  C C   . SER A 1 72 ? 30.004  -2.131  2.364  1.00 56.56  ? 72   SER A C   1 
ATOM   546  O O   . SER A 1 72 ? 30.258  -2.041  1.153  1.00 46.52  ? 72   SER A O   1 
ATOM   547  C CB  . SER A 1 72 ? 31.245  -0.777  4.201  1.00 27.22  ? 72   SER A CB  1 
ATOM   548  O OG  . SER A 1 72 ? 30.851  0.443   3.572  1.00 43.92  ? 72   SER A OG  1 
ATOM   549  N N   . SER A 1 73 ? 28.791  -2.389  2.851  1.00 32.36  ? 73   SER A N   1 
ATOM   550  C CA  . SER A 1 73 ? 27.648  -2.368  1.981  1.00 58.38  ? 73   SER A CA  1 
ATOM   551  C C   . SER A 1 73 ? 26.413  -1.877  2.690  1.00 57.26  ? 73   SER A C   1 
ATOM   552  O O   . SER A 1 73 ? 26.300  -2.176  3.857  1.00 23.47  ? 73   SER A O   1 
ATOM   553  C CB  . SER A 1 73 ? 27.381  -3.768  1.583  1.00 35.11  ? 73   SER A CB  1 
ATOM   554  O OG  . SER A 1 73 ? 26.007  -3.942  1.776  1.00 63.29  ? 73   SER A OG  1 
ATOM   555  N N   . LEU A 1 74 ? 25.523  -1.119  2.022  1.00 36.95  ? 74   LEU A N   1 
ATOM   556  C CA  . LEU A 1 74 ? 24.249  -0.692  2.667  1.00 30.75  ? 74   LEU A CA  1 
ATOM   557  C C   . LEU A 1 74 ? 23.021  -1.058  1.870  1.00 31.27  ? 74   LEU A C   1 
ATOM   558  O O   . LEU A 1 74 ? 22.933  -0.794  0.656  1.00 24.18  ? 74   LEU A O   1 
ATOM   559  C CB  . LEU A 1 74 ? 24.246  0.765   3.105  1.00 3.28   ? 74   LEU A CB  1 
ATOM   560  C CG  . LEU A 1 74 ? 23.103  1.314   3.884  1.00 28.44  ? 74   LEU A CG  1 
ATOM   561  C CD1 . LEU A 1 74 ? 22.811  0.580   5.190  1.00 24.97  ? 74   LEU A CD1 1 
ATOM   562  C CD2 . LEU A 1 74 ? 23.251  2.770   4.074  1.00 41.60  ? 74   LEU A CD2 1 
ATOM   563  N N   . SER A 1 75 ? 22.091  -1.738  2.529  1.00 32.07  ? 75   SER A N   1 
ATOM   564  C CA  . SER A 1 75 ? 20.822  -2.114  1.848  1.00 35.08  ? 75   SER A CA  1 
ATOM   565  C C   . SER A 1 75 ? 19.691  -1.131  2.039  1.00 47.31  ? 75   SER A C   1 
ATOM   566  O O   . SER A 1 75 ? 19.694  -0.291  2.932  1.00 43.20  ? 75   SER A O   1 
ATOM   567  C CB  . SER A 1 75 ? 20.355  -3.487  2.230  1.00 29.10  ? 75   SER A CB  1 
ATOM   568  O OG  . SER A 1 75 ? 19.557  -3.445  3.359  1.00 33.59  ? 75   SER A OG  1 
ATOM   569  N N   . SER A 1 76 ? 18.695  -1.243  1.188  1.00 52.15  ? 76   SER A N   1 
ATOM   570  C CA  . SER A 1 76 ? 17.562  -0.311  1.222  1.00 29.74  ? 76   SER A CA  1 
ATOM   571  C C   . SER A 1 76 ? 16.694  -0.489  2.486  1.00 57.49  ? 76   SER A C   1 
ATOM   572  O O   . SER A 1 76 ? 16.165  0.502   2.955  1.00 48.30  ? 76   SER A O   1 
ATOM   573  C CB  . SER A 1 76 ? 16.707  -0.519  -0.010 1.00 22.75  ? 76   SER A CB  1 
ATOM   574  O OG  . SER A 1 76 ? 16.446  -1.932  -0.056 1.00 83.62  ? 76   SER A OG  1 
ATOM   575  N N   . ASP A 1 77 ? 16.524  -1.726  2.997  1.00 31.04  ? 77   ASP A N   1 
ATOM   576  C CA  . ASP A 1 77 ? 15.775  -2.002  4.220  1.00 61.81  ? 77   ASP A CA  1 
ATOM   577  C C   . ASP A 1 77 ? 16.576  -1.922  5.523  1.00 35.95  ? 77   ASP A C   1 
ATOM   578  O O   . ASP A 1 77 ? 16.117  -2.206  6.621  1.00 82.02  ? 77   ASP A O   1 
ATOM   579  C CB  . ASP A 1 77 ? 15.019  -3.329  4.115  1.00 65.14  ? 77   ASP A CB  1 
ATOM   580  C CG  . ASP A 1 77 ? 15.879  -4.465  3.730  1.00 59.92  ? 77   ASP A CG  1 
ATOM   581  O OD1 . ASP A 1 77 ? 17.116  -4.346  3.790  1.00 73.91  ? 77   ASP A OD1 1 
ATOM   582  O OD2 . ASP A 1 77 ? 15.298  -5.495  3.331  1.00 121.22 ? 77   ASP A OD2 1 
ATOM   583  N N   . GLY A 1 78 ? 17.807  -1.586  5.381  1.00 58.65  ? 78   GLY A N   1 
ATOM   584  C CA  . GLY A 1 78 ? 18.492  -1.152  6.539  1.00 50.18  ? 78   GLY A CA  1 
ATOM   585  C C   . GLY A 1 78 ? 19.472  -2.116  7.139  1.00 31.88  ? 78   GLY A C   1 
ATOM   586  O O   . GLY A 1 78 ? 19.748  -1.928  8.261  1.00 40.49  ? 78   GLY A O   1 
ATOM   587  N N   . VAL A 1 79 ? 19.939  -3.144  6.422  1.00 41.56  ? 79   VAL A N   1 
ATOM   588  C CA  . VAL A 1 79 ? 21.095  -3.940  6.885  1.00 61.96  ? 79   VAL A CA  1 
ATOM   589  C C   . VAL A 1 79 ? 22.439  -3.361  6.418  1.00 29.44  ? 79   VAL A C   1 
ATOM   590  O O   . VAL A 1 79 ? 22.651  -3.162  5.259  1.00 32.62  ? 79   VAL A O   1 
ATOM   591  C CB  . VAL A 1 79 ? 20.989  -5.485  6.566  1.00 27.98  ? 79   VAL A CB  1 
ATOM   592  C CG1 . VAL A 1 79 ? 22.174  -6.225  7.185  1.00 33.25  ? 79   VAL A CG1 1 
ATOM   593  C CG2 . VAL A 1 79 ? 19.778  -5.979  7.153  1.00 45.30  ? 79   VAL A CG2 1 
ATOM   594  N N   . LEU A 1 80 ? 23.311  -3.075  7.363  1.00 34.70  ? 80   LEU A N   1 
ATOM   595  C CA  . LEU A 1 80 ? 24.645  -2.559  7.080  1.00 21.46  ? 80   LEU A CA  1 
ATOM   596  C C   . LEU A 1 80 ? 25.548  -3.763  7.329  1.00 43.32  ? 80   LEU A C   1 
ATOM   597  O O   . LEU A 1 80 ? 25.410  -4.459  8.336  1.00 24.59  ? 80   LEU A O   1 
ATOM   598  C CB  . LEU A 1 80 ? 25.075  -1.469  8.061  1.00 14.17  ? 80   LEU A CB  1 
ATOM   599  C CG  . LEU A 1 80 ? 26.488  -0.944  7.789  1.00 41.84  ? 80   LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 80 ? 26.548  -0.488  6.314  1.00 54.78  ? 80   LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 80 ? 26.741  0.196   8.586  1.00 20.05  ? 80   LEU A CD2 1 
ATOM   602  N N   . THR A 1 81 ? 26.469  -4.000  6.410  1.00 29.45  ? 81   THR A N   1 
ATOM   603  C CA  . THR A 1 81 ? 27.364  -5.119  6.453  1.00 37.74  ? 81   THR A CA  1 
ATOM   604  C C   . THR A 1 81 ? 28.722  -4.528  6.360  1.00 45.28  ? 81   THR A C   1 
ATOM   605  O O   . THR A 1 81 ? 28.926  -3.541  5.665  1.00 25.70  ? 81   THR A O   1 
ATOM   606  C CB  . THR A 1 81 ? 27.140  -6.037  5.251  1.00 35.53  ? 81   THR A CB  1 
ATOM   607  O OG1 . THR A 1 81 ? 25.911  -6.759  5.432  1.00 65.20  ? 81   THR A OG1 1 
ATOM   608  C CG2 . THR A 1 81 ? 28.298  -6.972  5.089  1.00 44.98  ? 81   THR A CG2 1 
ATOM   609  N N   . VAL A 1 82 ? 29.630  -5.124  7.111  1.00 39.75  ? 82   VAL A N   1 
ATOM   610  C CA  . VAL A 1 82 ? 31.063  -4.961  6.932  1.00 43.82  ? 82   VAL A CA  1 
ATOM   611  C C   . VAL A 1 82 ? 31.721  -6.359  6.750  1.00 39.25  ? 82   VAL A C   1 
ATOM   612  O O   . VAL A 1 82 ? 31.398  -7.270  7.473  1.00 42.40  ? 82   VAL A O   1 
ATOM   613  C CB  . VAL A 1 82 ? 31.628  -4.107  8.127  1.00 40.61  ? 82   VAL A CB  1 
ATOM   614  C CG1 . VAL A 1 82 ? 33.070  -3.690  7.943  1.00 27.52  ? 82   VAL A CG1 1 
ATOM   615  C CG2 . VAL A 1 82 ? 30.782  -2.819  8.308  1.00 28.81  ? 82   VAL A CG2 1 
ATOM   616  N N   . ASN A 1 83 ? 32.560  -6.533  5.727  1.00 58.76  ? 83   ASN A N   1 
ATOM   617  C CA  . ASN A 1 83 ? 33.323  -7.757  5.511  1.00 33.65  ? 83   ASN A CA  1 
ATOM   618  C C   . ASN A 1 83 ? 34.676  -7.547  4.909  1.00 50.58  ? 83   ASN A C   1 
ATOM   619  O O   . ASN A 1 83 ? 35.045  -6.448  4.607  1.00 35.78  ? 83   ASN A O   1 
ATOM   620  C CB  . ASN A 1 83 ? 32.554  -8.844  4.779  1.00 56.91  ? 83   ASN A CB  1 
ATOM   621  C CG  . ASN A 1 83 ? 31.586  -8.311  3.810  1.00 53.95  ? 83   ASN A CG  1 
ATOM   622  O OD1 . ASN A 1 83 ? 31.857  -7.357  3.113  1.00 73.66  ? 83   ASN A OD1 1 
ATOM   623  N ND2 . ASN A 1 83 ? 30.445  -8.936  3.735  1.00 69.87  ? 83   ASN A ND2 1 
ATOM   624  N N   . GLY A 1 84 ? 35.430  -8.632  4.848  1.00 40.82  ? 84   GLY A N   1 
ATOM   625  C CA  . GLY A 1 84 ? 36.860  -8.611  4.666  1.00 35.90  ? 84   GLY A CA  1 
ATOM   626  C C   . GLY A 1 84 ? 37.375  -10.009 4.316  1.00 47.33  ? 84   GLY A C   1 
ATOM   627  O O   . GLY A 1 84 ? 36.883  -11.054 4.745  1.00 39.24  ? 84   GLY A O   1 
ATOM   628  N N   . PRO A 1 85 ? 38.378  -10.054 3.474  1.00 61.92  ? 85   PRO A N   1 
ATOM   629  C CA  . PRO A 1 85 ? 39.044  -11.359 3.379  1.00 82.28  ? 85   PRO A CA  1 
ATOM   630  C C   . PRO A 1 85 ? 39.947  -11.597 4.595  1.00 36.68  ? 85   PRO A C   1 
ATOM   631  O O   . PRO A 1 85 ? 40.363  -10.635 5.261  1.00 47.79  ? 85   PRO A O   1 
ATOM   632  C CB  . PRO A 1 85 ? 39.925  -11.219 2.137  1.00 54.62  ? 85   PRO A CB  1 
ATOM   633  C CG  . PRO A 1 85 ? 39.888  -9.703  1.760  1.00 48.60  ? 85   PRO A CG  1 
ATOM   634  C CD  . PRO A 1 85 ? 39.112  -8.969  2.808  1.00 57.55  ? 85   PRO A CD  1 
ATOM   635  N N   . ARG A 1 86 ? 40.251  -12.852 4.872  1.00 27.08  ? 86   ARG A N   1 
ATOM   636  C CA  . ARG A 1 86 ? 41.332  -13.148 5.888  1.00 73.30  ? 86   ARG A CA  1 
ATOM   637  C C   . ARG A 1 86 ? 42.520  -13.871 5.255  1.00 55.45  ? 86   ARG A C   1 
ATOM   638  O O   . ARG A 1 86 ? 42.365  -14.791 4.442  1.00 56.12  ? 86   ARG A O   1 
ATOM   639  C CB  . ARG A 1 86 ? 40.894  -13.957 7.153  1.00 20.38  ? 86   ARG A CB  1 
ATOM   640  C CG  . ARG A 1 86 ? 39.574  -13.536 7.818  1.00 57.93  ? 86   ARG A CG  1 
ATOM   641  C CD  . ARG A 1 86 ? 39.076  -14.564 8.796  1.00 44.10  ? 86   ARG A CD  1 
ATOM   642  N NE  . ARG A 1 86 ? 39.854  -14.512 10.026 1.00 35.49  ? 86   ARG A NE  1 
ATOM   643  C CZ  . ARG A 1 86 ? 39.650  -15.271 11.099 1.00 30.71  ? 86   ARG A CZ  1 
ATOM   644  N NH1 . ARG A 1 86 ? 38.673  -16.186 11.109 1.00 43.03  ? 86   ARG A NH1 1 
ATOM   645  N NH2 . ARG A 1 86 ? 40.397  -15.076 12.192 1.00 20.51  ? 86   ARG A NH2 1 
ATOM   646  N N   . LYS A 1 87 ? 43.716  -13.490 5.655  1.00 54.60  ? 87   LYS A N   1 
ATOM   647  C CA  . LYS A 1 87 ? 44.879  -14.092 5.039  1.00 57.35  ? 87   LYS A CA  1 
ATOM   648  C C   . LYS A 1 87 ? 45.750  -14.717 6.110  1.00 38.29  ? 87   LYS A C   1 
ATOM   649  O O   . LYS A 1 87 ? 46.415  -13.989 6.864  1.00 81.32  ? 87   LYS A O   1 
ATOM   650  C CB  . LYS A 1 87 ? 45.640  -13.036 4.206  1.00 43.86  ? 87   LYS A CB  1 
ATOM   651  N N   . PHE B 1 12 ? -3.727  5.560   30.185 1.00 49.89  ? 12   PHE B N   1 
ATOM   652  C CA  . PHE B 1 12 ? -2.801  5.359   29.059 1.00 74.31  ? 12   PHE B CA  1 
ATOM   653  C C   . PHE B 1 12 ? -1.473  4.769   29.531 1.00 77.25  ? 12   PHE B C   1 
ATOM   654  O O   . PHE B 1 12 ? -1.129  4.852   30.718 1.00 97.57  ? 12   PHE B O   1 
ATOM   655  C CB  . PHE B 1 12 ? -2.578  6.649   28.258 1.00 34.35  ? 12   PHE B CB  1 
ATOM   656  C CG  . PHE B 1 12 ? -1.522  7.546   28.822 1.00 54.10  ? 12   PHE B CG  1 
ATOM   657  N N   . SER B 1 13 ? -0.743  4.158   28.605 1.00 61.32  ? 13   SER B N   1 
ATOM   658  C CA  . SER B 1 13 ? 0.430   3.372   28.958 1.00 77.58  ? 13   SER B CA  1 
ATOM   659  C C   . SER B 1 13 ? 1.385   3.327   27.805 1.00 69.37  ? 13   SER B C   1 
ATOM   660  O O   . SER B 1 13 ? 0.998   2.977   26.715 1.00 83.63  ? 13   SER B O   1 
ATOM   661  C CB  . SER B 1 13 ? 0.055   1.934   29.285 1.00 55.98  ? 13   SER B CB  1 
ATOM   662  O OG  . SER B 1 13 ? 1.150   1.254   29.885 1.00 96.70  ? 13   SER B OG  1 
ATOM   663  N N   . VAL B 1 14 ? 2.645   3.631   28.068 1.00 70.92  ? 14   VAL B N   1 
ATOM   664  C CA  . VAL B 1 14 ? 3.664   3.564   27.057 1.00 78.12  ? 14   VAL B CA  1 
ATOM   665  C C   . VAL B 1 14 ? 4.911   2.852   27.590 1.00 72.99  ? 14   VAL B C   1 
ATOM   666  O O   . VAL B 1 14 ? 5.493   3.274   28.565 1.00 67.11  ? 14   VAL B O   1 
ATOM   667  C CB  . VAL B 1 14 ? 4.018   4.966   26.569 1.00 54.73  ? 14   VAL B CB  1 
ATOM   668  C CG1 . VAL B 1 14 ? 5.164   4.868   25.649 1.00 70.05  ? 14   VAL B CG1 1 
ATOM   669  C CG2 . VAL B 1 14 ? 2.838   5.557   25.861 1.00 76.33  ? 14   VAL B CG2 1 
ATOM   670  N N   . ASN B 1 15 ? 5.290   1.773   26.924 1.00 50.91  ? 15   ASN B N   1 
ATOM   671  C CA  . ASN B 1 15 ? 6.404   0.942   27.278 1.00 50.66  ? 15   ASN B CA  1 
ATOM   672  C C   . ASN B 1 15 ? 7.593   1.129   26.371 1.00 75.54  ? 15   ASN B C   1 
ATOM   673  O O   . ASN B 1 15 ? 7.413   1.280   25.190 1.00 70.36  ? 15   ASN B O   1 
ATOM   674  C CB  . ASN B 1 15 ? 5.950   -0.511  27.261 1.00 43.16  ? 15   ASN B CB  1 
ATOM   675  C CG  . ASN B 1 15 ? 5.047   -0.822  28.456 1.00 95.51  ? 15   ASN B CG  1 
ATOM   676  O OD1 . ASN B 1 15 ? 5.072   -1.912  29.033 1.00 76.98  ? 15   ASN B OD1 1 
ATOM   677  N ND2 . ASN B 1 15 ? 4.255   0.173   28.846 1.00 105.57 ? 15   ASN B ND2 1 
ATOM   678  N N   . LEU B 1 16 ? 8.807   1.136   26.927 1.00 63.16  ? 16   LEU B N   1 
ATOM   679  C CA  . LEU B 1 16 ? 10.023  1.180   26.116 1.00 42.46  ? 16   LEU B CA  1 
ATOM   680  C C   . LEU B 1 16 ? 11.062  0.153   26.493 1.00 58.10  ? 16   LEU B C   1 
ATOM   681  O O   . LEU B 1 16 ? 11.304  -0.097  27.672 1.00 56.79  ? 16   LEU B O   1 
ATOM   682  C CB  . LEU B 1 16 ? 10.748  2.517   26.201 1.00 62.94  ? 16   LEU B CB  1 
ATOM   683  C CG  . LEU B 1 16 ? 10.207  3.775   25.591 1.00 53.64  ? 16   LEU B CG  1 
ATOM   684  C CD1 . LEU B 1 16 ? 8.970   4.115   26.376 1.00 57.48  ? 16   LEU B CD1 1 
ATOM   685  C CD2 . LEU B 1 16 ? 11.274  4.689   25.849 1.00 21.11  ? 16   LEU B CD2 1 
ATOM   686  N N   . ASP B 1 17 ? 11.730  -0.384  25.480 1.00 40.87  ? 17   ASP B N   1 
ATOM   687  C CA  . ASP B 1 17 ? 12.832  -1.258  25.720 1.00 62.43  ? 17   ASP B CA  1 
ATOM   688  C C   . ASP B 1 17 ? 14.143  -0.470  25.925 1.00 55.83  ? 17   ASP B C   1 
ATOM   689  O O   . ASP B 1 17 ? 14.683  0.102   25.007 1.00 62.31  ? 17   ASP B O   1 
ATOM   690  C CB  . ASP B 1 17 ? 12.943  -2.278  24.612 1.00 45.98  ? 17   ASP B CB  1 
ATOM   691  C CG  . ASP B 1 17 ? 14.159  -3.124  24.760 1.00 85.52  ? 17   ASP B CG  1 
ATOM   692  O OD1 . ASP B 1 17 ? 14.390  -3.619  25.888 1.00 67.58  ? 17   ASP B OD1 1 
ATOM   693  O OD2 . ASP B 1 17 ? 14.897  -3.253  23.757 1.00 87.76  ? 17   ASP B OD2 1 
ATOM   694  N N   . VAL B 1 18 ? 14.652  -0.463  27.143 1.00 47.68  ? 18   VAL B N   1 
ATOM   695  C CA  . VAL B 1 18 ? 15.737  0.431   27.548 1.00 56.73  ? 18   VAL B CA  1 
ATOM   696  C C   . VAL B 1 18 ? 16.772  -0.454  28.199 1.00 44.64  ? 18   VAL B C   1 
ATOM   697  O O   . VAL B 1 18 ? 17.594  -0.008  28.923 1.00 25.33  ? 18   VAL B O   1 
ATOM   698  C CB  . VAL B 1 18 ? 15.271  1.594   28.502 1.00 43.98  ? 18   VAL B CB  1 
ATOM   699  C CG1 . VAL B 1 18 ? 14.345  2.591   27.772 1.00 50.32  ? 18   VAL B CG1 1 
ATOM   700  C CG2 . VAL B 1 18 ? 14.530  1.070   29.781 1.00 40.07  ? 18   VAL B CG2 1 
ATOM   701  N N   . LYS B 1 19 ? 16.707  -1.737  27.878 1.00 45.63  ? 19   LYS B N   1 
ATOM   702  C CA  . LYS B 1 19 ? 17.635  -2.743  28.404 1.00 32.06  ? 19   LYS B CA  1 
ATOM   703  C C   . LYS B 1 19 ? 19.172  -2.452  28.344 1.00 42.30  ? 19   LYS B C   1 
ATOM   704  O O   . LYS B 1 19 ? 19.976  -3.110  28.986 1.00 52.35  ? 19   LYS B O   1 
ATOM   705  C CB  . LYS B 1 19 ? 17.287  -4.101  27.766 1.00 43.73  ? 19   LYS B CB  1 
ATOM   706  C CG  . LYS B 1 19 ? 17.868  -4.396  26.363 1.00 41.03  ? 19   LYS B CG  1 
ATOM   707  C CD  . LYS B 1 19 ? 17.171  -5.575  25.705 1.00 58.52  ? 19   LYS B CD  1 
ATOM   708  C CE  . LYS B 1 19 ? 17.578  -5.817  24.252 1.00 32.28  ? 19   LYS B CE  1 
ATOM   709  N NZ  . LYS B 1 19 ? 17.574  -4.511  23.438 1.00 78.91  ? 19   LYS B NZ  1 
ATOM   710  N N   . HIS B 1 20 ? 19.609  -1.478  27.578 1.00 54.12  ? 20   HIS B N   1 
ATOM   711  C CA  . HIS B 1 20 ? 21.051  -1.264  27.387 1.00 34.85  ? 20   HIS B CA  1 
ATOM   712  C C   . HIS B 1 20 ? 21.502  -0.107  28.243 1.00 57.18  ? 20   HIS B C   1 
ATOM   713  O O   . HIS B 1 20 ? 22.675  0.346   28.146 1.00 41.43  ? 20   HIS B O   1 
ATOM   714  C CB  . HIS B 1 20 ? 21.331  -0.811  25.933 1.00 63.15  ? 20   HIS B CB  1 
ATOM   715  C CG  . HIS B 1 20 ? 21.165  -1.881  24.902 1.00 53.69  ? 20   HIS B CG  1 
ATOM   716  N ND1 . HIS B 1 20 ? 20.229  -1.815  23.892 1.00 37.42  ? 20   HIS B ND1 1 
ATOM   717  C CD2 . HIS B 1 20 ? 21.817  -3.050  24.734 1.00 30.76  ? 20   HIS B CD2 1 
ATOM   718  C CE1 . HIS B 1 20 ? 20.330  -2.887  23.139 1.00 47.17  ? 20   HIS B CE1 1 
ATOM   719  N NE2 . HIS B 1 20 ? 21.303  -3.642  23.614 1.00 52.42  ? 20   HIS B NE2 1 
ATOM   720  N N   . PHE B 1 21 ? 20.523  0.427   28.986 1.00 34.04  ? 21   PHE B N   1 
ATOM   721  C CA  . PHE B 1 21 ? 20.683  1.598   29.821 1.00 49.04  ? 21   PHE B CA  1 
ATOM   722  C C   . PHE B 1 21 ? 20.428  1.210   31.225 1.00 33.64  ? 21   PHE B C   1 
ATOM   723  O O   . PHE B 1 21 ? 19.420  0.606   31.526 1.00 62.96  ? 21   PHE B O   1 
ATOM   724  C CB  . PHE B 1 21 ? 19.716  2.750   29.430 1.00 38.50  ? 21   PHE B CB  1 
ATOM   725  C CG  . PHE B 1 21 ? 19.921  3.234   28.058 1.00 36.72  ? 21   PHE B CG  1 
ATOM   726  C CD1 . PHE B 1 21 ? 20.869  4.249   27.773 1.00 34.07  ? 21   PHE B CD1 1 
ATOM   727  C CD2 . PHE B 1 21 ? 19.222  2.635   27.006 1.00 38.78  ? 21   PHE B CD2 1 
ATOM   728  C CE1 . PHE B 1 21 ? 21.105  4.677   26.417 1.00 28.27  ? 21   PHE B CE1 1 
ATOM   729  C CE2 . PHE B 1 21 ? 19.468  3.036   25.658 1.00 39.05  ? 21   PHE B CE2 1 
ATOM   730  C CZ  . PHE B 1 21 ? 20.403  4.080   25.368 1.00 23.08  ? 21   PHE B CZ  1 
ATOM   731  N N   . SER B 1 22 ? 21.328  1.617   32.098 1.00 39.76  ? 22   SER B N   1 
ATOM   732  C CA  . SER B 1 22 ? 21.146  1.431   33.520 1.00 57.13  ? 22   SER B CA  1 
ATOM   733  C C   . SER B 1 22 ? 20.396  2.662   34.051 1.00 52.71  ? 22   SER B C   1 
ATOM   734  O O   . SER B 1 22 ? 20.342  3.696   33.399 1.00 36.24  ? 22   SER B O   1 
ATOM   735  C CB  . SER B 1 22 ? 22.505  1.262   34.173 1.00 45.27  ? 22   SER B CB  1 
ATOM   736  O OG  . SER B 1 22 ? 23.119  2.521   34.290 1.00 51.49  ? 22   SER B OG  1 
ATOM   737  N N   . PRO B 1 23 ? 19.780  2.550   35.241 1.00 69.32  ? 23   PRO B N   1 
ATOM   738  C CA  . PRO B 1 23 ? 18.778  3.516   35.728 1.00 46.04  ? 23   PRO B CA  1 
ATOM   739  C C   . PRO B 1 23 ? 19.312  4.902   35.955 1.00 52.05  ? 23   PRO B C   1 
ATOM   740  O O   . PRO B 1 23 ? 18.604  5.868   35.725 1.00 63.50  ? 23   PRO B O   1 
ATOM   741  C CB  . PRO B 1 23 ? 18.325  2.899   37.028 1.00 62.39  ? 23   PRO B CB  1 
ATOM   742  C CG  . PRO B 1 23 ? 18.544  1.414   36.820 1.00 55.22  ? 23   PRO B CG  1 
ATOM   743  C CD  . PRO B 1 23 ? 19.853  1.368   36.116 1.00 65.74  ? 23   PRO B CD  1 
ATOM   744  N N   . GLU B 1 24 ? 20.554  5.016   36.386 1.00 42.84  ? 24   GLU B N   1 
ATOM   745  C CA  . GLU B 1 24 ? 21.213  6.316   36.337 1.00 54.40  ? 24   GLU B CA  1 
ATOM   746  C C   . GLU B 1 24 ? 21.303  6.944   34.941 1.00 70.17  ? 24   GLU B C   1 
ATOM   747  O O   . GLU B 1 24 ? 21.431  8.163   34.847 1.00 87.02  ? 24   GLU B O   1 
ATOM   748  C CB  . GLU B 1 24 ? 22.625  6.267   36.957 1.00 53.89  ? 24   GLU B CB  1 
ATOM   749  C CG  . GLU B 1 24 ? 23.367  4.940   36.841 1.00 52.02  ? 24   GLU B CG  1 
ATOM   750  N N   . GLU B 1 25 ? 21.264  6.130   33.870 1.00 46.87  ? 25   GLU B N   1 
ATOM   751  C CA  . GLU B 1 25 ? 21.422  6.625   32.514 1.00 25.35  ? 25   GLU B CA  1 
ATOM   752  C C   . GLU B 1 25 ? 20.128  7.073   31.821 1.00 41.62  ? 25   GLU B C   1 
ATOM   753  O O   . GLU B 1 25 ? 20.165  7.537   30.714 1.00 33.40  ? 25   GLU B O   1 
ATOM   754  C CB  . GLU B 1 25 ? 22.149  5.603   31.665 1.00 43.31  ? 25   GLU B CB  1 
ATOM   755  C CG  . GLU B 1 25 ? 23.517  5.354   32.173 1.00 26.67  ? 25   GLU B CG  1 
ATOM   756  C CD  . GLU B 1 25 ? 24.155  4.072   31.645 1.00 88.96  ? 25   GLU B CD  1 
ATOM   757  O OE1 . GLU B 1 25 ? 23.399  3.108   31.251 1.00 50.03  ? 25   GLU B OE1 1 
ATOM   758  O OE2 . GLU B 1 25 ? 25.431  4.065   31.663 1.00 31.53  ? 25   GLU B OE2 1 
ATOM   759  N N   . LEU B 1 26 ? 19.000  6.928   32.495 1.00 47.82  ? 26   LEU B N   1 
ATOM   760  C CA  . LEU B 1 26 ? 17.723  7.350   32.007 1.00 32.86  ? 26   LEU B CA  1 
ATOM   761  C C   . LEU B 1 26 ? 17.169  8.585   32.779 1.00 44.03  ? 26   LEU B C   1 
ATOM   762  O O   . LEU B 1 26 ? 17.387  8.744   33.957 1.00 56.60  ? 26   LEU B O   1 
ATOM   763  C CB  . LEU B 1 26 ? 16.778  6.161   32.113 1.00 26.75  ? 26   LEU B CB  1 
ATOM   764  C CG  . LEU B 1 26 ? 17.177  4.991   31.259 1.00 57.88  ? 26   LEU B CG  1 
ATOM   765  C CD1 . LEU B 1 26 ? 16.354  3.786   31.619 1.00 43.52  ? 26   LEU B CD1 1 
ATOM   766  C CD2 . LEU B 1 26 ? 17.012  5.369   29.781 1.00 38.30  ? 26   LEU B CD2 1 
ATOM   767  N N   . LYS B 1 27 ? 16.447  9.453   32.103 1.00 43.08  ? 27   LYS B N   1 
ATOM   768  C CA  . LYS B 1 27 ? 15.728  10.544  32.755 1.00 59.53  ? 27   LYS B CA  1 
ATOM   769  C C   . LYS B 1 27 ? 14.392  10.725  32.062 1.00 42.51  ? 27   LYS B C   1 
ATOM   770  O O   . LYS B 1 27 ? 14.338  10.724  30.878 1.00 34.45  ? 27   LYS B O   1 
ATOM   771  C CB  . LYS B 1 27 ? 16.554  11.858  32.806 1.00 38.22  ? 27   LYS B CB  1 
ATOM   772  C CG  . LYS B 1 27 ? 16.514  12.794  31.566 1.00 50.49  ? 27   LYS B CG  1 
ATOM   773  N N   . VAL B 1 28 ? 13.335  10.821  32.851 1.00 45.15  ? 28   VAL B N   1 
ATOM   774  C CA  . VAL B 1 28 ? 11.997  11.163  32.428 1.00 39.99  ? 28   VAL B CA  1 
ATOM   775  C C   . VAL B 1 28 ? 11.672  12.566  32.973 1.00 53.60  ? 28   VAL B C   1 
ATOM   776  O O   . VAL B 1 28 ? 11.962  12.876  34.124 1.00 61.78  ? 28   VAL B O   1 
ATOM   777  C CB  . VAL B 1 28 ? 10.980  10.064  32.885 1.00 47.84  ? 28   VAL B CB  1 
ATOM   778  C CG1 . VAL B 1 28 ? 9.536   10.327  32.348 1.00 67.22  ? 28   VAL B CG1 1 
ATOM   779  C CG2 . VAL B 1 28 ? 11.466  8.695   32.440 1.00 39.51  ? 28   VAL B CG2 1 
ATOM   780  N N   . LYS B 1 29 ? 11.130  13.430  32.119 1.00 57.94  ? 29   LYS B N   1 
ATOM   781  C CA  . LYS B 1 29 ? 10.651  14.752  32.507 1.00 38.13  ? 29   LYS B CA  1 
ATOM   782  C C   . LYS B 1 29 ? 9.310   14.960  31.845 1.00 68.58  ? 29   LYS B C   1 
ATOM   783  O O   . LYS B 1 29 ? 9.179   14.733  30.660 1.00 67.16  ? 29   LYS B O   1 
ATOM   784  C CB  . LYS B 1 29 ? 11.574  15.845  31.999 1.00 40.20  ? 29   LYS B CB  1 
ATOM   785  C CG  . LYS B 1 29 ? 12.817  16.041  32.791 1.00 56.59  ? 29   LYS B CG  1 
ATOM   786  C CD  . LYS B 1 29 ? 12.604  17.114  33.877 1.00 137.34 ? 29   LYS B CD  1 
ATOM   787  C CE  . LYS B 1 29 ? 11.121  17.361  34.253 1.00 119.38 ? 29   LYS B CE  1 
ATOM   788  N NZ  . LYS B 1 29 ? 10.700  16.953  35.640 1.00 62.70  ? 29   LYS B NZ  1 
ATOM   789  N N   . VAL B 1 30 ? 8.313   15.397  32.600 1.00 71.82  ? 30   VAL B N   1 
ATOM   790  C CA  . VAL B 1 30 ? 7.166   16.050  31.985 1.00 71.65  ? 30   VAL B CA  1 
ATOM   791  C C   . VAL B 1 30 ? 7.425   17.551  31.875 1.00 86.41  ? 30   VAL B C   1 
ATOM   792  O O   . VAL B 1 30 ? 7.484   18.263  32.886 1.00 80.21  ? 30   VAL B O   1 
ATOM   793  C CB  . VAL B 1 30 ? 5.877   15.864  32.755 1.00 44.68  ? 30   VAL B CB  1 
ATOM   794  C CG1 . VAL B 1 30 ? 4.777   16.533  31.947 1.00 61.66  ? 30   VAL B CG1 1 
ATOM   795  C CG2 . VAL B 1 30 ? 5.559   14.381  32.902 1.00 42.25  ? 30   VAL B CG2 1 
ATOM   796  N N   . LEU B 1 31 ? 7.608   18.028  30.649 1.00 94.42  ? 31   LEU B N   1 
ATOM   797  C CA  . LEU B 1 31 ? 7.738   19.461  30.399 1.00 71.71  ? 31   LEU B CA  1 
ATOM   798  C C   . LEU B 1 31 ? 6.480   19.891  29.660 1.00 94.26  ? 31   LEU B C   1 
ATOM   799  O O   . LEU B 1 31 ? 6.392   19.748  28.438 1.00 103.20 ? 31   LEU B O   1 
ATOM   800  C CB  . LEU B 1 31 ? 8.999   19.760  29.574 1.00 70.02  ? 31   LEU B CB  1 
ATOM   801  C CG  . LEU B 1 31 ? 10.323  19.421  30.281 1.00 94.62  ? 31   LEU B CG  1 
ATOM   802  C CD1 . LEU B 1 31 ? 11.508  19.728  29.392 1.00 107.96 ? 31   LEU B CD1 1 
ATOM   803  C CD2 . LEU B 1 31 ? 10.468  20.158  31.606 1.00 79.66  ? 31   LEU B CD2 1 
ATOM   804  N N   . GLY B 1 32 ? 5.486   20.378  30.401 1.00 91.63  ? 32   GLY B N   1 
ATOM   805  C CA  . GLY B 1 32 ? 4.240   20.814  29.793 1.00 78.43  ? 32   GLY B CA  1 
ATOM   806  C C   . GLY B 1 32 ? 3.346   19.676  29.320 1.00 90.18  ? 32   GLY B C   1 
ATOM   807  O O   . GLY B 1 32 ? 2.983   18.819  30.122 1.00 91.72  ? 32   GLY B O   1 
ATOM   808  N N   . ASP B 1 33 ? 2.987   19.689  28.028 1.00 91.27  ? 33   ASP B N   1 
ATOM   809  C CA  . ASP B 1 33 ? 2.111   18.672  27.395 1.00 88.72  ? 33   ASP B CA  1 
ATOM   810  C C   . ASP B 1 33 ? 2.896   17.431  26.877 1.00 90.43  ? 33   ASP B C   1 
ATOM   811  O O   . ASP B 1 33 ? 2.350   16.537  26.180 1.00 61.88  ? 33   ASP B O   1 
ATOM   812  C CB  . ASP B 1 33 ? 1.337   19.300  26.216 1.00 97.08  ? 33   ASP B CB  1 
ATOM   813  C CG  . ASP B 1 33 ? -0.120  19.599  26.541 1.00 104.39 ? 33   ASP B CG  1 
ATOM   814  O OD1 . ASP B 1 33 ? -0.655  18.998  27.489 1.00 100.68 ? 33   ASP B OD1 1 
ATOM   815  O OD2 . ASP B 1 33 ? -0.747  20.414  25.817 1.00 121.34 ? 33   ASP B OD2 1 
ATOM   816  N N   . VAL B 1 34 ? 4.189   17.393  27.205 1.00 73.45  ? 34   VAL B N   1 
ATOM   817  C CA  . VAL B 1 34 ? 5.117   16.448  26.568 1.00 87.03  ? 34   VAL B CA  1 
ATOM   818  C C   . VAL B 1 34 ? 5.896   15.615  27.553 1.00 68.57  ? 34   VAL B C   1 
ATOM   819  O O   . VAL B 1 34 ? 6.561   16.163  28.438 1.00 67.57  ? 34   VAL B O   1 
ATOM   820  C CB  . VAL B 1 34 ? 6.185   17.189  25.694 1.00 80.35  ? 34   VAL B CB  1 
ATOM   821  C CG1 . VAL B 1 34 ? 7.086   16.185  24.967 1.00 56.67  ? 34   VAL B CG1 1 
ATOM   822  C CG2 . VAL B 1 34 ? 5.513   18.162  24.688 1.00 49.68  ? 34   VAL B CG2 1 
ATOM   823  N N   . ILE B 1 35 ? 5.815   14.300  27.388 1.00 52.28  ? 35   ILE B N   1 
ATOM   824  C CA  . ILE B 1 35 ? 6.796   13.397  28.001 1.00 58.50  ? 35   ILE B CA  1 
ATOM   825  C C   . ILE B 1 35 ? 8.154   13.308  27.229 1.00 64.50  ? 35   ILE B C   1 
ATOM   826  O O   . ILE B 1 35 ? 8.216   12.875  26.071 1.00 54.73  ? 35   ILE B O   1 
ATOM   827  C CB  . ILE B 1 35 ? 6.239   11.989  28.148 1.00 55.56  ? 35   ILE B CB  1 
ATOM   828  C CG1 . ILE B 1 35 ? 5.007   12.004  29.078 1.00 48.83  ? 35   ILE B CG1 1 
ATOM   829  C CG2 . ILE B 1 35 ? 7.371   11.053  28.620 1.00 46.43  ? 35   ILE B CG2 1 
ATOM   830  C CD1 . ILE B 1 35 ? 3.968   10.878  28.849 1.00 38.50  ? 35   ILE B CD1 1 
ATOM   831  N N   . GLU B 1 36 ? 9.230   13.739  27.871 1.00 37.47  ? 36   GLU B N   1 
ATOM   832  C CA  . GLU B 1 36 ? 10.570  13.473  27.390 1.00 46.30  ? 36   GLU B CA  1 
ATOM   833  C C   . GLU B 1 36 ? 11.233  12.236  28.110 1.00 67.31  ? 36   GLU B C   1 
ATOM   834  O O   . GLU B 1 36 ? 11.225  12.100  29.358 1.00 38.69  ? 36   GLU B O   1 
ATOM   835  C CB  . GLU B 1 36 ? 11.467  14.711  27.554 1.00 48.35  ? 36   GLU B CB  1 
ATOM   836  C CG  . GLU B 1 36 ? 10.861  15.979  27.070 1.00 61.44  ? 36   GLU B CG  1 
ATOM   837  C CD  . GLU B 1 36 ? 11.839  17.142  27.163 1.00 102.88 ? 36   GLU B CD  1 
ATOM   838  O OE1 . GLU B 1 36 ? 13.003  16.929  27.564 1.00 101.16 ? 36   GLU B OE1 1 
ATOM   839  O OE2 . GLU B 1 36 ? 11.454  18.275  26.822 1.00 129.01 ? 36   GLU B OE2 1 
ATOM   840  N N   . VAL B 1 37 ? 11.784  11.320  27.315 1.00 49.74  ? 37   VAL B N   1 
ATOM   841  C CA  . VAL B 1 37 ? 12.628  10.255  27.844 1.00 43.17  ? 37   VAL B CA  1 
ATOM   842  C C   . VAL B 1 37 ? 13.991  10.431  27.229 1.00 49.90  ? 37   VAL B C   1 
ATOM   843  O O   . VAL B 1 37 ? 14.136  10.428  26.019 1.00 41.14  ? 37   VAL B O   1 
ATOM   844  C CB  . VAL B 1 37 ? 12.138  8.852   27.502 1.00 44.83  ? 37   VAL B CB  1 
ATOM   845  C CG1 . VAL B 1 37 ? 13.063  7.811   28.171 1.00 40.60  ? 37   VAL B CG1 1 
ATOM   846  C CG2 . VAL B 1 37 ? 10.639  8.677   27.852 1.00 19.82  ? 37   VAL B CG2 1 
ATOM   847  N N   . HIS B 1 38 ? 14.984  10.623  28.055 1.00 21.54  ? 38   HIS B N   1 
ATOM   848  C CA  . HIS B 1 38 ? 16.342  10.749  27.562 1.00 46.23  ? 38   HIS B CA  1 
ATOM   849  C C   . HIS B 1 38 ? 17.242  9.595   28.082 1.00 45.12  ? 38   HIS B C   1 
ATOM   850  O O   . HIS B 1 38 ? 17.121  9.159   29.187 1.00 37.42  ? 38   HIS B O   1 
ATOM   851  C CB  . HIS B 1 38 ? 16.918  12.132  27.867 1.00 26.72  ? 38   HIS B CB  1 
ATOM   852  C CG  . HIS B 1 38 ? 18.333  12.280  27.466 1.00 38.52  ? 38   HIS B CG  1 
ATOM   853  N ND1 . HIS B 1 38 ? 18.705  12.380  26.142 1.00 79.99  ? 38   HIS B ND1 1 
ATOM   854  C CD2 . HIS B 1 38 ? 19.478  12.268  28.179 1.00 61.66  ? 38   HIS B CD2 1 
ATOM   855  C CE1 . HIS B 1 38 ? 20.018  12.468  26.064 1.00 67.57  ? 38   HIS B CE1 1 
ATOM   856  N NE2 . HIS B 1 38 ? 20.512  12.422  27.290 1.00 42.77  ? 38   HIS B NE2 1 
ATOM   857  N N   . GLY B 1 39 ? 18.110  9.092   27.225 1.00 31.39  ? 39   GLY B N   1 
ATOM   858  C CA  . GLY B 1 39 ? 18.890  7.910   27.502 1.00 41.49  ? 39   GLY B CA  1 
ATOM   859  C C   . GLY B 1 39 ? 20.247  8.067   26.885 1.00 43.21  ? 39   GLY B C   1 
ATOM   860  O O   . GLY B 1 39 ? 20.357  8.545   25.783 1.00 38.34  ? 39   GLY B O   1 
ATOM   861  N N   . LYS B 1 40 ? 21.285  7.739   27.636 1.00 43.88  ? 40   LYS B N   1 
ATOM   862  C CA  . LYS B 1 40 ? 22.651  8.020   27.195 1.00 41.25  ? 40   LYS B CA  1 
ATOM   863  C C   . LYS B 1 40 ? 23.596  7.174   27.954 1.00 29.12  ? 40   LYS B C   1 
ATOM   864  O O   . LYS B 1 40 ? 23.341  6.847   29.079 1.00 40.52  ? 40   LYS B O   1 
ATOM   865  C CB  . LYS B 1 40 ? 23.050  9.447   27.398 1.00 27.37  ? 40   LYS B CB  1 
ATOM   866  C CG  . LYS B 1 40 ? 24.280  9.746   26.653 1.00 32.11  ? 40   LYS B CG  1 
ATOM   867  C CD  . LYS B 1 40 ? 24.924  10.798  27.379 1.00 21.01  ? 40   LYS B CD  1 
ATOM   868  C CE  . LYS B 1 40 ? 26.153  11.417  26.698 1.00 51.39  ? 40   LYS B CE  1 
ATOM   869  N NZ  . LYS B 1 40 ? 25.742  12.512  25.775 1.00 53.36  ? 40   LYS B NZ  1 
ATOM   870  N N   . HIS B 1 41 ? 24.643  6.731   27.294 1.00 45.07  ? 41   HIS B N   1 
ATOM   871  C CA  . HIS B 1 41 ? 25.596  5.848   27.901 1.00 39.12  ? 41   HIS B CA  1 
ATOM   872  C C   . HIS B 1 41 ? 26.891  5.928   27.164 1.00 37.23  ? 41   HIS B C   1 
ATOM   873  O O   . HIS B 1 41 ? 26.947  5.827   25.961 1.00 59.55  ? 41   HIS B O   1 
ATOM   874  C CB  . HIS B 1 41 ? 25.050  4.444   28.101 1.00 20.94  ? 41   HIS B CB  1 
ATOM   875  C CG  . HIS B 1 41 ? 25.421  3.457   27.041 1.00 41.22  ? 41   HIS B CG  1 
ATOM   876  N ND1 . HIS B 1 41 ? 24.477  2.673   26.405 1.00 43.47  ? 41   HIS B ND1 1 
ATOM   877  C CD2 . HIS B 1 41 ? 26.627  3.043   26.586 1.00 19.86  ? 41   HIS B CD2 1 
ATOM   878  C CE1 . HIS B 1 41 ? 25.089  1.848   25.579 1.00 23.18  ? 41   HIS B CE1 1 
ATOM   879  N NE2 . HIS B 1 41 ? 26.389  2.034   25.690 1.00 47.88  ? 41   HIS B NE2 1 
ATOM   880  N N   . GLU B 1 42 ? 27.932  6.171   27.923 1.00 56.26  ? 42   GLU B N   1 
ATOM   881  C CA  . GLU B 1 42 ? 29.247  6.419   27.410 1.00 61.44  ? 42   GLU B CA  1 
ATOM   882  C C   . GLU B 1 42 ? 29.801  5.034   26.911 1.00 54.82  ? 42   GLU B C   1 
ATOM   883  O O   . GLU B 1 42 ? 29.211  3.951   27.225 1.00 36.46  ? 42   GLU B O   1 
ATOM   884  C CB  . GLU B 1 42 ? 30.076  7.197   28.501 1.00 30.83  ? 42   GLU B CB  1 
ATOM   885  N N   . GLU B 1 43 ? 30.855  5.075   26.081 1.00 30.66  ? 43   GLU B N   1 
ATOM   886  C CA  . GLU B 1 43 ? 31.464  3.881   25.512 1.00 36.12  ? 43   GLU B CA  1 
ATOM   887  C C   . GLU B 1 43 ? 31.711  2.791   26.552 1.00 43.41  ? 43   GLU B C   1 
ATOM   888  O O   . GLU B 1 43 ? 32.153  3.028   27.660 1.00 51.76  ? 43   GLU B O   1 
ATOM   889  C CB  . GLU B 1 43 ? 32.786  4.198   24.758 1.00 43.66  ? 43   GLU B CB  1 
ATOM   890  N N   . ARG B 1 44 ? 31.483  1.566   26.152 1.00 57.54  ? 44   ARG B N   1 
ATOM   891  C CA  . ARG B 1 44 ? 31.444  0.506   27.092 1.00 45.17  ? 44   ARG B CA  1 
ATOM   892  C C   . ARG B 1 44 ? 31.525  -0.788  26.336 1.00 44.75  ? 44   ARG B C   1 
ATOM   893  O O   . ARG B 1 44 ? 30.933  -0.923  25.284 1.00 64.82  ? 44   ARG B O   1 
ATOM   894  C CB  . ARG B 1 44 ? 30.121  0.577   27.828 1.00 25.82  ? 44   ARG B CB  1 
ATOM   895  C CG  . ARG B 1 44 ? 29.644  -0.779  28.267 1.00 59.82  ? 44   ARG B CG  1 
ATOM   896  C CD  . ARG B 1 44 ? 28.146  -0.888  28.176 1.00 55.07  ? 44   ARG B CD  1 
ATOM   897  N NE  . ARG B 1 44 ? 27.466  0.111   28.981 1.00 57.10  ? 44   ARG B NE  1 
ATOM   898  C CZ  . ARG B 1 44 ? 26.136  0.262   29.017 1.00 113.26 ? 44   ARG B CZ  1 
ATOM   899  N NH1 . ARG B 1 44 ? 25.339  -0.555  28.275 1.00 49.05  ? 44   ARG B NH1 1 
ATOM   900  N NH2 . ARG B 1 44 ? 25.601  1.242   29.784 1.00 54.64  ? 44   ARG B NH2 1 
ATOM   901  N N   . GLN B 1 45 ? 32.223  -1.755  26.895 1.00 49.78  ? 45   GLN B N   1 
ATOM   902  C CA  . GLN B 1 45 ? 32.495  -2.943  26.179 1.00 45.13  ? 45   GLN B CA  1 
ATOM   903  C C   . GLN B 1 45 ? 31.320  -3.804  26.193 1.00 63.06  ? 45   GLN B C   1 
ATOM   904  O O   . GLN B 1 45 ? 30.472  -3.709  27.065 1.00 74.04  ? 45   GLN B O   1 
ATOM   905  C CB  . GLN B 1 45 ? 33.584  -3.731  26.829 1.00 32.53  ? 45   GLN B CB  1 
ATOM   906  C CG  . GLN B 1 45 ? 34.411  -4.460  25.807 1.00 59.45  ? 45   GLN B CG  1 
ATOM   907  C CD  . GLN B 1 45 ? 35.233  -5.515  26.463 1.00 95.69  ? 45   GLN B CD  1 
ATOM   908  O OE1 . GLN B 1 45 ? 36.271  -5.205  27.067 1.00 53.49  ? 45   GLN B OE1 1 
ATOM   909  N NE2 . GLN B 1 45 ? 34.758  -6.771  26.412 1.00 44.94  ? 45   GLN B NE2 1 
ATOM   910  N N   . ASP B 1 46 ? 31.276  -4.689  25.222 1.00 55.68  ? 46   ASP B N   1 
ATOM   911  C CA  . ASP B 1 46 ? 30.296  -5.712  25.318 1.00 60.02  ? 46   ASP B CA  1 
ATOM   912  C C   . ASP B 1 46 ? 30.868  -6.911  24.596 1.00 38.15  ? 46   ASP B C   1 
ATOM   913  O O   . ASP B 1 46 ? 32.077  -7.005  24.424 1.00 52.33  ? 46   ASP B O   1 
ATOM   914  C CB  . ASP B 1 46 ? 28.893  -5.206  24.831 1.00 55.58  ? 46   ASP B CB  1 
ATOM   915  C CG  . ASP B 1 46 ? 28.871  -4.804  23.383 1.00 57.74  ? 46   ASP B CG  1 
ATOM   916  O OD1 . ASP B 1 46 ? 29.975  -4.783  22.800 1.00 95.27  ? 46   ASP B OD1 1 
ATOM   917  O OD2 . ASP B 1 46 ? 27.782  -4.508  22.824 1.00 44.92  ? 46   ASP B OD2 1 
ATOM   918  N N   . GLU B 1 47 ? 29.998  -7.841  24.243 1.00 42.05  ? 47   GLU B N   1 
ATOM   919  C CA  . GLU B 1 47 ? 30.347  -8.974  23.412 1.00 74.23  ? 47   GLU B CA  1 
ATOM   920  C C   . GLU B 1 47 ? 31.027  -8.602  22.075 1.00 104.01 ? 47   GLU B C   1 
ATOM   921  O O   . GLU B 1 47 ? 32.050  -9.209  21.738 1.00 76.07  ? 47   GLU B O   1 
ATOM   922  C CB  . GLU B 1 47 ? 29.107  -9.848  23.169 1.00 94.93  ? 47   GLU B CB  1 
ATOM   923  C CG  . GLU B 1 47 ? 27.777  -9.087  23.283 1.00 117.49 ? 47   GLU B CG  1 
ATOM   924  C CD  . GLU B 1 47 ? 27.168  -9.123  24.683 1.00 114.92 ? 47   GLU B CD  1 
ATOM   925  O OE1 . GLU B 1 47 ? 26.824  -10.239 25.154 1.00 109.48 ? 47   GLU B OE1 1 
ATOM   926  O OE2 . GLU B 1 47 ? 27.011  -8.030  25.287 1.00 38.26  ? 47   GLU B OE2 1 
ATOM   927  N N   . HIS B 1 48 ? 30.494  -7.615  21.331 1.00 106.22 ? 48   HIS B N   1 
ATOM   928  C CA  . HIS B 1 48 ? 31.053  -7.267  20.007 1.00 46.73  ? 48   HIS B CA  1 
ATOM   929  C C   . HIS B 1 48 ? 32.175  -6.251  19.987 1.00 44.72  ? 48   HIS B C   1 
ATOM   930  O O   . HIS B 1 48 ? 32.847  -6.078  18.984 1.00 53.91  ? 48   HIS B O   1 
ATOM   931  C CB  . HIS B 1 48 ? 29.974  -6.846  19.032 1.00 56.27  ? 48   HIS B CB  1 
ATOM   932  C CG  . HIS B 1 48 ? 29.034  -7.948  18.660 1.00 87.62  ? 48   HIS B CG  1 
ATOM   933  N ND1 . HIS B 1 48 ? 28.589  -8.147  17.366 1.00 125.71 ? 48   HIS B ND1 1 
ATOM   934  C CD2 . HIS B 1 48 ? 28.443  -8.904  19.413 1.00 46.49  ? 48   HIS B CD2 1 
ATOM   935  C CE1 . HIS B 1 48 ? 27.760  -9.177  17.340 1.00 112.54 ? 48   HIS B CE1 1 
ATOM   936  N NE2 . HIS B 1 48 ? 27.655  -9.655  18.569 1.00 102.38 ? 48   HIS B NE2 1 
ATOM   937  N N   . GLY B 1 49 ? 32.412  -5.578  21.082 1.00 35.74  ? 49   GLY B N   1 
ATOM   938  C CA  . GLY B 1 49 ? 33.462  -4.596  21.055 1.00 31.76  ? 49   GLY B CA  1 
ATOM   939  C C   . GLY B 1 49 ? 33.001  -3.489  21.953 1.00 58.98  ? 49   GLY B C   1 
ATOM   940  O O   . GLY B 1 49 ? 32.570  -3.744  23.082 1.00 50.06  ? 49   GLY B O   1 
ATOM   941  N N   . PHE B 1 50 ? 33.035  -2.266  21.451 1.00 40.61  ? 50   PHE B N   1 
ATOM   942  C CA  . PHE B 1 50 ? 32.712  -1.104  22.268 1.00 40.11  ? 50   PHE B CA  1 
ATOM   943  C C   . PHE B 1 50 ? 31.588  -0.287  21.662 1.00 57.49  ? 50   PHE B C   1 
ATOM   944  O O   . PHE B 1 50 ? 31.482  -0.238  20.451 1.00 45.09  ? 50   PHE B O   1 
ATOM   945  C CB  . PHE B 1 50 ? 33.926  -0.216  22.389 1.00 50.12  ? 50   PHE B CB  1 
ATOM   946  C CG  . PHE B 1 50 ? 35.042  -0.876  23.046 1.00 80.34  ? 50   PHE B CG  1 
ATOM   947  C CD1 . PHE B 1 50 ? 35.231  -0.709  24.405 1.00 86.89  ? 50   PHE B CD1 1 
ATOM   948  C CD2 . PHE B 1 50 ? 35.879  -1.720  22.329 1.00 77.79  ? 50   PHE B CD2 1 
ATOM   949  C CE1 . PHE B 1 50 ? 36.245  -1.348  25.031 1.00 73.46  ? 50   PHE B CE1 1 
ATOM   950  C CE2 . PHE B 1 50 ? 36.887  -2.356  22.952 1.00 83.53  ? 50   PHE B CE2 1 
ATOM   951  C CZ  . PHE B 1 50 ? 37.071  -2.171  24.306 1.00 49.51  ? 50   PHE B CZ  1 
ATOM   952  N N   . ILE B 1 51 ? 30.795  0.411   22.480 1.00 30.36  ? 51   ILE B N   1 
ATOM   953  C CA  . ILE B 1 51 ? 29.584  1.012   21.947 1.00 25.20  ? 51   ILE B CA  1 
ATOM   954  C C   . ILE B 1 51 ? 29.018  2.047   22.895 1.00 29.32  ? 51   ILE B C   1 
ATOM   955  O O   . ILE B 1 51 ? 28.752  1.772   24.050 1.00 37.95  ? 51   ILE B O   1 
ATOM   956  C CB  . ILE B 1 51 ? 28.534  -0.100  21.647 1.00 27.21  ? 51   ILE B CB  1 
ATOM   957  C CG1 . ILE B 1 51 ? 27.132  0.467   21.487 1.00 54.72  ? 51   ILE B CG1 1 
ATOM   958  C CG2 . ILE B 1 51 ? 28.451  -1.013  22.783 1.00 38.61  ? 51   ILE B CG2 1 
ATOM   959  C CD1 . ILE B 1 51 ? 26.687  0.869   20.101 1.00 18.46  ? 51   ILE B CD1 1 
ATOM   960  N N   . SER B 1 52 ? 28.838  3.252   22.417 1.00 34.77  ? 52   SER B N   1 
ATOM   961  C CA  . SER B 1 52 ? 28.030  4.223   23.141 1.00 44.28  ? 52   SER B CA  1 
ATOM   962  C C   . SER B 1 52 ? 26.671  4.428   22.449 1.00 24.39  ? 52   SER B C   1 
ATOM   963  O O   . SER B 1 52 ? 26.550  4.215   21.269 1.00 39.33  ? 52   SER B O   1 
ATOM   964  C CB  . SER B 1 52 ? 28.774  5.565   23.281 1.00 40.37  ? 52   SER B CB  1 
ATOM   965  O OG  . SER B 1 52 ? 29.417  5.959   22.099 1.00 47.21  ? 52   SER B OG  1 
ATOM   966  N N   . ARG B 1 53 ? 25.673  4.890   23.180 1.00 29.43  ? 53   ARG B N   1 
ATOM   967  C CA  . ARG B 1 53 ? 24.354  5.139   22.637 1.00 28.92  ? 53   ARG B CA  1 
ATOM   968  C C   . ARG B 1 53 ? 23.700  6.296   23.332 1.00 37.98  ? 53   ARG B C   1 
ATOM   969  O O   . ARG B 1 53 ? 23.949  6.563   24.496 1.00 40.50  ? 53   ARG B O   1 
ATOM   970  C CB  . ARG B 1 53 ? 23.409  3.962   22.874 1.00 25.89  ? 53   ARG B CB  1 
ATOM   971  C CG  . ARG B 1 53 ? 23.873  2.633   22.486 1.00 23.79  ? 53   ARG B CG  1 
ATOM   972  C CD  . ARG B 1 53 ? 22.723  1.678   22.727 1.00 28.78  ? 53   ARG B CD  1 
ATOM   973  N NE  . ARG B 1 53 ? 22.993  0.291   22.353 1.00 31.13  ? 53   ARG B NE  1 
ATOM   974  C CZ  . ARG B 1 53 ? 23.906  -0.509  22.923 1.00 51.62  ? 53   ARG B CZ  1 
ATOM   975  N NH1 . ARG B 1 53 ? 24.700  -0.082  23.910 1.00 34.90  ? 53   ARG B NH1 1 
ATOM   976  N NH2 . ARG B 1 53 ? 24.063  -1.736  22.456 1.00 27.45  ? 53   ARG B NH2 1 
ATOM   977  N N   . GLU B 1 54 ? 22.853  6.990   22.591 1.00 44.92  ? 54   GLU B N   1 
ATOM   978  C CA  . GLU B 1 54 ? 22.094  8.110   23.087 1.00 28.20  ? 54   GLU B CA  1 
ATOM   979  C C   . GLU B 1 54 ? 20.796  8.190   22.313 1.00 48.46  ? 54   GLU B C   1 
ATOM   980  O O   . GLU B 1 54 ? 20.758  7.858   21.156 1.00 31.37  ? 54   GLU B O   1 
ATOM   981  C CB  . GLU B 1 54 ? 22.819  9.456   22.973 1.00 22.40  ? 54   GLU B CB  1 
ATOM   982  C CG  . GLU B 1 54 ? 21.956  10.569  23.656 1.00 46.08  ? 54   GLU B CG  1 
ATOM   983  C CD  . GLU B 1 54 ? 22.712  11.847  23.836 1.00 84.82  ? 54   GLU B CD  1 
ATOM   984  O OE1 . GLU B 1 54 ? 23.891  11.928  23.375 1.00 51.88  ? 54   GLU B OE1 1 
ATOM   985  O OE2 . GLU B 1 54 ? 22.106  12.773  24.415 1.00 65.80  ? 54   GLU B OE2 1 
ATOM   986  N N   . PHE B 1 55 ? 19.739  8.637   22.971 1.00 28.44  ? 55   PHE B N   1 
ATOM   987  C CA  . PHE B 1 55 ? 18.461  8.760   22.370 1.00 39.16  ? 55   PHE B CA  1 
ATOM   988  C C   . PHE B 1 55 ? 17.604  9.764   23.158 1.00 34.11  ? 55   PHE B C   1 
ATOM   989  O O   . PHE B 1 55 ? 17.786  9.974   24.324 1.00 33.90  ? 55   PHE B O   1 
ATOM   990  C CB  . PHE B 1 55 ? 17.829  7.370   22.276 1.00 38.22  ? 55   PHE B CB  1 
ATOM   991  C CG  . PHE B 1 55 ? 16.996  6.981   23.468 1.00 34.90  ? 55   PHE B CG  1 
ATOM   992  C CD1 . PHE B 1 55 ? 15.731  7.535   23.679 1.00 23.03  ? 55   PHE B CD1 1 
ATOM   993  C CD2 . PHE B 1 55 ? 17.453  6.001   24.361 1.00 44.18  ? 55   PHE B CD2 1 
ATOM   994  C CE1 . PHE B 1 55 ? 14.955  7.126   24.818 1.00 41.54  ? 55   PHE B CE1 1 
ATOM   995  C CE2 . PHE B 1 55 ? 16.705  5.616   25.513 1.00 29.60  ? 55   PHE B CE2 1 
ATOM   996  C CZ  . PHE B 1 55 ? 15.476  6.143   25.709 1.00 34.41  ? 55   PHE B CZ  1 
ATOM   997  N N   . HIS B 1 56 ? 16.736  10.450  22.459 1.00 31.92  ? 56   HIS B N   1 
ATOM   998  C CA  . HIS B 1 56 ? 15.857  11.452  23.017 1.00 26.79  ? 56   HIS B CA  1 
ATOM   999  C C   . HIS B 1 56 ? 14.500  11.357  22.364 1.00 22.66  ? 56   HIS B C   1 
ATOM   1000 O O   . HIS B 1 56 ? 14.328  11.788  21.237 1.00 49.40  ? 56   HIS B O   1 
ATOM   1001 C CB  . HIS B 1 56 ? 16.452  12.853  22.888 1.00 47.51  ? 56   HIS B CB  1 
ATOM   1002 C CG  . HIS B 1 56 ? 15.795  13.875  23.769 1.00 68.42  ? 56   HIS B CG  1 
ATOM   1003 N ND1 . HIS B 1 56 ? 14.912  13.534  24.766 1.00 65.39  ? 56   HIS B ND1 1 
ATOM   1004 C CD2 . HIS B 1 56 ? 15.905  15.222  23.813 1.00 65.18  ? 56   HIS B CD2 1 
ATOM   1005 C CE1 . HIS B 1 56 ? 14.478  14.626  25.363 1.00 78.96  ? 56   HIS B CE1 1 
ATOM   1006 N NE2 . HIS B 1 56 ? 15.082  15.665  24.816 1.00 73.92  ? 56   HIS B NE2 1 
ATOM   1007 N N   . ARG B 1 57 ? 13.549  10.786  23.117 1.00 39.99  ? 57   ARG B N   1 
ATOM   1008 C CA  . ARG B 1 57 ? 12.135  10.602  22.784 1.00 43.04  ? 57   ARG B CA  1 
ATOM   1009 C C   . ARG B 1 57 ? 11.078  11.565  23.428 1.00 43.90  ? 57   ARG B C   1 
ATOM   1010 O O   . ARG B 1 57 ? 11.215  11.945  24.556 1.00 44.96  ? 57   ARG B O   1 
ATOM   1011 C CB  . ARG B 1 57 ? 11.792  9.219   23.163 1.00 28.06  ? 57   ARG B CB  1 
ATOM   1012 C CG  . ARG B 1 57 ? 10.306  8.961   23.188 1.00 49.37  ? 57   ARG B CG  1 
ATOM   1013 C CD  . ARG B 1 57 ? 9.995   8.005   22.119 1.00 59.48  ? 57   ARG B CD  1 
ATOM   1014 N NE  . ARG B 1 57 ? 9.331   8.653   21.015 1.00 63.58  ? 57   ARG B NE  1 
ATOM   1015 C CZ  . ARG B 1 57 ? 9.310   8.145   19.799 1.00 84.11  ? 57   ARG B CZ  1 
ATOM   1016 N NH1 . ARG B 1 57 ? 9.938   6.983   19.570 1.00 31.33  ? 57   ARG B NH1 1 
ATOM   1017 N NH2 . ARG B 1 57 ? 8.682   8.814   18.831 1.00 81.43  ? 57   ARG B NH2 1 
ATOM   1018 N N   . LYS B 1 58 ? 10.052  11.964  22.664 1.00 64.41  ? 58   LYS B N   1 
ATOM   1019 C CA  . LYS B 1 58 ? 8.964   12.880  23.105 1.00 36.87  ? 58   LYS B CA  1 
ATOM   1020 C C   . LYS B 1 58 ? 7.630   12.302  22.690 1.00 36.91  ? 58   LYS B C   1 
ATOM   1021 O O   . LYS B 1 58 ? 7.413   11.928  21.541 1.00 44.98  ? 58   LYS B O   1 
ATOM   1022 C CB  . LYS B 1 58 ? 9.122   14.295  22.536 1.00 36.18  ? 58   LYS B CB  1 
ATOM   1023 C CG  . LYS B 1 58 ? 10.491  14.985  22.880 1.00 42.30  ? 58   LYS B CG  1 
ATOM   1024 C CD  . LYS B 1 58 ? 10.551  16.363  22.316 1.00 27.82  ? 58   LYS B CD  1 
ATOM   1025 C CE  . LYS B 1 58 ? 11.952  17.013  22.407 1.00 51.51  ? 58   LYS B CE  1 
ATOM   1026 N NZ  . LYS B 1 58 ? 12.855  16.457  23.443 1.00 88.70  ? 58   LYS B NZ  1 
ATOM   1027 N N   . TYR B 1 59 ? 6.759   12.119  23.679 1.00 43.52  ? 59   TYR B N   1 
ATOM   1028 C CA  . TYR B 1 59 ? 5.347   11.845  23.416 1.00 56.01  ? 59   TYR B CA  1 
ATOM   1029 C C   . TYR B 1 59 ? 4.390   13.005  23.789 1.00 67.30  ? 59   TYR B C   1 
ATOM   1030 O O   . TYR B 1 59 ? 4.591   13.748  24.764 1.00 65.58  ? 59   TYR B O   1 
ATOM   1031 C CB  . TYR B 1 59 ? 4.883   10.656  24.167 1.00 43.40  ? 59   TYR B CB  1 
ATOM   1032 C CG  . TYR B 1 59 ? 5.763   9.461   24.122 1.00 62.66  ? 59   TYR B CG  1 
ATOM   1033 C CD1 . TYR B 1 59 ? 5.555   8.481   23.189 1.00 51.19  ? 59   TYR B CD1 1 
ATOM   1034 C CD2 . TYR B 1 59 ? 6.761   9.258   25.081 1.00 67.62  ? 59   TYR B CD2 1 
ATOM   1035 C CE1 . TYR B 1 59 ? 6.327   7.328   23.169 1.00 45.61  ? 59   TYR B CE1 1 
ATOM   1036 C CE2 . TYR B 1 59 ? 7.557   8.110   25.057 1.00 54.14  ? 59   TYR B CE2 1 
ATOM   1037 C CZ  . TYR B 1 59 ? 7.329   7.157   24.096 1.00 65.92  ? 59   TYR B CZ  1 
ATOM   1038 O OH  . TYR B 1 59 ? 8.105   6.030   24.090 1.00 44.03  ? 59   TYR B OH  1 
ATOM   1039 N N   . ARG B 1 60 ? 3.339   13.146  22.997 1.00 66.08  ? 60   ARG B N   1 
ATOM   1040 C CA  . ARG B 1 60 ? 2.330   14.142  23.267 1.00 89.92  ? 60   ARG B CA  1 
ATOM   1041 C C   . ARG B 1 60 ? 1.408   13.372  24.193 1.00 88.83  ? 60   ARG B C   1 
ATOM   1042 O O   . ARG B 1 60 ? 1.161   12.181  23.913 1.00 46.64  ? 60   ARG B O   1 
ATOM   1043 C CB  . ARG B 1 60 ? 1.572   14.583  21.982 1.00 78.42  ? 60   ARG B CB  1 
ATOM   1044 C CG  . ARG B 1 60 ? 2.390   15.379  20.871 1.00 81.47  ? 60   ARG B CG  1 
ATOM   1045 C CD  . ARG B 1 60 ? 3.112   14.465  19.727 1.00 118.97 ? 60   ARG B CD  1 
ATOM   1046 N NE  . ARG B 1 60 ? 2.342   13.327  19.162 1.00 143.00 ? 60   ARG B NE  1 
ATOM   1047 C CZ  . ARG B 1 60 ? 2.714   12.565  18.117 1.00 124.42 ? 60   ARG B CZ  1 
ATOM   1048 N NH1 . ARG B 1 60 ? 3.851   12.805  17.469 1.00 111.27 ? 60   ARG B NH1 1 
ATOM   1049 N NH2 . ARG B 1 60 ? 1.934   11.560  17.694 1.00 66.34  ? 60   ARG B NH2 1 
ATOM   1050 N N   . ILE B 1 61 ? 0.926   14.027  25.277 1.00 71.83  ? 61   ILE B N   1 
ATOM   1051 C CA  . ILE B 1 61 ? -0.123  13.488  26.176 1.00 88.48  ? 61   ILE B CA  1 
ATOM   1052 C C   . ILE B 1 61 ? -1.594  13.640  25.638 1.00 113.48 ? 61   ILE B C   1 
ATOM   1053 O O   . ILE B 1 61 ? -2.072  14.738  25.296 1.00 54.47  ? 61   ILE B O   1 
ATOM   1054 C CB  . ILE B 1 61 ? 0.000   14.114  27.599 1.00 96.63  ? 61   ILE B CB  1 
ATOM   1055 C CG1 . ILE B 1 61 ? 0.559   15.522  27.458 1.00 85.77  ? 61   ILE B CG1 1 
ATOM   1056 C CG2 . ILE B 1 61 ? 0.831   13.243  28.548 1.00 90.06  ? 61   ILE B CG2 1 
ATOM   1057 C CD1 . ILE B 1 61 ? -0.270  16.410  26.465 1.00 97.44  ? 61   ILE B CD1 1 
ATOM   1058 N N   . PRO B 1 62 ? -2.321  12.523  25.579 1.00 57.99  ? 62   PRO B N   1 
ATOM   1059 C CA  . PRO B 1 62 ? -3.643  12.394  24.968 1.00 69.26  ? 62   PRO B CA  1 
ATOM   1060 C C   . PRO B 1 62 ? -4.710  13.370  25.494 1.00 119.00 ? 62   PRO B C   1 
ATOM   1061 O O   . PRO B 1 62 ? -5.892  12.988  25.538 1.00 119.55 ? 62   PRO B O   1 
ATOM   1062 C CB  . PRO B 1 62 ? -4.032  10.934  25.267 1.00 49.53  ? 62   PRO B CB  1 
ATOM   1063 C CG  . PRO B 1 62 ? -2.760  10.260  25.499 1.00 83.71  ? 62   PRO B CG  1 
ATOM   1064 C CD  . PRO B 1 62 ? -1.857  11.266  26.169 1.00 45.73  ? 62   PRO B CD  1 
ATOM   1065 N N   . ALA B 1 63 ? -4.301  14.584  25.884 1.00 74.86  ? 63   ALA B N   1 
ATOM   1066 C CA  . ALA B 1 63 ? -5.229  15.719  26.062 1.00 109.07 ? 63   ALA B CA  1 
ATOM   1067 C C   . ALA B 1 63 ? -6.214  15.550  27.229 1.00 127.32 ? 63   ALA B C   1 
ATOM   1068 O O   . ALA B 1 63 ? -6.247  16.398  28.146 1.00 93.90  ? 63   ALA B O   1 
ATOM   1069 C CB  . ALA B 1 63 ? -5.968  16.033  24.743 1.00 72.84  ? 63   ALA B CB  1 
ATOM   1070 N N   . ASP B 1 64 ? -7.004  14.468  27.182 1.00 88.55  ? 64   ASP B N   1 
ATOM   1071 C CA  . ASP B 1 64 ? -7.685  13.945  28.369 1.00 111.50 ? 64   ASP B CA  1 
ATOM   1072 C C   . ASP B 1 64 ? -6.634  13.526  29.404 1.00 114.81 ? 64   ASP B C   1 
ATOM   1073 O O   . ASP B 1 64 ? -6.778  12.502  30.070 1.00 89.16  ? 64   ASP B O   1 
ATOM   1074 C CB  . ASP B 1 64 ? -8.627  12.775  28.009 1.00 85.37  ? 64   ASP B CB  1 
ATOM   1075 C CG  . ASP B 1 64 ? -7.889  11.471  27.718 1.00 101.37 ? 64   ASP B CG  1 
ATOM   1076 O OD1 . ASP B 1 64 ? -7.896  11.046  26.551 1.00 73.24  ? 64   ASP B OD1 1 
ATOM   1077 O OD2 . ASP B 1 64 ? -7.322  10.851  28.650 1.00 87.84  ? 64   ASP B OD2 1 
ATOM   1078 N N   . VAL B 1 65 ? -5.600  14.363  29.522 1.00 130.04 ? 65   VAL B N   1 
ATOM   1079 C CA  . VAL B 1 65 ? -4.347  14.084  30.227 1.00 96.49  ? 65   VAL B CA  1 
ATOM   1080 C C   . VAL B 1 65 ? -3.436  15.351  30.123 1.00 123.39 ? 65   VAL B C   1 
ATOM   1081 O O   . VAL B 1 65 ? -3.337  15.945  29.030 1.00 99.11  ? 65   VAL B O   1 
ATOM   1082 C CB  . VAL B 1 65 ? -3.632  12.774  29.662 1.00 102.60 ? 65   VAL B CB  1 
ATOM   1083 C CG1 . VAL B 1 65 ? -2.134  12.802  29.856 1.00 116.55 ? 65   VAL B CG1 1 
ATOM   1084 C CG2 . VAL B 1 65 ? -4.152  11.519  30.304 1.00 59.39  ? 65   VAL B CG2 1 
ATOM   1085 N N   . ASP B 1 66 ? -2.821  15.818  31.226 1.00 88.35  ? 66   ASP B N   1 
ATOM   1086 C CA  . ASP B 1 66 ? -3.067  15.375  32.600 1.00 75.50  ? 66   ASP B CA  1 
ATOM   1087 C C   . ASP B 1 66 ? -2.002  15.844  33.567 1.00 95.23  ? 66   ASP B C   1 
ATOM   1088 O O   . ASP B 1 66 ? -0.812  15.481  33.402 1.00 64.00  ? 66   ASP B O   1 
ATOM   1089 C CB  . ASP B 1 66 ? -3.124  13.857  32.701 1.00 113.29 ? 66   ASP B CB  1 
ATOM   1090 C CG  . ASP B 1 66 ? -4.303  13.398  33.494 1.00 109.31 ? 66   ASP B CG  1 
ATOM   1091 O OD1 . ASP B 1 66 ? -4.813  14.265  34.242 1.00 85.61  ? 66   ASP B OD1 1 
ATOM   1092 O OD2 . ASP B 1 66 ? -4.730  12.223  33.357 1.00 85.67  ? 66   ASP B OD2 1 
ATOM   1093 N N   . PRO B 1 67 ? -2.433  16.609  34.597 1.00 86.48  ? 67   PRO B N   1 
ATOM   1094 C CA  . PRO B 1 67 ? -1.661  17.057  35.772 1.00 118.78 ? 67   PRO B CA  1 
ATOM   1095 C C   . PRO B 1 67 ? -0.682  16.001  36.293 1.00 112.54 ? 67   PRO B C   1 
ATOM   1096 O O   . PRO B 1 67 ? -0.270  15.130  35.512 1.00 97.50  ? 67   PRO B O   1 
ATOM   1097 C CB  . PRO B 1 67 ? -2.748  17.382  36.808 1.00 70.34  ? 67   PRO B CB  1 
ATOM   1098 C CG  . PRO B 1 67 ? -3.830  17.941  35.954 1.00 101.25 ? 67   PRO B CG  1 
ATOM   1099 C CD  . PRO B 1 67 ? -3.787  17.169  34.615 1.00 57.63  ? 67   PRO B CD  1 
ATOM   1100 N N   . LEU B 1 68 ? -0.279  16.100  37.560 1.00 72.66  ? 68   LEU B N   1 
ATOM   1101 C CA  . LEU B 1 68 ? 0.635   15.107  38.127 1.00 57.90  ? 68   LEU B CA  1 
ATOM   1102 C C   . LEU B 1 68 ? 0.365   13.763  37.415 1.00 86.66  ? 68   LEU B C   1 
ATOM   1103 O O   . LEU B 1 68 ? 1.191   13.238  36.683 1.00 97.87  ? 68   LEU B O   1 
ATOM   1104 C CB  . LEU B 1 68 ? 0.379   14.974  39.627 1.00 122.59 ? 68   LEU B CB  1 
ATOM   1105 C CG  . LEU B 1 68 ? 1.254   14.167  40.591 1.00 136.41 ? 68   LEU B CG  1 
ATOM   1106 C CD1 . LEU B 1 68 ? 0.728   14.434  42.021 1.00 89.96  ? 68   LEU B CD1 1 
ATOM   1107 C CD2 . LEU B 1 68 ? 1.350   12.641  40.255 1.00 87.32  ? 68   LEU B CD2 1 
ATOM   1108 N N   . THR B 1 69 ? -0.818  13.239  37.639 1.00 55.16  ? 69   THR B N   1 
ATOM   1109 C CA  . THR B 1 69 ? -1.307  12.045  37.013 1.00 80.08  ? 69   THR B CA  1 
ATOM   1110 C C   . THR B 1 69 ? -0.301  11.086  36.366 1.00 102.01 ? 69   THR B C   1 
ATOM   1111 O O   . THR B 1 69 ? -0.317  9.885   36.651 1.00 72.24  ? 69   THR B O   1 
ATOM   1112 C CB  . THR B 1 69 ? -2.299  12.472  36.020 1.00 83.09  ? 69   THR B CB  1 
ATOM   1113 O OG1 . THR B 1 69 ? -1.609  13.197  34.989 1.00 93.13  ? 69   THR B OG1 1 
ATOM   1114 C CG2 . THR B 1 69 ? -3.236  13.406  36.743 1.00 74.28  ? 69   THR B CG2 1 
ATOM   1115 N N   . ILE B 1 70 ? 0.544   11.574  35.467 1.00 65.32  ? 70   ILE B N   1 
ATOM   1116 C CA  . ILE B 1 70 ? 1.439   10.666  34.793 1.00 58.53  ? 70   ILE B CA  1 
ATOM   1117 C C   . ILE B 1 70 ? 2.501   10.200  35.794 1.00 82.98  ? 70   ILE B C   1 
ATOM   1118 O O   . ILE B 1 70 ? 3.007   11.036  36.541 1.00 34.95  ? 70   ILE B O   1 
ATOM   1119 C CB  . ILE B 1 70 ? 2.080   11.322  33.562 1.00 73.09  ? 70   ILE B CB  1 
ATOM   1120 C CG1 . ILE B 1 70 ? 1.022   11.707  32.525 1.00 64.01  ? 70   ILE B CG1 1 
ATOM   1121 C CG2 . ILE B 1 70 ? 3.098   10.391  32.973 1.00 53.53  ? 70   ILE B CG2 1 
ATOM   1122 C CD1 . ILE B 1 70 ? 0.748   10.644  31.463 1.00 61.88  ? 70   ILE B CD1 1 
ATOM   1123 N N   . THR B 1 71 ? 2.779   8.880   35.832 1.00 51.53  ? 71   THR B N   1 
ATOM   1124 C CA  . THR B 1 71 ? 3.920   8.271   36.551 1.00 29.65  ? 71   THR B CA  1 
ATOM   1125 C C   . THR B 1 71 ? 4.678   7.142   35.785 1.00 66.73  ? 71   THR B C   1 
ATOM   1126 O O   . THR B 1 71 ? 4.224   6.539   34.835 1.00 40.87  ? 71   THR B O   1 
ATOM   1127 C CB  . THR B 1 71 ? 3.514   7.670   37.952 1.00 97.12  ? 71   THR B CB  1 
ATOM   1128 O OG1 . THR B 1 71 ? 2.377   6.824   37.792 1.00 78.36  ? 71   THR B OG1 1 
ATOM   1129 C CG2 . THR B 1 71 ? 3.207   8.736   39.045 1.00 66.69  ? 71   THR B CG2 1 
ATOM   1130 N N   . SER B 1 72 ? 5.848   6.793   36.239 1.00 40.64  ? 72   SER B N   1 
ATOM   1131 C CA  . SER B 1 72 ? 6.575   5.844   35.472 1.00 55.22  ? 72   SER B CA  1 
ATOM   1132 C C   . SER B 1 72 ? 7.051   4.670   36.272 1.00 53.58  ? 72   SER B C   1 
ATOM   1133 O O   . SER B 1 72 ? 6.960   4.680   37.465 1.00 48.46  ? 72   SER B O   1 
ATOM   1134 C CB  . SER B 1 72 ? 7.773   6.548   34.885 1.00 57.83  ? 72   SER B CB  1 
ATOM   1135 O OG  . SER B 1 72 ? 8.618   7.027   35.915 1.00 52.96  ? 72   SER B OG  1 
ATOM   1136 N N   . SER B 1 73 ? 7.618   3.671   35.604 1.00 47.51  ? 73   SER B N   1 
ATOM   1137 C CA  . SER B 1 73 ? 8.081   2.545   36.323 1.00 36.08  ? 73   SER B CA  1 
ATOM   1138 C C   . SER B 1 73 ? 9.059   1.726   35.549 1.00 45.86  ? 73   SER B C   1 
ATOM   1139 O O   . SER B 1 73 ? 8.748   1.288   34.458 1.00 69.25  ? 73   SER B O   1 
ATOM   1140 C CB  . SER B 1 73 ? 6.900   1.686   36.697 1.00 39.60  ? 73   SER B CB  1 
ATOM   1141 O OG  . SER B 1 73 ? 7.338   0.352   36.950 1.00 98.33  ? 73   SER B OG  1 
ATOM   1142 N N   . LEU B 1 74 ? 10.222  1.486   36.154 1.00 30.38  ? 74   LEU B N   1 
ATOM   1143 C CA  . LEU B 1 74 ? 11.272  0.651   35.616 1.00 38.21  ? 74   LEU B CA  1 
ATOM   1144 C C   . LEU B 1 74 ? 11.431  -0.765  36.174 1.00 38.27  ? 74   LEU B C   1 
ATOM   1145 O O   . LEU B 1 74 ? 11.869  -0.994  37.288 1.00 48.01  ? 74   LEU B O   1 
ATOM   1146 C CB  . LEU B 1 74 ? 12.616  1.386   35.676 1.00 30.30  ? 74   LEU B CB  1 
ATOM   1147 C CG  . LEU B 1 74 ? 13.832  0.738   34.922 1.00 68.12  ? 74   LEU B CG  1 
ATOM   1148 C CD1 . LEU B 1 74 ? 13.678  0.549   33.345 1.00 41.78  ? 74   LEU B CD1 1 
ATOM   1149 C CD2 . LEU B 1 74 ? 15.164  1.469   35.254 1.00 48.86  ? 74   LEU B CD2 1 
ATOM   1150 N N   . SER B 1 75 ? 11.109  -1.702  35.338 1.00 23.89  ? 75   SER B N   1 
ATOM   1151 C CA  . SER B 1 75 ? 11.277  -3.078  35.605 1.00 47.22  ? 75   SER B CA  1 
ATOM   1152 C C   . SER B 1 75 ? 12.752  -3.480  35.573 1.00 26.88  ? 75   SER B C   1 
ATOM   1153 O O   . SER B 1 75 ? 13.559  -2.784  35.064 1.00 66.75  ? 75   SER B O   1 
ATOM   1154 C CB  . SER B 1 75 ? 10.507  -3.840  34.545 1.00 19.80  ? 75   SER B CB  1 
ATOM   1155 O OG  . SER B 1 75 ? 11.409  -4.217  33.510 1.00 47.15  ? 75   SER B OG  1 
ATOM   1156 N N   . SER B 1 76 ? 13.083  -4.639  36.086 1.00 42.15  ? 76   SER B N   1 
ATOM   1157 C CA  . SER B 1 76 ? 14.446  -5.123  36.027 1.00 64.62  ? 76   SER B CA  1 
ATOM   1158 C C   . SER B 1 76 ? 14.709  -6.004  34.798 1.00 49.13  ? 76   SER B C   1 
ATOM   1159 O O   . SER B 1 76 ? 15.764  -6.615  34.654 1.00 47.04  ? 76   SER B O   1 
ATOM   1160 C CB  . SER B 1 76 ? 14.686  -6.018  37.209 1.00 39.12  ? 76   SER B CB  1 
ATOM   1161 O OG  . SER B 1 76 ? 13.891  -7.159  36.964 1.00 41.47  ? 76   SER B OG  1 
ATOM   1162 N N   . ASP B 1 77 ? 13.733  -6.172  33.931 1.00 45.41  ? 77   ASP B N   1 
ATOM   1163 C CA  . ASP B 1 77 ? 14.113  -6.743  32.649 1.00 54.64  ? 77   ASP B CA  1 
ATOM   1164 C C   . ASP B 1 77 ? 14.217  -5.637  31.571 1.00 51.65  ? 77   ASP B C   1 
ATOM   1165 O O   . ASP B 1 77 ? 14.072  -5.876  30.408 1.00 76.73  ? 77   ASP B O   1 
ATOM   1166 C CB  . ASP B 1 77 ? 13.266  -7.950  32.252 1.00 48.20  ? 77   ASP B CB  1 
ATOM   1167 C CG  . ASP B 1 77 ? 11.779  -7.737  32.470 1.00 104.83 ? 77   ASP B CG  1 
ATOM   1168 O OD1 . ASP B 1 77 ? 11.267  -6.601  32.292 1.00 84.31  ? 77   ASP B OD1 1 
ATOM   1169 O OD2 . ASP B 1 77 ? 11.110  -8.735  32.812 1.00 92.07  ? 77   ASP B OD2 1 
ATOM   1170 N N   . GLY B 1 78 ? 14.442  -4.408  32.010 1.00 64.68  ? 78   GLY B N   1 
ATOM   1171 C CA  . GLY B 1 78 ? 14.716  -3.317  31.135 1.00 41.10  ? 78   GLY B CA  1 
ATOM   1172 C C   . GLY B 1 78 ? 13.520  -2.670  30.497 1.00 59.43  ? 78   GLY B C   1 
ATOM   1173 O O   . GLY B 1 78 ? 13.731  -1.893  29.590 1.00 59.06  ? 78   GLY B O   1 
ATOM   1174 N N   . VAL B 1 79 ? 12.290  -2.937  30.928 1.00 39.92  ? 79   VAL B N   1 
ATOM   1175 C CA  . VAL B 1 79 ? 11.202  -2.102  30.417 1.00 46.48  ? 79   VAL B CA  1 
ATOM   1176 C C   . VAL B 1 79 ? 10.910  -0.777  31.231 1.00 37.11  ? 79   VAL B C   1 
ATOM   1177 O O   . VAL B 1 79 ? 10.733  -0.744  32.418 1.00 49.64  ? 79   VAL B O   1 
ATOM   1178 C CB  . VAL B 1 79 ? 9.965   -2.946  30.149 1.00 44.75  ? 79   VAL B CB  1 
ATOM   1179 C CG1 . VAL B 1 79 ? 8.841   -2.124  29.499 1.00 20.30  ? 79   VAL B CG1 1 
ATOM   1180 C CG2 . VAL B 1 79 ? 10.340  -4.078  29.299 1.00 26.84  ? 79   VAL B CG2 1 
ATOM   1181 N N   . LEU B 1 80 ? 10.879  0.327   30.553 1.00 41.10  ? 80   LEU B N   1 
ATOM   1182 C CA  . LEU B 1 80 ? 10.434  1.576   31.145 1.00 45.06  ? 80   LEU B CA  1 
ATOM   1183 C C   . LEU B 1 80 ? 8.982   1.763   30.810 1.00 46.99  ? 80   LEU B C   1 
ATOM   1184 O O   . LEU B 1 80 ? 8.560   1.445   29.729 1.00 62.55  ? 80   LEU B O   1 
ATOM   1185 C CB  . LEU B 1 80 ? 11.187  2.750   30.516 1.00 49.93  ? 80   LEU B CB  1 
ATOM   1186 C CG  . LEU B 1 80 ? 10.927  4.104   31.159 1.00 65.12  ? 80   LEU B CG  1 
ATOM   1187 C CD1 . LEU B 1 80 ? 10.981  3.916   32.679 1.00 34.95  ? 80   LEU B CD1 1 
ATOM   1188 C CD2 . LEU B 1 80 ? 11.915  5.167   30.682 1.00 38.91  ? 80   LEU B CD2 1 
ATOM   1189 N N   . THR B 1 81 ? 8.212   2.253   31.750 1.00 54.82  ? 81   THR B N   1 
ATOM   1190 C CA  . THR B 1 81 ? 6.805   2.480   31.519 1.00 54.36  ? 81   THR B CA  1 
ATOM   1191 C C   . THR B 1 81 ? 6.426   3.878   31.971 1.00 60.67  ? 81   THR B C   1 
ATOM   1192 O O   . THR B 1 81 ? 6.942   4.368   32.972 1.00 66.36  ? 81   THR B O   1 
ATOM   1193 C CB  . THR B 1 81 ? 5.988   1.507   32.313 1.00 59.40  ? 81   THR B CB  1 
ATOM   1194 O OG1 . THR B 1 81 ? 6.091   0.205   31.702 1.00 57.48  ? 81   THR B OG1 1 
ATOM   1195 C CG2 . THR B 1 81 ? 4.572   1.987   32.344 1.00 59.60  ? 81   THR B CG2 1 
ATOM   1196 N N   . VAL B 1 82 ? 5.558   4.533   31.213 1.00 55.07  ? 82   VAL B N   1 
ATOM   1197 C CA  . VAL B 1 82 ? 5.010   5.823   31.605 1.00 47.59  ? 82   VAL B CA  1 
ATOM   1198 C C   . VAL B 1 82 ? 3.479   5.742   31.476 1.00 49.58  ? 82   VAL B C   1 
ATOM   1199 O O   . VAL B 1 82 ? 3.013   5.216   30.530 1.00 68.19  ? 82   VAL B O   1 
ATOM   1200 C CB  . VAL B 1 82 ? 5.589   6.935   30.771 1.00 49.04  ? 82   VAL B CB  1 
ATOM   1201 C CG1 . VAL B 1 82 ? 5.050   8.249   31.219 1.00 64.12  ? 82   VAL B CG1 1 
ATOM   1202 C CG2 . VAL B 1 82 ? 7.157   6.978   30.861 1.00 40.72  ? 82   VAL B CG2 1 
ATOM   1203 N N   . ASN B 1 83 ? 2.729   6.133   32.504 1.00 65.70  ? 83   ASN B N   1 
ATOM   1204 C CA  . ASN B 1 83 ? 1.247   6.054   32.519 1.00 69.09  ? 83   ASN B CA  1 
ATOM   1205 C C   . ASN B 1 83 ? 0.519   7.117   33.355 1.00 63.99  ? 83   ASN B C   1 
ATOM   1206 O O   . ASN B 1 83 ? 1.164   8.046   33.853 1.00 65.30  ? 83   ASN B O   1 
ATOM   1207 C CB  . ASN B 1 83 ? 0.696   4.656   32.848 1.00 60.38  ? 83   ASN B CB  1 
ATOM   1208 C CG  . ASN B 1 83 ? 1.549   3.887   33.785 1.00 69.90  ? 83   ASN B CG  1 
ATOM   1209 O OD1 . ASN B 1 83 ? 2.144   4.446   34.703 1.00 86.27  ? 83   ASN B OD1 1 
ATOM   1210 N ND2 . ASN B 1 83 ? 1.606   2.569   33.584 1.00 83.91  ? 83   ASN B ND2 1 
ATOM   1211 N N   . MET C 1 3  ? 6.815   -2.928  54.055 1.00 79.58  ? 3    MET C N   1 
ATOM   1212 C CA  . MET C 1 3  ? 5.555   -2.343  53.586 1.00 119.09 ? 3    MET C CA  1 
ATOM   1213 C C   . MET C 1 3  ? 4.587   -3.457  53.095 1.00 111.85 ? 3    MET C C   1 
ATOM   1214 O O   . MET C 1 3  ? 4.769   -4.633  53.484 1.00 102.63 ? 3    MET C O   1 
ATOM   1215 C CB  . MET C 1 3  ? 5.886   -1.255  52.550 1.00 87.55  ? 3    MET C CB  1 
ATOM   1216 C CG  . MET C 1 3  ? 7.216   -0.500  52.961 1.00 83.74  ? 3    MET C CG  1 
ATOM   1217 N N   . GLU C 1 4  ? 3.570   -3.098  52.294 1.00 72.11  ? 4    GLU C N   1 
ATOM   1218 C CA  . GLU C 1 4  ? 2.602   -4.074  51.718 1.00 70.24  ? 4    GLU C CA  1 
ATOM   1219 C C   . GLU C 1 4  ? 3.153   -5.402  51.125 1.00 89.25  ? 4    GLU C C   1 
ATOM   1220 O O   . GLU C 1 4  ? 4.265   -5.506  50.560 1.00 49.03  ? 4    GLU C O   1 
ATOM   1221 C CB  . GLU C 1 4  ? 1.700   -3.409  50.674 1.00 58.03  ? 4    GLU C CB  1 
ATOM   1222 N N   . MET C 1 5  ? 2.338   -6.431  51.233 1.00 50.83  ? 5    MET C N   1 
ATOM   1223 C CA  . MET C 1 5  ? 2.751   -7.683  50.657 1.00 80.10  ? 5    MET C CA  1 
ATOM   1224 C C   . MET C 1 5  ? 1.559   -8.520  50.182 1.00 76.59  ? 5    MET C C   1 
ATOM   1225 O O   . MET C 1 5  ? 0.554   -8.624  50.871 1.00 78.03  ? 5    MET C O   1 
ATOM   1226 C CB  . MET C 1 5  ? 3.560   -8.454  51.672 1.00 57.12  ? 5    MET C CB  1 
ATOM   1227 C CG  . MET C 1 5  ? 2.740   -9.492  52.346 1.00 53.45  ? 5    MET C CG  1 
ATOM   1228 S SD  . MET C 1 5  ? 3.925   -10.453 53.245 1.00 88.06  ? 5    MET C SD  1 
ATOM   1229 C CE  . MET C 1 5  ? 4.601   -11.472 51.935 1.00 41.15  ? 5    MET C CE  1 
ATOM   1230 N N   . ARG C 1 6  ? 1.668   -9.099  48.994 1.00 57.58  ? 6    ARG C N   1 
ATOM   1231 C CA  . ARG C 1 6  ? 0.632   -9.962  48.518 1.00 37.81  ? 6    ARG C CA  1 
ATOM   1232 C C   . ARG C 1 6  ? 1.230   -11.350 48.540 1.00 54.51  ? 6    ARG C C   1 
ATOM   1233 O O   . ARG C 1 6  ? 2.385   -11.552 48.236 1.00 34.40  ? 6    ARG C O   1 
ATOM   1234 C CB  . ARG C 1 6  ? 0.138   -9.544  47.106 1.00 25.32  ? 6    ARG C CB  1 
ATOM   1235 N N   . LEU C 1 7  ? 0.443   -12.325 48.936 1.00 46.47  ? 7    LEU C N   1 
ATOM   1236 C CA  . LEU C 1 7  ? 0.852   -13.703 48.767 1.00 50.11  ? 7    LEU C CA  1 
ATOM   1237 C C   . LEU C 1 7  ? -0.388  -14.463 48.356 1.00 44.20  ? 7    LEU C C   1 
ATOM   1238 O O   . LEU C 1 7  ? -1.306  -14.567 49.112 1.00 52.38  ? 7    LEU C O   1 
ATOM   1239 C CB  . LEU C 1 7  ? 1.376   -14.185 50.079 1.00 27.26  ? 7    LEU C CB  1 
ATOM   1240 C CG  . LEU C 1 7  ? 2.163   -15.438 50.319 1.00 45.58  ? 7    LEU C CG  1 
ATOM   1241 C CD1 . LEU C 1 7  ? 3.567   -15.275 49.890 1.00 55.84  ? 7    LEU C CD1 1 
ATOM   1242 C CD2 . LEU C 1 7  ? 2.112   -15.624 51.860 1.00 33.13  ? 7    LEU C CD2 1 
ATOM   1243 N N   . GLU C 1 8  ? -0.437  -14.922 47.115 1.00 36.81  ? 8    GLU C N   1 
ATOM   1244 C CA  . GLU C 1 8  ? -1.600  -15.614 46.579 1.00 32.36  ? 8    GLU C CA  1 
ATOM   1245 C C   . GLU C 1 8  ? -1.137  -16.995 46.217 1.00 42.78  ? 8    GLU C C   1 
ATOM   1246 O O   . GLU C 1 8  ? 0.056   -17.270 46.373 1.00 38.90  ? 8    GLU C O   1 
ATOM   1247 C CB  . GLU C 1 8  ? -2.082  -14.913 45.335 1.00 65.03  ? 8    GLU C CB  1 
ATOM   1248 C CG  . GLU C 1 8  ? -1.401  -13.597 45.100 1.00 55.49  ? 8    GLU C CG  1 
ATOM   1249 C CD  . GLU C 1 8  ? -2.307  -12.474 45.446 1.00 79.70  ? 8    GLU C CD  1 
ATOM   1250 O OE1 . GLU C 1 8  ? -3.247  -12.311 44.655 1.00 77.90  ? 8    GLU C OE1 1 
ATOM   1251 O OE2 . GLU C 1 8  ? -2.109  -11.773 46.483 1.00 100.62 ? 8    GLU C OE2 1 
ATOM   1252 N N   . LYS C 1 9  ? -2.020  -17.875 45.729 1.00 28.32  ? 9    LYS C N   1 
ATOM   1253 C CA  . LYS C 1 9  ? -1.513  -19.191 45.308 1.00 35.75  ? 9    LYS C CA  1 
ATOM   1254 C C   . LYS C 1 9  ? -0.429  -19.119 44.243 1.00 55.55  ? 9    LYS C C   1 
ATOM   1255 O O   . LYS C 1 9  ? 0.504   -19.875 44.317 1.00 38.28  ? 9    LYS C O   1 
ATOM   1256 C CB  . LYS C 1 9  ? -2.590  -20.126 44.816 1.00 24.03  ? 9    LYS C CB  1 
ATOM   1257 C CG  . LYS C 1 9  ? -3.970  -19.504 44.664 1.00 82.39  ? 9    LYS C CG  1 
ATOM   1258 C CD  . LYS C 1 9  ? -5.065  -20.603 44.495 1.00 86.46  ? 9    LYS C CD  1 
ATOM   1259 C CE  . LYS C 1 9  ? -4.718  -21.669 43.430 1.00 59.41  ? 9    LYS C CE  1 
ATOM   1260 N NZ  . LYS C 1 9  ? -3.387  -22.321 43.585 1.00 52.79  ? 9    LYS C NZ  1 
ATOM   1261 N N   . ASP C 1 10 ? -0.552  -18.178 43.294 1.00 38.04  ? 10   ASP C N   1 
ATOM   1262 C CA  . ASP C 1 10 ? 0.305   -18.063 42.109 1.00 52.93  ? 10   ASP C CA  1 
ATOM   1263 C C   . ASP C 1 10 ? 1.459   -17.029 42.090 1.00 67.75  ? 10   ASP C C   1 
ATOM   1264 O O   . ASP C 1 10 ? 2.363   -17.129 41.281 1.00 65.82  ? 10   ASP C O   1 
ATOM   1265 C CB  . ASP C 1 10 ? -0.587  -17.752 40.937 1.00 46.13  ? 10   ASP C CB  1 
ATOM   1266 C CG  . ASP C 1 10 ? -1.679  -18.787 40.758 1.00 92.00  ? 10   ASP C CG  1 
ATOM   1267 O OD1 . ASP C 1 10 ? -1.413  -19.986 40.979 1.00 54.41  ? 10   ASP C OD1 1 
ATOM   1268 O OD2 . ASP C 1 10 ? -2.819  -18.401 40.411 1.00 82.98  ? 10   ASP C OD2 1 
ATOM   1269 N N   . ARG C 1 11 ? 1.434   -16.038 42.959 1.00 47.16  ? 11   ARG C N   1 
ATOM   1270 C CA  . ARG C 1 11 ? 2.404   -14.983 42.890 1.00 50.12  ? 11   ARG C CA  1 
ATOM   1271 C C   . ARG C 1 11 ? 2.580   -14.521 44.326 1.00 49.74  ? 11   ARG C C   1 
ATOM   1272 O O   . ARG C 1 11 ? 1.715   -14.729 45.159 1.00 43.13  ? 11   ARG C O   1 
ATOM   1273 C CB  . ARG C 1 11 ? 1.902   -13.826 41.979 1.00 36.26  ? 11   ARG C CB  1 
ATOM   1274 C CG  . ARG C 1 11 ? 0.921   -14.235 40.904 1.00 69.41  ? 11   ARG C CG  1 
ATOM   1275 N N   . PHE C 1 12 ? 3.736   -13.959 44.627 1.00 44.18  ? 12   PHE C N   1 
ATOM   1276 C CA  . PHE C 1 12 ? 3.951   -13.179 45.849 1.00 66.47  ? 12   PHE C CA  1 
ATOM   1277 C C   . PHE C 1 12 ? 4.454   -11.785 45.488 1.00 57.96  ? 12   PHE C C   1 
ATOM   1278 O O   . PHE C 1 12 ? 4.826   -11.507 44.365 1.00 64.33  ? 12   PHE C O   1 
ATOM   1279 C CB  . PHE C 1 12 ? 4.918   -13.866 46.821 1.00 52.82  ? 12   PHE C CB  1 
ATOM   1280 C CG  . PHE C 1 12 ? 6.329   -13.801 46.409 1.00 37.18  ? 12   PHE C CG  1 
ATOM   1281 C CD1 . PHE C 1 12 ? 7.104   -12.696 46.740 1.00 77.77  ? 12   PHE C CD1 1 
ATOM   1282 C CD2 . PHE C 1 12 ? 6.907   -14.833 45.704 1.00 62.90  ? 12   PHE C CD2 1 
ATOM   1283 C CE1 . PHE C 1 12 ? 8.435   -12.605 46.361 1.00 47.40  ? 12   PHE C CE1 1 
ATOM   1284 C CE2 . PHE C 1 12 ? 8.234   -14.765 45.326 1.00 69.01  ? 12   PHE C CE2 1 
ATOM   1285 C CZ  . PHE C 1 12 ? 9.000   -13.642 45.663 1.00 74.78  ? 12   PHE C CZ  1 
ATOM   1286 N N   . SER C 1 13 ? 4.463   -10.900 46.454 1.00 55.37  ? 13   SER C N   1 
ATOM   1287 C CA  . SER C 1 13 ? 4.688   -9.518  46.177 1.00 60.97  ? 13   SER C CA  1 
ATOM   1288 C C   . SER C 1 13 ? 5.055   -8.818  47.455 1.00 56.60  ? 13   SER C C   1 
ATOM   1289 O O   . SER C 1 13 ? 4.362   -8.937  48.457 1.00 70.46  ? 13   SER C O   1 
ATOM   1290 C CB  . SER C 1 13 ? 3.409   -8.892  45.645 1.00 63.58  ? 13   SER C CB  1 
ATOM   1291 O OG  . SER C 1 13 ? 3.645   -7.561  45.220 1.00 101.99 ? 13   SER C OG  1 
ATOM   1292 N N   . VAL C 1 14 ? 6.151   -8.077  47.392 1.00 64.76  ? 14   VAL C N   1 
ATOM   1293 C CA  . VAL C 1 14 ? 6.653   -7.310  48.504 1.00 67.83  ? 14   VAL C CA  1 
ATOM   1294 C C   . VAL C 1 14 ? 7.028   -5.903  48.047 1.00 59.45  ? 14   VAL C C   1 
ATOM   1295 O O   . VAL C 1 14 ? 7.819   -5.726  47.122 1.00 56.31  ? 14   VAL C O   1 
ATOM   1296 C CB  . VAL C 1 14 ? 7.839   -8.036  49.157 1.00 56.58  ? 14   VAL C CB  1 
ATOM   1297 C CG1 . VAL C 1 14 ? 8.502   -7.139  50.198 1.00 72.71  ? 14   VAL C CG1 1 
ATOM   1298 C CG2 . VAL C 1 14 ? 7.343   -9.351  49.812 1.00 61.23  ? 14   VAL C CG2 1 
ATOM   1299 N N   . ASN C 1 15 ? 6.432   -4.914  48.699 1.00 39.86  ? 15   ASN C N   1 
ATOM   1300 C CA  . ASN C 1 15 ? 6.634   -3.520  48.395 1.00 59.57  ? 15   ASN C CA  1 
ATOM   1301 C C   . ASN C 1 15 ? 7.360   -2.737  49.469 1.00 59.85  ? 15   ASN C C   1 
ATOM   1302 O O   . ASN C 1 15 ? 7.127   -2.938  50.638 1.00 56.93  ? 15   ASN C O   1 
ATOM   1303 C CB  . ASN C 1 15 ? 5.298   -2.874  48.146 1.00 56.81  ? 15   ASN C CB  1 
ATOM   1304 C CG  . ASN C 1 15 ? 4.698   -3.299  46.859 1.00 76.01  ? 15   ASN C CG  1 
ATOM   1305 O OD1 . ASN C 1 15 ? 4.069   -2.498  46.176 1.00 74.27  ? 15   ASN C OD1 1 
ATOM   1306 N ND2 . ASN C 1 15 ? 4.897   -4.561  46.494 1.00 76.63  ? 15   ASN C ND2 1 
ATOM   1307 N N   . LEU C 1 16 ? 8.240   -1.841  49.053 1.00 50.20  ? 16   LEU C N   1 
ATOM   1308 C CA  . LEU C 1 16 ? 9.003   -1.026  49.996 1.00 42.64  ? 16   LEU C CA  1 
ATOM   1309 C C   . LEU C 1 16 ? 8.962   0.395   49.621 1.00 54.26  ? 16   LEU C C   1 
ATOM   1310 O O   . LEU C 1 16 ? 8.974   0.721   48.449 1.00 54.54  ? 16   LEU C O   1 
ATOM   1311 C CB  . LEU C 1 16 ? 10.480  -1.366  50.020 1.00 50.85  ? 16   LEU C CB  1 
ATOM   1312 C CG  . LEU C 1 16 ? 10.904  -2.688  50.613 1.00 71.68  ? 16   LEU C CG  1 
ATOM   1313 C CD1 . LEU C 1 16 ? 10.468  -3.844  49.672 1.00 50.75  ? 16   LEU C CD1 1 
ATOM   1314 C CD2 . LEU C 1 16 ? 12.377  -2.584  50.773 1.00 43.17  ? 16   LEU C CD2 1 
ATOM   1315 N N   . ASP C 1 17 ? 8.953   1.238   50.641 1.00 57.16  ? 17   ASP C N   1 
ATOM   1316 C CA  . ASP C 1 17 ? 9.054   2.653   50.447 1.00 57.84  ? 17   ASP C CA  1 
ATOM   1317 C C   . ASP C 1 17 ? 10.525  3.079   50.499 1.00 53.55  ? 17   ASP C C   1 
ATOM   1318 O O   . ASP C 1 17 ? 11.114  3.115   51.536 1.00 55.82  ? 17   ASP C O   1 
ATOM   1319 C CB  . ASP C 1 17 ? 8.258   3.379   51.502 1.00 52.07  ? 17   ASP C CB  1 
ATOM   1320 C CG  . ASP C 1 17 ? 8.408   4.856   51.373 1.00 98.55  ? 17   ASP C CG  1 
ATOM   1321 O OD1 . ASP C 1 17 ? 8.296   5.345   50.192 1.00 70.27  ? 17   ASP C OD1 1 
ATOM   1322 O OD2 . ASP C 1 17 ? 8.680   5.493   52.435 1.00 76.09  ? 17   ASP C OD2 1 
ATOM   1323 N N   . VAL C 1 18 ? 11.100  3.394   49.356 1.00 28.31  ? 18   VAL C N   1 
ATOM   1324 C CA  . VAL C 1 18 ? 12.481  3.664   49.230 1.00 45.97  ? 18   VAL C CA  1 
ATOM   1325 C C   . VAL C 1 18 ? 12.612  5.004   48.628 1.00 48.38  ? 18   VAL C C   1 
ATOM   1326 O O   . VAL C 1 18 ? 13.575  5.270   47.928 1.00 58.52  ? 18   VAL C O   1 
ATOM   1327 C CB  . VAL C 1 18 ? 13.129  2.641   48.390 1.00 37.57  ? 18   VAL C CB  1 
ATOM   1328 C CG1 . VAL C 1 18 ? 13.156  1.349   49.185 1.00 26.47  ? 18   VAL C CG1 1 
ATOM   1329 C CG2 . VAL C 1 18 ? 12.362  2.476   47.053 1.00 33.71  ? 18   VAL C CG2 1 
ATOM   1330 N N   . LYS C 1 19 ? 11.637  5.854   48.928 1.00 35.61  ? 19   LYS C N   1 
ATOM   1331 C CA  . LYS C 1 19 ? 11.536  7.175   48.306 1.00 38.98  ? 19   LYS C CA  1 
ATOM   1332 C C   . LYS C 1 19 ? 12.736  8.142   48.550 1.00 48.92  ? 19   LYS C C   1 
ATOM   1333 O O   . LYS C 1 19 ? 12.858  9.129   47.851 1.00 47.19  ? 19   LYS C O   1 
ATOM   1334 C CB  . LYS C 1 19 ? 10.220  7.817   48.753 1.00 37.39  ? 19   LYS C CB  1 
ATOM   1335 C CG  . LYS C 1 19 ? 10.192  8.214   50.218 1.00 44.13  ? 19   LYS C CG  1 
ATOM   1336 C CD  . LYS C 1 19 ? 8.843   8.727   50.631 1.00 55.88  ? 19   LYS C CD  1 
ATOM   1337 C CE  . LYS C 1 19 ? 8.784   9.116   52.120 1.00 55.18  ? 19   LYS C CE  1 
ATOM   1338 N NZ  . LYS C 1 19 ? 9.598   8.204   53.044 1.00 76.69  ? 19   LYS C NZ  1 
ATOM   1339 N N   . HIS C 1 20 ? 13.584  7.859   49.543 1.00 42.06  ? 20   HIS C N   1 
ATOM   1340 C CA  . HIS C 1 20 ? 14.718  8.694   49.882 1.00 37.54  ? 20   HIS C CA  1 
ATOM   1341 C C   . HIS C 1 20 ? 15.908  8.273   49.151 1.00 49.26  ? 20   HIS C C   1 
ATOM   1342 O O   . HIS C 1 20 ? 16.950  8.889   49.322 1.00 36.13  ? 20   HIS C O   1 
ATOM   1343 C CB  . HIS C 1 20 ? 15.055  8.530   51.355 1.00 46.85  ? 20   HIS C CB  1 
ATOM   1344 C CG  . HIS C 1 20 ? 14.057  9.161   52.256 1.00 58.77  ? 20   HIS C CG  1 
ATOM   1345 N ND1 . HIS C 1 20 ? 13.422  8.458   53.255 1.00 53.30  ? 20   HIS C ND1 1 
ATOM   1346 C CD2 . HIS C 1 20 ? 13.526  10.411  52.264 1.00 27.86  ? 20   HIS C CD2 1 
ATOM   1347 C CE1 . HIS C 1 20 ? 12.552  9.253   53.855 1.00 49.36  ? 20   HIS C CE1 1 
ATOM   1348 N NE2 . HIS C 1 20 ? 12.613  10.447  53.289 1.00 49.00  ? 20   HIS C NE2 1 
ATOM   1349 N N   . PHE C 1 21 ? 15.771  7.172   48.408 1.00 26.48  ? 21   PHE C N   1 
ATOM   1350 C CA  . PHE C 1 21 ? 16.885  6.606   47.646 1.00 49.26  ? 21   PHE C CA  1 
ATOM   1351 C C   . PHE C 1 21 ? 16.684  6.754   46.161 1.00 36.45  ? 21   PHE C C   1 
ATOM   1352 O O   . PHE C 1 21 ? 15.594  6.557   45.667 1.00 77.88  ? 21   PHE C O   1 
ATOM   1353 C CB  . PHE C 1 21 ? 17.114  5.141   48.025 1.00 44.34  ? 21   PHE C CB  1 
ATOM   1354 C CG  . PHE C 1 21 ? 17.351  4.941   49.500 1.00 38.08  ? 21   PHE C CG  1 
ATOM   1355 C CD1 . PHE C 1 21 ? 18.612  4.984   50.024 1.00 22.88  ? 21   PHE C CD1 1 
ATOM   1356 C CD2 . PHE C 1 21 ? 16.292  4.779   50.385 1.00 65.78  ? 21   PHE C CD2 1 
ATOM   1357 C CE1 . PHE C 1 21 ? 18.856  4.822   51.405 1.00 38.21  ? 21   PHE C CE1 1 
ATOM   1358 C CE2 . PHE C 1 21 ? 16.527  4.619   51.797 1.00 40.72  ? 21   PHE C CE2 1 
ATOM   1359 C CZ  . PHE C 1 21 ? 17.826  4.649   52.300 1.00 13.66  ? 21   PHE C CZ  1 
ATOM   1360 N N   . SER C 1 22 ? 17.709  7.156   45.448 1.00 38.17  ? 22   SER C N   1 
ATOM   1361 C CA  . SER C 1 22 ? 17.632  7.185   43.992 1.00 66.89  ? 22   SER C CA  1 
ATOM   1362 C C   . SER C 1 22 ? 18.095  5.797   43.503 1.00 66.00  ? 22   SER C C   1 
ATOM   1363 O O   . SER C 1 22 ? 18.781  5.093   44.229 1.00 62.94  ? 22   SER C O   1 
ATOM   1364 C CB  . SER C 1 22 ? 18.511  8.306   43.439 1.00 26.43  ? 22   SER C CB  1 
ATOM   1365 O OG  . SER C 1 22 ? 19.836  7.923   43.701 1.00 75.89  ? 22   SER C OG  1 
ATOM   1366 N N   . PRO C 1 23 ? 17.728  5.410   42.271 1.00 48.56  ? 23   PRO C N   1 
ATOM   1367 C CA  . PRO C 1 23 ? 17.879  4.052   41.767 1.00 51.57  ? 23   PRO C CA  1 
ATOM   1368 C C   . PRO C 1 23 ? 19.301  3.478   41.725 1.00 53.26  ? 23   PRO C C   1 
ATOM   1369 O O   . PRO C 1 23 ? 19.454  2.252   41.845 1.00 51.54  ? 23   PRO C O   1 
ATOM   1370 C CB  . PRO C 1 23 ? 17.288  4.163   40.369 1.00 67.67  ? 23   PRO C CB  1 
ATOM   1371 C CG  . PRO C 1 23 ? 16.273  5.284   40.503 1.00 45.61  ? 23   PRO C CG  1 
ATOM   1372 C CD  . PRO C 1 23 ? 17.047  6.270   41.292 1.00 59.98  ? 23   PRO C CD  1 
ATOM   1373 N N   . GLU C 1 24 ? 20.315  4.319   41.526 1.00 70.71  ? 24   GLU C N   1 
ATOM   1374 C CA  . GLU C 1 24 ? 21.721  3.895   41.690 1.00 59.35  ? 24   GLU C CA  1 
ATOM   1375 C C   . GLU C 1 24 ? 22.054  3.498   43.150 1.00 64.89  ? 24   GLU C C   1 
ATOM   1376 O O   . GLU C 1 24 ? 23.032  2.788   43.412 1.00 70.56  ? 24   GLU C O   1 
ATOM   1377 C CB  . GLU C 1 24 ? 22.680  5.009   41.244 1.00 34.51  ? 24   GLU C CB  1 
ATOM   1378 C CG  . GLU C 1 24 ? 22.265  6.403   41.626 1.00 38.16  ? 24   GLU C CG  1 
ATOM   1379 C CD  . GLU C 1 24 ? 21.096  6.908   40.813 1.00 81.14  ? 24   GLU C CD  1 
ATOM   1380 O OE1 . GLU C 1 24 ? 20.937  6.416   39.687 1.00 85.21  ? 24   GLU C OE1 1 
ATOM   1381 O OE2 . GLU C 1 24 ? 20.348  7.805   41.271 1.00 101.80 ? 24   GLU C OE2 1 
ATOM   1382 N N   . GLU C 1 25 ? 21.236  3.984   44.094 1.00 72.50  ? 25   GLU C N   1 
ATOM   1383 C CA  . GLU C 1 25 ? 21.452  3.793   45.536 1.00 47.74  ? 25   GLU C CA  1 
ATOM   1384 C C   . GLU C 1 25 ? 20.813  2.542   46.134 1.00 53.19  ? 25   GLU C C   1 
ATOM   1385 O O   . GLU C 1 25 ? 20.961  2.292   47.321 1.00 69.37  ? 25   GLU C O   1 
ATOM   1386 C CB  . GLU C 1 25 ? 21.017  5.021   46.332 1.00 44.48  ? 25   GLU C CB  1 
ATOM   1387 C CG  . GLU C 1 25 ? 21.964  6.218   46.157 1.00 28.81  ? 25   GLU C CG  1 
ATOM   1388 C CD  . GLU C 1 25 ? 21.337  7.575   46.456 1.00 74.95  ? 25   GLU C CD  1 
ATOM   1389 O OE1 . GLU C 1 25 ? 20.083  7.704   46.613 1.00 49.67  ? 25   GLU C OE1 1 
ATOM   1390 O OE2 . GLU C 1 25 ? 22.145  8.531   46.557 1.00 55.56  ? 25   GLU C OE2 1 
ATOM   1391 N N   . LEU C 1 26 ? 20.125  1.758   45.308 1.00 63.57  ? 26   LEU C N   1 
ATOM   1392 C CA  . LEU C 1 26 ? 19.460  0.500   45.700 1.00 41.22  ? 26   LEU C CA  1 
ATOM   1393 C C   . LEU C 1 26 ? 20.113  -0.686  44.968 1.00 32.00  ? 26   LEU C C   1 
ATOM   1394 O O   . LEU C 1 26 ? 20.610  -0.538  43.854 1.00 60.68  ? 26   LEU C O   1 
ATOM   1395 C CB  . LEU C 1 26 ? 17.938  0.589   45.416 1.00 26.06  ? 26   LEU C CB  1 
ATOM   1396 C CG  . LEU C 1 26 ? 17.273  1.780   46.098 1.00 60.10  ? 26   LEU C CG  1 
ATOM   1397 C CD1 . LEU C 1 26 ? 15.965  2.314   45.524 1.00 46.03  ? 26   LEU C CD1 1 
ATOM   1398 C CD2 . LEU C 1 26 ? 17.123  1.364   47.549 1.00 36.79  ? 26   LEU C CD2 1 
ATOM   1399 N N   . LYS C 1 27 ? 20.182  -1.833  45.625 1.00 32.48  ? 27   LYS C N   1 
ATOM   1400 C CA  . LYS C 1 27 ? 20.577  -3.080  44.988 1.00 56.99  ? 27   LYS C CA  1 
ATOM   1401 C C   . LYS C 1 27 ? 19.754  -4.240  45.554 1.00 56.63  ? 27   LYS C C   1 
ATOM   1402 O O   . LYS C 1 27 ? 19.643  -4.409  46.756 1.00 49.13  ? 27   LYS C O   1 
ATOM   1403 C CB  . LYS C 1 27 ? 22.061  -3.359  45.124 1.00 25.60  ? 27   LYS C CB  1 
ATOM   1404 C CG  . LYS C 1 27 ? 22.558  -3.068  46.488 1.00 55.17  ? 27   LYS C CG  1 
ATOM   1405 N N   . VAL C 1 28 ? 19.137  -4.998  44.657 1.00 51.86  ? 28   VAL C N   1 
ATOM   1406 C CA  . VAL C 1 28 ? 18.467  -6.270  44.957 1.00 52.13  ? 28   VAL C CA  1 
ATOM   1407 C C   . VAL C 1 28 ? 19.303  -7.469  44.498 1.00 43.30  ? 28   VAL C C   1 
ATOM   1408 O O   . VAL C 1 28 ? 19.795  -7.507  43.362 1.00 80.21  ? 28   VAL C O   1 
ATOM   1409 C CB  . VAL C 1 28 ? 17.077  -6.301  44.291 1.00 35.56  ? 28   VAL C CB  1 
ATOM   1410 C CG1 . VAL C 1 28 ? 16.273  -7.545  44.649 1.00 55.76  ? 28   VAL C CG1 1 
ATOM   1411 C CG2 . VAL C 1 28 ? 16.304  -5.097  44.750 1.00 44.84  ? 28   VAL C CG2 1 
ATOM   1412 N N   . LYS C 1 29 ? 19.529  -8.418  45.396 1.00 54.83  ? 29   LYS C N   1 
ATOM   1413 C CA  . LYS C 1 29 ? 20.242  -9.640  45.024 1.00 54.44  ? 29   LYS C CA  1 
ATOM   1414 C C   . LYS C 1 29 ? 19.415  -10.803 45.492 1.00 62.60  ? 29   LYS C C   1 
ATOM   1415 O O   . LYS C 1 29 ? 18.955  -10.787 46.623 1.00 53.00  ? 29   LYS C O   1 
ATOM   1416 C CB  . LYS C 1 29 ? 21.594  -9.715  45.751 1.00 58.88  ? 29   LYS C CB  1 
ATOM   1417 C CG  . LYS C 1 29 ? 22.671  -8.866  45.148 1.00 70.25  ? 29   LYS C CG  1 
ATOM   1418 N N   . VAL C 1 30 ? 19.209  -11.808 44.656 1.00 40.90  ? 30   VAL C N   1 
ATOM   1419 C CA  . VAL C 1 30 ? 18.791  -13.086 45.223 1.00 75.52  ? 30   VAL C CA  1 
ATOM   1420 C C   . VAL C 1 30 ? 20.015  -13.925 45.538 1.00 79.43  ? 30   VAL C C   1 
ATOM   1421 O O   . VAL C 1 30 ? 20.709  -14.340 44.641 1.00 80.92  ? 30   VAL C O   1 
ATOM   1422 C CB  . VAL C 1 30 ? 17.892  -13.900 44.307 1.00 64.39  ? 30   VAL C CB  1 
ATOM   1423 C CG1 . VAL C 1 30 ? 17.568  -15.232 44.991 1.00 60.35  ? 30   VAL C CG1 1 
ATOM   1424 C CG2 . VAL C 1 30 ? 16.647  -13.109 43.989 1.00 50.04  ? 30   VAL C CG2 1 
ATOM   1425 N N   . LEU C 1 31 ? 20.294  -14.143 46.816 1.00 94.19  ? 31   LEU C N   1 
ATOM   1426 C CA  . LEU C 1 31 ? 21.408  -14.978 47.250 1.00 67.86  ? 31   LEU C CA  1 
ATOM   1427 C C   . LEU C 1 31 ? 20.779  -16.225 47.848 1.00 84.87  ? 31   LEU C C   1 
ATOM   1428 O O   . LEU C 1 31 ? 20.508  -16.266 49.039 1.00 81.57  ? 31   LEU C O   1 
ATOM   1429 C CB  . LEU C 1 31 ? 22.299  -14.243 48.303 1.00 56.85  ? 31   LEU C CB  1 
ATOM   1430 N N   . GLY C 1 32 ? 20.516  -17.238 47.024 1.00 104.52 ? 32   GLY C N   1 
ATOM   1431 C CA  . GLY C 1 32 ? 19.968  -18.498 47.528 1.00 75.66  ? 32   GLY C CA  1 
ATOM   1432 C C   . GLY C 1 32 ? 18.468  -18.414 47.780 1.00 102.34 ? 32   GLY C C   1 
ATOM   1433 O O   . GLY C 1 32 ? 17.720  -18.116 46.831 1.00 107.45 ? 32   GLY C O   1 
ATOM   1434 N N   . ASP C 1 33 ? 18.045  -18.646 49.042 1.00 77.63  ? 33   ASP C N   1 
ATOM   1435 C CA  . ASP C 1 33 ? 16.630  -18.571 49.498 1.00 94.49  ? 33   ASP C CA  1 
ATOM   1436 C C   . ASP C 1 33 ? 16.384  -17.263 50.266 1.00 97.34  ? 33   ASP C C   1 
ATOM   1437 O O   . ASP C 1 33 ? 15.579  -17.188 51.213 1.00 77.62  ? 33   ASP C O   1 
ATOM   1438 C CB  . ASP C 1 33 ? 16.251  -19.800 50.368 1.00 119.35 ? 33   ASP C CB  1 
ATOM   1439 C CG  . ASP C 1 33 ? 14.811  -19.728 50.953 1.00 145.66 ? 33   ASP C CG  1 
ATOM   1440 O OD1 . ASP C 1 33 ? 14.682  -19.442 52.173 1.00 131.14 ? 33   ASP C OD1 1 
ATOM   1441 O OD2 . ASP C 1 33 ? 13.818  -19.972 50.212 1.00 114.46 ? 33   ASP C OD2 1 
ATOM   1442 N N   . VAL C 1 34 ? 17.092  -16.226 49.846 1.00 74.59  ? 34   VAL C N   1 
ATOM   1443 C CA  . VAL C 1 34 ? 16.936  -14.928 50.469 1.00 67.31  ? 34   VAL C CA  1 
ATOM   1444 C C   . VAL C 1 34 ? 16.988  -13.790 49.459 1.00 66.38  ? 34   VAL C C   1 
ATOM   1445 O O   . VAL C 1 34 ? 17.898  -13.678 48.655 1.00 69.43  ? 34   VAL C O   1 
ATOM   1446 C CB  . VAL C 1 34 ? 18.047  -14.682 51.511 1.00 60.98  ? 34   VAL C CB  1 
ATOM   1447 C CG1 . VAL C 1 34 ? 17.778  -13.457 52.272 1.00 50.29  ? 34   VAL C CG1 1 
ATOM   1448 C CG2 . VAL C 1 34 ? 18.112  -15.777 52.415 1.00 44.98  ? 34   VAL C CG2 1 
ATOM   1449 N N   . ILE C 1 35 ? 15.997  -12.931 49.516 1.00 61.05  ? 35   ILE C N   1 
ATOM   1450 C CA  . ILE C 1 35 ? 16.100  -11.636 48.877 1.00 51.87  ? 35   ILE C CA  1 
ATOM   1451 C C   . ILE C 1 35 ? 16.756  -10.570 49.776 1.00 49.18  ? 35   ILE C C   1 
ATOM   1452 O O   . ILE C 1 35 ? 16.254  -10.222 50.837 1.00 61.96  ? 35   ILE C O   1 
ATOM   1453 C CB  . ILE C 1 35 ? 14.717  -11.163 48.543 1.00 72.08  ? 35   ILE C CB  1 
ATOM   1454 C CG1 . ILE C 1 35 ? 14.054  -12.177 47.569 1.00 63.62  ? 35   ILE C CG1 1 
ATOM   1455 C CG2 . ILE C 1 35 ? 14.760  -9.674  48.114 1.00 50.70  ? 35   ILE C CG2 1 
ATOM   1456 C CD1 . ILE C 1 35 ? 12.503  -12.209 47.683 1.00 41.13  ? 35   ILE C CD1 1 
ATOM   1457 N N   . GLU C 1 36 ? 17.887  -10.050 49.356 1.00 59.66  ? 36   GLU C N   1 
ATOM   1458 C CA  . GLU C 1 36 ? 18.515  -8.901  50.027 1.00 41.05  ? 36   GLU C CA  1 
ATOM   1459 C C   . GLU C 1 36 ? 18.252  -7.608  49.269 1.00 63.98  ? 36   GLU C C   1 
ATOM   1460 O O   . GLU C 1 36 ? 18.515  -7.489  48.045 1.00 63.40  ? 36   GLU C O   1 
ATOM   1461 C CB  . GLU C 1 36 ? 20.024  -9.063  50.060 1.00 42.40  ? 36   GLU C CB  1 
ATOM   1462 C CG  . GLU C 1 36 ? 20.495  -10.414 50.503 1.00 56.58  ? 36   GLU C CG  1 
ATOM   1463 C CD  . GLU C 1 36 ? 21.969  -10.459 50.624 1.00 78.16  ? 36   GLU C CD  1 
ATOM   1464 O OE1 . GLU C 1 36 ? 22.599  -9.412  50.405 1.00 88.80  ? 36   GLU C OE1 1 
ATOM   1465 O OE2 . GLU C 1 36 ? 22.507  -11.541 50.927 1.00 147.94 ? 36   GLU C OE2 1 
ATOM   1466 N N   . VAL C 1 37 ? 17.728  -6.643  49.997 1.00 37.67  ? 37   VAL C N   1 
ATOM   1467 C CA  . VAL C 1 37 ? 17.668  -5.288  49.509 1.00 50.33  ? 37   VAL C CA  1 
ATOM   1468 C C   . VAL C 1 37 ? 18.646  -4.405  50.280 1.00 62.49  ? 37   VAL C C   1 
ATOM   1469 O O   . VAL C 1 37 ? 18.579  -4.292  51.504 1.00 51.25  ? 37   VAL C O   1 
ATOM   1470 C CB  . VAL C 1 37 ? 16.291  -4.648  49.648 1.00 49.02  ? 37   VAL C CB  1 
ATOM   1471 C CG1 . VAL C 1 37 ? 16.343  -3.207  49.079 1.00 30.93  ? 37   VAL C CG1 1 
ATOM   1472 C CG2 . VAL C 1 37 ? 15.166  -5.548  48.999 1.00 31.21  ? 37   VAL C CG2 1 
ATOM   1473 N N   . HIS C 1 38 ? 19.554  -3.765  49.556 1.00 60.17  ? 38   HIS C N   1 
ATOM   1474 C CA  . HIS C 1 38 ? 20.470  -2.844  50.185 1.00 47.17  ? 38   HIS C CA  1 
ATOM   1475 C C   . HIS C 1 38 ? 20.260  -1.396  49.710 1.00 48.75  ? 38   HIS C C   1 
ATOM   1476 O O   . HIS C 1 38 ? 20.098  -1.157  48.550 1.00 57.43  ? 38   HIS C O   1 
ATOM   1477 C CB  . HIS C 1 38 ? 21.902  -3.310  49.999 1.00 33.97  ? 38   HIS C CB  1 
ATOM   1478 C CG  . HIS C 1 38 ? 22.869  -2.381  50.626 1.00 45.88  ? 38   HIS C CG  1 
ATOM   1479 N ND1 . HIS C 1 38 ? 22.945  -2.211  51.991 1.00 85.77  ? 38   HIS C ND1 1 
ATOM   1480 C CD2 . HIS C 1 38 ? 23.701  -1.470  50.088 1.00 65.93  ? 38   HIS C CD2 1 
ATOM   1481 C CE1 . HIS C 1 38 ? 23.827  -1.274  52.265 1.00 52.73  ? 38   HIS C CE1 1 
ATOM   1482 N NE2 . HIS C 1 38 ? 24.299  -0.814  51.128 1.00 48.23  ? 38   HIS C NE2 1 
ATOM   1483 N N   . GLY C 1 39 ? 20.211  -0.443  50.631 1.00 47.10  ? 39   GLY C N   1 
ATOM   1484 C CA  . GLY C 1 39 ? 20.003  0.947   50.275 1.00 44.35  ? 39   GLY C CA  1 
ATOM   1485 C C   . GLY C 1 39 ? 20.995  1.791   51.047 1.00 55.52  ? 39   GLY C C   1 
ATOM   1486 O O   . GLY C 1 39 ? 21.275  1.476   52.181 1.00 53.75  ? 39   GLY C O   1 
ATOM   1487 N N   . LYS C 1 40 ? 21.573  2.813   50.423 1.00 45.08  ? 40   LYS C N   1 
ATOM   1488 C CA  . LYS C 1 40 ? 22.693  3.595   51.012 1.00 69.89  ? 40   LYS C CA  1 
ATOM   1489 C C   . LYS C 1 40 ? 22.831  4.879   50.266 1.00 38.47  ? 40   LYS C C   1 
ATOM   1490 O O   . LYS C 1 40 ? 22.846  4.882   49.055 1.00 54.70  ? 40   LYS C O   1 
ATOM   1491 C CB  . LYS C 1 40 ? 24.058  2.884   50.974 1.00 37.90  ? 40   LYS C CB  1 
ATOM   1492 C CG  . LYS C 1 40 ? 25.220  3.651   51.594 1.00 46.94  ? 40   LYS C CG  1 
ATOM   1493 C CD  . LYS C 1 40 ? 26.475  2.756   51.542 1.00 45.75  ? 40   LYS C CD  1 
ATOM   1494 C CE  . LYS C 1 40 ? 27.632  3.415   52.222 1.00 57.07  ? 40   LYS C CE  1 
ATOM   1495 N NZ  . LYS C 1 40 ? 27.376  3.613   53.703 1.00 42.26  ? 40   LYS C NZ  1 
ATOM   1496 N N   . HIS C 1 41 ? 22.921  5.963   51.020 1.00 51.86  ? 41   HIS C N   1 
ATOM   1497 C CA  . HIS C 1 41 ? 23.089  7.274   50.457 1.00 58.26  ? 41   HIS C CA  1 
ATOM   1498 C C   . HIS C 1 41 ? 23.972  8.119   51.351 1.00 54.74  ? 41   HIS C C   1 
ATOM   1499 O O   . HIS C 1 41 ? 23.836  8.122   52.574 1.00 59.00  ? 41   HIS C O   1 
ATOM   1500 C CB  . HIS C 1 41 ? 21.741  7.902   50.045 1.00 32.69  ? 41   HIS C CB  1 
ATOM   1501 C CG  . HIS C 1 41 ? 21.116  8.827   51.026 1.00 28.07  ? 41   HIS C CG  1 
ATOM   1502 N ND1 . HIS C 1 41 ? 19.800  8.687   51.417 1.00 54.73  ? 41   HIS C ND1 1 
ATOM   1503 C CD2 . HIS C 1 41 ? 21.573  9.938   51.631 1.00 27.67  ? 41   HIS C CD2 1 
ATOM   1504 C CE1 . HIS C 1 41 ? 19.469  9.685   52.211 1.00 34.47  ? 41   HIS C CE1 1 
ATOM   1505 N NE2 . HIS C 1 41 ? 20.531  10.450  52.372 1.00 46.90  ? 41   HIS C NE2 1 
ATOM   1506 N N   . GLU C 1 42 ? 24.937  8.761   50.702 1.00 60.35  ? 42   GLU C N   1 
ATOM   1507 C CA  . GLU C 1 42 ? 25.902  9.630   51.345 1.00 58.02  ? 42   GLU C CA  1 
ATOM   1508 C C   . GLU C 1 42 ? 25.221  10.942  51.844 1.00 51.89  ? 42   GLU C C   1 
ATOM   1509 O O   . GLU C 1 42 ? 24.020  11.200  51.577 1.00 52.94  ? 42   GLU C O   1 
ATOM   1510 C CB  . GLU C 1 42 ? 27.061  9.844   50.378 1.00 29.81  ? 42   GLU C CB  1 
ATOM   1511 C CG  . GLU C 1 42 ? 27.800  8.547   49.911 1.00 46.55  ? 42   GLU C CG  1 
ATOM   1512 C CD  . GLU C 1 42 ? 28.660  7.823   50.984 1.00 77.90  ? 42   GLU C CD  1 
ATOM   1513 O OE1 . GLU C 1 42 ? 28.662  6.547   51.055 1.00 52.24  ? 42   GLU C OE1 1 
ATOM   1514 O OE2 . GLU C 1 42 ? 29.347  8.529   51.749 1.00 63.80  ? 42   GLU C OE2 1 
ATOM   1515 N N   . GLU C 1 43 ? 25.930  11.737  52.636 1.00 39.11  ? 43   GLU C N   1 
ATOM   1516 C CA  . GLU C 1 43 ? 25.328  12.950  53.241 1.00 65.47  ? 43   GLU C CA  1 
ATOM   1517 C C   . GLU C 1 43 ? 24.812  13.934  52.176 1.00 49.93  ? 43   GLU C C   1 
ATOM   1518 O O   . GLU C 1 43 ? 25.430  14.107  51.156 1.00 44.79  ? 43   GLU C O   1 
ATOM   1519 C CB  . GLU C 1 43 ? 26.323  13.638  54.192 1.00 34.52  ? 43   GLU C CB  1 
ATOM   1520 C CG  . GLU C 1 43 ? 25.728  14.720  55.064 1.00 81.61  ? 43   GLU C CG  1 
ATOM   1521 N N   . ARG C 1 44 ? 23.698  14.591  52.411 1.00 40.00  ? 44   ARG C N   1 
ATOM   1522 C CA  . ARG C 1 44 ? 23.084  15.355  51.351 1.00 33.17  ? 44   ARG C CA  1 
ATOM   1523 C C   . ARG C 1 44 ? 22.061  16.244  52.037 1.00 35.39  ? 44   ARG C C   1 
ATOM   1524 O O   . ARG C 1 44 ? 21.449  15.897  53.015 1.00 45.39  ? 44   ARG C O   1 
ATOM   1525 C CB  . ARG C 1 44 ? 22.434  14.389  50.331 1.00 34.58  ? 44   ARG C CB  1 
ATOM   1526 C CG  . ARG C 1 44 ? 21.072  14.856  49.838 1.00 66.82  ? 44   ARG C CG  1 
ATOM   1527 C CD  . ARG C 1 44 ? 20.008  13.738  49.834 1.00 74.12  ? 44   ARG C CD  1 
ATOM   1528 N NE  . ARG C 1 44 ? 20.415  12.592  49.028 1.00 53.13  ? 44   ARG C NE  1 
ATOM   1529 C CZ  . ARG C 1 44 ? 19.624  11.567  48.747 1.00 82.97  ? 44   ARG C CZ  1 
ATOM   1530 N NH1 . ARG C 1 44 ? 18.354  11.553  49.188 1.00 43.14  ? 44   ARG C NH1 1 
ATOM   1531 N NH2 . ARG C 1 44 ? 20.116  10.574  47.998 1.00 27.96  ? 44   ARG C NH2 1 
ATOM   1532 N N   . GLN C 1 45 ? 21.907  17.440  51.566 1.00 34.52  ? 45   GLN C N   1 
ATOM   1533 C CA  . GLN C 1 45 ? 20.988  18.291  52.250 1.00 43.17  ? 45   GLN C CA  1 
ATOM   1534 C C   . GLN C 1 45 ? 19.626  17.880  51.829 1.00 46.15  ? 45   GLN C C   1 
ATOM   1535 O O   . GLN C 1 45 ? 19.490  17.386  50.733 1.00 51.97  ? 45   GLN C O   1 
ATOM   1536 C CB  . GLN C 1 45 ? 21.206  19.763  51.912 1.00 34.19  ? 45   GLN C CB  1 
ATOM   1537 C CG  . GLN C 1 45 ? 22.168  20.059  50.765 1.00 71.38  ? 45   GLN C CG  1 
ATOM   1538 C CD  . GLN C 1 45 ? 23.038  21.270  51.095 1.00 108.34 ? 45   GLN C CD  1 
ATOM   1539 O OE1 . GLN C 1 45 ? 22.771  21.950  52.119 1.00 48.05  ? 45   GLN C OE1 1 
ATOM   1540 N NE2 . GLN C 1 45 ? 24.092  21.545  50.259 1.00 33.35  ? 45   GLN C NE2 1 
ATOM   1541 N N   . ASP C 1 46 ? 18.660  18.046  52.744 1.00 48.53  ? 46   ASP C N   1 
ATOM   1542 C CA  . ASP C 1 46 ? 17.205  18.202  52.519 1.00 61.72  ? 46   ASP C CA  1 
ATOM   1543 C C   . ASP C 1 46 ? 16.645  19.483  53.235 1.00 59.45  ? 46   ASP C C   1 
ATOM   1544 O O   . ASP C 1 46 ? 17.437  20.390  53.545 1.00 61.19  ? 46   ASP C O   1 
ATOM   1545 C CB  . ASP C 1 46 ? 16.478  16.958  52.960 1.00 46.47  ? 46   ASP C CB  1 
ATOM   1546 C CG  . ASP C 1 46 ? 16.867  16.527  54.363 1.00 101.56 ? 46   ASP C CG  1 
ATOM   1547 O OD1 . ASP C 1 46 ? 16.884  17.419  55.271 1.00 57.11  ? 46   ASP C OD1 1 
ATOM   1548 O OD2 . ASP C 1 46 ? 17.162  15.307  54.537 1.00 85.11  ? 46   ASP C OD2 1 
ATOM   1549 N N   . GLU C 1 47 ? 15.324  19.603  53.472 1.00 74.12  ? 47   GLU C N   1 
ATOM   1550 C CA  . GLU C 1 47 ? 14.734  20.865  54.071 1.00 73.20  ? 47   GLU C CA  1 
ATOM   1551 C C   . GLU C 1 47 ? 15.116  21.172  55.527 1.00 63.28  ? 47   GLU C C   1 
ATOM   1552 O O   . GLU C 1 47 ? 15.037  22.325  55.949 1.00 80.43  ? 47   GLU C O   1 
ATOM   1553 C CB  . GLU C 1 47 ? 13.192  20.925  53.974 1.00 44.62  ? 47   GLU C CB  1 
ATOM   1554 N N   . HIS C 1 48 ? 15.535  20.146  56.276 1.00 43.50  ? 48   HIS C N   1 
ATOM   1555 C CA  . HIS C 1 48 ? 15.889  20.292  57.683 1.00 62.21  ? 48   HIS C CA  1 
ATOM   1556 C C   . HIS C 1 48 ? 17.376  20.339  57.988 1.00 52.96  ? 48   HIS C C   1 
ATOM   1557 O O   . HIS C 1 48 ? 17.785  20.714  59.085 1.00 55.59  ? 48   HIS C O   1 
ATOM   1558 C CB  . HIS C 1 48 ? 15.255  19.163  58.482 1.00 69.90  ? 48   HIS C CB  1 
ATOM   1559 C CG  . HIS C 1 48 ? 13.770  19.126  58.359 1.00 62.68  ? 48   HIS C CG  1 
ATOM   1560 N ND1 . HIS C 1 48 ? 12.939  19.814  59.215 1.00 106.79 ? 48   HIS C ND1 1 
ATOM   1561 C CD2 . HIS C 1 48 ? 12.963  18.506  57.466 1.00 77.70  ? 48   HIS C CD2 1 
ATOM   1562 C CE1 . HIS C 1 48 ? 11.682  19.618  58.859 1.00 111.48 ? 48   HIS C CE1 1 
ATOM   1563 N NE2 . HIS C 1 48 ? 11.669  18.832  57.797 1.00 108.07 ? 48   HIS C NE2 1 
ATOM   1564 N N   . GLY C 1 49 ? 18.196  19.940  57.033 1.00 54.50  ? 49   GLY C N   1 
ATOM   1565 C CA  . GLY C 1 49 ? 19.618  19.888  57.293 1.00 56.45  ? 49   GLY C CA  1 
ATOM   1566 C C   . GLY C 1 49 ? 20.340  18.878  56.433 1.00 54.69  ? 49   GLY C C   1 
ATOM   1567 O O   . GLY C 1 49 ? 20.194  18.855  55.235 1.00 58.07  ? 49   GLY C O   1 
ATOM   1568 N N   . PHE C 1 50 ? 21.133  18.032  57.040 1.00 40.07  ? 50   PHE C N   1 
ATOM   1569 C CA  . PHE C 1 50 ? 21.910  17.123  56.246 1.00 45.42  ? 50   PHE C CA  1 
ATOM   1570 C C   . PHE C 1 50 ? 21.651  15.756  56.746 1.00 51.96  ? 50   PHE C C   1 
ATOM   1571 O O   . PHE C 1 50 ? 21.367  15.599  57.911 1.00 66.13  ? 50   PHE C O   1 
ATOM   1572 C CB  . PHE C 1 50 ? 23.387  17.445  56.370 1.00 48.05  ? 50   PHE C CB  1 
ATOM   1573 C CG  . PHE C 1 50 ? 23.768  18.738  55.735 1.00 72.13  ? 50   PHE C CG  1 
ATOM   1574 C CD1 . PHE C 1 50 ? 24.253  18.785  54.433 1.00 85.12  ? 50   PHE C CD1 1 
ATOM   1575 C CD2 . PHE C 1 50 ? 23.624  19.920  56.427 1.00 72.90  ? 50   PHE C CD2 1 
ATOM   1576 C CE1 . PHE C 1 50 ? 24.594  20.000  53.847 1.00 60.00  ? 50   PHE C CE1 1 
ATOM   1577 C CE2 . PHE C 1 50 ? 23.973  21.114  55.852 1.00 75.33  ? 50   PHE C CE2 1 
ATOM   1578 C CZ  . PHE C 1 50 ? 24.475  21.149  54.564 1.00 51.00  ? 50   PHE C CZ  1 
ATOM   1579 N N   . ILE C 1 51 ? 21.709  14.761  55.874 1.00 52.14  ? 51   ILE C N   1 
ATOM   1580 C CA  . ILE C 1 51 ? 21.389  13.418  56.316 1.00 52.23  ? 51   ILE C CA  1 
ATOM   1581 C C   . ILE C 1 51 ? 21.984  12.400  55.401 1.00 47.36  ? 51   ILE C C   1 
ATOM   1582 O O   . ILE C 1 51 ? 21.898  12.575  54.227 1.00 36.90  ? 51   ILE C O   1 
ATOM   1583 C CB  . ILE C 1 51 ? 19.888  13.218  56.350 1.00 40.84  ? 51   ILE C CB  1 
ATOM   1584 C CG1 . ILE C 1 51 ? 19.551  11.790  56.791 1.00 58.52  ? 51   ILE C CG1 1 
ATOM   1585 C CG2 . ILE C 1 51 ? 19.304  13.530  55.036 1.00 27.55  ? 51   ILE C CG2 1 
ATOM   1586 C CD1 . ILE C 1 51 ? 18.188  11.685  57.525 1.00 50.01  ? 51   ILE C CD1 1 
ATOM   1587 N N   . SER C 1 52 ? 22.629  11.373  55.953 1.00 45.06  ? 52   SER C N   1 
ATOM   1588 C CA  . SER C 1 52 ? 22.916  10.126  55.238 1.00 38.88  ? 52   SER C CA  1 
ATOM   1589 C C   . SER C 1 52 ? 22.040  9.001   55.792 1.00 31.95  ? 52   SER C C   1 
ATOM   1590 O O   . SER C 1 52 ? 21.507  9.141   56.884 1.00 62.39  ? 52   SER C O   1 
ATOM   1591 C CB  . SER C 1 52 ? 24.419  9.744   55.257 1.00 29.17  ? 52   SER C CB  1 
ATOM   1592 O OG  . SER C 1 52 ? 25.065  9.818   56.497 1.00 35.46  ? 52   SER C OG  1 
ATOM   1593 N N   . ARG C 1 53 ? 21.887  7.906   55.049 1.00 41.58  ? 53   ARG C N   1 
ATOM   1594 C CA  . ARG C 1 53 ? 21.006  6.734   55.395 1.00 20.83  ? 53   ARG C CA  1 
ATOM   1595 C C   . ARG C 1 53 ? 21.521  5.402   54.792 1.00 20.77  ? 53   ARG C C   1 
ATOM   1596 O O   . ARG C 1 53 ? 22.006  5.356   53.676 1.00 47.47  ? 53   ARG C O   1 
ATOM   1597 C CB  . ARG C 1 53 ? 19.541  6.904   54.967 1.00 22.04  ? 53   ARG C CB  1 
ATOM   1598 C CG  . ARG C 1 53 ? 18.796  8.138   55.381 1.00 22.85  ? 53   ARG C CG  1 
ATOM   1599 C CD  . ARG C 1 53 ? 17.472  8.079   54.699 1.00 33.90  ? 53   ARG C CD  1 
ATOM   1600 N NE  . ARG C 1 53 ? 16.514  9.119   55.065 1.00 37.95  ? 53   ARG C NE  1 
ATOM   1601 C CZ  . ARG C 1 53 ? 16.441  10.311  54.524 1.00 36.09  ? 53   ARG C CZ  1 
ATOM   1602 N NH1 . ARG C 1 53 ? 17.298  10.662  53.585 1.00 77.07  ? 53   ARG C NH1 1 
ATOM   1603 N NH2 . ARG C 1 53 ? 15.541  11.165  54.937 1.00 33.80  ? 53   ARG C NH2 1 
ATOM   1604 N N   . GLU C 1 54 ? 21.470  4.331   55.548 1.00 36.04  ? 54   GLU C N   1 
ATOM   1605 C CA  . GLU C 1 54 ? 21.765  3.042   55.016 1.00 34.74  ? 54   GLU C CA  1 
ATOM   1606 C C   . GLU C 1 54 ? 20.823  2.033   55.661 1.00 51.14  ? 54   GLU C C   1 
ATOM   1607 O O   . GLU C 1 54 ? 20.265  2.273   56.734 1.00 49.39  ? 54   GLU C O   1 
ATOM   1608 C CB  . GLU C 1 54 ? 23.230  2.658   55.241 1.00 36.66  ? 54   GLU C CB  1 
ATOM   1609 C CG  . GLU C 1 54 ? 23.563  1.355   54.583 1.00 40.33  ? 54   GLU C CG  1 
ATOM   1610 C CD  . GLU C 1 54 ? 25.004  1.040   54.635 1.00 63.25  ? 54   GLU C CD  1 
ATOM   1611 O OE1 . GLU C 1 54 ? 25.717  1.862   55.216 1.00 67.85  ? 54   GLU C OE1 1 
ATOM   1612 O OE2 . GLU C 1 54 ? 25.431  -0.012  54.102 1.00 67.02  ? 54   GLU C OE2 1 
ATOM   1613 N N   . PHE C 1 55 ? 20.616  0.917   54.970 1.00 33.63  ? 55   PHE C N   1 
ATOM   1614 C CA  . PHE C 1 55 ? 19.659  -0.117  55.389 1.00 42.81  ? 55   PHE C CA  1 
ATOM   1615 C C   . PHE C 1 55 ? 19.903  -1.382  54.605 1.00 28.37  ? 55   PHE C C   1 
ATOM   1616 O O   . PHE C 1 55 ? 20.155  -1.359  53.431 1.00 53.22  ? 55   PHE C O   1 
ATOM   1617 C CB  . PHE C 1 55 ? 18.178  0.332   55.314 1.00 29.07  ? 55   PHE C CB  1 
ATOM   1618 C CG  . PHE C 1 55 ? 17.517  0.070   53.970 1.00 52.92  ? 55   PHE C CG  1 
ATOM   1619 C CD1 . PHE C 1 55 ? 17.144  -1.241  53.603 1.00 58.28  ? 55   PHE C CD1 1 
ATOM   1620 C CD2 . PHE C 1 55 ? 17.214  1.131   53.076 1.00 46.78  ? 55   PHE C CD2 1 
ATOM   1621 C CE1 . PHE C 1 55 ? 16.497  -1.490  52.386 1.00 48.58  ? 55   PHE C CE1 1 
ATOM   1622 C CE2 . PHE C 1 55 ? 16.549  0.898   51.872 1.00 46.99  ? 55   PHE C CE2 1 
ATOM   1623 C CZ  . PHE C 1 55 ? 16.185  -0.416  51.526 1.00 40.74  ? 55   PHE C CZ  1 
ATOM   1624 N N   . HIS C 1 56 ? 19.824  -2.495  55.287 1.00 41.83  ? 56   HIS C N   1 
ATOM   1625 C CA  . HIS C 1 56 ? 20.011  -3.763  54.652 1.00 49.46  ? 56   HIS C CA  1 
ATOM   1626 C C   . HIS C 1 56 ? 18.946  -4.771  55.109 1.00 51.13  ? 56   HIS C C   1 
ATOM   1627 O O   . HIS C 1 56 ? 18.893  -5.139  56.290 1.00 71.61  ? 56   HIS C O   1 
ATOM   1628 C CB  . HIS C 1 56 ? 21.388  -4.241  54.937 1.00 37.10  ? 56   HIS C CB  1 
ATOM   1629 C CG  . HIS C 1 56 ? 21.775  -5.423  54.142 1.00 56.22  ? 56   HIS C CG  1 
ATOM   1630 N ND1 . HIS C 1 56 ? 21.027  -5.871  53.078 1.00 65.97  ? 56   HIS C ND1 1 
ATOM   1631 C CD2 . HIS C 1 56 ? 22.857  -6.228  54.210 1.00 68.30  ? 56   HIS C CD2 1 
ATOM   1632 C CE1 . HIS C 1 56 ? 21.618  -6.920  52.540 1.00 68.02  ? 56   HIS C CE1 1 
ATOM   1633 N NE2 . HIS C 1 56 ? 22.731  -7.158  53.209 1.00 77.58  ? 56   HIS C NE2 1 
ATOM   1634 N N   . ARG C 1 57 ? 18.099  -5.187  54.153 1.00 43.11  ? 57   ARG C N   1 
ATOM   1635 C CA  . ARG C 1 57 ? 16.914  -6.011  54.379 1.00 45.27  ? 57   ARG C CA  1 
ATOM   1636 C C   . ARG C 1 57 ? 17.058  -7.396  53.813 1.00 49.07  ? 57   ARG C C   1 
ATOM   1637 O O   . ARG C 1 57 ? 17.635  -7.552  52.750 1.00 47.21  ? 57   ARG C O   1 
ATOM   1638 C CB  . ARG C 1 57 ? 15.732  -5.373  53.710 1.00 33.93  ? 57   ARG C CB  1 
ATOM   1639 C CG  . ARG C 1 57 ? 14.541  -6.206  53.663 1.00 49.38  ? 57   ARG C CG  1 
ATOM   1640 C CD  . ARG C 1 57 ? 13.530  -5.736  54.647 1.00 45.48  ? 57   ARG C CD  1 
ATOM   1641 N NE  . ARG C 1 57 ? 13.519  -6.633  55.780 1.00 74.31  ? 57   ARG C NE  1 
ATOM   1642 C CZ  . ARG C 1 57 ? 12.880  -6.390  56.903 1.00 73.06  ? 57   ARG C CZ  1 
ATOM   1643 N NH1 . ARG C 1 57 ? 12.186  -5.278  57.040 1.00 34.76  ? 57   ARG C NH1 1 
ATOM   1644 N NH2 . ARG C 1 57 ? 12.954  -7.268  57.878 1.00 73.13  ? 57   ARG C NH2 1 
ATOM   1645 N N   . LYS C 1 58 ? 16.523  -8.396  54.531 1.00 45.62  ? 58   LYS C N   1 
ATOM   1646 C CA  . LYS C 1 58 ? 16.514  -9.769  54.037 1.00 59.64  ? 58   LYS C CA  1 
ATOM   1647 C C   . LYS C 1 58 ? 15.115  -10.379 54.140 1.00 54.39  ? 58   LYS C C   1 
ATOM   1648 O O   . LYS C 1 58 ? 14.437  -10.212 55.132 1.00 55.45  ? 58   LYS C O   1 
ATOM   1649 C CB  . LYS C 1 58 ? 17.544  -10.611 54.786 1.00 43.18  ? 58   LYS C CB  1 
ATOM   1650 C CG  . LYS C 1 58 ? 18.997  -10.227 54.555 1.00 39.32  ? 58   LYS C CG  1 
ATOM   1651 N N   . TYR C 1 59 ? 14.659  -11.054 53.092 1.00 60.13  ? 59   TYR C N   1 
ATOM   1652 C CA  . TYR C 1 59 ? 13.409  -11.798 53.206 1.00 65.35  ? 59   TYR C CA  1 
ATOM   1653 C C   . TYR C 1 59 ? 13.660  -13.248 52.872 1.00 63.10  ? 59   TYR C C   1 
ATOM   1654 O O   . TYR C 1 59 ? 14.561  -13.555 52.079 1.00 60.38  ? 59   TYR C O   1 
ATOM   1655 C CB  . TYR C 1 59 ? 12.378  -11.297 52.236 1.00 49.26  ? 59   TYR C CB  1 
ATOM   1656 C CG  . TYR C 1 59 ? 12.022  -9.847  52.309 1.00 64.32  ? 59   TYR C CG  1 
ATOM   1657 C CD1 . TYR C 1 59 ? 11.062  -9.386  53.219 1.00 49.74  ? 59   TYR C CD1 1 
ATOM   1658 C CD2 . TYR C 1 59 ? 12.572  -8.944  51.405 1.00 50.93  ? 59   TYR C CD2 1 
ATOM   1659 C CE1 . TYR C 1 59 ? 10.654  -8.057  53.227 1.00 56.60  ? 59   TYR C CE1 1 
ATOM   1660 C CE2 . TYR C 1 59 ? 12.197  -7.618  51.406 1.00 54.16  ? 59   TYR C CE2 1 
ATOM   1661 C CZ  . TYR C 1 59 ? 11.226  -7.164  52.317 1.00 84.92  ? 59   TYR C CZ  1 
ATOM   1662 O OH  . TYR C 1 59 ? 10.813  -5.832  52.330 1.00 59.93  ? 59   TYR C OH  1 
ATOM   1663 N N   . ARG C 1 60 ? 12.863  -14.122 53.487 1.00 50.51  ? 60   ARG C N   1 
ATOM   1664 C CA  . ARG C 1 60 ? 12.873  -15.531 53.162 1.00 79.97  ? 60   ARG C CA  1 
ATOM   1665 C C   . ARG C 1 60 ? 11.908  -15.669 52.012 1.00 60.36  ? 60   ARG C C   1 
ATOM   1666 O O   . ARG C 1 60 ? 10.857  -15.066 51.975 1.00 45.58  ? 60   ARG C O   1 
ATOM   1667 C CB  . ARG C 1 60 ? 12.467  -16.409 54.360 1.00 76.66  ? 60   ARG C CB  1 
ATOM   1668 C CG  . ARG C 1 60 ? 13.490  -16.406 55.523 1.00 67.59  ? 60   ARG C CG  1 
ATOM   1669 N N   . ILE C 1 61 ? 12.343  -16.409 51.025 1.00 59.06  ? 61   ILE C N   1 
ATOM   1670 C CA  . ILE C 1 61 ? 11.560  -16.750 49.859 1.00 67.41  ? 61   ILE C CA  1 
ATOM   1671 C C   . ILE C 1 61 ? 10.648  -17.944 50.207 1.00 63.70  ? 61   ILE C C   1 
ATOM   1672 O O   . ILE C 1 61 ? 11.122  -18.956 50.766 1.00 68.82  ? 61   ILE C O   1 
ATOM   1673 C CB  . ILE C 1 61 ? 12.582  -17.118 48.737 1.00 78.92  ? 61   ILE C CB  1 
ATOM   1674 C CG1 . ILE C 1 61 ? 13.364  -15.860 48.318 1.00 69.96  ? 61   ILE C CG1 1 
ATOM   1675 C CG2 . ILE C 1 61 ? 11.938  -17.781 47.578 1.00 46.14  ? 61   ILE C CG2 1 
ATOM   1676 C CD1 . ILE C 1 61 ? 14.568  -16.129 47.426 1.00 60.85  ? 61   ILE C CD1 1 
ATOM   1677 N N   . PRO C 1 62 ? 9.333   -17.832 49.919 1.00 67.35  ? 62   PRO C N   1 
ATOM   1678 C CA  . PRO C 1 62 ? 8.408   -18.977 50.106 1.00 46.95  ? 62   PRO C CA  1 
ATOM   1679 C C   . PRO C 1 62 ? 8.930   -20.291 49.507 1.00 61.23  ? 62   PRO C C   1 
ATOM   1680 O O   . PRO C 1 62 ? 9.583   -20.272 48.463 1.00 61.47  ? 62   PRO C O   1 
ATOM   1681 C CB  . PRO C 1 62 ? 7.132   -18.529 49.366 1.00 63.23  ? 62   PRO C CB  1 
ATOM   1682 C CG  . PRO C 1 62 ? 7.130   -16.976 49.412 1.00 41.50  ? 62   PRO C CG  1 
ATOM   1683 C CD  . PRO C 1 62 ? 8.646   -16.604 49.457 1.00 60.67  ? 62   PRO C CD  1 
ATOM   1684 N N   . ALA C 1 63 ? 8.636   -21.418 50.153 1.00 96.80  ? 63   ALA C N   1 
ATOM   1685 C CA  . ALA C 1 63 ? 9.249   -22.706 49.806 1.00 84.48  ? 63   ALA C CA  1 
ATOM   1686 C C   . ALA C 1 63 ? 9.110   -23.078 48.329 1.00 97.87  ? 63   ALA C C   1 
ATOM   1687 O O   . ALA C 1 63 ? 10.051  -23.642 47.722 1.00 67.74  ? 63   ALA C O   1 
ATOM   1688 C CB  . ALA C 1 63 ? 8.687   -23.792 50.686 1.00 90.12  ? 63   ALA C CB  1 
ATOM   1689 N N   . ASP C 1 64 ? 7.944   -22.746 47.766 1.00 53.93  ? 64   ASP C N   1 
ATOM   1690 C CA  . ASP C 1 64 ? 7.642   -23.044 46.372 1.00 68.03  ? 64   ASP C CA  1 
ATOM   1691 C C   . ASP C 1 64 ? 7.867   -21.833 45.406 1.00 74.46  ? 64   ASP C C   1 
ATOM   1692 O O   . ASP C 1 64 ? 7.041   -21.517 44.493 1.00 38.68  ? 64   ASP C O   1 
ATOM   1693 C CB  . ASP C 1 64 ? 6.205   -23.536 46.290 1.00 65.25  ? 64   ASP C CB  1 
ATOM   1694 C CG  . ASP C 1 64 ? 5.226   -22.490 46.773 1.00 109.73 ? 64   ASP C CG  1 
ATOM   1695 O OD1 . ASP C 1 64 ? 5.690   -21.572 47.501 1.00 73.52  ? 64   ASP C OD1 1 
ATOM   1696 O OD2 . ASP C 1 64 ? 4.020   -22.572 46.407 1.00 93.26  ? 64   ASP C OD2 1 
ATOM   1697 N N   . VAL C 1 65 ? 8.992   -21.150 45.623 1.00 54.96  ? 65   VAL C N   1 
ATOM   1698 C CA  . VAL C 1 65 ? 9.453   -20.050 44.761 1.00 66.09  ? 65   VAL C CA  1 
ATOM   1699 C C   . VAL C 1 65 ? 10.878  -20.341 44.315 1.00 61.31  ? 65   VAL C C   1 
ATOM   1700 O O   . VAL C 1 65 ? 11.769  -20.470 45.142 1.00 65.75  ? 65   VAL C O   1 
ATOM   1701 C CB  . VAL C 1 65 ? 9.288   -18.636 45.413 1.00 52.92  ? 65   VAL C CB  1 
ATOM   1702 C CG1 . VAL C 1 65 ? 9.905   -17.561 44.566 1.00 40.04  ? 65   VAL C CG1 1 
ATOM   1703 C CG2 . VAL C 1 65 ? 7.807   -18.311 45.552 1.00 59.50  ? 65   VAL C CG2 1 
ATOM   1704 N N   . ASP C 1 66 ? 11.060  -20.544 43.011 1.00 58.36  ? 66   ASP C N   1 
ATOM   1705 C CA  . ASP C 1 66 ? 12.385  -20.664 42.428 1.00 61.21  ? 66   ASP C CA  1 
ATOM   1706 C C   . ASP C 1 66 ? 12.972  -19.265 42.457 1.00 68.37  ? 66   ASP C C   1 
ATOM   1707 O O   . ASP C 1 66 ? 12.375  -18.334 41.907 1.00 48.14  ? 66   ASP C O   1 
ATOM   1708 C CB  . ASP C 1 66 ? 12.278  -21.154 40.988 1.00 69.99  ? 66   ASP C CB  1 
ATOM   1709 C CG  . ASP C 1 66 ? 13.639  -21.288 40.285 1.00 108.19 ? 66   ASP C CG  1 
ATOM   1710 O OD1 . ASP C 1 66 ? 14.739  -21.343 40.929 1.00 75.76  ? 66   ASP C OD1 1 
ATOM   1711 O OD2 . ASP C 1 66 ? 13.574  -21.356 39.044 1.00 93.15  ? 66   ASP C OD2 1 
ATOM   1712 N N   . PRO C 1 67 ? 14.110  -19.105 43.149 1.00 46.20  ? 67   PRO C N   1 
ATOM   1713 C CA  . PRO C 1 67 ? 14.795  -17.821 43.358 1.00 75.67  ? 67   PRO C CA  1 
ATOM   1714 C C   . PRO C 1 67 ? 15.210  -17.172 42.061 1.00 63.83  ? 67   PRO C C   1 
ATOM   1715 O O   . PRO C 1 67 ? 15.402  -15.951 42.054 1.00 95.02  ? 67   PRO C O   1 
ATOM   1716 C CB  . PRO C 1 67 ? 16.043  -18.208 44.154 1.00 72.92  ? 67   PRO C CB  1 
ATOM   1717 C CG  . PRO C 1 67 ? 15.663  -19.448 44.847 1.00 55.14  ? 67   PRO C CG  1 
ATOM   1718 C CD  . PRO C 1 67 ? 14.712  -20.179 43.947 1.00 54.55  ? 67   PRO C CD  1 
ATOM   1719 N N   . LEU C 1 68 ? 15.352  -17.995 41.013 1.00 65.46  ? 68   LEU C N   1 
ATOM   1720 C CA  . LEU C 1 68 ? 15.753  -17.581 39.664 1.00 78.67  ? 68   LEU C CA  1 
ATOM   1721 C C   . LEU C 1 68 ? 14.610  -16.968 38.830 1.00 78.19  ? 68   LEU C C   1 
ATOM   1722 O O   . LEU C 1 68 ? 14.845  -16.441 37.746 1.00 66.87  ? 68   LEU C O   1 
ATOM   1723 C CB  . LEU C 1 68 ? 16.384  -18.767 38.895 1.00 48.05  ? 68   LEU C CB  1 
ATOM   1724 N N   . THR C 1 69 ? 13.375  -17.054 39.314 1.00 70.74  ? 69   THR C N   1 
ATOM   1725 C CA  . THR C 1 69 ? 12.233  -16.466 38.600 1.00 60.49  ? 69   THR C CA  1 
ATOM   1726 C C   . THR C 1 69 ? 11.737  -15.204 39.253 1.00 48.10  ? 69   THR C C   1 
ATOM   1727 O O   . THR C 1 69 ? 10.736  -14.681 38.822 1.00 54.39  ? 69   THR C O   1 
ATOM   1728 C CB  . THR C 1 69 ? 11.025  -17.400 38.527 1.00 61.24  ? 69   THR C CB  1 
ATOM   1729 O OG1 . THR C 1 69 ? 10.433  -17.533 39.843 1.00 67.51  ? 69   THR C OG1 1 
ATOM   1730 C CG2 . THR C 1 69 ? 11.437  -18.762 37.937 1.00 56.58  ? 69   THR C CG2 1 
ATOM   1731 N N   . ILE C 1 70 ? 12.432  -14.731 40.293 1.00 52.79  ? 70   ILE C N   1 
ATOM   1732 C CA  . ILE C 1 70 ? 12.022  -13.533 41.056 1.00 96.56  ? 70   ILE C CA  1 
ATOM   1733 C C   . ILE C 1 70 ? 12.318  -12.254 40.221 1.00 82.53  ? 70   ILE C C   1 
ATOM   1734 O O   . ILE C 1 70 ? 13.384  -12.132 39.633 1.00 60.22  ? 70   ILE C O   1 
ATOM   1735 C CB  . ILE C 1 70 ? 12.656  -13.491 42.532 1.00 46.82  ? 70   ILE C CB  1 
ATOM   1736 N N   . THR C 1 71 ? 11.366  -11.326 40.118 1.00 67.44  ? 71   THR C N   1 
ATOM   1737 C CA  . THR C 1 71 ? 11.640  -10.067 39.425 1.00 52.02  ? 71   THR C CA  1 
ATOM   1738 C C   . THR C 1 71 ? 11.549  -8.885  40.344 1.00 45.15  ? 71   THR C C   1 
ATOM   1739 O O   . THR C 1 71 ? 10.975  -8.983  41.420 1.00 39.27  ? 71   THR C O   1 
ATOM   1740 C CB  . THR C 1 71 ? 10.780  -9.855  38.153 1.00 58.30  ? 71   THR C CB  1 
ATOM   1741 O OG1 . THR C 1 71 ? 9.385   -9.909  38.455 1.00 77.86  ? 71   THR C OG1 1 
ATOM   1742 C CG2 . THR C 1 71 ? 11.057  -10.930 37.201 1.00 48.86  ? 71   THR C CG2 1 
ATOM   1743 N N   . SER C 1 72 ? 12.173  -7.788  39.933 1.00 34.60  ? 72   SER C N   1 
ATOM   1744 C CA  . SER C 1 72 ? 12.030  -6.568  40.695 1.00 52.03  ? 72   SER C CA  1 
ATOM   1745 C C   . SER C 1 72 ? 11.526  -5.380  39.845 1.00 62.93  ? 72   SER C C   1 
ATOM   1746 O O   . SER C 1 72 ? 11.583  -5.424  38.602 1.00 47.25  ? 72   SER C O   1 
ATOM   1747 C CB  . SER C 1 72 ? 13.313  -6.310  41.449 1.00 27.33  ? 72   SER C CB  1 
ATOM   1748 O OG  . SER C 1 72 ? 14.211  -5.565  40.697 1.00 41.80  ? 72   SER C OG  1 
ATOM   1749 N N   . SER C 1 73 ? 10.979  -4.349  40.485 1.00 44.15  ? 73   SER C N   1 
ATOM   1750 C CA  . SER C 1 73 ? 10.536  -3.180  39.706 1.00 51.59  ? 73   SER C CA  1 
ATOM   1751 C C   . SER C 1 73 ? 10.558  -1.964  40.576 1.00 44.47  ? 73   SER C C   1 
ATOM   1752 O O   . SER C 1 73 ? 10.278  -2.093  41.752 1.00 32.08  ? 73   SER C O   1 
ATOM   1753 C CB  . SER C 1 73 ? 9.111   -3.355  39.235 1.00 38.27  ? 73   SER C CB  1 
ATOM   1754 O OG  . SER C 1 73 ? 8.398   -2.259  39.743 1.00 77.21  ? 73   SER C OG  1 
ATOM   1755 N N   . LEU C 1 74 ? 10.893  -0.804  39.997 1.00 41.13  ? 74   LEU C N   1 
ATOM   1756 C CA  . LEU C 1 74 ? 10.923  0.469   40.730 1.00 31.47  ? 74   LEU C CA  1 
ATOM   1757 C C   . LEU C 1 74 ? 10.028  1.593   40.158 1.00 49.41  ? 74   LEU C C   1 
ATOM   1758 O O   . LEU C 1 74 ? 10.100  1.992   38.996 1.00 35.29  ? 74   LEU C O   1 
ATOM   1759 C CB  . LEU C 1 74 ? 12.382  0.973   40.959 1.00 32.63  ? 74   LEU C CB  1 
ATOM   1760 C CG  . LEU C 1 74 ? 12.636  2.131   41.964 1.00 54.41  ? 74   LEU C CG  1 
ATOM   1761 C CD1 . LEU C 1 74 ? 12.041  1.997   43.392 1.00 48.95  ? 74   LEU C CD1 1 
ATOM   1762 C CD2 . LEU C 1 74 ? 14.082  2.346   42.100 1.00 34.92  ? 74   LEU C CD2 1 
ATOM   1763 N N   . SER C 1 75 ? 9.180   2.146   41.002 1.00 41.55  ? 75   SER C N   1 
ATOM   1764 C CA  . SER C 1 75 ? 8.356   3.230   40.532 1.00 33.70  ? 75   SER C CA  1 
ATOM   1765 C C   . SER C 1 75 ? 8.901   4.638   40.832 1.00 51.03  ? 75   SER C C   1 
ATOM   1766 O O   . SER C 1 75 ? 9.872   4.829   41.582 1.00 42.59  ? 75   SER C O   1 
ATOM   1767 C CB  . SER C 1 75 ? 6.980   3.096   41.124 1.00 44.11  ? 75   SER C CB  1 
ATOM   1768 O OG  . SER C 1 75 ? 6.968   3.740   42.371 1.00 61.46  ? 75   SER C OG  1 
ATOM   1769 N N   . SER C 1 76 ? 8.242   5.626   40.242 1.00 43.93  ? 76   SER C N   1 
ATOM   1770 C CA  . SER C 1 76 ? 8.736   6.975   40.202 1.00 46.72  ? 76   SER C CA  1 
ATOM   1771 C C   . SER C 1 76 ? 8.428   7.646   41.508 1.00 64.76  ? 76   SER C C   1 
ATOM   1772 O O   . SER C 1 76 ? 9.145   8.548   41.949 1.00 69.29  ? 76   SER C O   1 
ATOM   1773 C CB  . SER C 1 76 ? 8.017   7.736   39.121 1.00 45.45  ? 76   SER C CB  1 
ATOM   1774 O OG  . SER C 1 76 ? 6.621   7.483   39.197 1.00 51.77  ? 76   SER C OG  1 
ATOM   1775 N N   . ASP C 1 77 ? 7.332   7.234   42.136 1.00 58.83  ? 77   ASP C N   1 
ATOM   1776 C CA  . ASP C 1 77 ? 7.031   7.739   43.500 1.00 101.34 ? 77   ASP C CA  1 
ATOM   1777 C C   . ASP C 1 77 ? 7.641   6.919   44.655 1.00 49.80  ? 77   ASP C C   1 
ATOM   1778 O O   . ASP C 1 77 ? 7.211   7.026   45.772 1.00 64.77  ? 77   ASP C O   1 
ATOM   1779 C CB  . ASP C 1 77 ? 5.529   8.000   43.736 1.00 73.48  ? 77   ASP C CB  1 
ATOM   1780 C CG  . ASP C 1 77 ? 4.683   6.920   43.202 1.00 79.40  ? 77   ASP C CG  1 
ATOM   1781 O OD1 . ASP C 1 77 ? 5.181   5.769   43.222 1.00 83.54  ? 77   ASP C OD1 1 
ATOM   1782 O OD2 . ASP C 1 77 ? 3.545   7.224   42.752 1.00 134.99 ? 77   ASP C OD2 1 
ATOM   1783 N N   . GLY C 1 78 ? 8.661   6.137   44.338 1.00 60.86  ? 78   GLY C N   1 
ATOM   1784 C CA  . GLY C 1 78 ? 9.536   5.563   45.312 1.00 60.37  ? 78   GLY C CA  1 
ATOM   1785 C C   . GLY C 1 78 ? 9.198   4.195   45.850 1.00 60.88  ? 78   GLY C C   1 
ATOM   1786 O O   . GLY C 1 78 ? 9.807   3.808   46.799 1.00 44.06  ? 78   GLY C O   1 
ATOM   1787 N N   . VAL C 1 79 ? 8.279   3.452   45.260 1.00 49.51  ? 79   VAL C N   1 
ATOM   1788 C CA  . VAL C 1 79 ? 8.057   2.105   45.719 1.00 25.83  ? 79   VAL C CA  1 
ATOM   1789 C C   . VAL C 1 79 ? 8.901   1.070   44.959 1.00 29.59  ? 79   VAL C C   1 
ATOM   1790 O O   . VAL C 1 79 ? 8.891   1.017   43.760 1.00 57.85  ? 79   VAL C O   1 
ATOM   1791 C CB  . VAL C 1 79 ? 6.565   1.735   45.587 1.00 53.33  ? 79   VAL C CB  1 
ATOM   1792 C CG1 . VAL C 1 79 ? 6.300   0.288   46.133 1.00 36.85  ? 79   VAL C CG1 1 
ATOM   1793 C CG2 . VAL C 1 79 ? 5.718   2.773   46.256 1.00 28.04  ? 79   VAL C CG2 1 
ATOM   1794 N N   . LEU C 1 80 ? 9.621   0.240   45.678 1.00 43.73  ? 80   LEU C N   1 
ATOM   1795 C CA  . LEU C 1 80 ? 10.342  -0.875  45.101 1.00 32.98  ? 80   LEU C CA  1 
ATOM   1796 C C   . LEU C 1 80 ? 9.517   -2.126  45.330 1.00 40.32  ? 80   LEU C C   1 
ATOM   1797 O O   . LEU C 1 80 ? 8.998   -2.346  46.409 1.00 44.07  ? 80   LEU C O   1 
ATOM   1798 C CB  . LEU C 1 80 ? 11.663  -1.053  45.833 1.00 33.98  ? 80   LEU C CB  1 
ATOM   1799 C CG  . LEU C 1 80 ? 12.470  -2.245  45.318 1.00 47.70  ? 80   LEU C CG  1 
ATOM   1800 C CD1 . LEU C 1 80 ? 12.700  -2.093  43.831 1.00 38.68  ? 80   LEU C CD1 1 
ATOM   1801 C CD2 . LEU C 1 80 ? 13.762  -2.319  46.010 1.00 31.71  ? 80   LEU C CD2 1 
ATOM   1802 N N   . THR C 1 81 ? 9.402   -2.959  44.319 1.00 50.85  ? 81   THR C N   1 
ATOM   1803 C CA  . THR C 1 81 ? 8.619   -4.174  44.424 1.00 51.10  ? 81   THR C CA  1 
ATOM   1804 C C   . THR C 1 81 ? 9.468   -5.330  44.041 1.00 37.01  ? 81   THR C C   1 
ATOM   1805 O O   . THR C 1 81 ? 10.296  -5.231  43.151 1.00 47.50  ? 81   THR C O   1 
ATOM   1806 C CB  . THR C 1 81 ? 7.501   -4.160  43.406 1.00 53.64  ? 81   THR C CB  1 
ATOM   1807 O OG1 . THR C 1 81 ? 6.559   -3.168  43.783 1.00 63.48  ? 81   THR C OG1 1 
ATOM   1808 C CG2 . THR C 1 81 ? 6.837   -5.535  43.328 1.00 47.48  ? 81   THR C CG2 1 
ATOM   1809 N N   . VAL C 1 82 ? 9.258   -6.426  44.713 1.00 32.34  ? 82   VAL C N   1 
ATOM   1810 C CA  . VAL C 1 82 ? 9.878   -7.690  44.336 1.00 46.27  ? 82   VAL C CA  1 
ATOM   1811 C C   . VAL C 1 82 ? 8.742   -8.758  44.248 1.00 45.40  ? 82   VAL C C   1 
ATOM   1812 O O   . VAL C 1 82 ? 7.900   -8.844  45.147 1.00 57.23  ? 82   VAL C O   1 
ATOM   1813 C CB  . VAL C 1 82 ? 11.043  -8.100  45.358 1.00 35.22  ? 82   VAL C CB  1 
ATOM   1814 C CG1 . VAL C 1 82 ? 11.764  -9.337  44.954 1.00 23.65  ? 82   VAL C CG1 1 
ATOM   1815 C CG2 . VAL C 1 82 ? 12.057  -6.998  45.576 1.00 36.83  ? 82   VAL C CG2 1 
ATOM   1816 N N   . ASN C 1 83 ? 8.689   -9.514  43.140 1.00 42.45  ? 83   ASN C N   1 
ATOM   1817 C CA  . ASN C 1 83 ? 7.687   -10.576 42.937 1.00 41.09  ? 83   ASN C CA  1 
ATOM   1818 C C   . ASN C 1 83 ? 8.147   -11.752 42.166 1.00 34.38  ? 83   ASN C C   1 
ATOM   1819 O O   . ASN C 1 83 ? 9.288   -11.894 41.831 1.00 50.92  ? 83   ASN C O   1 
ATOM   1820 C CB  . ASN C 1 83 ? 6.343   -10.091 42.412 1.00 54.50  ? 83   ASN C CB  1 
ATOM   1821 C CG  . ASN C 1 83 ? 6.473   -8.889  41.549 1.00 69.83  ? 83   ASN C CG  1 
ATOM   1822 O OD1 . ASN C 1 83 ? 7.428   -8.755  40.824 1.00 49.91  ? 83   ASN C OD1 1 
ATOM   1823 N ND2 . ASN C 1 83 ? 5.533   -7.980  41.648 1.00 84.12  ? 83   ASN C ND2 1 
ATOM   1824 N N   . GLY C 1 84 ? 7.237   -12.647 41.914 1.00 60.94  ? 84   GLY C N   1 
ATOM   1825 C CA  . GLY C 1 84 ? 7.626   -13.933 41.402 1.00 54.21  ? 84   GLY C CA  1 
ATOM   1826 C C   . GLY C 1 84 ? 6.394   -14.815 41.478 1.00 32.70  ? 84   GLY C C   1 
ATOM   1827 O O   . GLY C 1 84 ? 5.471   -14.565 42.247 1.00 55.57  ? 84   GLY C O   1 
ATOM   1828 N N   . PRO C 1 85 ? 6.362   -15.819 40.628 1.00 49.93  ? 85   PRO C N   1 
ATOM   1829 C CA  . PRO C 1 85 ? 5.307   -16.813 40.471 1.00 61.01  ? 85   PRO C CA  1 
ATOM   1830 C C   . PRO C 1 85 ? 5.626   -17.899 41.452 1.00 44.29  ? 85   PRO C C   1 
ATOM   1831 O O   . PRO C 1 85 ? 6.792   -17.938 41.874 1.00 41.43  ? 85   PRO C O   1 
ATOM   1832 C CB  . PRO C 1 85 ? 5.543   -17.350 39.045 1.00 39.54  ? 85   PRO C CB  1 
ATOM   1833 C CG  . PRO C 1 85 ? 6.772   -16.678 38.566 1.00 51.80  ? 85   PRO C CG  1 
ATOM   1834 C CD  . PRO C 1 85 ? 7.462   -16.043 39.682 1.00 51.34  ? 85   PRO C CD  1 
ATOM   1835 N N   . ARG C 1 86 ? 4.661   -18.761 41.780 1.00 46.67  ? 86   ARG C N   1 
ATOM   1836 C CA  . ARG C 1 86 ? 4.899   -19.830 42.735 1.00 50.04  ? 86   ARG C CA  1 
ATOM   1837 C C   . ARG C 1 86 ? 4.434   -21.116 42.064 1.00 56.96  ? 86   ARG C C   1 
ATOM   1838 O O   . ARG C 1 86 ? 4.998   -22.232 42.267 1.00 66.20  ? 86   ARG C O   1 
ATOM   1839 C CB  . ARG C 1 86 ? 4.083   -19.583 44.018 1.00 32.33  ? 86   ARG C CB  1 
ATOM   1840 C CG  . ARG C 1 86 ? 4.064   -18.209 44.554 1.00 29.73  ? 86   ARG C CG  1 
ATOM   1841 C CD  . ARG C 1 86 ? 3.064   -17.944 45.705 1.00 50.94  ? 86   ARG C CD  1 
ATOM   1842 N NE  . ARG C 1 86 ? 3.387   -18.814 46.810 1.00 25.86  ? 86   ARG C NE  1 
ATOM   1843 C CZ  . ARG C 1 86 ? 2.745   -18.871 47.974 1.00 71.68  ? 86   ARG C CZ  1 
ATOM   1844 N NH1 . ARG C 1 86 ? 1.723   -18.061 48.187 1.00 34.05  ? 86   ARG C NH1 1 
ATOM   1845 N NH2 . ARG C 1 86 ? 3.159   -19.705 48.951 1.00 23.97  ? 86   ARG C NH2 1 
ATOM   1846 N N   . LYS C 1 87 ? 3.383   -20.951 41.263 1.00 52.99  ? 87   LYS C N   1 
ATOM   1847 C CA  . LYS C 1 87 ? 2.740   -22.106 40.599 1.00 141.73 ? 87   LYS C CA  1 
ATOM   1848 C C   . LYS C 1 87 ? 1.228   -22.165 40.891 1.00 98.27  ? 87   LYS C C   1 
ATOM   1849 O O   . LYS C 1 87 ? 0.499   -22.998 40.329 1.00 63.19  ? 87   LYS C O   1 
ATOM   1850 C CB  . LYS C 1 87 ? 3.440   -23.463 40.942 1.00 80.26  ? 87   LYS C CB  1 
ATOM   1851 N N   . VAL D 1 14 ? 12.740  20.401  67.660 1.00 79.49  ? 14   VAL D N   1 
ATOM   1852 C CA  . VAL D 1 14 ? 12.911  19.462  66.537 1.00 78.28  ? 14   VAL D CA  1 
ATOM   1853 C C   . VAL D 1 14 ? 12.637  17.998  66.931 1.00 91.31  ? 14   VAL D C   1 
ATOM   1854 O O   . VAL D 1 14 ? 13.360  17.405  67.769 1.00 81.61  ? 14   VAL D O   1 
ATOM   1855 C CB  . VAL D 1 14 ? 14.336  19.555  65.893 1.00 55.98  ? 14   VAL D CB  1 
ATOM   1856 C CG1 . VAL D 1 14 ? 14.517  18.438  64.915 1.00 65.39  ? 14   VAL D CG1 1 
ATOM   1857 C CG2 . VAL D 1 14 ? 14.509  20.907  65.183 1.00 55.06  ? 14   VAL D CG2 1 
ATOM   1858 N N   . ASN D 1 15 ? 11.607  17.413  66.321 1.00 56.33  ? 15   ASN D N   1 
ATOM   1859 C CA  . ASN D 1 15 ? 11.213  16.058  66.679 1.00 68.73  ? 15   ASN D CA  1 
ATOM   1860 C C   . ASN D 1 15 ? 11.588  15.040  65.617 1.00 73.73  ? 15   ASN D C   1 
ATOM   1861 O O   . ASN D 1 15 ? 11.648  15.378  64.457 1.00 76.54  ? 15   ASN D O   1 
ATOM   1862 C CB  . ASN D 1 15 ? 9.720   16.045  66.919 1.00 68.58  ? 15   ASN D CB  1 
ATOM   1863 C CG  . ASN D 1 15 ? 9.337   16.722  68.220 1.00 94.86  ? 15   ASN D CG  1 
ATOM   1864 O OD1 . ASN D 1 15 ? 8.410   16.284  68.912 1.00 98.61  ? 15   ASN D OD1 1 
ATOM   1865 N ND2 . ASN D 1 15 ? 10.056  17.787  68.571 1.00 94.41  ? 15   ASN D ND2 1 
ATOM   1866 N N   . LEU D 1 16 ? 11.877  13.805  66.008 1.00 72.13  ? 16   LEU D N   1 
ATOM   1867 C CA  . LEU D 1 16 ? 12.195  12.750  65.028 1.00 57.87  ? 16   LEU D CA  1 
ATOM   1868 C C   . LEU D 1 16 ? 11.553  11.477  65.446 1.00 84.34  ? 16   LEU D C   1 
ATOM   1869 O O   . LEU D 1 16 ? 11.502  11.139  66.647 1.00 80.90  ? 16   LEU D O   1 
ATOM   1870 C CB  . LEU D 1 16 ? 13.683  12.384  64.983 1.00 65.10  ? 16   LEU D CB  1 
ATOM   1871 C CG  . LEU D 1 16 ? 14.705  13.292  64.362 1.00 60.69  ? 16   LEU D CG  1 
ATOM   1872 C CD1 . LEU D 1 16 ? 14.729  14.552  65.185 1.00 72.02  ? 16   LEU D CD1 1 
ATOM   1873 C CD2 . LEU D 1 16 ? 15.998  12.519  64.428 1.00 36.43  ? 16   LEU D CD2 1 
ATOM   1874 N N   . ASP D 1 17 ? 11.111  10.746  64.439 1.00 58.05  ? 17   ASP D N   1 
ATOM   1875 C CA  . ASP D 1 17 ? 10.607  9.422   64.656 1.00 58.95  ? 17   ASP D CA  1 
ATOM   1876 C C   . ASP D 1 17 ? 11.781  8.421   64.658 1.00 73.29  ? 17   ASP D C   1 
ATOM   1877 O O   . ASP D 1 17 ? 12.341  8.087   63.601 1.00 62.63  ? 17   ASP D O   1 
ATOM   1878 C CB  . ASP D 1 17 ? 9.556   9.084   63.601 1.00 51.18  ? 17   ASP D CB  1 
ATOM   1879 C CG  . ASP D 1 17 ? 9.080   7.686   63.726 1.00 90.06  ? 17   ASP D CG  1 
ATOM   1880 O OD1 . ASP D 1 17 ? 8.747   7.302   64.887 1.00 77.94  ? 17   ASP D OD1 1 
ATOM   1881 O OD2 . ASP D 1 17 ? 9.088   6.975   62.690 1.00 71.28  ? 17   ASP D OD2 1 
ATOM   1882 N N   . VAL D 1 18 ? 12.126  7.934   65.851 1.00 48.48  ? 18   VAL D N   1 
ATOM   1883 C CA  . VAL D 1 18 ? 13.253  7.015   66.023 1.00 74.51  ? 18   VAL D CA  1 
ATOM   1884 C C   . VAL D 1 18 ? 12.769  5.707   66.641 1.00 60.97  ? 18   VAL D C   1 
ATOM   1885 O O   . VAL D 1 18 ? 13.527  4.965   67.291 1.00 52.01  ? 18   VAL D O   1 
ATOM   1886 C CB  . VAL D 1 18 ? 14.352  7.647   66.871 1.00 64.27  ? 18   VAL D CB  1 
ATOM   1887 C CG1 . VAL D 1 18 ? 14.865  8.865   66.154 1.00 39.25  ? 18   VAL D CG1 1 
ATOM   1888 C CG2 . VAL D 1 18 ? 13.764  8.047   68.238 1.00 57.67  ? 18   VAL D CG2 1 
ATOM   1889 N N   . LYS D 1 19 ? 11.509  5.417   66.346 1.00 39.45  ? 19   LYS D N   1 
ATOM   1890 C CA  . LYS D 1 19 ? 10.838  4.196   66.803 1.00 62.00  ? 19   LYS D CA  1 
ATOM   1891 C C   . LYS D 1 19 ? 11.520  2.834   66.602 1.00 57.13  ? 19   LYS D C   1 
ATOM   1892 O O   . LYS D 1 19 ? 11.160  1.895   67.274 1.00 67.88  ? 19   LYS D O   1 
ATOM   1893 C CB  . LYS D 1 19 ? 9.420   4.133   66.224 1.00 45.06  ? 19   LYS D CB  1 
ATOM   1894 N N   . HIS D 1 20 ? 12.481  2.713   65.701 1.00 60.41  ? 20   HIS D N   1 
ATOM   1895 C CA  . HIS D 1 20 ? 13.107  1.417   65.354 1.00 46.61  ? 20   HIS D CA  1 
ATOM   1896 C C   . HIS D 1 20 ? 14.356  1.228   66.132 1.00 48.03  ? 20   HIS D C   1 
ATOM   1897 O O   . HIS D 1 20 ? 14.989  0.178   66.091 1.00 42.67  ? 20   HIS D O   1 
ATOM   1898 C CB  . HIS D 1 20 ? 13.483  1.365   63.860 1.00 58.87  ? 20   HIS D CB  1 
ATOM   1899 C CG  . HIS D 1 20 ? 12.302  1.279   62.925 1.00 70.57  ? 20   HIS D CG  1 
ATOM   1900 N ND1 . HIS D 1 20 ? 11.955  2.302   62.069 1.00 53.34  ? 20   HIS D ND1 1 
ATOM   1901 C CD2 . HIS D 1 20 ? 11.421  0.273   62.683 1.00 31.59  ? 20   HIS D CD2 1 
ATOM   1902 C CE1 . HIS D 1 20 ? 10.871  1.960   61.395 1.00 60.68  ? 20   HIS D CE1 1 
ATOM   1903 N NE2 . HIS D 1 20 ? 10.530  0.735   61.751 1.00 64.85  ? 20   HIS D NE2 1 
ATOM   1904 N N   . PHE D 1 21 ? 14.719  2.294   66.826 1.00 57.41  ? 21   PHE D N   1 
ATOM   1905 C CA  . PHE D 1 21 ? 15.967  2.346   67.607 1.00 65.58  ? 21   PHE D CA  1 
ATOM   1906 C C   . PHE D 1 21 ? 15.674  2.406   69.086 1.00 54.44  ? 21   PHE D C   1 
ATOM   1907 O O   . PHE D 1 21 ? 14.919  3.269   69.596 1.00 55.44  ? 21   PHE D O   1 
ATOM   1908 C CB  . PHE D 1 21 ? 16.831  3.561   67.225 1.00 57.47  ? 21   PHE D CB  1 
ATOM   1909 C CG  . PHE D 1 21 ? 17.147  3.626   65.755 1.00 59.79  ? 21   PHE D CG  1 
ATOM   1910 C CD1 . PHE D 1 21 ? 18.224  2.876   65.217 1.00 32.31  ? 21   PHE D CD1 1 
ATOM   1911 C CD2 . PHE D 1 21 ? 16.340  4.375   64.892 1.00 54.53  ? 21   PHE D CD2 1 
ATOM   1912 C CE1 . PHE D 1 21 ? 18.515  2.910   63.894 1.00 42.89  ? 21   PHE D CE1 1 
ATOM   1913 C CE2 . PHE D 1 21 ? 16.637  4.415   63.509 1.00 32.41  ? 21   PHE D CE2 1 
ATOM   1914 C CZ  . PHE D 1 21 ? 17.716  3.691   63.023 1.00 34.26  ? 21   PHE D CZ  1 
ATOM   1915 N N   . SER D 1 22 ? 16.310  1.485   69.774 1.00 44.53  ? 22   SER D N   1 
ATOM   1916 C CA  . SER D 1 22 ? 16.360  1.514   71.217 1.00 71.32  ? 22   SER D CA  1 
ATOM   1917 C C   . SER D 1 22 ? 17.377  2.587   71.737 1.00 57.84  ? 22   SER D C   1 
ATOM   1918 O O   . SER D 1 22 ? 18.326  2.906   71.056 1.00 44.64  ? 22   SER D O   1 
ATOM   1919 C CB  . SER D 1 22 ? 16.728  0.111   71.668 1.00 53.08  ? 22   SER D CB  1 
ATOM   1920 O OG  . SER D 1 22 ? 18.127  -0.095  71.597 1.00 67.80  ? 22   SER D OG  1 
ATOM   1921 N N   . PRO D 1 23 ? 17.170  3.130   72.959 1.00 85.19  ? 23   PRO D N   1 
ATOM   1922 C CA  . PRO D 1 23 ? 17.922  4.293   73.483 1.00 74.34  ? 23   PRO D CA  1 
ATOM   1923 C C   . PRO D 1 23 ? 19.442  4.148   73.482 1.00 65.88  ? 23   PRO D C   1 
ATOM   1924 O O   . PRO D 1 23 ? 20.117  5.117   73.163 1.00 56.89  ? 23   PRO D O   1 
ATOM   1925 C CB  . PRO D 1 23 ? 17.389  4.439   74.903 1.00 65.81  ? 23   PRO D CB  1 
ATOM   1926 C CG  . PRO D 1 23 ? 15.986  3.874   74.795 1.00 62.00  ? 23   PRO D CG  1 
ATOM   1927 C CD  . PRO D 1 23 ? 16.164  2.669   73.935 1.00 83.43  ? 23   PRO D CD  1 
ATOM   1928 N N   . GLU D 1 24 ? 19.968  2.966   73.784 1.00 67.77  ? 24   GLU D N   1 
ATOM   1929 C CA  . GLU D 1 24 ? 21.402  2.725   73.574 1.00 52.95  ? 24   GLU D CA  1 
ATOM   1930 C C   . GLU D 1 24 ? 21.868  2.911   72.120 1.00 68.85  ? 24   GLU D C   1 
ATOM   1931 O O   . GLU D 1 24 ? 23.064  3.031   71.870 1.00 89.20  ? 24   GLU D O   1 
ATOM   1932 C CB  . GLU D 1 24 ? 21.788  1.299   74.007 1.00 66.30  ? 24   GLU D CB  1 
ATOM   1933 N N   . GLU D 1 25 ? 20.945  2.883   71.156 1.00 78.92  ? 25   GLU D N   1 
ATOM   1934 C CA  . GLU D 1 25 ? 21.306  2.931   69.724 1.00 54.56  ? 25   GLU D CA  1 
ATOM   1935 C C   . GLU D 1 25 ? 21.236  4.347   69.153 1.00 65.25  ? 25   GLU D C   1 
ATOM   1936 O O   . GLU D 1 25 ? 21.537  4.565   67.976 1.00 72.69  ? 25   GLU D O   1 
ATOM   1937 C CB  . GLU D 1 25 ? 20.427  1.984   68.880 1.00 52.37  ? 25   GLU D CB  1 
ATOM   1938 C CG  . GLU D 1 25 ? 20.726  0.517   69.113 1.00 39.88  ? 25   GLU D CG  1 
ATOM   1939 C CD  . GLU D 1 25 ? 19.534  -0.432  68.750 1.00 99.56  ? 25   GLU D CD  1 
ATOM   1940 O OE1 . GLU D 1 25 ? 18.348  0.054   68.677 1.00 61.55  ? 25   GLU D OE1 1 
ATOM   1941 O OE2 . GLU D 1 25 ? 19.823  -1.662  68.537 1.00 51.90  ? 25   GLU D OE2 1 
ATOM   1942 N N   . LEU D 1 26 ? 20.853  5.306   69.987 1.00 65.17  ? 26   LEU D N   1 
ATOM   1943 C CA  . LEU D 1 26 ? 20.839  6.702   69.588 1.00 51.44  ? 26   LEU D CA  1 
ATOM   1944 C C   . LEU D 1 26 ? 21.955  7.499   70.280 1.00 49.55  ? 26   LEU D C   1 
ATOM   1945 O O   . LEU D 1 26 ? 22.411  7.111   71.348 1.00 77.34  ? 26   LEU D O   1 
ATOM   1946 C CB  . LEU D 1 26 ? 19.479  7.241   69.946 1.00 42.41  ? 26   LEU D CB  1 
ATOM   1947 C CG  . LEU D 1 26 ? 18.408  6.517   69.151 1.00 54.55  ? 26   LEU D CG  1 
ATOM   1948 C CD1 . LEU D 1 26 ? 17.072  6.866   69.704 1.00 45.91  ? 26   LEU D CD1 1 
ATOM   1949 C CD2 . LEU D 1 26 ? 18.513  6.882   67.648 1.00 38.12  ? 26   LEU D CD2 1 
ATOM   1950 N N   . LYS D 1 27 ? 22.441  8.564   69.645 1.00 49.87  ? 27   LYS D N   1 
ATOM   1951 C CA  . LYS D 1 27 ? 23.417  9.450   70.275 1.00 50.59  ? 27   LYS D CA  1 
ATOM   1952 C C   . LYS D 1 27 ? 23.220  10.823  69.717 1.00 53.24  ? 27   LYS D C   1 
ATOM   1953 O O   . LYS D 1 27 ? 23.085  10.981  68.521 1.00 62.65  ? 27   LYS D O   1 
ATOM   1954 C CB  . LYS D 1 27 ? 24.853  9.006   70.049 1.00 42.45  ? 27   LYS D CB  1 
ATOM   1955 C CG  . LYS D 1 27 ? 25.615  9.969   69.163 1.00 94.37  ? 27   LYS D CG  1 
ATOM   1956 N N   . VAL D 1 28 ? 23.146  11.802  70.601 1.00 51.77  ? 28   VAL D N   1 
ATOM   1957 C CA  . VAL D 1 28 ? 23.024  13.196  70.239 1.00 52.25  ? 28   VAL D CA  1 
ATOM   1958 C C   . VAL D 1 28 ? 24.314  13.886  70.757 1.00 68.86  ? 28   VAL D C   1 
ATOM   1959 O O   . VAL D 1 28 ? 24.766  13.611  71.877 1.00 75.89  ? 28   VAL D O   1 
ATOM   1960 C CB  . VAL D 1 28 ? 21.749  13.818  70.827 1.00 34.25  ? 28   VAL D CB  1 
ATOM   1961 C CG1 . VAL D 1 28 ? 21.576  15.274  70.416 1.00 62.25  ? 28   VAL D CG1 1 
ATOM   1962 C CG2 . VAL D 1 28 ? 20.553  13.022  70.422 1.00 40.83  ? 28   VAL D CG2 1 
ATOM   1963 N N   . LYS D 1 29 ? 24.926  14.713  69.903 1.00 72.85  ? 29   LYS D N   1 
ATOM   1964 C CA  . LYS D 1 29 ? 26.108  15.492  70.222 1.00 52.53  ? 29   LYS D CA  1 
ATOM   1965 C C   . LYS D 1 29 ? 25.842  16.861  69.686 1.00 73.62  ? 29   LYS D C   1 
ATOM   1966 O O   . LYS D 1 29 ? 25.404  16.981  68.551 1.00 71.62  ? 29   LYS D O   1 
ATOM   1967 C CB  . LYS D 1 29 ? 27.356  14.978  69.509 1.00 52.08  ? 29   LYS D CB  1 
ATOM   1968 C CG  . LYS D 1 29 ? 27.954  13.729  70.073 1.00 62.09  ? 29   LYS D CG  1 
ATOM   1969 N N   . VAL D 1 30 ? 26.101  17.895  70.492 1.00 73.05  ? 30   VAL D N   1 
ATOM   1970 C CA  . VAL D 1 30 ? 26.341  19.224  69.936 1.00 79.85  ? 30   VAL D CA  1 
ATOM   1971 C C   . VAL D 1 30 ? 27.831  19.392  69.697 1.00 91.67  ? 30   VAL D C   1 
ATOM   1972 O O   . VAL D 1 30 ? 28.602  19.420  70.658 1.00 79.92  ? 30   VAL D O   1 
ATOM   1973 C CB  . VAL D 1 30 ? 25.840  20.361  70.810 1.00 53.04  ? 30   VAL D CB  1 
ATOM   1974 C CG1 . VAL D 1 30 ? 26.214  21.666  70.189 1.00 68.58  ? 30   VAL D CG1 1 
ATOM   1975 C CG2 . VAL D 1 30 ? 24.331  20.323  70.936 1.00 38.62  ? 30   VAL D CG2 1 
ATOM   1976 N N   . LEU D 1 31 ? 28.221  19.459  68.420 1.00 96.41  ? 31   LEU D N   1 
ATOM   1977 C CA  . LEU D 1 31 ? 29.589  19.765  68.034 1.00 54.31  ? 31   LEU D CA  1 
ATOM   1978 C C   . LEU D 1 31 ? 29.560  21.145  67.383 1.00 90.82  ? 31   LEU D C   1 
ATOM   1979 O O   . LEU D 1 31 ? 29.324  21.259  66.187 1.00 104.32 ? 31   LEU D O   1 
ATOM   1980 C CB  . LEU D 1 31 ? 30.102  18.714  67.043 1.00 69.09  ? 31   LEU D CB  1 
ATOM   1981 C CG  . LEU D 1 31 ? 30.250  17.299  67.597 1.00 101.09 ? 31   LEU D CG  1 
ATOM   1982 C CD1 . LEU D 1 31 ? 30.789  16.352  66.536 1.00 93.79  ? 31   LEU D CD1 1 
ATOM   1983 C CD2 . LEU D 1 31 ? 31.156  17.287  68.804 1.00 83.28  ? 31   LEU D CD2 1 
ATOM   1984 N N   . GLY D 1 32 ? 29.776  22.197  68.165 1.00 91.41  ? 32   GLY D N   1 
ATOM   1985 C CA  . GLY D 1 32 ? 29.773  23.555  67.629 1.00 75.75  ? 32   GLY D CA  1 
ATOM   1986 C C   . GLY D 1 32 ? 28.371  24.154  67.489 1.00 81.54  ? 32   GLY D C   1 
ATOM   1987 O O   . GLY D 1 32 ? 27.603  24.066  68.407 1.00 81.81  ? 32   GLY D O   1 
ATOM   1988 N N   . ASP D 1 33 ? 28.009  24.787  66.373 1.00 63.16  ? 33   ASP D N   1 
ATOM   1989 C CA  . ASP D 1 33 ? 26.591  25.146  66.171 1.00 116.99 ? 33   ASP D CA  1 
ATOM   1990 C C   . ASP D 1 33 ? 25.757  24.038  65.428 1.00 114.24 ? 33   ASP D C   1 
ATOM   1991 O O   . ASP D 1 33 ? 24.702  24.289  64.846 1.00 59.60  ? 33   ASP D O   1 
ATOM   1992 C CB  . ASP D 1 33 ? 26.449  26.538  65.518 1.00 66.32  ? 33   ASP D CB  1 
ATOM   1993 N N   . VAL D 1 34 ? 26.228  22.800  65.463 1.00 73.42  ? 34   VAL D N   1 
ATOM   1994 C CA  . VAL D 1 34 ? 25.533  21.726  64.786 1.00 72.22  ? 34   VAL D CA  1 
ATOM   1995 C C   . VAL D 1 34 ? 25.080  20.682  65.798 1.00 80.40  ? 34   VAL D C   1 
ATOM   1996 O O   . VAL D 1 34 ? 25.893  20.149  66.564 1.00 84.12  ? 34   VAL D O   1 
ATOM   1997 C CB  . VAL D 1 34 ? 26.451  21.012  63.738 1.00 71.86  ? 34   VAL D CB  1 
ATOM   1998 C CG1 . VAL D 1 34 ? 25.635  20.000  62.904 1.00 45.49  ? 34   VAL D CG1 1 
ATOM   1999 C CG2 . VAL D 1 34 ? 27.199  22.046  62.848 1.00 40.10  ? 34   VAL D CG2 1 
ATOM   2000 N N   . ILE D 1 35 ? 23.784  20.398  65.803 1.00 48.28  ? 35   ILE D N   1 
ATOM   2001 C CA  . ILE D 1 35 ? 23.264  19.159  66.356 1.00 58.67  ? 35   ILE D CA  1 
ATOM   2002 C C   . ILE D 1 35 ? 23.437  17.899  65.442 1.00 69.27  ? 35   ILE D C   1 
ATOM   2003 O O   . ILE D 1 35 ? 22.909  17.860  64.350 1.00 62.72  ? 35   ILE D O   1 
ATOM   2004 C CB  . ILE D 1 35 ? 21.812  19.293  66.556 1.00 44.19  ? 35   ILE D CB  1 
ATOM   2005 C CG1 . ILE D 1 35 ? 21.558  20.430  67.534 1.00 75.95  ? 35   ILE D CG1 1 
ATOM   2006 C CG2 . ILE D 1 35 ? 21.266  17.959  67.003 1.00 55.75  ? 35   ILE D CG2 1 
ATOM   2007 C CD1 . ILE D 1 35 ? 20.219  21.163  67.329 1.00 53.32  ? 35   ILE D CD1 1 
ATOM   2008 N N   . GLU D 1 36 ? 24.171  16.888  65.909 1.00 61.56  ? 36   GLU D N   1 
ATOM   2009 C CA  . GLU D 1 36 ? 24.272  15.616  65.239 1.00 43.73  ? 36   GLU D CA  1 
ATOM   2010 C C   . GLU D 1 36 ? 23.427  14.546  65.946 1.00 62.55  ? 36   GLU D C   1 
ATOM   2011 O O   . GLU D 1 36 ? 23.541  14.347  67.123 1.00 66.67  ? 36   GLU D O   1 
ATOM   2012 C CB  . GLU D 1 36 ? 25.702  15.144  65.230 1.00 39.76  ? 36   GLU D CB  1 
ATOM   2013 C CG  . GLU D 1 36 ? 26.691  16.119  64.691 1.00 63.47  ? 36   GLU D CG  1 
ATOM   2014 C CD  . GLU D 1 36 ? 28.089  15.493  64.571 1.00 110.23 ? 36   GLU D CD  1 
ATOM   2015 O OE1 . GLU D 1 36 ? 28.235  14.260  64.785 1.00 105.21 ? 36   GLU D OE1 1 
ATOM   2016 O OE2 . GLU D 1 36 ? 29.047  16.234  64.266 1.00 134.35 ? 36   GLU D OE2 1 
ATOM   2017 N N   . VAL D 1 37 ? 22.579  13.837  65.215 1.00 79.69  ? 37   VAL D N   1 
ATOM   2018 C CA  . VAL D 1 37 ? 21.878  12.668  65.765 1.00 47.70  ? 37   VAL D CA  1 
ATOM   2019 C C   . VAL D 1 37 ? 22.368  11.474  64.971 1.00 56.27  ? 37   VAL D C   1 
ATOM   2020 O O   . VAL D 1 37 ? 22.422  11.489  63.761 1.00 52.97  ? 37   VAL D O   1 
ATOM   2021 C CB  . VAL D 1 37 ? 20.366  12.756  65.627 1.00 39.12  ? 37   VAL D CB  1 
ATOM   2022 C CG1 . VAL D 1 37 ? 19.709  11.606  66.327 1.00 50.02  ? 37   VAL D CG1 1 
ATOM   2023 C CG2 . VAL D 1 37 ? 19.791  14.060  66.209 1.00 34.87  ? 37   VAL D CG2 1 
ATOM   2024 N N   . HIS D 1 38 ? 22.777  10.440  65.664 1.00 43.86  ? 38   HIS D N   1 
ATOM   2025 C CA  . HIS D 1 38 ? 23.234  9.272   64.983 1.00 35.79  ? 38   HIS D CA  1 
ATOM   2026 C C   . HIS D 1 38 ? 22.423  8.110   65.519 1.00 62.05  ? 38   HIS D C   1 
ATOM   2027 O O   . HIS D 1 38 ? 22.139  8.037   66.710 1.00 75.65  ? 38   HIS D O   1 
ATOM   2028 C CB  . HIS D 1 38 ? 24.704  9.045   65.224 1.00 39.02  ? 38   HIS D CB  1 
ATOM   2029 C CG  . HIS D 1 38 ? 25.217  7.808   64.601 1.00 48.27  ? 38   HIS D CG  1 
ATOM   2030 N ND1 . HIS D 1 38 ? 25.382  7.681   63.237 1.00 70.42  ? 38   HIS D ND1 1 
ATOM   2031 C CD2 . HIS D 1 38 ? 25.543  6.616   65.137 1.00 62.07  ? 38   HIS D CD2 1 
ATOM   2032 C CE1 . HIS D 1 38 ? 25.810  6.462   62.968 1.00 65.74  ? 38   HIS D CE1 1 
ATOM   2033 N NE2 . HIS D 1 38 ? 25.924  5.798   64.102 1.00 64.18  ? 38   HIS D NE2 1 
ATOM   2034 N N   . GLY D 1 39 ? 22.023  7.218   64.620 1.00 66.66  ? 39   GLY D N   1 
ATOM   2035 C CA  . GLY D 1 39 ? 21.090  6.132   64.894 1.00 39.10  ? 39   GLY D CA  1 
ATOM   2036 C C   . GLY D 1 39 ? 21.679  4.935   64.182 1.00 68.10  ? 39   GLY D C   1 
ATOM   2037 O O   . GLY D 1 39 ? 22.127  4.989   63.024 1.00 68.39  ? 39   GLY D O   1 
ATOM   2038 N N   . LYS D 1 40 ? 21.729  3.832   64.883 1.00 61.01  ? 40   LYS D N   1 
ATOM   2039 C CA  . LYS D 1 40 ? 22.229  2.665   64.238 1.00 61.99  ? 40   LYS D CA  1 
ATOM   2040 C C   . LYS D 1 40 ? 21.669  1.482   65.002 1.00 95.17  ? 40   LYS D C   1 
ATOM   2041 O O   . LYS D 1 40 ? 21.179  1.657   66.146 1.00 59.31  ? 40   LYS D O   1 
ATOM   2042 C CB  . LYS D 1 40 ? 23.754  2.674   64.172 1.00 25.43  ? 40   LYS D CB  1 
ATOM   2043 C CG  . LYS D 1 40 ? 24.274  1.572   63.266 1.00 54.44  ? 40   LYS D CG  1 
ATOM   2044 C CD  . LYS D 1 40 ? 25.655  1.167   63.585 1.00 29.14  ? 40   LYS D CD  1 
ATOM   2045 C CE  . LYS D 1 40 ? 26.022  -0.114  62.848 1.00 62.81  ? 40   LYS D CE  1 
ATOM   2046 N NZ  . LYS D 1 40 ? 27.211  0.171   61.948 1.00 49.32  ? 40   LYS D NZ  1 
ATOM   2047 N N   . HIS D 1 41 ? 21.688  0.324   64.322 1.00 60.65  ? 41   HIS D N   1 
ATOM   2048 C CA  . HIS D 1 41 ? 21.197  -0.937  64.843 1.00 58.88  ? 41   HIS D CA  1 
ATOM   2049 C C   . HIS D 1 41 ? 21.615  -2.099  63.956 1.00 52.45  ? 41   HIS D C   1 
ATOM   2050 O O   . HIS D 1 41 ? 21.467  -2.057  62.742 1.00 88.88  ? 41   HIS D O   1 
ATOM   2051 C CB  . HIS D 1 41 ? 19.705  -0.857  65.228 1.00 40.30  ? 41   HIS D CB  1 
ATOM   2052 C CG  . HIS D 1 41 ? 18.735  -1.381  64.223 1.00 53.11  ? 41   HIS D CG  1 
ATOM   2053 N ND1 . HIS D 1 41 ? 17.584  -0.690  63.891 1.00 54.58  ? 41   HIS D ND1 1 
ATOM   2054 C CD2 . HIS D 1 41 ? 18.681  -2.558  63.551 1.00 45.47  ? 41   HIS D CD2 1 
ATOM   2055 C CE1 . HIS D 1 41 ? 16.870  -1.410  63.052 1.00 35.20  ? 41   HIS D CE1 1 
ATOM   2056 N NE2 . HIS D 1 41 ? 17.519  -2.545  62.819 1.00 71.03  ? 41   HIS D NE2 1 
ATOM   2057 N N   . GLU D 1 42 ? 22.204  -3.102  64.587 1.00 54.58  ? 42   GLU D N   1 
ATOM   2058 C CA  . GLU D 1 42 ? 22.725  -4.286  63.922 1.00 64.18  ? 42   GLU D CA  1 
ATOM   2059 C C   . GLU D 1 42 ? 21.552  -5.133  63.375 1.00 45.98  ? 42   GLU D C   1 
ATOM   2060 O O   . GLU D 1 42 ? 20.369  -4.867  63.686 1.00 38.04  ? 42   GLU D O   1 
ATOM   2061 C CB  . GLU D 1 42 ? 23.673  -5.069  64.889 1.00 45.12  ? 42   GLU D CB  1 
ATOM   2062 N N   . GLU D 1 43 ? 21.854  -6.113  62.517 1.00 45.78  ? 43   GLU D N   1 
ATOM   2063 C CA  . GLU D 1 43 ? 20.767  -6.998  62.008 1.00 65.93  ? 43   GLU D CA  1 
ATOM   2064 C C   . GLU D 1 43 ? 19.849  -7.596  63.098 1.00 55.61  ? 43   GLU D C   1 
ATOM   2065 O O   . GLU D 1 43 ? 20.298  -8.017  64.162 1.00 70.07  ? 43   GLU D O   1 
ATOM   2066 C CB  . GLU D 1 43 ? 21.342  -8.122  61.167 1.00 55.40  ? 43   GLU D CB  1 
ATOM   2067 C CG  . GLU D 1 43 ? 20.308  -8.826  60.290 1.00 95.80  ? 43   GLU D CG  1 
ATOM   2068 C CD  . GLU D 1 43 ? 20.963  -9.799  59.326 1.00 95.25  ? 43   GLU D CD  1 
ATOM   2069 O OE1 . GLU D 1 43 ? 22.084  -10.237 59.629 1.00 59.21  ? 43   GLU D OE1 1 
ATOM   2070 O OE2 . GLU D 1 43 ? 20.357  -10.120 58.277 1.00 112.51 ? 43   GLU D OE2 1 
ATOM   2071 N N   . ARG D 1 44 ? 18.564  -7.661  62.827 1.00 72.17  ? 44   ARG D N   1 
ATOM   2072 C CA  . ARG D 1 44 ? 17.613  -8.037  63.860 1.00 62.32  ? 44   ARG D CA  1 
ATOM   2073 C C   . ARG D 1 44 ? 16.320  -8.501  63.179 1.00 65.90  ? 44   ARG D C   1 
ATOM   2074 O O   . ARG D 1 44 ? 15.785  -7.812  62.294 1.00 79.99  ? 44   ARG D O   1 
ATOM   2075 C CB  . ARG D 1 44 ? 17.364  -6.836  64.775 1.00 36.22  ? 44   ARG D CB  1 
ATOM   2076 C CG  . ARG D 1 44 ? 15.970  -6.741  65.227 1.00 53.13  ? 44   ARG D CG  1 
ATOM   2077 C CD  . ARG D 1 44 ? 15.498  -5.316  65.301 1.00 64.31  ? 44   ARG D CD  1 
ATOM   2078 N NE  . ARG D 1 44 ? 16.369  -4.472  66.113 1.00 61.45  ? 44   ARG D NE  1 
ATOM   2079 C CZ  . ARG D 1 44 ? 16.127  -3.175  66.341 1.00 109.14 ? 44   ARG D CZ  1 
ATOM   2080 N NH1 . ARG D 1 44 ? 15.027  -2.591  65.796 1.00 53.15  ? 44   ARG D NH1 1 
ATOM   2081 N NH2 . ARG D 1 44 ? 16.988  -2.465  67.097 1.00 42.49  ? 44   ARG D NH2 1 
ATOM   2082 N N   . GLN D 1 45 ? 15.856  -9.690  63.548 1.00 67.10  ? 45   GLN D N   1 
ATOM   2083 C CA  . GLN D 1 45 ? 14.644  -10.235 62.976 1.00 79.25  ? 45   GLN D CA  1 
ATOM   2084 C C   . GLN D 1 45 ? 13.406  -9.389  63.323 1.00 75.76  ? 45   GLN D C   1 
ATOM   2085 O O   . GLN D 1 45 ? 13.427  -8.476  64.169 1.00 61.76  ? 45   GLN D O   1 
ATOM   2086 C CB  . GLN D 1 45 ? 14.478  -11.705 63.376 1.00 70.98  ? 45   GLN D CB  1 
ATOM   2087 C CG  . GLN D 1 45 ? 13.603  -12.555 62.454 1.00 113.12 ? 45   GLN D CG  1 
ATOM   2088 C CD  . GLN D 1 45 ? 13.154  -13.804 63.172 1.00 94.41  ? 45   GLN D CD  1 
ATOM   2089 O OE1 . GLN D 1 45 ? 13.166  -13.827 64.372 1.00 61.88  ? 45   GLN D OE1 1 
ATOM   2090 N NE2 . GLN D 1 45 ? 12.788  -14.842 62.453 1.00 52.10  ? 45   GLN D NE2 1 
ATOM   2091 N N   . ASP D 1 46 ? 12.337  -9.664  62.601 1.00 42.18  ? 46   ASP D N   1 
ATOM   2092 C CA  . ASP D 1 46 ? 11.128  -8.884  62.728 1.00 46.62  ? 46   ASP D CA  1 
ATOM   2093 C C   . ASP D 1 46 ? 10.040  -9.615  61.946 1.00 73.77  ? 46   ASP D C   1 
ATOM   2094 O O   . ASP D 1 46 ? 10.238  -10.756 61.461 1.00 52.82  ? 46   ASP D O   1 
ATOM   2095 C CB  . ASP D 1 46 ? 11.318  -7.394  62.309 1.00 54.02  ? 46   ASP D CB  1 
ATOM   2096 C CG  . ASP D 1 46 ? 11.430  -7.185  60.761 1.00 94.93  ? 46   ASP D CG  1 
ATOM   2097 O OD1 . ASP D 1 46 ? 11.986  -8.073  60.058 1.00 69.57  ? 46   ASP D OD1 1 
ATOM   2098 O OD2 . ASP D 1 46 ? 10.968  -6.129  60.251 1.00 48.12  ? 46   ASP D OD2 1 
ATOM   2099 N N   . GLU D 1 47 ? 8.895   -8.953  61.861 1.00 49.02  ? 47   GLU D N   1 
ATOM   2100 C CA  . GLU D 1 47 ? 7.702   -9.492  61.221 1.00 52.58  ? 47   GLU D CA  1 
ATOM   2101 C C   . GLU D 1 47 ? 7.993   -9.838  59.767 1.00 74.03  ? 47   GLU D C   1 
ATOM   2102 O O   . GLU D 1 47 ? 7.506   -10.849 59.256 1.00 81.38  ? 47   GLU D O   1 
ATOM   2103 C CB  . GLU D 1 47 ? 6.526   -8.480  61.340 1.00 28.69  ? 47   GLU D CB  1 
ATOM   2104 N N   . HIS D 1 48 ? 8.810   -8.998  59.122 1.00 83.71  ? 48   HIS D N   1 
ATOM   2105 C CA  . HIS D 1 48 ? 9.032   -9.043  57.681 1.00 50.71  ? 48   HIS D CA  1 
ATOM   2106 C C   . HIS D 1 48 ? 10.302  -9.911  57.283 1.00 62.39  ? 48   HIS D C   1 
ATOM   2107 O O   . HIS D 1 48 ? 10.393  -10.412 56.160 1.00 58.62  ? 48   HIS D O   1 
ATOM   2108 C CB  . HIS D 1 48 ? 9.056   -7.590  57.144 1.00 74.26  ? 48   HIS D CB  1 
ATOM   2109 C CG  . HIS D 1 48 ? 7.702   -7.001  56.787 1.00 60.87  ? 48   HIS D CG  1 
ATOM   2110 N ND1 . HIS D 1 48 ? 6.890   -6.363  57.702 1.00 98.18  ? 48   HIS D ND1 1 
ATOM   2111 C CD2 . HIS D 1 48 ? 7.085   -6.852  55.584 1.00 96.35  ? 48   HIS D CD2 1 
ATOM   2112 C CE1 . HIS D 1 48 ? 5.812   -5.898  57.092 1.00 107.69 ? 48   HIS D CE1 1 
ATOM   2113 N NE2 . HIS D 1 48 ? 5.905   -6.182  55.805 1.00 96.92  ? 48   HIS D NE2 1 
ATOM   2114 N N   . GLY D 1 49 ? 11.230  -10.132 58.221 1.00 43.10  ? 49   GLY D N   1 
ATOM   2115 C CA  . GLY D 1 49 ? 12.493  -10.839 57.959 1.00 53.01  ? 49   GLY D CA  1 
ATOM   2116 C C   . GLY D 1 49 ? 13.605  -10.319 58.876 1.00 70.38  ? 49   GLY D C   1 
ATOM   2117 O O   . GLY D 1 49 ? 13.429  -10.241 60.093 1.00 53.24  ? 49   GLY D O   1 
ATOM   2118 N N   . PHE D 1 50 ? 14.733  -9.904  58.294 1.00 70.62  ? 50   PHE D N   1 
ATOM   2119 C CA  . PHE D 1 50 ? 15.819  -9.287  59.064 1.00 66.49  ? 50   PHE D CA  1 
ATOM   2120 C C   . PHE D 1 50 ? 16.169  -7.873  58.552 1.00 58.68  ? 50   PHE D C   1 
ATOM   2121 O O   . PHE D 1 50 ? 16.243  -7.698  57.345 1.00 74.43  ? 50   PHE D O   1 
ATOM   2122 C CB  . PHE D 1 50 ? 17.021  -10.215 59.014 1.00 68.05  ? 50   PHE D CB  1 
ATOM   2123 C CG  . PHE D 1 50 ? 16.731  -11.606 59.520 1.00 70.82  ? 50   PHE D CG  1 
ATOM   2124 N N   . ILE D 1 51 ? 16.304  -6.861  59.441 1.00 59.67  ? 51   ILE D N   1 
ATOM   2125 C CA  . ILE D 1 51 ? 16.937  -5.561  59.073 1.00 48.27  ? 51   ILE D CA  1 
ATOM   2126 C C   . ILE D 1 51 ? 18.006  -5.030  60.004 1.00 75.79  ? 51   ILE D C   1 
ATOM   2127 O O   . ILE D 1 51 ? 17.844  -5.019  61.230 1.00 67.08  ? 51   ILE D O   1 
ATOM   2128 C CB  . ILE D 1 51 ? 16.022  -4.287  59.046 1.00 64.98  ? 51   ILE D CB  1 
ATOM   2129 C CG1 . ILE D 1 51 ? 14.692  -4.492  59.777 1.00 63.83  ? 51   ILE D CG1 1 
ATOM   2130 C CG2 . ILE D 1 51 ? 16.066  -3.544  57.613 1.00 20.92  ? 51   ILE D CG2 1 
ATOM   2131 C CD1 . ILE D 1 51 ? 14.835  -4.618  61.238 1.00 62.11  ? 51   ILE D CD1 1 
ATOM   2132 N N   . SER D 1 52 ? 19.049  -4.478  59.384 1.00 51.40  ? 52   SER D N   1 
ATOM   2133 C CA  . SER D 1 52 ? 19.835  -3.409  60.012 1.00 56.42  ? 52   SER D CA  1 
ATOM   2134 C C   . SER D 1 52 ? 19.577  -2.000  59.428 1.00 43.37  ? 52   SER D C   1 
ATOM   2135 O O   . SER D 1 52 ? 19.253  -1.865  58.271 1.00 54.47  ? 52   SER D O   1 
ATOM   2136 C CB  . SER D 1 52 ? 21.332  -3.728  59.970 1.00 35.18  ? 52   SER D CB  1 
ATOM   2137 O OG  . SER D 1 52 ? 21.767  -4.097  58.703 1.00 54.74  ? 52   SER D OG  1 
ATOM   2138 N N   . ARG D 1 53 ? 19.763  -0.970  60.245 1.00 37.00  ? 53   ARG D N   1 
ATOM   2139 C CA  . ARG D 1 53 ? 19.583  0.397   59.832 1.00 43.19  ? 53   ARG D CA  1 
ATOM   2140 C C   . ARG D 1 53 ? 20.648  1.307   60.425 1.00 44.98  ? 53   ARG D C   1 
ATOM   2141 O O   . ARG D 1 53 ? 21.015  1.136   61.548 1.00 66.68  ? 53   ARG D O   1 
ATOM   2142 C CB  . ARG D 1 53 ? 18.241  0.944   60.339 1.00 42.64  ? 53   ARG D CB  1 
ATOM   2143 C CG  . ARG D 1 53 ? 17.008  0.210   59.909 1.00 30.06  ? 53   ARG D CG  1 
ATOM   2144 C CD  . ARG D 1 53 ? 15.840  0.988   60.370 1.00 39.35  ? 53   ARG D CD  1 
ATOM   2145 N NE  . ARG D 1 53 ? 14.563  0.326   60.062 1.00 46.91  ? 53   ARG D NE  1 
ATOM   2146 C CZ  . ARG D 1 53 ? 14.127  -0.814  60.598 1.00 45.72  ? 53   ARG D CZ  1 
ATOM   2147 N NH1 . ARG D 1 53 ? 14.830  -1.480  61.482 1.00 58.96  ? 53   ARG D NH1 1 
ATOM   2148 N NH2 . ARG D 1 53 ? 12.980  -1.297  60.261 1.00 36.41  ? 53   ARG D NH2 1 
ATOM   2149 N N   . GLU D 1 54 ? 21.106  2.303   59.677 1.00 47.34  ? 54   GLU D N   1 
ATOM   2150 C CA  . GLU D 1 54 ? 21.918  3.353   60.235 1.00 40.64  ? 54   GLU D CA  1 
ATOM   2151 C C   . GLU D 1 54 ? 21.536  4.696   59.629 1.00 54.35  ? 54   GLU D C   1 
ATOM   2152 O O   . GLU D 1 54 ? 21.153  4.747   58.492 1.00 56.00  ? 54   GLU D O   1 
ATOM   2153 C CB  . GLU D 1 54 ? 23.392  3.068   60.023 1.00 40.24  ? 54   GLU D CB  1 
ATOM   2154 C CG  . GLU D 1 54 ? 24.249  4.087   60.735 1.00 38.28  ? 54   GLU D CG  1 
ATOM   2155 C CD  . GLU D 1 54 ? 25.731  3.758   60.655 1.00 81.56  ? 54   GLU D CD  1 
ATOM   2156 O OE1 . GLU D 1 54 ? 26.083  2.771   59.989 1.00 55.21  ? 54   GLU D OE1 1 
ATOM   2157 O OE2 . GLU D 1 54 ? 26.566  4.485   61.252 1.00 88.36  ? 54   GLU D OE2 1 
ATOM   2158 N N   . PHE D 1 55 ? 21.636  5.777   60.388 1.00 39.84  ? 55   PHE D N   1 
ATOM   2159 C CA  . PHE D 1 55 ? 21.367  7.108   59.860 1.00 42.59  ? 55   PHE D CA  1 
ATOM   2160 C C   . PHE D 1 55 ? 22.168  8.139   60.606 1.00 32.34  ? 55   PHE D C   1 
ATOM   2161 O O   . PHE D 1 55 ? 22.604  7.866   61.712 1.00 48.01  ? 55   PHE D O   1 
ATOM   2162 C CB  . PHE D 1 55 ? 19.881  7.430   59.893 1.00 38.67  ? 55   PHE D CB  1 
ATOM   2163 C CG  . PHE D 1 55 ? 19.409  8.014   61.157 1.00 44.63  ? 55   PHE D CG  1 
ATOM   2164 C CD1 . PHE D 1 55 ? 19.571  9.383   61.423 1.00 36.40  ? 55   PHE D CD1 1 
ATOM   2165 C CD2 . PHE D 1 55 ? 18.769  7.199   62.107 1.00 59.32  ? 55   PHE D CD2 1 
ATOM   2166 C CE1 . PHE D 1 55 ? 19.122  9.919   62.660 1.00 39.56  ? 55   PHE D CE1 1 
ATOM   2167 C CE2 . PHE D 1 55 ? 18.276  7.727   63.335 1.00 46.75  ? 55   PHE D CE2 1 
ATOM   2168 C CZ  . PHE D 1 55 ? 18.449  9.075   63.602 1.00 49.65  ? 55   PHE D CZ  1 
ATOM   2169 N N   . HIS D 1 56 ? 22.457  9.262   59.947 1.00 54.59  ? 56   HIS D N   1 
ATOM   2170 C CA  . HIS D 1 56 ? 23.278  10.346  60.508 1.00 39.72  ? 56   HIS D CA  1 
ATOM   2171 C C   . HIS D 1 56 ? 22.689  11.650  60.034 1.00 37.94  ? 56   HIS D C   1 
ATOM   2172 O O   . HIS D 1 56 ? 22.626  11.925  58.836 1.00 43.42  ? 56   HIS D O   1 
ATOM   2173 C CB  . HIS D 1 56 ? 24.779  10.199  60.188 1.00 23.18  ? 56   HIS D CB  1 
ATOM   2174 C CG  . HIS D 1 56 ? 25.658  11.039  61.063 1.00 61.10  ? 56   HIS D CG  1 
ATOM   2175 N ND1 . HIS D 1 56 ? 25.164  11.812  62.095 1.00 71.39  ? 56   HIS D ND1 1 
ATOM   2176 C CD2 . HIS D 1 56 ? 26.997  11.220  61.069 1.00 62.77  ? 56   HIS D CD2 1 
ATOM   2177 C CE1 . HIS D 1 56 ? 26.155  12.448  62.685 1.00 65.56  ? 56   HIS D CE1 1 
ATOM   2178 N NE2 . HIS D 1 56 ? 27.280  12.101  62.086 1.00 85.47  ? 56   HIS D NE2 1 
ATOM   2179 N N   . ARG D 1 57 ? 22.164  12.399  60.995 1.00 33.03  ? 57   ARG D N   1 
ATOM   2180 C CA  . ARG D 1 57 ? 21.518  13.680  60.790 1.00 46.16  ? 57   ARG D CA  1 
ATOM   2181 C C   . ARG D 1 57 ? 22.232  14.925  61.434 1.00 39.78  ? 57   ARG D C   1 
ATOM   2182 O O   . ARG D 1 57 ? 22.809  14.814  62.450 1.00 46.18  ? 57   ARG D O   1 
ATOM   2183 C CB  . ARG D 1 57 ? 20.138  13.578  61.356 1.00 32.42  ? 57   ARG D CB  1 
ATOM   2184 C CG  . ARG D 1 57 ? 19.519  14.913  61.442 1.00 41.94  ? 57   ARG D CG  1 
ATOM   2185 C CD  . ARG D 1 57 ? 18.411  14.972  60.477 1.00 55.13  ? 57   ARG D CD  1 
ATOM   2186 N NE  . ARG D 1 57 ? 18.753  15.807  59.350 1.00 79.08  ? 57   ARG D NE  1 
ATOM   2187 C CZ  . ARG D 1 57 ? 18.059  15.823  58.224 1.00 82.29  ? 57   ARG D CZ  1 
ATOM   2188 N NH1 . ARG D 1 57 ? 16.992  15.024  58.065 1.00 35.73  ? 57   ARG D NH1 1 
ATOM   2189 N NH2 . ARG D 1 57 ? 18.454  16.630  57.256 1.00 75.86  ? 57   ARG D NH2 1 
ATOM   2190 N N   . LYS D 1 58 ? 22.167  16.090  60.808 1.00 42.49  ? 58   LYS D N   1 
ATOM   2191 C CA  . LYS D 1 58 ? 22.823  17.314  61.250 1.00 35.84  ? 58   LYS D CA  1 
ATOM   2192 C C   . LYS D 1 58 ? 21.863  18.458  61.007 1.00 60.03  ? 58   LYS D C   1 
ATOM   2193 O O   . LYS D 1 58 ? 21.368  18.654  59.899 1.00 63.64  ? 58   LYS D O   1 
ATOM   2194 C CB  . LYS D 1 58 ? 24.128  17.615  60.524 1.00 27.55  ? 58   LYS D CB  1 
ATOM   2195 C CG  . LYS D 1 58 ? 25.223  16.489  60.699 1.00 41.75  ? 58   LYS D CG  1 
ATOM   2196 C CD  . LYS D 1 58 ? 26.533  16.839  60.051 1.00 25.74  ? 58   LYS D CD  1 
ATOM   2197 C CE  . LYS D 1 58 ? 27.593  15.726  59.929 1.00 47.82  ? 58   LYS D CE  1 
ATOM   2198 N NZ  . LYS D 1 58 ? 27.404  14.616  60.892 1.00 110.04 ? 58   LYS D NZ  1 
ATOM   2199 N N   . TYR D 1 59 ? 21.567  19.200  62.068 1.00 49.22  ? 59   TYR D N   1 
ATOM   2200 C CA  . TYR D 1 59 ? 20.907  20.477  61.938 1.00 50.11  ? 59   TYR D CA  1 
ATOM   2201 C C   . TYR D 1 59 ? 21.824  21.671  62.294 1.00 70.57  ? 59   TYR D C   1 
ATOM   2202 O O   . TYR D 1 59 ? 22.722  21.614  63.144 1.00 62.50  ? 59   TYR D O   1 
ATOM   2203 C CB  . TYR D 1 59 ? 19.736  20.537  62.871 1.00 61.07  ? 59   TYR D CB  1 
ATOM   2204 C CG  . TYR D 1 59 ? 18.809  19.360  62.843 1.00 75.14  ? 59   TYR D CG  1 
ATOM   2205 C CD1 . TYR D 1 59 ? 17.697  19.371  62.020 1.00 68.78  ? 59   TYR D CD1 1 
ATOM   2206 C CD2 . TYR D 1 59 ? 19.002  18.252  63.689 1.00 57.92  ? 59   TYR D CD2 1 
ATOM   2207 C CE1 . TYR D 1 59 ? 16.785  18.305  62.013 1.00 61.76  ? 59   TYR D CE1 1 
ATOM   2208 C CE2 . TYR D 1 59 ? 18.082  17.169  63.695 1.00 52.37  ? 59   TYR D CE2 1 
ATOM   2209 C CZ  . TYR D 1 59 ? 16.983  17.221  62.849 1.00 67.61  ? 59   TYR D CZ  1 
ATOM   2210 O OH  . TYR D 1 59 ? 16.100  16.187  62.821 1.00 55.17  ? 59   TYR D OH  1 
ATOM   2211 N N   . ARG D 1 60 ? 21.584  22.781  61.631 1.00 75.20  ? 60   ARG D N   1 
ATOM   2212 C CA  . ARG D 1 60 ? 22.253  24.022  61.998 1.00 95.52  ? 60   ARG D CA  1 
ATOM   2213 C C   . ARG D 1 60 ? 21.443  24.625  63.138 1.00 78.29  ? 60   ARG D C   1 
ATOM   2214 O O   . ARG D 1 60 ? 20.207  24.506  63.114 1.00 68.30  ? 60   ARG D O   1 
ATOM   2215 C CB  . ARG D 1 60 ? 22.326  24.999  60.799 1.00 83.03  ? 60   ARG D CB  1 
ATOM   2216 C CG  . ARG D 1 60 ? 23.199  24.528  59.600 1.00 79.33  ? 60   ARG D CG  1 
ATOM   2217 N N   . ILE D 1 61 ? 22.128  25.245  64.121 1.00 69.23  ? 61   ILE D N   1 
ATOM   2218 C CA  . ILE D 1 61 ? 21.466  25.928  65.237 1.00 72.46  ? 61   ILE D CA  1 
ATOM   2219 C C   . ILE D 1 61 ? 21.242  27.378  64.842 1.00 108.66 ? 61   ILE D C   1 
ATOM   2220 O O   . ILE D 1 61 ? 22.209  28.044  64.472 1.00 70.27  ? 61   ILE D O   1 
ATOM   2221 C CB  . ILE D 1 61 ? 22.258  25.837  66.554 1.00 67.36  ? 61   ILE D CB  1 
ATOM   2222 N N   . PRO D 1 62 ? 19.966  27.851  64.899 1.00 69.12  ? 62   PRO D N   1 
ATOM   2223 C CA  . PRO D 1 62 ? 19.427  29.136  64.419 1.00 76.50  ? 62   PRO D CA  1 
ATOM   2224 C C   . PRO D 1 62 ? 20.119  30.394  64.992 1.00 122.21 ? 62   PRO D C   1 
ATOM   2225 O O   . PRO D 1 62 ? 19.463  31.423  65.189 1.00 121.00 ? 62   PRO D O   1 
ATOM   2226 C CB  . PRO D 1 62 ? 17.946  29.087  64.841 1.00 58.71  ? 62   PRO D CB  1 
ATOM   2227 C CG  . PRO D 1 62 ? 17.642  27.689  65.003 1.00 76.91  ? 62   PRO D CG  1 
ATOM   2228 C CD  . PRO D 1 62 ? 18.908  27.042  65.511 1.00 66.31  ? 62   PRO D CD  1 
ATOM   2229 N N   . ALA D 1 63 ? 21.425  30.301  65.249 1.00 104.40 ? 63   ALA D N   1 
ATOM   2230 C CA  . ALA D 1 63 ? 22.284  31.478  65.438 1.00 125.58 ? 63   ALA D CA  1 
ATOM   2231 C C   . ALA D 1 63 ? 22.001  32.264  66.726 1.00 139.61 ? 63   ALA D C   1 
ATOM   2232 O O   . ALA D 1 63 ? 22.907  32.457  67.565 1.00 103.87 ? 63   ALA D O   1 
ATOM   2233 C CB  . ALA D 1 63 ? 22.223  32.394  64.202 1.00 68.22  ? 63   ALA D CB  1 
ATOM   2234 N N   . ASP D 1 64 ? 20.756  32.728  66.866 1.00 111.70 ? 64   ASP D N   1 
ATOM   2235 C CA  . ASP D 1 64 ? 20.237  33.161  68.159 1.00 102.22 ? 64   ASP D CA  1 
ATOM   2236 C C   . ASP D 1 64 ? 20.207  31.932  69.084 1.00 128.36 ? 64   ASP D C   1 
ATOM   2237 O O   . ASP D 1 64 ? 19.246  31.711  69.827 1.00 103.56 ? 64   ASP D O   1 
ATOM   2238 C CB  . ASP D 1 64 ? 18.853  33.819  68.003 1.00 89.78  ? 64   ASP D CB  1 
ATOM   2239 C CG  . ASP D 1 64 ? 17.740  32.823  67.679 1.00 115.34 ? 64   ASP D CG  1 
ATOM   2240 O OD1 . ASP D 1 64 ? 17.151  32.903  66.554 1.00 57.52  ? 64   ASP D OD1 1 
ATOM   2241 O OD2 . ASP D 1 64 ? 17.432  31.986  68.569 1.00 117.72 ? 64   ASP D OD2 1 
ATOM   2242 N N   . VAL D 1 65 ? 21.303  31.165  69.027 1.00 147.08 ? 65   VAL D N   1 
ATOM   2243 C CA  . VAL D 1 65 ? 21.453  29.835  69.624 1.00 100.29 ? 65   VAL D CA  1 
ATOM   2244 C C   . VAL D 1 65 ? 22.875  29.289  69.288 1.00 126.95 ? 65   VAL D C   1 
ATOM   2245 O O   . VAL D 1 65 ? 23.332  29.395  68.126 1.00 88.47  ? 65   VAL D O   1 
ATOM   2246 C CB  . VAL D 1 65 ? 20.313  28.859  69.134 1.00 117.65 ? 65   VAL D CB  1 
ATOM   2247 C CG1 . VAL D 1 65 ? 20.756  27.388  69.121 1.00 133.56 ? 65   VAL D CG1 1 
ATOM   2248 C CG2 . VAL D 1 65 ? 19.073  29.009  69.985 1.00 70.92  ? 65   VAL D CG2 1 
ATOM   2249 N N   . ASP D 1 66 ? 23.604  28.749  70.275 1.00 92.25  ? 66   ASP D N   1 
ATOM   2250 C CA  . ASP D 1 66 ? 23.234  28.735  71.690 1.00 89.90  ? 66   ASP D CA  1 
ATOM   2251 C C   . ASP D 1 66 ? 24.078  27.760  72.488 1.00 101.41 ? 66   ASP D C   1 
ATOM   2252 O O   . ASP D 1 66 ? 24.064  26.550  72.196 1.00 77.89  ? 66   ASP D O   1 
ATOM   2253 C CB  . ASP D 1 66 ? 21.769  28.372  71.907 1.00 116.54 ? 66   ASP D CB  1 
ATOM   2254 C CG  . ASP D 1 66 ? 21.099  29.304  72.879 1.00 131.71 ? 66   ASP D CG  1 
ATOM   2255 O OD1 . ASP D 1 66 ? 21.866  29.940  73.644 1.00 112.04 ? 66   ASP D OD1 1 
ATOM   2256 O OD2 . ASP D 1 66 ? 19.842  29.416  72.879 1.00 104.64 ? 66   ASP D OD2 1 
ATOM   2257 N N   . PRO D 1 67 ? 24.810  28.291  73.501 1.00 112.00 ? 67   PRO D N   1 
ATOM   2258 C CA  . PRO D 1 67 ? 25.587  27.564  74.516 1.00 117.47 ? 67   PRO D CA  1 
ATOM   2259 C C   . PRO D 1 67 ? 24.907  26.268  75.000 1.00 110.09 ? 67   PRO D C   1 
ATOM   2260 O O   . PRO D 1 67 ? 24.096  25.715  74.227 1.00 88.31  ? 67   PRO D O   1 
ATOM   2261 C CB  . PRO D 1 67 ? 25.726  28.610  75.636 1.00 86.51  ? 67   PRO D CB  1 
ATOM   2262 C CG  . PRO D 1 67 ? 25.885  29.882  74.880 1.00 101.68 ? 67   PRO D CG  1 
ATOM   2263 C CD  . PRO D 1 67 ? 25.024  29.750  73.631 1.00 81.31  ? 67   PRO D CD  1 
ATOM   2264 N N   . LEU D 1 68 ? 25.264  25.772  76.198 1.00 73.88  ? 68   LEU D N   1 
ATOM   2265 C CA  . LEU D 1 68 ? 24.549  24.642  76.813 1.00 47.64  ? 68   LEU D CA  1 
ATOM   2266 C C   . LEU D 1 68 ? 23.109  24.594  76.240 1.00 116.35 ? 68   LEU D C   1 
ATOM   2267 O O   . LEU D 1 68 ? 22.780  23.739  75.390 1.00 115.64 ? 68   LEU D O   1 
ATOM   2268 C CB  . LEU D 1 68 ? 24.476  24.779  78.341 1.00 124.46 ? 68   LEU D CB  1 
ATOM   2269 C CG  . LEU D 1 68 ? 24.051  23.613  79.265 1.00 135.89 ? 68   LEU D CG  1 
ATOM   2270 C CD1 . LEU D 1 68 ? 24.309  24.036  80.719 1.00 75.79  ? 68   LEU D CD1 1 
ATOM   2271 C CD2 . LEU D 1 68 ? 22.601  23.079  79.066 1.00 79.85  ? 68   LEU D CD2 1 
ATOM   2272 N N   . THR D 1 69 ? 22.270  25.516  76.725 1.00 61.98  ? 69   THR D N   1 
ATOM   2273 C CA  . THR D 1 69 ? 20.942  25.812  76.157 1.00 91.89  ? 69   THR D CA  1 
ATOM   2274 C C   . THR D 1 69 ? 20.155  24.684  75.474 1.00 106.51 ? 69   THR D C   1 
ATOM   2275 O O   . THR D 1 69 ? 19.012  24.419  75.846 1.00 79.53  ? 69   THR D O   1 
ATOM   2276 C CB  . THR D 1 69 ? 21.055  26.984  75.191 1.00 107.66 ? 69   THR D CB  1 
ATOM   2277 O OG1 . THR D 1 69 ? 21.817  26.582  74.027 1.00 91.77  ? 69   THR D OG1 1 
ATOM   2278 C CG2 . THR D 1 69 ? 21.757  28.129  75.920 1.00 81.48  ? 69   THR D CG2 1 
ATOM   2279 N N   . ILE D 1 70 ? 20.731  24.067  74.446 1.00 77.85  ? 70   ILE D N   1 
ATOM   2280 C CA  . ILE D 1 70 ? 20.061  22.964  73.800 1.00 59.11  ? 70   ILE D CA  1 
ATOM   2281 C C   . ILE D 1 70 ? 20.037  21.700  74.718 1.00 103.10 ? 70   ILE D C   1 
ATOM   2282 O O   . ILE D 1 70 ? 21.065  21.302  75.340 1.00 46.41  ? 70   ILE D O   1 
ATOM   2283 C CB  . ILE D 1 70 ? 20.714  22.665  72.432 1.00 94.24  ? 70   ILE D CB  1 
ATOM   2284 C CG1 . ILE D 1 70 ? 20.664  23.921  71.537 1.00 87.71  ? 70   ILE D CG1 1 
ATOM   2285 C CG2 . ILE D 1 70 ? 20.089  21.433  71.774 1.00 45.62  ? 70   ILE D CG2 1 
ATOM   2286 C CD1 . ILE D 1 70 ? 19.519  23.971  70.564 1.00 62.46  ? 70   ILE D CD1 1 
ATOM   2287 N N   . THR D 1 71 ? 18.843  21.104  74.825 1.00 61.89  ? 71   THR D N   1 
ATOM   2288 C CA  . THR D 1 71 ? 18.639  19.801  75.486 1.00 69.93  ? 71   THR D CA  1 
ATOM   2289 C C   . THR D 1 71 ? 17.605  18.918  74.742 1.00 94.54  ? 71   THR D C   1 
ATOM   2290 O O   . THR D 1 71 ? 16.807  19.373  73.890 1.00 59.24  ? 71   THR D O   1 
ATOM   2291 C CB  . THR D 1 71 ? 18.121  19.926  76.966 1.00 110.89 ? 71   THR D CB  1 
ATOM   2292 O OG1 . THR D 1 71 ? 17.022  20.861  77.026 1.00 81.62  ? 71   THR D OG1 1 
ATOM   2293 C CG2 . THR D 1 71 ? 19.248  20.321  77.973 1.00 72.45  ? 71   THR D CG2 1 
ATOM   2294 N N   . SER D 1 72 ? 17.578  17.650  75.111 1.00 58.27  ? 72   SER D N   1 
ATOM   2295 C CA  . SER D 1 72 ? 16.804  16.724  74.331 1.00 70.42  ? 72   SER D CA  1 
ATOM   2296 C C   . SER D 1 72 ? 15.906  15.849  75.160 1.00 64.49  ? 72   SER D C   1 
ATOM   2297 O O   . SER D 1 72 ? 16.037  15.772  76.373 1.00 72.81  ? 72   SER D O   1 
ATOM   2298 C CB  . SER D 1 72 ? 17.747  15.844  73.533 1.00 72.03  ? 72   SER D CB  1 
ATOM   2299 O OG  . SER D 1 72 ? 18.585  15.121  74.397 1.00 60.46  ? 72   SER D OG  1 
ATOM   2300 N N   . SER D 1 73 ? 15.005  15.143  74.503 1.00 63.15  ? 73   SER D N   1 
ATOM   2301 C CA  . SER D 1 73 ? 14.118  14.306  75.266 1.00 65.09  ? 73   SER D CA  1 
ATOM   2302 C C   . SER D 1 73 ? 13.464  13.208  74.445 1.00 61.44  ? 73   SER D C   1 
ATOM   2303 O O   . SER D 1 73 ? 12.760  13.491  73.485 1.00 67.50  ? 73   SER D O   1 
ATOM   2304 C CB  . SER D 1 73 ? 13.059  15.168  75.933 1.00 51.94  ? 73   SER D CB  1 
ATOM   2305 O OG  . SER D 1 73 ? 11.942  14.366  76.251 1.00 98.73  ? 73   SER D OG  1 
ATOM   2306 N N   . LEU D 1 74 ? 13.673  11.964  74.875 1.00 48.50  ? 74   LEU D N   1 
ATOM   2307 C CA  . LEU D 1 74 ? 13.120  10.784  74.227 1.00 44.40  ? 74   LEU D CA  1 
ATOM   2308 C C   . LEU D 1 74 ? 11.850  10.231  74.877 1.00 71.59  ? 74   LEU D C   1 
ATOM   2309 O O   . LEU D 1 74 ? 11.887  9.583   75.950 1.00 74.45  ? 74   LEU D O   1 
ATOM   2310 C CB  . LEU D 1 74 ? 14.169  9.673   74.243 1.00 38.36  ? 74   LEU D CB  1 
ATOM   2311 C CG  . LEU D 1 74 ? 13.744  8.403   73.432 1.00 88.13  ? 74   LEU D CG  1 
ATOM   2312 C CD1 . LEU D 1 74 ? 13.200  8.675   71.983 1.00 65.29  ? 74   LEU D CD1 1 
ATOM   2313 C CD2 . LEU D 1 74 ? 14.847  7.301   73.398 1.00 41.08  ? 74   LEU D CD2 1 
ATOM   2314 N N   . SER D 1 75 ? 10.727  10.449  74.210 1.00 57.05  ? 75   SER D N   1 
ATOM   2315 C CA  . SER D 1 75 ? 9.477   9.831   74.634 1.00 63.89  ? 75   SER D CA  1 
ATOM   2316 C C   . SER D 1 75 ? 9.494   8.290   74.495 1.00 38.78  ? 75   SER D C   1 
ATOM   2317 O O   . SER D 1 75 ? 10.376  7.716   73.877 1.00 72.88  ? 75   SER D O   1 
ATOM   2318 C CB  . SER D 1 75 ? 8.341   10.407  73.810 1.00 44.40  ? 75   SER D CB  1 
ATOM   2319 O OG  . SER D 1 75 ? 8.119   9.619   72.656 1.00 69.05  ? 75   SER D OG  1 
ATOM   2320 N N   . SER D 1 76 ? 8.519   7.622   75.088 1.00 63.31  ? 76   SER D N   1 
ATOM   2321 C CA  . SER D 1 76 ? 8.395   6.169   74.956 1.00 76.05  ? 76   SER D CA  1 
ATOM   2322 C C   . SER D 1 76 ? 7.480   5.789   73.775 1.00 55.92  ? 76   SER D C   1 
ATOM   2323 O O   . SER D 1 76 ? 7.206   4.619   73.522 1.00 66.50  ? 76   SER D O   1 
ATOM   2324 C CB  . SER D 1 76 ? 7.713   5.635   76.186 1.00 52.41  ? 76   SER D CB  1 
ATOM   2325 O OG  . SER D 1 76 ? 6.403   6.198   76.135 1.00 45.54  ? 76   SER D OG  1 
ATOM   2326 N N   . ASP D 1 77 ? 6.944   6.750   73.057 1.00 49.30  ? 77   ASP D N   1 
ATOM   2327 C CA  . ASP D 1 77 ? 6.422   6.351   71.755 1.00 73.13  ? 77   ASP D CA  1 
ATOM   2328 C C   . ASP D 1 77 ? 7.444   6.648   70.592 1.00 71.39  ? 77   ASP D C   1 
ATOM   2329 O O   . ASP D 1 77 ? 7.068   6.915   69.438 1.00 95.17  ? 77   ASP D O   1 
ATOM   2330 C CB  . ASP D 1 77 ? 4.994   6.891   71.530 1.00 74.50  ? 77   ASP D CB  1 
ATOM   2331 C CG  . ASP D 1 77 ? 4.843   8.369   71.929 1.00 123.37 ? 77   ASP D CG  1 
ATOM   2332 O OD1 . ASP D 1 77 ? 5.778   9.184   71.698 1.00 109.42 ? 77   ASP D OD1 1 
ATOM   2333 O OD2 . ASP D 1 77 ? 3.771   8.714   72.473 1.00 112.27 ? 77   ASP D OD2 1 
ATOM   2334 N N   . GLY D 1 78 ? 8.741   6.557   70.916 1.00 60.78  ? 78   GLY D N   1 
ATOM   2335 C CA  . GLY D 1 78 ? 9.799   6.626   69.928 1.00 65.61  ? 78   GLY D CA  1 
ATOM   2336 C C   . GLY D 1 78 ? 10.107  7.969   69.312 1.00 68.57  ? 78   GLY D C   1 
ATOM   2337 O O   . GLY D 1 78 ? 10.921  8.023   68.408 1.00 63.06  ? 78   GLY D O   1 
ATOM   2338 N N   . VAL D 1 79 ? 9.477   9.040   69.777 1.00 49.24  ? 79   VAL D N   1 
ATOM   2339 C CA  . VAL D 1 79 ? 9.910   10.384  69.403 1.00 48.03  ? 79   VAL D CA  1 
ATOM   2340 C C   . VAL D 1 79 ? 11.129  10.953  70.171 1.00 49.54  ? 79   VAL D C   1 
ATOM   2341 O O   . VAL D 1 79 ? 11.187  10.972  71.402 1.00 73.28  ? 79   VAL D O   1 
ATOM   2342 C CB  . VAL D 1 79 ? 8.749   11.356  69.488 1.00 54.69  ? 79   VAL D CB  1 
ATOM   2343 C CG1 . VAL D 1 79 ? 9.142   12.697  69.006 1.00 44.74  ? 79   VAL D CG1 1 
ATOM   2344 C CG2 . VAL D 1 79 ? 7.638   10.847  68.649 1.00 38.33  ? 79   VAL D CG2 1 
ATOM   2345 N N   . LEU D 1 80 ? 12.110  11.407  69.413 1.00 57.22  ? 80   LEU D N   1 
ATOM   2346 C CA  . LEU D 1 80 ? 13.279  12.073  69.954 1.00 49.94  ? 80   LEU D CA  1 
ATOM   2347 C C   . LEU D 1 80 ? 13.130  13.554  69.741 1.00 56.10  ? 80   LEU D C   1 
ATOM   2348 O O   . LEU D 1 80 ? 12.785  14.006  68.649 1.00 66.37  ? 80   LEU D O   1 
ATOM   2349 C CB  . LEU D 1 80 ? 14.504  11.633  69.200 1.00 50.41  ? 80   LEU D CB  1 
ATOM   2350 C CG  . LEU D 1 80 ? 15.746  12.267  69.757 1.00 66.39  ? 80   LEU D CG  1 
ATOM   2351 C CD1 . LEU D 1 80 ? 15.757  12.120  71.294 1.00 47.64  ? 80   LEU D CD1 1 
ATOM   2352 C CD2 . LEU D 1 80 ? 16.919  11.576  69.073 1.00 44.92  ? 80   LEU D CD2 1 
ATOM   2353 N N   . THR D 1 81 ? 13.409  14.325  70.776 1.00 62.59  ? 81   THR D N   1 
ATOM   2354 C CA  . THR D 1 81 ? 13.224  15.765  70.705 1.00 62.20  ? 81   THR D CA  1 
ATOM   2355 C C   . THR D 1 81 ? 14.494  16.472  71.098 1.00 73.39  ? 81   THR D C   1 
ATOM   2356 O O   . THR D 1 81 ? 15.218  16.014  71.975 1.00 65.35  ? 81   THR D O   1 
ATOM   2357 C CB  . THR D 1 81 ? 12.167  16.250  71.657 1.00 67.81  ? 81   THR D CB  1 
ATOM   2358 O OG1 . THR D 1 81 ? 10.875  15.873  71.166 1.00 83.54  ? 81   THR D OG1 1 
ATOM   2359 C CG2 . THR D 1 81 ? 12.226  17.740  71.705 1.00 66.89  ? 81   THR D CG2 1 
ATOM   2360 N N   . VAL D 1 82 ? 14.769  17.577  70.418 1.00 72.03  ? 82   VAL D N   1 
ATOM   2361 C CA  . VAL D 1 82 ? 15.880  18.429  70.768 1.00 55.57  ? 82   VAL D CA  1 
ATOM   2362 C C   . VAL D 1 82 ? 15.326  19.842  70.761 1.00 69.07  ? 82   VAL D C   1 
ATOM   2363 O O   . VAL D 1 82 ? 14.547  20.218  69.866 1.00 68.52  ? 82   VAL D O   1 
ATOM   2364 C CB  . VAL D 1 82 ? 17.012  18.278  69.773 1.00 54.35  ? 82   VAL D CB  1 
ATOM   2365 C CG1 . VAL D 1 82 ? 18.154  19.182  70.136 1.00 61.92  ? 82   VAL D CG1 1 
ATOM   2366 C CG2 . VAL D 1 82 ? 17.487  16.789  69.713 1.00 56.48  ? 82   VAL D CG2 1 
ATOM   2367 N N   . ASN D 1 83 ? 15.672  20.604  71.804 1.00 82.64  ? 83   ASN D N   1 
ATOM   2368 C CA  . ASN D 1 83 ? 15.247  22.015  71.922 1.00 69.46  ? 83   ASN D CA  1 
ATOM   2369 C C   . ASN D 1 83 ? 16.241  22.903  72.698 1.00 82.55  ? 83   ASN D C   1 
ATOM   2370 O O   . ASN D 1 83 ? 17.221  22.383  73.284 1.00 65.33  ? 83   ASN D O   1 
ATOM   2371 C CB  . ASN D 1 83 ? 13.816  22.144  72.465 1.00 75.73  ? 83   ASN D CB  1 
ATOM   2372 C CG  . ASN D 1 83 ? 13.429  21.001  73.438 1.00 101.73 ? 83   ASN D CG  1 
ATOM   2373 O OD1 . ASN D 1 83 ? 14.254  20.519  74.255 1.00 76.49  ? 83   ASN D OD1 1 
ATOM   2374 N ND2 . ASN D 1 83 ? 12.157  20.566  73.350 1.00 95.71  ? 83   ASN D ND2 1 
ATOM   2375 N N   . GLY D 1 84 ? 16.041  24.231  72.629 1.00 77.27  ? 84   GLY D N   1 
ATOM   2376 C CA  . GLY D 1 84 ? 16.951  25.175  73.279 1.00 114.70 ? 84   GLY D CA  1 
ATOM   2377 C C   . GLY D 1 84 ? 16.430  26.576  73.589 1.00 124.51 ? 84   GLY D C   1 
ATOM   2378 O O   . GLY D 1 84 ? 17.048  27.337  74.354 1.00 102.55 ? 84   GLY D O   1 
ATOM   2379 N N   . PHE E 1 12 ? -1.842  13.983  85.052 1.00 63.08  ? 12   PHE E N   1 
ATOM   2380 C CA  . PHE E 1 12 ? -0.879  13.754  86.147 1.00 78.30  ? 12   PHE E CA  1 
ATOM   2381 C C   . PHE E 1 12 ? 0.547   13.540  85.633 1.00 74.95  ? 12   PHE E C   1 
ATOM   2382 O O   . PHE E 1 12 ? 0.767   13.225  84.460 1.00 97.12  ? 12   PHE E O   1 
ATOM   2383 C CB  . PHE E 1 12 ? -1.319  12.593  87.095 1.00 81.30  ? 12   PHE E CB  1 
ATOM   2384 C CG  . PHE E 1 12 ? -0.923  11.204  86.620 1.00 66.80  ? 12   PHE E CG  1 
ATOM   2385 C CD1 . PHE E 1 12 ? 0.342   10.674  86.907 1.00 79.78  ? 12   PHE E CD1 1 
ATOM   2386 C CD2 . PHE E 1 12 ? -1.835  10.435  85.894 1.00 88.42  ? 12   PHE E CD2 1 
ATOM   2387 C CE1 . PHE E 1 12 ? 0.696   9.404   86.472 1.00 86.27  ? 12   PHE E CE1 1 
ATOM   2388 C CE2 . PHE E 1 12 ? -1.497  9.172   85.437 1.00 84.96  ? 12   PHE E CE2 1 
ATOM   2389 C CZ  . PHE E 1 12 ? -0.225  8.648   85.727 1.00 119.41 ? 12   PHE E CZ  1 
ATOM   2390 N N   . SER E 1 13 ? 1.516   13.726  86.516 1.00 67.03  ? 13   SER E N   1 
ATOM   2391 C CA  . SER E 1 13 ? 2.889   13.777  86.093 1.00 72.75  ? 13   SER E CA  1 
ATOM   2392 C C   . SER E 1 13 ? 3.729   13.483  87.278 1.00 60.28  ? 13   SER E C   1 
ATOM   2393 O O   . SER E 1 13 ? 3.503   14.040  88.340 1.00 77.00  ? 13   SER E O   1 
ATOM   2394 C CB  . SER E 1 13 ? 3.226   15.167  85.577 1.00 65.47  ? 13   SER E CB  1 
ATOM   2395 O OG  . SER E 1 13 ? 4.515   15.172  84.989 1.00 108.09 ? 13   SER E OG  1 
ATOM   2396 N N   . VAL E 1 14 ? 4.703   12.603  87.085 1.00 81.37  ? 14   VAL E N   1 
ATOM   2397 C CA  . VAL E 1 14 ? 5.657   12.246  88.120 1.00 75.19  ? 14   VAL E CA  1 
ATOM   2398 C C   . VAL E 1 14 ? 7.079   12.189  87.587 1.00 93.33  ? 14   VAL E C   1 
ATOM   2399 O O   . VAL E 1 14 ? 7.377   11.412  86.657 1.00 76.92  ? 14   VAL E O   1 
ATOM   2400 C CB  . VAL E 1 14 ? 5.310   10.919  88.722 1.00 58.39  ? 14   VAL E CB  1 
ATOM   2401 C CG1 . VAL E 1 14 ? 6.426   10.451  89.672 1.00 77.84  ? 14   VAL E CG1 1 
ATOM   2402 C CG2 . VAL E 1 14 ? 4.023   11.074  89.470 1.00 76.06  ? 14   VAL E CG2 1 
ATOM   2403 N N   . ASN E 1 15 ? 7.950   13.003  88.194 1.00 67.19  ? 15   ASN E N   1 
ATOM   2404 C CA  . ASN E 1 15 ? 9.331   13.128  87.727 1.00 82.99  ? 15   ASN E CA  1 
ATOM   2405 C C   . ASN E 1 15 ? 10.304  12.475  88.696 1.00 84.90  ? 15   ASN E C   1 
ATOM   2406 O O   . ASN E 1 15 ? 10.053  12.473  89.898 1.00 62.02  ? 15   ASN E O   1 
ATOM   2407 C CB  . ASN E 1 15 ? 9.697   14.603  87.464 1.00 67.52  ? 15   ASN E CB  1 
ATOM   2408 C CG  . ASN E 1 15 ? 9.009   15.168  86.216 1.00 96.55  ? 15   ASN E CG  1 
ATOM   2409 O OD1 . ASN E 1 15 ? 9.590   15.977  85.488 1.00 103.87 ? 15   ASN E OD1 1 
ATOM   2410 N ND2 . ASN E 1 15 ? 7.768   14.738  85.967 1.00 103.06 ? 15   ASN E ND2 1 
ATOM   2411 N N   . LEU E 1 16 ? 11.381  11.893  88.151 1.00 79.75  ? 16   LEU E N   1 
ATOM   2412 C CA  . LEU E 1 16 ? 12.469  11.281  88.938 1.00 60.37  ? 16   LEU E CA  1 
ATOM   2413 C C   . LEU E 1 16 ? 13.847  11.602  88.417 1.00 77.22  ? 16   LEU E C   1 
ATOM   2414 O O   . LEU E 1 16 ? 14.119  11.548  87.213 1.00 78.36  ? 16   LEU E O   1 
ATOM   2415 C CB  . LEU E 1 16 ? 12.436  9.770   88.915 1.00 65.06  ? 16   LEU E CB  1 
ATOM   2416 C CG  . LEU E 1 16 ? 11.332  9.034   89.621 1.00 81.87  ? 16   LEU E CG  1 
ATOM   2417 C CD1 . LEU E 1 16 ? 9.968   9.302   88.900 1.00 70.38  ? 16   LEU E CD1 1 
ATOM   2418 C CD2 . LEU E 1 16 ? 11.797  7.572   89.583 1.00 61.52  ? 16   LEU E CD2 1 
ATOM   2419 N N   . ASP E 1 17 ? 14.732  11.862  89.362 1.00 63.94  ? 17   ASP E N   1 
ATOM   2420 C CA  . ASP E 1 17 ? 16.103  12.116  89.059 1.00 72.73  ? 17   ASP E CA  1 
ATOM   2421 C C   . ASP E 1 17 ? 16.808  10.762  88.940 1.00 76.67  ? 17   ASP E C   1 
ATOM   2422 O O   . ASP E 1 17 ? 17.115  10.104  89.955 1.00 61.03  ? 17   ASP E O   1 
ATOM   2423 C CB  . ASP E 1 17 ? 16.732  13.045  90.104 1.00 58.75  ? 17   ASP E CB  1 
ATOM   2424 C CG  . ASP E 1 17 ? 18.196  13.188  89.894 1.00 97.59  ? 17   ASP E CG  1 
ATOM   2425 O OD1 . ASP E 1 17 ? 18.568  13.478  88.722 1.00 96.73  ? 17   ASP E OD1 1 
ATOM   2426 O OD2 . ASP E 1 17 ? 18.963  12.951  90.866 1.00 87.17  ? 17   ASP E OD2 1 
ATOM   2427 N N   . VAL E 1 18 ? 17.033  10.353  87.678 1.00 55.99  ? 18   VAL E N   1 
ATOM   2428 C CA  . VAL E 1 18 ? 17.670  9.065   87.372 1.00 74.40  ? 18   VAL E CA  1 
ATOM   2429 C C   . VAL E 1 18 ? 19.027  9.248   86.664 1.00 69.82  ? 18   VAL E C   1 
ATOM   2430 O O   . VAL E 1 18 ? 19.560  8.339   86.006 1.00 65.45  ? 18   VAL E O   1 
ATOM   2431 C CB  . VAL E 1 18 ? 16.721  8.170   86.562 1.00 54.59  ? 18   VAL E CB  1 
ATOM   2432 C CG1 . VAL E 1 18 ? 15.492  7.893   87.395 1.00 60.02  ? 18   VAL E CG1 1 
ATOM   2433 C CG2 . VAL E 1 18 ? 16.294  8.873   85.289 1.00 60.61  ? 18   VAL E CG2 1 
ATOM   2434 N N   . LYS E 1 19 ? 19.581  10.441  86.828 1.00 48.17  ? 19   LYS E N   1 
ATOM   2435 C CA  . LYS E 1 19 ? 20.866  10.792  86.260 1.00 55.94  ? 19   LYS E CA  1 
ATOM   2436 C C   . LYS E 1 19 ? 22.060  9.765   86.426 1.00 57.21  ? 19   LYS E C   1 
ATOM   2437 O O   . LYS E 1 19 ? 23.052  9.879   85.734 1.00 51.92  ? 19   LYS E O   1 
ATOM   2438 C CB  . LYS E 1 19 ? 21.225  12.221  86.723 1.00 49.61  ? 19   LYS E CB  1 
ATOM   2439 C CG  . LYS E 1 19 ? 21.743  12.286  88.181 1.00 79.57  ? 19   LYS E CG  1 
ATOM   2440 C CD  . LYS E 1 19 ? 21.888  13.731  88.753 1.00 89.53  ? 19   LYS E CD  1 
ATOM   2441 C CE  . LYS E 1 19 ? 22.393  13.741  90.253 1.00 60.05  ? 19   LYS E CE  1 
ATOM   2442 N NZ  . LYS E 1 19 ? 21.797  12.610  91.093 1.00 76.75  ? 19   LYS E NZ  1 
ATOM   2443 N N   . HIS E 1 20 ? 21.976  8.770   87.307 1.00 59.17  ? 20   HIS E N   1 
ATOM   2444 C CA  . HIS E 1 20 ? 23.148  7.891   87.565 1.00 63.87  ? 20   HIS E CA  1 
ATOM   2445 C C   . HIS E 1 20 ? 22.979  6.622   86.786 1.00 74.09  ? 20   HIS E C   1 
ATOM   2446 O O   . HIS E 1 20 ? 23.845  5.711   86.774 1.00 56.66  ? 20   HIS E O   1 
ATOM   2447 C CB  . HIS E 1 20 ? 23.227  7.488   89.053 1.00 70.57  ? 20   HIS E CB  1 
ATOM   2448 C CG  . HIS E 1 20 ? 23.687  8.589   89.935 1.00 75.15  ? 20   HIS E CG  1 
ATOM   2449 N ND1 . HIS E 1 20 ? 22.869  9.161   90.885 1.00 77.57  ? 20   HIS E ND1 1 
ATOM   2450 C CD2 . HIS E 1 20 ? 24.860  9.267   89.975 1.00 50.27  ? 20   HIS E CD2 1 
ATOM   2451 C CE1 . HIS E 1 20 ? 23.527  10.134  91.492 1.00 75.51  ? 20   HIS E CE1 1 
ATOM   2452 N NE2 . HIS E 1 20 ? 24.734  10.221  90.957 1.00 83.53  ? 20   HIS E NE2 1 
ATOM   2453 N N   . PHE E 1 21 ? 21.788  6.546   86.200 1.00 64.27  ? 21   PHE E N   1 
ATOM   2454 C CA  . PHE E 1 21 ? 21.387  5.382   85.409 1.00 77.85  ? 21   PHE E CA  1 
ATOM   2455 C C   . PHE E 1 21 ? 21.295  5.739   83.937 1.00 76.21  ? 21   PHE E C   1 
ATOM   2456 O O   . PHE E 1 21 ? 20.682  6.769   83.549 1.00 64.64  ? 21   PHE E O   1 
ATOM   2457 C CB  . PHE E 1 21 ? 20.061  4.796   85.890 1.00 58.99  ? 21   PHE E CB  1 
ATOM   2458 C CG  . PHE E 1 21 ? 20.063  4.491   87.349 1.00 67.42  ? 21   PHE E CG  1 
ATOM   2459 C CD1 . PHE E 1 21 ? 20.461  3.243   87.785 1.00 50.19  ? 21   PHE E CD1 1 
ATOM   2460 C CD2 . PHE E 1 21 ? 19.703  5.469   88.306 1.00 72.39  ? 21   PHE E CD2 1 
ATOM   2461 C CE1 . PHE E 1 21 ? 20.465  2.945   89.153 1.00 56.31  ? 21   PHE E CE1 1 
ATOM   2462 C CE2 . PHE E 1 21 ? 19.722  5.180   89.687 1.00 44.26  ? 21   PHE E CE2 1 
ATOM   2463 C CZ  . PHE E 1 21 ? 20.107  3.924   90.097 1.00 45.23  ? 21   PHE E CZ  1 
ATOM   2464 N N   . SER E 1 22 ? 21.934  4.886   83.132 1.00 56.86  ? 22   SER E N   1 
ATOM   2465 C CA  . SER E 1 22 ? 21.806  4.983   81.691 1.00 85.05  ? 22   SER E CA  1 
ATOM   2466 C C   . SER E 1 22 ? 20.496  4.268   81.266 1.00 72.89  ? 22   SER E C   1 
ATOM   2467 O O   . SER E 1 22 ? 19.991  3.423   81.995 1.00 71.68  ? 22   SER E O   1 
ATOM   2468 C CB  . SER E 1 22 ? 23.034  4.335   81.047 1.00 64.49  ? 22   SER E CB  1 
ATOM   2469 O OG  . SER E 1 22 ? 22.995  2.920   81.229 1.00 86.02  ? 22   SER E OG  1 
ATOM   2470 N N   . PRO E 1 23 ? 19.965  4.587   80.078 1.00 74.55  ? 23   PRO E N   1 
ATOM   2471 C CA  . PRO E 1 23 ? 18.622  4.150   79.664 1.00 60.10  ? 23   PRO E CA  1 
ATOM   2472 C C   . PRO E 1 23 ? 18.417  2.644   79.641 1.00 64.19  ? 23   PRO E C   1 
ATOM   2473 O O   . PRO E 1 23 ? 17.319  2.164   79.910 1.00 73.13  ? 23   PRO E O   1 
ATOM   2474 C CB  . PRO E 1 23 ? 18.477  4.759   78.272 1.00 83.25  ? 23   PRO E CB  1 
ATOM   2475 C CG  . PRO E 1 23 ? 19.389  5.978   78.293 1.00 64.28  ? 23   PRO E CG  1 
ATOM   2476 C CD  . PRO E 1 23 ? 20.576  5.499   79.096 1.00 80.92  ? 23   PRO E CD  1 
ATOM   2477 N N   . GLU E 1 24 ? 19.459  1.880   79.360 1.00 76.60  ? 24   GLU E N   1 
ATOM   2478 C CA  . GLU E 1 24 ? 19.323  0.417   79.440 1.00 75.64  ? 24   GLU E CA  1 
ATOM   2479 C C   . GLU E 1 24 ? 19.087  -0.077  80.853 1.00 71.78  ? 24   GLU E C   1 
ATOM   2480 O O   . GLU E 1 24 ? 18.639  -1.210  81.026 1.00 92.38  ? 24   GLU E O   1 
ATOM   2481 C CB  . GLU E 1 24 ? 20.551  -0.322  78.846 1.00 77.42  ? 24   GLU E CB  1 
ATOM   2482 C CG  . GLU E 1 24 ? 21.912  0.337   79.070 1.00 63.72  ? 24   GLU E CG  1 
ATOM   2483 C CD  . GLU E 1 24 ? 22.022  1.666   78.323 1.00 107.27 ? 24   GLU E CD  1 
ATOM   2484 O OE1 . GLU E 1 24 ? 21.396  1.806   77.242 1.00 85.07  ? 24   GLU E OE1 1 
ATOM   2485 O OE2 . GLU E 1 24 ? 22.735  2.575   78.806 1.00 125.41 ? 24   GLU E OE2 1 
ATOM   2486 N N   . GLU E 1 25 ? 19.417  0.761   81.847 1.00 78.47  ? 25   GLU E N   1 
ATOM   2487 C CA  . GLU E 1 25 ? 19.414  0.387   83.292 1.00 64.92  ? 25   GLU E CA  1 
ATOM   2488 C C   . GLU E 1 25 ? 18.109  0.762   84.039 1.00 60.85  ? 25   GLU E C   1 
ATOM   2489 O O   . GLU E 1 25 ? 17.954  0.588   85.246 1.00 62.48  ? 25   GLU E O   1 
ATOM   2490 C CB  . GLU E 1 25 ? 20.643  1.000   84.024 1.00 68.24  ? 25   GLU E CB  1 
ATOM   2491 C CG  . GLU E 1 25 ? 21.964  0.499   83.504 1.00 35.89  ? 25   GLU E CG  1 
ATOM   2492 C CD  . GLU E 1 25 ? 23.137  1.397   83.900 1.00 98.36  ? 25   GLU E CD  1 
ATOM   2493 O OE1 . GLU E 1 25 ? 22.884  2.640   84.050 1.00 58.74  ? 25   GLU E OE1 1 
ATOM   2494 O OE2 . GLU E 1 25 ? 24.292  0.845   84.041 1.00 53.70  ? 25   GLU E OE2 1 
ATOM   2495 N N   . LEU E 1 26 ? 17.179  1.285   83.288 1.00 66.43  ? 26   LEU E N   1 
ATOM   2496 C CA  . LEU E 1 26 ? 15.886  1.654   83.806 1.00 63.37  ? 26   LEU E CA  1 
ATOM   2497 C C   . LEU E 1 26 ? 14.794  0.752   83.154 1.00 55.98  ? 26   LEU E C   1 
ATOM   2498 O O   . LEU E 1 26 ? 14.930  0.328   82.006 1.00 89.23  ? 26   LEU E O   1 
ATOM   2499 C CB  . LEU E 1 26 ? 15.658  3.156   83.513 1.00 39.25  ? 26   LEU E CB  1 
ATOM   2500 C CG  . LEU E 1 26 ? 16.695  4.034   84.235 1.00 71.57  ? 26   LEU E CG  1 
ATOM   2501 C CD1 . LEU E 1 26 ? 16.747  5.468   83.682 1.00 71.43  ? 26   LEU E CD1 1 
ATOM   2502 C CD2 . LEU E 1 26 ? 16.402  4.053   85.739 1.00 64.28  ? 26   LEU E CD2 1 
ATOM   2503 N N   . LYS E 1 27 ? 13.748  0.427   83.909 1.00 65.59  ? 27   LYS E N   1 
ATOM   2504 C CA  . LYS E 1 27 ? 12.558  -0.250  83.378 1.00 75.68  ? 27   LYS E CA  1 
ATOM   2505 C C   . LYS E 1 27 ? 11.314  0.330   84.050 1.00 68.78  ? 27   LYS E C   1 
ATOM   2506 O O   . LYS E 1 27 ? 11.237  0.361   85.272 1.00 67.55  ? 27   LYS E O   1 
ATOM   2507 C CB  . LYS E 1 27 ? 12.599  -1.803  83.546 1.00 47.87  ? 27   LYS E CB  1 
ATOM   2508 C CG  . LYS E 1 27 ? 13.793  -2.430  84.334 1.00 70.21  ? 27   LYS E CG  1 
ATOM   2509 C CD  . LYS E 1 27 ? 14.827  -3.187  83.459 1.00 95.93  ? 27   LYS E CD  1 
ATOM   2510 C CE  . LYS E 1 27 ? 15.504  -4.365  84.232 1.00 68.50  ? 27   LYS E CE  1 
ATOM   2511 N NZ  . LYS E 1 27 ? 16.485  -3.969  85.309 1.00 77.48  ? 27   LYS E NZ  1 
ATOM   2512 N N   . VAL E 1 28 ? 10.370  0.806   83.238 1.00 70.71  ? 28   VAL E N   1 
ATOM   2513 C CA  . VAL E 1 28 ? 9.019   1.193   83.675 1.00 62.49  ? 28   VAL E CA  1 
ATOM   2514 C C   . VAL E 1 28 ? 7.952   0.123   83.230 1.00 65.30  ? 28   VAL E C   1 
ATOM   2515 O O   . VAL E 1 28 ? 7.918   -0.313  82.073 1.00 99.17  ? 28   VAL E O   1 
ATOM   2516 C CB  . VAL E 1 28 ? 8.683   2.621   83.156 1.00 39.91  ? 28   VAL E CB  1 
ATOM   2517 C CG1 . VAL E 1 28 ? 7.369   3.129   83.731 1.00 64.25  ? 28   VAL E CG1 1 
ATOM   2518 C CG2 . VAL E 1 28 ? 9.794   3.544   83.524 1.00 51.30  ? 28   VAL E CG2 1 
ATOM   2519 N N   . LYS E 1 29 ? 7.124   -0.325  84.159 1.00 70.24  ? 29   LYS E N   1 
ATOM   2520 C CA  . LYS E 1 29 ? 6.066   -1.303  83.893 1.00 62.97  ? 29   LYS E CA  1 
ATOM   2521 C C   . LYS E 1 29 ? 4.833   -0.770  84.575 1.00 79.32  ? 29   LYS E C   1 
ATOM   2522 O O   . LYS E 1 29 ? 4.889   -0.376  85.738 1.00 83.61  ? 29   LYS E O   1 
ATOM   2523 C CB  . LYS E 1 29 ? 6.381   -2.687  84.517 1.00 69.45  ? 29   LYS E CB  1 
ATOM   2524 C CG  . LYS E 1 29 ? 7.378   -3.532  83.678 1.00 81.11  ? 29   LYS E CG  1 
ATOM   2525 C CD  . LYS E 1 29 ? 8.080   -4.679  84.416 1.00 83.65  ? 29   LYS E CD  1 
ATOM   2526 C CE  . LYS E 1 29 ? 9.112   -4.193  85.412 1.00 91.23  ? 29   LYS E CE  1 
ATOM   2527 N NZ  . LYS E 1 29 ? 8.441   -3.512  86.539 1.00 81.71  ? 29   LYS E NZ  1 
ATOM   2528 N N   . VAL E 1 30 ? 3.723   -0.717  83.861 1.00 71.26  ? 30   VAL E N   1 
ATOM   2529 C CA  . VAL E 1 30 ? 2.437   -0.683  84.539 1.00 80.43  ? 30   VAL E CA  1 
ATOM   2530 C C   . VAL E 1 30 ? 1.971   -2.143  84.817 1.00 103.09 ? 30   VAL E C   1 
ATOM   2531 O O   . VAL E 1 30 ? 1.647   -2.911  83.900 1.00 108.15 ? 30   VAL E O   1 
ATOM   2532 C CB  . VAL E 1 30 ? 1.380   0.069   83.723 1.00 52.52  ? 30   VAL E CB  1 
ATOM   2533 C CG1 . VAL E 1 30 ? 0.054   0.098   84.503 1.00 71.17  ? 30   VAL E CG1 1 
ATOM   2534 C CG2 . VAL E 1 30 ? 1.866   1.471   83.396 1.00 46.25  ? 30   VAL E CG2 1 
ATOM   2535 N N   . LEU E 1 31 ? 1.990   -2.535  86.083 1.00 104.20 ? 31   LEU E N   1 
ATOM   2536 C CA  . LEU E 1 31 ? 1.425   -3.802  86.505 1.00 76.91  ? 31   LEU E CA  1 
ATOM   2537 C C   . LEU E 1 31 ? 0.115   -3.442  87.237 1.00 106.71 ? 31   LEU E C   1 
ATOM   2538 O O   . LEU E 1 31 ? 0.125   -3.119  88.435 1.00 105.09 ? 31   LEU E O   1 
ATOM   2539 C CB  . LEU E 1 31 ? 2.419   -4.543  87.414 1.00 61.63  ? 31   LEU E CB  1 
ATOM   2540 N N   . GLY E 1 32 ? -0.996  -3.427  86.498 1.00 103.92 ? 32   GLY E N   1 
ATOM   2541 C CA  . GLY E 1 32 ? -2.304  -3.165  87.072 1.00 80.72  ? 32   GLY E CA  1 
ATOM   2542 C C   . GLY E 1 32 ? -2.518  -1.706  87.358 1.00 85.26  ? 32   GLY E C   1 
ATOM   2543 O O   . GLY E 1 32 ? -2.544  -0.865  86.458 1.00 89.35  ? 32   GLY E O   1 
ATOM   2544 N N   . ASP E 1 33 ? -2.629  -1.421  88.640 1.00 85.82  ? 33   ASP E N   1 
ATOM   2545 C CA  . ASP E 1 33 ? -2.984  -0.112  89.145 1.00 120.55 ? 33   ASP E CA  1 
ATOM   2546 C C   . ASP E 1 33 ? -1.722  0.705   89.313 1.00 112.94 ? 33   ASP E C   1 
ATOM   2547 O O   . ASP E 1 33 ? -1.762  1.938   89.374 1.00 87.79  ? 33   ASP E O   1 
ATOM   2548 C CB  . ASP E 1 33 ? -3.667  -0.292  90.512 1.00 162.19 ? 33   ASP E CB  1 
ATOM   2549 C CG  . ASP E 1 33 ? -3.007  -1.399  91.385 1.00 149.23 ? 33   ASP E CG  1 
ATOM   2550 O OD1 . ASP E 1 33 ? -2.078  -2.119  90.913 1.00 89.38  ? 33   ASP E OD1 1 
ATOM   2551 O OD2 . ASP E 1 33 ? -3.432  -1.544  92.559 1.00 147.02 ? 33   ASP E OD2 1 
ATOM   2552 N N   . VAL E 1 34 ? -0.607  -0.024  89.359 1.00 83.58  ? 34   VAL E N   1 
ATOM   2553 C CA  . VAL E 1 34 ? 0.640   0.449   89.921 1.00 88.01  ? 34   VAL E CA  1 
ATOM   2554 C C   . VAL E 1 34 ? 1.676   0.728   88.855 1.00 87.31  ? 34   VAL E C   1 
ATOM   2555 O O   . VAL E 1 34 ? 1.946   -0.126  88.008 1.00 95.57  ? 34   VAL E O   1 
ATOM   2556 C CB  . VAL E 1 34 ? 1.254   -0.624  90.843 1.00 63.32  ? 34   VAL E CB  1 
ATOM   2557 C CG1 . VAL E 1 34 ? 2.483   -0.071  91.551 1.00 66.03  ? 34   VAL E CG1 1 
ATOM   2558 C CG2 . VAL E 1 34 ? 0.243   -1.103  91.841 1.00 66.84  ? 34   VAL E CG2 1 
ATOM   2559 N N   . ILE E 1 35 ? 2.281   1.910   88.927 1.00 61.04  ? 35   ILE E N   1 
ATOM   2560 C CA  . ILE E 1 35 ? 3.536   2.147   88.221 1.00 79.57  ? 35   ILE E CA  1 
ATOM   2561 C C   . ILE E 1 35 ? 4.799   1.589   88.958 1.00 64.77  ? 35   ILE E C   1 
ATOM   2562 O O   . ILE E 1 35 ? 5.134   2.044   90.054 1.00 83.46  ? 35   ILE E O   1 
ATOM   2563 C CB  . ILE E 1 35 ? 3.719   3.669   87.927 1.00 53.66  ? 35   ILE E CB  1 
ATOM   2564 C CG1 . ILE E 1 35 ? 2.610   4.187   87.022 1.00 74.74  ? 35   ILE E CG1 1 
ATOM   2565 C CG2 . ILE E 1 35 ? 5.061   3.895   87.286 1.00 69.84  ? 35   ILE E CG2 1 
ATOM   2566 C CD1 . ILE E 1 35 ? 2.344   5.704   87.167 1.00 61.53  ? 35   ILE E CD1 1 
ATOM   2567 N N   . GLU E 1 36 ? 5.518   0.643   88.363 1.00 56.89  ? 36   GLU E N   1 
ATOM   2568 C CA  . GLU E 1 36 ? 6.844   0.307   88.904 1.00 66.45  ? 36   GLU E CA  1 
ATOM   2569 C C   . GLU E 1 36 ? 7.997   0.911   88.080 1.00 79.68  ? 36   GLU E C   1 
ATOM   2570 O O   . GLU E 1 36 ? 8.033   0.774   86.870 1.00 78.09  ? 36   GLU E O   1 
ATOM   2571 C CB  . GLU E 1 36 ? 7.054   -1.195  88.974 1.00 73.04  ? 36   GLU E CB  1 
ATOM   2572 C CG  . GLU E 1 36 ? 5.878   -1.977  89.517 1.00 84.49  ? 36   GLU E CG  1 
ATOM   2573 C CD  . GLU E 1 36 ? 6.161   -3.473  89.528 1.00 121.38 ? 36   GLU E CD  1 
ATOM   2574 O OE1 . GLU E 1 36 ? 7.342   -3.873  89.304 1.00 90.74  ? 36   GLU E OE1 1 
ATOM   2575 O OE2 . GLU E 1 36 ? 5.198   -4.242  89.772 1.00 147.41 ? 36   GLU E OE2 1 
ATOM   2576 N N   . VAL E 1 37 ? 8.931   1.581   88.750 1.00 76.17  ? 37   VAL E N   1 
ATOM   2577 C CA  . VAL E 1 37 ? 10.179  2.011   88.133 1.00 54.17  ? 37   VAL E CA  1 
ATOM   2578 C C   . VAL E 1 37 ? 11.320  1.202   88.769 1.00 63.75  ? 37   VAL E C   1 
ATOM   2579 O O   . VAL E 1 37 ? 11.492  1.171   89.978 1.00 58.29  ? 37   VAL E O   1 
ATOM   2580 C CB  . VAL E 1 37 ? 10.484  3.520   88.324 1.00 44.73  ? 37   VAL E CB  1 
ATOM   2581 C CG1 . VAL E 1 37 ? 11.762  3.851   87.607 1.00 47.99  ? 37   VAL E CG1 1 
ATOM   2582 C CG2 . VAL E 1 37 ? 9.363   4.408   87.799 1.00 29.54  ? 37   VAL E CG2 1 
ATOM   2583 N N   . HIS E 1 38 ? 12.101  0.524   87.959 1.00 52.32  ? 38   HIS E N   1 
ATOM   2584 C CA  . HIS E 1 38 ? 13.206  -0.191  88.537 1.00 61.40  ? 38   HIS E CA  1 
ATOM   2585 C C   . HIS E 1 38 ? 14.464  0.357   87.919 1.00 78.53  ? 38   HIS E C   1 
ATOM   2586 O O   . HIS E 1 38 ? 14.449  0.722   86.735 1.00 79.28  ? 38   HIS E O   1 
ATOM   2587 C CB  . HIS E 1 38 ? 13.095  -1.678  88.269 1.00 57.23  ? 38   HIS E CB  1 
ATOM   2588 C CG  . HIS E 1 38 ? 14.278  -2.452  88.752 1.00 65.81  ? 38   HIS E CG  1 
ATOM   2589 N ND1 . HIS E 1 38 ? 14.519  -2.668  90.086 1.00 77.69  ? 38   HIS E ND1 1 
ATOM   2590 C CD2 . HIS E 1 38 ? 15.284  -3.062  88.083 1.00 76.68  ? 38   HIS E CD2 1 
ATOM   2591 C CE1 . HIS E 1 38 ? 15.624  -3.380  90.225 1.00 72.33  ? 38   HIS E CE1 1 
ATOM   2592 N NE2 . HIS E 1 38 ? 16.104  -3.639  89.027 1.00 75.03  ? 38   HIS E NE2 1 
ATOM   2593 N N   . GLY E 1 39 ? 15.532  0.426   88.723 1.00 68.17  ? 39   GLY E N   1 
ATOM   2594 C CA  . GLY E 1 39 ? 16.774  1.085   88.345 1.00 41.90  ? 39   GLY E CA  1 
ATOM   2595 C C   . GLY E 1 39 ? 17.862  0.245   88.955 1.00 64.54  ? 39   GLY E C   1 
ATOM   2596 O O   . GLY E 1 39 ? 17.812  -0.141  90.125 1.00 64.89  ? 39   GLY E O   1 
ATOM   2597 N N   . LYS E 1 40 ? 18.841  -0.088  88.149 1.00 60.62  ? 40   LYS E N   1 
ATOM   2598 C CA  . LYS E 1 40 ? 19.991  -0.799  88.685 1.00 94.09  ? 40   LYS E CA  1 
ATOM   2599 C C   . LYS E 1 40 ? 21.248  -0.397  87.897 1.00 112.08 ? 40   LYS E C   1 
ATOM   2600 O O   . LYS E 1 40 ? 21.191  0.268   86.832 1.00 107.72 ? 40   LYS E O   1 
ATOM   2601 C CB  . LYS E 1 40 ? 19.747  -2.332  88.756 1.00 64.35  ? 40   LYS E CB  1 
ATOM   2602 C CG  . LYS E 1 40 ? 20.934  -3.186  89.186 1.00 88.71  ? 40   LYS E CG  1 
ATOM   2603 C CD  . LYS E 1 40 ? 20.598  -4.666  89.213 1.00 56.95  ? 40   LYS E CD  1 
ATOM   2604 C CE  . LYS E 1 40 ? 21.501  -5.376  90.207 1.00 63.99  ? 40   LYS E CE  1 
ATOM   2605 N NZ  . LYS E 1 40 ? 20.899  -6.682  90.629 1.00 59.65  ? 40   LYS E NZ  1 
ATOM   2606 N N   . HIS E 1 41 ? 22.387  -0.734  88.478 1.00 59.00  ? 41   HIS E N   1 
ATOM   2607 C CA  . HIS E 1 41 ? 23.659  -0.515  87.802 1.00 77.99  ? 41   HIS E CA  1 
ATOM   2608 C C   . HIS E 1 41 ? 24.828  -1.154  88.564 1.00 74.49  ? 41   HIS E C   1 
ATOM   2609 O O   . HIS E 1 41 ? 24.997  -0.954  89.778 1.00 71.59  ? 41   HIS E O   1 
ATOM   2610 C CB  . HIS E 1 41 ? 23.866  0.958   87.444 1.00 48.74  ? 41   HIS E CB  1 
ATOM   2611 C CG  . HIS E 1 41 ? 24.735  1.715   88.398 1.00 54.47  ? 41   HIS E CG  1 
ATOM   2612 N ND1 . HIS E 1 41 ? 24.380  2.961   88.876 1.00 64.41  ? 41   HIS E ND1 1 
ATOM   2613 C CD2 . HIS E 1 41 ? 25.953  1.436   88.922 1.00 42.19  ? 41   HIS E CD2 1 
ATOM   2614 C CE1 . HIS E 1 41 ? 25.343  3.414   89.661 1.00 52.47  ? 41   HIS E CE1 1 
ATOM   2615 N NE2 . HIS E 1 41 ? 26.307  2.509   89.708 1.00 63.42  ? 41   HIS E NE2 1 
ATOM   2616 N N   . GLU E 1 42 ? 25.569  -1.986  87.827 1.00 71.63  ? 42   GLU E N   1 
ATOM   2617 C CA  . GLU E 1 42 ? 26.636  -2.796  88.369 1.00 76.96  ? 42   GLU E CA  1 
ATOM   2618 C C   . GLU E 1 42 ? 27.793  -1.879  88.830 1.00 74.86  ? 42   GLU E C   1 
ATOM   2619 O O   . GLU E 1 42 ? 27.811  -0.648  88.547 1.00 55.36  ? 42   GLU E O   1 
ATOM   2620 C CB  . GLU E 1 42 ? 27.084  -3.797  87.294 1.00 66.58  ? 42   GLU E CB  1 
ATOM   2621 C CG  . GLU E 1 42 ? 25.960  -4.510  86.636 1.00 117.13 ? 42   GLU E CG  1 
ATOM   2622 C CD  . GLU E 1 42 ? 25.440  -5.593  87.526 1.00 159.88 ? 42   GLU E CD  1 
ATOM   2623 O OE1 . GLU E 1 42 ? 24.279  -5.479  87.972 1.00 154.31 ? 42   GLU E OE1 1 
ATOM   2624 O OE2 . GLU E 1 42 ? 26.216  -6.539  87.803 1.00 160.22 ? 42   GLU E OE2 1 
ATOM   2625 N N   . GLU E 1 43 ? 28.744  -2.459  89.561 1.00 56.98  ? 43   GLU E N   1 
ATOM   2626 C CA  . GLU E 1 43 ? 29.852  -1.638  90.037 1.00 77.22  ? 43   GLU E CA  1 
ATOM   2627 C C   . GLU E 1 43 ? 30.525  -0.851  88.882 1.00 75.83  ? 43   GLU E C   1 
ATOM   2628 O O   . GLU E 1 43 ? 30.627  -1.338  87.743 1.00 64.35  ? 43   GLU E O   1 
ATOM   2629 C CB  . GLU E 1 43 ? 30.875  -2.508  90.764 1.00 59.67  ? 43   GLU E CB  1 
ATOM   2630 C CG  . GLU E 1 43 ? 31.831  -1.718  91.643 1.00 103.19 ? 43   GLU E CG  1 
ATOM   2631 C CD  . GLU E 1 43 ? 32.708  -2.627  92.481 1.00 107.16 ? 43   GLU E CD  1 
ATOM   2632 O OE1 . GLU E 1 43 ? 32.800  -3.840  92.161 1.00 73.30  ? 43   GLU E OE1 1 
ATOM   2633 O OE2 . GLU E 1 43 ? 33.295  -2.123  93.466 1.00 129.08 ? 43   GLU E OE2 1 
ATOM   2634 N N   . ARG E 1 44 ? 31.012  0.350   89.177 1.00 75.35  ? 44   ARG E N   1 
ATOM   2635 C CA  . ARG E 1 44 ? 31.502  1.225   88.120 1.00 69.16  ? 44   ARG E CA  1 
ATOM   2636 C C   . ARG E 1 44 ? 32.230  2.381   88.810 1.00 63.58  ? 44   ARG E C   1 
ATOM   2637 O O   . ARG E 1 44 ? 31.798  2.831   89.862 1.00 80.06  ? 44   ARG E O   1 
ATOM   2638 C CB  . ARG E 1 44 ? 30.315  1.721   87.229 1.00 31.42  ? 44   ARG E CB  1 
ATOM   2639 C CG  . ARG E 1 44 ? 30.461  3.188   86.819 1.00 56.21  ? 44   ARG E CG  1 
ATOM   2640 C CD  . ARG E 1 44 ? 29.204  3.991   86.938 1.00 62.62  ? 44   ARG E CD  1 
ATOM   2641 N NE  . ARG E 1 44 ? 28.073  3.386   86.222 1.00 66.12  ? 44   ARG E NE  1 
ATOM   2642 C CZ  . ARG E 1 44 ? 26.870  3.981   86.110 1.00 120.66 ? 44   ARG E CZ  1 
ATOM   2643 N NH1 . ARG E 1 44 ? 26.643  5.206   86.677 1.00 62.07  ? 44   ARG E NH1 1 
ATOM   2644 N NH2 . ARG E 1 44 ? 25.886  3.361   85.434 1.00 67.41  ? 44   ARG E NH2 1 
ATOM   2645 N N   . GLN E 1 45 ? 33.296  2.892   88.201 1.00 87.99  ? 45   GLN E N   1 
ATOM   2646 C CA  . GLN E 1 45 ? 34.020  4.053   88.740 1.00 76.61  ? 45   GLN E CA  1 
ATOM   2647 C C   . GLN E 1 45 ? 33.277  5.429   88.653 1.00 95.28  ? 45   GLN E C   1 
ATOM   2648 O O   . GLN E 1 45 ? 32.148  5.506   88.132 1.00 92.42  ? 45   GLN E O   1 
ATOM   2649 C CB  . GLN E 1 45 ? 35.396  4.068   88.102 1.00 64.53  ? 45   GLN E CB  1 
ATOM   2650 C CG  . GLN E 1 45 ? 35.802  2.622   87.658 1.00 92.45  ? 45   GLN E CG  1 
ATOM   2651 C CD  . GLN E 1 45 ? 37.332  2.373   87.479 1.00 159.97 ? 45   GLN E CD  1 
ATOM   2652 O OE1 . GLN E 1 45 ? 38.189  3.124   87.981 1.00 107.46 ? 45   GLN E OE1 1 
ATOM   2653 N NE2 . GLN E 1 45 ? 37.662  1.286   86.768 1.00 146.01 ? 45   GLN E NE2 1 
ATOM   2654 N N   . ASP E 1 46 ? 33.878  6.500   89.190 1.00 77.20  ? 46   ASP E N   1 
ATOM   2655 C CA  . ASP E 1 46 ? 33.183  7.810   89.239 1.00 104.35 ? 46   ASP E CA  1 
ATOM   2656 C C   . ASP E 1 46 ? 34.098  8.987   89.606 1.00 110.81 ? 46   ASP E C   1 
ATOM   2657 O O   . ASP E 1 46 ? 33.648  10.135  89.712 1.00 99.55  ? 46   ASP E O   1 
ATOM   2658 C CB  . ASP E 1 46 ? 31.962  7.768   90.179 1.00 79.89  ? 46   ASP E CB  1 
ATOM   2659 C CG  . ASP E 1 46 ? 32.289  7.156   91.535 1.00 119.63 ? 46   ASP E CG  1 
ATOM   2660 O OD1 . ASP E 1 46 ? 31.938  5.954   91.763 1.00 73.53  ? 46   ASP E OD1 1 
ATOM   2661 O OD2 . ASP E 1 46 ? 32.920  7.875   92.357 1.00 102.36 ? 46   ASP E OD2 1 
ATOM   2662 N N   . GLU E 1 47 ? 35.385  8.684   89.748 1.00 91.47  ? 47   GLU E N   1 
ATOM   2663 C CA  . GLU E 1 47 ? 36.369  9.599   90.322 1.00 126.61 ? 47   GLU E CA  1 
ATOM   2664 C C   . GLU E 1 47 ? 36.520  9.202   91.772 1.00 143.41 ? 47   GLU E C   1 
ATOM   2665 O O   . GLU E 1 47 ? 37.575  8.690   92.165 1.00 129.26 ? 47   GLU E O   1 
ATOM   2666 C CB  . GLU E 1 47 ? 35.968  11.077  90.209 1.00 106.67 ? 47   GLU E CB  1 
ATOM   2667 N N   . HIS E 1 48 ? 35.456  9.405   92.556 1.00 121.55 ? 48   HIS E N   1 
ATOM   2668 C CA  . HIS E 1 48 ? 35.494  9.092   93.981 1.00 60.91  ? 48   HIS E CA  1 
ATOM   2669 C C   . HIS E 1 48 ? 36.053  7.706   94.181 1.00 125.23 ? 48   HIS E C   1 
ATOM   2670 O O   . HIS E 1 48 ? 37.112  7.519   94.803 1.00 109.95 ? 48   HIS E O   1 
ATOM   2671 C CB  . HIS E 1 48 ? 34.110  9.175   94.584 1.00 102.66 ? 48   HIS E CB  1 
ATOM   2672 C CG  . HIS E 1 48 ? 33.434  10.467  94.301 1.00 115.41 ? 48   HIS E CG  1 
ATOM   2673 N ND1 . HIS E 1 48 ? 34.008  11.679  94.624 1.00 93.75  ? 48   HIS E ND1 1 
ATOM   2674 C CD2 . HIS E 1 48 ? 32.250  10.748  93.710 1.00 98.40  ? 48   HIS E CD2 1 
ATOM   2675 C CE1 . HIS E 1 48 ? 33.197  12.653  94.252 1.00 117.34 ? 48   HIS E CE1 1 
ATOM   2676 N NE2 . HIS E 1 48 ? 32.124  12.116  93.696 1.00 122.02 ? 48   HIS E NE2 1 
ATOM   2677 N N   . GLY E 1 49 ? 35.349  6.727   93.636 1.00 69.03  ? 49   GLY E N   1 
ATOM   2678 C CA  . GLY E 1 49 ? 35.769  5.360   93.843 1.00 71.96  ? 49   GLY E CA  1 
ATOM   2679 C C   . GLY E 1 49 ? 34.884  4.494   92.994 1.00 81.12  ? 49   GLY E C   1 
ATOM   2680 O O   . GLY E 1 49 ? 34.689  4.787   91.817 1.00 72.13  ? 49   GLY E O   1 
ATOM   2681 N N   . PHE E 1 50 ? 34.319  3.455   93.606 1.00 76.42  ? 50   PHE E N   1 
ATOM   2682 C CA  . PHE E 1 50 ? 33.477  2.498   92.879 1.00 80.12  ? 50   PHE E CA  1 
ATOM   2683 C C   . PHE E 1 50 ? 32.114  2.395   93.518 1.00 83.84  ? 50   PHE E C   1 
ATOM   2684 O O   . PHE E 1 50 ? 32.019  2.417   94.744 1.00 90.10  ? 50   PHE E O   1 
ATOM   2685 C CB  . PHE E 1 50 ? 34.108  1.101   92.866 1.00 67.97  ? 50   PHE E CB  1 
ATOM   2686 C CG  . PHE E 1 50 ? 35.408  1.055   92.163 1.00 88.90  ? 50   PHE E CG  1 
ATOM   2687 C CD1 . PHE E 1 50 ? 35.460  0.640   90.842 1.00 102.33 ? 50   PHE E CD1 1 
ATOM   2688 C CD2 . PHE E 1 50 ? 36.584  1.457   92.804 1.00 76.56  ? 50   PHE E CD2 1 
ATOM   2689 C CE1 . PHE E 1 50 ? 36.668  0.589   90.173 1.00 87.96  ? 50   PHE E CE1 1 
ATOM   2690 C CE2 . PHE E 1 50 ? 37.792  1.410   92.140 1.00 87.34  ? 50   PHE E CE2 1 
ATOM   2691 C CZ  . PHE E 1 50 ? 37.838  0.977   90.816 1.00 63.40  ? 50   PHE E CZ  1 
ATOM   2692 N N   . ILE E 1 51 ? 31.081  2.257   92.690 1.00 101.42 ? 51   ILE E N   1 
ATOM   2693 C CA  . ILE E 1 51 ? 29.724  2.228   93.171 1.00 54.69  ? 51   ILE E CA  1 
ATOM   2694 C C   . ILE E 1 51 ? 28.833  1.329   92.353 1.00 83.47  ? 51   ILE E C   1 
ATOM   2695 O O   . ILE E 1 51 ? 28.852  1.364   91.119 1.00 74.44  ? 51   ILE E O   1 
ATOM   2696 C CB  . ILE E 1 51 ? 29.102  3.640   93.187 1.00 87.35  ? 51   ILE E CB  1 
ATOM   2697 C CG1 . ILE E 1 51 ? 27.689  3.598   93.806 1.00 97.33  ? 51   ILE E CG1 1 
ATOM   2698 C CG2 . ILE E 1 51 ? 29.104  4.246   91.796 1.00 57.88  ? 51   ILE E CG2 1 
ATOM   2699 C CD1 . ILE E 1 51 ? 27.257  4.899   94.480 1.00 73.05  ? 51   ILE E CD1 1 
ATOM   2700 N N   . SER E 1 52 ? 28.037  0.523   93.055 1.00 67.72  ? 52   SER E N   1 
ATOM   2701 C CA  . SER E 1 52 ? 26.814  -0.021  92.456 1.00 76.21  ? 52   SER E CA  1 
ATOM   2702 C C   . SER E 1 52 ? 25.599  0.547   93.145 1.00 44.91  ? 52   SER E C   1 
ATOM   2703 O O   . SER E 1 52 ? 25.696  0.936   94.300 1.00 76.54  ? 52   SER E O   1 
ATOM   2704 C CB  . SER E 1 52 ? 26.777  -1.545  92.514 1.00 56.54  ? 52   SER E CB  1 
ATOM   2705 O OG  . SER E 1 52 ? 27.300  -2.001  93.741 1.00 61.66  ? 52   SER E OG  1 
ATOM   2706 N N   . ARG E 1 53 ? 24.468  0.559   92.437 1.00 51.10  ? 53   ARG E N   1 
ATOM   2707 C CA  . ARG E 1 53 ? 23.193  1.131   92.900 1.00 50.63  ? 53   ARG E CA  1 
ATOM   2708 C C   . ARG E 1 53 ? 21.998  0.320   92.399 1.00 52.88  ? 53   ARG E C   1 
ATOM   2709 O O   . ARG E 1 53 ? 21.981  -0.143  91.273 1.00 79.31  ? 53   ARG E O   1 
ATOM   2710 C CB  . ARG E 1 53 ? 23.010  2.565   92.388 1.00 42.04  ? 53   ARG E CB  1 
ATOM   2711 C CG  . ARG E 1 53 ? 24.068  3.575   92.868 1.00 31.84  ? 53   ARG E CG  1 
ATOM   2712 C CD  . ARG E 1 53 ? 23.484  4.912   92.352 1.00 47.19  ? 53   ARG E CD  1 
ATOM   2713 N NE  . ARG E 1 53 ? 24.361  6.047   92.642 1.00 60.82  ? 53   ARG E NE  1 
ATOM   2714 C CZ  . ARG E 1 53 ? 25.533  6.285   92.057 1.00 67.30  ? 53   ARG E CZ  1 
ATOM   2715 N NH1 . ARG E 1 53 ? 26.001  5.470   91.111 1.00 71.11  ? 53   ARG E NH1 1 
ATOM   2716 N NH2 . ARG E 1 53 ? 26.239  7.351   92.424 1.00 56.77  ? 53   ARG E NH2 1 
ATOM   2717 N N   . GLU E 1 54 ? 20.997  0.144   93.238 1.00 65.59  ? 54   GLU E N   1 
ATOM   2718 C CA  . GLU E 1 54 ? 19.727  -0.432  92.791 1.00 65.97  ? 54   GLU E CA  1 
ATOM   2719 C C   . GLU E 1 54 ? 18.537  0.267   93.540 1.00 84.50  ? 54   GLU E C   1 
ATOM   2720 O O   . GLU E 1 54 ? 18.711  0.781   94.710 1.00 63.04  ? 54   GLU E O   1 
ATOM   2721 C CB  . GLU E 1 54 ? 19.721  -1.969  92.965 1.00 50.10  ? 54   GLU E CB  1 
ATOM   2722 C CG  . GLU E 1 54 ? 18.468  -2.575  92.319 1.00 81.57  ? 54   GLU E CG  1 
ATOM   2723 C CD  . GLU E 1 54 ? 18.398  -4.096  92.420 1.00 102.87 ? 54   GLU E CD  1 
ATOM   2724 O OE1 . GLU E 1 54 ? 19.305  -4.705  93.067 1.00 52.56  ? 54   GLU E OE1 1 
ATOM   2725 O OE2 . GLU E 1 54 ? 17.418  -4.665  91.867 1.00 81.29  ? 54   GLU E OE2 1 
ATOM   2726 N N   . PHE E 1 55 ? 17.372  0.331   92.868 1.00 54.12  ? 55   PHE E N   1 
ATOM   2727 C CA  . PHE E 1 55 ? 16.189  0.925   93.493 1.00 56.45  ? 55   PHE E CA  1 
ATOM   2728 C C   . PHE E 1 55 ? 14.940  0.424   92.868 1.00 50.37  ? 55   PHE E C   1 
ATOM   2729 O O   . PHE E 1 55 ? 14.928  0.086   91.684 1.00 69.00  ? 55   PHE E O   1 
ATOM   2730 C CB  . PHE E 1 55 ? 16.246  2.459   93.473 1.00 46.43  ? 55   PHE E CB  1 
ATOM   2731 C CG  . PHE E 1 55 ? 15.719  3.094   92.240 1.00 58.30  ? 55   PHE E CG  1 
ATOM   2732 C CD1 . PHE E 1 55 ? 14.331  3.222   92.046 1.00 58.41  ? 55   PHE E CD1 1 
ATOM   2733 C CD2 . PHE E 1 55 ? 16.611  3.622   91.272 1.00 63.63  ? 55   PHE E CD2 1 
ATOM   2734 C CE1 . PHE E 1 55 ? 13.803  3.863   90.879 1.00 53.52  ? 55   PHE E CE1 1 
ATOM   2735 C CE2 . PHE E 1 55 ? 16.119  4.272   90.108 1.00 59.61  ? 55   PHE E CE2 1 
ATOM   2736 C CZ  . PHE E 1 55 ? 14.711  4.401   89.913 1.00 57.04  ? 55   PHE E CZ  1 
ATOM   2737 N N   . HIS E 1 56 ? 13.876  0.357   93.647 1.00 54.60  ? 56   HIS E N   1 
ATOM   2738 C CA  . HIS E 1 56 ? 12.619  -0.155  93.077 1.00 52.66  ? 56   HIS E CA  1 
ATOM   2739 C C   . HIS E 1 56 ? 11.486  0.630   93.675 1.00 55.74  ? 56   HIS E C   1 
ATOM   2740 O O   . HIS E 1 56 ? 11.225  0.565   94.903 1.00 78.93  ? 56   HIS E O   1 
ATOM   2741 C CB  . HIS E 1 56 ? 12.477  -1.685  93.278 1.00 40.16  ? 56   HIS E CB  1 
ATOM   2742 C CG  . HIS E 1 56 ? 11.329  -2.299  92.536 1.00 74.95  ? 56   HIS E CG  1 
ATOM   2743 N ND1 . HIS E 1 56 ? 10.601  -1.613  91.583 1.00 71.06  ? 56   HIS E ND1 1 
ATOM   2744 C CD2 . HIS E 1 56 ? 10.806  -3.552  92.582 1.00 65.94  ? 56   HIS E CD2 1 
ATOM   2745 C CE1 . HIS E 1 56 ? 9.673   -2.413  91.084 1.00 83.04  ? 56   HIS E CE1 1 
ATOM   2746 N NE2 . HIS E 1 56 ? 9.776   -3.596  91.677 1.00 75.53  ? 56   HIS E NE2 1 
ATOM   2747 N N   . ARG E 1 57 ? 10.848  1.399   92.796 1.00 55.80  ? 57   ARG E N   1 
ATOM   2748 C CA  . ARG E 1 57 ? 9.795   2.344   93.151 1.00 57.95  ? 57   ARG E CA  1 
ATOM   2749 C C   . ARG E 1 57 ? 8.382   1.933   92.695 1.00 66.47  ? 57   ARG E C   1 
ATOM   2750 O O   . ARG E 1 57 ? 8.228   1.336   91.603 1.00 69.24  ? 57   ARG E O   1 
ATOM   2751 C CB  . ARG E 1 57 ? 10.136  3.673   92.548 1.00 36.84  ? 57   ARG E CB  1 
ATOM   2752 C CG  . ARG E 1 57 ? 8.978   4.620   92.612 1.00 67.04  ? 57   ARG E CG  1 
ATOM   2753 C CD  . ARG E 1 57 ? 9.263   5.662   93.647 1.00 55.81  ? 57   ARG E CD  1 
ATOM   2754 N NE  . ARG E 1 57 ? 8.426   5.467   94.807 1.00 81.72  ? 57   ARG E NE  1 
ATOM   2755 C CZ  . ARG E 1 57 ? 8.589   6.143   95.925 1.00 83.57  ? 57   ARG E CZ  1 
ATOM   2756 N NH1 . ARG E 1 57 ? 9.564   7.050   96.018 1.00 55.17  ? 57   ARG E NH1 1 
ATOM   2757 N NH2 . ARG E 1 57 ? 7.780   5.902   96.931 1.00 76.95  ? 57   ARG E NH2 1 
ATOM   2758 N N   . LYS E 1 58 ? 7.362   2.242   93.515 1.00 48.20  ? 58   LYS E N   1 
ATOM   2759 C CA  . LYS E 1 58 ? 5.984   1.928   93.124 1.00 66.21  ? 58   LYS E CA  1 
ATOM   2760 C C   . LYS E 1 58 ? 5.084   3.123   93.373 1.00 71.04  ? 58   LYS E C   1 
ATOM   2761 O O   . LYS E 1 58 ? 5.156   3.724   94.458 1.00 70.93  ? 58   LYS E O   1 
ATOM   2762 C CB  . LYS E 1 58 ? 5.455   0.680   93.863 1.00 58.29  ? 58   LYS E CB  1 
ATOM   2763 C CG  . LYS E 1 58 ? 6.199   -0.667  93.588 1.00 40.88  ? 58   LYS E CG  1 
ATOM   2764 N N   . TYR E 1 59 ? 4.266   3.484   92.376 1.00 42.27  ? 59   TYR E N   1 
ATOM   2765 C CA  . TYR E 1 59 ? 3.259   4.503   92.605 1.00 65.85  ? 59   TYR E CA  1 
ATOM   2766 C C   . TYR E 1 59 ? 1.860   3.935   92.386 1.00 84.08  ? 59   TYR E C   1 
ATOM   2767 O O   . TYR E 1 59 ? 1.675   3.024   91.562 1.00 85.75  ? 59   TYR E O   1 
ATOM   2768 C CB  . TYR E 1 59 ? 3.429   5.689   91.681 1.00 68.26  ? 59   TYR E CB  1 
ATOM   2769 C CG  . TYR E 1 59 ? 4.779   6.360   91.679 1.00 76.05  ? 59   TYR E CG  1 
ATOM   2770 C CD1 . TYR E 1 59 ? 5.096   7.377   92.598 1.00 69.62  ? 59   TYR E CD1 1 
ATOM   2771 C CD2 . TYR E 1 59 ? 5.716   6.039   90.706 1.00 77.02  ? 59   TYR E CD2 1 
ATOM   2772 C CE1 . TYR E 1 59 ? 6.342   8.046   92.553 1.00 58.18  ? 59   TYR E CE1 1 
ATOM   2773 C CE2 . TYR E 1 59 ? 6.960   6.679   90.657 1.00 70.91  ? 59   TYR E CE2 1 
ATOM   2774 C CZ  . TYR E 1 59 ? 7.259   7.682   91.581 1.00 81.33  ? 59   TYR E CZ  1 
ATOM   2775 O OH  . TYR E 1 59 ? 8.489   8.287   91.551 1.00 57.28  ? 59   TYR E OH  1 
ATOM   2776 N N   . ARG E 1 60 ? 0.878   4.468   93.125 1.00 81.90  ? 60   ARG E N   1 
ATOM   2777 C CA  . ARG E 1 60 ? -0.528  4.126   92.886 1.00 105.73 ? 60   ARG E CA  1 
ATOM   2778 C C   . ARG E 1 60 ? -0.988  5.154   91.847 1.00 93.52  ? 60   ARG E C   1 
ATOM   2779 O O   . ARG E 1 60 ? -0.570  6.311   91.937 1.00 83.39  ? 60   ARG E O   1 
ATOM   2780 C CB  . ARG E 1 60 ? -1.382  4.190   94.172 1.00 51.42  ? 60   ARG E CB  1 
ATOM   2781 C CG  . ARG E 1 60 ? -1.044  3.113   95.202 1.00 80.44  ? 60   ARG E CG  1 
ATOM   2782 N N   . ILE E 1 61 ? -1.792  4.731   90.858 1.00 61.02  ? 61   ILE E N   1 
ATOM   2783 C CA  . ILE E 1 61 ? -2.297  5.572   89.772 1.00 80.44  ? 61   ILE E CA  1 
ATOM   2784 C C   . ILE E 1 61 ? -3.605  6.183   90.259 1.00 77.24  ? 61   ILE E C   1 
ATOM   2785 O O   . ILE E 1 61 ? -4.448  5.442   90.769 1.00 72.75  ? 61   ILE E O   1 
ATOM   2786 C CB  . ILE E 1 61 ? -2.551  4.657   88.510 1.00 92.12  ? 61   ILE E CB  1 
ATOM   2787 C CG1 . ILE E 1 61 ? -1.221  4.201   87.897 1.00 85.66  ? 61   ILE E CG1 1 
ATOM   2788 C CG2 . ILE E 1 61 ? -3.410  5.338   87.442 1.00 69.85  ? 61   ILE E CG2 1 
ATOM   2789 C CD1 . ILE E 1 61 ? -1.353  3.054   86.923 1.00 75.98  ? 61   ILE E CD1 1 
ATOM   2790 N N   . PRO E 1 62 ? -3.791  7.521   90.106 1.00 85.89  ? 62   PRO E N   1 
ATOM   2791 C CA  . PRO E 1 62 ? -5.076  8.157   90.503 1.00 62.63  ? 62   PRO E CA  1 
ATOM   2792 C C   . PRO E 1 62 ? -6.262  7.388   89.948 1.00 71.90  ? 62   PRO E C   1 
ATOM   2793 O O   . PRO E 1 62 ? -6.148  6.792   88.865 1.00 83.00  ? 62   PRO E O   1 
ATOM   2794 C CB  . PRO E 1 62 ? -5.023  9.559   89.880 1.00 52.40  ? 62   PRO E CB  1 
ATOM   2795 C CG  . PRO E 1 62 ? -3.525  9.858   89.805 1.00 66.20  ? 62   PRO E CG  1 
ATOM   2796 C CD  . PRO E 1 62 ? -2.803  8.498   89.606 1.00 80.94  ? 62   PRO E CD  1 
ATOM   2797 N N   . ALA E 1 63 ? -7.372  7.394   90.690 1.00 107.57 ? 63   ALA E N   1 
ATOM   2798 C CA  . ALA E 1 63 ? -8.553  6.563   90.389 1.00 104.44 ? 63   ALA E CA  1 
ATOM   2799 C C   . ALA E 1 63 ? -9.092  6.749   88.951 1.00 113.84 ? 63   ALA E C   1 
ATOM   2800 O O   . ALA E 1 63 ? -9.462  5.771   88.265 1.00 80.92  ? 63   ALA E O   1 
ATOM   2801 C CB  . ALA E 1 63 ? -9.682  6.799   91.450 1.00 113.54 ? 63   ALA E CB  1 
ATOM   2802 N N   . ASP E 1 64 ? -9.109  8.008   88.511 1.00 87.65  ? 64   ASP E N   1 
ATOM   2803 C CA  . ASP E 1 64 ? -9.597  8.396   87.188 1.00 84.68  ? 64   ASP E CA  1 
ATOM   2804 C C   . ASP E 1 64 ? -8.441  8.518   86.166 1.00 90.14  ? 64   ASP E C   1 
ATOM   2805 O O   . ASP E 1 64 ? -8.377  9.485   85.384 1.00 84.04  ? 64   ASP E O   1 
ATOM   2806 C CB  . ASP E 1 64 ? -10.376 9.719   87.285 1.00 66.82  ? 64   ASP E CB  1 
ATOM   2807 C CG  . ASP E 1 64 ? -9.517  10.880  87.845 1.00 117.34 ? 64   ASP E CG  1 
ATOM   2808 O OD1 . ASP E 1 64 ? -8.453  10.646  88.487 1.00 91.89  ? 64   ASP E OD1 1 
ATOM   2809 O OD2 . ASP E 1 64 ? -9.926  12.044  87.641 1.00 103.96 ? 64   ASP E OD2 1 
ATOM   2810 N N   . VAL E 1 65 ? -7.527  7.547   86.185 1.00 63.62  ? 65   VAL E N   1 
ATOM   2811 C CA  . VAL E 1 65 ? -6.496  7.477   85.153 1.00 72.40  ? 65   VAL E CA  1 
ATOM   2812 C C   . VAL E 1 65 ? -6.470  6.060   84.588 1.00 98.15  ? 65   VAL E C   1 
ATOM   2813 O O   . VAL E 1 65 ? -6.180  5.096   85.323 1.00 92.09  ? 65   VAL E O   1 
ATOM   2814 C CB  . VAL E 1 65 ? -5.086  7.917   85.650 1.00 77.73  ? 65   VAL E CB  1 
ATOM   2815 C CG1 . VAL E 1 65 ? -3.983  7.535   84.624 1.00 69.28  ? 65   VAL E CG1 1 
ATOM   2816 C CG2 . VAL E 1 65 ? -5.052  9.409   85.915 1.00 60.99  ? 65   VAL E CG2 1 
ATOM   2817 N N   . ASP E 1 66 ? -6.817  5.946   83.298 1.00 84.49  ? 66   ASP E N   1 
ATOM   2818 C CA  . ASP E 1 66 ? -6.686  4.689   82.568 1.00 86.83  ? 66   ASP E CA  1 
ATOM   2819 C C   . ASP E 1 66 ? -5.193  4.390   82.461 1.00 93.82  ? 66   ASP E C   1 
ATOM   2820 O O   . ASP E 1 66 ? -4.452  5.228   81.904 1.00 73.85  ? 66   ASP E O   1 
ATOM   2821 C CB  . ASP E 1 66 ? -7.300  4.803   81.161 1.00 67.64  ? 66   ASP E CB  1 
ATOM   2822 C CG  . ASP E 1 66 ? -7.230  3.458   80.358 1.00 127.38 ? 66   ASP E CG  1 
ATOM   2823 O OD1 . ASP E 1 66 ? -6.977  2.363   80.946 1.00 108.50 ? 66   ASP E OD1 1 
ATOM   2824 O OD2 . ASP E 1 66 ? -7.429  3.498   79.116 1.00 123.02 ? 66   ASP E OD2 1 
ATOM   2825 N N   . PRO E 1 67 ? -4.748  3.218   83.012 1.00 90.49  ? 67   PRO E N   1 
ATOM   2826 C CA  . PRO E 1 67 ? -3.333  2.776   83.006 1.00 89.38  ? 67   PRO E CA  1 
ATOM   2827 C C   . PRO E 1 67 ? -2.754  2.645   81.622 1.00 62.56  ? 67   PRO E C   1 
ATOM   2828 O O   . PRO E 1 67 ? -1.547  2.779   81.454 1.00 96.19  ? 67   PRO E O   1 
ATOM   2829 C CB  . PRO E 1 67 ? -3.370  1.396   83.696 1.00 84.19  ? 67   PRO E CB  1 
ATOM   2830 C CG  . PRO E 1 67 ? -4.586  1.474   84.602 1.00 82.70  ? 67   PRO E CG  1 
ATOM   2831 C CD  . PRO E 1 67 ? -5.602  2.319   83.827 1.00 70.16  ? 67   PRO E CD  1 
ATOM   2832 N N   . LEU E 1 68 ? -3.622  2.404   80.645 1.00 92.74  ? 68   LEU E N   1 
ATOM   2833 C CA  . LEU E 1 68 ? -3.238  2.273   79.236 1.00 91.40  ? 68   LEU E CA  1 
ATOM   2834 C C   . LEU E 1 68 ? -2.982  3.605   78.503 1.00 81.17  ? 68   LEU E C   1 
ATOM   2835 O O   . LEU E 1 68 ? -2.558  3.596   77.358 1.00 81.83  ? 68   LEU E O   1 
ATOM   2836 C CB  . LEU E 1 68 ? -4.314  1.479   78.465 1.00 84.13  ? 68   LEU E CB  1 
ATOM   2837 C CG  . LEU E 1 68 ? -4.927  0.159   78.986 1.00 132.54 ? 68   LEU E CG  1 
ATOM   2838 C CD1 . LEU E 1 68 ? -6.252  -0.123  78.250 1.00 108.34 ? 68   LEU E CD1 1 
ATOM   2839 C CD2 . LEU E 1 68 ? -3.982  -1.078  78.911 1.00 42.69  ? 68   LEU E CD2 1 
ATOM   2840 N N   . THR E 1 69 ? -3.251  4.740   79.134 1.00 55.91  ? 69   THR E N   1 
ATOM   2841 C CA  . THR E 1 69 ? -3.039  6.031   78.481 1.00 72.01  ? 69   THR E CA  1 
ATOM   2842 C C   . THR E 1 69 ? -1.881  6.787   79.089 1.00 77.33  ? 69   THR E C   1 
ATOM   2843 O O   . THR E 1 69 ? -1.666  7.976   78.778 1.00 67.26  ? 69   THR E O   1 
ATOM   2844 C CB  . THR E 1 69 ? -4.244  6.982   78.604 1.00 70.60  ? 69   THR E CB  1 
ATOM   2845 O OG1 . THR E 1 69 ? -4.430  7.352   79.986 1.00 76.24  ? 69   THR E OG1 1 
ATOM   2846 C CG2 . THR E 1 69 ? -5.514  6.341   77.995 1.00 61.34  ? 69   THR E CG2 1 
ATOM   2847 N N   . ILE E 1 70 ? -1.166  6.116   79.990 1.00 86.97  ? 70   ILE E N   1 
ATOM   2848 C CA  . ILE E 1 70 ? -0.040  6.720   80.704 1.00 90.21  ? 70   ILE E CA  1 
ATOM   2849 C C   . ILE E 1 70 ? 1.184   6.693   79.785 1.00 95.87  ? 70   ILE E C   1 
ATOM   2850 O O   . ILE E 1 70 ? 1.455   5.647   79.176 1.00 66.94  ? 70   ILE E O   1 
ATOM   2851 C CB  . ILE E 1 70 ? 0.250   5.937   81.996 1.00 67.29  ? 70   ILE E CB  1 
ATOM   2852 C CG1 . ILE E 1 70 ? -0.892  6.114   82.985 1.00 74.87  ? 70   ILE E CG1 1 
ATOM   2853 C CG2 . ILE E 1 70 ? 1.592   6.340   82.643 1.00 65.89  ? 70   ILE E CG2 1 
ATOM   2854 C CD1 . ILE E 1 70 ? -0.580  5.418   84.310 1.00 92.72  ? 70   ILE E CD1 1 
ATOM   2855 N N   . THR E 1 71 ? 1.888   7.833   79.676 1.00 75.05  ? 71   THR E N   1 
ATOM   2856 C CA  . THR E 1 71 ? 3.110   7.926   78.872 1.00 70.07  ? 71   THR E CA  1 
ATOM   2857 C C   . THR E 1 71 ? 4.364   8.244   79.683 1.00 68.20  ? 71   THR E C   1 
ATOM   2858 O O   . THR E 1 71 ? 4.280   8.728   80.822 1.00 69.57  ? 71   THR E O   1 
ATOM   2859 C CB  . THR E 1 71 ? 2.960   8.909   77.687 1.00 81.04  ? 71   THR E CB  1 
ATOM   2860 O OG1 . THR E 1 71 ? 2.693   10.236  78.172 1.00 102.81 ? 71   THR E OG1 1 
ATOM   2861 C CG2 . THR E 1 71 ? 1.806   8.474   76.844 1.00 51.28  ? 71   THR E CG2 1 
ATOM   2862 N N   . SER E 1 72 ? 5.518   7.927   79.100 1.00 67.39  ? 72   SER E N   1 
ATOM   2863 C CA  . SER E 1 72 ? 6.801   8.179   79.755 1.00 68.30  ? 72   SER E CA  1 
ATOM   2864 C C   . SER E 1 72 ? 7.738   8.934   78.800 1.00 83.12  ? 72   SER E C   1 
ATOM   2865 O O   . SER E 1 72 ? 7.515   8.984   77.569 1.00 76.26  ? 72   SER E O   1 
ATOM   2866 C CB  . SER E 1 72 ? 7.395   6.882   80.375 1.00 44.01  ? 72   SER E CB  1 
ATOM   2867 O OG  . SER E 1 72 ? 8.264   6.147   79.552 1.00 55.81  ? 72   SER E OG  1 
ATOM   2868 N N   . SER E 1 73 ? 8.755   9.560   79.370 1.00 60.02  ? 73   SER E N   1 
ATOM   2869 C CA  . SER E 1 73 ? 9.666   10.406  78.589 1.00 57.83  ? 73   SER E CA  1 
ATOM   2870 C C   . SER E 1 73 ? 10.993  10.570  79.341 1.00 74.72  ? 73   SER E C   1 
ATOM   2871 O O   . SER E 1 73 ? 11.025  10.781  80.563 1.00 77.20  ? 73   SER E O   1 
ATOM   2872 C CB  . SER E 1 73 ? 9.048   11.797  78.374 1.00 43.20  ? 73   SER E CB  1 
ATOM   2873 O OG  . SER E 1 73 ? 10.010  12.789  78.769 1.00 91.66  ? 73   SER E OG  1 
ATOM   2874 N N   . LEU E 1 74 ? 12.105  10.494  78.637 1.00 66.14  ? 74   LEU E N   1 
ATOM   2875 C CA  . LEU E 1 74 ? 13.399  10.714  79.310 1.00 63.07  ? 74   LEU E CA  1 
ATOM   2876 C C   . LEU E 1 74 ? 14.199  11.904  78.730 1.00 73.10  ? 74   LEU E C   1 
ATOM   2877 O O   . LEU E 1 74 ? 14.386  12.018  77.479 1.00 55.97  ? 74   LEU E O   1 
ATOM   2878 C CB  . LEU E 1 74 ? 14.251  9.439   79.279 1.00 38.29  ? 74   LEU E CB  1 
ATOM   2879 C CG  . LEU E 1 74 ? 15.493  9.442   80.192 1.00 69.92  ? 74   LEU E CG  1 
ATOM   2880 C CD1 . LEU E 1 74 ? 15.187  9.906   81.667 1.00 75.25  ? 74   LEU E CD1 1 
ATOM   2881 C CD2 . LEU E 1 74 ? 16.139  8.051   80.233 1.00 58.25  ? 74   LEU E CD2 1 
ATOM   2882 N N   . SER E 1 75 ? 14.677  12.779  79.634 1.00 63.60  ? 75   SER E N   1 
ATOM   2883 C CA  . SER E 1 75 ? 15.504  13.911  79.212 1.00 47.38  ? 75   SER E CA  1 
ATOM   2884 C C   . SER E 1 75 ? 16.985  13.675  79.328 1.00 63.90  ? 75   SER E C   1 
ATOM   2885 O O   . SER E 1 75 ? 17.426  12.776  80.049 1.00 47.58  ? 75   SER E O   1 
ATOM   2886 C CB  . SER E 1 75 ? 15.166  15.155  79.965 1.00 47.51  ? 75   SER E CB  1 
ATOM   2887 O OG  . SER E 1 75 ? 15.900  15.173  81.166 1.00 79.47  ? 75   SER E OG  1 
ATOM   2888 N N   . SER E 1 76 ? 17.737  14.508  78.594 1.00 85.15  ? 76   SER E N   1 
ATOM   2889 C CA  . SER E 1 76 ? 19.196  14.379  78.429 1.00 83.94  ? 76   SER E CA  1 
ATOM   2890 C C   . SER E 1 76 ? 19.923  14.611  79.741 1.00 90.86  ? 76   SER E C   1 
ATOM   2891 O O   . SER E 1 76 ? 20.937  13.946  80.037 1.00 74.97  ? 76   SER E O   1 
ATOM   2892 C CB  . SER E 1 76 ? 19.712  15.387  77.397 1.00 59.57  ? 76   SER E CB  1 
ATOM   2893 O OG  . SER E 1 76 ? 19.174  16.697  77.653 1.00 58.16  ? 76   SER E OG  1 
ATOM   2894 N N   . ASP E 1 77 ? 19.401  15.562  80.518 1.00 70.60  ? 77   ASP E N   1 
ATOM   2895 C CA  . ASP E 1 77 ? 19.966  15.797  81.845 1.00 95.09  ? 77   ASP E CA  1 
ATOM   2896 C C   . ASP E 1 77 ? 19.365  14.906  82.980 1.00 60.26  ? 77   ASP E C   1 
ATOM   2897 O O   . ASP E 1 77 ? 19.451  15.297  84.140 1.00 110.95 ? 77   ASP E O   1 
ATOM   2898 C CB  . ASP E 1 77 ? 19.964  17.301  82.164 1.00 86.61  ? 77   ASP E CB  1 
ATOM   2899 C CG  . ASP E 1 77 ? 18.655  17.956  81.804 1.00 108.08 ? 77   ASP E CG  1 
ATOM   2900 O OD1 . ASP E 1 77 ? 17.620  17.244  81.873 1.00 107.51 ? 77   ASP E OD1 1 
ATOM   2901 O OD2 . ASP E 1 77 ? 18.668  19.162  81.457 1.00 136.87 ? 77   ASP E OD2 1 
ATOM   2902 N N   . GLY E 1 78 ? 18.809  13.704  82.634 1.00 81.05  ? 78   GLY E N   1 
ATOM   2903 C CA  . GLY E 1 78 ? 18.534  12.569  83.544 1.00 72.77  ? 78   GLY E CA  1 
ATOM   2904 C C   . GLY E 1 78 ? 17.226  12.496  84.314 1.00 71.26  ? 78   GLY E C   1 
ATOM   2905 O O   . GLY E 1 78 ? 17.115  11.768  85.302 1.00 75.04  ? 78   GLY E O   1 
ATOM   2906 N N   . VAL E 1 79 ? 16.240  13.268  83.880 1.00 75.64  ? 79   VAL E N   1 
ATOM   2907 C CA  . VAL E 1 79 ? 14.892  13.180  84.445 1.00 53.99  ? 79   VAL E CA  1 
ATOM   2908 C C   . VAL E 1 79 ? 14.015  12.142  83.715 1.00 68.23  ? 79   VAL E C   1 
ATOM   2909 O O   . VAL E 1 79 ? 13.807  12.215  82.488 1.00 86.50  ? 79   VAL E O   1 
ATOM   2910 C CB  . VAL E 1 79 ? 14.235  14.561  84.457 1.00 63.87  ? 79   VAL E CB  1 
ATOM   2911 C CG1 . VAL E 1 79 ? 12.779  14.512  84.979 1.00 52.12  ? 79   VAL E CG1 1 
ATOM   2912 C CG2 . VAL E 1 79 ? 15.083  15.471  85.336 1.00 48.66  ? 79   VAL E CG2 1 
ATOM   2913 N N   . LEU E 1 80 ? 13.538  11.153  84.472 1.00 68.38  ? 80   LEU E N   1 
ATOM   2914 C CA  . LEU E 1 80 ? 12.487  10.244  84.009 1.00 66.10  ? 80   LEU E CA  1 
ATOM   2915 C C   . LEU E 1 80 ? 11.104  10.826  84.314 1.00 54.94  ? 80   LEU E C   1 
ATOM   2916 O O   . LEU E 1 80 ? 10.902  11.380  85.375 1.00 86.82  ? 80   LEU E O   1 
ATOM   2917 C CB  . LEU E 1 80 ? 12.621  8.901   84.714 1.00 52.08  ? 80   LEU E CB  1 
ATOM   2918 C CG  . LEU E 1 80 ? 11.650  7.854   84.189 1.00 69.44  ? 80   LEU E CG  1 
ATOM   2919 C CD1 . LEU E 1 80 ? 11.574  7.813   82.607 1.00 38.51  ? 80   LEU E CD1 1 
ATOM   2920 C CD2 . LEU E 1 80 ? 12.098  6.549   84.816 1.00 32.01  ? 80   LEU E CD2 1 
ATOM   2921 N N   . THR E 1 81 ? 10.153  10.701  83.398 1.00 64.74  ? 81   THR E N   1 
ATOM   2922 C CA  . THR E 1 81 ? 8.807   11.235  83.619 1.00 67.88  ? 81   THR E CA  1 
ATOM   2923 C C   . THR E 1 81 ? 7.797   10.156  83.295 1.00 77.07  ? 81   THR E C   1 
ATOM   2924 O O   . THR E 1 81 ? 8.034   9.352   82.388 1.00 75.02  ? 81   THR E O   1 
ATOM   2925 C CB  . THR E 1 81 ? 8.459   12.485  82.734 1.00 75.42  ? 81   THR E CB  1 
ATOM   2926 O OG1 . THR E 1 81 ? 9.164   13.633  83.217 1.00 70.75  ? 81   THR E OG1 1 
ATOM   2927 C CG2 . THR E 1 81 ? 6.908   12.770  82.748 1.00 57.61  ? 81   THR E CG2 1 
ATOM   2928 N N   . VAL E 1 82 ? 6.684   10.146  84.033 1.00 67.46  ? 82   VAL E N   1 
ATOM   2929 C CA  . VAL E 1 82 ? 5.598   9.258   83.732 1.00 49.75  ? 82   VAL E CA  1 
ATOM   2930 C C   . VAL E 1 82 ? 4.383   10.125  83.853 1.00 60.73  ? 82   VAL E C   1 
ATOM   2931 O O   . VAL E 1 82 ? 4.311   10.944  84.742 1.00 79.89  ? 82   VAL E O   1 
ATOM   2932 C CB  . VAL E 1 82 ? 5.579   8.067   84.692 1.00 50.58  ? 82   VAL E CB  1 
ATOM   2933 C CG1 . VAL E 1 82 ? 4.450   7.111   84.340 1.00 58.79  ? 82   VAL E CG1 1 
ATOM   2934 C CG2 . VAL E 1 82 ? 6.964   7.293   84.703 1.00 48.43  ? 82   VAL E CG2 1 
ATOM   2935 N N   . ASN E 1 83 ? 3.458   10.003  82.908 1.00 80.45  ? 83   ASN E N   1 
ATOM   2936 C CA  . ASN E 1 83 ? 2.207   10.792  82.917 1.00 76.13  ? 83   ASN E CA  1 
ATOM   2937 C C   . ASN E 1 83 ? 1.038   10.139  82.155 1.00 85.64  ? 83   ASN E C   1 
ATOM   2938 O O   . ASN E 1 83 ? 1.171   9.043   81.619 1.00 80.76  ? 83   ASN E O   1 
ATOM   2939 C CB  . ASN E 1 83 ? 2.404   12.263  82.474 1.00 60.99  ? 83   ASN E CB  1 
ATOM   2940 C CG  . ASN E 1 83 ? 3.451   12.417  81.400 1.00 96.16  ? 83   ASN E CG  1 
ATOM   2941 O OD1 . ASN E 1 83 ? 3.626   11.543  80.527 1.00 79.27  ? 83   ASN E OD1 1 
ATOM   2942 N ND2 . ASN E 1 83 ? 4.177   13.537  81.462 1.00 99.28  ? 83   ASN E ND2 1 
ATOM   2943 N N   . GLY E 1 84 ? -0.109  10.817  82.142 1.00 108.97 ? 84   GLY E N   1 
ATOM   2944 C CA  . GLY E 1 84 ? -1.308  10.313  81.498 1.00 107.47 ? 84   GLY E CA  1 
ATOM   2945 C C   . GLY E 1 84 ? -2.428  11.323  81.652 1.00 118.15 ? 84   GLY E C   1 
ATOM   2946 O O   . GLY E 1 84 ? -2.221  12.421  82.177 1.00 118.24 ? 84   GLY E O   1 
ATOM   2947 N N   . PRO E 1 85 ? -3.615  10.969  81.162 1.00 109.20 ? 85   PRO E N   1 
ATOM   2948 C CA  . PRO E 1 85 ? -4.885  11.712  81.243 1.00 125.46 ? 85   PRO E CA  1 
ATOM   2949 C C   . PRO E 1 85 ? -5.822  11.225  82.364 1.00 117.53 ? 85   PRO E C   1 
ATOM   2950 O O   . PRO E 1 85 ? -6.743  11.953  82.767 1.00 69.13  ? 85   PRO E O   1 
ATOM   2951 C CB  . PRO E 1 85 ? -5.537  11.433  79.881 1.00 126.35 ? 85   PRO E CB  1 
ATOM   2952 C CG  . PRO E 1 85 ? -4.494  10.634  79.072 1.00 94.75  ? 85   PRO E CG  1 
ATOM   2953 C CD  . PRO E 1 85 ? -3.617  9.988   80.073 1.00 100.22 ? 85   PRO E CD  1 
HETATM 2954 O O   . HOH F 2 .  ? 26.638  -16.468 11.270 1.00 64.51  ? 2001 HOH A O   1 
HETATM 2955 O O   . HOH F 2 .  ? 41.252  -17.685 9.857  1.00 33.84  ? 2002 HOH A O   1 
HETATM 2956 O O   . HOH F 2 .  ? 41.787  -21.684 4.252  1.00 37.19  ? 2003 HOH A O   1 
HETATM 2957 O O   . HOH F 2 .  ? 36.498  -19.527 4.861  1.00 36.69  ? 2004 HOH A O   1 
HETATM 2958 O O   . HOH F 2 .  ? 16.851  -4.083  8.674  1.00 40.42  ? 2005 HOH A O   1 
HETATM 2959 O O   . HOH F 2 .  ? 16.376  1.835   6.262  1.00 38.07  ? 2006 HOH A O   1 
HETATM 2960 O O   . HOH F 2 .  ? 2.673   18.403  16.268 1.00 50.84  ? 2007 HOH A O   1 
HETATM 2961 O O   . HOH F 2 .  ? 14.830  6.243   7.602  1.00 43.05  ? 2008 HOH A O   1 
HETATM 2962 O O   . HOH F 2 .  ? 18.356  1.226   13.694 1.00 20.48  ? 2009 HOH A O   1 
HETATM 2963 O O   . HOH F 2 .  ? 18.983  1.799   6.609  1.00 54.13  ? 2010 HOH A O   1 
HETATM 2964 O O   . HOH F 2 .  ? 27.449  10.227  10.211 1.00 51.72  ? 2011 HOH A O   1 
HETATM 2965 O O   . HOH F 2 .  ? 27.069  13.068  11.051 1.00 44.04  ? 2012 HOH A O   1 
HETATM 2966 O O   . HOH F 2 .  ? 12.948  7.069   12.538 1.00 46.02  ? 2013 HOH A O   1 
HETATM 2967 O O   . HOH F 2 .  ? 12.767  8.047   7.671  1.00 36.68  ? 2014 HOH A O   1 
HETATM 2968 O O   . HOH F 2 .  ? 3.215   16.985  14.230 1.00 57.81  ? 2015 HOH A O   1 
HETATM 2969 O O   . HOH F 2 .  ? 10.191  8.683   11.463 1.00 55.91  ? 2016 HOH A O   1 
HETATM 2970 O O   . HOH F 2 .  ? 11.954  6.150   14.540 1.00 32.77  ? 2017 HOH A O   1 
HETATM 2971 O O   . HOH F 2 .  ? 15.260  15.472  20.468 1.00 62.32  ? 2018 HOH A O   1 
HETATM 2972 O O   . HOH F 2 .  ? 41.800  -8.451  17.125 1.00 59.99  ? 2019 HOH A O   1 
HETATM 2973 O O   . HOH F 2 .  ? 28.838  1.761   3.198  1.00 43.13  ? 2020 HOH A O   1 
HETATM 2974 O O   . HOH F 2 .  ? 23.788  -5.018  3.171  1.00 51.87  ? 2021 HOH A O   1 
HETATM 2975 O O   . HOH F 2 .  ? 21.283  1.931   -0.741 1.00 31.37  ? 2022 HOH A O   1 
HETATM 2976 O O   . HOH F 2 .  ? 19.611  2.405   4.135  1.00 47.79  ? 2023 HOH A O   1 
HETATM 2977 O O   . HOH F 2 .  ? 48.648  -15.106 6.404  1.00 53.86  ? 2024 HOH A O   1 
HETATM 2978 O O   . HOH G 2 .  ? 14.290  0.447   21.073 1.00 46.83  ? 2001 HOH B O   1 
HETATM 2979 O O   . HOH G 2 .  ? 13.327  3.882   22.164 1.00 40.18  ? 2002 HOH B O   1 
HETATM 2980 O O   . HOH G 2 .  ? 23.505  -1.866  31.703 1.00 52.05  ? 2003 HOH B O   1 
HETATM 2981 O O   . HOH G 2 .  ? 27.651  -8.646  32.781 1.00 58.19  ? 2004 HOH B O   1 
HETATM 2982 O O   . HOH G 2 .  ? 31.543  -7.523  29.380 1.00 42.56  ? 2005 HOH B O   1 
HETATM 2983 O O   . HOH G 2 .  ? -7.797  6.712   32.248 1.00 38.73  ? 2006 HOH B O   1 
HETATM 2984 O O   . HOH G 2 .  ? 15.479  2.113   22.459 1.00 30.52  ? 2007 HOH B O   1 
HETATM 2985 O O   . HOH G 2 .  ? 12.741  1.394   22.365 1.00 42.50  ? 2008 HOH B O   1 
HETATM 2986 O O   . HOH G 2 .  ? 14.238  -4.806  27.788 1.00 41.43  ? 2009 HOH B O   1 
HETATM 2987 O O   . HOH G 2 .  ? 22.302  -3.249  30.101 1.00 60.97  ? 2010 HOH B O   1 
HETATM 2988 O O   . HOH G 2 .  ? 28.488  -8.184  29.972 1.00 50.07  ? 2011 HOH B O   1 
HETATM 2989 O O   . HOH G 2 .  ? 31.404  -8.811  27.567 1.00 44.25  ? 2012 HOH B O   1 
HETATM 2990 O O   . HOH G 2 .  ? 18.360  2.193   32.716 1.00 63.65  ? 2013 HOH B O   1 
HETATM 2991 O O   . HOH G 2 .  ? 23.173  0.673   17.142 1.00 41.37  ? 2014 HOH B O   1 
HETATM 2992 O O   . HOH G 2 .  ? 18.168  8.419   36.686 1.00 65.47  ? 2015 HOH B O   1 
HETATM 2993 O O   . HOH G 2 .  ? 20.371  10.582  31.096 1.00 37.41  ? 2016 HOH B O   1 
HETATM 2994 O O   . HOH G 2 .  ? 9.181   19.291  34.003 1.00 67.57  ? 2017 HOH B O   1 
HETATM 2995 O O   . HOH G 2 .  ? 5.810   21.630  32.729 1.00 62.91  ? 2018 HOH B O   1 
HETATM 2996 O O   . HOH G 2 .  ? 15.322  19.429  25.701 1.00 62.80  ? 2019 HOH B O   1 
HETATM 2997 O O   . HOH G 2 .  ? 14.358  20.493  23.409 1.00 65.24  ? 2020 HOH B O   1 
HETATM 2998 O O   . HOH G 2 .  ? 28.958  -4.907  29.275 1.00 59.11  ? 2021 HOH B O   1 
HETATM 2999 O O   . HOH G 2 .  ? 34.465  -7.134  23.645 1.00 50.67  ? 2022 HOH B O   1 
HETATM 3000 O O   . HOH G 2 .  ? 28.623  -8.963  27.219 1.00 38.41  ? 2023 HOH B O   1 
HETATM 3001 O O   . HOH G 2 .  ? 21.923  0.033   19.356 1.00 46.00  ? 2024 HOH B O   1 
HETATM 3002 O O   . HOH G 2 .  ? -6.394  9.012   25.848 1.00 54.89  ? 2025 HOH B O   1 
HETATM 3003 O O   . HOH G 2 .  ? -9.446  9.108   32.429 1.00 47.41  ? 2026 HOH B O   1 
HETATM 3004 O O   . HOH H 2 .  ? 6.290   -5.968  52.245 1.00 49.89  ? 2001 HOH C O   1 
HETATM 3005 O O   . HOH H 2 .  ? 4.599   -11.411 39.566 1.00 47.28  ? 2002 HOH C O   1 
HETATM 3006 O O   . HOH H 2 .  ? -4.773  -16.879 45.951 1.00 58.17  ? 2003 HOH C O   1 
HETATM 3007 O O   . HOH H 2 .  ? 3.115   -10.707 41.811 1.00 56.32  ? 2004 HOH C O   1 
HETATM 3008 O O   . HOH H 2 .  ? 1.391   -6.297  45.436 1.00 58.44  ? 2005 HOH C O   1 
HETATM 3009 O O   . HOH H 2 .  ? 12.613  5.601   52.009 1.00 46.81  ? 2006 HOH C O   1 
HETATM 3010 O O   . HOH H 2 .  ? 27.049  2.200   48.154 1.00 61.94  ? 2007 HOH C O   1 
HETATM 3011 O O   . HOH H 2 .  ? 18.504  7.846   38.936 1.00 61.79  ? 2008 HOH C O   1 
HETATM 3012 O O   . HOH H 2 .  ? 18.295  -9.307  40.232 1.00 53.54  ? 2009 HOH C O   1 
HETATM 3013 O O   . HOH H 2 .  ? 25.036  4.773   47.681 1.00 46.31  ? 2010 HOH C O   1 
HETATM 3014 O O   . HOH H 2 .  ? 25.754  6.138   53.586 1.00 50.31  ? 2011 HOH C O   1 
HETATM 3015 O O   . HOH H 2 .  ? 27.708  4.758   48.341 1.00 50.85  ? 2012 HOH C O   1 
HETATM 3016 O O   . HOH H 2 .  ? 28.420  10.414  53.530 1.00 34.25  ? 2013 HOH C O   1 
HETATM 3017 O O   . HOH H 2 .  ? 16.904  12.624  50.544 1.00 33.62  ? 2014 HOH C O   1 
HETATM 3018 O O   . HOH H 2 .  ? 20.345  17.368  48.200 1.00 44.09  ? 2015 HOH C O   1 
HETATM 3019 O O   . HOH H 2 .  ? 9.204   -4.724  53.953 1.00 50.64  ? 2016 HOH C O   1 
HETATM 3020 O O   . HOH H 2 .  ? 11.711  -12.799 55.577 1.00 63.03  ? 2017 HOH C O   1 
HETATM 3021 O O   . HOH H 2 .  ? 10.145  -19.445 53.279 1.00 54.84  ? 2018 HOH C O   1 
HETATM 3022 O O   . HOH H 2 .  ? 15.873  -8.768  40.842 1.00 41.65  ? 2019 HOH C O   1 
HETATM 3023 O O   . HOH H 2 .  ? 14.851  -2.439  39.299 1.00 43.74  ? 2020 HOH C O   1 
HETATM 3024 O O   . HOH H 2 .  ? 16.124  -2.599  41.242 1.00 53.09  ? 2021 HOH C O   1 
HETATM 3025 O O   . HOH H 2 .  ? 6.776   -0.732  39.976 1.00 42.66  ? 2022 HOH C O   1 
HETATM 3026 O O   . HOH H 2 .  ? 5.627   9.677   39.768 1.00 53.62  ? 2023 HOH C O   1 
HETATM 3027 O O   . HOH H 2 .  ? 6.930   -0.592  42.541 1.00 38.80  ? 2024 HOH C O   1 
HETATM 3028 O O   . HOH I 2 .  ? 30.565  12.968  63.819 1.00 63.42  ? 2001 HOH D O   1 
HETATM 3029 O O   . HOH I 2 .  ? 22.591  -9.211  64.615 1.00 47.29  ? 2002 HOH D O   1 
HETATM 3030 O O   . HOH I 2 .  ? 16.688  13.197  75.318 1.00 58.01  ? 2003 HOH D O   1 
HETATM 3031 O O   . HOH I 2 .  ? 4.476   6.144   77.539 1.00 63.62  ? 2004 HOH D O   1 
HETATM 3032 O O   . HOH I 2 .  ? 10.307  12.818  72.621 1.00 65.20  ? 2005 HOH D O   1 
HETATM 3033 O O   . HOH J 2 .  ? 16.456  8.184   92.166 1.00 50.59  ? 2001 HOH E O   1 
HETATM 3034 O O   . HOH J 2 .  ? 20.308  8.950   90.103 1.00 59.11  ? 2002 HOH E O   1 
HETATM 3035 O O   . HOH J 2 .  ? 12.548  5.655   78.301 1.00 66.84  ? 2003 HOH E O   1 
HETATM 3036 O O   . HOH J 2 .  ? 10.315  7.412   78.197 1.00 63.47  ? 2004 HOH E O   1 
HETATM 3037 O O   . HOH J 2 .  ? 5.674   12.829  79.650 1.00 53.41  ? 2005 HOH E O   1 
HETATM 3038 O O   . HOH J 2 .  ? -9.471  11.023  82.603 1.00 54.48  ? 2006 HOH E O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  ?  ?   ?   A . n 
A 1 2  ALA 2  2  ?  ?   ?   A . n 
A 1 3  MET 3  3  3  MET MET A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  MET 5  5  5  MET MET A . n 
A 1 6  ARG 6  6  6  ARG ARG A . n 
A 1 7  LEU 7  7  7  LEU LEU A . n 
A 1 8  GLU 8  8  8  GLU GLU A . n 
A 1 9  LYS 9  9  9  LYS LYS A . n 
A 1 10 ASP 10 10 10 ASP ASP A . n 
A 1 11 ARG 11 11 11 ARG ARG A . n 
A 1 12 PHE 12 12 12 PHE PHE A . n 
A 1 13 SER 13 13 13 SER SER A . n 
A 1 14 VAL 14 14 14 VAL VAL A . n 
A 1 15 ASN 15 15 15 ASN ASN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 ASP 17 17 17 ASP ASP A . n 
A 1 18 VAL 18 18 18 VAL VAL A . n 
A 1 19 LYS 19 19 19 LYS LYS A . n 
A 1 20 HIS 20 20 20 HIS HIS A . n 
A 1 21 PHE 21 21 21 PHE PHE A . n 
A 1 22 SER 22 22 22 SER SER A . n 
A 1 23 PRO 23 23 23 PRO PRO A . n 
A 1 24 GLU 24 24 24 GLU GLU A . n 
A 1 25 GLU 25 25 25 GLU GLU A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 VAL 28 28 28 VAL VAL A . n 
A 1 29 LYS 29 29 29 LYS LYS A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 ASP 33 33 33 ASP ASP A . n 
A 1 34 VAL 34 34 34 VAL VAL A . n 
A 1 35 ILE 35 35 35 ILE ILE A . n 
A 1 36 GLU 36 36 36 GLU GLU A . n 
A 1 37 VAL 37 37 37 VAL VAL A . n 
A 1 38 HIS 38 38 38 HIS HIS A . n 
A 1 39 GLY 39 39 39 GLY GLY A . n 
A 1 40 LYS 40 40 40 LYS LYS A . n 
A 1 41 HIS 41 41 41 HIS HIS A . n 
A 1 42 GLU 42 42 42 GLU GLU A . n 
A 1 43 GLU 43 43 43 GLU GLU A . n 
A 1 44 ARG 44 44 44 ARG ARG A . n 
A 1 45 GLN 45 45 45 GLN GLN A . n 
A 1 46 ASP 46 46 46 ASP ASP A . n 
A 1 47 GLU 47 47 47 GLU GLU A . n 
A 1 48 HIS 48 48 48 HIS HIS A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 PHE 50 50 50 PHE PHE A . n 
A 1 51 ILE 51 51 51 ILE ILE A . n 
A 1 52 SER 52 52 52 SER SER A . n 
A 1 53 ARG 53 53 53 ARG ARG A . n 
A 1 54 GLU 54 54 54 GLU GLU A . n 
A 1 55 PHE 55 55 55 PHE PHE A . n 
A 1 56 HIS 56 56 56 HIS HIS A . n 
A 1 57 ARG 57 57 57 ARG ARG A . n 
A 1 58 LYS 58 58 58 LYS LYS A . n 
A 1 59 TYR 59 59 59 TYR TYR A . n 
A 1 60 ARG 60 60 60 ARG ARG A . n 
A 1 61 ILE 61 61 61 ILE ILE A . n 
A 1 62 PRO 62 62 62 PRO PRO A . n 
A 1 63 ALA 63 63 63 ALA ALA A . n 
A 1 64 ASP 64 64 64 ASP ASP A . n 
A 1 65 VAL 65 65 65 VAL VAL A . n 
A 1 66 ASP 66 66 66 ASP ASP A . n 
A 1 67 PRO 67 67 67 PRO PRO A . n 
A 1 68 LEU 68 68 68 LEU LEU A . n 
A 1 69 THR 69 69 69 THR THR A . n 
A 1 70 ILE 70 70 70 ILE ILE A . n 
A 1 71 THR 71 71 71 THR THR A . n 
A 1 72 SER 72 72 72 SER SER A . n 
A 1 73 SER 73 73 73 SER SER A . n 
A 1 74 LEU 74 74 74 LEU LEU A . n 
A 1 75 SER 75 75 75 SER SER A . n 
A 1 76 SER 76 76 76 SER SER A . n 
A 1 77 ASP 77 77 77 ASP ASP A . n 
A 1 78 GLY 78 78 78 GLY GLY A . n 
A 1 79 VAL 79 79 79 VAL VAL A . n 
A 1 80 LEU 80 80 80 LEU LEU A . n 
A 1 81 THR 81 81 81 THR THR A . n 
A 1 82 VAL 82 82 82 VAL VAL A . n 
A 1 83 ASN 83 83 83 ASN ASN A . n 
A 1 84 GLY 84 84 84 GLY GLY A . n 
A 1 85 PRO 85 85 85 PRO PRO A . n 
A 1 86 ARG 86 86 86 ARG ARG A . n 
A 1 87 LYS 87 87 87 LYS LYS A . n 
A 1 88 GLN 88 88 ?  ?   ?   A . n 
A 1 89 VAL 89 89 ?  ?   ?   A . n 
A 1 90 SER 90 90 ?  ?   ?   A . n 
A 1 91 GLY 91 91 ?  ?   ?   A . n 
A 1 92 PRO 92 92 ?  ?   ?   A . n 
A 1 93 GLU 93 93 ?  ?   ?   A . n 
A 1 94 ARG 94 94 ?  ?   ?   A . n 
B 1 1  GLY 1  1  ?  ?   ?   B . n 
B 1 2  ALA 2  2  ?  ?   ?   B . n 
B 1 3  MET 3  3  ?  ?   ?   B . n 
B 1 4  GLU 4  4  ?  ?   ?   B . n 
B 1 5  MET 5  5  ?  ?   ?   B . n 
B 1 6  ARG 6  6  ?  ?   ?   B . n 
B 1 7  LEU 7  7  ?  ?   ?   B . n 
B 1 8  GLU 8  8  ?  ?   ?   B . n 
B 1 9  LYS 9  9  ?  ?   ?   B . n 
B 1 10 ASP 10 10 ?  ?   ?   B . n 
B 1 11 ARG 11 11 ?  ?   ?   B . n 
B 1 12 PHE 12 12 12 PHE PHE B . n 
B 1 13 SER 13 13 13 SER SER B . n 
B 1 14 VAL 14 14 14 VAL VAL B . n 
B 1 15 ASN 15 15 15 ASN ASN B . n 
B 1 16 LEU 16 16 16 LEU LEU B . n 
B 1 17 ASP 17 17 17 ASP ASP B . n 
B 1 18 VAL 18 18 18 VAL VAL B . n 
B 1 19 LYS 19 19 19 LYS LYS B . n 
B 1 20 HIS 20 20 20 HIS HIS B . n 
B 1 21 PHE 21 21 21 PHE PHE B . n 
B 1 22 SER 22 22 22 SER SER B . n 
B 1 23 PRO 23 23 23 PRO PRO B . n 
B 1 24 GLU 24 24 24 GLU GLU B . n 
B 1 25 GLU 25 25 25 GLU GLU B . n 
B 1 26 LEU 26 26 26 LEU LEU B . n 
B 1 27 LYS 27 27 27 LYS LYS B . n 
B 1 28 VAL 28 28 28 VAL VAL B . n 
B 1 29 LYS 29 29 29 LYS LYS B . n 
B 1 30 VAL 30 30 30 VAL VAL B . n 
B 1 31 LEU 31 31 31 LEU LEU B . n 
B 1 32 GLY 32 32 32 GLY GLY B . n 
B 1 33 ASP 33 33 33 ASP ASP B . n 
B 1 34 VAL 34 34 34 VAL VAL B . n 
B 1 35 ILE 35 35 35 ILE ILE B . n 
B 1 36 GLU 36 36 36 GLU GLU B . n 
B 1 37 VAL 37 37 37 VAL VAL B . n 
B 1 38 HIS 38 38 38 HIS HIS B . n 
B 1 39 GLY 39 39 39 GLY GLY B . n 
B 1 40 LYS 40 40 40 LYS LYS B . n 
B 1 41 HIS 41 41 41 HIS HIS B . n 
B 1 42 GLU 42 42 42 GLU GLU B . n 
B 1 43 GLU 43 43 43 GLU GLU B . n 
B 1 44 ARG 44 44 44 ARG ARG B . n 
B 1 45 GLN 45 45 45 GLN GLN B . n 
B 1 46 ASP 46 46 46 ASP ASP B . n 
B 1 47 GLU 47 47 47 GLU GLU B . n 
B 1 48 HIS 48 48 48 HIS HIS B . n 
B 1 49 GLY 49 49 49 GLY GLY B . n 
B 1 50 PHE 50 50 50 PHE PHE B . n 
B 1 51 ILE 51 51 51 ILE ILE B . n 
B 1 52 SER 52 52 52 SER SER B . n 
B 1 53 ARG 53 53 53 ARG ARG B . n 
B 1 54 GLU 54 54 54 GLU GLU B . n 
B 1 55 PHE 55 55 55 PHE PHE B . n 
B 1 56 HIS 56 56 56 HIS HIS B . n 
B 1 57 ARG 57 57 57 ARG ARG B . n 
B 1 58 LYS 58 58 58 LYS LYS B . n 
B 1 59 TYR 59 59 59 TYR TYR B . n 
B 1 60 ARG 60 60 60 ARG ARG B . n 
B 1 61 ILE 61 61 61 ILE ILE B . n 
B 1 62 PRO 62 62 62 PRO PRO B . n 
B 1 63 ALA 63 63 63 ALA ALA B . n 
B 1 64 ASP 64 64 64 ASP ASP B . n 
B 1 65 VAL 65 65 65 VAL VAL B . n 
B 1 66 ASP 66 66 66 ASP ASP B . n 
B 1 67 PRO 67 67 67 PRO PRO B . n 
B 1 68 LEU 68 68 68 LEU LEU B . n 
B 1 69 THR 69 69 69 THR THR B . n 
B 1 70 ILE 70 70 70 ILE ILE B . n 
B 1 71 THR 71 71 71 THR THR B . n 
B 1 72 SER 72 72 72 SER SER B . n 
B 1 73 SER 73 73 73 SER SER B . n 
B 1 74 LEU 74 74 74 LEU LEU B . n 
B 1 75 SER 75 75 75 SER SER B . n 
B 1 76 SER 76 76 76 SER SER B . n 
B 1 77 ASP 77 77 77 ASP ASP B . n 
B 1 78 GLY 78 78 78 GLY GLY B . n 
B 1 79 VAL 79 79 79 VAL VAL B . n 
B 1 80 LEU 80 80 80 LEU LEU B . n 
B 1 81 THR 81 81 81 THR THR B . n 
B 1 82 VAL 82 82 82 VAL VAL B . n 
B 1 83 ASN 83 83 83 ASN ASN B . n 
B 1 84 GLY 84 84 ?  ?   ?   B . n 
B 1 85 PRO 85 85 ?  ?   ?   B . n 
B 1 86 ARG 86 86 ?  ?   ?   B . n 
B 1 87 LYS 87 87 ?  ?   ?   B . n 
B 1 88 GLN 88 88 ?  ?   ?   B . n 
B 1 89 VAL 89 89 ?  ?   ?   B . n 
B 1 90 SER 90 90 ?  ?   ?   B . n 
B 1 91 GLY 91 91 ?  ?   ?   B . n 
B 1 92 PRO 92 92 ?  ?   ?   B . n 
B 1 93 GLU 93 93 ?  ?   ?   B . n 
B 1 94 ARG 94 94 ?  ?   ?   B . n 
C 1 1  GLY 1  1  ?  ?   ?   C . n 
C 1 2  ALA 2  2  ?  ?   ?   C . n 
C 1 3  MET 3  3  3  MET MET C . n 
C 1 4  GLU 4  4  4  GLU GLU C . n 
C 1 5  MET 5  5  5  MET MET C . n 
C 1 6  ARG 6  6  6  ARG ARG C . n 
C 1 7  LEU 7  7  7  LEU LEU C . n 
C 1 8  GLU 8  8  8  GLU GLU C . n 
C 1 9  LYS 9  9  9  LYS LYS C . n 
C 1 10 ASP 10 10 10 ASP ASP C . n 
C 1 11 ARG 11 11 11 ARG ARG C . n 
C 1 12 PHE 12 12 12 PHE PHE C . n 
C 1 13 SER 13 13 13 SER SER C . n 
C 1 14 VAL 14 14 14 VAL VAL C . n 
C 1 15 ASN 15 15 15 ASN ASN C . n 
C 1 16 LEU 16 16 16 LEU LEU C . n 
C 1 17 ASP 17 17 17 ASP ASP C . n 
C 1 18 VAL 18 18 18 VAL VAL C . n 
C 1 19 LYS 19 19 19 LYS LYS C . n 
C 1 20 HIS 20 20 20 HIS HIS C . n 
C 1 21 PHE 21 21 21 PHE PHE C . n 
C 1 22 SER 22 22 22 SER SER C . n 
C 1 23 PRO 23 23 23 PRO PRO C . n 
C 1 24 GLU 24 24 24 GLU GLU C . n 
C 1 25 GLU 25 25 25 GLU GLU C . n 
C 1 26 LEU 26 26 26 LEU LEU C . n 
C 1 27 LYS 27 27 27 LYS LYS C . n 
C 1 28 VAL 28 28 28 VAL VAL C . n 
C 1 29 LYS 29 29 29 LYS LYS C . n 
C 1 30 VAL 30 30 30 VAL VAL C . n 
C 1 31 LEU 31 31 31 LEU LEU C . n 
C 1 32 GLY 32 32 32 GLY GLY C . n 
C 1 33 ASP 33 33 33 ASP ASP C . n 
C 1 34 VAL 34 34 34 VAL VAL C . n 
C 1 35 ILE 35 35 35 ILE ILE C . n 
C 1 36 GLU 36 36 36 GLU GLU C . n 
C 1 37 VAL 37 37 37 VAL VAL C . n 
C 1 38 HIS 38 38 38 HIS HIS C . n 
C 1 39 GLY 39 39 39 GLY GLY C . n 
C 1 40 LYS 40 40 40 LYS LYS C . n 
C 1 41 HIS 41 41 41 HIS HIS C . n 
C 1 42 GLU 42 42 42 GLU GLU C . n 
C 1 43 GLU 43 43 43 GLU GLU C . n 
C 1 44 ARG 44 44 44 ARG ARG C . n 
C 1 45 GLN 45 45 45 GLN GLN C . n 
C 1 46 ASP 46 46 46 ASP ASP C . n 
C 1 47 GLU 47 47 47 GLU GLU C . n 
C 1 48 HIS 48 48 48 HIS HIS C . n 
C 1 49 GLY 49 49 49 GLY GLY C . n 
C 1 50 PHE 50 50 50 PHE PHE C . n 
C 1 51 ILE 51 51 51 ILE ILE C . n 
C 1 52 SER 52 52 52 SER SER C . n 
C 1 53 ARG 53 53 53 ARG ARG C . n 
C 1 54 GLU 54 54 54 GLU GLU C . n 
C 1 55 PHE 55 55 55 PHE PHE C . n 
C 1 56 HIS 56 56 56 HIS HIS C . n 
C 1 57 ARG 57 57 57 ARG ARG C . n 
C 1 58 LYS 58 58 58 LYS LYS C . n 
C 1 59 TYR 59 59 59 TYR TYR C . n 
C 1 60 ARG 60 60 60 ARG ARG C . n 
C 1 61 ILE 61 61 61 ILE ILE C . n 
C 1 62 PRO 62 62 62 PRO PRO C . n 
C 1 63 ALA 63 63 63 ALA ALA C . n 
C 1 64 ASP 64 64 64 ASP ASP C . n 
C 1 65 VAL 65 65 65 VAL VAL C . n 
C 1 66 ASP 66 66 66 ASP ASP C . n 
C 1 67 PRO 67 67 67 PRO PRO C . n 
C 1 68 LEU 68 68 68 LEU LEU C . n 
C 1 69 THR 69 69 69 THR THR C . n 
C 1 70 ILE 70 70 70 ILE ILE C . n 
C 1 71 THR 71 71 71 THR THR C . n 
C 1 72 SER 72 72 72 SER SER C . n 
C 1 73 SER 73 73 73 SER SER C . n 
C 1 74 LEU 74 74 74 LEU LEU C . n 
C 1 75 SER 75 75 75 SER SER C . n 
C 1 76 SER 76 76 76 SER SER C . n 
C 1 77 ASP 77 77 77 ASP ASP C . n 
C 1 78 GLY 78 78 78 GLY GLY C . n 
C 1 79 VAL 79 79 79 VAL VAL C . n 
C 1 80 LEU 80 80 80 LEU LEU C . n 
C 1 81 THR 81 81 81 THR THR C . n 
C 1 82 VAL 82 82 82 VAL VAL C . n 
C 1 83 ASN 83 83 83 ASN ASN C . n 
C 1 84 GLY 84 84 84 GLY GLY C . n 
C 1 85 PRO 85 85 85 PRO PRO C . n 
C 1 86 ARG 86 86 86 ARG ARG C . n 
C 1 87 LYS 87 87 87 LYS LYS C . n 
C 1 88 GLN 88 88 ?  ?   ?   C . n 
C 1 89 VAL 89 89 ?  ?   ?   C . n 
C 1 90 SER 90 90 ?  ?   ?   C . n 
C 1 91 GLY 91 91 ?  ?   ?   C . n 
C 1 92 PRO 92 92 ?  ?   ?   C . n 
C 1 93 GLU 93 93 ?  ?   ?   C . n 
C 1 94 ARG 94 94 ?  ?   ?   C . n 
D 1 1  GLY 1  1  ?  ?   ?   D . n 
D 1 2  ALA 2  2  ?  ?   ?   D . n 
D 1 3  MET 3  3  ?  ?   ?   D . n 
D 1 4  GLU 4  4  ?  ?   ?   D . n 
D 1 5  MET 5  5  ?  ?   ?   D . n 
D 1 6  ARG 6  6  ?  ?   ?   D . n 
D 1 7  LEU 7  7  ?  ?   ?   D . n 
D 1 8  GLU 8  8  ?  ?   ?   D . n 
D 1 9  LYS 9  9  ?  ?   ?   D . n 
D 1 10 ASP 10 10 ?  ?   ?   D . n 
D 1 11 ARG 11 11 ?  ?   ?   D . n 
D 1 12 PHE 12 12 ?  ?   ?   D . n 
D 1 13 SER 13 13 ?  ?   ?   D . n 
D 1 14 VAL 14 14 14 VAL VAL D . n 
D 1 15 ASN 15 15 15 ASN ASN D . n 
D 1 16 LEU 16 16 16 LEU LEU D . n 
D 1 17 ASP 17 17 17 ASP ASP D . n 
D 1 18 VAL 18 18 18 VAL VAL D . n 
D 1 19 LYS 19 19 19 LYS LYS D . n 
D 1 20 HIS 20 20 20 HIS HIS D . n 
D 1 21 PHE 21 21 21 PHE PHE D . n 
D 1 22 SER 22 22 22 SER SER D . n 
D 1 23 PRO 23 23 23 PRO PRO D . n 
D 1 24 GLU 24 24 24 GLU GLU D . n 
D 1 25 GLU 25 25 25 GLU GLU D . n 
D 1 26 LEU 26 26 26 LEU LEU D . n 
D 1 27 LYS 27 27 27 LYS LYS D . n 
D 1 28 VAL 28 28 28 VAL VAL D . n 
D 1 29 LYS 29 29 29 LYS LYS D . n 
D 1 30 VAL 30 30 30 VAL VAL D . n 
D 1 31 LEU 31 31 31 LEU LEU D . n 
D 1 32 GLY 32 32 32 GLY GLY D . n 
D 1 33 ASP 33 33 33 ASP ASP D . n 
D 1 34 VAL 34 34 34 VAL VAL D . n 
D 1 35 ILE 35 35 35 ILE ILE D . n 
D 1 36 GLU 36 36 36 GLU GLU D . n 
D 1 37 VAL 37 37 37 VAL VAL D . n 
D 1 38 HIS 38 38 38 HIS HIS D . n 
D 1 39 GLY 39 39 39 GLY GLY D . n 
D 1 40 LYS 40 40 40 LYS LYS D . n 
D 1 41 HIS 41 41 41 HIS HIS D . n 
D 1 42 GLU 42 42 42 GLU GLU D . n 
D 1 43 GLU 43 43 43 GLU GLU D . n 
D 1 44 ARG 44 44 44 ARG ARG D . n 
D 1 45 GLN 45 45 45 GLN GLN D . n 
D 1 46 ASP 46 46 46 ASP ASP D . n 
D 1 47 GLU 47 47 47 GLU GLU D . n 
D 1 48 HIS 48 48 48 HIS HIS D . n 
D 1 49 GLY 49 49 49 GLY GLY D . n 
D 1 50 PHE 50 50 50 PHE PHE D . n 
D 1 51 ILE 51 51 51 ILE ILE D . n 
D 1 52 SER 52 52 52 SER SER D . n 
D 1 53 ARG 53 53 53 ARG ARG D . n 
D 1 54 GLU 54 54 54 GLU GLU D . n 
D 1 55 PHE 55 55 55 PHE PHE D . n 
D 1 56 HIS 56 56 56 HIS HIS D . n 
D 1 57 ARG 57 57 57 ARG ARG D . n 
D 1 58 LYS 58 58 58 LYS LYS D . n 
D 1 59 TYR 59 59 59 TYR TYR D . n 
D 1 60 ARG 60 60 60 ARG ARG D . n 
D 1 61 ILE 61 61 61 ILE ILE D . n 
D 1 62 PRO 62 62 62 PRO PRO D . n 
D 1 63 ALA 63 63 63 ALA ALA D . n 
D 1 64 ASP 64 64 64 ASP ASP D . n 
D 1 65 VAL 65 65 65 VAL VAL D . n 
D 1 66 ASP 66 66 66 ASP ASP D . n 
D 1 67 PRO 67 67 67 PRO PRO D . n 
D 1 68 LEU 68 68 68 LEU LEU D . n 
D 1 69 THR 69 69 69 THR THR D . n 
D 1 70 ILE 70 70 70 ILE ILE D . n 
D 1 71 THR 71 71 71 THR THR D . n 
D 1 72 SER 72 72 72 SER SER D . n 
D 1 73 SER 73 73 73 SER SER D . n 
D 1 74 LEU 74 74 74 LEU LEU D . n 
D 1 75 SER 75 75 75 SER SER D . n 
D 1 76 SER 76 76 76 SER SER D . n 
D 1 77 ASP 77 77 77 ASP ASP D . n 
D 1 78 GLY 78 78 78 GLY GLY D . n 
D 1 79 VAL 79 79 79 VAL VAL D . n 
D 1 80 LEU 80 80 80 LEU LEU D . n 
D 1 81 THR 81 81 81 THR THR D . n 
D 1 82 VAL 82 82 82 VAL VAL D . n 
D 1 83 ASN 83 83 83 ASN ASN D . n 
D 1 84 GLY 84 84 84 GLY GLY D . n 
D 1 85 PRO 85 85 ?  ?   ?   D . n 
D 1 86 ARG 86 86 ?  ?   ?   D . n 
D 1 87 LYS 87 87 ?  ?   ?   D . n 
D 1 88 GLN 88 88 ?  ?   ?   D . n 
D 1 89 VAL 89 89 ?  ?   ?   D . n 
D 1 90 SER 90 90 ?  ?   ?   D . n 
D 1 91 GLY 91 91 ?  ?   ?   D . n 
D 1 92 PRO 92 92 ?  ?   ?   D . n 
D 1 93 GLU 93 93 ?  ?   ?   D . n 
D 1 94 ARG 94 94 ?  ?   ?   D . n 
E 1 1  GLY 1  1  ?  ?   ?   E . n 
E 1 2  ALA 2  2  ?  ?   ?   E . n 
E 1 3  MET 3  3  ?  ?   ?   E . n 
E 1 4  GLU 4  4  ?  ?   ?   E . n 
E 1 5  MET 5  5  ?  ?   ?   E . n 
E 1 6  ARG 6  6  ?  ?   ?   E . n 
E 1 7  LEU 7  7  ?  ?   ?   E . n 
E 1 8  GLU 8  8  ?  ?   ?   E . n 
E 1 9  LYS 9  9  ?  ?   ?   E . n 
E 1 10 ASP 10 10 ?  ?   ?   E . n 
E 1 11 ARG 11 11 ?  ?   ?   E . n 
E 1 12 PHE 12 12 12 PHE PHE E . n 
E 1 13 SER 13 13 13 SER SER E . n 
E 1 14 VAL 14 14 14 VAL VAL E . n 
E 1 15 ASN 15 15 15 ASN ASN E . n 
E 1 16 LEU 16 16 16 LEU LEU E . n 
E 1 17 ASP 17 17 17 ASP ASP E . n 
E 1 18 VAL 18 18 18 VAL VAL E . n 
E 1 19 LYS 19 19 19 LYS LYS E . n 
E 1 20 HIS 20 20 20 HIS HIS E . n 
E 1 21 PHE 21 21 21 PHE PHE E . n 
E 1 22 SER 22 22 22 SER SER E . n 
E 1 23 PRO 23 23 23 PRO PRO E . n 
E 1 24 GLU 24 24 24 GLU GLU E . n 
E 1 25 GLU 25 25 25 GLU GLU E . n 
E 1 26 LEU 26 26 26 LEU LEU E . n 
E 1 27 LYS 27 27 27 LYS LYS E . n 
E 1 28 VAL 28 28 28 VAL VAL E . n 
E 1 29 LYS 29 29 29 LYS LYS E . n 
E 1 30 VAL 30 30 30 VAL VAL E . n 
E 1 31 LEU 31 31 31 LEU LEU E . n 
E 1 32 GLY 32 32 32 GLY GLY E . n 
E 1 33 ASP 33 33 33 ASP ASP E . n 
E 1 34 VAL 34 34 34 VAL VAL E . n 
E 1 35 ILE 35 35 35 ILE ILE E . n 
E 1 36 GLU 36 36 36 GLU GLU E . n 
E 1 37 VAL 37 37 37 VAL VAL E . n 
E 1 38 HIS 38 38 38 HIS HIS E . n 
E 1 39 GLY 39 39 39 GLY GLY E . n 
E 1 40 LYS 40 40 40 LYS LYS E . n 
E 1 41 HIS 41 41 41 HIS HIS E . n 
E 1 42 GLU 42 42 42 GLU GLU E . n 
E 1 43 GLU 43 43 43 GLU GLU E . n 
E 1 44 ARG 44 44 44 ARG ARG E . n 
E 1 45 GLN 45 45 45 GLN GLN E . n 
E 1 46 ASP 46 46 46 ASP ASP E . n 
E 1 47 GLU 47 47 47 GLU GLU E . n 
E 1 48 HIS 48 48 48 HIS HIS E . n 
E 1 49 GLY 49 49 49 GLY GLY E . n 
E 1 50 PHE 50 50 50 PHE PHE E . n 
E 1 51 ILE 51 51 51 ILE ILE E . n 
E 1 52 SER 52 52 52 SER SER E . n 
E 1 53 ARG 53 53 53 ARG ARG E . n 
E 1 54 GLU 54 54 54 GLU GLU E . n 
E 1 55 PHE 55 55 55 PHE PHE E . n 
E 1 56 HIS 56 56 56 HIS HIS E . n 
E 1 57 ARG 57 57 57 ARG ARG E . n 
E 1 58 LYS 58 58 58 LYS LYS E . n 
E 1 59 TYR 59 59 59 TYR TYR E . n 
E 1 60 ARG 60 60 60 ARG ARG E . n 
E 1 61 ILE 61 61 61 ILE ILE E . n 
E 1 62 PRO 62 62 62 PRO PRO E . n 
E 1 63 ALA 63 63 63 ALA ALA E . n 
E 1 64 ASP 64 64 64 ASP ASP E . n 
E 1 65 VAL 65 65 65 VAL VAL E . n 
E 1 66 ASP 66 66 66 ASP ASP E . n 
E 1 67 PRO 67 67 67 PRO PRO E . n 
E 1 68 LEU 68 68 68 LEU LEU E . n 
E 1 69 THR 69 69 69 THR THR E . n 
E 1 70 ILE 70 70 70 ILE ILE E . n 
E 1 71 THR 71 71 71 THR THR E . n 
E 1 72 SER 72 72 72 SER SER E . n 
E 1 73 SER 73 73 73 SER SER E . n 
E 1 74 LEU 74 74 74 LEU LEU E . n 
E 1 75 SER 75 75 75 SER SER E . n 
E 1 76 SER 76 76 76 SER SER E . n 
E 1 77 ASP 77 77 77 ASP ASP E . n 
E 1 78 GLY 78 78 78 GLY GLY E . n 
E 1 79 VAL 79 79 79 VAL VAL E . n 
E 1 80 LEU 80 80 80 LEU LEU E . n 
E 1 81 THR 81 81 81 THR THR E . n 
E 1 82 VAL 82 82 82 VAL VAL E . n 
E 1 83 ASN 83 83 83 ASN ASN E . n 
E 1 84 GLY 84 84 84 GLY GLY E . n 
E 1 85 PRO 85 85 85 PRO PRO E . n 
E 1 86 ARG 86 86 ?  ?   ?   E . n 
E 1 87 LYS 87 87 ?  ?   ?   E . n 
E 1 88 GLN 88 88 ?  ?   ?   E . n 
E 1 89 VAL 89 89 ?  ?   ?   E . n 
E 1 90 SER 90 90 ?  ?   ?   E . n 
E 1 91 GLY 91 91 ?  ?   ?   E . n 
E 1 92 PRO 92 92 ?  ?   ?   E . n 
E 1 93 GLU 93 93 ?  ?   ?   E . n 
E 1 94 ARG 94 94 ?  ?   ?   E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 2 HOH 1  2001 2001 HOH HOH A . 
F 2 HOH 2  2002 2002 HOH HOH A . 
F 2 HOH 3  2003 2003 HOH HOH A . 
F 2 HOH 4  2004 2004 HOH HOH A . 
F 2 HOH 5  2005 2005 HOH HOH A . 
F 2 HOH 6  2006 2006 HOH HOH A . 
F 2 HOH 7  2007 2007 HOH HOH A . 
F 2 HOH 8  2008 2008 HOH HOH A . 
F 2 HOH 9  2009 2009 HOH HOH A . 
F 2 HOH 10 2010 2010 HOH HOH A . 
F 2 HOH 11 2011 2011 HOH HOH A . 
F 2 HOH 12 2012 2012 HOH HOH A . 
F 2 HOH 13 2013 2013 HOH HOH A . 
F 2 HOH 14 2014 2014 HOH HOH A . 
F 2 HOH 15 2015 2015 HOH HOH A . 
F 2 HOH 16 2016 2016 HOH HOH A . 
F 2 HOH 17 2017 2017 HOH HOH A . 
F 2 HOH 18 2018 2018 HOH HOH A . 
F 2 HOH 19 2019 2019 HOH HOH A . 
F 2 HOH 20 2020 2020 HOH HOH A . 
F 2 HOH 21 2021 2021 HOH HOH A . 
F 2 HOH 22 2022 2022 HOH HOH A . 
F 2 HOH 23 2023 2023 HOH HOH A . 
F 2 HOH 24 2024 2024 HOH HOH A . 
G 2 HOH 1  2001 2001 HOH HOH B . 
G 2 HOH 2  2002 2002 HOH HOH B . 
G 2 HOH 3  2003 2003 HOH HOH B . 
G 2 HOH 4  2004 2004 HOH HOH B . 
G 2 HOH 5  2005 2005 HOH HOH B . 
G 2 HOH 6  2006 2006 HOH HOH B . 
G 2 HOH 7  2007 2007 HOH HOH B . 
G 2 HOH 8  2008 2008 HOH HOH B . 
G 2 HOH 9  2009 2009 HOH HOH B . 
G 2 HOH 10 2010 2010 HOH HOH B . 
G 2 HOH 11 2011 2011 HOH HOH B . 
G 2 HOH 12 2012 2012 HOH HOH B . 
G 2 HOH 13 2013 2013 HOH HOH B . 
G 2 HOH 14 2014 2014 HOH HOH B . 
G 2 HOH 15 2015 2015 HOH HOH B . 
G 2 HOH 16 2016 2016 HOH HOH B . 
G 2 HOH 17 2017 2017 HOH HOH B . 
G 2 HOH 18 2018 2018 HOH HOH B . 
G 2 HOH 19 2019 2019 HOH HOH B . 
G 2 HOH 20 2020 2020 HOH HOH B . 
G 2 HOH 21 2021 2021 HOH HOH B . 
G 2 HOH 22 2022 2022 HOH HOH B . 
G 2 HOH 23 2023 2023 HOH HOH B . 
G 2 HOH 24 2024 2024 HOH HOH B . 
G 2 HOH 25 2025 2025 HOH HOH B . 
G 2 HOH 26 2026 2026 HOH HOH B . 
H 2 HOH 1  2001 2001 HOH HOH C . 
H 2 HOH 2  2002 2002 HOH HOH C . 
H 2 HOH 3  2003 2003 HOH HOH C . 
H 2 HOH 4  2004 2004 HOH HOH C . 
H 2 HOH 5  2005 2005 HOH HOH C . 
H 2 HOH 6  2006 2006 HOH HOH C . 
H 2 HOH 7  2007 2007 HOH HOH C . 
H 2 HOH 8  2008 2008 HOH HOH C . 
H 2 HOH 9  2009 2009 HOH HOH C . 
H 2 HOH 10 2010 2010 HOH HOH C . 
H 2 HOH 11 2011 2011 HOH HOH C . 
H 2 HOH 12 2012 2012 HOH HOH C . 
H 2 HOH 13 2013 2013 HOH HOH C . 
H 2 HOH 14 2014 2014 HOH HOH C . 
H 2 HOH 15 2015 2015 HOH HOH C . 
H 2 HOH 16 2016 2016 HOH HOH C . 
H 2 HOH 17 2017 2017 HOH HOH C . 
H 2 HOH 18 2018 2018 HOH HOH C . 
H 2 HOH 19 2019 2019 HOH HOH C . 
H 2 HOH 20 2020 2020 HOH HOH C . 
H 2 HOH 21 2021 2021 HOH HOH C . 
H 2 HOH 22 2022 2022 HOH HOH C . 
H 2 HOH 23 2023 2023 HOH HOH C . 
H 2 HOH 24 2024 2024 HOH HOH C . 
I 2 HOH 1  2001 2001 HOH HOH D . 
I 2 HOH 2  2002 2002 HOH HOH D . 
I 2 HOH 3  2003 2003 HOH HOH D . 
I 2 HOH 4  2004 2004 HOH HOH D . 
I 2 HOH 5  2005 2005 HOH HOH D . 
J 2 HOH 1  2001 2001 HOH HOH E . 
J 2 HOH 2  2002 2002 HOH HOH E . 
J 2 HOH 3  2003 2003 HOH HOH E . 
J 2 HOH 4  2004 2004 HOH HOH E . 
J 2 HOH 5  2005 2005 HOH HOH E . 
J 2 HOH 6  2006 2006 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
3 author_and_software_defined_assembly PQS monomeric 1 
4 author_and_software_defined_assembly PQS monomeric 1 
5 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,F 
2 1 B,G 
3 1 C,H 
4 1 D,I 
5 1 E,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-08-11 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Experimental preparation'  
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow   
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
4 4 'Structure model' struct_biol          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_exptl_crystal_grow.temp'                    
3 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 ? ? ? ? 
MOSFLM 'data reduction' .                 ? 2 ? ? ? ? 
SCALA  'data scaling'   .                 ? 3 ? ? ? ? 
PHASER phasing          .                 ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             2WJ7 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'THE SEQUENCE IS RESIDUES 67-157 PRECEDED BY A GAM TAG' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ A LYS 9  ? ? O A HOH 2003 ? ? 1.96 
2 1 O  B LEU 68 ? ? N B ILE 70   ? ? 2.16 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    N 
_pdbx_validate_symm_contact.auth_asym_id_1    C 
_pdbx_validate_symm_contact.auth_comp_id_1    LEU 
_pdbx_validate_symm_contact.auth_seq_id_1     7 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NE2 
_pdbx_validate_symm_contact.auth_asym_id_2    C 
_pdbx_validate_symm_contact.auth_comp_id_2    GLN 
_pdbx_validate_symm_contact.auth_seq_id_2     45 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_445 
_pdbx_validate_symm_contact.dist              1.90 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A GLU 4 ? ? CG A GLU 4 ? ? 1.657 1.517 0.140 0.019 N 
2 1 CG A GLU 4 ? ? CD A GLU 4 ? ? 1.628 1.515 0.113 0.015 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 44 ? ? CZ A ARG 44 ? ? NH2 A ARG 44 ? ? 115.44 120.30 -4.86  0.50 N 
2 1 CB D ILE 51 ? ? CA D ILE 51 ? ? C   D ILE 51 ? ? 97.91  111.60 -13.69 2.00 N 
3 1 C  D ILE 61 ? ? N  D PRO 62 ? ? CA  D PRO 62 ? ? 129.18 119.30 9.88   1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 4  ? ? -34.23  150.84  
2  1 ASP A 64 ? ? -98.19  37.78   
3  1 LYS B 19 ? ? -49.04  -14.79  
4  1 PRO B 62 ? ? -55.14  32.45   
5  1 ALA B 63 ? ? 67.36   -57.96  
6  1 ASP B 64 ? ? -61.55  40.93   
7  1 VAL B 65 ? ? -179.28 133.14  
8  1 ASP B 66 ? ? 166.29  121.00  
9  1 PRO B 67 ? ? -37.54  -157.92 
10 1 THR B 69 ? ? 18.61   -53.82  
11 1 ASP C 46 ? ? -127.19 -161.27 
12 1 ASP C 64 ? ? -98.33  43.56   
13 1 LYS D 19 ? ? -49.81  -19.73  
14 1 ASP D 46 ? ? -170.32 -173.86 
15 1 PRO D 62 ? ? -56.25  33.37   
16 1 ALA D 63 ? ? 68.86   -58.16  
17 1 ASP D 64 ? ? -63.93  43.87   
18 1 VAL D 65 ? ? 178.68  132.98  
19 1 ASP D 66 ? ? 165.56  120.03  
20 1 PRO D 67 ? ? -38.00  -157.92 
21 1 LEU D 68 ? ? -24.48  -75.81  
22 1 THR D 69 ? ? 30.88   -58.07  
23 1 ASP D 77 ? ? -97.83  32.00   
24 1 LYS E 19 ? ? -46.60  -14.98  
25 1 HIS E 41 ? ? -171.97 125.73  
26 1 ASP E 46 ? ? -167.81 3.83    
27 1 GLU E 47 ? ? 97.52   -67.13  
28 1 ASP E 64 ? ? -95.83  43.98   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2004 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   7.55 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A MET 3  ? CG  ? A MET 3  CG  
2   1 Y 1 A MET 3  ? SD  ? A MET 3  SD  
3   1 Y 1 A MET 3  ? CE  ? A MET 3  CE  
4   1 Y 1 A ARG 6  ? CG  ? A ARG 6  CG  
5   1 Y 1 A ARG 6  ? CD  ? A ARG 6  CD  
6   1 Y 1 A ARG 6  ? NE  ? A ARG 6  NE  
7   1 Y 1 A ARG 6  ? CZ  ? A ARG 6  CZ  
8   1 Y 1 A ARG 6  ? NH1 ? A ARG 6  NH1 
9   1 Y 1 A ARG 6  ? NH2 ? A ARG 6  NH2 
10  1 Y 1 A ARG 11 ? CG  ? A ARG 11 CG  
11  1 Y 1 A ARG 11 ? CD  ? A ARG 11 CD  
12  1 Y 1 A ARG 11 ? NE  ? A ARG 11 NE  
13  1 Y 1 A ARG 11 ? CZ  ? A ARG 11 CZ  
14  1 Y 1 A ARG 11 ? NH1 ? A ARG 11 NH1 
15  1 Y 1 A ARG 11 ? NH2 ? A ARG 11 NH2 
16  1 Y 1 A LYS 27 ? CG  ? A LYS 27 CG  
17  1 Y 1 A LYS 27 ? CD  ? A LYS 27 CD  
18  1 Y 1 A LYS 27 ? CE  ? A LYS 27 CE  
19  1 Y 1 A LYS 27 ? NZ  ? A LYS 27 NZ  
20  1 Y 1 A LYS 29 ? CD  ? A LYS 29 CD  
21  1 Y 1 A LYS 29 ? CE  ? A LYS 29 CE  
22  1 Y 1 A LYS 29 ? NZ  ? A LYS 29 NZ  
23  1 Y 1 A ASP 33 ? CG  ? A ASP 33 CG  
24  1 Y 1 A ASP 33 ? OD1 ? A ASP 33 OD1 
25  1 Y 1 A ASP 33 ? OD2 ? A ASP 33 OD2 
26  1 Y 1 A LYS 40 ? CD  ? A LYS 40 CD  
27  1 Y 1 A LYS 40 ? CE  ? A LYS 40 CE  
28  1 Y 1 A LYS 40 ? NZ  ? A LYS 40 NZ  
29  1 Y 1 A GLU 42 ? CG  ? A GLU 42 CG  
30  1 Y 1 A GLU 42 ? CD  ? A GLU 42 CD  
31  1 Y 1 A GLU 42 ? OE1 ? A GLU 42 OE1 
32  1 Y 1 A GLU 42 ? OE2 ? A GLU 42 OE2 
33  1 Y 1 A ARG 60 ? CD  ? A ARG 60 CD  
34  1 Y 1 A ARG 60 ? NE  ? A ARG 60 NE  
35  1 Y 1 A ARG 60 ? CZ  ? A ARG 60 CZ  
36  1 Y 1 A ARG 60 ? NH1 ? A ARG 60 NH1 
37  1 Y 1 A ARG 60 ? NH2 ? A ARG 60 NH2 
38  1 Y 1 A LYS 87 ? CG  ? A LYS 87 CG  
39  1 Y 1 A LYS 87 ? CD  ? A LYS 87 CD  
40  1 Y 1 A LYS 87 ? CE  ? A LYS 87 CE  
41  1 Y 1 A LYS 87 ? NZ  ? A LYS 87 NZ  
42  1 Y 1 B PHE 12 ? CD1 ? B PHE 12 CD1 
43  1 Y 1 B PHE 12 ? CD2 ? B PHE 12 CD2 
44  1 Y 1 B PHE 12 ? CE1 ? B PHE 12 CE1 
45  1 Y 1 B PHE 12 ? CE2 ? B PHE 12 CE2 
46  1 Y 1 B PHE 12 ? CZ  ? B PHE 12 CZ  
47  1 Y 1 B GLU 24 ? CD  ? B GLU 24 CD  
48  1 Y 1 B GLU 24 ? OE1 ? B GLU 24 OE1 
49  1 Y 1 B GLU 24 ? OE2 ? B GLU 24 OE2 
50  1 Y 1 B LYS 27 ? CD  ? B LYS 27 CD  
51  1 Y 1 B LYS 27 ? CE  ? B LYS 27 CE  
52  1 Y 1 B LYS 27 ? NZ  ? B LYS 27 NZ  
53  1 Y 1 B GLU 42 ? CG  ? B GLU 42 CG  
54  1 Y 1 B GLU 42 ? CD  ? B GLU 42 CD  
55  1 Y 1 B GLU 42 ? OE1 ? B GLU 42 OE1 
56  1 Y 1 B GLU 42 ? OE2 ? B GLU 42 OE2 
57  1 Y 1 B GLU 43 ? CG  ? B GLU 43 CG  
58  1 Y 1 B GLU 43 ? CD  ? B GLU 43 CD  
59  1 Y 1 B GLU 43 ? OE1 ? B GLU 43 OE1 
60  1 Y 1 B GLU 43 ? OE2 ? B GLU 43 OE2 
61  1 Y 1 C MET 3  ? SD  ? C MET 3  SD  
62  1 Y 1 C MET 3  ? CE  ? C MET 3  CE  
63  1 Y 1 C GLU 4  ? CG  ? C GLU 4  CG  
64  1 Y 1 C GLU 4  ? CD  ? C GLU 4  CD  
65  1 Y 1 C GLU 4  ? OE1 ? C GLU 4  OE1 
66  1 Y 1 C GLU 4  ? OE2 ? C GLU 4  OE2 
67  1 Y 1 C ARG 6  ? CG  ? C ARG 6  CG  
68  1 Y 1 C ARG 6  ? CD  ? C ARG 6  CD  
69  1 Y 1 C ARG 6  ? NE  ? C ARG 6  NE  
70  1 Y 1 C ARG 6  ? CZ  ? C ARG 6  CZ  
71  1 Y 1 C ARG 6  ? NH1 ? C ARG 6  NH1 
72  1 Y 1 C ARG 6  ? NH2 ? C ARG 6  NH2 
73  1 Y 1 C ARG 11 ? CD  ? C ARG 11 CD  
74  1 Y 1 C ARG 11 ? NE  ? C ARG 11 NE  
75  1 Y 1 C ARG 11 ? CZ  ? C ARG 11 CZ  
76  1 Y 1 C ARG 11 ? NH1 ? C ARG 11 NH1 
77  1 Y 1 C ARG 11 ? NH2 ? C ARG 11 NH2 
78  1 Y 1 C LYS 27 ? CD  ? C LYS 27 CD  
79  1 Y 1 C LYS 27 ? CE  ? C LYS 27 CE  
80  1 Y 1 C LYS 27 ? NZ  ? C LYS 27 NZ  
81  1 Y 1 C LYS 29 ? CD  ? C LYS 29 CD  
82  1 Y 1 C LYS 29 ? CE  ? C LYS 29 CE  
83  1 Y 1 C LYS 29 ? NZ  ? C LYS 29 NZ  
84  1 Y 1 C LEU 31 ? CG  ? C LEU 31 CG  
85  1 Y 1 C LEU 31 ? CD1 ? C LEU 31 CD1 
86  1 Y 1 C LEU 31 ? CD2 ? C LEU 31 CD2 
87  1 Y 1 C GLU 43 ? CD  ? C GLU 43 CD  
88  1 Y 1 C GLU 43 ? OE1 ? C GLU 43 OE1 
89  1 Y 1 C GLU 43 ? OE2 ? C GLU 43 OE2 
90  1 Y 1 C GLU 47 ? CG  ? C GLU 47 CG  
91  1 Y 1 C GLU 47 ? CD  ? C GLU 47 CD  
92  1 Y 1 C GLU 47 ? OE1 ? C GLU 47 OE1 
93  1 Y 1 C GLU 47 ? OE2 ? C GLU 47 OE2 
94  1 Y 1 C LYS 58 ? CD  ? C LYS 58 CD  
95  1 Y 1 C LYS 58 ? CE  ? C LYS 58 CE  
96  1 Y 1 C LYS 58 ? NZ  ? C LYS 58 NZ  
97  1 Y 1 C ARG 60 ? CD  ? C ARG 60 CD  
98  1 Y 1 C ARG 60 ? NE  ? C ARG 60 NE  
99  1 Y 1 C ARG 60 ? CZ  ? C ARG 60 CZ  
100 1 Y 1 C ARG 60 ? NH1 ? C ARG 60 NH1 
101 1 Y 1 C ARG 60 ? NH2 ? C ARG 60 NH2 
102 1 Y 1 C LEU 68 ? CG  ? C LEU 68 CG  
103 1 Y 1 C LEU 68 ? CD1 ? C LEU 68 CD1 
104 1 Y 1 C LEU 68 ? CD2 ? C LEU 68 CD2 
105 1 Y 1 C ILE 70 ? CG1 ? C ILE 70 CG1 
106 1 Y 1 C ILE 70 ? CG2 ? C ILE 70 CG2 
107 1 Y 1 C ILE 70 ? CD1 ? C ILE 70 CD1 
108 1 Y 1 C LYS 87 ? CG  ? C LYS 87 CG  
109 1 Y 1 C LYS 87 ? CD  ? C LYS 87 CD  
110 1 Y 1 C LYS 87 ? CE  ? C LYS 87 CE  
111 1 Y 1 C LYS 87 ? NZ  ? C LYS 87 NZ  
112 1 Y 1 D LYS 19 ? CG  ? D LYS 19 CG  
113 1 Y 1 D LYS 19 ? CD  ? D LYS 19 CD  
114 1 Y 1 D LYS 19 ? CE  ? D LYS 19 CE  
115 1 Y 1 D LYS 19 ? NZ  ? D LYS 19 NZ  
116 1 Y 1 D GLU 24 ? CG  ? D GLU 24 CG  
117 1 Y 1 D GLU 24 ? CD  ? D GLU 24 CD  
118 1 Y 1 D GLU 24 ? OE1 ? D GLU 24 OE1 
119 1 Y 1 D GLU 24 ? OE2 ? D GLU 24 OE2 
120 1 Y 1 D LYS 27 ? CD  ? D LYS 27 CD  
121 1 Y 1 D LYS 27 ? CE  ? D LYS 27 CE  
122 1 Y 1 D LYS 27 ? NZ  ? D LYS 27 NZ  
123 1 Y 1 D LYS 29 ? CD  ? D LYS 29 CD  
124 1 Y 1 D LYS 29 ? CE  ? D LYS 29 CE  
125 1 Y 1 D LYS 29 ? NZ  ? D LYS 29 NZ  
126 1 Y 1 D ASP 33 ? CG  ? D ASP 33 CG  
127 1 Y 1 D ASP 33 ? OD1 ? D ASP 33 OD1 
128 1 Y 1 D ASP 33 ? OD2 ? D ASP 33 OD2 
129 1 Y 1 D GLU 42 ? CG  ? D GLU 42 CG  
130 1 Y 1 D GLU 42 ? CD  ? D GLU 42 CD  
131 1 Y 1 D GLU 42 ? OE1 ? D GLU 42 OE1 
132 1 Y 1 D GLU 42 ? OE2 ? D GLU 42 OE2 
133 1 Y 1 D GLU 47 ? CG  ? D GLU 47 CG  
134 1 Y 1 D GLU 47 ? CD  ? D GLU 47 CD  
135 1 Y 1 D GLU 47 ? OE1 ? D GLU 47 OE1 
136 1 Y 1 D GLU 47 ? OE2 ? D GLU 47 OE2 
137 1 Y 1 D PHE 50 ? CD1 ? D PHE 50 CD1 
138 1 Y 1 D PHE 50 ? CD2 ? D PHE 50 CD2 
139 1 Y 1 D PHE 50 ? CE1 ? D PHE 50 CE1 
140 1 Y 1 D PHE 50 ? CE2 ? D PHE 50 CE2 
141 1 Y 1 D PHE 50 ? CZ  ? D PHE 50 CZ  
142 1 Y 1 D ARG 60 ? CD  ? D ARG 60 CD  
143 1 Y 1 D ARG 60 ? NE  ? D ARG 60 NE  
144 1 Y 1 D ARG 60 ? CZ  ? D ARG 60 CZ  
145 1 Y 1 D ARG 60 ? NH1 ? D ARG 60 NH1 
146 1 Y 1 D ARG 60 ? NH2 ? D ARG 60 NH2 
147 1 Y 1 D ILE 61 ? CG1 ? D ILE 61 CG1 
148 1 Y 1 D ILE 61 ? CG2 ? D ILE 61 CG2 
149 1 Y 1 D ILE 61 ? CD1 ? D ILE 61 CD1 
150 1 Y 1 E LEU 31 ? CG  ? E LEU 31 CG  
151 1 Y 1 E LEU 31 ? CD1 ? E LEU 31 CD1 
152 1 Y 1 E LEU 31 ? CD2 ? E LEU 31 CD2 
153 1 Y 1 E GLU 47 ? CG  ? E GLU 47 CG  
154 1 Y 1 E GLU 47 ? CD  ? E GLU 47 CD  
155 1 Y 1 E GLU 47 ? OE1 ? E GLU 47 OE1 
156 1 Y 1 E GLU 47 ? OE2 ? E GLU 47 OE2 
157 1 Y 1 E LYS 58 ? CD  ? E LYS 58 CD  
158 1 Y 1 E LYS 58 ? CE  ? E LYS 58 CE  
159 1 Y 1 E LYS 58 ? NZ  ? E LYS 58 NZ  
160 1 Y 1 E ARG 60 ? CD  ? E ARG 60 CD  
161 1 Y 1 E ARG 60 ? NE  ? E ARG 60 NE  
162 1 Y 1 E ARG 60 ? CZ  ? E ARG 60 CZ  
163 1 Y 1 E ARG 60 ? NH1 ? E ARG 60 NH1 
164 1 Y 1 E ARG 60 ? NH2 ? E ARG 60 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1  ? A GLY 1  
2  1 Y 1 A ALA 2  ? A ALA 2  
3  1 Y 1 A GLN 88 ? A GLN 88 
4  1 Y 1 A VAL 89 ? A VAL 89 
5  1 Y 1 A SER 90 ? A SER 90 
6  1 Y 1 A GLY 91 ? A GLY 91 
7  1 Y 1 A PRO 92 ? A PRO 92 
8  1 Y 1 A GLU 93 ? A GLU 93 
9  1 Y 1 A ARG 94 ? A ARG 94 
10 1 Y 1 B GLY 1  ? B GLY 1  
11 1 Y 1 B ALA 2  ? B ALA 2  
12 1 Y 1 B MET 3  ? B MET 3  
13 1 Y 1 B GLU 4  ? B GLU 4  
14 1 Y 1 B MET 5  ? B MET 5  
15 1 Y 1 B ARG 6  ? B ARG 6  
16 1 Y 1 B LEU 7  ? B LEU 7  
17 1 Y 1 B GLU 8  ? B GLU 8  
18 1 Y 1 B LYS 9  ? B LYS 9  
19 1 Y 1 B ASP 10 ? B ASP 10 
20 1 Y 1 B ARG 11 ? B ARG 11 
21 1 Y 1 B GLY 84 ? B GLY 84 
22 1 Y 1 B PRO 85 ? B PRO 85 
23 1 Y 1 B ARG 86 ? B ARG 86 
24 1 Y 1 B LYS 87 ? B LYS 87 
25 1 Y 1 B GLN 88 ? B GLN 88 
26 1 Y 1 B VAL 89 ? B VAL 89 
27 1 Y 1 B SER 90 ? B SER 90 
28 1 Y 1 B GLY 91 ? B GLY 91 
29 1 Y 1 B PRO 92 ? B PRO 92 
30 1 Y 1 B GLU 93 ? B GLU 93 
31 1 Y 1 B ARG 94 ? B ARG 94 
32 1 Y 1 C GLY 1  ? C GLY 1  
33 1 Y 1 C ALA 2  ? C ALA 2  
34 1 Y 1 C GLN 88 ? C GLN 88 
35 1 Y 1 C VAL 89 ? C VAL 89 
36 1 Y 1 C SER 90 ? C SER 90 
37 1 Y 1 C GLY 91 ? C GLY 91 
38 1 Y 1 C PRO 92 ? C PRO 92 
39 1 Y 1 C GLU 93 ? C GLU 93 
40 1 Y 1 C ARG 94 ? C ARG 94 
41 1 Y 1 D GLY 1  ? D GLY 1  
42 1 Y 1 D ALA 2  ? D ALA 2  
43 1 Y 1 D MET 3  ? D MET 3  
44 1 Y 1 D GLU 4  ? D GLU 4  
45 1 Y 1 D MET 5  ? D MET 5  
46 1 Y 1 D ARG 6  ? D ARG 6  
47 1 Y 1 D LEU 7  ? D LEU 7  
48 1 Y 1 D GLU 8  ? D GLU 8  
49 1 Y 1 D LYS 9  ? D LYS 9  
50 1 Y 1 D ASP 10 ? D ASP 10 
51 1 Y 1 D ARG 11 ? D ARG 11 
52 1 Y 1 D PHE 12 ? D PHE 12 
53 1 Y 1 D SER 13 ? D SER 13 
54 1 Y 1 D PRO 85 ? D PRO 85 
55 1 Y 1 D ARG 86 ? D ARG 86 
56 1 Y 1 D LYS 87 ? D LYS 87 
57 1 Y 1 D GLN 88 ? D GLN 88 
58 1 Y 1 D VAL 89 ? D VAL 89 
59 1 Y 1 D SER 90 ? D SER 90 
60 1 Y 1 D GLY 91 ? D GLY 91 
61 1 Y 1 D PRO 92 ? D PRO 92 
62 1 Y 1 D GLU 93 ? D GLU 93 
63 1 Y 1 D ARG 94 ? D ARG 94 
64 1 Y 1 E GLY 1  ? E GLY 1  
65 1 Y 1 E ALA 2  ? E ALA 2  
66 1 Y 1 E MET 3  ? E MET 3  
67 1 Y 1 E GLU 4  ? E GLU 4  
68 1 Y 1 E MET 5  ? E MET 5  
69 1 Y 1 E ARG 6  ? E ARG 6  
70 1 Y 1 E LEU 7  ? E LEU 7  
71 1 Y 1 E GLU 8  ? E GLU 8  
72 1 Y 1 E LYS 9  ? E LYS 9  
73 1 Y 1 E ASP 10 ? E ASP 10 
74 1 Y 1 E ARG 11 ? E ARG 11 
75 1 Y 1 E ARG 86 ? E ARG 86 
76 1 Y 1 E LYS 87 ? E LYS 87 
77 1 Y 1 E GLN 88 ? E GLN 88 
78 1 Y 1 E VAL 89 ? E VAL 89 
79 1 Y 1 E SER 90 ? E SER 90 
80 1 Y 1 E GLY 91 ? E GLY 91 
81 1 Y 1 E PRO 92 ? E PRO 92 
82 1 Y 1 E GLU 93 ? E GLU 93 
83 1 Y 1 E ARG 94 ? E ARG 94 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#