data_2WLJ
# 
_entry.id   2WLJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WLJ         
PDBE  EBI-40206    
WWPDB D_1290040206 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1XL4 re-refinement 'INTERMEDIATE GATING STRUCTURE 1 OF THE INWARDLY RECTIFYINGK+ CHANNEL KIRBAC3.1'                          
PDB 2WLN unspecified   'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLO unspecified   'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLL unspecified   'POTASSIUM CHANNEL FROM BURKHOLDERIA PSEUDOMALLEI'                                                        
PDB 2WLI unspecified   'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLM unspecified   'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 1XL6 unspecified   'INTERMEDIATE GATING STRUCTURE 2 OF THE INWARDLY RECTIFYINGK+ CHANNEL KIRBAC3.1'                          
PDB 2WLH unspecified   'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLK unspecified   'STRUCTURE OF THE ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM' 
PDB 2X6B unspecified   'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2X6A unspecified   'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2X6C unspecified   'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WLJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-24 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clarke, O.B.' 1 
'Caputo, A.T.' 2 
'Smith, B.J.'  3 
'Gulbis, J.M.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary         'Domain Reorientation and Rotation of an Intracellular Assembly Regulate Conduction in Kir Potassium Channels.' 
'Cell(Cambridge,Mass.)' 141 1018 ? 2010 CELLB5 US 0092-8674 0998 ? 20564790 10.1016/J.CELL.2010.05.003 
original_data_1 'Two Intermediate Gating State Crystal Structures of the Kirbac3.1 K+ Channel'                                  
'To be Published'       ?   ?    ? ?    ?      ?  ?         0353 ? ?        ?                          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary         'Clarke, O.B.'     1  ? 
primary         'Caputo, A.T.'     2  ? 
primary         'Hill, A.P.'       3  ? 
primary         'Vandenberg, J.I.' 4  ? 
primary         'Smith, B.J.'      5  ? 
primary         'Gulbis, J.M.'     6  ? 
original_data_1 'Gulbis, J.M.'     7  ? 
original_data_1 'Kuo, A.'          8  ? 
original_data_1 'Smith, B.'        9  ? 
original_data_1 'Doyle, D.A.'      10 ? 
original_data_1 'Edwards, A.'      11 ? 
original_data_1 'Arrowsmith, C.'   12 ? 
original_data_1 'Sundstrom, M.'    13 ? 
# 
_cell.entry_id           2WLJ 
_cell.length_a           105.627 
_cell.length_b           109.385 
_cell.length_c           88.786 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WLJ 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'POTASSIUM CHANNEL' 33782.766 2   ? ? ? 'C-TERMINAL HEXAHISTIDINE TAG APPENDED' 
2 non-polymer syn 'POTASSIUM ION'     39.098    2   ? ? ? ?                                       
3 non-polymer syn 'CHLORIDE ION'      35.453    3   ? ? ? ?                                       
4 non-polymer syn SPERMINE            202.340   1   ? ? ? ?                                       
5 non-polymer syn 'CALCIUM ION'       40.078    1   ? ? ? ?                                       
6 water       nat water               18.015    173 ? ? ? ?                                       
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        KIRBAC3.1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   GLY n 
1 4   GLY n 
1 5   MET n 
1 6   LYS n 
1 7   PRO n 
1 8   PRO n 
1 9   ALA n 
1 10  ARG n 
1 11  LYS n 
1 12  PRO n 
1 13  ARG n 
1 14  ILE n 
1 15  LEU n 
1 16  ASN n 
1 17  SER n 
1 18  ASP n 
1 19  GLY n 
1 20  SER n 
1 21  SER n 
1 22  ASN n 
1 23  ILE n 
1 24  THR n 
1 25  ARG n 
1 26  LEU n 
1 27  GLY n 
1 28  LEU n 
1 29  GLU n 
1 30  LYS n 
1 31  ARG n 
1 32  GLY n 
1 33  TRP n 
1 34  LEU n 
1 35  ASP n 
1 36  ASP n 
1 37  HIS n 
1 38  TYR n 
1 39  HIS n 
1 40  ASP n 
1 41  LEU n 
1 42  LEU n 
1 43  THR n 
1 44  VAL n 
1 45  SER n 
1 46  TRP n 
1 47  PRO n 
1 48  VAL n 
1 49  PHE n 
1 50  ILE n 
1 51  THR n 
1 52  LEU n 
1 53  ILE n 
1 54  THR n 
1 55  GLY n 
1 56  LEU n 
1 57  TYR n 
1 58  LEU n 
1 59  VAL n 
1 60  THR n 
1 61  ASN n 
1 62  ALA n 
1 63  LEU n 
1 64  PHE n 
1 65  ALA n 
1 66  LEU n 
1 67  ALA n 
1 68  TYR n 
1 69  LEU n 
1 70  ALA n 
1 71  CYS n 
1 72  GLY n 
1 73  ASP n 
1 74  VAL n 
1 75  ILE n 
1 76  GLU n 
1 77  ASN n 
1 78  ALA n 
1 79  ARG n 
1 80  PRO n 
1 81  GLY n 
1 82  SER n 
1 83  PHE n 
1 84  THR n 
1 85  ASP n 
1 86  ALA n 
1 87  PHE n 
1 88  PHE n 
1 89  PHE n 
1 90  SER n 
1 91  VAL n 
1 92  GLN n 
1 93  THR n 
1 94  MET n 
1 95  ALA n 
1 96  THR n 
1 97  ILE n 
1 98  GLY n 
1 99  TYR n 
1 100 GLY n 
1 101 LYS n 
1 102 LEU n 
1 103 ILE n 
1 104 PRO n 
1 105 ILE n 
1 106 GLY n 
1 107 PRO n 
1 108 LEU n 
1 109 ALA n 
1 110 ASN n 
1 111 THR n 
1 112 LEU n 
1 113 VAL n 
1 114 THR n 
1 115 LEU n 
1 116 GLU n 
1 117 ALA n 
1 118 LEU n 
1 119 CYS n 
1 120 GLY n 
1 121 MET n 
1 122 LEU n 
1 123 GLY n 
1 124 LEU n 
1 125 ALA n 
1 126 VAL n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ILE n 
1 132 TYR n 
1 133 ALA n 
1 134 ARG n 
1 135 PHE n 
1 136 THR n 
1 137 ARG n 
1 138 PRO n 
1 139 THR n 
1 140 ALA n 
1 141 GLY n 
1 142 VAL n 
1 143 LEU n 
1 144 PHE n 
1 145 SER n 
1 146 SER n 
1 147 ARG n 
1 148 MET n 
1 149 VAL n 
1 150 ILE n 
1 151 SER n 
1 152 ASP n 
1 153 PHE n 
1 154 GLU n 
1 155 GLY n 
1 156 LYS n 
1 157 PRO n 
1 158 THR n 
1 159 LEU n 
1 160 MET n 
1 161 MET n 
1 162 ARG n 
1 163 LEU n 
1 164 ALA n 
1 165 ASN n 
1 166 LEU n 
1 167 ARG n 
1 168 ILE n 
1 169 GLU n 
1 170 GLN n 
1 171 ILE n 
1 172 ILE n 
1 173 GLU n 
1 174 ALA n 
1 175 ASP n 
1 176 VAL n 
1 177 HIS n 
1 178 LEU n 
1 179 VAL n 
1 180 LEU n 
1 181 VAL n 
1 182 ARG n 
1 183 SER n 
1 184 GLU n 
1 185 ILE n 
1 186 SER n 
1 187 GLN n 
1 188 GLU n 
1 189 GLY n 
1 190 MET n 
1 191 VAL n 
1 192 PHE n 
1 193 ARG n 
1 194 ARG n 
1 195 PHE n 
1 196 HIS n 
1 197 ASP n 
1 198 LEU n 
1 199 THR n 
1 200 LEU n 
1 201 THR n 
1 202 ARG n 
1 203 SER n 
1 204 ARG n 
1 205 SER n 
1 206 PRO n 
1 207 ILE n 
1 208 PHE n 
1 209 SER n 
1 210 LEU n 
1 211 SER n 
1 212 TRP n 
1 213 THR n 
1 214 VAL n 
1 215 MET n 
1 216 HIS n 
1 217 PRO n 
1 218 ILE n 
1 219 ASP n 
1 220 HIS n 
1 221 HIS n 
1 222 SER n 
1 223 PRO n 
1 224 ILE n 
1 225 TYR n 
1 226 GLY n 
1 227 GLU n 
1 228 THR n 
1 229 ASP n 
1 230 GLU n 
1 231 THR n 
1 232 LEU n 
1 233 ARG n 
1 234 ASN n 
1 235 SER n 
1 236 HIS n 
1 237 SER n 
1 238 GLU n 
1 239 PHE n 
1 240 LEU n 
1 241 VAL n 
1 242 LEU n 
1 243 PHE n 
1 244 THR n 
1 245 GLY n 
1 246 HIS n 
1 247 HIS n 
1 248 GLU n 
1 249 ALA n 
1 250 PHE n 
1 251 ALA n 
1 252 GLN n 
1 253 ASN n 
1 254 VAL n 
1 255 HIS n 
1 256 ALA n 
1 257 ARG n 
1 258 HIS n 
1 259 ALA n 
1 260 TYR n 
1 261 SER n 
1 262 CYS n 
1 263 ASP n 
1 264 GLU n 
1 265 ILE n 
1 266 ILE n 
1 267 TRP n 
1 268 GLY n 
1 269 GLY n 
1 270 HIS n 
1 271 PHE n 
1 272 VAL n 
1 273 ASP n 
1 274 VAL n 
1 275 PHE n 
1 276 THR n 
1 277 THR n 
1 278 LEU n 
1 279 PRO n 
1 280 ASP n 
1 281 GLY n 
1 282 ARG n 
1 283 ARG n 
1 284 ALA n 
1 285 LEU n 
1 286 ASP n 
1 287 LEU n 
1 288 GLY n 
1 289 LYS n 
1 290 PHE n 
1 291 HIS n 
1 292 GLU n 
1 293 ILE n 
1 294 ALA n 
1 295 GLN n 
1 296 HIS n 
1 297 HIS n 
1 298 HIS n 
1 299 HIS n 
1 300 HIS n 
1 301 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MAGNETOSPIRILLUM MAGNETOTACTICUM' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     188 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21STAR(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET-30A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    2WLJ 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          2WLJ 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2WLJ A 1   ? 4   ? 2WLJ 1   ? 4   ? 1   4   
2 1 2WLJ A 5   ? 295 ? 2WLJ 5   ? 295 ? 5   295 
3 1 2WLJ A 296 ? 301 ? 2WLJ 296 ? 301 ? 296 301 
4 1 2WLJ B 1   ? 4   ? 2WLJ 1   ? 4   ? 1   4   
5 1 2WLJ B 5   ? 295 ? 2WLJ 5   ? 295 ? 5   295 
6 1 2WLJ B 296 ? 301 ? 2WLJ 296 ? 301 ? 296 301 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SPM non-polymer         . SPERMINE        ? 'C10 H26 N4'     202.340 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2WLJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.80 
_exptl_crystal.density_percent_sol   65.00 
_exptl_crystal.description           'AUTHOR USED THE SF DATA FROM ENTRY 1XL4.' 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;90MM HEPES, 2.5% PEG 8000, 2.5% PEG 4000, 20% PEG 400, 12.5MM MAGNESIUM CHLORIDE, 42.5MM MAGNESIUM ACETATE, 2.5% GLYCEROL, 14MM HEGA-10, PH 7.6, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 293K
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     ? 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WLJ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   29551 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WLJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     27897 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    91.58 
_refine.ls_R_factor_obs                          0.22148 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22028 
_refine.ls_R_factor_R_free                       0.24331 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  1525 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.931 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               78.133 
_refine.aniso_B[1][1]                            0.57 
_refine.aniso_B[2][2]                            0.87 
_refine.aniso_B[3][3]                            -1.44 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             1.00 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ATOM RECORD CONTAINS RESIDUAL B FACTORS ONLY. THIS ENTRY IS A RE-REFINEMENT OF PDB ENTRY 1XL4. IMPROVED REFINEMENT STATISTICS WERE OBTAINED AND AN ADDITIONAL LIGAND (SPERMINE) MODELLED. STRUCTURE WAS INITIALLY REFINED IN PHENIX, THEN TRANSFERRED TO REFMAC. ANY ANISOTROPIC THERMAL PARAMETERS WERE CALCULATED BY PHENIX FROM THE TLS PARAMETERS, AND WERE NOT REFINED EXPLICITLY.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1P7B' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.420 
_refine.pdbx_overall_ESU_R_Free                  0.270 
_refine.overall_SU_ML                            0.179 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             17.526 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4331 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             173 
_refine_hist.number_atoms_total               4524 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.021  ? 4562 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.477  1.934  ? 6207 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.821  5.000  ? 569  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.239 21.932 ? 207  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.305 15.000 ? 716  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.804 15.000 ? 36   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.092  0.200  ? 708  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.021  ? 3452 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.334  1.500  ? 2769 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 5.083  2.000  ? 4482 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.128  3.000  ? 1793 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.209  4.500  ? 1714 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.666 
_refine_ls_shell.number_reflns_R_work             1771 
_refine_ls_shell.R_factor_R_work                  0.328 
_refine_ls_shell.percent_reflns_obs               82.52 
_refine_ls_shell.R_factor_R_free                  0.391 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             122 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2WLJ 
_struct.title                     'Potassium channel from Magnetospirillum magnetotacticum' 
_struct.pdbx_descriptor           'POTASSIUM CHANNEL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WLJ 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 5 ? 
I N N 3 ? 
J N N 6 ? 
K N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 37  ? LEU A 42  ? HIS A 37  LEU A 42  1 ? 6  
HELX_P HELX_P2  2  SER A 45  ? ALA A 70  ? SER A 45  ALA A 70  1 ? 26 
HELX_P HELX_P3  3  SER A 82  ? ALA A 95  ? SER A 82  ALA A 95  1 ? 14 
HELX_P HELX_P4  4  GLY A 106 ? THR A 136 ? GLY A 106 THR A 136 1 ? 31 
HELX_P HELX_P5  5  THR A 228 ? HIS A 236 ? THR A 228 HIS A 236 1 ? 9  
HELX_P HELX_P6  6  TYR B 38  ? THR B 43  ? TYR B 38  THR B 43  5 ? 6  
HELX_P HELX_P7  7  SER B 45  ? CYS B 71  ? SER B 45  CYS B 71  1 ? 27 
HELX_P HELX_P8  8  SER B 82  ? ALA B 95  ? SER B 82  ALA B 95  1 ? 14 
HELX_P HELX_P9  9  GLY B 106 ? PHE B 135 ? GLY B 106 PHE B 135 1 ? 30 
HELX_P HELX_P10 10 THR B 228 ? SER B 235 ? THR B 228 SER B 235 1 ? 8  
HELX_P HELX_P11 11 GLY B 288 ? PHE B 290 ? GLY B 288 PHE B 290 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1300 A GLY 98 1_555 ? ? ? ? ? ? ? 2.940 ? 
metalc2  metalc ? ? C K  . K  ? ? ? 1_555 A ILE 97 O   ? ? A K  1300 A ILE 97 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc3  metalc ? ? C K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1300 A GLY 98 2_645 ? ? ? ? ? ? ? 2.957 ? 
metalc4  metalc ? ? C K  . K  ? ? ? 1_555 B GLY 98 O   ? ? A K  1300 B GLY 98 1_555 ? ? ? ? ? ? ? 3.148 ? 
metalc5  metalc ? ? C K  . K  ? ? ? 1_555 A ILE 97 O   ? ? A K  1300 A ILE 97 2_645 ? ? ? ? ? ? ? 2.737 ? 
metalc6  metalc ? ? C K  . K  ? ? ? 1_555 B ILE 97 O   ? ? A K  1300 B ILE 97 1_555 ? ? ? ? ? ? ? 2.727 ? 
metalc7  metalc ? ? C K  . K  ? ? ? 1_555 B GLY 98 O   ? ? A K  1300 B GLY 98 2_645 ? ? ? ? ? ? ? 3.184 ? 
metalc8  metalc ? ? C K  . K  ? ? ? 1_555 B ILE 97 O   ? ? A K  1300 B ILE 97 2_645 ? ? ? ? ? ? ? 2.782 ? 
metalc9  metalc ? ? D K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1301 A GLY 98 1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc10 metalc ? ? D K  . K  ? ? ? 1_555 A TYR 99 O   ? ? A K  1301 A TYR 99 1_555 ? ? ? ? ? ? ? 2.802 ? 
metalc11 metalc ? ? D K  . K  ? ? ? 1_555 A GLY 98 O   ? ? A K  1301 A GLY 98 2_645 ? ? ? ? ? ? ? 2.737 ? 
metalc12 metalc ? ? D K  . K  ? ? ? 1_555 A TYR 99 O   ? ? A K  1301 A TYR 99 2_645 ? ? ? ? ? ? ? 2.810 ? 
metalc13 metalc ? ? D K  . K  ? ? ? 1_555 B GLY 98 O   ? ? A K  1301 B GLY 98 1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc14 metalc ? ? D K  . K  ? ? ? 1_555 B TYR 99 O   ? ? A K  1301 B TYR 99 1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc15 metalc ? ? D K  . K  ? ? ? 1_555 B GLY 98 O   ? ? A K  1301 B GLY 98 2_645 ? ? ? ? ? ? ? 2.860 ? 
metalc16 metalc ? ? D K  . K  ? ? ? 1_555 B TYR 99 O   ? ? A K  1301 B TYR 99 2_645 ? ? ? ? ? ? ? 2.722 ? 
metalc17 metalc ? ? H CA . CA ? ? ? 1_555 A THR 96 OG1 ? ? A CA 1305 A THR 96 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc18 metalc ? ? H CA . CA ? ? ? 1_555 B THR 96 OG1 ? ? A CA 1305 B THR 96 2_645 ? ? ? ? ? ? ? 2.531 ? 
metalc19 metalc ? ? H CA . CA ? ? ? 1_555 A THR 96 O   ? ? A CA 1305 A THR 96 2_645 ? ? ? ? ? ? ? 2.557 ? 
metalc20 metalc ? ? H CA . CA ? ? ? 1_555 A THR 96 OG1 ? ? A CA 1305 A THR 96 2_645 ? ? ? ? ? ? ? 2.436 ? 
metalc21 metalc ? ? H CA . CA ? ? ? 1_555 B THR 96 O   ? ? A CA 1305 B THR 96 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc22 metalc ? ? H CA . CA ? ? ? 1_555 B THR 96 OG1 ? ? A CA 1305 B THR 96 1_555 ? ? ? ? ? ? ? 2.506 ? 
metalc23 metalc ? ? H CA . CA ? ? ? 1_555 B THR 96 O   ? ? A CA 1305 B THR 96 2_645 ? ? ? ? ? ? ? 2.601 ? 
metalc24 metalc ? ? H CA . CA ? ? ? 1_555 A THR 96 O   ? ? A CA 1305 A THR 96 1_555 ? ? ? ? ? ? ? 2.540 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 2 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 3 ? 
AF ? 4 ? 
AG ? 2 ? 
AH ? 2 ? 
BA ? 2 ? 
BB ? 4 ? 
BC ? 3 ? 
BD ? 7 ? 
BE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 5 6 ? anti-parallel 
BD 6 7 ? anti-parallel 
BE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 24  ? LEU A 26  ? THR A 24  LEU A 26  
AA 2 ARG B 283 ? ASP B 286 ? ARG B 283 ASP B 286 
AA 3 PHE B 275 ? THR B 277 ? PHE B 275 THR B 277 
AB 1 ILE A 75  ? GLU A 76  ? ILE A 75  GLU A 76  
AB 2 ILE A 103 ? PRO A 104 ? ILE A 103 PRO A 104 
AC 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
AC 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 
AC 3 MET A 148 ? PHE A 153 ? MET A 148 PHE A 153 
AC 4 ILE A 265 ? TRP A 267 ? ILE A 265 TRP A 267 
AD 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
AD 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 
AD 3 SER A 211 ? PRO A 217 ? SER A 211 PRO A 217 
AE 1 VAL A 191 ? ASP A 197 ? VAL A 191 ASP A 197 
AE 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AE 3 ARG A 204 ? PHE A 208 ? ARG A 204 PHE A 208 
AF 1 VAL A 191 ? ASP A 197 ? VAL A 191 ASP A 197 
AF 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AF 3 GLU A 238 ? HIS A 247 ? GLU A 238 HIS A 247 
AF 4 GLN A 252 ? SER A 261 ? GLN A 252 SER A 261 
AG 1 HIS A 270 ? PHE A 271 ? HIS A 270 PHE A 271 
AG 2 ILE A 293 ? ALA A 294 ? ILE A 293 ALA A 294 
AH 1 PHE A 275 ? THR A 277 ? PHE A 275 THR A 277 
AH 2 ARG A 283 ? LEU A 285 ? ARG A 283 LEU A 285 
BA 1 ILE B 75  ? GLU B 76  ? ILE B 75  GLU B 76  
BA 2 ILE B 103 ? PRO B 104 ? ILE B 103 PRO B 104 
BB 1 VAL B 142 ? PHE B 144 ? VAL B 142 PHE B 144 
BB 2 LYS B 156 ? ASN B 165 ? LYS B 156 ASN B 165 
BB 3 MET B 148 ? PHE B 153 ? MET B 148 PHE B 153 
BB 4 ILE B 265 ? TRP B 267 ? ILE B 265 TRP B 267 
BC 1 VAL B 142 ? PHE B 144 ? VAL B 142 PHE B 144 
BC 2 LYS B 156 ? ASN B 165 ? LYS B 156 ASN B 165 
BC 3 SER B 211 ? PRO B 217 ? SER B 211 PRO B 217 
BD 1 VAL B 191 ? ASP B 197 ? VAL B 191 ASP B 197 
BD 2 ILE B 171 ? ILE B 185 ? ILE B 171 ILE B 185 
BD 3 ARG B 204 ? PHE B 208 ? ARG B 204 PHE B 208 
BD 4 ILE B 171 ? ILE B 185 ? ILE B 171 ILE B 185 
BD 5 GLN B 252 ? SER B 261 ? GLN B 252 SER B 261 
BD 6 GLU B 238 ? HIS B 247 ? GLU B 238 HIS B 247 
BD 7 ILE B 171 ? ILE B 185 ? ILE B 171 ILE B 185 
BE 1 HIS B 270 ? PHE B 271 ? HIS B 270 PHE B 271 
BE 2 ILE B 293 ? ALA B 294 ? ILE B 293 ALA B 294 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 24  ? N THR A 24  O ARG B 283 ? O ARG B 283 
AA 2 3 N ALA B 284 ? N ALA B 284 O THR B 276 ? O THR B 276 
AB 1 2 N GLU A 76  ? N GLU A 76  O ILE A 103 ? O ILE A 103 
AC 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
AC 2 3 N MET A 160 ? N MET A 160 O VAL A 149 ? O VAL A 149 
AC 3 4 N ILE A 150 ? N ILE A 150 O ILE A 266 ? O ILE A 266 
AD 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
AD 2 3 N LEU A 163 ? N LEU A 163 O TRP A 212 ? O TRP A 212 
AE 1 2 N HIS A 196 ? N HIS A 196 O LEU A 180 ? O LEU A 180 
AE 2 3 N ALA A 174 ? N ALA A 174 O SER A 205 ? O SER A 205 
AF 1 2 N HIS A 196 ? N HIS A 196 O LEU A 180 ? O LEU A 180 
AF 2 3 N VAL A 181 ? N VAL A 181 O GLU A 238 ? O GLU A 238 
AF 3 4 N HIS A 247 ? N HIS A 247 O GLN A 252 ? O GLN A 252 
AG 1 2 N HIS A 270 ? N HIS A 270 O ALA A 294 ? O ALA A 294 
AH 1 2 N THR A 276 ? N THR A 276 O ALA A 284 ? O ALA A 284 
BA 1 2 N GLU B 76  ? N GLU B 76  O ILE B 103 ? O ILE B 103 
BB 1 2 N LEU B 143 ? N LEU B 143 O ALA B 164 ? O ALA B 164 
BB 2 3 N MET B 160 ? N MET B 160 O VAL B 149 ? O VAL B 149 
BB 3 4 O MET B 148 ? O MET B 148 N ILE B 266 ? N ILE B 266 
BC 1 2 N LEU B 143 ? N LEU B 143 O ALA B 164 ? O ALA B 164 
BC 2 3 N LEU B 163 ? N LEU B 163 O TRP B 212 ? O TRP B 212 
BD 1 2 N HIS B 196 ? N HIS B 196 O LEU B 180 ? O LEU B 180 
BD 2 3 N ALA B 174 ? N ALA B 174 O SER B 205 ? O SER B 205 
BD 3 4 N PHE B 208 ? N PHE B 208 O ILE B 171 ? O ILE B 171 
BD 5 6 N TYR B 260 ? N TYR B 260 O PHE B 239 ? O PHE B 239 
BD 6 7 N HIS B 246 ? N HIS B 246 O ILE B 172 ? O ILE B 172 
BE 1 2 N HIS B 270 ? N HIS B 270 O ALA B 294 ? O ALA B 294 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE K A 1300'   
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE K A 1301'   
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE SPM A 1303' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 1304'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1305'  
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1306'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ILE A 97  ? ILE A 97   . ? 1_555 ? 
2  AC1 8  ILE A 97  ? ILE A 97   . ? 2_645 ? 
3  AC1 8  GLY A 98  ? GLY A 98   . ? 2_645 ? 
4  AC1 8  GLY A 98  ? GLY A 98   . ? 1_555 ? 
5  AC1 8  ILE B 97  ? ILE B 97   . ? 1_555 ? 
6  AC1 8  ILE B 97  ? ILE B 97   . ? 2_645 ? 
7  AC1 8  GLY B 98  ? GLY B 98   . ? 2_645 ? 
8  AC1 8  GLY B 98  ? GLY B 98   . ? 1_555 ? 
9  AC2 8  GLY A 98  ? GLY A 98   . ? 1_555 ? 
10 AC2 8  GLY A 98  ? GLY A 98   . ? 2_645 ? 
11 AC2 8  TYR A 99  ? TYR A 99   . ? 1_555 ? 
12 AC2 8  TYR A 99  ? TYR A 99   . ? 2_645 ? 
13 AC2 8  GLY B 98  ? GLY B 98   . ? 2_645 ? 
14 AC2 8  GLY B 98  ? GLY B 98   . ? 1_555 ? 
15 AC2 8  TYR B 99  ? TYR B 99   . ? 2_645 ? 
16 AC2 8  TYR B 99  ? TYR B 99   . ? 1_555 ? 
17 AC3 14 ARG A 202 ? ARG A 202  . ? 1_555 ? 
18 AC3 14 ARG A 204 ? ARG A 204  . ? 1_555 ? 
19 AC3 14 PRO A 206 ? PRO A 206  . ? 1_555 ? 
20 AC3 14 CL  G .   ? CL  A 1304 . ? 1_555 ? 
21 AC3 14 HOH J .   ? HOH A 2091 . ? 1_555 ? 
22 AC3 14 HOH J .   ? HOH A 2092 . ? 1_555 ? 
23 AC3 14 HOH J .   ? HOH A 2093 . ? 1_555 ? 
24 AC3 14 HOH J .   ? HOH A 2094 . ? 1_555 ? 
25 AC3 14 HIS B 177 ? HIS B 177  . ? 2_645 ? 
26 AC3 14 VAL B 179 ? VAL B 179  . ? 2_645 ? 
27 AC3 14 PHE B 195 ? PHE B 195  . ? 2_645 ? 
28 AC3 14 HIS B 196 ? HIS B 196  . ? 2_645 ? 
29 AC3 14 ASP B 197 ? ASP B 197  . ? 2_645 ? 
30 AC3 14 HOH K .   ? HOH B 2032 . ? 2_645 ? 
31 AC4 3  SER A 203 ? SER A 203  . ? 1_555 ? 
32 AC4 3  ARG A 204 ? ARG A 204  . ? 1_555 ? 
33 AC4 3  SPM F .   ? SPM A 1303 . ? 1_555 ? 
34 AC5 4  THR A 96  ? THR A 96   . ? 1_555 ? 
35 AC5 4  THR A 96  ? THR A 96   . ? 2_645 ? 
36 AC5 4  THR B 96  ? THR B 96   . ? 1_555 ? 
37 AC5 4  THR B 96  ? THR B 96   . ? 2_645 ? 
38 AC6 1  ARG A 167 ? ARG A 167  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2WLJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WLJ 
_atom_sites.fract_transf_matrix[1][1]   0.009467 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009142 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011263 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
K  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 12  ? 46.663 -90.393  215.340 1.00 105.86 ? 12   PRO A N   1 
ATOM   2    C  CA  . PRO A 1 12  ? 46.954 -89.915  216.683 1.00 106.79 ? 12   PRO A CA  1 
ATOM   3    C  C   . PRO A 1 12  ? 47.476 -88.489  216.732 1.00 100.78 ? 12   PRO A C   1 
ATOM   4    O  O   . PRO A 1 12  ? 47.566 -87.936  217.820 1.00 103.04 ? 12   PRO A O   1 
ATOM   5    C  CB  . PRO A 1 12  ? 48.044 -90.880  217.164 1.00 112.08 ? 12   PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 12  ? 47.675 -92.183  216.519 1.00 116.84 ? 12   PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 12  ? 47.096 -91.799  215.158 1.00 111.79 ? 12   PRO A CD  1 
ATOM   8    N  N   . ARG A 1 13  ? 47.811 -87.889  215.592 1.00 94.69  ? 13   ARG A N   1 
ATOM   9    C  CA  . ARG A 1 13  ? 48.411 -86.536  215.590 1.00 89.44  ? 13   ARG A CA  1 
ATOM   10   C  C   . ARG A 1 13  ? 47.420 -85.422  215.330 1.00 85.42  ? 13   ARG A C   1 
ATOM   11   O  O   . ARG A 1 13  ? 46.761 -85.419  214.290 1.00 84.24  ? 13   ARG A O   1 
ATOM   12   C  CB  . ARG A 1 13  ? 49.482 -86.433  214.515 1.00 87.50  ? 13   ARG A CB  1 
ATOM   13   C  CG  . ARG A 1 13  ? 50.886 -86.470  215.015 1.00 87.19  ? 13   ARG A CG  1 
ATOM   14   C  CD  . ARG A 1 13  ? 51.741 -85.863  213.954 1.00 83.09  ? 13   ARG A CD  1 
ATOM   15   N  NE  . ARG A 1 13  ? 53.125 -86.291  214.092 1.00 83.71  ? 13   ARG A NE  1 
ATOM   16   C  CZ  . ARG A 1 13  ? 54.071 -85.571  214.681 1.00 80.94  ? 13   ARG A CZ  1 
ATOM   17   N  NH1 . ARG A 1 13  ? 53.779 -84.378  215.192 1.00 74.93  ? 13   ARG A NH1 1 
ATOM   18   N  NH2 . ARG A 1 13  ? 55.307 -86.049  214.748 1.00 80.87  ? 13   ARG A NH2 1 
ATOM   19   N  N   . ILE A 1 14  ? 47.323 -84.454  216.232 1.00 83.53  ? 14   ILE A N   1 
ATOM   20   C  CA  . ILE A 1 14  ? 46.393 -83.353  215.986 1.00 80.54  ? 14   ILE A CA  1 
ATOM   21   C  C   . ILE A 1 14  ? 47.001 -82.282  215.056 1.00 75.90  ? 14   ILE A C   1 
ATOM   22   O  O   . ILE A 1 14  ? 46.337 -81.807  214.130 1.00 74.79  ? 14   ILE A O   1 
ATOM   23   C  CB  . ILE A 1 14  ? 45.837 -82.767  217.304 1.00 83.92  ? 14   ILE A CB  1 
ATOM   24   C  CG1 . ILE A 1 14  ? 45.065 -83.860  218.071 1.00 89.17  ? 14   ILE A CG1 1 
ATOM   25   C  CG2 . ILE A 1 14  ? 44.963 -81.526  217.039 1.00 82.72  ? 14   ILE A CG2 1 
ATOM   26   C  CD1 . ILE A 1 14  ? 44.740 -83.506  219.530 1.00 94.82  ? 14   ILE A CD1 1 
ATOM   27   N  N   . LEU A 1 15  ? 48.260 -81.920  215.298 1.00 73.29  ? 15   LEU A N   1 
ATOM   28   C  CA  . LEU A 1 15  ? 49.025 -81.111  214.373 1.00 68.97  ? 15   LEU A CA  1 
ATOM   29   C  C   . LEU A 1 15  ? 50.041 -82.012  213.698 1.00 67.62  ? 15   LEU A C   1 
ATOM   30   O  O   . LEU A 1 15  ? 50.644 -82.867  214.341 1.00 68.96  ? 15   LEU A O   1 
ATOM   31   C  CB  . LEU A 1 15  ? 49.744 -79.979  215.116 1.00 69.47  ? 15   LEU A CB  1 
ATOM   32   C  CG  . LEU A 1 15  ? 48.781 -79.002  215.813 1.00 71.30  ? 15   LEU A CG  1 
ATOM   33   C  CD1 . LEU A 1 15  ? 49.380 -78.437  217.101 1.00 72.67  ? 15   LEU A CD1 1 
ATOM   34   C  CD2 . LEU A 1 15  ? 48.227 -77.885  214.885 1.00 68.62  ? 15   LEU A CD2 1 
ATOM   35   N  N   . ASN A 1 16  ? 50.217 -81.841  212.394 1.00 65.03  ? 16   ASN A N   1 
ATOM   36   C  CA  . ASN A 1 16  ? 51.339 -82.468  211.726 1.00 64.44  ? 16   ASN A CA  1 
ATOM   37   C  C   . ASN A 1 16  ? 52.612 -81.666  211.952 1.00 62.85  ? 16   ASN A C   1 
ATOM   38   O  O   . ASN A 1 16  ? 52.569 -80.480  212.270 1.00 61.50  ? 16   ASN A O   1 
ATOM   39   C  CB  . ASN A 1 16  ? 51.154 -82.450  210.199 1.00 65.62  ? 16   ASN A CB  1 
ATOM   40   C  CG  . ASN A 1 16  ? 49.777 -82.979  209.754 1.00 66.62  ? 16   ASN A CG  1 
ATOM   41   O  OD1 . ASN A 1 16  ? 49.462 -84.155  209.938 1.00 70.92  ? 16   ASN A OD1 1 
ATOM   42   N  ND2 . ASN A 1 16  ? 48.979 -82.118  209.151 1.00 63.27  ? 16   ASN A ND2 1 
ATOM   43   N  N   . SER A 1 17  ? 53.750 -82.314  211.776 1.00 63.08  ? 17   SER A N   1 
ATOM   44   C  CA  . SER A 1 17  ? 55.042 -81.701  212.009 1.00 63.08  ? 17   SER A CA  1 
ATOM   45   C  C   . SER A 1 17  ? 55.271 -80.328  211.432 1.00 62.81  ? 17   SER A C   1 
ATOM   46   O  O   . SER A 1 17  ? 56.030 -79.521  211.991 1.00 62.31  ? 17   SER A O   1 
ATOM   47   C  CB  . SER A 1 17  ? 56.096 -82.607  211.456 1.00 64.52  ? 17   SER A CB  1 
ATOM   48   O  OG  . SER A 1 17  ? 55.918 -83.823  212.099 1.00 66.89  ? 17   SER A OG  1 
ATOM   49   N  N   . ASP A 1 18  ? 54.627 -80.091  210.298 1.00 63.21  ? 18   ASP A N   1 
ATOM   50   C  CA  . ASP A 1 18  ? 54.805 -78.865  209.556 1.00 65.72  ? 18   ASP A CA  1 
ATOM   51   C  C   . ASP A 1 18  ? 53.797 -77.849  210.043 1.00 65.42  ? 18   ASP A C   1 
ATOM   52   O  O   . ASP A 1 18  ? 53.584 -76.819  209.420 1.00 67.26  ? 18   ASP A O   1 
ATOM   53   C  CB  . ASP A 1 18  ? 54.644 -79.123  208.053 1.00 67.64  ? 18   ASP A CB  1 
ATOM   54   C  CG  . ASP A 1 18  ? 53.193 -79.306  207.631 1.00 69.15  ? 18   ASP A CG  1 
ATOM   55   O  OD1 . ASP A 1 18  ? 52.262 -79.346  208.476 1.00 68.47  ? 18   ASP A OD1 1 
ATOM   56   O  OD2 . ASP A 1 18  ? 52.967 -79.406  206.413 1.00 74.88  ? 18   ASP A OD2 1 
ATOM   57   N  N   . GLY A 1 19  ? 53.151 -78.166  211.155 1.00 64.91  ? 19   GLY A N   1 
ATOM   58   C  CA  . GLY A 1 19  ? 52.291 -77.205  211.817 1.00 67.14  ? 19   GLY A CA  1 
ATOM   59   C  C   . GLY A 1 19  ? 50.867 -77.167  211.330 1.00 68.22  ? 19   GLY A C   1 
ATOM   60   O  O   . GLY A 1 19  ? 50.050 -76.453  211.899 1.00 69.06  ? 19   GLY A O   1 
ATOM   61   N  N   . SER A 1 20  ? 50.557 -77.923  210.279 1.00 69.00  ? 20   SER A N   1 
ATOM   62   C  CA  . SER A 1 20  ? 49.207 -77.904  209.723 1.00 70.43  ? 20   SER A CA  1 
ATOM   63   C  C   . SER A 1 20  ? 48.300 -78.900  210.439 1.00 70.28  ? 20   SER A C   1 
ATOM   64   O  O   . SER A 1 20  ? 48.761 -79.866  211.062 1.00 69.23  ? 20   SER A O   1 
ATOM   65   C  CB  . SER A 1 20  ? 49.229 -78.245  208.241 1.00 71.82  ? 20   SER A CB  1 
ATOM   66   O  OG  . SER A 1 20  ? 49.762 -79.545  208.063 1.00 70.55  ? 20   SER A OG  1 
ATOM   67   N  N   . SER A 1 21  ? 47.002 -78.666  210.310 1.00 72.51  ? 21   SER A N   1 
ATOM   68   C  CA  . SER A 1 21  ? 46.002 -79.438  211.029 1.00 73.86  ? 21   SER A CA  1 
ATOM   69   C  C   . SER A 1 21  ? 45.794 -80.825  210.466 1.00 73.89  ? 21   SER A C   1 
ATOM   70   O  O   . SER A 1 21  ? 45.790 -81.038  209.259 1.00 74.75  ? 21   SER A O   1 
ATOM   71   C  CB  . SER A 1 21  ? 44.650 -78.723  211.045 1.00 75.30  ? 21   SER A CB  1 
ATOM   72   O  OG  . SER A 1 21  ? 43.761 -79.463  211.877 1.00 77.24  ? 21   SER A OG  1 
ATOM   73   N  N   . ASN A 1 22  ? 45.580 -81.774  211.347 1.00 74.66  ? 22   ASN A N   1 
ATOM   74   C  CA  . ASN A 1 22  ? 45.362 -83.110  210.866 1.00 76.55  ? 22   ASN A CA  1 
ATOM   75   C  C   . ASN A 1 22  ? 43.898 -83.470  210.802 1.00 78.06  ? 22   ASN A C   1 
ATOM   76   O  O   . ASN A 1 22  ? 43.568 -84.516  210.305 1.00 80.43  ? 22   ASN A O   1 
ATOM   77   C  CB  . ASN A 1 22  ? 46.071 -84.116  211.747 1.00 77.87  ? 22   ASN A CB  1 
ATOM   78   C  CG  . ASN A 1 22  ? 46.383 -85.389  211.017 1.00 78.58  ? 22   ASN A CG  1 
ATOM   79   O  OD1 . ASN A 1 22  ? 46.280 -85.451  209.790 1.00 78.10  ? 22   ASN A OD1 1 
ATOM   80   N  ND2 . ASN A 1 22  ? 46.799 -86.405  211.761 1.00 77.57  ? 22   ASN A ND2 1 
ATOM   81   N  N   . ILE A 1 23  ? 43.028 -82.606  211.295 1.00 78.74  ? 23   ILE A N   1 
ATOM   82   C  CA  . ILE A 1 23  ? 41.598 -82.863  211.306 1.00 80.99  ? 23   ILE A CA  1 
ATOM   83   C  C   . ILE A 1 23  ? 40.969 -82.937  209.904 1.00 82.01  ? 23   ILE A C   1 
ATOM   84   O  O   . ILE A 1 23  ? 41.505 -82.395  208.939 1.00 82.32  ? 23   ILE A O   1 
ATOM   85   C  CB  . ILE A 1 23  ? 40.870 -81.807  212.162 1.00 82.02  ? 23   ILE A CB  1 
ATOM   86   C  CG1 . ILE A 1 23  ? 41.070 -82.105  213.659 1.00 84.36  ? 23   ILE A CG1 1 
ATOM   87   C  CG2 . ILE A 1 23  ? 39.402 -81.793  211.855 1.00 83.08  ? 23   ILE A CG2 1 
ATOM   88   C  CD1 . ILE A 1 23  ? 42.528 -82.030  214.155 1.00 80.73  ? 23   ILE A CD1 1 
ATOM   89   N  N   . THR A 1 24  ? 39.839 -83.637  209.802 1.00 83.77  ? 24   THR A N   1 
ATOM   90   C  CA  . THR A 1 24  ? 39.074 -83.721  208.563 1.00 84.92  ? 24   THR A CA  1 
ATOM   91   C  C   . THR A 1 24  ? 38.031 -82.624  208.593 1.00 86.08  ? 24   THR A C   1 
ATOM   92   O  O   . THR A 1 24  ? 37.426 -82.364  209.641 1.00 86.38  ? 24   THR A O   1 
ATOM   93   C  CB  . THR A 1 24  ? 38.358 -85.086  208.435 1.00 87.14  ? 24   THR A CB  1 
ATOM   94   O  OG1 . THR A 1 24  ? 39.324 -86.125  208.222 1.00 87.18  ? 24   THR A OG1 1 
ATOM   95   C  CG2 . THR A 1 24  ? 37.384 -85.078  207.275 1.00 88.64  ? 24   THR A CG2 1 
ATOM   96   N  N   . ARG A 1 25  ? 37.806 -81.986  207.452 1.00 87.49  ? 25   ARG A N   1 
ATOM   97   C  CA  A ARG A 1 25  ? 36.927 -80.823  207.395 0.55 90.06  ? 25   ARG A CA  1 
ATOM   98   C  CA  B ARG A 1 25  ? 36.919 -80.829  207.417 0.45 89.75  ? 25   ARG A CA  1 
ATOM   99   C  C   . ARG A 1 25  ? 35.598 -81.096  206.691 1.00 93.27  ? 25   ARG A C   1 
ATOM   100  O  O   . ARG A 1 25  ? 35.569 -81.486  205.519 1.00 95.46  ? 25   ARG A O   1 
ATOM   101  C  CB  A ARG A 1 25  ? 37.647 -79.644  206.731 0.55 90.72  ? 25   ARG A CB  1 
ATOM   102  C  CB  B ARG A 1 25  ? 37.628 -79.598  206.830 0.45 90.18  ? 25   ARG A CB  1 
ATOM   103  C  CG  A ARG A 1 25  ? 38.583 -78.900  207.661 0.55 89.05  ? 25   ARG A CG  1 
ATOM   104  C  CG  B ARG A 1 25  ? 39.122 -79.538  207.118 0.45 86.43  ? 25   ARG A CG  1 
ATOM   105  C  CD  A ARG A 1 25  ? 39.562 -78.030  206.891 0.55 90.05  ? 25   ARG A CD  1 
ATOM   106  C  CD  B ARG A 1 25  ? 39.561 -78.154  207.606 0.45 84.60  ? 25   ARG A CD  1 
ATOM   107  N  NE  A ARG A 1 25  ? 40.747 -78.776  206.477 0.55 87.55  ? 25   ARG A NE  1 
ATOM   108  N  NE  B ARG A 1 25  ? 38.510 -77.149  207.448 0.45 85.37  ? 25   ARG A NE  1 
ATOM   109  C  CZ  A ARG A 1 25  ? 41.931 -78.665  207.064 0.55 83.99  ? 25   ARG A CZ  1 
ATOM   110  C  CZ  B ARG A 1 25  ? 38.715 -75.838  207.492 0.45 85.22  ? 25   ARG A CZ  1 
ATOM   111  N  NH1 A ARG A 1 25  ? 42.083 -77.837  208.081 0.55 82.23  ? 25   ARG A NH1 1 
ATOM   112  N  NH1 B ARG A 1 25  ? 39.938 -75.363  207.667 0.45 82.74  ? 25   ARG A NH1 1 
ATOM   113  N  NH2 A ARG A 1 25  ? 42.958 -79.375  206.629 0.55 82.23  ? 25   ARG A NH2 1 
ATOM   114  N  NH2 B ARG A 1 25  ? 37.699 -75.004  207.341 0.45 87.87  ? 25   ARG A NH2 1 
ATOM   115  N  N   . LEU A 1 26  ? 34.499 -80.886  207.406 1.00 95.12  ? 26   LEU A N   1 
ATOM   116  C  CA  . LEU A 1 26  ? 33.166 -81.036  206.840 1.00 99.21  ? 26   LEU A CA  1 
ATOM   117  C  C   . LEU A 1 26  ? 32.507 -79.661  206.927 1.00 102.89 ? 26   LEU A C   1 
ATOM   118  O  O   . LEU A 1 26  ? 32.750 -78.907  207.880 1.00 102.42 ? 26   LEU A O   1 
ATOM   119  C  CB  . LEU A 1 26  ? 32.352 -82.055  207.651 1.00 99.22  ? 26   LEU A CB  1 
ATOM   120  C  CG  . LEU A 1 26  ? 32.660 -83.558  207.660 1.00 97.78  ? 26   LEU A CG  1 
ATOM   121  C  CD1 . LEU A 1 26  ? 34.062 -83.868  207.181 1.00 96.29  ? 26   LEU A CD1 1 
ATOM   122  C  CD2 . LEU A 1 26  ? 32.452 -84.126  209.056 1.00 95.86  ? 26   LEU A CD2 1 
ATOM   123  N  N   . GLY A 1 27  ? 31.687 -79.323  205.935 1.00 107.70 ? 27   GLY A N   1 
ATOM   124  C  CA  . GLY A 1 27  ? 30.933 -78.062  205.974 1.00 112.73 ? 27   GLY A CA  1 
ATOM   125  C  C   . GLY A 1 27  ? 31.012 -77.245  204.693 1.00 117.36 ? 27   GLY A C   1 
ATOM   126  O  O   . GLY A 1 27  ? 31.598 -76.153  204.679 1.00 119.27 ? 27   GLY A O   1 
ATOM   127  N  N   . LEU A 1 34  ? 37.296 -72.925  189.583 1.00 163.32 ? 34   LEU A N   1 
ATOM   128  C  CA  . LEU A 1 34  ? 37.768 -71.673  188.993 1.00 159.18 ? 34   LEU A CA  1 
ATOM   129  C  C   . LEU A 1 34  ? 38.689 -70.930  189.960 1.00 156.78 ? 34   LEU A C   1 
ATOM   130  O  O   . LEU A 1 34  ? 39.846 -70.651  189.632 1.00 152.62 ? 34   LEU A O   1 
ATOM   131  C  CB  . LEU A 1 34  ? 36.581 -70.781  188.592 1.00 161.28 ? 34   LEU A CB  1 
ATOM   132  N  N   . ASP A 1 35  ? 38.165 -70.627  191.154 1.00 159.96 ? 35   ASP A N   1 
ATOM   133  C  CA  . ASP A 1 35  ? 38.887 -69.866  192.192 1.00 158.42 ? 35   ASP A CA  1 
ATOM   134  C  C   . ASP A 1 35  ? 39.999 -70.672  192.867 1.00 157.10 ? 35   ASP A C   1 
ATOM   135  O  O   . ASP A 1 35  ? 40.808 -70.128  193.626 1.00 155.30 ? 35   ASP A O   1 
ATOM   136  C  CB  . ASP A 1 35  ? 37.904 -69.350  193.255 1.00 167.37 ? 35   ASP A CB  1 
ATOM   137  N  N   . ASP A 1 36  ? 40.022 -71.973  192.588 1.00 158.30 ? 36   ASP A N   1 
ATOM   138  C  CA  . ASP A 1 36  ? 41.051 -72.869  193.114 1.00 157.60 ? 36   ASP A CA  1 
ATOM   139  C  C   . ASP A 1 36  ? 42.324 -72.781  192.279 1.00 152.38 ? 36   ASP A C   1 
ATOM   140  O  O   . ASP A 1 36  ? 43.430 -72.914  192.804 1.00 150.81 ? 36   ASP A O   1 
ATOM   141  C  CB  . ASP A 1 36  ? 40.551 -74.317  193.131 1.00 161.66 ? 36   ASP A CB  1 
ATOM   142  C  CG  . ASP A 1 36  ? 40.613 -74.976  191.755 1.00 161.15 ? 36   ASP A CG  1 
ATOM   143  O  OD1 . ASP A 1 36  ? 40.459 -74.265  190.730 1.00 159.65 ? 36   ASP A OD1 1 
ATOM   144  O  OD2 . ASP A 1 36  ? 40.813 -76.211  191.700 1.00 163.76 ? 36   ASP A OD2 1 
ATOM   145  N  N   . HIS A 1 37  ? 42.159 -72.567  190.975 1.00 150.13 ? 37   HIS A N   1 
ATOM   146  C  CA  . HIS A 1 37  ? 43.298 -72.453  190.069 1.00 145.51 ? 37   HIS A CA  1 
ATOM   147  C  C   . HIS A 1 37  ? 44.029 -71.112  190.247 1.00 141.78 ? 37   HIS A C   1 
ATOM   148  O  O   . HIS A 1 37  ? 45.091 -70.896  189.651 1.00 138.90 ? 37   HIS A O   1 
ATOM   149  C  CB  . HIS A 1 37  ? 42.866 -72.676  188.605 1.00 145.08 ? 37   HIS A CB  1 
ATOM   150  N  N   . TYR A 1 38  ? 43.475 -70.218  191.072 1.00 141.95 ? 38   TYR A N   1 
ATOM   151  C  CA  . TYR A 1 38  ? 44.188 -68.980  191.413 1.00 138.63 ? 38   TYR A CA  1 
ATOM   152  C  C   . TYR A 1 38  ? 45.269 -69.219  192.475 1.00 137.02 ? 38   TYR A C   1 
ATOM   153  O  O   . TYR A 1 38  ? 46.469 -69.122  192.178 1.00 134.29 ? 38   TYR A O   1 
ATOM   154  C  CB  . TYR A 1 38  ? 43.238 -67.858  191.864 1.00 140.60 ? 38   TYR A CB  1 
ATOM   155  C  CG  . TYR A 1 38  ? 43.982 -66.661  192.446 1.00 139.74 ? 38   TYR A CG  1 
ATOM   156  C  CD1 . TYR A 1 38  ? 44.916 -65.959  191.683 1.00 136.76 ? 38   TYR A CD1 1 
ATOM   157  C  CD2 . TYR A 1 38  ? 43.764 -66.243  193.766 1.00 142.85 ? 38   TYR A CD2 1 
ATOM   158  C  CE1 . TYR A 1 38  ? 45.611 -64.867  192.216 1.00 136.17 ? 38   TYR A CE1 1 
ATOM   159  C  CE2 . TYR A 1 38  ? 44.453 -65.151  194.307 1.00 141.74 ? 38   TYR A CE2 1 
ATOM   160  C  CZ  . TYR A 1 38  ? 45.374 -64.471  193.525 1.00 138.45 ? 38   TYR A CZ  1 
ATOM   161  O  OH  . TYR A 1 38  ? 46.058 -63.392  194.041 1.00 137.72 ? 38   TYR A OH  1 
ATOM   162  N  N   . HIS A 1 39  ? 44.842 -69.522  193.703 1.00 138.42 ? 39   HIS A N   1 
ATOM   163  C  CA  . HIS A 1 39  ? 45.775 -69.821  194.790 1.00 137.09 ? 39   HIS A CA  1 
ATOM   164  C  C   . HIS A 1 39  ? 46.687 -70.964  194.362 1.00 134.60 ? 39   HIS A C   1 
ATOM   165  O  O   . HIS A 1 39  ? 47.582 -71.377  195.098 1.00 134.84 ? 39   HIS A O   1 
ATOM   166  C  CB  . HIS A 1 39  ? 45.027 -70.190  196.086 1.00 141.72 ? 39   HIS A CB  1 
ATOM   167  C  CG  . HIS A 1 39  ? 44.246 -69.057  196.684 1.00 143.98 ? 39   HIS A CG  1 
ATOM   168  N  ND1 . HIS A 1 39  ? 42.877 -68.943  196.552 1.00 147.79 ? 39   HIS A ND1 1 
ATOM   169  C  CD2 . HIS A 1 39  ? 44.642 -67.985  197.412 1.00 143.57 ? 39   HIS A CD2 1 
ATOM   170  C  CE1 . HIS A 1 39  ? 42.465 -67.848  197.170 1.00 149.09 ? 39   HIS A CE1 1 
ATOM   171  N  NE2 . HIS A 1 39  ? 43.517 -67.248  197.700 1.00 146.13 ? 39   HIS A NE2 1 
ATOM   172  N  N   . ASP A 1 40  ? 46.455 -71.456  193.150 1.00 131.81 ? 40   ASP A N   1 
ATOM   173  C  CA  . ASP A 1 40  ? 47.129 -72.641  192.644 1.00 129.80 ? 40   ASP A CA  1 
ATOM   174  C  C   . ASP A 1 40  ? 48.320 -72.264  191.771 1.00 124.51 ? 40   ASP A C   1 
ATOM   175  O  O   . ASP A 1 40  ? 49.359 -72.920  191.792 1.00 123.92 ? 40   ASP A O   1 
ATOM   176  C  CB  . ASP A 1 40  ? 46.140 -73.479  191.833 1.00 132.17 ? 40   ASP A CB  1 
ATOM   177  C  CG  . ASP A 1 40  ? 46.212 -74.947  192.172 1.00 135.97 ? 40   ASP A CG  1 
ATOM   178  O  OD1 . ASP A 1 40  ? 46.879 -75.284  193.179 1.00 138.56 ? 40   ASP A OD1 1 
ATOM   179  O  OD2 . ASP A 1 40  ? 45.597 -75.761  191.444 1.00 138.55 ? 40   ASP A OD2 1 
ATOM   180  N  N   . LEU A 1 41  ? 48.155 -71.208  190.987 1.00 120.21 ? 41   LEU A N   1 
ATOM   181  C  CA  . LEU A 1 41  ? 49.232 -70.719  190.149 1.00 115.22 ? 41   LEU A CA  1 
ATOM   182  C  C   . LEU A 1 41  ? 50.229 -70.012  191.046 1.00 112.63 ? 41   LEU A C   1 
ATOM   183  O  O   . LEU A 1 41  ? 51.387 -69.816  190.693 1.00 110.44 ? 41   LEU A O   1 
ATOM   184  C  CB  . LEU A 1 41  ? 48.670 -69.764  189.108 1.00 114.03 ? 41   LEU A CB  1 
ATOM   185  C  CG  . LEU A 1 41  ? 47.796 -70.414  188.033 1.00 114.61 ? 41   LEU A CG  1 
ATOM   186  C  CD1 . LEU A 1 41  ? 46.847 -69.390  187.421 1.00 113.67 ? 41   LEU A CD1 1 
ATOM   187  C  CD2 . LEU A 1 41  ? 48.653 -71.096  186.967 1.00 112.61 ? 41   LEU A CD2 1 
ATOM   188  N  N   . LEU A 1 42  ? 49.744 -69.660  192.230 1.00 112.37 ? 42   LEU A N   1 
ATOM   189  C  CA  . LEU A 1 42  ? 50.541 -69.025  193.258 1.00 110.44 ? 42   LEU A CA  1 
ATOM   190  C  C   . LEU A 1 42  ? 51.465 -69.998  193.956 1.00 110.25 ? 42   LEU A C   1 
ATOM   191  O  O   . LEU A 1 42  ? 52.558 -69.625  194.363 1.00 109.25 ? 42   LEU A O   1 
ATOM   192  C  CB  . LEU A 1 42  ? 49.622 -68.387  194.300 1.00 112.55 ? 42   LEU A CB  1 
ATOM   193  C  CG  . LEU A 1 42  ? 48.634 -67.348  193.761 1.00 112.25 ? 42   LEU A CG  1 
ATOM   194  C  CD1 . LEU A 1 42  ? 47.596 -66.981  194.830 1.00 115.11 ? 42   LEU A CD1 1 
ATOM   195  C  CD2 . LEU A 1 42  ? 49.384 -66.115  193.234 1.00 108.17 ? 42   LEU A CD2 1 
ATOM   196  N  N   . THR A 1 43  ? 51.040 -71.248  194.096 1.00 111.02 ? 43   THR A N   1 
ATOM   197  C  CA  . THR A 1 43  ? 51.787 -72.186  194.930 1.00 111.66 ? 43   THR A CA  1 
ATOM   198  C  C   . THR A 1 43  ? 52.617 -73.244  194.184 1.00 110.56 ? 43   THR A C   1 
ATOM   199  O  O   . THR A 1 43  ? 53.640 -73.690  194.700 1.00 111.75 ? 43   THR A O   1 
ATOM   200  C  CB  . THR A 1 43  ? 50.896 -72.838  196.020 1.00 115.28 ? 43   THR A CB  1 
ATOM   201  O  OG1 . THR A 1 43  ? 50.102 -73.880  195.446 1.00 117.16 ? 43   THR A OG1 1 
ATOM   202  C  CG2 . THR A 1 43  ? 49.982 -71.800  196.630 1.00 115.74 ? 43   THR A CG2 1 
ATOM   203  N  N   . VAL A 1 44  ? 52.199 -73.646  192.987 1.00 113.28 ? 44   VAL A N   1 
ATOM   204  C  CA  . VAL A 1 44  ? 52.956 -74.650  192.232 1.00 111.31 ? 44   VAL A CA  1 
ATOM   205  C  C   . VAL A 1 44  ? 54.395 -74.196  191.972 1.00 107.49 ? 44   VAL A C   1 
ATOM   206  O  O   . VAL A 1 44  ? 54.764 -73.067  192.287 1.00 104.85 ? 44   VAL A O   1 
ATOM   207  C  CB  . VAL A 1 44  ? 52.261 -75.010  190.900 1.00 110.43 ? 44   VAL A CB  1 
ATOM   208  C  CG1 . VAL A 1 44  ? 50.974 -75.747  191.170 1.00 114.42 ? 44   VAL A CG1 1 
ATOM   209  C  CG2 . VAL A 1 44  ? 51.993 -73.763  190.062 1.00 104.86 ? 44   VAL A CG2 1 
ATOM   210  N  N   . SER A 1 45  ? 55.205 -75.073  191.396 1.00 107.50 ? 45   SER A N   1 
ATOM   211  C  CA  . SER A 1 45  ? 56.587 -74.732  191.050 1.00 105.19 ? 45   SER A CA  1 
ATOM   212  C  C   . SER A 1 45  ? 56.693 -73.980  189.708 1.00 100.90 ? 45   SER A C   1 
ATOM   213  O  O   . SER A 1 45  ? 55.766 -74.022  188.905 1.00 100.10 ? 45   SER A O   1 
ATOM   214  C  CB  . SER A 1 45  ? 57.405 -76.008  190.959 1.00 108.74 ? 45   SER A CB  1 
ATOM   215  O  OG  . SER A 1 45  ? 56.908 -76.802  189.897 1.00 110.64 ? 45   SER A OG  1 
ATOM   216  N  N   . TRP A 1 46  ? 57.832 -73.331  189.451 1.00 98.67  ? 46   TRP A N   1 
ATOM   217  C  CA  . TRP A 1 46  ? 58.002 -72.544  188.221 1.00 95.59  ? 46   TRP A CA  1 
ATOM   218  C  C   . TRP A 1 46  ? 57.718 -73.307  186.903 1.00 96.17  ? 46   TRP A C   1 
ATOM   219  O  O   . TRP A 1 46  ? 56.902 -72.852  186.086 1.00 94.29  ? 46   TRP A O   1 
ATOM   220  C  CB  . TRP A 1 46  ? 59.340 -71.775  188.200 1.00 95.02  ? 46   TRP A CB  1 
ATOM   221  C  CG  . TRP A 1 46  ? 59.330 -70.558  189.127 1.00 93.81  ? 46   TRP A CG  1 
ATOM   222  C  CD1 . TRP A 1 46  ? 59.889 -70.477  190.365 1.00 95.23  ? 46   TRP A CD1 1 
ATOM   223  C  CD2 . TRP A 1 46  ? 58.697 -69.278  188.897 1.00 91.51  ? 46   TRP A CD2 1 
ATOM   224  N  NE1 . TRP A 1 46  ? 59.658 -69.241  190.917 1.00 94.10  ? 46   TRP A NE1 1 
ATOM   225  C  CE2 . TRP A 1 46  ? 58.930 -68.485  190.037 1.00 91.80  ? 46   TRP A CE2 1 
ATOM   226  C  CE3 . TRP A 1 46  ? 57.968 -68.728  187.839 1.00 89.25  ? 46   TRP A CE3 1 
ATOM   227  C  CZ2 . TRP A 1 46  ? 58.462 -67.178  190.150 1.00 89.59  ? 46   TRP A CZ2 1 
ATOM   228  C  CZ3 . TRP A 1 46  ? 57.499 -67.421  187.962 1.00 88.54  ? 46   TRP A CZ3 1 
ATOM   229  C  CH2 . TRP A 1 46  ? 57.752 -66.667  189.108 1.00 88.38  ? 46   TRP A CH2 1 
ATOM   230  N  N   . PRO A 1 47  ? 58.368 -74.473  186.703 1.00 99.34  ? 47   PRO A N   1 
ATOM   231  C  CA  . PRO A 1 47  ? 58.088 -75.376  185.580 1.00 100.93 ? 47   PRO A CA  1 
ATOM   232  C  C   . PRO A 1 47  ? 56.601 -75.574  185.332 1.00 99.77  ? 47   PRO A C   1 
ATOM   233  O  O   . PRO A 1 47  ? 56.125 -75.451  184.205 1.00 98.85  ? 47   PRO A O   1 
ATOM   234  C  CB  . PRO A 1 47  ? 58.690 -76.699  186.054 1.00 105.80 ? 47   PRO A CB  1 
ATOM   235  C  CG  . PRO A 1 47  ? 59.842 -76.282  186.876 1.00 105.99 ? 47   PRO A CG  1 
ATOM   236  C  CD  . PRO A 1 47  ? 59.454 -74.995  187.555 1.00 102.34 ? 47   PRO A CD  1 
ATOM   237  N  N   . VAL A 1 48  ? 55.870 -75.895  186.385 1.00 100.56 ? 48   VAL A N   1 
ATOM   238  C  CA  . VAL A 1 48  ? 54.450 -76.145  186.247 1.00 100.81 ? 48   VAL A CA  1 
ATOM   239  C  C   . VAL A 1 48  ? 53.682 -74.863  185.973 1.00 96.12  ? 48   VAL A C   1 
ATOM   240  O  O   . VAL A 1 48  ? 52.748 -74.850  185.167 1.00 95.82  ? 48   VAL A O   1 
ATOM   241  C  CB  . VAL A 1 48  ? 53.884 -76.825  187.490 1.00 104.42 ? 48   VAL A CB  1 
ATOM   242  C  CG1 . VAL A 1 48  ? 52.364 -76.916  187.401 1.00 106.08 ? 48   VAL A CG1 1 
ATOM   243  C  CG2 . VAL A 1 48  ? 54.493 -78.210  187.630 1.00 109.85 ? 48   VAL A CG2 1 
ATOM   244  N  N   . PHE A 1 49  ? 54.076 -73.791  186.652 1.00 92.86  ? 49   PHE A N   1 
ATOM   245  C  CA  . PHE A 1 49  ? 53.419 -72.513  186.486 1.00 89.11  ? 49   PHE A CA  1 
ATOM   246  C  C   . PHE A 1 49  ? 53.535 -72.121  185.028 1.00 87.06  ? 49   PHE A C   1 
ATOM   247  O  O   . PHE A 1 49  ? 52.552 -71.739  184.382 1.00 85.73  ? 49   PHE A O   1 
ATOM   248  C  CB  . PHE A 1 49  ? 54.075 -71.451  187.370 1.00 87.50  ? 49   PHE A CB  1 
ATOM   249  C  CG  . PHE A 1 49  ? 53.559 -70.051  187.121 1.00 84.33  ? 49   PHE A CG  1 
ATOM   250  C  CD1 . PHE A 1 49  ? 52.275 -69.697  187.492 1.00 83.75  ? 49   PHE A CD1 1 
ATOM   251  C  CD2 . PHE A 1 49  ? 54.357 -69.104  186.498 1.00 80.02  ? 49   PHE A CD2 1 
ATOM   252  C  CE1 . PHE A 1 49  ? 51.809 -68.434  187.247 1.00 81.80  ? 49   PHE A CE1 1 
ATOM   253  C  CE2 . PHE A 1 49  ? 53.894 -67.859  186.257 1.00 77.67  ? 49   PHE A CE2 1 
ATOM   254  C  CZ  . PHE A 1 49  ? 52.616 -67.515  186.632 1.00 79.03  ? 49   PHE A CZ  1 
ATOM   255  N  N   . ILE A 1 50  ? 54.754 -72.247  184.511 1.00 87.32  ? 50   ILE A N   1 
ATOM   256  C  CA  . ILE A 1 50  ? 55.040 -71.910  183.130 1.00 86.24  ? 50   ILE A CA  1 
ATOM   257  C  C   . ILE A 1 50  ? 54.252 -72.795  182.191 1.00 87.56  ? 50   ILE A C   1 
ATOM   258  O  O   . ILE A 1 50  ? 53.592 -72.309  181.286 1.00 86.59  ? 50   ILE A O   1 
ATOM   259  C  CB  . ILE A 1 50  ? 56.554 -71.942  182.845 1.00 87.61  ? 50   ILE A CB  1 
ATOM   260  C  CG1 . ILE A 1 50  ? 57.178 -70.650  183.395 1.00 85.72  ? 50   ILE A CG1 1 
ATOM   261  C  CG2 . ILE A 1 50  ? 56.821 -72.057  181.341 1.00 88.09  ? 50   ILE A CG2 1 
ATOM   262  C  CD1 . ILE A 1 50  ? 58.650 -70.736  183.649 1.00 89.43  ? 50   ILE A CD1 1 
ATOM   263  N  N   . THR A 1 51  ? 54.277 -74.094  182.442 1.00 90.63  ? 51   THR A N   1 
ATOM   264  C  CA  . THR A 1 51  ? 53.532 -75.023  181.614 1.00 92.79  ? 51   THR A CA  1 
ATOM   265  C  C   . THR A 1 51  ? 52.061 -74.639  181.544 1.00 91.55  ? 51   THR A C   1 
ATOM   266  O  O   . THR A 1 51  ? 51.496 -74.532  180.453 1.00 91.60  ? 51   THR A O   1 
ATOM   267  C  CB  . THR A 1 51  ? 53.698 -76.489  182.108 1.00 98.08  ? 51   THR A CB  1 
ATOM   268  O  OG1 . THR A 1 51  ? 55.059 -76.891  181.930 1.00 99.81  ? 51   THR A OG1 1 
ATOM   269  C  CG2 . THR A 1 51  ? 52.808 -77.442  181.337 1.00 100.03 ? 51   THR A CG2 1 
ATOM   270  N  N   . LEU A 1 52  ? 51.440 -74.422  182.696 1.00 90.88  ? 52   LEU A N   1 
ATOM   271  C  CA  . LEU A 1 52  ? 50.032 -74.056  182.716 1.00 90.58  ? 52   LEU A CA  1 
ATOM   272  C  C   . LEU A 1 52  ? 49.784 -72.798  181.889 1.00 86.61  ? 52   LEU A C   1 
ATOM   273  O  O   . LEU A 1 52  ? 48.781 -72.682  181.169 1.00 86.47  ? 52   LEU A O   1 
ATOM   274  C  CB  . LEU A 1 52  ? 49.584 -73.829  184.158 1.00 91.79  ? 52   LEU A CB  1 
ATOM   275  C  CG  . LEU A 1 52  ? 49.881 -75.060  185.029 1.00 97.01  ? 52   LEU A CG  1 
ATOM   276  C  CD1 . LEU A 1 52  ? 49.985 -74.721  186.516 1.00 97.03  ? 52   LEU A CD1 1 
ATOM   277  C  CD2 . LEU A 1 52  ? 48.848 -76.151  184.770 1.00 100.50 ? 52   LEU A CD2 1 
ATOM   278  N  N   . ILE A 1 53  ? 50.711 -71.852  182.006 1.00 83.27  ? 53   ILE A N   1 
ATOM   279  C  CA  . ILE A 1 53  ? 50.530 -70.560  181.389 1.00 80.22  ? 53   ILE A CA  1 
ATOM   280  C  C   . ILE A 1 53  ? 50.629 -70.753  179.899 1.00 79.86  ? 53   ILE A C   1 
ATOM   281  O  O   . ILE A 1 53  ? 49.786 -70.279  179.137 1.00 79.08  ? 53   ILE A O   1 
ATOM   282  C  CB  . ILE A 1 53  ? 51.578 -69.550  181.871 1.00 78.57  ? 53   ILE A CB  1 
ATOM   283  C  CG1 . ILE A 1 53  ? 51.226 -69.090  183.284 1.00 78.80  ? 53   ILE A CG1 1 
ATOM   284  C  CG2 . ILE A 1 53  ? 51.624 -68.348  180.951 1.00 75.80  ? 53   ILE A CG2 1 
ATOM   285  C  CD1 . ILE A 1 53  ? 49.871 -68.394  183.362 1.00 78.47  ? 53   ILE A CD1 1 
ATOM   286  N  N   . THR A 1 54  ? 51.649 -71.486  179.490 1.00 80.59  ? 54   THR A N   1 
ATOM   287  C  CA  . THR A 1 54  ? 51.817 -71.811  178.095 1.00 81.19  ? 54   THR A CA  1 
ATOM   288  C  C   . THR A 1 54  ? 50.558 -72.500  177.593 1.00 83.02  ? 54   THR A C   1 
ATOM   289  O  O   . THR A 1 54  ? 49.978 -72.092  176.580 1.00 82.40  ? 54   THR A O   1 
ATOM   290  C  CB  . THR A 1 54  ? 53.036 -72.682  177.931 1.00 83.83  ? 54   THR A CB  1 
ATOM   291  O  OG1 . THR A 1 54  ? 54.151 -71.973  178.482 1.00 82.90  ? 54   THR A OG1 1 
ATOM   292  C  CG2 . THR A 1 54  ? 53.301 -72.973  176.468 1.00 85.01  ? 54   THR A CG2 1 
ATOM   293  N  N   . GLY A 1 55  ? 50.116 -73.519  178.326 1.00 85.50  ? 55   GLY A N   1 
ATOM   294  C  CA  . GLY A 1 55  ? 48.898 -74.220  177.993 1.00 88.22  ? 55   GLY A CA  1 
ATOM   295  C  C   . GLY A 1 55  ? 47.716 -73.280  177.826 1.00 86.76  ? 55   GLY A C   1 
ATOM   296  O  O   . GLY A 1 55  ? 47.003 -73.318  176.804 1.00 87.12  ? 55   GLY A O   1 
ATOM   297  N  N   . LEU A 1 56  ? 47.486 -72.433  178.822 1.00 84.83  ? 56   LEU A N   1 
ATOM   298  C  CA  . LEU A 1 56  ? 46.333 -71.550  178.733 1.00 84.90  ? 56   LEU A CA  1 
ATOM   299  C  C   . LEU A 1 56  ? 46.472 -70.652  177.499 1.00 81.82  ? 56   LEU A C   1 
ATOM   300  O  O   . LEU A 1 56  ? 45.479 -70.299  176.860 1.00 82.09  ? 56   LEU A O   1 
ATOM   301  C  CB  . LEU A 1 56  ? 46.135 -70.742  180.025 1.00 84.69  ? 56   LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 56  ? 45.027 -69.674  179.949 1.00 87.08  ? 56   LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 56  ? 43.687 -70.260  179.512 1.00 92.16  ? 56   LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 56  ? 44.866 -68.887  181.275 1.00 89.88  ? 56   LEU A CD2 1 
ATOM   305  N  N   . TYR A 1 57  ? 47.714 -70.342  177.141 1.00 79.42  ? 57   TYR A N   1 
ATOM   306  C  CA  . TYR A 1 57  ? 48.025 -69.556  175.947 1.00 77.75  ? 57   TYR A CA  1 
ATOM   307  C  C   . TYR A 1 57  ? 47.829 -70.272  174.607 1.00 79.12  ? 57   TYR A C   1 
ATOM   308  O  O   . TYR A 1 57  ? 47.259 -69.711  173.678 1.00 78.59  ? 57   TYR A O   1 
ATOM   309  C  CB  . TYR A 1 57  ? 49.446 -69.034  176.063 1.00 76.72  ? 57   TYR A CB  1 
ATOM   310  C  CG  . TYR A 1 57  ? 50.047 -68.373  174.837 1.00 78.49  ? 57   TYR A CG  1 
ATOM   311  C  CD1 . TYR A 1 57  ? 49.767 -67.039  174.507 1.00 78.45  ? 57   TYR A CD1 1 
ATOM   312  C  CD2 . TYR A 1 57  ? 50.953 -69.058  174.048 1.00 81.09  ? 57   TYR A CD2 1 
ATOM   313  C  CE1 . TYR A 1 57  ? 50.363 -66.435  173.396 1.00 78.27  ? 57   TYR A CE1 1 
ATOM   314  C  CE2 . TYR A 1 57  ? 51.540 -68.466  172.949 1.00 81.94  ? 57   TYR A CE2 1 
ATOM   315  C  CZ  . TYR A 1 57  ? 51.246 -67.167  172.626 1.00 80.79  ? 57   TYR A CZ  1 
ATOM   316  O  OH  . TYR A 1 57  ? 51.866 -66.617  171.525 1.00 83.54  ? 57   TYR A OH  1 
ATOM   317  N  N   . LEU A 1 58  ? 48.303 -71.500  174.484 1.00 81.44  ? 58   LEU A N   1 
ATOM   318  C  CA  . LEU A 1 58  ? 47.972 -72.282  173.284 1.00 84.11  ? 58   LEU A CA  1 
ATOM   319  C  C   . LEU A 1 58  ? 46.460 -72.460  173.134 1.00 85.37  ? 58   LEU A C   1 
ATOM   320  O  O   . LEU A 1 58  ? 45.895 -72.165  172.085 1.00 85.37  ? 58   LEU A O   1 
ATOM   321  C  CB  . LEU A 1 58  ? 48.673 -73.644  173.306 1.00 87.71  ? 58   LEU A CB  1 
ATOM   322  C  CG  . LEU A 1 58  ? 50.197 -73.521  173.443 1.00 87.19  ? 58   LEU A CG  1 
ATOM   323  C  CD1 . LEU A 1 58  ? 50.887 -74.884  173.444 1.00 90.48  ? 58   LEU A CD1 1 
ATOM   324  C  CD2 . LEU A 1 58  ? 50.727 -72.631  172.335 1.00 84.63  ? 58   LEU A CD2 1 
ATOM   325  N  N   . VAL A 1 59  ? 45.813 -72.939  174.195 1.00 87.30  ? 59   VAL A N   1 
ATOM   326  C  CA  . VAL A 1 59  ? 44.371 -73.187  174.191 1.00 90.20  ? 59   VAL A CA  1 
ATOM   327  C  C   . VAL A 1 59  ? 43.585 -71.965  173.740 1.00 88.69  ? 59   VAL A C   1 
ATOM   328  O  O   . VAL A 1 59  ? 42.637 -72.063  172.958 1.00 91.06  ? 59   VAL A O   1 
ATOM   329  C  CB  . VAL A 1 59  ? 43.847 -73.596  175.589 1.00 92.03  ? 59   VAL A CB  1 
ATOM   330  C  CG1 . VAL A 1 59  ? 42.359 -73.845  175.533 1.00 94.90  ? 59   VAL A CG1 1 
ATOM   331  C  CG2 . VAL A 1 59  ? 44.561 -74.837  176.095 1.00 94.66  ? 59   VAL A CG2 1 
ATOM   332  N  N   . THR A 1 60  ? 43.976 -70.808  174.254 1.00 85.99  ? 60   THR A N   1 
ATOM   333  C  CA  . THR A 1 60  ? 43.232 -69.574  174.013 1.00 84.87  ? 60   THR A CA  1 
ATOM   334  C  C   . THR A 1 60  ? 43.303 -69.240  172.542 1.00 84.37  ? 60   THR A C   1 
ATOM   335  O  O   . THR A 1 60  ? 42.303 -68.882  171.912 1.00 85.05  ? 60   THR A O   1 
ATOM   336  C  CB  . THR A 1 60  ? 43.823 -68.405  174.830 1.00 82.13  ? 60   THR A CB  1 
ATOM   337  O  OG1 . THR A 1 60  ? 43.671 -68.680  176.234 1.00 83.02  ? 60   THR A OG1 1 
ATOM   338  C  CG2 . THR A 1 60  ? 43.112 -67.113  174.479 1.00 81.24  ? 60   THR A CG2 1 
ATOM   339  N  N   . ASN A 1 61  ? 44.514 -69.359  172.011 1.00 83.70  ? 61   ASN A N   1 
ATOM   340  C  CA  . ASN A 1 61  ? 44.748 -69.187  170.593 1.00 84.39  ? 61   ASN A CA  1 
ATOM   341  C  C   . ASN A 1 61  ? 43.972 -70.234  169.787 1.00 88.22  ? 61   ASN A C   1 
ATOM   342  O  O   . ASN A 1 61  ? 43.343 -69.895  168.788 1.00 89.22  ? 61   ASN A O   1 
ATOM   343  C  CB  . ASN A 1 61  ? 46.253 -69.185  170.285 1.00 83.40  ? 61   ASN A CB  1 
ATOM   344  C  CG  . ASN A 1 61  ? 46.897 -67.809  170.501 1.00 80.90  ? 61   ASN A CG  1 
ATOM   345  O  OD1 . ASN A 1 61  ? 46.605 -66.860  169.780 1.00 81.42  ? 61   ASN A OD1 1 
ATOM   346  N  ND2 . ASN A 1 61  ? 47.770 -67.702  171.495 1.00 79.42  ? 61   ASN A ND2 1 
ATOM   347  N  N   . ALA A 1 62  ? 43.976 -71.490  170.235 1.00 91.27  ? 62   ALA A N   1 
ATOM   348  C  CA  . ALA A 1 62  ? 43.180 -72.522  169.560 1.00 96.21  ? 62   ALA A CA  1 
ATOM   349  C  C   . ALA A 1 62  ? 41.734 -72.056  169.437 1.00 97.22  ? 62   ALA A C   1 
ATOM   350  O  O   . ALA A 1 62  ? 41.131 -72.136  168.369 1.00 99.55  ? 62   ALA A O   1 
ATOM   351  C  CB  . ALA A 1 62  ? 43.254 -73.851  170.295 1.00 99.32  ? 62   ALA A CB  1 
ATOM   352  N  N   . LEU A 1 63  ? 41.185 -71.544  170.526 1.00 96.46  ? 63   LEU A N   1 
ATOM   353  C  CA  . LEU A 1 63  ? 39.807 -71.110  170.510 1.00 98.75  ? 63   LEU A CA  1 
ATOM   354  C  C   . LEU A 1 63  ? 39.539 -70.037  169.460 1.00 97.37  ? 63   LEU A C   1 
ATOM   355  O  O   . LEU A 1 63  ? 38.669 -70.208  168.613 1.00 100.26 ? 63   LEU A O   1 
ATOM   356  C  CB  . LEU A 1 63  ? 39.374 -70.653  171.899 1.00 98.57  ? 63   LEU A CB  1 
ATOM   357  C  CG  . LEU A 1 63  ? 39.289 -71.882  172.805 1.00 102.70 ? 63   LEU A CG  1 
ATOM   358  C  CD1 . LEU A 1 63  ? 38.843 -71.535  174.218 1.00 102.86 ? 63   LEU A CD1 1 
ATOM   359  C  CD2 . LEU A 1 63  ? 38.367 -72.930  172.166 1.00 108.23 ? 63   LEU A CD2 1 
ATOM   360  N  N   . PHE A 1 64  ? 40.279 -68.937  169.510 1.00 93.80  ? 64   PHE A N   1 
ATOM   361  C  CA  . PHE A 1 64  ? 40.089 -67.872  168.539 1.00 93.03  ? 64   PHE A CA  1 
ATOM   362  C  C   . PHE A 1 64  ? 40.248 -68.379  167.104 1.00 95.14  ? 64   PHE A C   1 
ATOM   363  O  O   . PHE A 1 64  ? 39.420 -68.093  166.246 1.00 96.50  ? 64   PHE A O   1 
ATOM   364  C  CB  . PHE A 1 64  ? 41.028 -66.685  168.816 1.00 89.53  ? 64   PHE A CB  1 
ATOM   365  C  CG  . PHE A 1 64  ? 40.466 -65.686  169.791 1.00 88.72  ? 64   PHE A CG  1 
ATOM   366  C  CD1 . PHE A 1 64  ? 40.794 -65.746  171.141 1.00 87.94  ? 64   PHE A CD1 1 
ATOM   367  C  CD2 . PHE A 1 64  ? 39.600 -64.690  169.364 1.00 89.10  ? 64   PHE A CD2 1 
ATOM   368  C  CE1 . PHE A 1 64  ? 40.270 -64.829  172.053 1.00 87.38  ? 64   PHE A CE1 1 
ATOM   369  C  CE2 . PHE A 1 64  ? 39.074 -63.767  170.271 1.00 90.36  ? 64   PHE A CE2 1 
ATOM   370  C  CZ  . PHE A 1 64  ? 39.410 -63.843  171.618 1.00 88.94  ? 64   PHE A CZ  1 
ATOM   371  N  N   . ALA A 1 65  ? 41.311 -69.136  166.841 1.00 96.18  ? 65   ALA A N   1 
ATOM   372  C  CA  . ALA A 1 65  ? 41.508 -69.714  165.509 1.00 99.35  ? 65   ALA A CA  1 
ATOM   373  C  C   . ALA A 1 65  ? 40.204 -70.357  165.018 1.00 103.74 ? 65   ALA A C   1 
ATOM   374  O  O   . ALA A 1 65  ? 39.770 -70.113  163.886 1.00 105.39 ? 65   ALA A O   1 
ATOM   375  C  CB  . ALA A 1 65  ? 42.650 -70.736  165.519 1.00 100.40 ? 65   ALA A CB  1 
ATOM   376  N  N   . LEU A 1 66  ? 39.590 -71.169  165.879 1.00 106.37 ? 66   LEU A N   1 
ATOM   377  C  CA  . LEU A 1 66  ? 38.319 -71.813  165.571 1.00 111.50 ? 66   LEU A CA  1 
ATOM   378  C  C   . LEU A 1 66  ? 37.226 -70.785  165.369 1.00 111.66 ? 66   LEU A C   1 
ATOM   379  O  O   . LEU A 1 66  ? 36.383 -70.929  164.486 1.00 115.03 ? 66   LEU A O   1 
ATOM   380  C  CB  . LEU A 1 66  ? 37.898 -72.773  166.686 1.00 114.34 ? 66   LEU A CB  1 
ATOM   381  C  CG  . LEU A 1 66  ? 38.661 -74.091  166.804 1.00 116.86 ? 66   LEU A CG  1 
ATOM   382  C  CD1 . LEU A 1 66  ? 38.089 -74.904  167.931 1.00 119.88 ? 66   LEU A CD1 1 
ATOM   383  C  CD2 . LEU A 1 66  ? 38.588 -74.868  165.510 1.00 120.76 ? 66   LEU A CD2 1 
ATOM   384  N  N   . ALA A 1 67  ? 37.231 -69.752  166.197 1.00 108.79 ? 67   ALA A N   1 
ATOM   385  C  CA  . ALA A 1 67  ? 36.240 -68.712  166.066 1.00 109.68 ? 67   ALA A CA  1 
ATOM   386  C  C   . ALA A 1 67  ? 36.370 -68.027  164.712 1.00 109.70 ? 67   ALA A C   1 
ATOM   387  O  O   . ALA A 1 67  ? 35.407 -67.469  164.213 1.00 111.78 ? 67   ALA A O   1 
ATOM   388  C  CB  . ALA A 1 67  ? 36.367 -67.714  167.185 1.00 106.93 ? 67   ALA A CB  1 
ATOM   389  N  N   . TYR A 1 68  ? 37.550 -68.072  164.102 1.00 108.64 ? 68   TYR A N   1 
ATOM   390  C  CA  . TYR A 1 68  ? 37.727 -67.451  162.783 1.00 109.68 ? 68   TYR A CA  1 
ATOM   391  C  C   . TYR A 1 68  ? 37.268 -68.389  161.663 1.00 114.25 ? 68   TYR A C   1 
ATOM   392  O  O   . TYR A 1 68  ? 36.813 -67.947  160.601 1.00 115.67 ? 68   TYR A O   1 
ATOM   393  C  CB  . TYR A 1 68  ? 39.182 -67.018  162.557 1.00 107.16 ? 68   TYR A CB  1 
ATOM   394  C  CG  . TYR A 1 68  ? 39.623 -65.807  163.372 1.00 104.51 ? 68   TYR A CG  1 
ATOM   395  C  CD1 . TYR A 1 68  ? 39.001 -64.569  163.221 1.00 105.15 ? 68   TYR A CD1 1 
ATOM   396  C  CD2 . TYR A 1 68  ? 40.671 -65.898  164.273 1.00 101.85 ? 68   TYR A CD2 1 
ATOM   397  C  CE1 . TYR A 1 68  ? 39.408 -63.465  163.953 1.00 103.17 ? 68   TYR A CE1 1 
ATOM   398  C  CE2 . TYR A 1 68  ? 41.082 -64.803  165.000 1.00 100.04 ? 68   TYR A CE2 1 
ATOM   399  C  CZ  . TYR A 1 68  ? 40.451 -63.594  164.844 1.00 100.42 ? 68   TYR A CZ  1 
ATOM   400  O  OH  . TYR A 1 68  ? 40.873 -62.515  165.588 1.00 98.88  ? 68   TYR A OH  1 
ATOM   401  N  N   . LEU A 1 69  ? 37.387 -69.690  161.923 1.00 117.07 ? 69   LEU A N   1 
ATOM   402  C  CA  . LEU A 1 69  ? 36.976 -70.726  160.979 1.00 122.35 ? 69   LEU A CA  1 
ATOM   403  C  C   . LEU A 1 69  ? 35.448 -70.955  160.966 1.00 126.79 ? 69   LEU A C   1 
ATOM   404  O  O   . LEU A 1 69  ? 34.891 -71.437  159.981 1.00 131.07 ? 69   LEU A O   1 
ATOM   405  C  CB  . LEU A 1 69  ? 37.723 -72.037  161.268 1.00 124.03 ? 69   LEU A CB  1 
ATOM   406  C  CG  . LEU A 1 69  ? 39.236 -72.017  161.021 1.00 121.22 ? 69   LEU A CG  1 
ATOM   407  C  CD1 . LEU A 1 69  ? 39.849 -73.399  161.214 1.00 123.36 ? 69   LEU A CD1 1 
ATOM   408  C  CD2 . LEU A 1 69  ? 39.573 -71.465  159.650 1.00 120.36 ? 69   LEU A CD2 1 
ATOM   409  N  N   . ALA A 1 70  ? 34.775 -70.618  162.060 1.00 126.80 ? 70   ALA A N   1 
ATOM   410  C  CA  . ALA A 1 70  ? 33.318 -70.630  162.089 1.00 131.36 ? 70   ALA A CA  1 
ATOM   411  C  C   . ALA A 1 70  ? 32.771 -69.477  161.253 1.00 131.43 ? 70   ALA A C   1 
ATOM   412  O  O   . ALA A 1 70  ? 31.583 -69.410  160.984 1.00 135.60 ? 70   ALA A O   1 
ATOM   413  C  CB  . ALA A 1 70  ? 32.817 -70.528  163.509 1.00 131.32 ? 70   ALA A CB  1 
ATOM   414  N  N   . CYS A 1 71  ? 33.650 -68.568  160.854 1.00 128.17 ? 71   CYS A N   1 
ATOM   415  C  CA  . CYS A 1 71  ? 33.276 -67.401  160.070 1.00 128.53 ? 71   CYS A CA  1 
ATOM   416  C  C   . CYS A 1 71  ? 33.521 -67.659  158.591 1.00 130.69 ? 71   CYS A C   1 
ATOM   417  O  O   . CYS A 1 71  ? 33.180 -66.836  157.740 1.00 131.55 ? 71   CYS A O   1 
ATOM   418  C  CB  . CYS A 1 71  ? 34.129 -66.194  160.488 1.00 124.22 ? 71   CYS A CB  1 
ATOM   419  S  SG  . CYS A 1 71  ? 33.600 -65.304  161.963 1.00 123.59 ? 71   CYS A SG  1 
ATOM   420  N  N   . GLY A 1 72  ? 34.140 -68.796  158.294 1.00 129.94 ? 72   GLY A N   1 
ATOM   421  C  CA  . GLY A 1 72  ? 34.575 -69.088  156.934 1.00 132.33 ? 72   GLY A CA  1 
ATOM   422  C  C   . GLY A 1 72  ? 36.006 -68.637  156.701 1.00 128.48 ? 72   GLY A C   1 
ATOM   423  O  O   . GLY A 1 72  ? 36.914 -68.995  157.462 1.00 125.36 ? 72   GLY A O   1 
ATOM   424  N  N   . ASP A 1 73  ? 36.209 -67.852  155.646 1.00 129.31 ? 73   ASP A N   1 
ATOM   425  C  CA  . ASP A 1 73  ? 37.544 -67.397  155.291 1.00 126.37 ? 73   ASP A CA  1 
ATOM   426  C  C   . ASP A 1 73  ? 37.666 -65.896  155.503 1.00 123.42 ? 73   ASP A C   1 
ATOM   427  O  O   . ASP A 1 73  ? 37.650 -65.141  154.540 1.00 125.66 ? 73   ASP A O   1 
ATOM   428  C  CB  . ASP A 1 73  ? 37.867 -67.722  153.822 1.00 130.53 ? 73   ASP A CB  1 
ATOM   429  C  CG  . ASP A 1 73  ? 37.422 -69.116  153.409 1.00 142.40 ? 73   ASP A CG  1 
ATOM   430  O  OD1 . ASP A 1 73  ? 38.173 -69.783  152.658 1.00 151.97 ? 73   ASP A OD1 1 
ATOM   431  O  OD2 . ASP A 1 73  ? 36.321 -69.544  153.817 1.00 155.93 ? 73   ASP A OD2 1 
ATOM   432  N  N   . VAL A 1 74  ? 37.792 -65.450  156.748 1.00 119.05 ? 74   VAL A N   1 
ATOM   433  C  CA  . VAL A 1 74  ? 37.903 -64.008  157.002 1.00 116.67 ? 74   VAL A CA  1 
ATOM   434  C  C   . VAL A 1 74  ? 39.351 -63.552  157.279 1.00 112.11 ? 74   VAL A C   1 
ATOM   435  O  O   . VAL A 1 74  ? 39.595 -62.454  157.785 1.00 110.45 ? 74   VAL A O   1 
ATOM   436  C  CB  . VAL A 1 74  ? 36.943 -63.567  158.105 1.00 116.71 ? 74   VAL A CB  1 
ATOM   437  C  CG1 . VAL A 1 74  ? 35.561 -63.282  157.527 1.00 121.39 ? 74   VAL A CG1 1 
ATOM   438  C  CG2 . VAL A 1 74  ? 36.859 -64.651  159.163 1.00 116.01 ? 74   VAL A CG2 1 
ATOM   439  N  N   . ILE A 1 75  ? 40.299 -64.410  156.908 1.00 110.40 ? 75   ILE A N   1 
ATOM   440  C  CA  . ILE A 1 75  ? 41.717 -64.129  157.024 1.00 106.65 ? 75   ILE A CA  1 
ATOM   441  C  C   . ILE A 1 75  ? 42.379 -64.143  155.645 1.00 108.38 ? 75   ILE A C   1 
ATOM   442  O  O   . ILE A 1 75  ? 42.716 -65.205  155.115 1.00 109.79 ? 75   ILE A O   1 
ATOM   443  C  CB  . ILE A 1 75  ? 42.415 -65.185  157.912 1.00 104.60 ? 75   ILE A CB  1 
ATOM   444  C  CG1 . ILE A 1 75  ? 41.539 -65.544  159.120 1.00 103.76 ? 75   ILE A CG1 1 
ATOM   445  C  CG2 . ILE A 1 75  ? 43.809 -64.709  158.354 1.00 101.86 ? 75   ILE A CG2 1 
ATOM   446  C  CD1 . ILE A 1 75  ? 42.195 -66.524  160.106 1.00 102.11 ? 75   ILE A CD1 1 
ATOM   447  N  N   . GLU A 1 76  ? 42.573 -62.964  155.074 1.00 108.28 ? 76   GLU A N   1 
ATOM   448  C  CA  . GLU A 1 76  ? 43.228 -62.885  153.785 1.00 110.64 ? 76   GLU A CA  1 
ATOM   449  C  C   . GLU A 1 76  ? 44.563 -63.597  153.822 1.00 109.02 ? 76   GLU A C   1 
ATOM   450  O  O   . GLU A 1 76  ? 45.247 -63.590  154.839 1.00 105.86 ? 76   GLU A O   1 
ATOM   451  C  CB  . GLU A 1 76  ? 43.453 -61.436  153.360 1.00 111.57 ? 76   GLU A CB  1 
ATOM   452  C  CG  . GLU A 1 76  ? 42.193 -60.671  153.070 1.00 115.00 ? 76   GLU A CG  1 
ATOM   453  C  CD  . GLU A 1 76  ? 42.445 -59.466  152.179 1.00 119.49 ? 76   GLU A CD  1 
ATOM   454  O  OE1 . GLU A 1 76  ? 42.621 -58.340  152.717 1.00 118.92 ? 76   GLU A OE1 1 
ATOM   455  O  OE2 . GLU A 1 76  ? 42.469 -59.650  150.943 1.00 124.10 ? 76   GLU A OE2 1 
ATOM   456  N  N   . ASN A 1 77  ? 44.931 -64.179  152.688 1.00 111.86 ? 77   ASN A N   1 
ATOM   457  C  CA  . ASN A 1 77  ? 46.214 -64.832  152.493 1.00 111.64 ? 77   ASN A CA  1 
ATOM   458  C  C   . ASN A 1 77  ? 46.367 -66.120  153.289 1.00 110.19 ? 77   ASN A C   1 
ATOM   459  O  O   . ASN A 1 77  ? 47.455 -66.662  153.400 1.00 110.08 ? 77   ASN A O   1 
ATOM   460  C  CB  . ASN A 1 77  ? 47.367 -63.864  152.735 1.00 109.63 ? 77   ASN A CB  1 
ATOM   461  C  CG  . ASN A 1 77  ? 47.538 -62.876  151.598 1.00 112.64 ? 77   ASN A CG  1 
ATOM   462  O  OD1 . ASN A 1 77  ? 47.349 -63.218  150.435 1.00 118.47 ? 77   ASN A OD1 1 
ATOM   463  N  ND2 . ASN A 1 77  ? 47.909 -61.651  151.925 1.00 110.44 ? 77   ASN A ND2 1 
ATOM   464  N  N   . ALA A 1 78  ? 45.253 -66.629  153.794 1.00 109.77 ? 78   ALA A N   1 
ATOM   465  C  CA  . ALA A 1 78  ? 45.250 -67.875  154.538 1.00 110.16 ? 78   ALA A CA  1 
ATOM   466  C  C   . ALA A 1 78  ? 44.662 -69.040  153.737 1.00 115.85 ? 78   ALA A C   1 
ATOM   467  O  O   . ALA A 1 78  ? 43.678 -68.880  153.009 1.00 118.87 ? 78   ALA A O   1 
ATOM   468  C  CB  . ALA A 1 78  ? 44.480 -67.694  155.833 1.00 106.29 ? 78   ALA A CB  1 
ATOM   469  N  N   . ARG A 1 79  ? 45.255 -70.221  153.871 1.00 118.50 ? 79   ARG A N   1 
ATOM   470  C  CA  . ARG A 1 79  ? 44.712 -71.408  153.213 1.00 124.48 ? 79   ARG A CA  1 
ATOM   471  C  C   . ARG A 1 79  ? 43.351 -71.780  153.817 1.00 124.69 ? 79   ARG A C   1 
ATOM   472  O  O   . ARG A 1 79  ? 43.264 -72.075  155.005 1.00 122.05 ? 79   ARG A O   1 
ATOM   473  C  CB  . ARG A 1 79  ? 45.688 -72.579  153.339 1.00 127.16 ? 79   ARG A CB  1 
ATOM   474  C  CG  . ARG A 1 79  ? 47.060 -72.321  152.738 1.00 128.68 ? 79   ARG A CG  1 
ATOM   475  C  CD  . ARG A 1 79  ? 48.057 -73.372  153.197 1.00 131.52 ? 79   ARG A CD  1 
ATOM   476  N  NE  . ARG A 1 79  ? 48.389 -73.206  154.609 1.00 128.05 ? 79   ARG A NE  1 
ATOM   477  C  CZ  . ARG A 1 79  ? 48.646 -74.211  155.440 1.00 129.86 ? 79   ARG A CZ  1 
ATOM   478  N  NH1 . ARG A 1 79  ? 48.606 -75.459  154.997 1.00 135.98 ? 79   ARG A NH1 1 
ATOM   479  N  NH2 . ARG A 1 79  ? 48.942 -73.969  156.714 1.00 125.39 ? 79   ARG A NH2 1 
ATOM   480  N  N   . PRO A 1 80  ? 42.286 -71.803  152.991 1.00 128.97 ? 80   PRO A N   1 
ATOM   481  C  CA  . PRO A 1 80  ? 40.916 -72.014  153.492 1.00 129.29 ? 80   PRO A CA  1 
ATOM   482  C  C   . PRO A 1 80  ? 40.740 -73.266  154.362 1.00 142.03 ? 80   PRO A C   1 
ATOM   483  O  O   . PRO A 1 80  ? 41.212 -74.348  154.003 1.00 168.22 ? 80   PRO A O   1 
ATOM   484  C  CB  . PRO A 1 80  ? 40.086 -72.156  152.209 1.00 135.21 ? 80   PRO A CB  1 
ATOM   485  C  CG  . PRO A 1 80  ? 40.899 -71.466  151.151 1.00 136.43 ? 80   PRO A CG  1 
ATOM   486  C  CD  . PRO A 1 80  ? 42.323 -71.783  151.513 1.00 134.41 ? 80   PRO A CD  1 
ATOM   487  N  N   . GLY A 1 81  ? 40.054 -73.108  155.493 1.00 126.79 ? 81   GLY A N   1 
ATOM   488  C  CA  . GLY A 1 81  ? 39.730 -74.235  156.354 1.00 127.89 ? 81   GLY A CA  1 
ATOM   489  C  C   . GLY A 1 81  ? 40.913 -74.701  157.174 1.00 125.41 ? 81   GLY A C   1 
ATOM   490  O  O   . GLY A 1 81  ? 40.772 -75.576  158.027 1.00 126.64 ? 81   GLY A O   1 
ATOM   491  N  N   . SER A 1 82  ? 42.085 -74.122  156.918 1.00 128.02 ? 82   SER A N   1 
ATOM   492  C  CA  . SER A 1 82  ? 43.275 -74.432  157.712 1.00 125.98 ? 82   SER A CA  1 
ATOM   493  C  C   . SER A 1 82  ? 43.190 -73.893  159.139 1.00 121.05 ? 82   SER A C   1 
ATOM   494  O  O   . SER A 1 82  ? 42.871 -72.722  159.376 1.00 117.39 ? 82   SER A O   1 
ATOM   495  C  CB  . SER A 1 82  ? 44.548 -73.919  157.038 1.00 125.86 ? 82   SER A CB  1 
ATOM   496  O  OG  . SER A 1 82  ? 45.687 -74.225  157.827 1.00 125.10 ? 82   SER A OG  1 
ATOM   497  N  N   . PHE A 1 83  ? 43.465 -74.783  160.085 1.00 121.35 ? 83   PHE A N   1 
ATOM   498  C  CA  . PHE A 1 83  ? 43.563 -74.426  161.490 1.00 117.44 ? 83   PHE A CA  1 
ATOM   499  C  C   . PHE A 1 83  ? 44.921 -73.766  161.693 1.00 114.27 ? 83   PHE A C   1 
ATOM   500  O  O   . PHE A 1 83  ? 45.030 -72.677  162.261 1.00 110.54 ? 83   PHE A O   1 
ATOM   501  C  CB  . PHE A 1 83  ? 43.426 -75.678  162.361 1.00 119.46 ? 83   PHE A CB  1 
ATOM   502  C  CG  . PHE A 1 83  ? 43.586 -75.412  163.820 1.00 116.59 ? 83   PHE A CG  1 
ATOM   503  C  CD1 . PHE A 1 83  ? 42.545 -74.880  164.551 1.00 114.85 ? 83   PHE A CD1 1 
ATOM   504  C  CD2 . PHE A 1 83  ? 44.785 -75.688  164.462 1.00 115.94 ? 83   PHE A CD2 1 
ATOM   505  C  CE1 . PHE A 1 83  ? 42.696 -74.624  165.886 1.00 112.72 ? 83   PHE A CE1 1 
ATOM   506  C  CE2 . PHE A 1 83  ? 44.941 -75.435  165.794 1.00 112.59 ? 83   PHE A CE2 1 
ATOM   507  C  CZ  . PHE A 1 83  ? 43.899 -74.901  166.509 1.00 111.87 ? 83   PHE A CZ  1 
ATOM   508  N  N   . THR A 1 84  ? 45.949 -74.441  161.197 1.00 116.13 ? 84   THR A N   1 
ATOM   509  C  CA  . THR A 1 84  ? 47.302 -73.946  161.236 1.00 114.09 ? 84   THR A CA  1 
ATOM   510  C  C   . THR A 1 84  ? 47.387 -72.454  160.930 1.00 110.22 ? 84   THR A C   1 
ATOM   511  O  O   . THR A 1 84  ? 47.952 -71.685  161.701 1.00 106.60 ? 84   THR A O   1 
ATOM   512  C  CB  . THR A 1 84  ? 48.161 -74.729  160.251 1.00 118.74 ? 84   THR A CB  1 
ATOM   513  O  OG1 . THR A 1 84  ? 48.328 -76.058  160.746 1.00 122.20 ? 84   THR A OG1 1 
ATOM   514  C  CG2 . THR A 1 84  ? 49.533 -74.092  160.074 1.00 118.20 ? 84   THR A CG2 1 
ATOM   515  N  N   . ASP A 1 85  ? 46.829 -72.040  159.801 1.00 111.02 ? 85   ASP A N   1 
ATOM   516  C  CA  . ASP A 1 85  ? 46.926 -70.633  159.411 1.00 107.84 ? 85   ASP A CA  1 
ATOM   517  C  C   . ASP A 1 85  ? 46.098 -69.682  160.298 1.00 102.78 ? 85   ASP A C   1 
ATOM   518  O  O   . ASP A 1 85  ? 46.534 -68.567  160.603 1.00 99.78  ? 85   ASP A O   1 
ATOM   519  C  CB  . ASP A 1 85  ? 46.570 -70.458  157.934 1.00 111.65 ? 85   ASP A CB  1 
ATOM   520  C  CG  . ASP A 1 85  ? 47.694 -70.889  157.007 1.00 116.84 ? 85   ASP A CG  1 
ATOM   521  O  OD1 . ASP A 1 85  ? 48.747 -71.329  157.518 1.00 117.80 ? 85   ASP A OD1 1 
ATOM   522  O  OD2 . ASP A 1 85  ? 47.521 -70.783  155.766 1.00 121.92 ? 85   ASP A OD2 1 
ATOM   523  N  N   . ALA A 1 86  ? 44.911 -70.122  160.701 1.00 101.80 ? 86   ALA A N   1 
ATOM   524  C  CA  . ALA A 1 86  ? 44.032 -69.289  161.499 1.00 97.99  ? 86   ALA A CA  1 
ATOM   525  C  C   . ALA A 1 86  ? 44.554 -69.234  162.942 1.00 94.40  ? 86   ALA A C   1 
ATOM   526  O  O   . ALA A 1 86  ? 44.245 -68.302  163.691 1.00 91.92  ? 86   ALA A O   1 
ATOM   527  C  CB  . ALA A 1 86  ? 42.586 -69.803  161.442 1.00 99.73  ? 86   ALA A CB  1 
ATOM   528  N  N   . PHE A 1 87  ? 45.346 -70.242  163.309 1.00 94.25  ? 87   PHE A N   1 
ATOM   529  C  CA  . PHE A 1 87  ? 45.979 -70.305  164.606 1.00 90.84  ? 87   PHE A CA  1 
ATOM   530  C  C   . PHE A 1 87  ? 47.178 -69.367  164.640 1.00 88.18  ? 87   PHE A C   1 
ATOM   531  O  O   . PHE A 1 87  ? 47.359 -68.653  165.621 1.00 86.16  ? 87   PHE A O   1 
ATOM   532  C  CB  . PHE A 1 87  ? 46.417 -71.725  164.940 1.00 93.23  ? 87   PHE A CB  1 
ATOM   533  C  CG  . PHE A 1 87  ? 47.156 -71.845  166.252 1.00 91.33  ? 87   PHE A CG  1 
ATOM   534  C  CD1 . PHE A 1 87  ? 46.470 -72.074  167.436 1.00 90.65  ? 87   PHE A CD1 1 
ATOM   535  C  CD2 . PHE A 1 87  ? 48.539 -71.731  166.302 1.00 89.85  ? 87   PHE A CD2 1 
ATOM   536  C  CE1 . PHE A 1 87  ? 47.154 -72.191  168.648 1.00 89.48  ? 87   PHE A CE1 1 
ATOM   537  C  CE2 . PHE A 1 87  ? 49.232 -71.838  167.513 1.00 87.59  ? 87   PHE A CE2 1 
ATOM   538  C  CZ  . PHE A 1 87  ? 48.540 -72.067  168.683 1.00 86.87  ? 87   PHE A CZ  1 
ATOM   539  N  N   . PHE A 1 88  ? 47.997 -69.341  163.591 1.00 88.37  ? 88   PHE A N   1 
ATOM   540  C  CA  . PHE A 1 88  ? 49.090 -68.375  163.561 1.00 85.57  ? 88   PHE A CA  1 
ATOM   541  C  C   . PHE A 1 88  ? 48.598 -66.948  163.324 1.00 82.80  ? 88   PHE A C   1 
ATOM   542  O  O   . PHE A 1 88  ? 49.270 -65.986  163.700 1.00 80.18  ? 88   PHE A O   1 
ATOM   543  C  CB  . PHE A 1 88  ? 50.164 -68.766  162.560 1.00 88.54  ? 88   PHE A CB  1 
ATOM   544  C  CG  . PHE A 1 88  ? 50.836 -70.060  162.890 1.00 91.55  ? 88   PHE A CG  1 
ATOM   545  C  CD1 . PHE A 1 88  ? 51.215 -70.341  164.193 1.00 90.50  ? 88   PHE A CD1 1 
ATOM   546  C  CD2 . PHE A 1 88  ? 51.085 -71.006  161.902 1.00 96.87  ? 88   PHE A CD2 1 
ATOM   547  C  CE1 . PHE A 1 88  ? 51.835 -71.539  164.516 1.00 93.26  ? 88   PHE A CE1 1 
ATOM   548  C  CE2 . PHE A 1 88  ? 51.708 -72.219  162.214 1.00 99.39  ? 88   PHE A CE2 1 
ATOM   549  C  CZ  . PHE A 1 88  ? 52.083 -72.481  163.523 1.00 98.78  ? 88   PHE A CZ  1 
ATOM   550  N  N   . PHE A 1 89  ? 47.419 -66.806  162.716 1.00 83.12  ? 89   PHE A N   1 
ATOM   551  C  CA  . PHE A 1 89  ? 46.792 -65.494  162.659 1.00 80.48  ? 89   PHE A CA  1 
ATOM   552  C  C   . PHE A 1 89  ? 46.525 -64.975  164.082 1.00 78.25  ? 89   PHE A C   1 
ATOM   553  O  O   . PHE A 1 89  ? 46.949 -63.866  164.464 1.00 76.01  ? 89   PHE A O   1 
ATOM   554  C  CB  . PHE A 1 89  ? 45.469 -65.535  161.936 1.00 81.29  ? 89   PHE A CB  1 
ATOM   555  C  CG  . PHE A 1 89  ? 44.814 -64.191  161.856 1.00 77.96  ? 89   PHE A CG  1 
ATOM   556  C  CD1 . PHE A 1 89  ? 45.479 -63.121  161.258 1.00 73.72  ? 89   PHE A CD1 1 
ATOM   557  C  CD2 . PHE A 1 89  ? 43.555 -63.979  162.397 1.00 76.29  ? 89   PHE A CD2 1 
ATOM   558  C  CE1 . PHE A 1 89  ? 44.893 -61.858  161.187 1.00 73.39  ? 89   PHE A CE1 1 
ATOM   559  C  CE2 . PHE A 1 89  ? 42.956 -62.724  162.324 1.00 75.90  ? 89   PHE A CE2 1 
ATOM   560  C  CZ  . PHE A 1 89  ? 43.632 -61.651  161.719 1.00 72.75  ? 89   PHE A CZ  1 
ATOM   561  N  N   . SER A 1 90  ? 45.795 -65.791  164.837 1.00 78.82  ? 90   SER A N   1 
ATOM   562  C  CA  . SER A 1 90  ? 45.421 -65.498  166.205 1.00 78.02  ? 90   SER A CA  1 
ATOM   563  C  C   . SER A 1 90  ? 46.624 -65.080  167.046 1.00 75.16  ? 90   SER A C   1 
ATOM   564  O  O   . SER A 1 90  ? 46.664 -63.981  167.588 1.00 73.17  ? 90   SER A O   1 
ATOM   565  C  CB  . SER A 1 90  ? 44.761 -66.727  166.819 1.00 80.28  ? 90   SER A CB  1 
ATOM   566  O  OG  . SER A 1 90  ? 44.134 -66.385  168.051 1.00 83.58  ? 90   SER A OG  1 
ATOM   567  N  N   . VAL A 1 91  ? 47.610 -65.963  167.124 1.00 75.36  ? 91   VAL A N   1 
ATOM   568  C  CA  . VAL A 1 91  ? 48.871 -65.645  167.764 1.00 73.77  ? 91   VAL A CA  1 
ATOM   569  C  C   . VAL A 1 91  ? 49.360 -64.276  167.375 1.00 72.53  ? 91   VAL A C   1 
ATOM   570  O  O   . VAL A 1 91  ? 49.724 -63.490  168.226 1.00 71.98  ? 91   VAL A O   1 
ATOM   571  C  CB  . VAL A 1 91  ? 49.972 -66.660  167.437 1.00 75.23  ? 91   VAL A CB  1 
ATOM   572  C  CG1 . VAL A 1 91  ? 51.307 -66.151  167.942 1.00 72.33  ? 91   VAL A CG1 1 
ATOM   573  C  CG2 . VAL A 1 91  ? 49.644 -67.994  168.074 1.00 76.88  ? 91   VAL A CG2 1 
ATOM   574  N  N   . GLN A 1 92  ? 49.373 -63.976  166.094 1.00 73.73  ? 92   GLN A N   1 
ATOM   575  C  CA  . GLN A 1 92  ? 49.944 -62.723  165.654 1.00 72.74  ? 92   GLN A CA  1 
ATOM   576  C  C   . GLN A 1 92  ? 49.113 -61.547  166.061 1.00 71.58  ? 92   GLN A C   1 
ATOM   577  O  O   . GLN A 1 92  ? 49.641 -60.438  166.172 1.00 70.73  ? 92   GLN A O   1 
ATOM   578  C  CB  . GLN A 1 92  ? 50.055 -62.718  164.153 1.00 74.88  ? 92   GLN A CB  1 
ATOM   579  C  CG  . GLN A 1 92  ? 51.227 -63.484  163.660 1.00 76.76  ? 92   GLN A CG  1 
ATOM   580  C  CD  . GLN A 1 92  ? 51.139 -63.709  162.172 1.00 79.15  ? 92   GLN A CD  1 
ATOM   581  O  OE1 . GLN A 1 92  ? 51.746 -64.621  161.647 1.00 81.27  ? 92   GLN A OE1 1 
ATOM   582  N  NE2 . GLN A 1 92  ? 50.352 -62.891  161.495 1.00 78.28  ? 92   GLN A NE2 1 
ATOM   583  N  N   . THR A 1 93  ? 47.808 -61.784  166.221 1.00 71.96  ? 93   THR A N   1 
ATOM   584  C  CA  . THR A 1 93  ? 46.853 -60.761  166.626 1.00 71.53  ? 93   THR A CA  1 
ATOM   585  C  C   . THR A 1 93  ? 46.950 -60.575  168.152 1.00 69.50  ? 93   THR A C   1 
ATOM   586  O  O   . THR A 1 93  ? 47.173 -59.470  168.675 1.00 68.16  ? 93   THR A O   1 
ATOM   587  C  CB  . THR A 1 93  ? 45.405 -61.200  166.280 1.00 74.07  ? 93   THR A CB  1 
ATOM   588  O  OG1 . THR A 1 93  ? 45.293 -61.490  164.877 1.00 78.21  ? 93   THR A OG1 1 
ATOM   589  C  CG2 . THR A 1 93  ? 44.399 -60.113  166.624 1.00 75.78  ? 93   THR A CG2 1 
ATOM   590  N  N   . MET A 1 94  ? 46.794 -61.677  168.878 1.00 69.06  ? 94   MET A N   1 
ATOM   591  C  CA  . MET A 1 94  ? 46.758 -61.595  170.313 1.00 66.69  ? 94   MET A CA  1 
ATOM   592  C  C   . MET A 1 94  ? 48.090 -61.059  170.827 1.00 63.93  ? 94   MET A C   1 
ATOM   593  O  O   . MET A 1 94  ? 48.122 -60.273  171.750 1.00 62.94  ? 94   MET A O   1 
ATOM   594  C  CB  . MET A 1 94  ? 46.450 -62.945  170.922 1.00 67.87  ? 94   MET A CB  1 
ATOM   595  C  CG  . MET A 1 94  ? 46.470 -62.916  172.455 1.00 68.88  ? 94   MET A CG  1 
ATOM   596  S  SD  . MET A 1 94  ? 46.020 -64.531  173.101 1.00 75.17  ? 94   MET A SD  1 
ATOM   597  C  CE  . MET A 1 94  ? 47.616 -65.329  173.185 1.00 72.91  ? 94   MET A CE  1 
ATOM   598  N  N   . ALA A 1 95  ? 49.203 -61.485  170.253 1.00 62.08  ? 95   ALA A N   1 
ATOM   599  C  CA  . ALA A 1 95  ? 50.460 -60.950  170.742 1.00 59.85  ? 95   ALA A CA  1 
ATOM   600  C  C   . ALA A 1 95  ? 50.663 -59.507  170.226 1.00 58.94  ? 95   ALA A C   1 
ATOM   601  O  O   . ALA A 1 95  ? 51.584 -58.795  170.626 1.00 57.46  ? 95   ALA A O   1 
ATOM   602  C  CB  . ALA A 1 95  ? 51.601 -61.858  170.347 1.00 59.70  ? 95   ALA A CB  1 
ATOM   603  N  N   . THR A 1 96  ? 49.785 -59.094  169.315 1.00 59.78  ? 96   THR A N   1 
ATOM   604  C  CA  . THR A 1 96  ? 49.926 -57.828  168.581 1.00 59.31  ? 96   THR A CA  1 
ATOM   605  C  C   . THR A 1 96  ? 51.211 -57.708  167.731 1.00 60.38  ? 96   THR A C   1 
ATOM   606  O  O   . THR A 1 96  ? 51.770 -56.609  167.622 1.00 60.26  ? 96   THR A O   1 
ATOM   607  C  CB  . THR A 1 96  ? 49.902 -56.597  169.522 1.00 58.57  ? 96   THR A CB  1 
ATOM   608  O  OG1 . THR A 1 96  ? 51.234 -56.267  169.884 1.00 55.08  ? 96   THR A OG1 1 
ATOM   609  C  CG2 . THR A 1 96  ? 49.070 -56.841  170.755 1.00 56.37  ? 96   THR A CG2 1 
ATOM   610  N  N   . ILE A 1 97  ? 51.686 -58.809  167.145 1.00 61.30  ? 97   ILE A N   1 
ATOM   611  C  CA  . ILE A 1 97  ? 52.830 -58.708  166.236 1.00 63.57  ? 97   ILE A CA  1 
ATOM   612  C  C   . ILE A 1 97  ? 52.440 -58.133  164.862 1.00 66.11  ? 97   ILE A C   1 
ATOM   613  O  O   . ILE A 1 97  ? 53.184 -57.334  164.235 1.00 66.82  ? 97   ILE A O   1 
ATOM   614  C  CB  . ILE A 1 97  ? 53.455 -60.084  165.929 1.00 65.57  ? 97   ILE A CB  1 
ATOM   615  C  CG1 . ILE A 1 97  ? 53.701 -60.879  167.226 1.00 63.85  ? 97   ILE A CG1 1 
ATOM   616  C  CG2 . ILE A 1 97  ? 54.722 -59.926  165.081 1.00 66.70  ? 97   ILE A CG2 1 
ATOM   617  C  CD1 . ILE A 1 97  ? 54.711 -62.018  167.061 1.00 65.05  ? 97   ILE A CD1 1 
ATOM   618  N  N   . GLY A 1 98  ? 51.248 -58.504  164.416 1.00 67.58  ? 98   GLY A N   1 
ATOM   619  C  CA  . GLY A 1 98  ? 50.684 -57.914  163.196 1.00 71.84  ? 98   GLY A CA  1 
ATOM   620  C  C   . GLY A 1 98  ? 51.620 -57.735  161.992 1.00 75.36  ? 98   GLY A C   1 
ATOM   621  O  O   . GLY A 1 98  ? 51.875 -56.586  161.542 1.00 76.02  ? 98   GLY A O   1 
ATOM   622  N  N   . TYR A 1 99  ? 52.151 -58.854  161.490 1.00 77.10  ? 99   TYR A N   1 
ATOM   623  C  CA  . TYR A 1 99  ? 53.077 -58.794  160.380 1.00 81.84  ? 99   TYR A CA  1 
ATOM   624  C  C   . TYR A 1 99  ? 52.398 -58.173  159.145 1.00 85.70  ? 99   TYR A C   1 
ATOM   625  O  O   . TYR A 1 99  ? 52.892 -57.198  158.558 1.00 87.33  ? 99   TYR A O   1 
ATOM   626  C  CB  . TYR A 1 99  ? 53.522 -60.194  159.967 1.00 83.81  ? 99   TYR A CB  1 
ATOM   627  C  CG  . TYR A 1 99  ? 54.436 -60.902  160.929 1.00 81.43  ? 99   TYR A CG  1 
ATOM   628  C  CD1 . TYR A 1 99  ? 54.060 -62.114  161.507 1.00 80.99  ? 99   TYR A CD1 1 
ATOM   629  C  CD2 . TYR A 1 99  ? 55.683 -60.378  161.245 1.00 81.01  ? 99   TYR A CD2 1 
ATOM   630  C  CE1 . TYR A 1 99  ? 54.909 -62.790  162.400 1.00 80.59  ? 99   TYR A CE1 1 
ATOM   631  C  CE2 . TYR A 1 99  ? 56.534 -61.033  162.127 1.00 81.15  ? 99   TYR A CE2 1 
ATOM   632  C  CZ  . TYR A 1 99  ? 56.137 -62.237  162.700 1.00 81.19  ? 99   TYR A CZ  1 
ATOM   633  O  OH  . TYR A 1 99  ? 56.983 -62.894  163.556 1.00 83.00  ? 99   TYR A OH  1 
ATOM   634  N  N   . GLY A 1 100 ? 51.239 -58.703  158.787 1.00 87.12  ? 100  GLY A N   1 
ATOM   635  C  CA  . GLY A 1 100 ? 50.485 -58.141  157.688 1.00 92.41  ? 100  GLY A CA  1 
ATOM   636  C  C   . GLY A 1 100 ? 50.098 -59.076  156.553 1.00 97.57  ? 100  GLY A C   1 
ATOM   637  O  O   . GLY A 1 100 ? 49.093 -58.844  155.897 1.00 100.17 ? 100  GLY A O   1 
ATOM   638  N  N   . LYS A 1 101 ? 50.874 -60.127  156.311 1.00 95.72  ? 101  LYS A N   1 
ATOM   639  C  CA  . LYS A 1 101 ? 50.423 -61.155  155.384 1.00 101.12 ? 101  LYS A CA  1 
ATOM   640  C  C   . LYS A 1 101 ? 48.992 -61.523  155.757 1.00 100.30 ? 101  LYS A C   1 
ATOM   641  O  O   . LYS A 1 101 ? 48.064 -61.189  155.037 1.00 102.74 ? 101  LYS A O   1 
ATOM   642  C  CB  . LYS A 1 101 ? 51.328 -62.393  155.436 1.00 103.53 ? 101  LYS A CB  1 
ATOM   643  C  CG  . LYS A 1 101 ? 51.002 -63.515  154.438 1.00 108.73 ? 101  LYS A CG  1 
ATOM   644  C  CD  . LYS A 1 101 ? 51.830 -63.404  153.162 1.00 116.73 ? 101  LYS A CD  1 
ATOM   645  C  CE  . LYS A 1 101 ? 52.401 -64.783  152.749 1.00 123.52 ? 101  LYS A CE  1 
ATOM   646  N  NZ  . LYS A 1 101 ? 52.494 -65.024  151.266 1.00 131.86 ? 101  LYS A NZ  1 
ATOM   647  N  N   . LEU A 1 102 ? 48.806 -62.192  156.895 1.00 97.92  ? 102  LEU A N   1 
ATOM   648  C  CA  . LEU A 1 102 ? 47.464 -62.565  157.318 1.00 97.34  ? 102  LEU A CA  1 
ATOM   649  C  C   . LEU A 1 102 ? 46.803 -61.322  157.866 1.00 94.87  ? 102  LEU A C   1 
ATOM   650  O  O   . LEU A 1 102 ? 47.447 -60.521  158.536 1.00 92.31  ? 102  LEU A O   1 
ATOM   651  C  CB  . LEU A 1 102 ? 47.508 -63.690  158.350 1.00 95.48  ? 102  LEU A CB  1 
ATOM   652  C  CG  . LEU A 1 102 ? 48.183 -64.948  157.785 1.00 99.66  ? 102  LEU A CG  1 
ATOM   653  C  CD1 . LEU A 1 102 ? 48.691 -65.901  158.839 1.00 98.67  ? 102  LEU A CD1 1 
ATOM   654  C  CD2 . LEU A 1 102 ? 47.249 -65.675  156.858 1.00 104.51 ? 102  LEU A CD2 1 
ATOM   655  N  N   . ILE A 1 103 ? 45.530 -61.131  157.546 1.00 96.78  ? 103  ILE A N   1 
ATOM   656  C  CA  . ILE A 1 103 ? 44.798 -59.969  158.028 1.00 95.32  ? 103  ILE A CA  1 
ATOM   657  C  C   . ILE A 1 103 ? 43.298 -60.176  157.940 1.00 97.07  ? 103  ILE A C   1 
ATOM   658  O  O   . ILE A 1 103 ? 42.806 -60.883  157.076 1.00 100.89 ? 103  ILE A O   1 
ATOM   659  C  CB  . ILE A 1 103 ? 45.150 -58.693  157.260 1.00 96.77  ? 103  ILE A CB  1 
ATOM   660  C  CG1 . ILE A 1 103 ? 44.500 -58.731  155.881 1.00 102.00 ? 103  ILE A CG1 1 
ATOM   661  C  CG2 . ILE A 1 103 ? 46.668 -58.503  157.173 1.00 95.99  ? 103  ILE A CG2 1 
ATOM   662  C  CD1 . ILE A 1 103 ? 43.952 -57.385  155.469 1.00 106.25 ? 103  ILE A CD1 1 
ATOM   663  N  N   . PRO A 1 104 ? 42.563 -59.542  158.849 1.00 95.15  ? 104  PRO A N   1 
ATOM   664  C  CA  . PRO A 1 104 ? 41.132 -59.788  158.957 1.00 97.29  ? 104  PRO A CA  1 
ATOM   665  C  C   . PRO A 1 104 ? 40.381 -59.185  157.770 1.00 101.51 ? 104  PRO A C   1 
ATOM   666  O  O   . PRO A 1 104 ? 40.769 -58.120  157.292 1.00 101.59 ? 104  PRO A O   1 
ATOM   667  C  CB  . PRO A 1 104 ? 40.764 -59.052  160.244 1.00 94.14  ? 104  PRO A CB  1 
ATOM   668  C  CG  . PRO A 1 104 ? 41.761 -57.930  160.324 1.00 91.48  ? 104  PRO A CG  1 
ATOM   669  C  CD  . PRO A 1 104 ? 43.030 -58.460  159.740 1.00 91.29  ? 104  PRO A CD  1 
ATOM   670  N  N   . ILE A 1 105 ? 39.318 -59.841  157.309 1.00 105.56 ? 105  ILE A N   1 
ATOM   671  C  CA  . ILE A 1 105 ? 38.497 -59.267  156.238 1.00 110.42 ? 105  ILE A CA  1 
ATOM   672  C  C   . ILE A 1 105 ? 37.101 -58.834  156.671 1.00 111.97 ? 105  ILE A C   1 
ATOM   673  O  O   . ILE A 1 105 ? 36.721 -57.665  156.501 1.00 112.58 ? 105  ILE A O   1 
ATOM   674  C  CB  . ILE A 1 105 ? 38.379 -60.194  155.003 1.00 115.38 ? 105  ILE A CB  1 
ATOM   675  C  CG1 . ILE A 1 105 ? 39.741 -60.358  154.318 1.00 115.63 ? 105  ILE A CG1 1 
ATOM   676  C  CG2 . ILE A 1 105 ? 37.357 -59.636  154.025 1.00 119.19 ? 105  ILE A CG2 1 
ATOM   677  C  CD1 . ILE A 1 105 ? 39.760 -61.460  153.257 1.00 118.64 ? 105  ILE A CD1 1 
ATOM   678  N  N   . GLY A 1 106 ? 36.329 -59.769  157.212 1.00 112.99 ? 106  GLY A N   1 
ATOM   679  C  CA  . GLY A 1 106 ? 34.972 -59.433  157.627 1.00 115.54 ? 106  GLY A CA  1 
ATOM   680  C  C   . GLY A 1 106 ? 34.936 -58.447  158.785 1.00 112.54 ? 106  GLY A C   1 
ATOM   681  O  O   . GLY A 1 106 ? 35.921 -58.324  159.525 1.00 108.94 ? 106  GLY A O   1 
ATOM   682  N  N   . PRO A 1 107 ? 33.812 -57.721  158.941 1.00 114.62 ? 107  PRO A N   1 
ATOM   683  C  CA  . PRO A 1 107 ? 33.573 -57.051  160.205 1.00 112.26 ? 107  PRO A CA  1 
ATOM   684  C  C   . PRO A 1 107 ? 33.554 -58.120  161.285 1.00 110.48 ? 107  PRO A C   1 
ATOM   685  O  O   . PRO A 1 107 ? 33.926 -57.850  162.426 1.00 107.86 ? 107  PRO A O   1 
ATOM   686  C  CB  . PRO A 1 107 ? 32.172 -56.456  160.033 1.00 116.81 ? 107  PRO A CB  1 
ATOM   687  C  CG  . PRO A 1 107 ? 32.017 -56.277  158.598 1.00 120.31 ? 107  PRO A CG  1 
ATOM   688  C  CD  . PRO A 1 107 ? 32.750 -57.433  157.965 1.00 119.95 ? 107  PRO A CD  1 
ATOM   689  N  N   . LEU A 1 108 ? 33.133 -59.331  160.923 1.00 112.31 ? 108  LEU A N   1 
ATOM   690  C  CA  . LEU A 1 108 ? 33.218 -60.447  161.857 1.00 110.98 ? 108  LEU A CA  1 
ATOM   691  C  C   . LEU A 1 108 ? 34.670 -60.691  162.290 1.00 105.52 ? 108  LEU A C   1 
ATOM   692  O  O   . LEU A 1 108 ? 34.966 -60.706  163.478 1.00 103.58 ? 108  LEU A O   1 
ATOM   693  C  CB  . LEU A 1 108 ? 32.588 -61.712  161.279 1.00 114.97 ? 108  LEU A CB  1 
ATOM   694  C  CG  . LEU A 1 108 ? 31.076 -61.594  161.072 1.00 120.96 ? 108  LEU A CG  1 
ATOM   695  C  CD1 . LEU A 1 108 ? 30.449 -62.932  160.650 1.00 125.03 ? 108  LEU A CD1 1 
ATOM   696  C  CD2 . LEU A 1 108 ? 30.397 -61.028  162.324 1.00 121.15 ? 108  LEU A CD2 1 
ATOM   697  N  N   . ALA A 1 109 ? 35.577 -60.858  161.339 1.00 103.46 ? 109  ALA A N   1 
ATOM   698  C  CA  . ALA A 1 109 ? 36.981 -61.025  161.686 1.00 98.62  ? 109  ALA A CA  1 
ATOM   699  C  C   . ALA A 1 109 ? 37.518 -59.840  162.478 1.00 94.59  ? 109  ALA A C   1 
ATOM   700  O  O   . ALA A 1 109 ? 38.274 -60.029  163.425 1.00 91.76  ? 109  ALA A O   1 
ATOM   701  C  CB  . ALA A 1 109 ? 37.827 -61.249  160.440 1.00 99.00  ? 109  ALA A CB  1 
ATOM   702  N  N   . ASN A 1 110 ? 37.140 -58.623  162.089 1.00 94.27  ? 110  ASN A N   1 
ATOM   703  C  CA  . ASN A 1 110 ? 37.662 -57.430  162.742 1.00 90.91  ? 110  ASN A CA  1 
ATOM   704  C  C   . ASN A 1 110 ? 37.138 -57.248  164.169 1.00 90.61  ? 110  ASN A C   1 
ATOM   705  O  O   . ASN A 1 110 ? 37.747 -56.550  164.978 1.00 88.31  ? 110  ASN A O   1 
ATOM   706  C  CB  . ASN A 1 110 ? 37.387 -56.170  161.913 1.00 92.09  ? 110  ASN A CB  1 
ATOM   707  C  CG  . ASN A 1 110 ? 38.338 -56.020  160.731 1.00 90.99  ? 110  ASN A CG  1 
ATOM   708  O  OD1 . ASN A 1 110 ? 38.018 -56.408  159.613 1.00 93.33  ? 110  ASN A OD1 1 
ATOM   709  N  ND2 . ASN A 1 110 ? 39.505 -55.464  160.977 1.00 86.49  ? 110  ASN A ND2 1 
ATOM   710  N  N   . THR A 1 111 ? 36.003 -57.864  164.478 1.00 93.40  ? 111  THR A N   1 
ATOM   711  C  CA  . THR A 1 111 ? 35.465 -57.794  165.836 1.00 93.67  ? 111  THR A CA  1 
ATOM   712  C  C   . THR A 1 111 ? 36.199 -58.766  166.735 1.00 91.54  ? 111  THR A C   1 
ATOM   713  O  O   . THR A 1 111 ? 36.481 -58.468  167.897 1.00 90.83  ? 111  THR A O   1 
ATOM   714  C  CB  . THR A 1 111 ? 33.956 -58.111  165.900 1.00 98.40  ? 111  THR A CB  1 
ATOM   715  O  OG1 . THR A 1 111 ? 33.235 -57.058  165.254 1.00 99.58  ? 111  THR A OG1 1 
ATOM   716  C  CG2 . THR A 1 111 ? 33.500 -58.219  167.366 1.00 98.37  ? 111  THR A CG2 1 
ATOM   717  N  N   . LEU A 1 112 ? 36.499 -59.939  166.189 1.00 90.86  ? 112  LEU A N   1 
ATOM   718  C  CA  . LEU A 1 112 ? 37.283 -60.913  166.920 1.00 88.09  ? 112  LEU A CA  1 
ATOM   719  C  C   . LEU A 1 112 ? 38.643 -60.317  167.235 1.00 83.02  ? 112  LEU A C   1 
ATOM   720  O  O   . LEU A 1 112 ? 39.130 -60.413  168.351 1.00 81.59  ? 112  LEU A O   1 
ATOM   721  C  CB  . LEU A 1 112 ? 37.395 -62.221  166.126 1.00 89.55  ? 112  LEU A CB  1 
ATOM   722  C  CG  . LEU A 1 112 ? 36.148 -63.082  166.369 1.00 93.53  ? 112  LEU A CG  1 
ATOM   723  C  CD1 . LEU A 1 112 ? 36.217 -64.424  165.674 1.00 95.77  ? 112  LEU A CD1 1 
ATOM   724  C  CD2 . LEU A 1 112 ? 35.939 -63.272  167.873 1.00 92.38  ? 112  LEU A CD2 1 
ATOM   725  N  N   . VAL A 1 113 ? 39.242 -59.671  166.248 1.00 80.92  ? 113  VAL A N   1 
ATOM   726  C  CA  . VAL A 1 113 ? 40.550 -59.080  166.452 1.00 76.63  ? 113  VAL A CA  1 
ATOM   727  C  C   . VAL A 1 113 ? 40.478 -58.129  167.628 1.00 75.72  ? 113  VAL A C   1 
ATOM   728  O  O   . VAL A 1 113 ? 41.372 -58.094  168.480 1.00 73.38  ? 113  VAL A O   1 
ATOM   729  C  CB  . VAL A 1 113 ? 41.032 -58.313  165.229 1.00 75.73  ? 113  VAL A CB  1 
ATOM   730  C  CG1 . VAL A 1 113 ? 42.166 -57.358  165.623 1.00 70.67  ? 113  VAL A CG1 1 
ATOM   731  C  CG2 . VAL A 1 113 ? 41.457 -59.293  164.149 1.00 76.19  ? 113  VAL A CG2 1 
ATOM   732  N  N   . THR A 1 114 ? 39.401 -57.357  167.670 1.00 77.20  ? 114  THR A N   1 
ATOM   733  C  CA  . THR A 1 114 ? 39.250 -56.386  168.711 1.00 77.01  ? 114  THR A CA  1 
ATOM   734  C  C   . THR A 1 114 ? 39.227 -57.072  170.079 1.00 77.95  ? 114  THR A C   1 
ATOM   735  O  O   . THR A 1 114 ? 39.917 -56.647  171.023 1.00 76.64  ? 114  THR A O   1 
ATOM   736  C  CB  . THR A 1 114 ? 37.983 -55.615  168.524 1.00 79.81  ? 114  THR A CB  1 
ATOM   737  O  OG1 . THR A 1 114 ? 38.136 -54.769  167.386 1.00 78.82  ? 114  THR A OG1 1 
ATOM   738  C  CG2 . THR A 1 114 ? 37.704 -54.775  169.767 1.00 80.72  ? 114  THR A CG2 1 
ATOM   739  N  N   . LEU A 1 115 ? 38.445 -58.142  170.165 1.00 80.03  ? 115  LEU A N   1 
ATOM   740  C  CA  . LEU A 1 115 ? 38.257 -58.849  171.398 1.00 81.45  ? 115  LEU A CA  1 
ATOM   741  C  C   . LEU A 1 115 ? 39.549 -59.533  171.765 1.00 78.73  ? 115  LEU A C   1 
ATOM   742  O  O   . LEU A 1 115 ? 39.985 -59.523  172.922 1.00 78.24  ? 115  LEU A O   1 
ATOM   743  C  CB  . LEU A 1 115 ? 37.173 -59.884  171.197 1.00 85.55  ? 115  LEU A CB  1 
ATOM   744  C  CG  . LEU A 1 115 ? 36.874 -60.793  172.384 1.00 90.24  ? 115  LEU A CG  1 
ATOM   745  C  CD1 . LEU A 1 115 ? 36.355 -59.972  173.564 1.00 95.10  ? 115  LEU A CD1 1 
ATOM   746  C  CD2 . LEU A 1 115 ? 35.860 -61.833  171.968 1.00 93.67  ? 115  LEU A CD2 1 
ATOM   747  N  N   . GLU A 1 116 ? 40.180 -60.121  170.764 1.00 76.99  ? 116  GLU A N   1 
ATOM   748  C  CA  . GLU A 1 116 ? 41.390 -60.863  171.004 1.00 75.16  ? 116  GLU A CA  1 
ATOM   749  C  C   . GLU A 1 116 ? 42.455 -59.922  171.528 1.00 72.90  ? 116  GLU A C   1 
ATOM   750  O  O   . GLU A 1 116 ? 43.275 -60.297  172.352 1.00 73.46  ? 116  GLU A O   1 
ATOM   751  C  CB  . GLU A 1 116 ? 41.856 -61.568  169.729 1.00 74.68  ? 116  GLU A CB  1 
ATOM   752  C  CG  . GLU A 1 116 ? 43.022 -62.473  169.942 1.00 73.12  ? 116  GLU A CG  1 
ATOM   753  C  CD  . GLU A 1 116 ? 43.192 -63.484  168.830 1.00 75.85  ? 116  GLU A CD  1 
ATOM   754  O  OE1 . GLU A 1 116 ? 42.675 -63.263  167.714 1.00 75.40  ? 116  GLU A OE1 1 
ATOM   755  O  OE2 . GLU A 1 116 ? 43.862 -64.512  169.076 1.00 77.51  ? 116  GLU A OE2 1 
ATOM   756  N  N   . ALA A 1 117 ? 42.447 -58.688  171.058 1.00 71.84  ? 117  ALA A N   1 
ATOM   757  C  CA  . ALA A 1 117 ? 43.421 -57.711  171.505 1.00 69.37  ? 117  ALA A CA  1 
ATOM   758  C  C   . ALA A 1 117 ? 43.217 -57.429  172.988 1.00 70.60  ? 117  ALA A C   1 
ATOM   759  O  O   . ALA A 1 117 ? 44.166 -57.263  173.749 1.00 69.78  ? 117  ALA A O   1 
ATOM   760  C  CB  . ALA A 1 117 ? 43.260 -56.430  170.708 1.00 69.05  ? 117  ALA A CB  1 
ATOM   761  N  N   . LEU A 1 118 ? 41.966 -57.343  173.400 1.00 73.23  ? 118  LEU A N   1 
ATOM   762  C  CA  . LEU A 1 118 ? 41.699 -57.079  174.785 1.00 75.64  ? 118  LEU A CA  1 
ATOM   763  C  C   . LEU A 1 118 ? 42.211 -58.240  175.630 1.00 76.28  ? 118  LEU A C   1 
ATOM   764  O  O   . LEU A 1 118 ? 42.884 -58.014  176.629 1.00 76.17  ? 118  LEU A O   1 
ATOM   765  C  CB  . LEU A 1 118 ? 40.208 -56.811  175.023 1.00 79.54  ? 118  LEU A CB  1 
ATOM   766  C  CG  . LEU A 1 118 ? 39.886 -56.219  176.388 1.00 82.02  ? 118  LEU A CG  1 
ATOM   767  C  CD1 . LEU A 1 118 ? 40.690 -54.960  176.559 1.00 80.49  ? 118  LEU A CD1 1 
ATOM   768  C  CD2 . LEU A 1 118 ? 38.415 -55.923  176.524 1.00 86.09  ? 118  LEU A CD2 1 
ATOM   769  N  N   . CYS A 1 119 ? 41.938 -59.476  175.217 1.00 77.24  ? 119  CYS A N   1 
ATOM   770  C  CA  . CYS A 1 119 ? 42.400 -60.648  175.988 1.00 79.19  ? 119  CYS A CA  1 
ATOM   771  C  C   . CYS A 1 119 ? 43.908 -60.718  176.176 1.00 76.48  ? 119  CYS A C   1 
ATOM   772  O  O   . CYS A 1 119 ? 44.409 -61.071  177.248 1.00 77.62  ? 119  CYS A O   1 
ATOM   773  C  CB  . CYS A 1 119 ? 41.916 -61.966  175.370 1.00 80.97  ? 119  CYS A CB  1 
ATOM   774  S  SG  . CYS A 1 119 ? 40.137 -61.937  174.995 1.00 89.55  ? 119  CYS A SG  1 
ATOM   775  N  N   . GLY A 1 120 ? 44.652 -60.414  175.130 1.00 73.44  ? 120  GLY A N   1 
ATOM   776  C  CA  . GLY A 1 120 ? 46.091 -60.471  175.259 1.00 70.62  ? 120  GLY A CA  1 
ATOM   777  C  C   . GLY A 1 120 ? 46.530 -59.406  176.234 1.00 70.24  ? 120  GLY A C   1 
ATOM   778  O  O   . GLY A 1 120 ? 47.450 -59.633  177.031 1.00 70.50  ? 120  GLY A O   1 
ATOM   779  N  N   . MET A 1 121 ? 45.893 -58.230  176.175 1.00 65.09  ? 121  MET A N   1 
ATOM   780  C  CA  A MET A 1 121 ? 46.283 -57.172  177.076 0.57 64.36  ? 121  MET A CA  1 
ATOM   781  C  CA  B MET A 1 121 ? 46.216 -57.140  177.098 0.43 63.63  ? 121  MET A CA  1 
ATOM   782  C  C   . MET A 1 121 ? 45.924 -57.613  178.511 1.00 63.47  ? 121  MET A C   1 
ATOM   783  O  O   . MET A 1 121 ? 46.776 -57.588  179.375 1.00 62.34  ? 121  MET A O   1 
ATOM   784  C  CB  A MET A 1 121 ? 45.704 -55.814  176.635 0.57 65.75  ? 121  MET A CB  1 
ATOM   785  C  CB  B MET A 1 121 ? 45.396 -55.883  176.797 0.43 64.60  ? 121  MET A CB  1 
ATOM   786  C  CG  A MET A 1 121 ? 46.504 -55.154  175.449 0.57 69.86  ? 121  MET A CG  1 
ATOM   787  C  CG  B MET A 1 121 ? 45.607 -54.743  177.804 0.43 64.23  ? 121  MET A CG  1 
ATOM   788  S  SD  A MET A 1 121 ? 45.828 -53.642  174.630 0.57 76.66  ? 121  MET A SD  1 
ATOM   789  S  SD  B MET A 1 121 ? 44.460 -54.702  179.207 0.43 66.15  ? 121  MET A SD  1 
ATOM   790  C  CE  A MET A 1 121 ? 47.331 -52.677  174.437 0.57 76.75  ? 121  MET A CE  1 
ATOM   791  C  CE  B MET A 1 121 ? 43.436 -53.259  178.830 0.43 64.53  ? 121  MET A CE  1 
ATOM   792  N  N   . LEU A 1 122 ? 44.690 -58.069  178.735 1.00 64.37  ? 122  LEU A N   1 
ATOM   793  C  CA  . LEU A 1 122 ? 44.295 -58.642  180.016 1.00 64.94  ? 122  LEU A CA  1 
ATOM   794  C  C   . LEU A 1 122 ? 45.256 -59.790  180.395 1.00 63.79  ? 122  LEU A C   1 
ATOM   795  O  O   . LEU A 1 122 ? 45.825 -59.805  181.488 1.00 63.52  ? 122  LEU A O   1 
ATOM   796  C  CB  . LEU A 1 122 ? 42.848 -59.148  179.959 1.00 67.21  ? 122  LEU A CB  1 
ATOM   797  C  CG  . LEU A 1 122 ? 41.780 -58.073  179.765 1.00 69.53  ? 122  LEU A CG  1 
ATOM   798  C  CD1 . LEU A 1 122 ? 40.390 -58.674  179.902 1.00 73.55  ? 122  LEU A CD1 1 
ATOM   799  C  CD2 . LEU A 1 122 ? 41.951 -56.897  180.729 1.00 68.52  ? 122  LEU A CD2 1 
ATOM   800  N  N   . GLY A 1 123 ? 45.441 -60.739  179.480 1.00 63.65  ? 123  GLY A N   1 
ATOM   801  C  CA  . GLY A 1 123 ? 46.322 -61.898  179.713 1.00 63.16  ? 123  GLY A CA  1 
ATOM   802  C  C   . GLY A 1 123 ? 47.701 -61.487  180.194 1.00 60.92  ? 123  GLY A C   1 
ATOM   803  O  O   . GLY A 1 123 ? 48.251 -62.097  181.095 1.00 61.55  ? 123  GLY A O   1 
ATOM   804  N  N   . LEU A 1 124 ? 48.267 -60.439  179.616 1.00 59.13  ? 124  LEU A N   1 
ATOM   805  C  CA  . LEU A 1 124 ? 49.583 -59.968  180.050 1.00 58.43  ? 124  LEU A CA  1 
ATOM   806  C  C   . LEU A 1 124 ? 49.557 -59.479  181.494 1.00 57.34  ? 124  LEU A C   1 
ATOM   807  O  O   . LEU A 1 124 ? 50.430 -59.815  182.306 1.00 57.01  ? 124  LEU A O   1 
ATOM   808  C  CB  . LEU A 1 124 ? 50.082 -58.840  179.148 1.00 58.49  ? 124  LEU A CB  1 
ATOM   809  C  CG  . LEU A 1 124 ? 51.381 -58.178  179.598 1.00 60.12  ? 124  LEU A CG  1 
ATOM   810  C  CD1 . LEU A 1 124 ? 52.481 -59.222  179.712 1.00 61.78  ? 124  LEU A CD1 1 
ATOM   811  C  CD2 . LEU A 1 124 ? 51.798 -57.100  178.597 1.00 64.10  ? 124  LEU A CD2 1 
ATOM   812  N  N   . ALA A 1 125 ? 48.536 -58.692  181.802 1.00 57.23  ? 125  ALA A N   1 
ATOM   813  C  CA  . ALA A 1 125 ? 48.442 -58.034  183.085 1.00 57.61  ? 125  ALA A CA  1 
ATOM   814  C  C   . ALA A 1 125 ? 48.302 -59.090  184.139 1.00 58.39  ? 125  ALA A C   1 
ATOM   815  O  O   . ALA A 1 125 ? 48.984 -59.036  185.167 1.00 58.30  ? 125  ALA A O   1 
ATOM   816  C  CB  . ALA A 1 125 ? 47.231 -57.110  183.110 1.00 59.35  ? 125  ALA A CB  1 
ATOM   817  N  N   . VAL A 1 126 ? 47.412 -60.053  183.892 1.00 59.90  ? 126  VAL A N   1 
ATOM   818  C  CA  . VAL A 1 126 ? 47.201 -61.109  184.860 1.00 62.78  ? 126  VAL A CA  1 
ATOM   819  C  C   . VAL A 1 126 ? 48.505 -61.883  185.005 1.00 62.40  ? 126  VAL A C   1 
ATOM   820  O  O   . VAL A 1 126 ? 49.006 -62.078  186.107 1.00 64.03  ? 126  VAL A O   1 
ATOM   821  C  CB  . VAL A 1 126 ? 46.043 -62.051  184.491 1.00 65.79  ? 126  VAL A CB  1 
ATOM   822  C  CG1 . VAL A 1 126 ? 46.013 -63.223  185.445 1.00 69.39  ? 126  VAL A CG1 1 
ATOM   823  C  CG2 . VAL A 1 126 ? 44.709 -61.327  184.562 1.00 67.59  ? 126  VAL A CG2 1 
ATOM   824  N  N   . ALA A 1 127 ? 49.108 -62.282  183.902 1.00 61.89  ? 127  ALA A N   1 
ATOM   825  C  CA  . ALA A 1 127 ? 50.336 -63.054  184.025 1.00 62.40  ? 127  ALA A CA  1 
ATOM   826  C  C   . ALA A 1 127 ? 51.416 -62.267  184.756 1.00 61.25  ? 127  ALA A C   1 
ATOM   827  O  O   . ALA A 1 127 ? 52.208 -62.846  185.502 1.00 62.23  ? 127  ALA A O   1 
ATOM   828  C  CB  . ALA A 1 127 ? 50.827 -63.510  182.663 1.00 63.30  ? 127  ALA A CB  1 
ATOM   829  N  N   . ALA A 1 128 ? 51.468 -60.956  184.553 1.00 59.46  ? 128  ALA A N   1 
ATOM   830  C  CA  . ALA A 1 128 ? 52.445 -60.164  185.283 1.00 59.22  ? 128  ALA A CA  1 
ATOM   831  C  C   . ALA A 1 128 ? 52.101 -60.119  186.780 1.00 60.81  ? 128  ALA A C   1 
ATOM   832  O  O   . ALA A 1 128 ? 52.984 -60.108  187.638 1.00 60.94  ? 128  ALA A O   1 
ATOM   833  C  CB  . ALA A 1 128 ? 52.529 -58.774  184.708 1.00 58.34  ? 128  ALA A CB  1 
ATOM   834  N  N   . SER A 1 129 ? 50.816 -60.079  187.096 1.00 62.66  ? 129  SER A N   1 
ATOM   835  C  CA  . SER A 1 129 ? 50.396 -60.140  188.495 1.00 65.83  ? 129  SER A CA  1 
ATOM   836  C  C   . SER A 1 129 ? 50.882 -61.422  189.120 1.00 66.35  ? 129  SER A C   1 
ATOM   837  O  O   . SER A 1 129 ? 51.554 -61.426  190.149 1.00 67.30  ? 129  SER A O   1 
ATOM   838  C  CB  . SER A 1 129 ? 48.881 -60.078  188.602 1.00 68.57  ? 129  SER A CB  1 
ATOM   839  O  OG  . SER A 1 129 ? 48.444 -58.779  188.204 1.00 72.01  ? 129  SER A OG  1 
ATOM   840  N  N   . LEU A 1 130 ? 50.543 -62.534  188.501 1.00 66.17  ? 130  LEU A N   1 
ATOM   841  C  CA  . LEU A 1 130 ? 50.899 -63.787  189.118 1.00 67.63  ? 130  LEU A CA  1 
ATOM   842  C  C   . LEU A 1 130 ? 52.406 -63.879  189.305 1.00 65.82  ? 130  LEU A C   1 
ATOM   843  O  O   . LEU A 1 130 ? 52.895 -64.346  190.326 1.00 66.99  ? 130  LEU A O   1 
ATOM   844  C  CB  . LEU A 1 130 ? 50.343 -64.937  188.292 1.00 69.61  ? 130  LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 130 ? 48.804 -64.919  188.276 1.00 72.93  ? 130  LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 130 ? 48.258 -65.960  187.290 1.00 75.84  ? 130  LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 130 ? 48.218 -65.135  189.688 1.00 75.97  ? 130  LEU A CD2 1 
ATOM   848  N  N   . ILE A 1 131 ? 53.166 -63.409  188.335 1.00 63.23  ? 131  ILE A N   1 
ATOM   849  C  CA  . ILE A 1 131 ? 54.599 -63.540  188.472 1.00 62.94  ? 131  ILE A CA  1 
ATOM   850  C  C   . ILE A 1 131 ? 55.130 -62.712  189.644 1.00 63.82  ? 131  ILE A C   1 
ATOM   851  O  O   . ILE A 1 131 ? 55.950 -63.184  190.452 1.00 63.88  ? 131  ILE A O   1 
ATOM   852  C  CB  . ILE A 1 131 ? 55.279 -63.135  187.200 1.00 61.56  ? 131  ILE A CB  1 
ATOM   853  C  CG1 . ILE A 1 131 ? 55.023 -64.229  186.142 1.00 63.43  ? 131  ILE A CG1 1 
ATOM   854  C  CG2 . ILE A 1 131 ? 56.753 -62.890  187.442 1.00 60.86  ? 131  ILE A CG2 1 
ATOM   855  C  CD1 . ILE A 1 131 ? 55.598 -63.911  184.782 1.00 59.78  ? 131  ILE A CD1 1 
ATOM   856  N  N   . TYR A 1 132 ? 54.658 -61.475  189.745 1.00 63.89  ? 132  TYR A N   1 
ATOM   857  C  CA  . TYR A 1 132 ? 55.083 -60.643  190.844 1.00 66.50  ? 132  TYR A CA  1 
ATOM   858  C  C   . TYR A 1 132 ? 54.659 -61.236  192.204 1.00 69.59  ? 132  TYR A C   1 
ATOM   859  O  O   . TYR A 1 132 ? 55.457 -61.288  193.150 1.00 70.91  ? 132  TYR A O   1 
ATOM   860  C  CB  . TYR A 1 132 ? 54.573 -59.211  190.689 1.00 66.80  ? 132  TYR A CB  1 
ATOM   861  C  CG  . TYR A 1 132 ? 55.010 -58.343  191.850 1.00 71.43  ? 132  TYR A CG  1 
ATOM   862  C  CD1 . TYR A 1 132 ? 56.224 -57.678  191.829 1.00 74.22  ? 132  TYR A CD1 1 
ATOM   863  C  CD2 . TYR A 1 132 ? 54.236 -58.234  192.990 1.00 77.04  ? 132  TYR A CD2 1 
ATOM   864  C  CE1 . TYR A 1 132 ? 56.645 -56.912  192.900 1.00 76.29  ? 132  TYR A CE1 1 
ATOM   865  C  CE2 . TYR A 1 132 ? 54.650 -57.470  194.067 1.00 80.24  ? 132  TYR A CE2 1 
ATOM   866  C  CZ  . TYR A 1 132 ? 55.855 -56.807  194.002 1.00 80.11  ? 132  TYR A CZ  1 
ATOM   867  O  OH  . TYR A 1 132 ? 56.262 -56.032  195.058 1.00 86.26  ? 132  TYR A OH  1 
ATOM   868  N  N   . ALA A 1 133 ? 53.411 -61.697  192.298 1.00 71.57  ? 133  ALA A N   1 
ATOM   869  C  CA  . ALA A 1 133 ? 52.914 -62.311  193.524 1.00 75.69  ? 133  ALA A CA  1 
ATOM   870  C  C   . ALA A 1 133 ? 53.790 -63.480  193.952 1.00 77.20  ? 133  ALA A C   1 
ATOM   871  O  O   . ALA A 1 133 ? 54.092 -63.645  195.115 1.00 80.25  ? 133  ALA A O   1 
ATOM   872  C  CB  . ALA A 1 133 ? 51.486 -62.761  193.347 1.00 77.27  ? 133  ALA A CB  1 
ATOM   873  N  N   . ARG A 1 134 ? 54.189 -64.306  193.007 1.00 77.17  ? 134  ARG A N   1 
ATOM   874  C  CA  . ARG A 1 134 ? 55.002 -65.451  193.335 1.00 80.09  ? 134  ARG A CA  1 
ATOM   875  C  C   . ARG A 1 134 ? 56.339 -64.982  193.849 1.00 80.34  ? 134  ARG A C   1 
ATOM   876  O  O   . ARG A 1 134 ? 56.893 -65.583  194.761 1.00 83.63  ? 134  ARG A O   1 
ATOM   877  C  CB  . ARG A 1 134 ? 55.148 -66.369  192.126 1.00 79.57  ? 134  ARG A CB  1 
ATOM   878  C  CG  . ARG A 1 134 ? 53.835 -67.088  191.798 1.00 83.14  ? 134  ARG A CG  1 
ATOM   879  C  CD  . ARG A 1 134 ? 53.848 -67.729  190.411 1.00 83.78  ? 134  ARG A CD  1 
ATOM   880  N  NE  . ARG A 1 134 ? 54.994 -68.612  190.262 1.00 85.10  ? 134  ARG A NE  1 
ATOM   881  C  CZ  . ARG A 1 134 ? 55.028 -69.867  190.702 1.00 88.80  ? 134  ARG A CZ  1 
ATOM   882  N  NH1 . ARG A 1 134 ? 53.973 -70.411  191.310 1.00 90.58  ? 134  ARG A NH1 1 
ATOM   883  N  NH2 . ARG A 1 134 ? 56.125 -70.579  190.519 1.00 89.85  ? 134  ARG A NH2 1 
ATOM   884  N  N   . PHE A 1 135 ? 56.834 -63.883  193.293 1.00 79.14  ? 135  PHE A N   1 
ATOM   885  C  CA  . PHE A 1 135 ? 58.097 -63.275  193.721 1.00 80.35  ? 135  PHE A CA  1 
ATOM   886  C  C   . PHE A 1 135 ? 58.006 -62.744  195.149 1.00 83.09  ? 135  PHE A C   1 
ATOM   887  O  O   . PHE A 1 135 ? 59.020 -62.636  195.822 1.00 84.51  ? 135  PHE A O   1 
ATOM   888  C  CB  . PHE A 1 135 ? 58.460 -62.098  192.811 1.00 79.28  ? 135  PHE A CB  1 
ATOM   889  C  CG  . PHE A 1 135 ? 59.233 -62.475  191.584 1.00 79.53  ? 135  PHE A CG  1 
ATOM   890  C  CD1 . PHE A 1 135 ? 59.312 -63.785  191.171 1.00 80.49  ? 135  PHE A CD1 1 
ATOM   891  C  CD2 . PHE A 1 135 ? 59.853 -61.498  190.824 1.00 81.26  ? 135  PHE A CD2 1 
ATOM   892  C  CE1 . PHE A 1 135 ? 60.020 -64.128  190.038 1.00 82.07  ? 135  PHE A CE1 1 
ATOM   893  C  CE2 . PHE A 1 135 ? 60.566 -61.838  189.680 1.00 83.00  ? 135  PHE A CE2 1 
ATOM   894  C  CZ  . PHE A 1 135 ? 60.646 -63.161  189.290 1.00 82.33  ? 135  PHE A CZ  1 
ATOM   895  N  N   . THR A 1 136 ? 56.798 -62.383  195.590 1.00 84.94  ? 136  THR A N   1 
ATOM   896  C  CA  . THR A 1 136 ? 56.581 -61.855  196.947 1.00 88.61  ? 136  THR A CA  1 
ATOM   897  C  C   . THR A 1 136 ? 55.932 -62.844  197.918 1.00 92.72  ? 136  THR A C   1 
ATOM   898  O  O   . THR A 1 136 ? 54.992 -62.485  198.620 1.00 96.81  ? 136  THR A O   1 
ATOM   899  C  CB  . THR A 1 136 ? 55.680 -60.592  196.951 1.00 89.61  ? 136  THR A CB  1 
ATOM   900  O  OG1 . THR A 1 136 ? 54.343 -60.949  196.571 1.00 88.84  ? 136  THR A OG1 1 
ATOM   901  C  CG2 . THR A 1 136 ? 56.233 -59.517  196.035 1.00 86.90  ? 136  THR A CG2 1 
ATOM   902  N  N   . ARG A 1 137 ? 56.405 -64.085  197.946 1.00 81.55  ? 137  ARG A N   1 
ATOM   903  C  CA  . ARG A 1 137 ? 55.990 -65.067  198.969 1.00 81.34  ? 137  ARG A CA  1 
ATOM   904  C  C   . ARG A 1 137 ? 57.118 -66.057  199.139 1.00 78.88  ? 137  ARG A C   1 
ATOM   905  O  O   . ARG A 1 137 ? 56.910 -67.258  198.980 1.00 80.15  ? 137  ARG A O   1 
ATOM   906  C  CB  . ARG A 1 137 ? 54.737 -65.835  198.548 1.00 83.27  ? 137  ARG A CB  1 
ATOM   907  C  CG  . ARG A 1 137 ? 53.579 -64.939  198.182 1.00 89.39  ? 137  ARG A CG  1 
ATOM   908  C  CD  . ARG A 1 137 ? 52.647 -65.603  197.153 1.00 97.36  ? 137  ARG A CD  1 
ATOM   909  N  NE  . ARG A 1 137 ? 51.696 -66.549  197.753 1.00 103.33 ? 137  ARG A NE  1 
ATOM   910  C  CZ  . ARG A 1 137 ? 50.430 -66.248  198.051 1.00 107.85 ? 137  ARG A CZ  1 
ATOM   911  N  NH1 . ARG A 1 137 ? 49.958 -65.019  197.815 1.00 107.26 ? 137  ARG A NH1 1 
ATOM   912  N  NH2 . ARG A 1 137 ? 49.634 -67.176  198.586 1.00 111.68 ? 137  ARG A NH2 1 
ATOM   913  N  N   . PRO A 1 138 ? 58.324 -65.561  199.435 1.00 75.25  ? 138  PRO A N   1 
ATOM   914  C  CA  . PRO A 1 138 ? 59.461 -66.454  199.600 1.00 73.62  ? 138  PRO A CA  1 
ATOM   915  C  C   . PRO A 1 138 ? 59.274 -67.342  200.809 1.00 70.39  ? 138  PRO A C   1 
ATOM   916  O  O   . PRO A 1 138 ? 58.568 -66.984  201.749 1.00 69.09  ? 138  PRO A O   1 
ATOM   917  C  CB  . PRO A 1 138 ? 60.619 -65.497  199.875 1.00 74.25  ? 138  PRO A CB  1 
ATOM   918  C  CG  . PRO A 1 138 ? 59.953 -64.348  200.597 1.00 74.81  ? 138  PRO A CG  1 
ATOM   919  C  CD  . PRO A 1 138 ? 58.625 -64.188  199.879 1.00 75.53  ? 138  PRO A CD  1 
ATOM   920  N  N   . THR A 1 139 ? 59.904 -68.504  200.773 1.00 68.61  ? 139  THR A N   1 
ATOM   921  C  CA  . THR A 1 139 ? 59.913 -69.379  201.926 1.00 65.47  ? 139  THR A CA  1 
ATOM   922  C  C   . THR A 1 139 ? 60.890 -68.799  202.953 1.00 63.33  ? 139  THR A C   1 
ATOM   923  O  O   . THR A 1 139 ? 61.843 -68.074  202.589 1.00 63.95  ? 139  THR A O   1 
ATOM   924  C  CB  . THR A 1 139 ? 60.354 -70.778  201.510 1.00 66.31  ? 139  THR A CB  1 
ATOM   925  O  OG1 . THR A 1 139 ? 61.719 -70.726  201.048 1.00 66.62  ? 139  THR A OG1 1 
ATOM   926  C  CG2 . THR A 1 139 ? 59.442 -71.291  200.391 1.00 66.64  ? 139  THR A CG2 1 
ATOM   927  N  N   . ALA A 1 140 ? 60.661 -69.110  204.226 1.00 59.63  ? 140  ALA A N   1 
ATOM   928  C  CA  . ALA A 1 140 ? 61.530 -68.611  205.273 1.00 56.99  ? 140  ALA A CA  1 
ATOM   929  C  C   . ALA A 1 140 ? 62.912 -69.283  205.231 1.00 56.32  ? 140  ALA A C   1 
ATOM   930  O  O   . ALA A 1 140 ? 63.893 -68.694  205.653 1.00 56.60  ? 140  ALA A O   1 
ATOM   931  C  CB  . ALA A 1 140 ? 60.887 -68.775  206.616 1.00 55.21  ? 140  ALA A CB  1 
ATOM   932  N  N   . GLY A 1 141 ? 63.001 -70.507  204.716 1.00 55.09  ? 141  GLY A N   1 
ATOM   933  C  CA  . GLY A 1 141 ? 64.256 -71.247  204.781 1.00 53.80  ? 141  GLY A CA  1 
ATOM   934  C  C   . GLY A 1 141 ? 64.754 -71.342  206.203 1.00 52.75  ? 141  GLY A C   1 
ATOM   935  O  O   . GLY A 1 141 ? 65.894 -71.009  206.502 1.00 53.71  ? 141  GLY A O   1 
ATOM   936  N  N   . VAL A 1 142 ? 63.880 -71.787  207.094 1.00 50.73  ? 142  VAL A N   1 
ATOM   937  C  CA  . VAL A 1 142 ? 64.237 -72.050  208.468 1.00 49.53  ? 142  VAL A CA  1 
ATOM   938  C  C   . VAL A 1 142 ? 64.080 -73.547  208.782 1.00 49.43  ? 142  VAL A C   1 
ATOM   939  O  O   . VAL A 1 142 ? 63.046 -74.137  208.452 1.00 50.24  ? 142  VAL A O   1 
ATOM   940  C  CB  . VAL A 1 142 ? 63.314 -71.267  209.394 1.00 48.55  ? 142  VAL A CB  1 
ATOM   941  C  CG1 . VAL A 1 142 ? 63.501 -71.693  210.833 1.00 46.58  ? 142  VAL A CG1 1 
ATOM   942  C  CG2 . VAL A 1 142 ? 63.570 -69.797  209.232 1.00 49.26  ? 142  VAL A CG2 1 
ATOM   943  N  N   . LEU A 1 143 ? 65.081 -74.159  209.420 1.00 48.67  ? 143  LEU A N   1 
ATOM   944  C  CA  . LEU A 1 143 ? 65.039 -75.576  209.750 1.00 47.62  ? 143  LEU A CA  1 
ATOM   945  C  C   . LEU A 1 143 ? 64.662 -75.755  211.185 1.00 46.78  ? 143  LEU A C   1 
ATOM   946  O  O   . LEU A 1 143 ? 65.124 -75.029  212.057 1.00 46.28  ? 143  LEU A O   1 
ATOM   947  C  CB  . LEU A 1 143 ? 66.415 -76.177  209.592 1.00 49.89  ? 143  LEU A CB  1 
ATOM   948  C  CG  . LEU A 1 143 ? 66.642 -77.691  209.766 1.00 50.67  ? 143  LEU A CG  1 
ATOM   949  C  CD1 . LEU A 1 143 ? 65.755 -78.503  208.815 1.00 47.36  ? 143  LEU A CD1 1 
ATOM   950  C  CD2 . LEU A 1 143 ? 68.137 -77.992  209.513 1.00 50.04  ? 143  LEU A CD2 1 
ATOM   951  N  N   . PHE A 1 144 ? 63.823 -76.742  211.447 1.00 46.52  ? 144  PHE A N   1 
ATOM   952  C  CA  . PHE A 1 144 ? 63.449 -77.035  212.805 1.00 45.29  ? 144  PHE A CA  1 
ATOM   953  C  C   . PHE A 1 144 ? 64.126 -78.345  213.224 1.00 46.54  ? 144  PHE A C   1 
ATOM   954  O  O   . PHE A 1 144 ? 64.274 -79.257  212.404 1.00 47.52  ? 144  PHE A O   1 
ATOM   955  C  CB  . PHE A 1 144 ? 61.946 -77.168  212.868 1.00 44.39  ? 144  PHE A CB  1 
ATOM   956  C  CG  . PHE A 1 144 ? 61.207 -75.848  212.685 1.00 44.21  ? 144  PHE A CG  1 
ATOM   957  C  CD1 . PHE A 1 144 ? 60.716 -75.479  211.454 1.00 42.48  ? 144  PHE A CD1 1 
ATOM   958  C  CD2 . PHE A 1 144 ? 60.995 -74.992  213.757 1.00 41.51  ? 144  PHE A CD2 1 
ATOM   959  C  CE1 . PHE A 1 144 ? 60.012 -74.283  211.304 1.00 44.12  ? 144  PHE A CE1 1 
ATOM   960  C  CE2 . PHE A 1 144 ? 60.307 -73.806  213.591 1.00 42.97  ? 144  PHE A CE2 1 
ATOM   961  C  CZ  . PHE A 1 144 ? 59.798 -73.467  212.361 1.00 41.32  ? 144  PHE A CZ  1 
ATOM   962  N  N   . SER A 1 145 ? 64.540 -78.447  214.485 1.00 45.67  ? 145  SER A N   1 
ATOM   963  C  CA  . SER A 1 145 ? 65.172 -79.662  214.933 1.00 46.29  ? 145  SER A CA  1 
ATOM   964  C  C   . SER A 1 145 ? 64.079 -80.707  214.998 1.00 46.82  ? 145  SER A C   1 
ATOM   965  O  O   . SER A 1 145 ? 62.924 -80.389  215.265 1.00 45.85  ? 145  SER A O   1 
ATOM   966  C  CB  . SER A 1 145 ? 65.816 -79.469  216.304 1.00 46.54  ? 145  SER A CB  1 
ATOM   967  O  OG  . SER A 1 145 ? 64.845 -79.223  217.307 1.00 45.18  ? 145  SER A OG  1 
ATOM   968  N  N   . SER A 1 146 ? 64.433 -81.965  214.772 1.00 47.78  ? 146  SER A N   1 
ATOM   969  C  CA  . SER A 1 146 ? 63.410 -82.940  214.565 1.00 47.55  ? 146  SER A CA  1 
ATOM   970  C  C   . SER A 1 146 ? 62.787 -83.287  215.905 1.00 47.63  ? 146  SER A C   1 
ATOM   971  O  O   . SER A 1 146 ? 61.692 -83.848  215.970 1.00 48.08  ? 146  SER A O   1 
ATOM   972  C  CB  . SER A 1 146 ? 63.985 -84.164  213.874 1.00 48.85  ? 146  SER A CB  1 
ATOM   973  O  OG  . SER A 1 146 ? 64.789 -84.911  214.759 1.00 51.56  ? 146  SER A OG  1 
ATOM   974  N  N   . ARG A 1 147 ? 63.455 -82.910  216.983 1.00 47.07  ? 147  ARG A N   1 
ATOM   975  C  CA  . ARG A 1 147 ? 62.948 -83.219  218.301 1.00 47.52  ? 147  ARG A CA  1 
ATOM   976  C  C   . ARG A 1 147 ? 63.117 -82.025  219.245 1.00 46.45  ? 147  ARG A C   1 
ATOM   977  O  O   . ARG A 1 147 ? 63.892 -81.095  218.973 1.00 46.06  ? 147  ARG A O   1 
ATOM   978  C  CB  . ARG A 1 147 ? 63.765 -84.371  218.891 1.00 49.69  ? 147  ARG A CB  1 
ATOM   979  C  CG  . ARG A 1 147 ? 63.828 -85.622  218.034 1.00 52.34  ? 147  ARG A CG  1 
ATOM   980  C  CD  . ARG A 1 147 ? 62.618 -86.491  218.302 1.00 55.66  ? 147  ARG A CD  1 
ATOM   981  N  NE  . ARG A 1 147 ? 62.661 -87.677  217.449 1.00 62.66  ? 147  ARG A NE  1 
ATOM   982  C  CZ  . ARG A 1 147 ? 62.343 -87.712  216.152 1.00 63.26  ? 147  ARG A CZ  1 
ATOM   983  N  NH1 . ARG A 1 147 ? 61.943 -86.619  215.500 1.00 60.81  ? 147  ARG A NH1 1 
ATOM   984  N  NH2 . ARG A 1 147 ? 62.455 -88.857  215.498 1.00 64.40  ? 147  ARG A NH2 1 
ATOM   985  N  N   . MET A 1 148 ? 62.412 -82.068  220.372 1.00 46.05  ? 148  MET A N   1 
ATOM   986  C  CA  . MET A 1 148 ? 62.716 -81.172  221.504 1.00 45.89  ? 148  MET A CA  1 
ATOM   987  C  C   . MET A 1 148 ? 63.472 -82.010  222.573 1.00 46.70  ? 148  MET A C   1 
ATOM   988  O  O   . MET A 1 148 ? 63.477 -83.215  222.502 1.00 48.13  ? 148  MET A O   1 
ATOM   989  C  CB  . MET A 1 148 ? 61.433 -80.615  222.104 1.00 44.31  ? 148  MET A CB  1 
ATOM   990  C  CG  . MET A 1 148 ? 60.267 -80.509  221.135 1.00 45.37  ? 148  MET A CG  1 
ATOM   991  S  SD  . MET A 1 148 ? 58.901 -79.492  221.817 1.00 46.42  ? 148  MET A SD  1 
ATOM   992  C  CE  . MET A 1 148 ? 59.806 -77.992  222.130 1.00 35.19  ? 148  MET A CE  1 
ATOM   993  N  N   . VAL A 1 149 ? 64.091 -81.365  223.543 1.00 46.47  ? 149  VAL A N   1 
ATOM   994  C  CA  . VAL A 1 149 ? 64.661 -82.052  224.691 1.00 47.83  ? 149  VAL A CA  1 
ATOM   995  C  C   . VAL A 1 149 ? 64.194 -81.323  225.927 1.00 47.47  ? 149  VAL A C   1 
ATOM   996  O  O   . VAL A 1 149 ? 63.875 -80.173  225.869 1.00 47.60  ? 149  VAL A O   1 
ATOM   997  C  CB  . VAL A 1 149 ? 66.190 -81.952  224.671 1.00 49.16  ? 149  VAL A CB  1 
ATOM   998  C  CG1 . VAL A 1 149 ? 66.742 -82.560  223.358 1.00 50.23  ? 149  VAL A CG1 1 
ATOM   999  C  CG2 . VAL A 1 149 ? 66.622 -80.495  224.807 1.00 44.79  ? 149  VAL A CG2 1 
ATOM   1000 N  N   . ILE A 1 150 ? 64.129 -82.004  227.040 1.00 49.16  ? 150  ILE A N   1 
ATOM   1001 C  CA  . ILE A 1 150 ? 64.065 -81.357  228.339 1.00 49.69  ? 150  ILE A CA  1 
ATOM   1002 C  C   . ILE A 1 150 ? 65.330 -81.687  229.142 1.00 52.83  ? 150  ILE A C   1 
ATOM   1003 O  O   . ILE A 1 150 ? 65.660 -82.849  229.351 1.00 54.62  ? 150  ILE A O   1 
ATOM   1004 C  CB  . ILE A 1 150 ? 62.897 -81.890  229.145 1.00 49.07  ? 150  ILE A CB  1 
ATOM   1005 C  CG1 . ILE A 1 150 ? 61.592 -81.549  228.437 1.00 46.66  ? 150  ILE A CG1 1 
ATOM   1006 C  CG2 . ILE A 1 150 ? 62.946 -81.352  230.548 1.00 48.34  ? 150  ILE A CG2 1 
ATOM   1007 C  CD1 . ILE A 1 150 ? 60.373 -81.817  229.239 1.00 43.08  ? 150  ILE A CD1 1 
ATOM   1008 N  N   . SER A 1 151 ? 66.040 -80.665  229.580 1.00 54.56  ? 151  SER A N   1 
ATOM   1009 C  CA  . SER A 1 151 ? 67.168 -80.862  230.440 1.00 57.80  ? 151  SER A CA  1 
ATOM   1010 C  C   . SER A 1 151 ? 67.572 -79.518  231.086 1.00 59.24  ? 151  SER A C   1 
ATOM   1011 O  O   . SER A 1 151 ? 67.021 -78.486  230.747 1.00 59.07  ? 151  SER A O   1 
ATOM   1012 C  CB  . SER A 1 151 ? 68.300 -81.484  229.641 1.00 58.70  ? 151  SER A CB  1 
ATOM   1013 O  OG  . SER A 1 151 ? 68.713 -80.625  228.595 1.00 59.15  ? 151  SER A OG  1 
ATOM   1014 N  N   . ASP A 1 152 ? 68.521 -79.536  232.014 1.00 61.84  ? 152  ASP A N   1 
ATOM   1015 C  CA  . ASP A 1 152 ? 68.832 -78.380  232.832 1.00 63.58  ? 152  ASP A CA  1 
ATOM   1016 C  C   . ASP A 1 152 ? 69.461 -77.205  232.114 1.00 64.25  ? 152  ASP A C   1 
ATOM   1017 O  O   . ASP A 1 152 ? 70.498 -77.343  231.461 1.00 65.23  ? 152  ASP A O   1 
ATOM   1018 C  CB  . ASP A 1 152 ? 69.821 -78.769  233.891 1.00 65.96  ? 152  ASP A CB  1 
ATOM   1019 C  CG  . ASP A 1 152 ? 69.209 -79.576  234.977 1.00 68.98  ? 152  ASP A CG  1 
ATOM   1020 O  OD1 . ASP A 1 152 ? 67.969 -79.693  235.011 1.00 70.13  ? 152  ASP A OD1 1 
ATOM   1021 O  OD2 . ASP A 1 152 ? 69.989 -80.092  235.816 1.00 75.96  ? 152  ASP A OD2 1 
ATOM   1022 N  N   . PHE A 1 153 ? 68.871 -76.027  232.284 1.00 63.78  ? 153  PHE A N   1 
ATOM   1023 C  CA  . PHE A 1 153 ? 69.597 -74.806  231.978 1.00 64.58  ? 153  PHE A CA  1 
ATOM   1024 C  C   . PHE A 1 153 ? 69.495 -73.876  233.186 1.00 66.36  ? 153  PHE A C   1 
ATOM   1025 O  O   . PHE A 1 153 ? 68.389 -73.623  233.705 1.00 65.31  ? 153  PHE A O   1 
ATOM   1026 C  CB  . PHE A 1 153 ? 69.071 -74.174  230.702 1.00 63.14  ? 153  PHE A CB  1 
ATOM   1027 C  CG  . PHE A 1 153 ? 69.714 -72.858  230.355 1.00 63.90  ? 153  PHE A CG  1 
ATOM   1028 C  CD1 . PHE A 1 153 ? 71.046 -72.802  229.951 1.00 62.23  ? 153  PHE A CD1 1 
ATOM   1029 C  CD2 . PHE A 1 153 ? 68.954 -71.666  230.408 1.00 61.56  ? 153  PHE A CD2 1 
ATOM   1030 C  CE1 . PHE A 1 153 ? 71.628 -71.574  229.618 1.00 64.92  ? 153  PHE A CE1 1 
ATOM   1031 C  CE2 . PHE A 1 153 ? 69.520 -70.441  230.095 1.00 61.77  ? 153  PHE A CE2 1 
ATOM   1032 C  CZ  . PHE A 1 153 ? 70.855 -70.383  229.688 1.00 65.00  ? 153  PHE A CZ  1 
ATOM   1033 N  N   . GLU A 1 154 ? 70.651 -73.376  233.641 1.00 69.12  ? 154  GLU A N   1 
ATOM   1034 C  CA  . GLU A 1 154 ? 70.694 -72.595  234.861 1.00 71.26  ? 154  GLU A CA  1 
ATOM   1035 C  C   . GLU A 1 154 ? 70.002 -73.380  235.969 1.00 71.58  ? 154  GLU A C   1 
ATOM   1036 O  O   . GLU A 1 154 ? 69.190 -72.824  236.707 1.00 71.59  ? 154  GLU A O   1 
ATOM   1037 C  CB  . GLU A 1 154 ? 69.985 -71.252  234.687 1.00 70.72  ? 154  GLU A CB  1 
ATOM   1038 C  CG  . GLU A 1 154 ? 70.528 -70.417  233.556 1.00 71.54  ? 154  GLU A CG  1 
ATOM   1039 C  CD  . GLU A 1 154 ? 71.947 -69.924  233.793 1.00 78.52  ? 154  GLU A CD  1 
ATOM   1040 O  OE1 . GLU A 1 154 ? 72.757 -70.533  234.540 1.00 81.88  ? 154  GLU A OE1 1 
ATOM   1041 O  OE2 . GLU A 1 154 ? 72.265 -68.889  233.200 1.00 82.66  ? 154  GLU A OE2 1 
ATOM   1042 N  N   . GLY A 1 155 ? 70.302 -74.675  236.070 1.00 72.09  ? 155  GLY A N   1 
ATOM   1043 C  CA  . GLY A 1 155 ? 69.833 -75.466  237.199 1.00 72.41  ? 155  GLY A CA  1 
ATOM   1044 C  C   . GLY A 1 155 ? 68.356 -75.785  237.144 1.00 70.74  ? 155  GLY A C   1 
ATOM   1045 O  O   . GLY A 1 155 ? 67.825 -76.401  238.068 1.00 72.86  ? 155  GLY A O   1 
ATOM   1046 N  N   . LYS A 1 156 ? 67.689 -75.386  236.063 1.00 67.94  ? 156  LYS A N   1 
ATOM   1047 C  CA  . LYS A 1 156 ? 66.290 -75.713  235.863 1.00 64.76  ? 156  LYS A CA  1 
ATOM   1048 C  C   . LYS A 1 156 ? 66.066 -76.632  234.671 1.00 61.73  ? 156  LYS A C   1 
ATOM   1049 O  O   . LYS A 1 156 ? 66.667 -76.423  233.604 1.00 60.95  ? 156  LYS A O   1 
ATOM   1050 C  CB  . LYS A 1 156 ? 65.491 -74.448  235.625 1.00 64.83  ? 156  LYS A CB  1 
ATOM   1051 C  CG  . LYS A 1 156 ? 65.046 -73.753  236.880 1.00 67.64  ? 156  LYS A CG  1 
ATOM   1052 C  CD  . LYS A 1 156 ? 63.839 -72.900  236.589 1.00 69.49  ? 156  LYS A CD  1 
ATOM   1053 C  CE  . LYS A 1 156 ? 63.539 -71.976  237.750 1.00 73.10  ? 156  LYS A CE  1 
ATOM   1054 N  NZ  . LYS A 1 156 ? 64.384 -70.752  237.644 1.00 75.24  ? 156  LYS A NZ  1 
ATOM   1055 N  N   . PRO A 1 157 ? 65.179 -77.638  234.841 1.00 59.17  ? 157  PRO A N   1 
ATOM   1056 C  CA  . PRO A 1 157 ? 64.704 -78.372  233.675 1.00 56.36  ? 157  PRO A CA  1 
ATOM   1057 C  C   . PRO A 1 157 ? 64.086 -77.392  232.672 1.00 54.52  ? 157  PRO A C   1 
ATOM   1058 O  O   . PRO A 1 157 ? 63.297 -76.548  233.062 1.00 54.09  ? 157  PRO A O   1 
ATOM   1059 C  CB  . PRO A 1 157 ? 63.632 -79.313  234.247 1.00 56.01  ? 157  PRO A CB  1 
ATOM   1060 C  CG  . PRO A 1 157 ? 63.886 -79.378  235.746 1.00 57.90  ? 157  PRO A CG  1 
ATOM   1061 C  CD  . PRO A 1 157 ? 64.525 -78.063  236.099 1.00 59.55  ? 157  PRO A CD  1 
ATOM   1062 N  N   . THR A 1 158 ? 64.430 -77.523  231.387 1.00 52.93  ? 158  THR A N   1 
ATOM   1063 C  CA  . THR A 1 158 ? 64.068 -76.564  230.376 1.00 50.61  ? 158  THR A CA  1 
ATOM   1064 C  C   . THR A 1 158 ? 63.736 -77.333  229.101 1.00 49.85  ? 158  THR A C   1 
ATOM   1065 O  O   . THR A 1 158 ? 64.501 -78.216  228.660 1.00 49.59  ? 158  THR A O   1 
ATOM   1066 C  CB  . THR A 1 158 ? 65.274 -75.602  230.062 1.00 51.78  ? 158  THR A CB  1 
ATOM   1067 O  OG1 . THR A 1 158 ? 65.805 -75.095  231.283 1.00 53.81  ? 158  THR A OG1 1 
ATOM   1068 C  CG2 . THR A 1 158 ? 64.859 -74.415  229.184 1.00 48.99  ? 158  THR A CG2 1 
ATOM   1069 N  N   . LEU A 1 159 ? 62.597 -76.981  228.509 1.00 47.68  ? 159  LEU A N   1 
ATOM   1070 C  CA  . LEU A 1 159 ? 62.129 -77.562  227.265 1.00 46.07  ? 159  LEU A CA  1 
ATOM   1071 C  C   . LEU A 1 159 ? 62.826 -76.768  226.168 1.00 45.59  ? 159  LEU A C   1 
ATOM   1072 O  O   . LEU A 1 159 ? 62.758 -75.535  226.172 1.00 45.32  ? 159  LEU A O   1 
ATOM   1073 C  CB  . LEU A 1 159 ? 60.617 -77.331  227.147 1.00 45.11  ? 159  LEU A CB  1 
ATOM   1074 C  CG  . LEU A 1 159 ? 59.922 -77.678  225.842 1.00 43.58  ? 159  LEU A CG  1 
ATOM   1075 C  CD1 . LEU A 1 159 ? 60.148 -79.181  225.613 1.00 41.42  ? 159  LEU A CD1 1 
ATOM   1076 C  CD2 . LEU A 1 159 ? 58.429 -77.365  225.984 1.00 40.96  ? 159  LEU A CD2 1 
ATOM   1077 N  N   . MET A 1 160 ? 63.488 -77.447  225.228 1.00 44.55  ? 160  MET A N   1 
ATOM   1078 C  CA  . MET A 1 160 ? 64.232 -76.709  224.222 1.00 43.83  ? 160  MET A CA  1 
ATOM   1079 C  C   . MET A 1 160 ? 63.970 -77.281  222.864 1.00 42.80  ? 160  MET A C   1 
ATOM   1080 O  O   . MET A 1 160 ? 63.572 -78.408  222.747 1.00 43.01  ? 160  MET A O   1 
ATOM   1081 C  CB  . MET A 1 160 ? 65.734 -76.761  224.502 1.00 45.33  ? 160  MET A CB  1 
ATOM   1082 C  CG  . MET A 1 160 ? 66.164 -76.628  225.954 1.00 46.07  ? 160  MET A CG  1 
ATOM   1083 S  SD  . MET A 1 160 ? 67.999 -76.605  226.045 1.00 49.91  ? 160  MET A SD  1 
ATOM   1084 C  CE  . MET A 1 160 ? 68.348 -76.847  227.771 1.00 44.29  ? 160  MET A CE  1 
ATOM   1085 N  N   . MET A 1 161 ? 64.165 -76.476  221.836 1.00 42.65  ? 161  MET A N   1 
ATOM   1086 C  CA  . MET A 1 161 ? 64.167 -76.949  220.465 1.00 42.96  ? 161  MET A CA  1 
ATOM   1087 C  C   . MET A 1 161 ? 65.065 -75.976  219.710 1.00 43.62  ? 161  MET A C   1 
ATOM   1088 O  O   . MET A 1 161 ? 65.436 -74.933  220.246 1.00 43.86  ? 161  MET A O   1 
ATOM   1089 C  CB  . MET A 1 161 ? 62.739 -77.107  219.882 1.00 42.83  ? 161  MET A CB  1 
ATOM   1090 C  CG  . MET A 1 161 ? 61.750 -75.895  220.017 1.00 43.31  ? 161  MET A CG  1 
ATOM   1091 S  SD  . MET A 1 161 ? 62.324 -74.572  218.949 1.00 48.56  ? 161  MET A SD  1 
ATOM   1092 C  CE  . MET A 1 161 ? 62.150 -75.185  217.276 1.00 45.30  ? 161  MET A CE  1 
ATOM   1093 N  N   . ARG A 1 162 ? 65.534 -76.317  218.521 1.00 44.36  ? 162  ARG A N   1 
ATOM   1094 C  CA  . ARG A 1 162 ? 66.334 -75.311  217.878 1.00 45.36  ? 162  ARG A CA  1 
ATOM   1095 C  C   . ARG A 1 162 ? 65.966 -75.080  216.454 1.00 45.24  ? 162  ARG A C   1 
ATOM   1096 O  O   . ARG A 1 162 ? 65.270 -75.884  215.858 1.00 43.70  ? 162  ARG A O   1 
ATOM   1097 C  CB  . ARG A 1 162 ? 67.837 -75.514  218.062 1.00 47.78  ? 162  ARG A CB  1 
ATOM   1098 C  CG  . ARG A 1 162 ? 68.443 -76.759  217.521 1.00 50.11  ? 162  ARG A CG  1 
ATOM   1099 C  CD  . ARG A 1 162 ? 69.895 -76.777  217.899 1.00 57.73  ? 162  ARG A CD  1 
ATOM   1100 N  NE  . ARG A 1 162 ? 70.515 -78.028  217.472 1.00 64.89  ? 162  ARG A NE  1 
ATOM   1101 C  CZ  . ARG A 1 162 ? 71.794 -78.328  217.658 1.00 68.52  ? 162  ARG A CZ  1 
ATOM   1102 N  NH1 . ARG A 1 162 ? 72.601 -77.477  218.274 1.00 69.10  ? 162  ARG A NH1 1 
ATOM   1103 N  NH2 . ARG A 1 162 ? 72.263 -79.476  217.212 1.00 72.78  ? 162  ARG A NH2 1 
ATOM   1104 N  N   . LEU A 1 163 ? 66.449 -73.959  215.941 1.00 46.61  ? 163  LEU A N   1 
ATOM   1105 C  CA  . LEU A 1 163 ? 66.086 -73.489  214.629 1.00 48.50  ? 163  LEU A CA  1 
ATOM   1106 C  C   . LEU A 1 163 ? 67.370 -73.126  213.939 1.00 49.94  ? 163  LEU A C   1 
ATOM   1107 O  O   . LEU A 1 163 ? 68.281 -72.612  214.581 1.00 51.07  ? 163  LEU A O   1 
ATOM   1108 C  CB  . LEU A 1 163 ? 65.297 -72.180  214.756 1.00 48.68  ? 163  LEU A CB  1 
ATOM   1109 C  CG  . LEU A 1 163 ? 63.872 -72.198  215.278 1.00 49.29  ? 163  LEU A CG  1 
ATOM   1110 C  CD1 . LEU A 1 163 ? 63.454 -70.817  215.638 1.00 50.40  ? 163  LEU A CD1 1 
ATOM   1111 C  CD2 . LEU A 1 163 ? 62.997 -72.707  214.178 1.00 54.30  ? 163  LEU A CD2 1 
ATOM   1112 N  N   . ALA A 1 164 ? 67.430 -73.330  212.629 1.00 50.84  ? 164  ALA A N   1 
ATOM   1113 C  CA  . ALA A 1 164 ? 68.582 -72.855  211.861 1.00 52.80  ? 164  ALA A CA  1 
ATOM   1114 C  C   . ALA A 1 164 ? 68.146 -72.098  210.623 1.00 53.04  ? 164  ALA A C   1 
ATOM   1115 O  O   . ALA A 1 164 ? 67.122 -72.416  210.015 1.00 51.99  ? 164  ALA A O   1 
ATOM   1116 C  CB  . ALA A 1 164 ? 69.521 -74.058  211.464 1.00 53.49  ? 164  ALA A CB  1 
ATOM   1117 N  N   . ASN A 1 165 ? 68.953 -71.118  210.241 1.00 54.97  ? 165  ASN A N   1 
ATOM   1118 C  CA  . ASN A 1 165 ? 68.762 -70.392  208.989 1.00 56.12  ? 165  ASN A CA  1 
ATOM   1119 C  C   . ASN A 1 165 ? 69.463 -71.119  207.861 1.00 57.90  ? 165  ASN A C   1 
ATOM   1120 O  O   . ASN A 1 165 ? 70.673 -71.329  207.917 1.00 59.42  ? 165  ASN A O   1 
ATOM   1121 C  CB  . ASN A 1 165 ? 69.328 -68.961  209.084 1.00 57.02  ? 165  ASN A CB  1 
ATOM   1122 C  CG  . ASN A 1 165 ? 69.037 -68.151  207.835 1.00 58.59  ? 165  ASN A CG  1 
ATOM   1123 O  OD1 . ASN A 1 165 ? 68.611 -68.701  206.828 1.00 59.26  ? 165  ASN A OD1 1 
ATOM   1124 N  ND2 . ASN A 1 165 ? 69.241 -66.849  207.898 1.00 61.37  ? 165  ASN A ND2 1 
ATOM   1125 N  N   . LEU A 1 166 ? 68.714 -71.487  206.829 1.00 58.25  ? 166  LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 166 ? 69.281 -72.234  205.711 1.00 60.03  ? 166  LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 166 ? 69.869 -71.353  204.596 1.00 63.06  ? 166  LEU A C   1 
ATOM   1128 O  O   . LEU A 1 166 ? 70.385 -71.867  203.598 1.00 65.59  ? 166  LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 166 ? 68.226 -73.158  205.126 1.00 58.01  ? 166  LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 166 ? 67.810 -74.316  206.020 1.00 57.07  ? 166  LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 166 ? 66.601 -75.020  205.438 1.00 54.72  ? 166  LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 166 ? 68.967 -75.310  206.258 1.00 54.74  ? 166  LEU A CD2 1 
ATOM   1133 N  N   . ARG A 1 167 ? 69.781 -70.036  204.722 1.00 63.39  ? 167  ARG A N   1 
ATOM   1134 C  CA  . ARG A 1 167 ? 70.369 -69.206  203.704 1.00 65.65  ? 167  ARG A CA  1 
ATOM   1135 C  C   . ARG A 1 167 ? 71.461 -68.383  204.327 1.00 67.78  ? 167  ARG A C   1 
ATOM   1136 O  O   . ARG A 1 167 ? 71.557 -68.308  205.547 1.00 67.68  ? 167  ARG A O   1 
ATOM   1137 C  CB  . ARG A 1 167 ? 69.321 -68.318  203.077 1.00 65.52  ? 167  ARG A CB  1 
ATOM   1138 C  CG  . ARG A 1 167 ? 68.197 -69.069  202.381 1.00 65.96  ? 167  ARG A CG  1 
ATOM   1139 C  CD  . ARG A 1 167 ? 67.203 -68.064  201.865 1.00 67.95  ? 167  ARG A CD  1 
ATOM   1140 N  NE  . ARG A 1 167 ? 66.131 -68.645  201.069 1.00 71.65  ? 167  ARG A NE  1 
ATOM   1141 C  CZ  . ARG A 1 167 ? 64.856 -68.671  201.456 1.00 73.15  ? 167  ARG A CZ  1 
ATOM   1142 N  NH1 . ARG A 1 167 ? 64.507 -68.153  202.628 1.00 71.85  ? 167  ARG A NH1 1 
ATOM   1143 N  NH2 . ARG A 1 167 ? 63.920 -69.199  200.674 1.00 74.64  ? 167  ARG A NH2 1 
ATOM   1144 N  N   . ILE A 1 168 ? 72.294 -67.770  203.491 1.00 71.23  ? 168  ILE A N   1 
ATOM   1145 C  CA  . ILE A 1 168 ? 73.424 -66.944  203.946 1.00 73.80  ? 168  ILE A CA  1 
ATOM   1146 C  C   . ILE A 1 168 ? 72.930 -65.594  204.407 1.00 73.18  ? 168  ILE A C   1 
ATOM   1147 O  O   . ILE A 1 168 ? 73.503 -64.990  205.302 1.00 74.19  ? 168  ILE A O   1 
ATOM   1148 C  CB  . ILE A 1 168 ? 74.437 -66.685  202.816 1.00 77.18  ? 168  ILE A CB  1 
ATOM   1149 C  CG1 . ILE A 1 168 ? 75.116 -67.980  202.393 1.00 79.56  ? 168  ILE A CG1 1 
ATOM   1150 C  CG2 . ILE A 1 168 ? 75.524 -65.735  203.285 1.00 80.11  ? 168  ILE A CG2 1 
ATOM   1151 C  CD1 . ILE A 1 168 ? 75.940 -67.821  201.082 1.00 85.24  ? 168  ILE A CD1 1 
ATOM   1152 N  N   . GLU A 1 169 ? 71.870 -65.100  203.787 1.00 72.11  ? 169  GLU A N   1 
ATOM   1153 C  CA  . GLU A 1 169 ? 71.313 -63.840  204.246 1.00 71.91  ? 169  GLU A CA  1 
ATOM   1154 C  C   . GLU A 1 169 ? 70.615 -64.019  205.591 1.00 69.11  ? 169  GLU A C   1 
ATOM   1155 O  O   . GLU A 1 169 ? 70.115 -65.101  205.934 1.00 67.01  ? 169  GLU A O   1 
ATOM   1156 C  CB  . GLU A 1 169 ? 70.348 -63.238  203.231 1.00 72.60  ? 169  GLU A CB  1 
ATOM   1157 C  CG  . GLU A 1 169 ? 70.927 -63.045  201.837 1.00 78.06  ? 169  GLU A CG  1 
ATOM   1158 C  CD  . GLU A 1 169 ? 70.869 -64.327  201.022 1.00 83.08  ? 169  GLU A CD  1 
ATOM   1159 O  OE1 . GLU A 1 169 ? 70.512 -65.382  201.597 1.00 82.89  ? 169  GLU A OE1 1 
ATOM   1160 O  OE2 . GLU A 1 169 ? 71.186 -64.290  199.807 1.00 88.02  ? 169  GLU A OE2 1 
ATOM   1161 N  N   . GLN A 1 170 ? 70.572 -62.932  206.339 1.00 68.34  ? 170  GLN A N   1 
ATOM   1162 C  CA  . GLN A 1 170 ? 70.046 -62.977  207.670 1.00 66.13  ? 170  GLN A CA  1 
ATOM   1163 C  C   . GLN A 1 170 ? 68.600 -62.617  207.757 1.00 63.19  ? 170  GLN A C   1 
ATOM   1164 O  O   . GLN A 1 170 ? 68.069 -61.886  206.935 1.00 62.74  ? 170  GLN A O   1 
ATOM   1165 C  CB  . GLN A 1 170 ? 70.827 -62.032  208.558 1.00 68.40  ? 170  GLN A CB  1 
ATOM   1166 C  CG  . GLN A 1 170 ? 72.159 -62.606  208.908 1.00 72.21  ? 170  GLN A CG  1 
ATOM   1167 C  CD  . GLN A 1 170 ? 73.221 -61.582  208.791 1.00 79.10  ? 170  GLN A CD  1 
ATOM   1168 O  OE1 . GLN A 1 170 ? 72.953 -60.443  208.422 1.00 83.69  ? 170  GLN A OE1 1 
ATOM   1169 N  NE2 . GLN A 1 170 ? 74.444 -61.960  209.120 1.00 84.32  ? 170  GLN A NE2 1 
ATOM   1170 N  N   . ILE A 1 171 ? 67.969 -63.148  208.787 1.00 60.14  ? 171  ILE A N   1 
ATOM   1171 C  CA  . ILE A 1 171 ? 66.637 -62.745  209.092 1.00 58.13  ? 171  ILE A CA  1 
ATOM   1172 C  C   . ILE A 1 171 ? 66.809 -61.854  210.302 1.00 58.87  ? 171  ILE A C   1 
ATOM   1173 O  O   . ILE A 1 171 ? 67.510 -62.237  211.256 1.00 59.09  ? 171  ILE A O   1 
ATOM   1174 C  CB  . ILE A 1 171 ? 65.778 -63.964  209.429 1.00 55.67  ? 171  ILE A CB  1 
ATOM   1175 C  CG1 . ILE A 1 171 ? 65.856 -64.980  208.280 1.00 56.00  ? 171  ILE A CG1 1 
ATOM   1176 C  CG2 . ILE A 1 171 ? 64.351 -63.545  209.770 1.00 52.22  ? 171  ILE A CG2 1 
ATOM   1177 C  CD1 . ILE A 1 171 ? 64.977 -66.250  208.474 1.00 55.16  ? 171  ILE A CD1 1 
ATOM   1178 N  N   . ILE A 1 172 ? 66.214 -60.668  210.272 1.00 58.77  ? 172  ILE A N   1 
ATOM   1179 C  CA  . ILE A 1 172 ? 66.371 -59.762  211.397 1.00 60.30  ? 172  ILE A CA  1 
ATOM   1180 C  C   . ILE A 1 172 ? 65.052 -59.559  212.067 1.00 59.86  ? 172  ILE A C   1 
ATOM   1181 O  O   . ILE A 1 172 ? 64.012 -59.845  211.474 1.00 59.39  ? 172  ILE A O   1 
ATOM   1182 C  CB  . ILE A 1 172 ? 66.996 -58.365  210.971 1.00 63.21  ? 172  ILE A CB  1 
ATOM   1183 C  CG1 . ILE A 1 172 ? 66.111 -57.671  209.933 1.00 62.68  ? 172  ILE A CG1 1 
ATOM   1184 C  CG2 . ILE A 1 172 ? 68.426 -58.570  210.440 1.00 61.97  ? 172  ILE A CG2 1 
ATOM   1185 C  CD1 . ILE A 1 172 ? 66.313 -56.199  209.828 1.00 64.00  ? 172  ILE A CD1 1 
ATOM   1186 N  N   . GLU A 1 173 ? 65.079 -59.066  213.302 1.00 61.44  ? 173  GLU A N   1 
ATOM   1187 C  CA  . GLU A 1 173 ? 63.834 -58.773  214.030 1.00 61.99  ? 173  GLU A CA  1 
ATOM   1188 C  C   . GLU A 1 173 ? 62.938 -60.005  214.149 1.00 58.74  ? 173  GLU A C   1 
ATOM   1189 O  O   . GLU A 1 173 ? 61.718 -59.924  214.044 1.00 58.38  ? 173  GLU A O   1 
ATOM   1190 C  CB  . GLU A 1 173 ? 63.084 -57.632  213.358 1.00 63.69  ? 173  GLU A CB  1 
ATOM   1191 C  CG  . GLU A 1 173 ? 63.899 -56.334  213.367 1.00 72.60  ? 173  GLU A CG  1 
ATOM   1192 C  CD  . GLU A 1 173 ? 63.295 -55.241  212.492 1.00 80.52  ? 173  GLU A CD  1 
ATOM   1193 O  OE1 . GLU A 1 173 ? 62.033 -55.173  212.401 1.00 83.25  ? 173  GLU A OE1 1 
ATOM   1194 O  OE2 . GLU A 1 173 ? 64.084 -54.457  211.899 1.00 84.08  ? 173  GLU A OE2 1 
ATOM   1195 N  N   . ALA A 1 174 ? 63.588 -61.135  214.390 1.00 57.27  ? 174  ALA A N   1 
ATOM   1196 C  CA  . ALA A 1 174 ? 62.977 -62.451  214.456 1.00 54.43  ? 174  ALA A CA  1 
ATOM   1197 C  C   . ALA A 1 174 ? 62.436 -62.744  215.862 1.00 53.69  ? 174  ALA A C   1 
ATOM   1198 O  O   . ALA A 1 174 ? 63.004 -62.334  216.886 1.00 53.70  ? 174  ALA A O   1 
ATOM   1199 C  CB  . ALA A 1 174 ? 64.012 -63.501  214.058 1.00 53.59  ? 174  ALA A CB  1 
ATOM   1200 N  N   . ASP A 1 175 ? 61.318 -63.444  215.912 1.00 52.45  ? 175  ASP A N   1 
ATOM   1201 C  CA  . ASP A 1 175 ? 60.760 -63.816  217.198 1.00 53.10  ? 175  ASP A CA  1 
ATOM   1202 C  C   . ASP A 1 175 ? 60.167 -65.197  217.064 1.00 50.37  ? 175  ASP A C   1 
ATOM   1203 O  O   . ASP A 1 175 ? 59.933 -65.707  215.952 1.00 49.80  ? 175  ASP A O   1 
ATOM   1204 C  CB  . ASP A 1 175 ? 59.698 -62.826  217.645 1.00 54.76  ? 175  ASP A CB  1 
ATOM   1205 C  CG  . ASP A 1 175 ? 58.721 -62.571  216.574 1.00 59.53  ? 175  ASP A CG  1 
ATOM   1206 O  OD1 . ASP A 1 175 ? 58.254 -63.572  215.984 1.00 62.58  ? 175  ASP A OD1 1 
ATOM   1207 O  OD2 . ASP A 1 175 ? 58.453 -61.382  216.273 1.00 70.22  ? 175  ASP A OD2 1 
ATOM   1208 N  N   . VAL A 1 176 ? 59.944 -65.815  218.195 1.00 48.28  ? 176  VAL A N   1 
ATOM   1209 C  CA  . VAL A 1 176 ? 59.467 -67.149  218.152 1.00 47.33  ? 176  VAL A CA  1 
ATOM   1210 C  C   . VAL A 1 176 ? 58.428 -67.293  219.230 1.00 47.02  ? 176  VAL A C   1 
ATOM   1211 O  O   . VAL A 1 176 ? 58.496 -66.651  220.269 1.00 46.53  ? 176  VAL A O   1 
ATOM   1212 C  CB  . VAL A 1 176 ? 60.634 -68.163  218.336 1.00 47.27  ? 176  VAL A CB  1 
ATOM   1213 C  CG1 . VAL A 1 176 ? 61.270 -67.988  219.685 1.00 48.60  ? 176  VAL A CG1 1 
ATOM   1214 C  CG2 . VAL A 1 176 ? 60.134 -69.573  218.199 1.00 47.95  ? 176  VAL A CG2 1 
ATOM   1215 N  N   . HIS A 1 177 ? 57.428 -68.104  218.950 1.00 47.03  ? 177  HIS A N   1 
ATOM   1216 C  CA  A HIS A 1 177 ? 56.383 -68.392  219.929 0.40 47.33  ? 177  HIS A CA  1 
ATOM   1217 C  CA  B HIS A 1 177 ? 56.332 -68.369  219.886 0.37 47.48  ? 177  HIS A CA  1 
ATOM   1218 C  CA  C HIS A 1 177 ? 56.396 -68.386  219.929 0.23 47.53  ? 177  HIS A CA  1 
ATOM   1219 C  C   . HIS A 1 177 ? 56.311 -69.899  220.116 1.00 47.08  ? 177  HIS A C   1 
ATOM   1220 O  O   . HIS A 1 177 ? 56.195 -70.661  219.147 1.00 47.83  ? 177  HIS A O   1 
ATOM   1221 C  CB  A HIS A 1 177 ? 55.023 -67.849  219.482 0.40 47.64  ? 177  HIS A CB  1 
ATOM   1222 C  CB  B HIS A 1 177 ? 55.022 -67.881  219.240 0.37 47.83  ? 177  HIS A CB  1 
ATOM   1223 C  CB  C HIS A 1 177 ? 55.071 -67.794  219.459 0.23 48.07  ? 177  HIS A CB  1 
ATOM   1224 C  CG  A HIS A 1 177 ? 54.795 -66.413  219.834 0.40 47.74  ? 177  HIS A CG  1 
ATOM   1225 C  CG  B HIS A 1 177 ? 53.974 -67.411  220.207 0.37 48.46  ? 177  HIS A CG  1 
ATOM   1226 C  CG  C HIS A 1 177 ? 55.239 -66.607  218.562 0.23 49.04  ? 177  HIS A CG  1 
ATOM   1227 N  ND1 A HIS A 1 177 ? 54.975 -65.922  221.110 0.40 48.14  ? 177  HIS A ND1 1 
ATOM   1228 N  ND1 B HIS A 1 177 ? 52.634 -67.343  219.872 0.37 48.41  ? 177  HIS A ND1 1 
ATOM   1229 N  ND1 C HIS A 1 177 ? 55.827 -65.434  218.983 0.23 50.95  ? 177  HIS A ND1 1 
ATOM   1230 C  CD2 A HIS A 1 177 ? 54.369 -65.368  219.087 0.40 48.82  ? 177  HIS A CD2 1 
ATOM   1231 C  CD2 B HIS A 1 177 ? 54.063 -66.969  221.484 0.37 48.75  ? 177  HIS A CD2 1 
ATOM   1232 C  CD2 C HIS A 1 177 ? 54.921 -66.421  217.258 0.23 49.66  ? 177  HIS A CD2 1 
ATOM   1233 C  CE1 A HIS A 1 177 ? 54.696 -64.631  221.129 0.40 48.78  ? 177  HIS A CE1 1 
ATOM   1234 C  CE1 B HIS A 1 177 ? 51.944 -66.895  220.903 0.37 48.16  ? 177  HIS A CE1 1 
ATOM   1235 C  CE1 C HIS A 1 177 ? 55.848 -64.571  217.982 0.23 52.01  ? 177  HIS A CE1 1 
ATOM   1236 N  NE2 A HIS A 1 177 ? 54.327 -64.269  219.914 0.40 49.83  ? 177  HIS A NE2 1 
ATOM   1237 N  NE2 B HIS A 1 177 ? 52.786 -66.661  221.895 0.37 48.61  ? 177  HIS A NE2 1 
ATOM   1238 N  NE2 C HIS A 1 177 ? 55.306 -65.146  216.923 0.23 50.77  ? 177  HIS A NE2 1 
ATOM   1239 N  N   . LEU A 1 178 ? 56.425 -70.351  221.355 1.00 46.39  ? 178  LEU A N   1 
ATOM   1240 C  CA  . LEU A 1 178 ? 56.323 -71.776  221.612 1.00 45.54  ? 178  LEU A CA  1 
ATOM   1241 C  C   . LEU A 1 178 ? 55.033 -72.022  222.379 1.00 45.69  ? 178  LEU A C   1 
ATOM   1242 O  O   . LEU A 1 178 ? 54.849 -71.434  223.445 1.00 47.64  ? 178  LEU A O   1 
ATOM   1243 C  CB  . LEU A 1 178 ? 57.538 -72.234  222.402 1.00 45.80  ? 178  LEU A CB  1 
ATOM   1244 C  CG  . LEU A 1 178 ? 57.558 -73.701  222.830 1.00 47.82  ? 178  LEU A CG  1 
ATOM   1245 C  CD1 . LEU A 1 178 ? 57.374 -74.639  221.616 1.00 47.90  ? 178  LEU A CD1 1 
ATOM   1246 C  CD2 . LEU A 1 178 ? 58.825 -74.057  223.608 1.00 47.25  ? 178  LEU A CD2 1 
ATOM   1247 N  N   . VAL A 1 179 ? 54.123 -72.837  221.858 1.00 44.44  ? 179  VAL A N   1 
ATOM   1248 C  CA  . VAL A 1 179 ? 52.786 -72.994  222.474 1.00 44.77  ? 179  VAL A CA  1 
ATOM   1249 C  C   . VAL A 1 179 ? 52.427 -74.466  222.788 1.00 45.17  ? 179  VAL A C   1 
ATOM   1250 O  O   . VAL A 1 179 ? 52.552 -75.358  221.927 1.00 45.02  ? 179  VAL A O   1 
ATOM   1251 C  CB  . VAL A 1 179 ? 51.661 -72.451  221.517 1.00 46.19  ? 179  VAL A CB  1 
ATOM   1252 C  CG1 . VAL A 1 179 ? 50.321 -72.440  222.199 1.00 47.20  ? 179  VAL A CG1 1 
ATOM   1253 C  CG2 . VAL A 1 179 ? 51.960 -71.032  221.042 1.00 45.63  ? 179  VAL A CG2 1 
ATOM   1254 N  N   . LEU A 1 180 ? 52.002 -74.732  224.014 1.00 44.88  ? 180  LEU A N   1 
ATOM   1255 C  CA  . LEU A 1 180 ? 51.479 -76.039  224.386 1.00 45.48  ? 180  LEU A CA  1 
ATOM   1256 C  C   . LEU A 1 180 ? 50.004 -76.164  223.927 1.00 47.18  ? 180  LEU A C   1 
ATOM   1257 O  O   . LEU A 1 180 ? 49.208 -75.216  224.081 1.00 48.48  ? 180  LEU A O   1 
ATOM   1258 C  CB  . LEU A 1 180 ? 51.584 -76.179  225.913 1.00 45.20  ? 180  LEU A CB  1 
ATOM   1259 C  CG  . LEU A 1 180 ? 50.878 -77.389  226.547 1.00 47.86  ? 180  LEU A CG  1 
ATOM   1260 C  CD1 . LEU A 1 180 ? 51.587 -78.711  226.225 1.00 46.33  ? 180  LEU A CD1 1 
ATOM   1261 C  CD2 . LEU A 1 180 ? 50.661 -77.275  228.044 1.00 44.56  ? 180  LEU A CD2 1 
ATOM   1262 N  N   . VAL A 1 181 ? 49.617 -77.287  223.341 1.00 48.10  ? 181  VAL A N   1 
ATOM   1263 C  CA  . VAL A 1 181 ? 48.181 -77.558  223.146 1.00 50.21  ? 181  VAL A CA  1 
ATOM   1264 C  C   . VAL A 1 181 ? 47.869 -78.858  223.814 1.00 52.08  ? 181  VAL A C   1 
ATOM   1265 O  O   . VAL A 1 181 ? 48.464 -79.871  223.464 1.00 52.39  ? 181  VAL A O   1 
ATOM   1266 C  CB  . VAL A 1 181 ? 47.782 -77.764  221.665 1.00 51.14  ? 181  VAL A CB  1 
ATOM   1267 C  CG1 . VAL A 1 181 ? 46.263 -77.748  221.530 1.00 51.33  ? 181  VAL A CG1 1 
ATOM   1268 C  CG2 . VAL A 1 181 ? 48.404 -76.680  220.759 1.00 49.88  ? 181  VAL A CG2 1 
ATOM   1269 N  N   . ARG A 1 182 ? 46.952 -78.842  224.772 1.00 53.97  ? 182  ARG A N   1 
ATOM   1270 C  CA  . ARG A 1 182 ? 46.507 -80.057  225.387 1.00 56.75  ? 182  ARG A CA  1 
ATOM   1271 C  C   . ARG A 1 182 ? 45.018 -80.074  225.719 1.00 60.02  ? 182  ARG A C   1 
ATOM   1272 O  O   . ARG A 1 182 ? 44.347 -79.018  225.752 1.00 59.71  ? 182  ARG A O   1 
ATOM   1273 C  CB  . ARG A 1 182 ? 47.302 -80.321  226.648 1.00 56.36  ? 182  ARG A CB  1 
ATOM   1274 C  CG  . ARG A 1 182 ? 47.030 -79.395  227.773 1.00 58.72  ? 182  ARG A CG  1 
ATOM   1275 C  CD  . ARG A 1 182 ? 47.914 -79.781  228.981 1.00 61.41  ? 182  ARG A CD  1 
ATOM   1276 N  NE  . ARG A 1 182 ? 47.910 -78.733  230.008 1.00 63.49  ? 182  ARG A NE  1 
ATOM   1277 C  CZ  . ARG A 1 182 ? 48.846 -78.602  230.943 1.00 63.67  ? 182  ARG A CZ  1 
ATOM   1278 N  NH1 . ARG A 1 182 ? 49.882 -79.437  231.003 1.00 63.05  ? 182  ARG A NH1 1 
ATOM   1279 N  NH2 . ARG A 1 182 ? 48.743 -77.621  231.817 1.00 64.61  ? 182  ARG A NH2 1 
ATOM   1280 N  N   . SER A 1 183 ? 44.524 -81.281  226.003 1.00 61.64  ? 183  SER A N   1 
ATOM   1281 C  CA  . SER A 1 183 ? 43.142 -81.483  226.403 1.00 64.19  ? 183  SER A CA  1 
ATOM   1282 C  C   . SER A 1 183 ? 42.969 -81.264  227.885 1.00 64.33  ? 183  SER A C   1 
ATOM   1283 O  O   . SER A 1 183 ? 43.682 -81.845  228.708 1.00 63.99  ? 183  SER A O   1 
ATOM   1284 C  CB  . SER A 1 183 ? 42.694 -82.915  226.080 1.00 66.20  ? 183  SER A CB  1 
ATOM   1285 O  OG  . SER A 1 183 ? 42.802 -83.188  224.691 1.00 68.97  ? 183  SER A OG  1 
ATOM   1286 N  N   . GLU A 1 184 ? 41.979 -80.462  228.232 1.00 65.51  ? 184  GLU A N   1 
ATOM   1287 C  CA  . GLU A 1 184 ? 41.697 -80.235  229.622 1.00 66.18  ? 184  GLU A CA  1 
ATOM   1288 C  C   . GLU A 1 184 ? 40.215 -80.416  229.921 1.00 68.50  ? 184  GLU A C   1 
ATOM   1289 O  O   . GLU A 1 184 ? 39.374 -80.455  229.013 1.00 69.80  ? 184  GLU A O   1 
ATOM   1290 C  CB  . GLU A 1 184 ? 42.216 -78.858  230.002 1.00 65.44  ? 184  GLU A CB  1 
ATOM   1291 C  CG  . GLU A 1 184 ? 43.735 -78.761  229.841 1.00 66.28  ? 184  GLU A CG  1 
ATOM   1292 C  CD  . GLU A 1 184 ? 44.321 -77.432  230.328 1.00 71.67  ? 184  GLU A CD  1 
ATOM   1293 O  OE1 . GLU A 1 184 ? 43.522 -76.609  230.869 1.00 74.00  ? 184  GLU A OE1 1 
ATOM   1294 O  OE2 . GLU A 1 184 ? 45.573 -77.218  230.161 1.00 69.65  ? 184  GLU A OE2 1 
ATOM   1295 N  N   . ILE A 1 185 ? 39.904 -80.585  231.201 1.00 69.72  ? 185  ILE A N   1 
ATOM   1296 C  CA  . ILE A 1 185 ? 38.534 -80.761  231.646 1.00 72.24  ? 185  ILE A CA  1 
ATOM   1297 C  C   . ILE A 1 185 ? 38.135 -79.555  232.495 1.00 72.26  ? 185  ILE A C   1 
ATOM   1298 O  O   . ILE A 1 185 ? 38.788 -79.255  233.497 1.00 72.27  ? 185  ILE A O   1 
ATOM   1299 C  CB  . ILE A 1 185 ? 38.419 -82.041  232.488 1.00 74.73  ? 185  ILE A CB  1 
ATOM   1300 C  CG1 . ILE A 1 185 ? 38.924 -83.238  231.677 1.00 76.29  ? 185  ILE A CG1 1 
ATOM   1301 C  CG2 . ILE A 1 185 ? 36.988 -82.263  232.959 1.00 77.01  ? 185  ILE A CG2 1 
ATOM   1302 C  CD1 . ILE A 1 185 ? 39.108 -84.523  232.496 1.00 79.94  ? 185  ILE A CD1 1 
ATOM   1303 N  N   . SER A 1 186 ? 37.084 -78.854  232.109 1.00 72.70  ? 186  SER A N   1 
ATOM   1304 C  CA  . SER A 1 186 ? 36.650 -77.734  232.921 1.00 73.97  ? 186  SER A CA  1 
ATOM   1305 C  C   . SER A 1 186 ? 35.873 -78.179  234.172 1.00 77.42  ? 186  SER A C   1 
ATOM   1306 O  O   . SER A 1 186 ? 35.420 -79.330  234.265 1.00 78.76  ? 186  SER A O   1 
ATOM   1307 C  CB  . SER A 1 186 ? 35.788 -76.780  232.089 1.00 74.67  ? 186  SER A CB  1 
ATOM   1308 O  OG  . SER A 1 186 ? 34.506 -77.317  231.815 1.00 74.39  ? 186  SER A OG  1 
ATOM   1309 N  N   . GLN A 1 187 ? 35.703 -77.253  235.116 1.00 78.90  ? 187  GLN A N   1 
ATOM   1310 C  CA  . GLN A 1 187 ? 34.853 -77.484  236.285 1.00 82.66  ? 187  GLN A CA  1 
ATOM   1311 C  C   . GLN A 1 187 ? 33.456 -77.951  235.873 1.00 85.13  ? 187  GLN A C   1 
ATOM   1312 O  O   . GLN A 1 187 ? 32.806 -78.718  236.576 1.00 88.22  ? 187  GLN A O   1 
ATOM   1313 C  CB  . GLN A 1 187 ? 34.704 -76.216  237.134 1.00 84.01  ? 187  GLN A CB  1 
ATOM   1314 C  CG  . GLN A 1 187 ? 36.009 -75.573  237.683 1.00 84.87  ? 187  GLN A CG  1 
ATOM   1315 C  CD  . GLN A 1 187 ? 35.700 -74.413  238.638 1.00 89.71  ? 187  GLN A CD  1 
ATOM   1316 O  OE1 . GLN A 1 187 ? 34.541 -74.226  239.058 1.00 94.55  ? 187  GLN A OE1 1 
ATOM   1317 N  NE2 . GLN A 1 187 ? 36.719 -73.636  238.981 1.00 88.95  ? 187  GLN A NE2 1 
ATOM   1318 N  N   . GLU A 1 188 ? 32.972 -77.474  234.745 1.00 84.49  ? 188  GLU A N   1 
ATOM   1319 C  CA  . GLU A 1 188 ? 31.670 -77.914  234.299 1.00 87.21  ? 188  GLU A CA  1 
ATOM   1320 C  C   . GLU A 1 188 ? 31.760 -79.281  233.609 1.00 88.34  ? 188  GLU A C   1 
ATOM   1321 O  O   . GLU A 1 188 ? 30.786 -79.772  233.045 1.00 91.35  ? 188  GLU A O   1 
ATOM   1322 C  CB  . GLU A 1 188 ? 31.032 -76.856  233.403 1.00 87.13  ? 188  GLU A CB  1 
ATOM   1323 C  CG  . GLU A 1 188 ? 30.862 -75.507  234.107 1.00 86.87  ? 188  GLU A CG  1 
ATOM   1324 C  CD  . GLU A 1 188 ? 32.190 -74.739  234.332 1.00 83.70  ? 188  GLU A CD  1 
ATOM   1325 O  OE1 . GLU A 1 188 ? 33.127 -74.842  233.508 1.00 80.50  ? 188  GLU A OE1 1 
ATOM   1326 O  OE2 . GLU A 1 188 ? 32.282 -74.007  235.342 1.00 84.18  ? 188  GLU A OE2 1 
ATOM   1327 N  N   . GLY A 1 189 ? 32.927 -79.909  233.673 1.00 86.53  ? 189  GLY A N   1 
ATOM   1328 C  CA  . GLY A 1 189 ? 33.100 -81.218  233.065 1.00 87.89  ? 189  GLY A CA  1 
ATOM   1329 C  C   . GLY A 1 189 ? 33.081 -81.254  231.546 1.00 87.85  ? 189  GLY A C   1 
ATOM   1330 O  O   . GLY A 1 189 ? 32.707 -82.261  230.943 1.00 90.46  ? 189  GLY A O   1 
ATOM   1331 N  N   . MET A 1 190 ? 33.471 -80.157  230.917 1.00 85.57  ? 190  MET A N   1 
ATOM   1332 C  CA  . MET A 1 190 ? 33.616 -80.144  229.479 1.00 85.96  ? 190  MET A CA  1 
ATOM   1333 C  C   . MET A 1 190 ? 35.081 -80.411  229.114 1.00 82.57  ? 190  MET A C   1 
ATOM   1334 O  O   . MET A 1 190 ? 36.004 -79.901  229.766 1.00 79.22  ? 190  MET A O   1 
ATOM   1335 C  CB  . MET A 1 190 ? 33.142 -78.804  228.905 1.00 86.62  ? 190  MET A CB  1 
ATOM   1336 C  CG  . MET A 1 190 ? 33.609 -78.559  227.470 1.00 89.60  ? 190  MET A CG  1 
ATOM   1337 S  SD  . MET A 1 190 ? 33.403 -76.865  226.820 1.00 97.24  ? 190  MET A SD  1 
ATOM   1338 C  CE  . MET A 1 190 ? 34.826 -75.972  227.469 1.00 92.77  ? 190  MET A CE  1 
ATOM   1339 N  N   . VAL A 1 191 ? 35.291 -81.236  228.091 1.00 83.29  ? 191  VAL A N   1 
ATOM   1340 C  CA  . VAL A 1 191 ? 36.633 -81.471  227.601 1.00 81.00  ? 191  VAL A CA  1 
ATOM   1341 C  C   . VAL A 1 191 ? 36.919 -80.587  226.408 1.00 80.03  ? 191  VAL A C   1 
ATOM   1342 O  O   . VAL A 1 191 ? 36.087 -80.464  225.518 1.00 82.57  ? 191  VAL A O   1 
ATOM   1343 C  CB  . VAL A 1 191 ? 36.871 -82.932  227.204 1.00 83.23  ? 191  VAL A CB  1 
ATOM   1344 C  CG1 . VAL A 1 191 ? 38.161 -83.058  226.360 1.00 80.37  ? 191  VAL A CG1 1 
ATOM   1345 C  CG2 . VAL A 1 191 ? 36.968 -83.803  228.452 1.00 83.95  ? 191  VAL A CG2 1 
ATOM   1346 N  N   . PHE A 1 192 ? 38.099 -79.967  226.393 1.00 76.68  ? 192  PHE A N   1 
ATOM   1347 C  CA  . PHE A 1 192 ? 38.437 -79.013  225.339 1.00 75.85  ? 192  PHE A CA  1 
ATOM   1348 C  C   . PHE A 1 192 ? 39.958 -78.831  225.225 1.00 73.42  ? 192  PHE A C   1 
ATOM   1349 O  O   . PHE A 1 192 ? 40.703 -79.053  226.195 1.00 71.32  ? 192  PHE A O   1 
ATOM   1350 C  CB  . PHE A 1 192 ? 37.758 -77.669  225.618 1.00 75.59  ? 192  PHE A CB  1 
ATOM   1351 C  CG  . PHE A 1 192 ? 38.337 -76.946  226.782 1.00 73.01  ? 192  PHE A CG  1 
ATOM   1352 C  CD1 . PHE A 1 192 ? 39.243 -75.890  226.584 1.00 71.59  ? 192  PHE A CD1 1 
ATOM   1353 C  CD2 . PHE A 1 192 ? 38.033 -77.339  228.084 1.00 70.86  ? 192  PHE A CD2 1 
ATOM   1354 C  CE1 . PHE A 1 192 ? 39.817 -75.202  227.681 1.00 69.90  ? 192  PHE A CE1 1 
ATOM   1355 C  CE2 . PHE A 1 192 ? 38.596 -76.675  229.187 1.00 71.52  ? 192  PHE A CE2 1 
ATOM   1356 C  CZ  . PHE A 1 192 ? 39.497 -75.594  228.989 1.00 70.02  ? 192  PHE A CZ  1 
ATOM   1357 N  N   . ARG A 1 193 ? 40.416 -78.440  224.039 1.00 73.86  ? 193  ARG A N   1 
ATOM   1358 C  CA  . ARG A 1 193 ? 41.840 -78.218  223.825 1.00 72.67  ? 193  ARG A CA  1 
ATOM   1359 C  C   . ARG A 1 193 ? 42.125 -76.766  224.094 1.00 72.63  ? 193  ARG A C   1 
ATOM   1360 O  O   . ARG A 1 193 ? 41.390 -75.909  223.664 1.00 75.40  ? 193  ARG A O   1 
ATOM   1361 C  CB  . ARG A 1 193 ? 42.269 -78.593  222.415 1.00 73.45  ? 193  ARG A CB  1 
ATOM   1362 C  CG  . ARG A 1 193 ? 41.805 -79.984  221.964 1.00 74.91  ? 193  ARG A CG  1 
ATOM   1363 C  CD  . ARG A 1 193 ? 42.847 -81.012  222.256 1.00 75.68  ? 193  ARG A CD  1 
ATOM   1364 N  NE  . ARG A 1 193 ? 44.132 -80.668  221.647 1.00 75.76  ? 193  ARG A NE  1 
ATOM   1365 C  CZ  . ARG A 1 193 ? 45.271 -81.316  221.898 1.00 74.34  ? 193  ARG A CZ  1 
ATOM   1366 N  NH1 . ARG A 1 193 ? 45.290 -82.328  222.741 1.00 75.08  ? 193  ARG A NH1 1 
ATOM   1367 N  NH2 . ARG A 1 193 ? 46.396 -80.954  221.312 1.00 74.45  ? 193  ARG A NH2 1 
ATOM   1368 N  N   . ARG A 1 194 ? 43.170 -76.493  224.850 1.00 68.94  ? 194  ARG A N   1 
ATOM   1369 C  CA  . ARG A 1 194 ? 43.528 -75.137  225.181 1.00 68.19  ? 194  ARG A CA  1 
ATOM   1370 C  C   . ARG A 1 194 ? 45.009 -74.862  224.840 1.00 65.99  ? 194  ARG A C   1 
ATOM   1371 O  O   . ARG A 1 194 ? 45.884 -75.744  224.988 1.00 64.87  ? 194  ARG A O   1 
ATOM   1372 C  CB  . ARG A 1 194 ? 43.274 -74.911  226.664 1.00 69.43  ? 194  ARG A CB  1 
ATOM   1373 C  CG  . ARG A 1 194 ? 44.299 -74.076  227.374 1.00 69.69  ? 194  ARG A CG  1 
ATOM   1374 C  CD  . ARG A 1 194 ? 43.793 -73.741  228.803 1.00 76.32  ? 194  ARG A CD  1 
ATOM   1375 N  NE  . ARG A 1 194 ? 42.818 -72.644  228.800 1.00 79.76  ? 194  ARG A NE  1 
ATOM   1376 C  CZ  . ARG A 1 194 ? 41.921 -72.406  229.761 1.00 83.47  ? 194  ARG A CZ  1 
ATOM   1377 N  NH1 . ARG A 1 194 ? 41.834 -73.221  230.829 1.00 83.69  ? 194  ARG A NH1 1 
ATOM   1378 N  NH2 . ARG A 1 194 ? 41.095 -71.354  229.647 1.00 81.83  ? 194  ARG A NH2 1 
ATOM   1379 N  N   . PHE A 1 195 ? 45.283 -73.639  224.377 1.00 64.52  ? 195  PHE A N   1 
ATOM   1380 C  CA  . PHE A 1 195 ? 46.618 -73.224  224.036 1.00 61.68  ? 195  PHE A CA  1 
ATOM   1381 C  C   . PHE A 1 195 ? 47.278 -72.602  225.249 1.00 59.83  ? 195  PHE A C   1 
ATOM   1382 O  O   . PHE A 1 195 ? 46.615 -71.901  225.967 1.00 60.15  ? 195  PHE A O   1 
ATOM   1383 C  CB  . PHE A 1 195 ? 46.529 -72.244  222.885 1.00 62.54  ? 195  PHE A CB  1 
ATOM   1384 C  CG  . PHE A 1 195 ? 46.003 -72.863  221.625 1.00 67.05  ? 195  PHE A CG  1 
ATOM   1385 C  CD1 . PHE A 1 195 ? 44.733 -73.480  221.607 1.00 71.91  ? 195  PHE A CD1 1 
ATOM   1386 C  CD2 . PHE A 1 195 ? 46.771 -72.854  220.452 1.00 68.12  ? 195  PHE A CD2 1 
ATOM   1387 C  CE1 . PHE A 1 195 ? 44.226 -74.088  220.413 1.00 72.97  ? 195  PHE A CE1 1 
ATOM   1388 C  CE2 . PHE A 1 195 ? 46.295 -73.455  219.265 1.00 69.74  ? 195  PHE A CE2 1 
ATOM   1389 C  CZ  . PHE A 1 195 ? 45.011 -74.071  219.248 1.00 72.67  ? 195  PHE A CZ  1 
ATOM   1390 N  N   . HIS A 1 196 ? 48.555 -72.908  225.521 1.00 57.61  ? 196  HIS A N   1 
ATOM   1391 C  CA  . HIS A 1 196 ? 49.337 -72.114  226.492 1.00 56.89  ? 196  HIS A CA  1 
ATOM   1392 C  C   . HIS A 1 196 ? 50.574 -71.591  225.834 1.00 56.15  ? 196  HIS A C   1 
ATOM   1393 O  O   . HIS A 1 196 ? 51.310 -72.339  225.238 1.00 56.13  ? 196  HIS A O   1 
ATOM   1394 C  CB  . HIS A 1 196 ? 49.770 -72.925  227.685 1.00 56.14  ? 196  HIS A CB  1 
ATOM   1395 C  CG  . HIS A 1 196 ? 48.646 -73.584  228.389 1.00 56.98  ? 196  HIS A CG  1 
ATOM   1396 N  ND1 . HIS A 1 196 ? 48.185 -73.152  229.609 1.00 61.37  ? 196  HIS A ND1 1 
ATOM   1397 C  CD2 . HIS A 1 196 ? 47.882 -74.645  228.051 1.00 57.41  ? 196  HIS A CD2 1 
ATOM   1398 C  CE1 . HIS A 1 196 ? 47.181 -73.921  229.994 1.00 60.75  ? 196  HIS A CE1 1 
ATOM   1399 N  NE2 . HIS A 1 196 ? 46.976 -74.831  229.062 1.00 61.07  ? 196  HIS A NE2 1 
ATOM   1400 N  N   . ASP A 1 197 ? 50.788 -70.291  225.911 1.00 57.72  ? 197  ASP A N   1 
ATOM   1401 C  CA  . ASP A 1 197 ? 51.955 -69.688  225.306 1.00 57.69  ? 197  ASP A CA  1 
ATOM   1402 C  C   . ASP A 1 197 ? 52.970 -69.945  226.394 1.00 56.30  ? 197  ASP A C   1 
ATOM   1403 O  O   . ASP A 1 197 ? 52.647 -69.816  227.559 1.00 58.41  ? 197  ASP A O   1 
ATOM   1404 C  CB  . ASP A 1 197 ? 51.743 -68.186  225.033 1.00 59.50  ? 197  ASP A CB  1 
ATOM   1405 C  CG  . ASP A 1 197 ? 52.767 -67.597  223.960 1.00 65.61  ? 197  ASP A CG  1 
ATOM   1406 O  OD1 . ASP A 1 197 ? 53.129 -68.290  222.968 1.00 71.24  ? 197  ASP A OD1 1 
ATOM   1407 O  OD2 . ASP A 1 197 ? 53.214 -66.418  224.087 1.00 70.83  ? 197  ASP A OD2 1 
ATOM   1408 N  N   . LEU A 1 198 ? 54.155 -70.421  226.034 1.00 53.27  ? 198  LEU A N   1 
ATOM   1409 C  CA  . LEU A 1 198 ? 55.162 -70.749  227.008 1.00 50.00  ? 198  LEU A CA  1 
ATOM   1410 C  C   . LEU A 1 198 ? 56.195 -69.615  227.098 1.00 49.33  ? 198  LEU A C   1 
ATOM   1411 O  O   . LEU A 1 198 ? 56.750 -69.133  226.087 1.00 48.11  ? 198  LEU A O   1 
ATOM   1412 C  CB  . LEU A 1 198 ? 55.805 -72.068  226.610 1.00 49.86  ? 198  LEU A CB  1 
ATOM   1413 C  CG  . LEU A 1 198 ? 54.888 -73.314  226.518 1.00 48.39  ? 198  LEU A CG  1 
ATOM   1414 C  CD1 . LEU A 1 198 ? 55.700 -74.513  226.096 1.00 47.50  ? 198  LEU A CD1 1 
ATOM   1415 C  CD2 . LEU A 1 198 ? 54.211 -73.644  227.850 1.00 45.19  ? 198  LEU A CD2 1 
ATOM   1416 N  N   . THR A 1 199 ? 56.467 -69.154  228.302 1.00 48.08  ? 199  THR A N   1 
ATOM   1417 C  CA  . THR A 1 199 ? 57.420 -68.122  228.345 1.00 47.72  ? 199  THR A CA  1 
ATOM   1418 C  C   . THR A 1 199 ? 58.826 -68.687  228.046 1.00 47.31  ? 199  THR A C   1 
ATOM   1419 O  O   . THR A 1 199 ? 59.211 -69.748  228.533 1.00 47.26  ? 199  THR A O   1 
ATOM   1420 C  CB  . THR A 1 199 ? 57.250 -67.213  229.608 1.00 50.30  ? 199  THR A CB  1 
ATOM   1421 O  OG1 . THR A 1 199 ? 57.367 -67.959  230.828 1.00 50.95  ? 199  THR A OG1 1 
ATOM   1422 C  CG2 . THR A 1 199 ? 55.946 -66.399  229.558 1.00 48.45  ? 199  THR A CG2 1 
ATOM   1423 N  N   . LEU A 1 200 ? 59.568 -67.987  227.207 1.00 46.26  ? 200  LEU A N   1 
ATOM   1424 C  CA  . LEU A 1 200 ? 60.845 -68.434  226.755 1.00 45.97  ? 200  LEU A CA  1 
ATOM   1425 C  C   . LEU A 1 200 ? 61.939 -67.702  227.531 1.00 48.12  ? 200  LEU A C   1 
ATOM   1426 O  O   . LEU A 1 200 ? 61.743 -66.608  227.927 1.00 48.51  ? 200  LEU A O   1 
ATOM   1427 C  CB  . LEU A 1 200 ? 60.963 -68.093  225.274 1.00 44.63  ? 200  LEU A CB  1 
ATOM   1428 C  CG  . LEU A 1 200 ? 59.865 -68.754  224.429 1.00 44.33  ? 200  LEU A CG  1 
ATOM   1429 C  CD1 . LEU A 1 200 ? 60.086 -68.522  222.965 1.00 40.08  ? 200  LEU A CD1 1 
ATOM   1430 C  CD2 . LEU A 1 200 ? 59.785 -70.291  224.706 1.00 42.76  ? 200  LEU A CD2 1 
ATOM   1431 N  N   . THR A 1 201 ? 63.125 -68.274  227.728 1.00 50.05  ? 201  THR A N   1 
ATOM   1432 C  CA  . THR A 1 201 ? 64.170 -67.419  228.267 1.00 52.39  ? 201  THR A CA  1 
ATOM   1433 C  C   . THR A 1 201 ? 64.423 -66.254  227.313 1.00 52.37  ? 201  THR A C   1 
ATOM   1434 O  O   . THR A 1 201 ? 64.784 -65.199  227.748 1.00 54.48  ? 201  THR A O   1 
ATOM   1435 C  CB  . THR A 1 201 ? 65.472 -68.151  228.528 1.00 53.50  ? 201  THR A CB  1 
ATOM   1436 O  OG1 . THR A 1 201 ? 66.009 -68.531  227.269 1.00 56.47  ? 201  THR A OG1 1 
ATOM   1437 C  CG2 . THR A 1 201 ? 65.256 -69.395  229.425 1.00 51.38  ? 201  THR A CG2 1 
ATOM   1438 N  N   . ARG A 1 202 ? 64.210 -66.434  226.017 1.00 51.35  ? 202  ARG A N   1 
ATOM   1439 C  CA  . ARG A 1 202 ? 64.406 -65.356  225.065 1.00 51.85  ? 202  ARG A CA  1 
ATOM   1440 C  C   . ARG A 1 202 ? 63.610 -65.650  223.818 1.00 50.68  ? 202  ARG A C   1 
ATOM   1441 O  O   . ARG A 1 202 ? 63.841 -66.641  223.158 1.00 51.08  ? 202  ARG A O   1 
ATOM   1442 C  CB  . ARG A 1 202 ? 65.881 -65.218  224.701 1.00 52.92  ? 202  ARG A CB  1 
ATOM   1443 C  CG  . ARG A 1 202 ? 66.140 -64.524  223.391 1.00 53.94  ? 202  ARG A CG  1 
ATOM   1444 C  CD  . ARG A 1 202 ? 67.578 -63.963  223.294 1.00 56.91  ? 202  ARG A CD  1 
ATOM   1445 N  NE  . ARG A 1 202 ? 68.570 -64.924  222.804 1.00 56.53  ? 202  ARG A NE  1 
ATOM   1446 C  CZ  . ARG A 1 202 ? 68.734 -65.248  221.523 1.00 55.27  ? 202  ARG A CZ  1 
ATOM   1447 N  NH1 . ARG A 1 202 ? 67.966 -64.693  220.576 1.00 55.79  ? 202  ARG A NH1 1 
ATOM   1448 N  NH2 . ARG A 1 202 ? 69.682 -66.109  221.184 1.00 52.71  ? 202  ARG A NH2 1 
ATOM   1449 N  N   . SER A 1 203 ? 62.683 -64.787  223.461 1.00 50.32  ? 203  SER A N   1 
ATOM   1450 C  CA  . SER A 1 203 ? 61.864 -65.079  222.329 1.00 49.48  ? 203  SER A CA  1 
ATOM   1451 C  C   . SER A 1 203 ? 62.116 -64.212  221.093 1.00 50.87  ? 203  SER A C   1 
ATOM   1452 O  O   . SER A 1 203 ? 61.347 -64.277  220.088 1.00 50.20  ? 203  SER A O   1 
ATOM   1453 C  CB  . SER A 1 203 ? 60.414 -65.043  222.733 1.00 48.44  ? 203  SER A CB  1 
ATOM   1454 O  OG  . SER A 1 203 ? 60.156 -63.782  223.166 1.00 50.19  ? 203  SER A OG  1 
ATOM   1455 N  N   . ARG A 1 204 ? 63.222 -63.454  221.131 1.00 52.55  ? 204  ARG A N   1 
ATOM   1456 C  CA  A ARG A 1 204 ? 63.617 -62.551  220.032 0.71 52.69  ? 204  ARG A CA  1 
ATOM   1457 C  CA  B ARG A 1 204 ? 63.592 -62.637  219.985 0.29 53.29  ? 204  ARG A CA  1 
ATOM   1458 C  C   . ARG A 1 204 ? 65.078 -62.752  219.633 1.00 54.20  ? 204  ARG A C   1 
ATOM   1459 O  O   . ARG A 1 204 ? 65.944 -62.986  220.499 1.00 55.12  ? 204  ARG A O   1 
ATOM   1460 C  CB  A ARG A 1 204 ? 63.420 -61.095  220.443 0.71 53.62  ? 204  ARG A CB  1 
ATOM   1461 C  CB  B ARG A 1 204 ? 63.157 -61.184  220.182 0.29 54.67  ? 204  ARG A CB  1 
ATOM   1462 C  CG  A ARG A 1 204 ? 61.958 -60.663  220.506 0.71 52.10  ? 204  ARG A CG  1 
ATOM   1463 C  CG  B ARG A 1 204 ? 62.414 -60.642  218.967 0.29 55.54  ? 204  ARG A CG  1 
ATOM   1464 C  CD  A ARG A 1 204 ? 61.782 -59.316  221.185 0.71 50.60  ? 204  ARG A CD  1 
ATOM   1465 C  CD  B ARG A 1 204 ? 61.415 -59.533  219.298 0.29 56.18  ? 204  ARG A CD  1 
ATOM   1466 N  NE  A ARG A 1 204 ? 62.320 -59.355  222.547 0.71 52.98  ? 204  ARG A NE  1 
ATOM   1467 N  NE  B ARG A 1 204 ? 60.390 -59.435  218.257 0.29 54.74  ? 204  ARG A NE  1 
ATOM   1468 C  CZ  A ARG A 1 204 ? 62.523 -58.284  223.310 0.71 53.51  ? 204  ARG A CZ  1 
ATOM   1469 C  CZ  B ARG A 1 204 ? 60.428 -58.572  217.250 0.29 56.00  ? 204  ARG A CZ  1 
ATOM   1470 N  NH1 A ARG A 1 204 ? 62.235 -57.071  222.840 0.71 51.89  ? 204  ARG A NH1 1 
ATOM   1471 N  NH1 B ARG A 1 204 ? 61.430 -57.713  217.153 0.29 56.93  ? 204  ARG A NH1 1 
ATOM   1472 N  NH2 A ARG A 1 204 ? 63.010 -58.429  224.539 0.71 52.35  ? 204  ARG A NH2 1 
ATOM   1473 N  NH2 B ARG A 1 204 ? 59.456 -58.557  216.348 0.29 55.59  ? 204  ARG A NH2 1 
ATOM   1474 N  N   . SER A 1 205 ? 65.354 -62.638  218.336 1.00 54.12  ? 205  SER A N   1 
ATOM   1475 C  CA  . SER A 1 205 ? 66.699 -62.672  217.841 1.00 55.38  ? 205  SER A CA  1 
ATOM   1476 C  C   . SER A 1 205 ? 66.863 -61.504  216.904 1.00 57.21  ? 205  SER A C   1 
ATOM   1477 O  O   . SER A 1 205 ? 66.150 -61.406  215.890 1.00 57.29  ? 205  SER A O   1 
ATOM   1478 C  CB  . SER A 1 205 ? 66.940 -63.964  217.088 1.00 54.20  ? 205  SER A CB  1 
ATOM   1479 O  OG  . SER A 1 205 ? 68.264 -64.007  216.616 1.00 55.95  ? 205  SER A OG  1 
ATOM   1480 N  N   . PRO A 1 206 ? 67.785 -60.592  217.233 1.00 59.03  ? 206  PRO A N   1 
ATOM   1481 C  CA  . PRO A 1 206 ? 67.974 -59.384  216.439 1.00 60.59  ? 206  PRO A CA  1 
ATOM   1482 C  C   . PRO A 1 206 ? 68.517 -59.707  215.044 1.00 61.21  ? 206  PRO A C   1 
ATOM   1483 O  O   . PRO A 1 206 ? 68.030 -59.169  214.056 1.00 61.29  ? 206  PRO A O   1 
ATOM   1484 C  CB  . PRO A 1 206 ? 68.986 -58.568  217.245 1.00 63.41  ? 206  PRO A CB  1 
ATOM   1485 C  CG  . PRO A 1 206 ? 69.422 -59.429  218.399 1.00 62.74  ? 206  PRO A CG  1 
ATOM   1486 C  CD  . PRO A 1 206 ? 68.714 -60.717  218.361 1.00 60.13  ? 206  PRO A CD  1 
ATOM   1487 N  N   . ILE A 1 207 ? 69.531 -60.571  214.977 1.00 61.79  ? 207  ILE A N   1 
ATOM   1488 C  CA  . ILE A 1 207 ? 70.082 -61.030  213.714 1.00 62.49  ? 207  ILE A CA  1 
ATOM   1489 C  C   . ILE A 1 207 ? 70.118 -62.568  213.701 1.00 60.97  ? 207  ILE A C   1 
ATOM   1490 O  O   . ILE A 1 207 ? 70.986 -63.169  214.313 1.00 61.14  ? 207  ILE A O   1 
ATOM   1491 C  CB  . ILE A 1 207 ? 71.526 -60.553  213.533 1.00 65.31  ? 207  ILE A CB  1 
ATOM   1492 C  CG1 . ILE A 1 207 ? 71.589 -59.089  213.133 1.00 69.84  ? 207  ILE A CG1 1 
ATOM   1493 C  CG2 . ILE A 1 207 ? 72.154 -61.267  212.388 1.00 64.41  ? 207  ILE A CG2 1 
ATOM   1494 C  CD1 . ILE A 1 207 ? 71.849 -58.159  214.240 1.00 74.71  ? 207  ILE A CD1 1 
ATOM   1495 N  N   . PHE A 1 208 ? 69.179 -63.212  213.024 1.00 59.95  ? 208  PHE A N   1 
ATOM   1496 C  CA  . PHE A 1 208 ? 69.141 -64.664  213.029 1.00 59.16  ? 208  PHE A CA  1 
ATOM   1497 C  C   . PHE A 1 208 ? 69.930 -65.172  211.838 1.00 60.74  ? 208  PHE A C   1 
ATOM   1498 O  O   . PHE A 1 208 ? 69.449 -65.142  210.703 1.00 60.60  ? 208  PHE A O   1 
ATOM   1499 C  CB  . PHE A 1 208 ? 67.698 -65.151  212.986 1.00 57.03  ? 208  PHE A CB  1 
ATOM   1500 C  CG  . PHE A 1 208 ? 67.560 -66.658  212.914 1.00 56.95  ? 208  PHE A CG  1 
ATOM   1501 C  CD1 . PHE A 1 208 ? 68.312 -67.473  213.729 1.00 57.57  ? 208  PHE A CD1 1 
ATOM   1502 C  CD2 . PHE A 1 208 ? 66.666 -67.246  212.036 1.00 56.57  ? 208  PHE A CD2 1 
ATOM   1503 C  CE1 . PHE A 1 208 ? 68.190 -68.835  213.661 1.00 59.16  ? 208  PHE A CE1 1 
ATOM   1504 C  CE2 . PHE A 1 208 ? 66.530 -68.628  211.963 1.00 56.59  ? 208  PHE A CE2 1 
ATOM   1505 C  CZ  . PHE A 1 208 ? 67.277 -69.424  212.777 1.00 57.33  ? 208  PHE A CZ  1 
ATOM   1506 N  N   . SER A 1 209 ? 71.156 -65.629  212.069 1.00 62.88  ? 209  SER A N   1 
ATOM   1507 C  CA  . SER A 1 209 ? 71.972 -65.962  210.930 1.00 65.79  ? 209  SER A CA  1 
ATOM   1508 C  C   . SER A 1 209 ? 72.487 -67.379  210.963 1.00 65.67  ? 209  SER A C   1 
ATOM   1509 O  O   . SER A 1 209 ? 72.800 -67.943  209.922 1.00 66.88  ? 209  SER A O   1 
ATOM   1510 C  CB  . SER A 1 209 ? 73.130 -64.984  210.786 1.00 69.04  ? 209  SER A CB  1 
ATOM   1511 O  OG  . SER A 1 209 ? 74.101 -65.283  211.761 1.00 74.58  ? 209  SER A OG  1 
ATOM   1512 N  N   . LEU A 1 210 ? 72.551 -67.984  212.131 1.00 65.18  ? 210  LEU A N   1 
ATOM   1513 C  CA  . LEU A 1 210 ? 73.016 -69.368  212.153 1.00 66.15  ? 210  LEU A CA  1 
ATOM   1514 C  C   . LEU A 1 210 ? 72.038 -70.354  212.770 1.00 63.92  ? 210  LEU A C   1 
ATOM   1515 O  O   . LEU A 1 210 ? 71.220 -70.962  212.077 1.00 63.67  ? 210  LEU A O   1 
ATOM   1516 C  CB  . LEU A 1 210 ? 74.357 -69.480  212.868 1.00 68.48  ? 210  LEU A CB  1 
ATOM   1517 C  CG  . LEU A 1 210 ? 75.570 -68.916  212.142 1.00 72.59  ? 210  LEU A CG  1 
ATOM   1518 C  CD1 . LEU A 1 210 ? 76.733 -68.874  213.109 1.00 75.06  ? 210  LEU A CD1 1 
ATOM   1519 C  CD2 . LEU A 1 210 ? 75.893 -69.756  210.896 1.00 74.60  ? 210  LEU A CD2 1 
ATOM   1520 N  N   . SER A 1 211 ? 72.139 -70.517  214.078 1.00 62.99  ? 211  SER A N   1 
ATOM   1521 C  CA  . SER A 1 211 ? 71.355 -71.502  214.788 1.00 60.95  ? 211  SER A CA  1 
ATOM   1522 C  C   . SER A 1 211 ? 70.829 -70.844  216.043 1.00 59.59  ? 211  SER A C   1 
ATOM   1523 O  O   . SER A 1 211 ? 71.390 -69.846  216.508 1.00 61.62  ? 211  SER A O   1 
ATOM   1524 C  CB  . SER A 1 211 ? 72.244 -72.656  215.189 1.00 62.41  ? 211  SER A CB  1 
ATOM   1525 O  OG  . SER A 1 211 ? 71.440 -73.668  215.731 1.00 62.99  ? 211  SER A OG  1 
ATOM   1526 N  N   . TRP A 1 212 ? 69.769 -71.388  216.620 1.00 56.10  ? 212  TRP A N   1 
ATOM   1527 C  CA  . TRP A 1 212 ? 69.168 -70.722  217.770 1.00 53.26  ? 212  TRP A CA  1 
ATOM   1528 C  C   . TRP A 1 212 ? 68.432 -71.758  218.607 1.00 52.10  ? 212  TRP A C   1 
ATOM   1529 O  O   . TRP A 1 212 ? 67.558 -72.490  218.118 1.00 51.66  ? 212  TRP A O   1 
ATOM   1530 C  CB  . TRP A 1 212 ? 68.294 -69.546  217.287 1.00 52.08  ? 212  TRP A CB  1 
ATOM   1531 C  CG  . TRP A 1 212 ? 67.534 -68.835  218.376 1.00 49.75  ? 212  TRP A CG  1 
ATOM   1532 C  CD1 . TRP A 1 212 ? 67.801 -68.865  219.726 1.00 47.12  ? 212  TRP A CD1 1 
ATOM   1533 C  CD2 . TRP A 1 212 ? 66.397 -67.955  218.214 1.00 45.50  ? 212  TRP A CD2 1 
ATOM   1534 N  NE1 . TRP A 1 212 ? 66.902 -68.075  220.389 1.00 46.00  ? 212  TRP A NE1 1 
ATOM   1535 C  CE2 . TRP A 1 212 ? 66.035 -67.506  219.493 1.00 41.85  ? 212  TRP A CE2 1 
ATOM   1536 C  CE3 . TRP A 1 212 ? 65.663 -67.508  217.109 1.00 44.38  ? 212  TRP A CE3 1 
ATOM   1537 C  CZ2 . TRP A 1 212 ? 64.956 -66.677  219.710 1.00 43.07  ? 212  TRP A CZ2 1 
ATOM   1538 C  CZ3 . TRP A 1 212 ? 64.586 -66.636  217.326 1.00 43.58  ? 212  TRP A CZ3 1 
ATOM   1539 C  CH2 . TRP A 1 212 ? 64.232 -66.247  218.611 1.00 42.79  ? 212  TRP A CH2 1 
ATOM   1540 N  N   . THR A 1 213 ? 68.860 -71.895  219.849 1.00 52.33  ? 213  THR A N   1 
ATOM   1541 C  CA  . THR A 1 213 ? 68.242 -72.831  220.757 1.00 51.68  ? 213  THR A CA  1 
ATOM   1542 C  C   . THR A 1 213 ? 67.223 -72.031  221.577 1.00 51.09  ? 213  THR A C   1 
ATOM   1543 O  O   . THR A 1 213 ? 67.595 -71.139  222.306 1.00 51.69  ? 213  THR A O   1 
ATOM   1544 C  CB  . THR A 1 213 ? 69.325 -73.489  221.652 1.00 53.17  ? 213  THR A CB  1 
ATOM   1545 O  OG1 . THR A 1 213 ? 70.228 -74.216  220.807 1.00 54.98  ? 213  THR A OG1 1 
ATOM   1546 C  CG2 . THR A 1 213 ? 68.718 -74.466  222.643 1.00 49.43  ? 213  THR A CG2 1 
ATOM   1547 N  N   . VAL A 1 214 ? 65.943 -72.316  221.371 1.00 49.94  ? 214  VAL A N   1 
ATOM   1548 C  CA  . VAL A 1 214 ? 64.846 -71.665  222.045 1.00 49.21  ? 214  VAL A CA  1 
ATOM   1549 C  C   . VAL A 1 214 ? 64.541 -72.466  223.291 1.00 49.41  ? 214  VAL A C   1 
ATOM   1550 O  O   . VAL A 1 214 ? 64.602 -73.711  223.267 1.00 49.73  ? 214  VAL A O   1 
ATOM   1551 C  CB  . VAL A 1 214 ? 63.644 -71.642  221.144 1.00 48.12  ? 214  VAL A CB  1 
ATOM   1552 C  CG1 . VAL A 1 214 ? 62.482 -71.029  221.850 1.00 48.66  ? 214  VAL A CG1 1 
ATOM   1553 C  CG2 . VAL A 1 214 ? 63.961 -70.804  219.885 1.00 49.05  ? 214  VAL A CG2 1 
ATOM   1554 N  N   . MET A 1 215 ? 64.230 -71.769  224.390 1.00 49.14  ? 215  MET A N   1 
ATOM   1555 C  CA  . MET A 1 215 ? 64.168 -72.416  225.716 1.00 48.45  ? 215  MET A CA  1 
ATOM   1556 C  C   . MET A 1 215 ? 63.014 -71.971  226.629 1.00 48.30  ? 215  MET A C   1 
ATOM   1557 O  O   . MET A 1 215 ? 62.749 -70.770  226.818 1.00 48.96  ? 215  MET A O   1 
ATOM   1558 C  CB  . MET A 1 215 ? 65.478 -72.205  226.451 1.00 49.42  ? 215  MET A CB  1 
ATOM   1559 C  CG  . MET A 1 215 ? 66.680 -72.747  225.709 1.00 52.02  ? 215  MET A CG  1 
ATOM   1560 S  SD  . MET A 1 215 ? 68.170 -72.612  226.741 1.00 56.63  ? 215  MET A SD  1 
ATOM   1561 C  CE  . MET A 1 215 ? 68.504 -70.838  226.791 1.00 58.43  ? 215  MET A CE  1 
ATOM   1562 N  N   . HIS A 1 216 ? 62.348 -72.953  227.212 1.00 47.18  ? 216  HIS A N   1 
ATOM   1563 C  CA  . HIS A 1 216 ? 61.280 -72.712  228.134 1.00 46.79  ? 216  HIS A CA  1 
ATOM   1564 C  C   . HIS A 1 216 ? 61.608 -73.321  229.489 1.00 47.99  ? 216  HIS A C   1 
ATOM   1565 O  O   . HIS A 1 216 ? 61.468 -74.536  229.674 1.00 47.87  ? 216  HIS A O   1 
ATOM   1566 C  CB  . HIS A 1 216 ? 60.017 -73.354  227.601 1.00 45.12  ? 216  HIS A CB  1 
ATOM   1567 C  CG  . HIS A 1 216 ? 58.882 -73.337  228.582 1.00 46.99  ? 216  HIS A CG  1 
ATOM   1568 N  ND1 . HIS A 1 216 ? 58.320 -74.492  229.105 1.00 46.42  ? 216  HIS A ND1 1 
ATOM   1569 C  CD2 . HIS A 1 216 ? 58.220 -72.306  229.152 1.00 42.99  ? 216  HIS A CD2 1 
ATOM   1570 C  CE1 . HIS A 1 216 ? 57.358 -74.169  229.950 1.00 44.28  ? 216  HIS A CE1 1 
ATOM   1571 N  NE2 . HIS A 1 216 ? 57.271 -72.849  229.987 1.00 44.66  ? 216  HIS A NE2 1 
ATOM   1572 N  N   . PRO A 1 217 ? 62.060 -72.496  230.441 1.00 48.97  ? 217  PRO A N   1 
ATOM   1573 C  CA  . PRO A 1 217 ? 62.353 -73.053  231.740 1.00 50.10  ? 217  PRO A CA  1 
ATOM   1574 C  C   . PRO A 1 217 ? 61.076 -73.591  232.339 1.00 50.61  ? 217  PRO A C   1 
ATOM   1575 O  O   . PRO A 1 217 ? 60.061 -72.912  232.314 1.00 51.34  ? 217  PRO A O   1 
ATOM   1576 C  CB  . PRO A 1 217 ? 62.852 -71.834  232.526 1.00 51.12  ? 217  PRO A CB  1 
ATOM   1577 C  CG  . PRO A 1 217 ? 63.459 -70.955  231.464 1.00 50.12  ? 217  PRO A CG  1 
ATOM   1578 C  CD  . PRO A 1 217 ? 63.242 -71.751  230.228 1.00 49.41  ? 217  PRO A CD  1 
ATOM   1579 N  N   . ILE A 1 218 ? 61.102 -74.806  232.866 1.00 51.46  ? 218  ILE A N   1 
ATOM   1580 C  CA  . ILE A 1 218 ? 59.922 -75.339  233.458 1.00 52.66  ? 218  ILE A CA  1 
ATOM   1581 C  C   . ILE A 1 218 ? 59.986 -74.909  234.910 1.00 56.08  ? 218  ILE A C   1 
ATOM   1582 O  O   . ILE A 1 218 ? 60.577 -75.583  235.713 1.00 57.78  ? 218  ILE A O   1 
ATOM   1583 C  CB  . ILE A 1 218 ? 59.854 -76.867  233.314 1.00 52.23  ? 218  ILE A CB  1 
ATOM   1584 C  CG1 . ILE A 1 218 ? 60.087 -77.244  231.844 1.00 51.38  ? 218  ILE A CG1 1 
ATOM   1585 C  CG2 . ILE A 1 218 ? 58.493 -77.406  233.804 1.00 49.73  ? 218  ILE A CG2 1 
ATOM   1586 C  CD1 . ILE A 1 218 ? 59.893 -78.695  231.511 1.00 49.73  ? 218  ILE A CD1 1 
ATOM   1587 N  N   . ASP A 1 219 ? 59.410 -73.755  235.230 1.00 57.84  ? 219  ASP A N   1 
ATOM   1588 C  CA  . ASP A 1 219 ? 59.402 -73.266  236.589 1.00 60.68  ? 219  ASP A CA  1 
ATOM   1589 C  C   . ASP A 1 219 ? 57.972 -73.378  237.158 1.00 61.42  ? 219  ASP A C   1 
ATOM   1590 O  O   . ASP A 1 219 ? 57.066 -73.870  236.487 1.00 60.50  ? 219  ASP A O   1 
ATOM   1591 C  CB  . ASP A 1 219 ? 59.956 -71.831  236.629 1.00 61.72  ? 219  ASP A CB  1 
ATOM   1592 C  CG  . ASP A 1 219 ? 59.043 -70.820  235.909 1.00 64.05  ? 219  ASP A CG  1 
ATOM   1593 O  OD1 . ASP A 1 219 ? 57.822 -71.115  235.694 1.00 63.93  ? 219  ASP A OD1 1 
ATOM   1594 O  OD2 . ASP A 1 219 ? 59.547 -69.713  235.570 1.00 66.00  ? 219  ASP A OD2 1 
ATOM   1595 N  N   . HIS A 1 220 ? 57.798 -72.964  238.412 1.00 63.56  ? 220  HIS A N   1 
ATOM   1596 C  CA  A HIS A 1 220 ? 56.487 -73.031  239.070 0.49 64.32  ? 220  HIS A CA  1 
ATOM   1597 C  CA  B HIS A 1 220 ? 56.508 -72.943  239.102 0.51 64.50  ? 220  HIS A CA  1 
ATOM   1598 C  C   . HIS A 1 220 ? 55.388 -72.453  238.182 1.00 63.51  ? 220  HIS A C   1 
ATOM   1599 O  O   . HIS A 1 220 ? 54.277 -72.944  238.210 1.00 64.11  ? 220  HIS A O   1 
ATOM   1600 C  CB  A HIS A 1 220 ? 56.487 -72.323  240.436 0.49 66.39  ? 220  HIS A CB  1 
ATOM   1601 C  CB  B HIS A 1 220 ? 56.666 -72.003  240.297 0.51 66.63  ? 220  HIS A CB  1 
ATOM   1602 C  CG  A HIS A 1 220 ? 57.099 -73.128  241.546 0.49 68.36  ? 220  HIS A CG  1 
ATOM   1603 C  CG  B HIS A 1 220 ? 57.851 -71.089  240.162 0.51 68.02  ? 220  HIS A CG  1 
ATOM   1604 N  ND1 A HIS A 1 220 ? 58.410 -72.971  241.946 0.49 69.41  ? 220  HIS A ND1 1 
ATOM   1605 N  ND1 B HIS A 1 220 ? 59.144 -71.563  240.037 0.51 68.54  ? 220  HIS A ND1 1 
ATOM   1606 C  CD2 A HIS A 1 220 ? 56.572 -74.083  242.351 0.49 69.56  ? 220  HIS A CD2 1 
ATOM   1607 C  CD2 B HIS A 1 220 ? 57.938 -69.740  240.078 0.51 69.38  ? 220  HIS A CD2 1 
ATOM   1608 C  CE1 A HIS A 1 220 ? 58.668 -73.803  242.939 0.49 71.02  ? 220  HIS A CE1 1 
ATOM   1609 C  CE1 B HIS A 1 220 ? 59.977 -70.546  239.901 0.51 69.00  ? 220  HIS A CE1 1 
ATOM   1610 N  NE2 A HIS A 1 220 ? 57.571 -74.493  243.200 0.49 71.41  ? 220  HIS A NE2 1 
ATOM   1611 N  NE2 B HIS A 1 220 ? 59.271 -69.427  239.921 0.51 69.93  ? 220  HIS A NE2 1 
ATOM   1612 N  N   . HIS A 1 221 ? 55.696 -71.443  237.376 1.00 62.98  ? 221  HIS A N   1 
ATOM   1613 C  CA  . HIS A 1 221 ? 54.698 -70.823  236.474 1.00 62.29  ? 221  HIS A CA  1 
ATOM   1614 C  C   . HIS A 1 221 ? 54.393 -71.609  235.206 1.00 59.83  ? 221  HIS A C   1 
ATOM   1615 O  O   . HIS A 1 221 ? 53.462 -71.260  234.494 1.00 59.56  ? 221  HIS A O   1 
ATOM   1616 C  CB  . HIS A 1 221 ? 55.156 -69.438  236.028 1.00 62.94  ? 221  HIS A CB  1 
ATOM   1617 C  CG  . HIS A 1 221 ? 55.296 -68.465  237.149 1.00 68.34  ? 221  HIS A CG  1 
ATOM   1618 N  ND1 . HIS A 1 221 ? 54.306 -68.275  238.096 1.00 74.33  ? 221  HIS A ND1 1 
ATOM   1619 C  CD2 . HIS A 1 221 ? 56.311 -67.637  237.486 1.00 71.25  ? 221  HIS A CD2 1 
ATOM   1620 C  CE1 . HIS A 1 221 ? 54.713 -67.375  238.972 1.00 77.63  ? 221  HIS A CE1 1 
ATOM   1621 N  NE2 . HIS A 1 221 ? 55.927 -66.977  238.628 1.00 77.83  ? 221  HIS A NE2 1 
ATOM   1622 N  N   . SER A 1 222 ? 55.185 -72.641  234.907 1.00 57.46  ? 222  SER A N   1 
ATOM   1623 C  CA  . SER A 1 222 ? 55.011 -73.385  233.678 1.00 54.61  ? 222  SER A CA  1 
ATOM   1624 C  C   . SER A 1 222 ? 53.762 -74.248  233.664 1.00 54.59  ? 222  SER A C   1 
ATOM   1625 O  O   . SER A 1 222 ? 53.445 -74.908  234.637 1.00 56.62  ? 222  SER A O   1 
ATOM   1626 C  CB  . SER A 1 222 ? 56.220 -74.270  233.402 1.00 53.67  ? 222  SER A CB  1 
ATOM   1627 O  OG  . SER A 1 222 ? 55.940 -75.041  232.259 1.00 50.70  ? 222  SER A OG  1 
ATOM   1628 N  N   . PRO A 1 223 ? 53.041 -74.268  232.546 1.00 53.46  ? 223  PRO A N   1 
ATOM   1629 C  CA  . PRO A 1 223 ? 51.966 -75.268  232.480 1.00 53.30  ? 223  PRO A CA  1 
ATOM   1630 C  C   . PRO A 1 223 ? 52.479 -76.718  232.370 1.00 53.72  ? 223  PRO A C   1 
ATOM   1631 O  O   . PRO A 1 223 ? 51.672 -77.653  232.402 1.00 54.97  ? 223  PRO A O   1 
ATOM   1632 C  CB  . PRO A 1 223 ? 51.208 -74.889  231.204 1.00 52.06  ? 223  PRO A CB  1 
ATOM   1633 C  CG  . PRO A 1 223 ? 52.131 -74.013  230.450 1.00 51.58  ? 223  PRO A CG  1 
ATOM   1634 C  CD  . PRO A 1 223 ? 52.987 -73.298  231.438 1.00 51.76  ? 223  PRO A CD  1 
ATOM   1635 N  N   . ILE A 1 224 ? 53.775 -76.936  232.185 1.00 52.34  ? 224  ILE A N   1 
ATOM   1636 C  CA  . ILE A 1 224 ? 54.235 -78.300  232.224 1.00 53.05  ? 224  ILE A CA  1 
ATOM   1637 C  C   . ILE A 1 224 ? 55.073 -78.577  233.466 1.00 55.24  ? 224  ILE A C   1 
ATOM   1638 O  O   . ILE A 1 224 ? 55.735 -79.618  233.560 1.00 54.88  ? 224  ILE A O   1 
ATOM   1639 C  CB  . ILE A 1 224 ? 54.943 -78.781  230.928 1.00 52.73  ? 224  ILE A CB  1 
ATOM   1640 C  CG1 . ILE A 1 224 ? 56.133 -77.903  230.561 1.00 51.59  ? 224  ILE A CG1 1 
ATOM   1641 C  CG2 . ILE A 1 224 ? 53.941 -78.875  229.734 1.00 51.88  ? 224  ILE A CG2 1 
ATOM   1642 C  CD1 . ILE A 1 224 ? 57.176 -78.680  229.858 1.00 51.33  ? 224  ILE A CD1 1 
ATOM   1643 N  N   . TYR A 1 225 ? 55.019 -77.659  234.442 1.00 56.50  ? 225  TYR A N   1 
ATOM   1644 C  CA  . TYR A 1 225 ? 55.585 -77.943  235.756 1.00 58.32  ? 225  TYR A CA  1 
ATOM   1645 C  C   . TYR A 1 225 ? 54.957 -79.208  236.325 1.00 60.08  ? 225  TYR A C   1 
ATOM   1646 O  O   . TYR A 1 225 ? 53.742 -79.334  236.362 1.00 60.41  ? 225  TYR A O   1 
ATOM   1647 C  CB  . TYR A 1 225 ? 55.302 -76.797  236.713 1.00 59.67  ? 225  TYR A CB  1 
ATOM   1648 C  CG  . TYR A 1 225 ? 56.081 -76.898  238.002 1.00 60.95  ? 225  TYR A CG  1 
ATOM   1649 C  CD1 . TYR A 1 225 ? 57.452 -76.663  238.017 1.00 62.05  ? 225  TYR A CD1 1 
ATOM   1650 C  CD2 . TYR A 1 225 ? 55.452 -77.218  239.206 1.00 62.88  ? 225  TYR A CD2 1 
ATOM   1651 C  CE1 . TYR A 1 225 ? 58.186 -76.765  239.187 1.00 63.05  ? 225  TYR A CE1 1 
ATOM   1652 C  CE2 . TYR A 1 225 ? 56.175 -77.326  240.385 1.00 63.50  ? 225  TYR A CE2 1 
ATOM   1653 C  CZ  . TYR A 1 225 ? 57.541 -77.092  240.360 1.00 65.69  ? 225  TYR A CZ  1 
ATOM   1654 O  OH  . TYR A 1 225 ? 58.283 -77.180  241.504 1.00 70.34  ? 225  TYR A OH  1 
ATOM   1655 N  N   . GLY A 1 226 ? 55.783 -80.152  236.763 1.00 61.61  ? 226  GLY A N   1 
ATOM   1656 C  CA  . GLY A 1 226 ? 55.284 -81.353  237.416 1.00 62.82  ? 226  GLY A CA  1 
ATOM   1657 C  C   . GLY A 1 226 ? 54.825 -82.410  236.433 1.00 63.06  ? 226  GLY A C   1 
ATOM   1658 O  O   . GLY A 1 226 ? 54.413 -83.482  236.808 1.00 64.71  ? 226  GLY A O   1 
ATOM   1659 N  N   . GLU A 1 227 ? 54.896 -82.112  235.159 1.00 62.23  ? 227  GLU A N   1 
ATOM   1660 C  CA  . GLU A 1 227 ? 54.370 -83.005  234.137 1.00 62.91  ? 227  GLU A CA  1 
ATOM   1661 C  C   . GLU A 1 227 ? 55.427 -84.080  233.797 1.00 63.21  ? 227  GLU A C   1 
ATOM   1662 O  O   . GLU A 1 227 ? 56.620 -83.849  233.919 1.00 63.27  ? 227  GLU A O   1 
ATOM   1663 C  CB  . GLU A 1 227 ? 54.055 -82.138  232.924 1.00 61.23  ? 227  GLU A CB  1 
ATOM   1664 C  CG  . GLU A 1 227 ? 52.732 -82.332  232.262 1.00 63.39  ? 227  GLU A CG  1 
ATOM   1665 C  CD  . GLU A 1 227 ? 51.556 -82.397  233.202 1.00 65.61  ? 227  GLU A CD  1 
ATOM   1666 O  OE1 . GLU A 1 227 ? 51.419 -81.606  234.148 1.00 67.54  ? 227  GLU A OE1 1 
ATOM   1667 O  OE2 . GLU A 1 227 ? 50.729 -83.270  232.967 1.00 68.99  ? 227  GLU A OE2 1 
ATOM   1668 N  N   . THR A 1 228 ? 54.993 -85.264  233.402 1.00 64.54  ? 228  THR A N   1 
ATOM   1669 C  CA  . THR A 1 228 ? 55.924 -86.292  232.957 1.00 65.38  ? 228  THR A CA  1 
ATOM   1670 C  C   . THR A 1 228 ? 55.563 -86.755  231.560 1.00 66.60  ? 228  THR A C   1 
ATOM   1671 O  O   . THR A 1 228 ? 54.506 -86.425  231.000 1.00 66.85  ? 228  THR A O   1 
ATOM   1672 C  CB  . THR A 1 228 ? 55.902 -87.569  233.873 1.00 67.44  ? 228  THR A CB  1 
ATOM   1673 O  OG1 . THR A 1 228 ? 54.573 -88.111  233.921 1.00 67.41  ? 228  THR A OG1 1 
ATOM   1674 C  CG2 . THR A 1 228 ? 56.388 -87.254  235.274 1.00 65.25  ? 228  THR A CG2 1 
ATOM   1675 N  N   . ASP A 1 229 ? 56.436 -87.553  230.995 1.00 68.10  ? 229  ASP A N   1 
ATOM   1676 C  CA  . ASP A 1 229 ? 56.132 -88.133  229.729 1.00 70.15  ? 229  ASP A CA  1 
ATOM   1677 C  C   . ASP A 1 229 ? 54.737 -88.744  229.776 1.00 70.93  ? 229  ASP A C   1 
ATOM   1678 O  O   . ASP A 1 229 ? 53.960 -88.660  228.831 1.00 71.34  ? 229  ASP A O   1 
ATOM   1679 C  CB  . ASP A 1 229 ? 57.155 -89.212  229.414 1.00 72.38  ? 229  ASP A CB  1 
ATOM   1680 C  CG  . ASP A 1 229 ? 57.002 -89.741  228.013 1.00 78.09  ? 229  ASP A CG  1 
ATOM   1681 O  OD1 . ASP A 1 229 ? 55.947 -90.346  227.683 1.00 84.77  ? 229  ASP A OD1 1 
ATOM   1682 O  OD2 . ASP A 1 229 ? 57.937 -89.530  227.219 1.00 85.05  ? 229  ASP A OD2 1 
ATOM   1683 N  N   . GLU A 1 230 ? 54.409 -89.364  230.888 1.00 71.87  ? 230  GLU A N   1 
ATOM   1684 C  CA  . GLU A 1 230 ? 53.164 -90.080  230.944 1.00 73.70  ? 230  GLU A CA  1 
ATOM   1685 C  C   . GLU A 1 230 ? 51.987 -89.115  230.980 1.00 72.00  ? 230  GLU A C   1 
ATOM   1686 O  O   . GLU A 1 230 ? 51.027 -89.303  230.255 1.00 72.63  ? 230  GLU A O   1 
ATOM   1687 C  CB  . GLU A 1 230 ? 53.145 -91.028  232.148 1.00 76.01  ? 230  GLU A CB  1 
ATOM   1688 C  CG  . GLU A 1 230 ? 51.855 -91.819  232.270 1.00 82.08  ? 230  GLU A CG  1 
ATOM   1689 C  CD  . GLU A 1 230 ? 51.654 -92.412  233.688 1.00 89.43  ? 230  GLU A CD  1 
ATOM   1690 O  OE1 . GLU A 1 230 ? 51.617 -91.630  234.678 1.00 89.06  ? 230  GLU A OE1 1 
ATOM   1691 O  OE2 . GLU A 1 230 ? 51.523 -93.660  233.806 1.00 91.83  ? 230  GLU A OE2 1 
ATOM   1692 N  N   . THR A 1 231 ? 52.068 -88.080  231.814 1.00 69.81  ? 231  THR A N   1 
ATOM   1693 C  CA  . THR A 1 231 ? 50.950 -87.145  231.960 1.00 68.96  ? 231  THR A CA  1 
ATOM   1694 C  C   . THR A 1 231 ? 50.756 -86.284  230.708 1.00 67.66  ? 231  THR A C   1 
ATOM   1695 O  O   . THR A 1 231 ? 49.610 -85.951  230.350 1.00 68.37  ? 231  THR A O   1 
ATOM   1696 C  CB  . THR A 1 231 ? 51.062 -86.244  233.222 1.00 68.32  ? 231  THR A CB  1 
ATOM   1697 O  OG1 . THR A 1 231 ? 52.253 -85.444  233.163 1.00 66.93  ? 231  THR A OG1 1 
ATOM   1698 C  CG2 . THR A 1 231 ? 51.086 -87.094  234.476 1.00 68.26  ? 231  THR A CG2 1 
ATOM   1699 N  N   . LEU A 1 232 ? 51.849 -85.953  230.021 1.00 64.97  ? 232  LEU A N   1 
ATOM   1700 C  CA  . LEU A 1 232 ? 51.710 -85.254  228.745 1.00 62.93  ? 232  LEU A CA  1 
ATOM   1701 C  C   . LEU A 1 232 ? 50.976 -86.137  227.757 1.00 64.30  ? 232  LEU A C   1 
ATOM   1702 O  O   . LEU A 1 232 ? 50.112 -85.659  227.033 1.00 63.78  ? 232  LEU A O   1 
ATOM   1703 C  CB  . LEU A 1 232 ? 53.065 -84.793  228.160 1.00 60.20  ? 232  LEU A CB  1 
ATOM   1704 C  CG  . LEU A 1 232 ? 53.913 -83.770  228.925 1.00 57.61  ? 232  LEU A CG  1 
ATOM   1705 C  CD1 . LEU A 1 232 ? 55.068 -83.343  228.043 1.00 56.85  ? 232  LEU A CD1 1 
ATOM   1706 C  CD2 . LEU A 1 232 ? 53.129 -82.555  229.342 1.00 53.04  ? 232  LEU A CD2 1 
ATOM   1707 N  N   . ARG A 1 233 ? 51.348 -87.417  227.696 1.00 66.51  ? 233  ARG A N   1 
ATOM   1708 C  CA  . ARG A 1 233 ? 50.685 -88.360  226.784 1.00 69.50  ? 233  ARG A CA  1 
ATOM   1709 C  C   . ARG A 1 233 ? 49.191 -88.404  227.010 1.00 70.77  ? 233  ARG A C   1 
ATOM   1710 O  O   . ARG A 1 233 ? 48.421 -88.304  226.063 1.00 71.44  ? 233  ARG A O   1 
ATOM   1711 C  CB  . ARG A 1 233 ? 51.230 -89.779  226.913 1.00 71.76  ? 233  ARG A CB  1 
ATOM   1712 C  CG  . ARG A 1 233 ? 52.456 -90.004  226.085 1.00 74.41  ? 233  ARG A CG  1 
ATOM   1713 C  CD  . ARG A 1 233 ? 53.073 -91.404  226.199 1.00 80.20  ? 233  ARG A CD  1 
ATOM   1714 N  NE  . ARG A 1 233 ? 54.387 -91.339  225.556 1.00 83.20  ? 233  ARG A NE  1 
ATOM   1715 C  CZ  . ARG A 1 233 ? 54.565 -91.167  224.242 1.00 84.43  ? 233  ARG A CZ  1 
ATOM   1716 N  NH1 . ARG A 1 233 ? 53.519 -91.077  223.426 1.00 86.64  ? 233  ARG A NH1 1 
ATOM   1717 N  NH2 . ARG A 1 233 ? 55.784 -91.096  223.735 1.00 84.46  ? 233  ARG A NH2 1 
ATOM   1718 N  N   . ASN A 1 234 ? 48.794 -88.551  228.268 1.00 71.37  ? 234  ASN A N   1 
ATOM   1719 C  CA  . ASN A 1 234 ? 47.391 -88.643  228.603 1.00 73.94  ? 234  ASN A CA  1 
ATOM   1720 C  C   . ASN A 1 234 ? 46.579 -87.377  228.293 1.00 72.35  ? 234  ASN A C   1 
ATOM   1721 O  O   . ASN A 1 234 ? 45.387 -87.462  227.998 1.00 74.51  ? 234  ASN A O   1 
ATOM   1722 C  CB  . ASN A 1 234 ? 47.195 -89.121  230.059 1.00 76.00  ? 234  ASN A CB  1 
ATOM   1723 C  CG  . ASN A 1 234 ? 47.707 -90.549  230.286 1.00 81.05  ? 234  ASN A CG  1 
ATOM   1724 O  OD1 . ASN A 1 234 ? 47.734 -91.388  229.363 1.00 85.87  ? 234  ASN A OD1 1 
ATOM   1725 N  ND2 . ASN A 1 234 ? 48.119 -90.833  231.516 1.00 84.20  ? 234  ASN A ND2 1 
ATOM   1726 N  N   . SER A 1 235 ? 47.199 -86.204  228.340 1.00 69.31  ? 235  SER A N   1 
ATOM   1727 C  CA  . SER A 1 235 ? 46.471 -84.979  227.942 1.00 67.77  ? 235  SER A CA  1 
ATOM   1728 C  C   . SER A 1 235 ? 46.556 -84.709  226.433 1.00 66.69  ? 235  SER A C   1 
ATOM   1729 O  O   . SER A 1 235 ? 45.916 -83.789  225.914 1.00 66.96  ? 235  SER A O   1 
ATOM   1730 C  CB  . SER A 1 235 ? 46.893 -83.759  228.772 1.00 65.95  ? 235  SER A CB  1 
ATOM   1731 O  OG  . SER A 1 235 ? 48.306 -83.625  228.833 1.00 64.49  ? 235  SER A OG  1 
ATOM   1732 N  N   . HIS A 1 236 ? 47.285 -85.557  225.719 1.00 65.91  ? 236  HIS A N   1 
ATOM   1733 C  CA  A HIS A 1 236 ? 47.469 -85.421  224.270 0.42 64.91  ? 236  HIS A CA  1 
ATOM   1734 C  CA  B HIS A 1 236 ? 47.377 -85.396  224.278 0.58 65.55  ? 236  HIS A CA  1 
ATOM   1735 C  C   . HIS A 1 236 ? 48.147 -84.111  223.940 1.00 61.96  ? 236  HIS A C   1 
ATOM   1736 O  O   . HIS A 1 236 ? 47.761 -83.377  223.037 1.00 61.82  ? 236  HIS A O   1 
ATOM   1737 C  CB  A HIS A 1 236 ? 46.176 -85.588  223.468 0.42 66.63  ? 236  HIS A CB  1 
ATOM   1738 C  CB  B HIS A 1 236 ? 45.969 -85.373  223.662 0.58 67.32  ? 236  HIS A CB  1 
ATOM   1739 C  CG  A HIS A 1 236 ? 46.417 -85.987  222.042 0.42 67.03  ? 236  HIS A CG  1 
ATOM   1740 C  CG  B HIS A 1 236 ? 45.219 -86.671  223.806 0.58 73.13  ? 236  HIS A CG  1 
ATOM   1741 N  ND1 A HIS A 1 236 ? 45.511 -85.747  221.030 0.42 69.04  ? 236  HIS A ND1 1 
ATOM   1742 N  ND1 B HIS A 1 236 ? 45.419 -87.749  222.965 0.58 76.09  ? 236  HIS A ND1 1 
ATOM   1743 C  CD2 A HIS A 1 236 ? 47.480 -86.593  221.458 0.42 66.18  ? 236  HIS A CD2 1 
ATOM   1744 C  CD2 B HIS A 1 236 ? 44.262 -87.060  224.687 0.58 76.00  ? 236  HIS A CD2 1 
ATOM   1745 C  CE1 A HIS A 1 236 ? 46.003 -86.197  219.887 0.42 69.16  ? 236  HIS A CE1 1 
ATOM   1746 C  CE1 B HIS A 1 236 ? 44.624 -88.744  223.325 0.58 78.24  ? 236  HIS A CE1 1 
ATOM   1747 N  NE2 A HIS A 1 236 ? 47.196 -86.715  220.120 0.42 66.65  ? 236  HIS A NE2 1 
ATOM   1748 N  NE2 B HIS A 1 236 ? 43.911 -88.351  224.365 0.58 78.65  ? 236  HIS A NE2 1 
ATOM   1749 N  N   . SER A 1 237 ? 49.204 -83.852  224.687 1.00 59.32  ? 237  SER A N   1 
ATOM   1750 C  CA  . SER A 1 237 ? 49.962 -82.629  224.570 1.00 55.19  ? 237  SER A CA  1 
ATOM   1751 C  C   . SER A 1 237 ? 50.776 -82.585  223.290 1.00 53.53  ? 237  SER A C   1 
ATOM   1752 O  O   . SER A 1 237 ? 51.508 -83.539  222.972 1.00 54.05  ? 237  SER A O   1 
ATOM   1753 C  CB  . SER A 1 237 ? 50.902 -82.492  225.780 1.00 54.31  ? 237  SER A CB  1 
ATOM   1754 O  OG  . SER A 1 237 ? 50.163 -82.239  226.966 1.00 53.55  ? 237  SER A OG  1 
ATOM   1755 N  N   . GLU A 1 238 ? 50.654 -81.471  222.572 1.00 50.52  ? 238  GLU A N   1 
ATOM   1756 C  CA  . GLU A 1 238 ? 51.501 -81.194  221.442 1.00 48.54  ? 238  GLU A CA  1 
ATOM   1757 C  C   . GLU A 1 238 ? 52.148 -79.820  221.640 1.00 46.60  ? 238  GLU A C   1 
ATOM   1758 O  O   . GLU A 1 238 ? 51.751 -79.063  222.537 1.00 45.44  ? 238  GLU A O   1 
ATOM   1759 C  CB  . GLU A 1 238 ? 50.696 -81.297  220.148 1.00 49.33  ? 238  GLU A CB  1 
ATOM   1760 C  CG  . GLU A 1 238 ? 50.160 -82.730  219.942 1.00 52.84  ? 238  GLU A CG  1 
ATOM   1761 C  CD  . GLU A 1 238 ? 49.461 -82.944  218.614 1.00 56.84  ? 238  GLU A CD  1 
ATOM   1762 O  OE1 . GLU A 1 238 ? 49.278 -81.983  217.857 1.00 59.55  ? 238  GLU A OE1 1 
ATOM   1763 O  OE2 . GLU A 1 238 ? 49.080 -84.085  218.307 1.00 63.67  ? 238  GLU A OE2 1 
ATOM   1764 N  N   . PHE A 1 239 ? 53.185 -79.534  220.858 1.00 44.79  ? 239  PHE A N   1 
ATOM   1765 C  CA  . PHE A 1 239 ? 53.885 -78.270  220.988 1.00 43.68  ? 239  PHE A CA  1 
ATOM   1766 C  C   . PHE A 1 239 ? 53.981 -77.677  219.633 1.00 44.85  ? 239  PHE A C   1 
ATOM   1767 O  O   . PHE A 1 239 ? 54.342 -78.361  218.664 1.00 45.34  ? 239  PHE A O   1 
ATOM   1768 C  CB  . PHE A 1 239 ? 55.272 -78.407  221.629 1.00 42.17  ? 239  PHE A CB  1 
ATOM   1769 C  CG  . PHE A 1 239 ? 55.213 -78.965  223.005 1.00 42.81  ? 239  PHE A CG  1 
ATOM   1770 C  CD1 . PHE A 1 239 ? 55.034 -80.330  223.199 1.00 43.41  ? 239  PHE A CD1 1 
ATOM   1771 C  CD2 . PHE A 1 239 ? 55.243 -78.129  224.107 1.00 42.97  ? 239  PHE A CD2 1 
ATOM   1772 C  CE1 . PHE A 1 239 ? 54.925 -80.833  224.463 1.00 46.86  ? 239  PHE A CE1 1 
ATOM   1773 C  CE2 . PHE A 1 239 ? 55.143 -78.625  225.400 1.00 43.26  ? 239  PHE A CE2 1 
ATOM   1774 C  CZ  . PHE A 1 239 ? 54.985 -79.970  225.591 1.00 44.64  ? 239  PHE A CZ  1 
ATOM   1775 N  N   . LEU A 1 240 ? 53.608 -76.395  219.563 1.00 45.42  ? 240  LEU A N   1 
ATOM   1776 C  CA  . LEU A 1 240 ? 53.474 -75.713  218.313 1.00 45.75  ? 240  LEU A CA  1 
ATOM   1777 C  C   . LEU A 1 240 ? 54.424 -74.514  218.318 1.00 45.31  ? 240  LEU A C   1 
ATOM   1778 O  O   . LEU A 1 240 ? 54.592 -73.839  219.314 1.00 45.00  ? 240  LEU A O   1 
ATOM   1779 C  CB  . LEU A 1 240 ? 52.021 -75.355  218.174 1.00 46.66  ? 240  LEU A CB  1 
ATOM   1780 C  CG  . LEU A 1 240 ? 51.636 -74.459  217.013 1.00 50.54  ? 240  LEU A CG  1 
ATOM   1781 C  CD1 . LEU A 1 240 ? 51.884 -75.225  215.670 1.00 53.71  ? 240  LEU A CD1 1 
ATOM   1782 C  CD2 . LEU A 1 240 ? 50.186 -74.022  217.176 1.00 50.01  ? 240  LEU A CD2 1 
ATOM   1783 N  N   . VAL A 1 241 ? 55.129 -74.288  217.224 1.00 46.11  ? 241  VAL A N   1 
ATOM   1784 C  CA  . VAL A 1 241 ? 56.122 -73.214  217.219 1.00 45.78  ? 241  VAL A CA  1 
ATOM   1785 C  C   . VAL A 1 241 ? 55.863 -72.362  216.006 1.00 45.75  ? 241  VAL A C   1 
ATOM   1786 O  O   . VAL A 1 241 ? 55.712 -72.899  214.902 1.00 47.31  ? 241  VAL A O   1 
ATOM   1787 C  CB  . VAL A 1 241 ? 57.524 -73.773  217.007 1.00 46.48  ? 241  VAL A CB  1 
ATOM   1788 C  CG1 . VAL A 1 241 ? 58.584 -72.687  217.271 1.00 45.82  ? 241  VAL A CG1 1 
ATOM   1789 C  CG2 . VAL A 1 241 ? 57.735 -74.989  217.880 1.00 47.99  ? 241  VAL A CG2 1 
ATOM   1790 N  N   . LEU A 1 242 ? 55.803 -71.053  216.192 1.00 44.86  ? 242  LEU A N   1 
ATOM   1791 C  CA  . LEU A 1 242 ? 55.718 -70.123  215.078 1.00 44.45  ? 242  LEU A CA  1 
ATOM   1792 C  C   . LEU A 1 242 ? 56.961 -69.299  215.149 1.00 43.31  ? 242  LEU A C   1 
ATOM   1793 O  O   . LEU A 1 242 ? 57.375 -68.905  216.236 1.00 42.64  ? 242  LEU A O   1 
ATOM   1794 C  CB  . LEU A 1 242 ? 54.496 -69.209  215.202 1.00 45.34  ? 242  LEU A CB  1 
ATOM   1795 C  CG  . LEU A 1 242 ? 54.421 -68.103  214.124 1.00 48.74  ? 242  LEU A CG  1 
ATOM   1796 C  CD1 . LEU A 1 242 ? 54.138 -68.658  212.666 1.00 49.72  ? 242  LEU A CD1 1 
ATOM   1797 C  CD2 . LEU A 1 242 ? 53.437 -66.934  214.507 1.00 47.40  ? 242  LEU A CD2 1 
ATOM   1798 N  N   . PHE A 1 243 ? 57.586 -69.086  214.000 1.00 43.00  ? 243  PHE A N   1 
ATOM   1799 C  CA  . PHE A 1 243 ? 58.764 -68.239  213.886 1.00 42.45  ? 243  PHE A CA  1 
ATOM   1800 C  C   . PHE A 1 243 ? 58.403 -67.137  212.885 1.00 43.39  ? 243  PHE A C   1 
ATOM   1801 O  O   . PHE A 1 243 ? 57.730 -67.418  211.881 1.00 44.80  ? 243  PHE A O   1 
ATOM   1802 C  CB  . PHE A 1 243 ? 59.930 -69.037  213.320 1.00 41.63  ? 243  PHE A CB  1 
ATOM   1803 C  CG  . PHE A 1 243 ? 61.074 -68.173  212.839 1.00 42.46  ? 243  PHE A CG  1 
ATOM   1804 C  CD1 . PHE A 1 243 ? 62.151 -67.899  213.662 1.00 40.39  ? 243  PHE A CD1 1 
ATOM   1805 C  CD2 . PHE A 1 243 ? 61.062 -67.619  211.562 1.00 42.77  ? 243  PHE A CD2 1 
ATOM   1806 C  CE1 . PHE A 1 243 ? 63.211 -67.099  213.222 1.00 43.86  ? 243  PHE A CE1 1 
ATOM   1807 C  CE2 . PHE A 1 243 ? 62.112 -66.797  211.130 1.00 45.39  ? 243  PHE A CE2 1 
ATOM   1808 C  CZ  . PHE A 1 243 ? 63.192 -66.544  211.965 1.00 44.98  ? 243  PHE A CZ  1 
ATOM   1809 N  N   . THR A 1 244 ? 58.849 -65.907  213.108 1.00 42.81  ? 244  THR A N   1 
ATOM   1810 C  CA  . THR A 1 244 ? 58.663 -64.887  212.067 1.00 44.07  ? 244  THR A CA  1 
ATOM   1811 C  C   . THR A 1 244 ? 59.893 -63.976  212.027 1.00 45.66  ? 244  THR A C   1 
ATOM   1812 O  O   . THR A 1 244 ? 60.643 -63.878  212.994 1.00 45.61  ? 244  THR A O   1 
ATOM   1813 C  CB  . THR A 1 244 ? 57.458 -63.948  212.337 1.00 44.27  ? 244  THR A CB  1 
ATOM   1814 O  OG1 . THR A 1 244 ? 57.719 -63.231  213.536 1.00 43.88  ? 244  THR A OG1 1 
ATOM   1815 C  CG2 . THR A 1 244 ? 56.163 -64.676  212.511 1.00 43.00  ? 244  THR A CG2 1 
ATOM   1816 N  N   . GLY A 1 245 ? 60.112 -63.300  210.912 1.00 47.17  ? 245  GLY A N   1 
ATOM   1817 C  CA  . GLY A 1 245 ? 61.163 -62.325  210.881 1.00 49.46  ? 245  GLY A CA  1 
ATOM   1818 C  C   . GLY A 1 245 ? 61.181 -61.606  209.581 1.00 51.89  ? 245  GLY A C   1 
ATOM   1819 O  O   . GLY A 1 245 ? 60.378 -61.879  208.699 1.00 51.77  ? 245  GLY A O   1 
ATOM   1820 N  N   . HIS A 1 246 ? 62.121 -60.686  209.449 1.00 54.71  ? 246  HIS A N   1 
ATOM   1821 C  CA  . HIS A 1 246 ? 62.243 -59.948  208.223 1.00 57.14  ? 246  HIS A CA  1 
ATOM   1822 C  C   . HIS A 1 246 ? 63.445 -60.542  207.497 1.00 58.72  ? 246  HIS A C   1 
ATOM   1823 O  O   . HIS A 1 246 ? 64.587 -60.472  207.953 1.00 59.08  ? 246  HIS A O   1 
ATOM   1824 C  CB  . HIS A 1 246 ? 62.379 -58.432  208.507 1.00 59.01  ? 246  HIS A CB  1 
ATOM   1825 C  CG  . HIS A 1 246 ? 62.474 -57.598  207.273 1.00 60.49  ? 246  HIS A CG  1 
ATOM   1826 N  ND1 . HIS A 1 246 ? 61.370 -57.246  206.524 1.00 61.03  ? 246  HIS A ND1 1 
ATOM   1827 C  CD2 . HIS A 1 246 ? 63.545 -57.075  206.631 1.00 63.32  ? 246  HIS A CD2 1 
ATOM   1828 C  CE1 . HIS A 1 246 ? 61.756 -56.541  205.474 1.00 62.25  ? 246  HIS A CE1 1 
ATOM   1829 N  NE2 . HIS A 1 246 ? 63.071 -56.417  205.517 1.00 64.41  ? 246  HIS A NE2 1 
ATOM   1830 N  N   . HIS A 1 247 ? 63.174 -61.174  206.369 1.00 60.83  ? 247  HIS A N   1 
ATOM   1831 C  CA  . HIS A 1 247 ? 64.244 -61.695  205.558 1.00 63.60  ? 247  HIS A CA  1 
ATOM   1832 C  C   . HIS A 1 247 ? 64.910 -60.589  204.724 1.00 67.68  ? 247  HIS A C   1 
ATOM   1833 O  O   . HIS A 1 247 ? 64.268 -59.914  203.899 1.00 68.82  ? 247  HIS A O   1 
ATOM   1834 C  CB  . HIS A 1 247 ? 63.762 -62.857  204.680 1.00 62.28  ? 247  HIS A CB  1 
ATOM   1835 C  CG  . HIS A 1 247 ? 64.806 -63.916  204.514 1.00 63.57  ? 247  HIS A CG  1 
ATOM   1836 N  ND1 . HIS A 1 247 ? 66.071 -63.633  204.046 1.00 66.40  ? 247  HIS A ND1 1 
ATOM   1837 C  CD2 . HIS A 1 247 ? 64.806 -65.232  204.827 1.00 61.67  ? 247  HIS A CD2 1 
ATOM   1838 C  CE1 . HIS A 1 247 ? 66.796 -64.734  204.050 1.00 66.06  ? 247  HIS A CE1 1 
ATOM   1839 N  NE2 . HIS A 1 247 ? 66.049 -65.721  204.509 1.00 63.74  ? 247  HIS A NE2 1 
ATOM   1840 N  N   . GLU A 1 248 ? 66.206 -60.399  204.951 1.00 71.25  ? 248  GLU A N   1 
ATOM   1841 C  CA  . GLU A 1 248 ? 66.970 -59.384  204.222 1.00 75.66  ? 248  GLU A CA  1 
ATOM   1842 C  C   . GLU A 1 248 ? 67.180 -59.794  202.776 1.00 77.78  ? 248  GLU A C   1 
ATOM   1843 O  O   . GLU A 1 248 ? 67.166 -58.941  201.884 1.00 79.56  ? 248  GLU A O   1 
ATOM   1844 C  CB  . GLU A 1 248 ? 68.313 -59.115  204.896 1.00 77.15  ? 248  GLU A CB  1 
ATOM   1845 C  CG  . GLU A 1 248 ? 68.182 -58.346  206.199 1.00 77.61  ? 248  GLU A CG  1 
ATOM   1846 C  CD  . GLU A 1 248 ? 69.460 -57.633  206.577 1.00 80.72  ? 248  GLU A CD  1 
ATOM   1847 O  OE1 . GLU A 1 248 ? 70.545 -58.186  206.307 1.00 83.09  ? 248  GLU A OE1 1 
ATOM   1848 O  OE2 . GLU A 1 248 ? 69.385 -56.530  207.149 1.00 81.73  ? 248  GLU A OE2 1 
ATOM   1849 N  N   . ALA A 1 249 ? 67.353 -61.102  202.540 1.00 77.82  ? 249  ALA A N   1 
ATOM   1850 C  CA  . ALA A 1 249 ? 67.435 -61.614  201.164 1.00 79.01  ? 249  ALA A CA  1 
ATOM   1851 C  C   . ALA A 1 249 ? 66.330 -61.023  200.285 1.00 79.74  ? 249  ALA A C   1 
ATOM   1852 O  O   . ALA A 1 249 ? 66.595 -60.540  199.195 1.00 82.06  ? 249  ALA A O   1 
ATOM   1853 C  CB  . ALA A 1 249 ? 67.359 -63.121  201.151 1.00 77.80  ? 249  ALA A CB  1 
ATOM   1854 N  N   . PHE A 1 250 ? 65.094 -61.032  200.783 1.00 78.54  ? 250  PHE A N   1 
ATOM   1855 C  CA  . PHE A 1 250 ? 63.925 -60.672  199.985 1.00 78.72  ? 250  PHE A CA  1 
ATOM   1856 C  C   . PHE A 1 250 ? 63.324 -59.328  200.387 1.00 78.92  ? 250  PHE A C   1 
ATOM   1857 O  O   . PHE A 1 250 ? 62.295 -58.908  199.863 1.00 78.78  ? 250  PHE A O   1 
ATOM   1858 C  CB  . PHE A 1 250 ? 62.849 -61.755  200.140 1.00 77.45  ? 250  PHE A CB  1 
ATOM   1859 C  CG  . PHE A 1 250 ? 63.353 -63.159  199.905 1.00 78.95  ? 250  PHE A CG  1 
ATOM   1860 C  CD1 . PHE A 1 250 ? 63.308 -64.103  200.933 1.00 78.98  ? 250  PHE A CD1 1 
ATOM   1861 C  CD2 . PHE A 1 250 ? 63.879 -63.537  198.657 1.00 81.66  ? 250  PHE A CD2 1 
ATOM   1862 C  CE1 . PHE A 1 250 ? 63.766 -65.399  200.724 1.00 79.55  ? 250  PHE A CE1 1 
ATOM   1863 C  CE2 . PHE A 1 250 ? 64.341 -64.829  198.434 1.00 81.94  ? 250  PHE A CE2 1 
ATOM   1864 C  CZ  . PHE A 1 250 ? 64.279 -65.769  199.469 1.00 81.95  ? 250  PHE A CZ  1 
ATOM   1865 N  N   . ALA A 1 251 ? 63.953 -58.663  201.345 1.00 79.04  ? 251  ALA A N   1 
ATOM   1866 C  CA  . ALA A 1 251 ? 63.388 -57.424  201.874 1.00 79.06  ? 251  ALA A CA  1 
ATOM   1867 C  C   . ALA A 1 251 ? 61.912 -57.586  202.195 1.00 76.96  ? 251  ALA A C   1 
ATOM   1868 O  O   . ALA A 1 251 ? 61.119 -56.694  201.935 1.00 78.52  ? 251  ALA A O   1 
ATOM   1869 C  CB  . ALA A 1 251 ? 63.590 -56.276  200.884 1.00 81.30  ? 251  ALA A CB  1 
ATOM   1870 N  N   . GLN A 1 252 ? 61.530 -58.720  202.752 1.00 74.06  ? 252  GLN A N   1 
ATOM   1871 C  CA  . GLN A 1 252 ? 60.149 -58.859  203.206 1.00 72.28  ? 252  GLN A CA  1 
ATOM   1872 C  C   . GLN A 1 252 ? 59.973 -59.836  204.356 1.00 68.56  ? 252  GLN A C   1 
ATOM   1873 O  O   . GLN A 1 252 ? 60.887 -60.586  204.693 1.00 67.40  ? 252  GLN A O   1 
ATOM   1874 C  CB  . GLN A 1 252 ? 59.228 -59.219  202.051 1.00 73.30  ? 252  GLN A CB  1 
ATOM   1875 C  CG  . GLN A 1 252 ? 59.702 -60.364  201.212 1.00 76.06  ? 252  GLN A CG  1 
ATOM   1876 C  CD  . GLN A 1 252 ? 58.762 -60.606  200.061 1.00 82.78  ? 252  GLN A CD  1 
ATOM   1877 O  OE1 . GLN A 1 252 ? 57.531 -60.497  200.206 1.00 84.86  ? 252  GLN A OE1 1 
ATOM   1878 N  NE2 . GLN A 1 252 ? 59.328 -60.933  198.899 1.00 86.10  ? 252  GLN A NE2 1 
ATOM   1879 N  N   . ASN A 1 253 ? 58.798 -59.818  204.970 1.00 66.14  ? 253  ASN A N   1 
ATOM   1880 C  CA  . ASN A 1 253 ? 58.569 -60.717  206.103 1.00 63.23  ? 253  ASN A CA  1 
ATOM   1881 C  C   . ASN A 1 253 ? 58.322 -62.171  205.751 1.00 60.18  ? 253  ASN A C   1 
ATOM   1882 O  O   . ASN A 1 253 ? 57.589 -62.484  204.805 1.00 60.75  ? 253  ASN A O   1 
ATOM   1883 C  CB  . ASN A 1 253 ? 57.473 -60.196  207.000 1.00 63.23  ? 253  ASN A CB  1 
ATOM   1884 C  CG  . ASN A 1 253 ? 57.869 -58.899  207.670 1.00 67.64  ? 253  ASN A CG  1 
ATOM   1885 O  OD1 . ASN A 1 253 ? 59.067 -58.565  207.784 1.00 71.17  ? 253  ASN A OD1 1 
ATOM   1886 N  ND2 . ASN A 1 253 ? 56.872 -58.143  208.102 1.00 69.01  ? 253  ASN A ND2 1 
ATOM   1887 N  N   . VAL A 1 254 ? 58.942 -63.055  206.530 1.00 56.14  ? 254  VAL A N   1 
ATOM   1888 C  CA  . VAL A 1 254 ? 58.709 -64.474  206.398 1.00 52.47  ? 254  VAL A CA  1 
ATOM   1889 C  C   . VAL A 1 254 ? 58.230 -65.075  207.708 1.00 50.18  ? 254  VAL A C   1 
ATOM   1890 O  O   . VAL A 1 254 ? 58.396 -64.509  208.770 1.00 49.84  ? 254  VAL A O   1 
ATOM   1891 C  CB  . VAL A 1 254 ? 59.978 -65.206  205.911 1.00 52.81  ? 254  VAL A CB  1 
ATOM   1892 C  CG1 . VAL A 1 254 ? 60.354 -64.692  204.516 1.00 53.35  ? 254  VAL A CG1 1 
ATOM   1893 C  CG2 . VAL A 1 254 ? 61.135 -65.056  206.935 1.00 50.25  ? 254  VAL A CG2 1 
ATOM   1894 N  N   . HIS A 1 255 ? 57.649 -66.254  207.630 1.00 48.69  ? 255  HIS A N   1 
ATOM   1895 C  CA  A HIS A 1 255 ? 57.060 -66.932  208.770 0.39 47.58  ? 255  HIS A CA  1 
ATOM   1896 C  CA  B HIS A 1 255 ? 57.249 -66.941  208.844 0.61 47.34  ? 255  HIS A CA  1 
ATOM   1897 C  C   . HIS A 1 255 ? 57.365 -68.431  208.593 1.00 47.11  ? 255  HIS A C   1 
ATOM   1898 O  O   . HIS A 1 255 ? 57.468 -68.886  207.433 1.00 47.84  ? 255  HIS A O   1 
ATOM   1899 C  CB  A HIS A 1 255 ? 55.564 -66.644  208.704 0.39 47.69  ? 255  HIS A CB  1 
ATOM   1900 C  CB  B HIS A 1 255 ? 55.828 -66.598  209.255 0.61 46.82  ? 255  HIS A CB  1 
ATOM   1901 C  CG  A HIS A 1 255 ? 55.260 -65.383  207.948 0.39 48.65  ? 255  HIS A CG  1 
ATOM   1902 C  CG  B HIS A 1 255 ? 54.801 -67.293  208.434 0.61 46.02  ? 255  HIS A CG  1 
ATOM   1903 N  ND1 A HIS A 1 255 ? 54.662 -64.282  208.526 0.39 49.23  ? 255  HIS A ND1 1 
ATOM   1904 N  ND1 B HIS A 1 255 ? 54.238 -66.725  207.311 0.61 47.92  ? 255  HIS A ND1 1 
ATOM   1905 C  CD2 A HIS A 1 255 ? 55.550 -65.024  206.673 0.39 48.03  ? 255  HIS A CD2 1 
ATOM   1906 C  CD2 B HIS A 1 255 ? 54.251 -68.520  208.553 0.61 44.78  ? 255  HIS A CD2 1 
ATOM   1907 C  CE1 A HIS A 1 255 ? 54.577 -63.311  207.634 0.39 48.73  ? 255  HIS A CE1 1 
ATOM   1908 C  CE1 B HIS A 1 255 ? 53.375 -67.569  206.777 0.61 47.88  ? 255  HIS A CE1 1 
ATOM   1909 N  NE2 A HIS A 1 255 ? 55.108 -63.737  206.502 0.39 47.47  ? 255  HIS A NE2 1 
ATOM   1910 N  NE2 B HIS A 1 255 ? 53.356 -68.662  207.519 0.61 48.00  ? 255  HIS A NE2 1 
ATOM   1911 N  N   . ALA A 1 256 ? 57.470 -69.191  209.687 1.00 45.05  ? 256  ALA A N   1 
ATOM   1912 C  CA  . ALA A 1 256 ? 57.635 -70.645  209.561 1.00 44.86  ? 256  ALA A CA  1 
ATOM   1913 C  C   . ALA A 1 256 ? 56.973 -71.336  210.752 1.00 44.55  ? 256  ALA A C   1 
ATOM   1914 O  O   . ALA A 1 256 ? 56.878 -70.759  211.845 1.00 44.10  ? 256  ALA A O   1 
ATOM   1915 C  CB  . ALA A 1 256 ? 59.117 -71.023  209.437 1.00 43.63  ? 256  ALA A CB  1 
ATOM   1916 N  N   . ARG A 1 257 ? 56.480 -72.553  210.564 1.00 44.93  ? 257  ARG A N   1 
ATOM   1917 C  CA  . ARG A 1 257 ? 55.829 -73.226  211.698 1.00 44.88  ? 257  ARG A CA  1 
ATOM   1918 C  C   . ARG A 1 257 ? 56.202 -74.710  211.786 1.00 44.27  ? 257  ARG A C   1 
ATOM   1919 O  O   . ARG A 1 257 ? 56.596 -75.324  210.797 1.00 44.82  ? 257  ARG A O   1 
ATOM   1920 C  CB  . ARG A 1 257 ? 54.324 -73.051  211.592 1.00 45.87  ? 257  ARG A CB  1 
ATOM   1921 C  CG  . ARG A 1 257 ? 53.821 -73.189  210.160 1.00 50.28  ? 257  ARG A CG  1 
ATOM   1922 C  CD  . ARG A 1 257 ? 52.321 -72.811  210.041 1.00 58.03  ? 257  ARG A CD  1 
ATOM   1923 N  NE  . ARG A 1 257 ? 51.901 -72.906  208.638 1.00 65.31  ? 257  ARG A NE  1 
ATOM   1924 C  CZ  . ARG A 1 257 ? 51.626 -74.054  208.004 1.00 68.24  ? 257  ARG A CZ  1 
ATOM   1925 N  NH1 . ARG A 1 257 ? 51.686 -75.211  208.663 1.00 68.81  ? 257  ARG A NH1 1 
ATOM   1926 N  NH2 . ARG A 1 257 ? 51.287 -74.049  206.712 1.00 69.30  ? 257  ARG A NH2 1 
ATOM   1927 N  N   . HIS A 1 258 ? 56.053 -75.298  212.956 1.00 42.70  ? 258  HIS A N   1 
ATOM   1928 C  CA  . HIS A 1 258 ? 56.394 -76.697  213.126 1.00 43.58  ? 258  HIS A CA  1 
ATOM   1929 C  C   . HIS A 1 258 ? 55.641 -77.147  214.356 1.00 44.08  ? 258  HIS A C   1 
ATOM   1930 O  O   . HIS A 1 258 ? 55.238 -76.320  215.200 1.00 44.75  ? 258  HIS A O   1 
ATOM   1931 C  CB  . HIS A 1 258 ? 57.904 -76.822  213.343 1.00 42.29  ? 258  HIS A CB  1 
ATOM   1932 C  CG  . HIS A 1 258 ? 58.431 -78.214  213.249 1.00 45.04  ? 258  HIS A CG  1 
ATOM   1933 N  ND1 . HIS A 1 258 ? 58.847 -78.776  212.055 1.00 46.62  ? 258  HIS A ND1 1 
ATOM   1934 C  CD2 . HIS A 1 258 ? 58.667 -79.150  214.207 1.00 47.47  ? 258  HIS A CD2 1 
ATOM   1935 C  CE1 . HIS A 1 258 ? 59.284 -80.004  212.272 1.00 45.86  ? 258  HIS A CE1 1 
ATOM   1936 N  NE2 . HIS A 1 258 ? 59.187 -80.256  213.570 1.00 48.64  ? 258  HIS A NE2 1 
ATOM   1937 N  N   . ALA A 1 259 ? 55.445 -78.441  214.491 1.00 44.89  ? 259  ALA A N   1 
ATOM   1938 C  CA  . ALA A 1 259 ? 54.764 -78.944  215.658 1.00 44.79  ? 259  ALA A CA  1 
ATOM   1939 C  C   . ALA A 1 259 ? 55.445 -80.240  216.100 1.00 46.16  ? 259  ALA A C   1 
ATOM   1940 O  O   . ALA A 1 259 ? 56.015 -80.961  215.273 1.00 46.92  ? 259  ALA A O   1 
ATOM   1941 C  CB  . ALA A 1 259 ? 53.333 -79.188  215.322 1.00 45.66  ? 259  ALA A CB  1 
ATOM   1942 N  N   . TYR A 1 260 ? 55.388 -80.516  217.395 1.00 46.18  ? 260  TYR A N   1 
ATOM   1943 C  CA  . TYR A 1 260 ? 55.933 -81.723  217.967 1.00 48.35  ? 260  TYR A CA  1 
ATOM   1944 C  C   . TYR A 1 260 ? 54.902 -82.425  218.853 1.00 50.64  ? 260  TYR A C   1 
ATOM   1945 O  O   . TYR A 1 260 ? 54.170 -81.767  219.620 1.00 49.56  ? 260  TYR A O   1 
ATOM   1946 C  CB  . TYR A 1 260 ? 57.105 -81.397  218.877 1.00 47.11  ? 260  TYR A CB  1 
ATOM   1947 C  CG  . TYR A 1 260 ? 58.246 -80.639  218.242 1.00 46.14  ? 260  TYR A CG  1 
ATOM   1948 C  CD1 . TYR A 1 260 ? 58.295 -79.255  218.310 1.00 41.35  ? 260  TYR A CD1 1 
ATOM   1949 C  CD2 . TYR A 1 260 ? 59.299 -81.321  217.611 1.00 42.55  ? 260  TYR A CD2 1 
ATOM   1950 C  CE1 . TYR A 1 260 ? 59.339 -78.574  217.746 1.00 43.37  ? 260  TYR A CE1 1 
ATOM   1951 C  CE2 . TYR A 1 260 ? 60.344 -80.650  217.055 1.00 42.71  ? 260  TYR A CE2 1 
ATOM   1952 C  CZ  . TYR A 1 260 ? 60.370 -79.271  217.128 1.00 43.67  ? 260  TYR A CZ  1 
ATOM   1953 O  OH  . TYR A 1 260 ? 61.413 -78.573  216.583 1.00 41.34  ? 260  TYR A OH  1 
ATOM   1954 N  N   . SER A 1 261 ? 54.899 -83.759  218.800 1.00 53.90  ? 261  SER A N   1 
ATOM   1955 C  CA  . SER A 1 261 ? 54.115 -84.546  219.746 1.00 58.16  ? 261  SER A CA  1 
ATOM   1956 C  C   . SER A 1 261 ? 54.978 -84.926  220.959 1.00 58.88  ? 261  SER A C   1 
ATOM   1957 O  O   . SER A 1 261 ? 56.162 -84.653  220.965 1.00 57.98  ? 261  SER A O   1 
ATOM   1958 C  CB  . SER A 1 261 ? 53.571 -85.801  219.055 1.00 60.26  ? 261  SER A CB  1 
ATOM   1959 O  OG  . SER A 1 261 ? 54.653 -86.596  218.616 1.00 62.86  ? 261  SER A OG  1 
ATOM   1960 N  N   . CYS A 1 262 ? 54.386 -85.557  221.968 1.00 62.15  ? 262  CYS A N   1 
ATOM   1961 C  CA  . CYS A 1 262 ? 55.126 -85.993  223.178 1.00 64.76  ? 262  CYS A CA  1 
ATOM   1962 C  C   . CYS A 1 262 ? 56.282 -86.905  222.865 1.00 65.62  ? 262  CYS A C   1 
ATOM   1963 O  O   . CYS A 1 262 ? 57.308 -86.854  223.525 1.00 65.34  ? 262  CYS A O   1 
ATOM   1964 C  CB  . CYS A 1 262 ? 54.224 -86.816  224.078 1.00 66.57  ? 262  CYS A CB  1 
ATOM   1965 S  SG  . CYS A 1 262 ? 52.958 -85.892  224.749 1.00 71.70  ? 262  CYS A SG  1 
ATOM   1966 N  N   . ASP A 1 263 ? 56.049 -87.790  221.905 1.00 67.51  ? 263  ASP A N   1 
ATOM   1967 C  CA  . ASP A 1 263 ? 57.040 -88.718  221.427 1.00 69.37  ? 263  ASP A CA  1 
ATOM   1968 C  C   . ASP A 1 263 ? 58.342 -88.034  221.126 1.00 67.09  ? 263  ASP A C   1 
ATOM   1969 O  O   . ASP A 1 263 ? 59.396 -88.710  221.104 1.00 69.18  ? 263  ASP A O   1 
ATOM   1970 C  CB  . ASP A 1 263 ? 56.610 -89.303  220.076 1.00 72.05  ? 263  ASP A CB  1 
ATOM   1971 C  CG  . ASP A 1 263 ? 55.365 -90.119  220.170 1.00 78.73  ? 263  ASP A CG  1 
ATOM   1972 O  OD1 . ASP A 1 263 ? 55.323 -91.006  221.047 1.00 83.97  ? 263  ASP A OD1 1 
ATOM   1973 O  OD2 . ASP A 1 263 ? 54.427 -89.867  219.372 1.00 85.62  ? 263  ASP A OD2 1 
ATOM   1974 N  N   . GLU A 1 264 ? 58.282 -86.739  220.794 1.00 62.42  ? 264  GLU A N   1 
ATOM   1975 C  CA  . GLU A 1 264 ? 59.428 -86.121  220.164 1.00 59.40  ? 264  GLU A CA  1 
ATOM   1976 C  C   . GLU A 1 264 ? 60.120 -85.250  221.147 1.00 56.94  ? 264  GLU A C   1 
ATOM   1977 O  O   . GLU A 1 264 ? 60.918 -84.376  220.785 1.00 56.06  ? 264  GLU A O   1 
ATOM   1978 C  CB  . GLU A 1 264 ? 59.016 -85.403  218.906 1.00 58.64  ? 264  GLU A CB  1 
ATOM   1979 C  CG  . GLU A 1 264 ? 57.941 -86.202  218.220 1.00 60.75  ? 264  GLU A CG  1 
ATOM   1980 C  CD  . GLU A 1 264 ? 57.576 -85.698  216.862 1.00 61.81  ? 264  GLU A CD  1 
ATOM   1981 O  OE1 . GLU A 1 264 ? 56.840 -84.702  216.744 1.00 63.81  ? 264  GLU A OE1 1 
ATOM   1982 O  OE2 . GLU A 1 264 ? 57.986 -86.332  215.893 1.00 64.40  ? 264  GLU A OE2 1 
ATOM   1983 N  N   . ILE A 1 265 ? 59.834 -85.511  222.414 1.00 55.06  ? 265  ILE A N   1 
ATOM   1984 C  CA  . ILE A 1 265 ? 60.641 -84.934  223.450 1.00 53.50  ? 265  ILE A CA  1 
ATOM   1985 C  C   . ILE A 1 265 ? 61.593 -85.968  224.011 1.00 54.91  ? 265  ILE A C   1 
ATOM   1986 O  O   . ILE A 1 265 ? 61.155 -87.007  224.492 1.00 56.52  ? 265  ILE A O   1 
ATOM   1987 C  CB  . ILE A 1 265 ? 59.788 -84.420  224.566 1.00 53.11  ? 265  ILE A CB  1 
ATOM   1988 C  CG1 . ILE A 1 265 ? 58.721 -83.477  223.989 1.00 51.47  ? 265  ILE A CG1 1 
ATOM   1989 C  CG2 . ILE A 1 265 ? 60.678 -83.750  225.604 1.00 50.22  ? 265  ILE A CG2 1 
ATOM   1990 C  CD1 . ILE A 1 265 ? 57.926 -82.773  225.074 1.00 50.67  ? 265  ILE A CD1 1 
ATOM   1991 N  N   . ILE A 1 266 ? 62.894 -85.713  223.926 1.00 53.83  ? 266  ILE A N   1 
ATOM   1992 C  CA  . ILE A 1 266 ? 63.830 -86.556  224.595 1.00 54.94  ? 266  ILE A CA  1 
ATOM   1993 C  C   . ILE A 1 266 ? 64.083 -86.017  226.007 1.00 55.37  ? 266  ILE A C   1 
ATOM   1994 O  O   . ILE A 1 266 ? 64.795 -85.022  226.156 1.00 55.54  ? 266  ILE A O   1 
ATOM   1995 C  CB  . ILE A 1 266 ? 65.136 -86.596  223.850 1.00 55.73  ? 266  ILE A CB  1 
ATOM   1996 C  CG1 . ILE A 1 266 ? 64.880 -86.885  222.372 1.00 55.02  ? 266  ILE A CG1 1 
ATOM   1997 C  CG2 . ILE A 1 266 ? 66.050 -87.649  224.483 1.00 57.30  ? 266  ILE A CG2 1 
ATOM   1998 C  CD1 . ILE A 1 266 ? 63.843 -87.952  222.158 1.00 55.32  ? 266  ILE A CD1 1 
ATOM   1999 N  N   . TRP A 1 267 ? 63.467 -86.622  227.026 1.00 55.20  ? 267  TRP A N   1 
ATOM   2000 C  CA  . TRP A 1 267 ? 63.739 -86.257  228.415 1.00 55.92  ? 267  TRP A CA  1 
ATOM   2001 C  C   . TRP A 1 267 ? 65.194 -86.564  228.821 1.00 57.74  ? 267  TRP A C   1 
ATOM   2002 O  O   . TRP A 1 267 ? 65.593 -87.705  228.798 1.00 60.65  ? 267  TRP A O   1 
ATOM   2003 C  CB  . TRP A 1 267 ? 62.807 -87.038  229.314 1.00 55.79  ? 267  TRP A CB  1 
ATOM   2004 C  CG  . TRP A 1 267 ? 61.399 -86.667  229.081 1.00 56.33  ? 267  TRP A CG  1 
ATOM   2005 C  CD1 . TRP A 1 267 ? 60.609 -87.046  228.027 1.00 56.77  ? 267  TRP A CD1 1 
ATOM   2006 C  CD2 . TRP A 1 267 ? 60.587 -85.814  229.902 1.00 55.37  ? 267  TRP A CD2 1 
ATOM   2007 N  NE1 . TRP A 1 267 ? 59.357 -86.496  228.156 1.00 54.38  ? 267  TRP A NE1 1 
ATOM   2008 C  CE2 . TRP A 1 267 ? 59.317 -85.734  229.292 1.00 53.37  ? 267  TRP A CE2 1 
ATOM   2009 C  CE3 . TRP A 1 267 ? 60.800 -85.137  231.113 1.00 55.15  ? 267  TRP A CE3 1 
ATOM   2010 C  CZ2 . TRP A 1 267 ? 58.271 -84.987  229.837 1.00 52.99  ? 267  TRP A CZ2 1 
ATOM   2011 C  CZ3 . TRP A 1 267 ? 59.745 -84.377  231.654 1.00 52.25  ? 267  TRP A CZ3 1 
ATOM   2012 C  CH2 . TRP A 1 267 ? 58.509 -84.319  231.014 1.00 51.58  ? 267  TRP A CH2 1 
ATOM   2013 N  N   . GLY A 1 268 ? 65.993 -85.572  229.192 1.00 57.17  ? 268  GLY A N   1 
ATOM   2014 C  CA  . GLY A 1 268 ? 67.380 -85.846  229.512 1.00 58.37  ? 268  GLY A CA  1 
ATOM   2015 C  C   . GLY A 1 268 ? 68.379 -85.550  228.400 1.00 59.81  ? 268  GLY A C   1 
ATOM   2016 O  O   . GLY A 1 268 ? 69.577 -85.388  228.667 1.00 62.51  ? 268  GLY A O   1 
ATOM   2017 N  N   . GLY A 1 269 ? 67.936 -85.463  227.150 1.00 58.02  ? 269  GLY A N   1 
ATOM   2018 C  CA  . GLY A 1 269 ? 68.873 -85.184  226.084 1.00 57.78  ? 269  GLY A CA  1 
ATOM   2019 C  C   . GLY A 1 269 ? 69.349 -83.744  226.035 1.00 57.35  ? 269  GLY A C   1 
ATOM   2020 O  O   . GLY A 1 269 ? 68.783 -82.879  226.689 1.00 56.74  ? 269  GLY A O   1 
ATOM   2021 N  N   . HIS A 1 270 ? 70.404 -83.485  225.268 1.00 57.65  ? 270  HIS A N   1 
ATOM   2022 C  CA  A HIS A 1 270 ? 70.930 -82.136  225.084 0.52 57.42  ? 270  HIS A CA  1 
ATOM   2023 C  CA  B HIS A 1 270 ? 70.860 -82.130  225.057 0.48 57.11  ? 270  HIS A CA  1 
ATOM   2024 C  C   . HIS A 1 270 ? 71.357 -81.991  223.620 1.00 57.76  ? 270  HIS A C   1 
ATOM   2025 O  O   . HIS A 1 270 ? 71.909 -82.930  223.031 1.00 59.49  ? 270  HIS A O   1 
ATOM   2026 C  CB  A HIS A 1 270 ? 72.149 -81.883  225.984 0.52 59.26  ? 270  HIS A CB  1 
ATOM   2027 C  CB  B HIS A 1 270 ? 71.917 -81.710  226.093 0.48 58.39  ? 270  HIS A CB  1 
ATOM   2028 C  CG  A HIS A 1 270 ? 71.967 -82.314  227.407 0.52 60.38  ? 270  HIS A CG  1 
ATOM   2029 C  CG  B HIS A 1 270 ? 73.188 -82.507  226.048 0.48 60.69  ? 270  HIS A CG  1 
ATOM   2030 N  ND1 A HIS A 1 270 ? 71.979 -83.640  227.794 0.52 62.27  ? 270  HIS A ND1 1 
ATOM   2031 N  ND1 B HIS A 1 270 ? 73.427 -83.578  226.888 0.48 61.94  ? 270  HIS A ND1 1 
ATOM   2032 C  CD2 A HIS A 1 270 ? 71.796 -81.592  228.542 0.52 60.47  ? 270  HIS A CD2 1 
ATOM   2033 C  CD2 B HIS A 1 270 ? 74.301 -82.373  225.286 0.48 60.87  ? 270  HIS A CD2 1 
ATOM   2034 C  CE1 A HIS A 1 270 ? 71.794 -83.715  229.102 0.52 62.83  ? 270  HIS A CE1 1 
ATOM   2035 C  CE1 B HIS A 1 270 ? 74.628 -84.073  226.638 0.48 63.24  ? 270  HIS A CE1 1 
ATOM   2036 N  NE2 A HIS A 1 270 ? 71.685 -82.487  229.579 0.52 61.01  ? 270  HIS A NE2 1 
ATOM   2037 N  NE2 B HIS A 1 270 ? 75.181 -83.358  225.676 0.48 63.35  ? 270  HIS A NE2 1 
ATOM   2038 N  N   . PHE A 1 271 ? 71.112 -80.839  223.017 1.00 56.67  ? 271  PHE A N   1 
ATOM   2039 C  CA  . PHE A 1 271 ? 71.494 -80.689  221.629 1.00 57.67  ? 271  PHE A CA  1 
ATOM   2040 C  C   . PHE A 1 271 ? 73.004 -80.733  221.568 1.00 61.45  ? 271  PHE A C   1 
ATOM   2041 O  O   . PHE A 1 271 ? 73.656 -80.365  222.528 1.00 63.40  ? 271  PHE A O   1 
ATOM   2042 C  CB  . PHE A 1 271 ? 70.886 -79.442  220.995 1.00 54.25  ? 271  PHE A CB  1 
ATOM   2043 C  CG  . PHE A 1 271 ? 69.434 -79.602  220.690 1.00 50.71  ? 271  PHE A CG  1 
ATOM   2044 C  CD1 . PHE A 1 271 ? 68.463 -78.861  221.386 1.00 48.59  ? 271  PHE A CD1 1 
ATOM   2045 C  CD2 . PHE A 1 271 ? 69.023 -80.517  219.736 1.00 48.39  ? 271  PHE A CD2 1 
ATOM   2046 C  CE1 . PHE A 1 271 ? 67.122 -79.017  221.131 1.00 42.77  ? 271  PHE A CE1 1 
ATOM   2047 C  CE2 . PHE A 1 271 ? 67.683 -80.694  219.453 1.00 46.28  ? 271  PHE A CE2 1 
ATOM   2048 C  CZ  . PHE A 1 271 ? 66.721 -79.931  220.156 1.00 46.74  ? 271  PHE A CZ  1 
ATOM   2049 N  N   . VAL A 1 272 ? 73.548 -81.229  220.470 1.00 64.14  ? 272  VAL A N   1 
ATOM   2050 C  CA  . VAL A 1 272 ? 74.976 -81.340  220.326 1.00 69.33  ? 272  VAL A CA  1 
ATOM   2051 C  C   . VAL A 1 272 ? 75.552 -80.125  219.606 1.00 71.34  ? 272  VAL A C   1 
ATOM   2052 O  O   . VAL A 1 272 ? 74.909 -79.542  218.749 1.00 69.54  ? 272  VAL A O   1 
ATOM   2053 C  CB  . VAL A 1 272 ? 75.353 -82.607  219.500 1.00 71.25  ? 272  VAL A CB  1 
ATOM   2054 C  CG1 . VAL A 1 272 ? 76.789 -82.499  219.005 1.00 74.02  ? 272  VAL A CG1 1 
ATOM   2055 C  CG2 . VAL A 1 272 ? 75.155 -83.858  220.330 1.00 71.36  ? 272  VAL A CG2 1 
ATOM   2056 N  N   . ASP A 1 273 ? 76.774 -79.763  219.965 1.00 76.43  ? 273  ASP A N   1 
ATOM   2057 C  CA  . ASP A 1 273 ? 77.515 -78.712  219.295 1.00 80.39  ? 273  ASP A CA  1 
ATOM   2058 C  C   . ASP A 1 273 ? 77.333 -78.891  217.801 1.00 81.23  ? 273  ASP A C   1 
ATOM   2059 O  O   . ASP A 1 273 ? 77.487 -79.996  217.285 1.00 82.09  ? 273  ASP A O   1 
ATOM   2060 C  CB  . ASP A 1 273 ? 78.989 -78.849  219.637 1.00 121.72 ? 273  ASP A CB  1 
ATOM   2061 C  CG  . ASP A 1 273 ? 79.814 -77.761  219.029 1.00 113.08 ? 273  ASP A CG  1 
ATOM   2062 O  OD1 . ASP A 1 273 ? 79.212 -76.732  218.649 1.00 108.72 ? 273  ASP A OD1 1 
ATOM   2063 O  OD2 . ASP A 1 273 ? 81.051 -77.932  218.940 1.00 117.94 ? 273  ASP A OD2 1 
ATOM   2064 N  N   . VAL A 1 274 ? 77.009 -77.816  217.092 1.00 81.76  ? 274  VAL A N   1 
ATOM   2065 C  CA  . VAL A 1 274 ? 76.567 -77.985  215.714 1.00 82.65  ? 274  VAL A CA  1 
ATOM   2066 C  C   . VAL A 1 274 ? 77.715 -77.727  214.725 1.00 87.01  ? 274  VAL A C   1 
ATOM   2067 O  O   . VAL A 1 274 ? 77.593 -77.930  213.513 1.00 87.73  ? 274  VAL A O   1 
ATOM   2068 C  CB  . VAL A 1 274 ? 75.269 -77.155  215.432 1.00 79.21  ? 274  VAL A CB  1 
ATOM   2069 C  CG1 . VAL A 1 274 ? 75.588 -75.816  214.875 1.00 78.65  ? 274  VAL A CG1 1 
ATOM   2070 C  CG2 . VAL A 1 274 ? 74.358 -77.913  214.499 1.00 78.40  ? 274  VAL A CG2 1 
ATOM   2071 N  N   . PHE A 1 275 ? 78.846 -77.302  215.268 1.00 88.90  ? 275  PHE A N   1 
ATOM   2072 C  CA  . PHE A 1 275 ? 79.965 -76.895  214.449 1.00 91.93  ? 275  PHE A CA  1 
ATOM   2073 C  C   . PHE A 1 275 ? 80.983 -78.033  214.130 1.00 95.25  ? 275  PHE A C   1 
ATOM   2074 O  O   . PHE A 1 275 ? 81.045 -79.077  214.811 1.00 97.00  ? 275  PHE A O   1 
ATOM   2075 C  CB  . PHE A 1 275 ? 80.629 -75.660  215.083 1.00 92.75  ? 275  PHE A CB  1 
ATOM   2076 C  CG  . PHE A 1 275 ? 79.701 -74.458  215.195 1.00 92.08  ? 275  PHE A CG  1 
ATOM   2077 C  CD1 . PHE A 1 275 ? 79.235 -74.031  216.417 1.00 92.07  ? 275  PHE A CD1 1 
ATOM   2078 C  CD2 . PHE A 1 275 ? 79.302 -73.761  214.060 1.00 93.27  ? 275  PHE A CD2 1 
ATOM   2079 C  CE1 . PHE A 1 275 ? 78.385 -72.931  216.515 1.00 92.75  ? 275  PHE A CE1 1 
ATOM   2080 C  CE2 . PHE A 1 275 ? 78.457 -72.658  214.152 1.00 92.75  ? 275  PHE A CE2 1 
ATOM   2081 C  CZ  . PHE A 1 275 ? 77.999 -72.248  215.385 1.00 91.98  ? 275  PHE A CZ  1 
ATOM   2082 N  N   . THR A 1 276 ? 81.765 -77.826  213.074 1.00 97.05  ? 276  THR A N   1 
ATOM   2083 C  CA  . THR A 1 276 ? 82.750 -78.806  212.630 1.00 99.94  ? 276  THR A CA  1 
ATOM   2084 C  C   . THR A 1 276 ? 84.115 -78.136  212.458 1.00 102.12 ? 276  THR A C   1 
ATOM   2085 O  O   . THR A 1 276 ? 84.250 -76.920  212.670 1.00 102.04 ? 276  THR A O   1 
ATOM   2086 C  CB  . THR A 1 276 ? 82.280 -79.487  211.320 1.00 99.96  ? 276  THR A CB  1 
ATOM   2087 O  OG1 . THR A 1 276 ? 81.474 -80.619  211.659 1.00 101.24 ? 276  THR A OG1 1 
ATOM   2088 C  CG2 . THR A 1 276 ? 83.458 -79.949  210.453 1.00 102.51 ? 276  THR A CG2 1 
ATOM   2089 N  N   . THR A 1 277 ? 85.132 -78.924  212.115 1.00 104.55 ? 277  THR A N   1 
ATOM   2090 C  CA  . THR A 1 277 ? 86.395 -78.346  211.712 1.00 106.96 ? 277  THR A CA  1 
ATOM   2091 C  C   . THR A 1 277 ? 86.795 -78.887  210.347 1.00 108.86 ? 277  THR A C   1 
ATOM   2092 O  O   . THR A 1 277 ? 86.833 -80.087  210.121 1.00 109.72 ? 277  THR A O   1 
ATOM   2093 C  CB  . THR A 1 277 ? 87.510 -78.569  212.745 1.00 109.57 ? 277  THR A CB  1 
ATOM   2094 O  OG1 . THR A 1 277 ? 87.209 -77.835  213.933 1.00 108.31 ? 277  THR A OG1 1 
ATOM   2095 C  CG2 . THR A 1 277 ? 88.839 -78.066  212.205 1.00 112.94 ? 277  THR A CG2 1 
ATOM   2096 N  N   . LEU A 1 278 ? 87.071 -77.979  209.425 1.00 110.40 ? 278  LEU A N   1 
ATOM   2097 C  CA  . LEU A 1 278 ? 87.509 -78.361  208.096 1.00 112.87 ? 278  LEU A CA  1 
ATOM   2098 C  C   . LEU A 1 278 ? 89.013 -78.587  208.095 1.00 116.68 ? 278  LEU A C   1 
ATOM   2099 O  O   . LEU A 1 278 ? 89.705 -78.087  208.972 1.00 117.63 ? 278  LEU A O   1 
ATOM   2100 C  CB  . LEU A 1 278 ? 87.128 -77.271  207.093 1.00 112.83 ? 278  LEU A CB  1 
ATOM   2101 C  CG  . LEU A 1 278 ? 85.730 -77.369  206.493 1.00 110.41 ? 278  LEU A CG  1 
ATOM   2102 C  CD1 . LEU A 1 278 ? 84.718 -77.675  207.568 1.00 107.54 ? 278  LEU A CD1 1 
ATOM   2103 C  CD2 . LEU A 1 278 ? 85.412 -76.077  205.775 1.00 111.50 ? 278  LEU A CD2 1 
ATOM   2104 N  N   . PRO A 1 279 ? 89.518 -79.332  207.097 1.00 119.41 ? 279  PRO A N   1 
ATOM   2105 C  CA  . PRO A 1 279 ? 90.941 -79.654  206.997 1.00 123.91 ? 279  PRO A CA  1 
ATOM   2106 C  C   . PRO A 1 279 ? 91.870 -78.465  207.291 1.00 126.98 ? 279  PRO A C   1 
ATOM   2107 O  O   . PRO A 1 279 ? 92.782 -78.597  208.101 1.00 129.82 ? 279  PRO A O   1 
ATOM   2108 C  CB  . PRO A 1 279 ? 91.087 -80.126  205.550 1.00 156.15 ? 279  PRO A CB  1 
ATOM   2109 C  CG  . PRO A 1 279 ? 89.771 -80.737  205.240 1.00 157.34 ? 279  PRO A CG  1 
ATOM   2110 C  CD  . PRO A 1 279 ? 88.746 -79.910  205.981 1.00 133.00 ? 279  PRO A CD  1 
ATOM   2111 N  N   . ASP A 1 280 ? 91.650 -77.316  206.655 1.00 127.65 ? 280  ASP A N   1 
ATOM   2112 C  CA  . ASP A 1 280 ? 92.517 -76.147  206.875 1.00 131.52 ? 280  ASP A CA  1 
ATOM   2113 C  C   . ASP A 1 280 ? 92.481 -75.604  208.316 1.00 131.53 ? 280  ASP A C   1 
ATOM   2114 O  O   . ASP A 1 280 ? 93.451 -74.994  208.779 1.00 135.64 ? 280  ASP A O   1 
ATOM   2115 C  CB  . ASP A 1 280 ? 92.213 -75.028  205.868 1.00 132.27 ? 280  ASP A CB  1 
ATOM   2116 C  CG  . ASP A 1 280 ? 90.799 -74.468  206.011 1.00 128.25 ? 280  ASP A CG  1 
ATOM   2117 O  OD1 . ASP A 1 280 ? 90.313 -74.325  207.154 1.00 124.74 ? 280  ASP A OD1 1 
ATOM   2118 O  OD2 . ASP A 1 280 ? 90.176 -74.161  204.969 1.00 128.17 ? 280  ASP A OD2 1 
ATOM   2119 N  N   . GLY A 1 281 ? 91.369 -75.826  209.017 1.00 127.56 ? 281  GLY A N   1 
ATOM   2120 C  CA  . GLY A 1 281 ? 91.240 -75.382  210.404 1.00 127.67 ? 281  GLY A CA  1 
ATOM   2121 C  C   . GLY A 1 281 ? 90.058 -74.458  210.610 1.00 124.98 ? 281  GLY A C   1 
ATOM   2122 O  O   . GLY A 1 281 ? 89.749 -74.063  211.735 1.00 124.14 ? 281  GLY A O   1 
ATOM   2123 N  N   . ARG A 1 282 ? 89.393 -74.117  209.511 1.00 124.07 ? 282  ARG A N   1 
ATOM   2124 C  CA  . ARG A 1 282 ? 88.233 -73.234  209.548 1.00 122.16 ? 282  ARG A CA  1 
ATOM   2125 C  C   . ARG A 1 282 ? 87.105 -73.900  210.328 1.00 118.20 ? 282  ARG A C   1 
ATOM   2126 O  O   . ARG A 1 282 ? 87.175 -75.077  210.662 1.00 117.25 ? 282  ARG A O   1 
ATOM   2127 C  CB  . ARG A 1 282 ? 87.770 -72.909  208.122 1.00 122.14 ? 282  ARG A CB  1 
ATOM   2128 C  CG  . ARG A 1 282 ? 87.412 -71.442  207.859 1.00 124.15 ? 282  ARG A CG  1 
ATOM   2129 C  CD  . ARG A 1 282 ? 86.860 -71.262  206.433 1.00 125.44 ? 282  ARG A CD  1 
ATOM   2130 N  NE  . ARG A 1 282 ? 87.676 -71.980  205.450 1.00 128.30 ? 282  ARG A NE  1 
ATOM   2131 C  CZ  . ARG A 1 282 ? 87.239 -72.400  204.266 1.00 128.34 ? 282  ARG A CZ  1 
ATOM   2132 N  NH1 . ARG A 1 282 ? 85.980 -72.184  203.902 1.00 126.67 ? 282  ARG A NH1 1 
ATOM   2133 N  NH2 . ARG A 1 282 ? 88.059 -73.048  203.450 1.00 130.19 ? 282  ARG A NH2 1 
ATOM   2134 N  N   . ARG A 1 283 ? 86.064 -73.139  210.627 1.00 116.54 ? 283  ARG A N   1 
ATOM   2135 C  CA  . ARG A 1 283 ? 84.903 -73.703  211.291 1.00 113.33 ? 283  ARG A CA  1 
ATOM   2136 C  C   . ARG A 1 283 ? 83.697 -73.604  210.374 1.00 110.65 ? 283  ARG A C   1 
ATOM   2137 O  O   . ARG A 1 283 ? 83.456 -72.559  209.774 1.00 111.88 ? 283  ARG A O   1 
ATOM   2138 C  CB  . ARG A 1 283 ? 84.635 -72.978  212.610 1.00 113.34 ? 283  ARG A CB  1 
ATOM   2139 C  CG  . ARG A 1 283 ? 85.629 -73.321  213.702 1.00 117.54 ? 283  ARG A CG  1 
ATOM   2140 C  CD  . ARG A 1 283 ? 85.226 -74.623  214.387 1.00 118.79 ? 283  ARG A CD  1 
ATOM   2141 N  NE  . ARG A 1 283 ? 85.374 -74.510  215.832 1.00 122.54 ? 283  ARG A NE  1 
ATOM   2142 C  CZ  . ARG A 1 283 ? 84.482 -73.929  216.632 1.00 123.15 ? 283  ARG A CZ  1 
ATOM   2143 N  NH1 . ARG A 1 283 ? 83.357 -73.413  216.133 1.00 120.02 ? 283  ARG A NH1 1 
ATOM   2144 N  NH2 . ARG A 1 283 ? 84.714 -73.866  217.939 1.00 126.46 ? 283  ARG A NH2 1 
ATOM   2145 N  N   . ALA A 1 284 ? 82.954 -74.700  210.255 1.00 107.82 ? 284  ALA A N   1 
ATOM   2146 C  CA  . ALA A 1 284 ? 81.720 -74.716  209.478 1.00 105.08 ? 284  ALA A CA  1 
ATOM   2147 C  C   . ALA A 1 284 ? 80.556 -75.234  210.322 1.00 102.10 ? 284  ALA A C   1 
ATOM   2148 O  O   . ALA A 1 284 ? 80.738 -76.044  211.227 1.00 101.69 ? 284  ALA A O   1 
ATOM   2149 C  CB  . ALA A 1 284 ? 81.891 -75.555  208.218 1.00 106.34 ? 284  ALA A CB  1 
ATOM   2150 N  N   . LEU A 1 285 ? 79.357 -74.741  210.038 1.00 100.18 ? 285  LEU A N   1 
ATOM   2151 C  CA  . LEU A 1 285 ? 78.166 -75.220  210.706 1.00 97.54  ? 285  LEU A CA  1 
ATOM   2152 C  C   . LEU A 1 285 ? 77.848 -76.558  210.057 1.00 97.39  ? 285  LEU A C   1 
ATOM   2153 O  O   . LEU A 1 285 ? 77.678 -76.636  208.835 1.00 98.93  ? 285  LEU A O   1 
ATOM   2154 C  CB  . LEU A 1 285 ? 77.027 -74.225  210.498 1.00 97.06  ? 285  LEU A CB  1 
ATOM   2155 C  CG  . LEU A 1 285 ? 75.612 -74.497  211.036 1.00 97.23  ? 285  LEU A CG  1 
ATOM   2156 C  CD1 . LEU A 1 285 ? 75.656 -74.576  212.564 1.00 96.29  ? 285  LEU A CD1 1 
ATOM   2157 C  CD2 . LEU A 1 285 ? 74.609 -73.439  210.594 1.00 97.96  ? 285  LEU A CD2 1 
ATOM   2158 N  N   . ASP A 1 286 ? 77.814 -77.623  210.844 1.00 97.20  ? 286  ASP A N   1 
ATOM   2159 C  CA  . ASP A 1 286 ? 77.463 -78.917  210.279 1.00 95.88  ? 286  ASP A CA  1 
ATOM   2160 C  C   . ASP A 1 286 ? 75.992 -79.176  210.563 1.00 91.66  ? 286  ASP A C   1 
ATOM   2161 O  O   . ASP A 1 286 ? 75.638 -79.731  211.612 1.00 90.36  ? 286  ASP A O   1 
ATOM   2162 C  CB  . ASP A 1 286 ? 78.343 -80.051  210.840 1.00 98.48  ? 286  ASP A CB  1 
ATOM   2163 C  CG  . ASP A 1 286 ? 78.237 -81.342  210.016 1.00 100.74 ? 286  ASP A CG  1 
ATOM   2164 O  OD1 . ASP A 1 286 ? 77.317 -81.439  209.173 1.00 99.86  ? 286  ASP A OD1 1 
ATOM   2165 O  OD2 . ASP A 1 286 ? 79.072 -82.259  210.203 1.00 104.46 ? 286  ASP A OD2 1 
ATOM   2166 N  N   . LEU A 1 287 ? 75.141 -78.757  209.629 1.00 88.37  ? 287  LEU A N   1 
ATOM   2167 C  CA  . LEU A 1 287 ? 73.706 -78.937  209.782 1.00 84.36  ? 287  LEU A CA  1 
ATOM   2168 C  C   . LEU A 1 287 ? 73.366 -80.400  209.760 1.00 83.28  ? 287  LEU A C   1 
ATOM   2169 O  O   . LEU A 1 287 ? 72.206 -80.765  209.857 1.00 80.80  ? 287  LEU A O   1 
ATOM   2170 C  CB  . LEU A 1 287 ? 72.931 -78.191  208.696 1.00 84.10  ? 287  LEU A CB  1 
ATOM   2171 C  CG  . LEU A 1 287 ? 72.992 -76.663  208.831 1.00 83.59  ? 287  LEU A CG  1 
ATOM   2172 C  CD1 . LEU A 1 287 ? 72.417 -76.017  207.591 1.00 83.71  ? 287  LEU A CD1 1 
ATOM   2173 C  CD2 . LEU A 1 287 ? 72.294 -76.167  210.097 1.00 80.94  ? 287  LEU A CD2 1 
ATOM   2174 N  N   . GLY A 1 288 ? 74.404 -81.228  209.628 1.00 84.50  ? 288  GLY A N   1 
ATOM   2175 C  CA  . GLY A 1 288 ? 74.291 -82.669  209.772 1.00 83.53  ? 288  GLY A CA  1 
ATOM   2176 C  C   . GLY A 1 288 ? 74.170 -83.022  211.238 1.00 81.92  ? 288  GLY A C   1 
ATOM   2177 O  O   . GLY A 1 288 ? 73.472 -83.954  211.595 1.00 82.06  ? 288  GLY A O   1 
ATOM   2178 N  N   . LYS A 1 289 ? 74.828 -82.259  212.098 1.00 80.64  ? 289  LYS A N   1 
ATOM   2179 C  CA  . LYS A 1 289 ? 74.708 -82.471  213.542 1.00 79.13  ? 289  LYS A CA  1 
ATOM   2180 C  C   . LYS A 1 289 ? 73.428 -81.839  214.152 1.00 74.83  ? 289  LYS A C   1 
ATOM   2181 O  O   . LYS A 1 289 ? 73.018 -82.184  215.279 1.00 74.09  ? 289  LYS A O   1 
ATOM   2182 C  CB  . LYS A 1 289 ? 75.955 -81.932  214.256 1.00 81.02  ? 289  LYS A CB  1 
ATOM   2183 C  CG  . LYS A 1 289 ? 77.273 -82.590  213.803 1.00 86.65  ? 289  LYS A CG  1 
ATOM   2184 C  CD  . LYS A 1 289 ? 78.404 -82.379  214.836 1.00 91.32  ? 289  LYS A CD  1 
ATOM   2185 C  CE  . LYS A 1 289 ? 79.745 -82.529  214.171 1.00 95.85  ? 289  LYS A CE  1 
ATOM   2186 N  NZ  . LYS A 1 289 ? 79.796 -83.850  213.458 1.00 101.33 ? 289  LYS A NZ  1 
ATOM   2187 N  N   . PHE A 1 290 ? 72.803 -80.942  213.386 1.00 70.74  ? 290  PHE A N   1 
ATOM   2188 C  CA  . PHE A 1 290 ? 71.725 -80.098  213.864 1.00 65.73  ? 290  PHE A CA  1 
ATOM   2189 C  C   . PHE A 1 290 ? 70.608 -80.841  214.590 1.00 62.94  ? 290  PHE A C   1 
ATOM   2190 O  O   . PHE A 1 290 ? 70.109 -80.348  215.572 1.00 61.23  ? 290  PHE A O   1 
ATOM   2191 C  CB  . PHE A 1 290 ? 71.147 -79.255  212.705 1.00 65.24  ? 290  PHE A CB  1 
ATOM   2192 C  CG  . PHE A 1 290 ? 70.095 -78.274  213.146 1.00 60.44  ? 290  PHE A CG  1 
ATOM   2193 C  CD1 . PHE A 1 290 ? 70.454 -77.074  213.708 1.00 58.02  ? 290  PHE A CD1 1 
ATOM   2194 C  CD2 . PHE A 1 290 ? 68.738 -78.587  213.038 1.00 58.47  ? 290  PHE A CD2 1 
ATOM   2195 C  CE1 . PHE A 1 290 ? 69.472 -76.172  214.136 1.00 57.21  ? 290  PHE A CE1 1 
ATOM   2196 C  CE2 . PHE A 1 290 ? 67.753 -77.705  213.486 1.00 55.21  ? 290  PHE A CE2 1 
ATOM   2197 C  CZ  . PHE A 1 290 ? 68.116 -76.509  214.035 1.00 54.76  ? 290  PHE A CZ  1 
ATOM   2198 N  N   . HIS A 1 291 ? 70.208 -82.005  214.087 1.00 61.71  ? 291  HIS A N   1 
ATOM   2199 C  CA  . HIS A 1 291 ? 69.225 -82.837  214.746 1.00 59.88  ? 291  HIS A CA  1 
ATOM   2200 C  C   . HIS A 1 291 ? 69.847 -83.848  215.714 1.00 62.07  ? 291  HIS A C   1 
ATOM   2201 O  O   . HIS A 1 291 ? 69.152 -84.750  216.206 1.00 62.35  ? 291  HIS A O   1 
ATOM   2202 C  CB  . HIS A 1 291 ? 68.447 -83.663  213.730 1.00 58.68  ? 291  HIS A CB  1 
ATOM   2203 C  CG  . HIS A 1 291 ? 67.789 -82.864  212.661 1.00 56.95  ? 291  HIS A CG  1 
ATOM   2204 N  ND1 . HIS A 1 291 ? 66.637 -82.126  212.876 1.00 53.53  ? 291  HIS A ND1 1 
ATOM   2205 C  CD2 . HIS A 1 291 ? 68.100 -82.714  211.350 1.00 53.90  ? 291  HIS A CD2 1 
ATOM   2206 C  CE1 . HIS A 1 291 ? 66.280 -81.548  211.745 1.00 51.16  ? 291  HIS A CE1 1 
ATOM   2207 N  NE2 . HIS A 1 291 ? 67.153 -81.884  210.807 1.00 52.32  ? 291  HIS A NE2 1 
ATOM   2208 N  N   . GLU A 1 292 ? 71.145 -83.770  215.967 1.00 63.44  ? 292  GLU A N   1 
ATOM   2209 C  CA  . GLU A 1 292 ? 71.706 -84.765  216.856 1.00 65.93  ? 292  GLU A CA  1 
ATOM   2210 C  C   . GLU A 1 292 ? 71.474 -84.410  218.325 1.00 64.59  ? 292  GLU A C   1 
ATOM   2211 O  O   . GLU A 1 292 ? 71.530 -83.226  218.737 1.00 63.66  ? 292  GLU A O   1 
ATOM   2212 C  CB  . GLU A 1 292 ? 73.188 -85.005  216.571 1.00 69.47  ? 292  GLU A CB  1 
ATOM   2213 C  CG  . GLU A 1 292 ? 73.473 -85.970  215.423 1.00 73.31  ? 292  GLU A CG  1 
ATOM   2214 C  CD  . GLU A 1 292 ? 74.969 -86.124  215.206 1.00 80.59  ? 292  GLU A CD  1 
ATOM   2215 O  OE1 . GLU A 1 292 ? 75.720 -85.696  216.111 1.00 82.53  ? 292  GLU A OE1 1 
ATOM   2216 O  OE2 . GLU A 1 292 ? 75.405 -86.664  214.151 1.00 85.45  ? 292  GLU A OE2 1 
ATOM   2217 N  N   . ILE A 1 293 ? 71.199 -85.449  219.098 1.00 64.42  ? 293  ILE A N   1 
ATOM   2218 C  CA  . ILE A 1 293 ? 70.939 -85.316  220.526 1.00 62.99  ? 293  ILE A CA  1 
ATOM   2219 C  C   . ILE A 1 293 ? 71.752 -86.317  221.375 1.00 64.86  ? 293  ILE A C   1 
ATOM   2220 O  O   . ILE A 1 293 ? 71.655 -87.525  221.187 1.00 65.35  ? 293  ILE A O   1 
ATOM   2221 C  CB  . ILE A 1 293 ? 69.423 -85.454  220.812 1.00 60.96  ? 293  ILE A CB  1 
ATOM   2222 C  CG1 . ILE A 1 293 ? 68.718 -84.173  220.341 1.00 57.87  ? 293  ILE A CG1 1 
ATOM   2223 C  CG2 . ILE A 1 293 ? 69.159 -85.741  222.298 1.00 58.72  ? 293  ILE A CG2 1 
ATOM   2224 C  CD1 . ILE A 1 293 ? 67.250 -84.334  220.124 1.00 55.94  ? 293  ILE A CD1 1 
ATOM   2225 N  N   . ALA A 1 294 ? 72.553 -85.776  222.289 1.00 65.02  ? 294  ALA A N   1 
ATOM   2226 C  CA  . ALA A 1 294 ? 73.236 -86.544  223.326 1.00 66.65  ? 294  ALA A CA  1 
ATOM   2227 C  C   . ALA A 1 294 ? 72.316 -87.066  224.432 1.00 65.84  ? 294  ALA A C   1 
ATOM   2228 O  O   . ALA A 1 294 ? 71.485 -86.358  224.916 1.00 64.83  ? 294  ALA A O   1 
ATOM   2229 C  CB  . ALA A 1 294 ? 74.321 -85.675  223.938 1.00 67.29  ? 294  ALA A CB  1 
ATOM   2230 N  N   . GLN A 1 295 ? 72.488 -88.308  224.852 1.00 68.15  ? 295  GLN A N   1 
ATOM   2231 C  CA  . GLN A 1 295 ? 71.871 -88.815  226.085 1.00 67.39  ? 295  GLN A CA  1 
ATOM   2232 C  C   . GLN A 1 295 ? 72.844 -89.670  226.872 1.00 70.32  ? 295  GLN A C   1 
ATOM   2233 O  O   . GLN A 1 295 ? 73.736 -90.328  226.312 1.00 72.56  ? 295  GLN A O   1 
ATOM   2234 C  CB  . GLN A 1 295 ? 70.667 -89.680  225.800 1.00 66.81  ? 295  GLN A CB  1 
ATOM   2235 C  CG  . GLN A 1 295 ? 69.485 -88.953  225.222 1.00 64.75  ? 295  GLN A CG  1 
ATOM   2236 C  CD  . GLN A 1 295 ? 68.406 -89.948  224.832 1.00 64.23  ? 295  GLN A CD  1 
ATOM   2237 O  OE1 . GLN A 1 295 ? 68.269 -90.337  223.657 1.00 62.72  ? 295  GLN A OE1 1 
ATOM   2238 N  NE2 . GLN A 1 295 ? 67.677 -90.406  225.820 1.00 62.44  ? 295  GLN A NE2 1 
ATOM   2239 N  N   . HIS A 1 296 ? 72.652 -89.669  228.179 1.00 70.77  ? 296  HIS A N   1 
ATOM   2240 C  CA  . HIS A 1 296 ? 73.381 -90.539  229.074 1.00 74.02  ? 296  HIS A CA  1 
ATOM   2241 C  C   . HIS A 1 296 ? 72.792 -91.934  228.925 1.00 75.92  ? 296  HIS A C   1 
ATOM   2242 O  O   . HIS A 1 296 ? 71.588 -92.087  228.830 1.00 74.75  ? 296  HIS A O   1 
ATOM   2243 C  CB  . HIS A 1 296 ? 73.260 -90.043  230.522 1.00 72.85  ? 296  HIS A CB  1 
ATOM   2244 C  CG  . HIS A 1 296 ? 73.792 -91.003  231.533 1.00 76.09  ? 296  HIS A CG  1 
ATOM   2245 N  ND1 . HIS A 1 296 ? 75.120 -91.039  231.902 1.00 78.36  ? 296  HIS A ND1 1 
ATOM   2246 C  CD2 . HIS A 1 296 ? 73.185 -91.989  232.235 1.00 77.87  ? 296  HIS A CD2 1 
ATOM   2247 C  CE1 . HIS A 1 296 ? 75.304 -91.991  232.800 1.00 79.90  ? 296  HIS A CE1 1 
ATOM   2248 N  NE2 . HIS A 1 296 ? 74.145 -92.583  233.018 1.00 79.83  ? 296  HIS A NE2 1 
ATOM   2249 N  N   . HIS A 1 297 ? 73.644 -92.947  228.883 1.00 80.18  ? 297  HIS A N   1 
ATOM   2250 C  CA  . HIS A 1 297 ? 73.181 -94.319  228.807 1.00 83.53  ? 297  HIS A CA  1 
ATOM   2251 C  C   . HIS A 1 297 ? 73.613 -95.050  230.056 1.00 87.57  ? 297  HIS A C   1 
ATOM   2252 O  O   . HIS A 1 297 ? 74.793 -95.058  230.387 1.00 89.29  ? 297  HIS A O   1 
ATOM   2253 C  CB  . HIS A 1 297 ? 73.739 -95.003  227.558 1.00 85.31  ? 297  HIS A CB  1 
ATOM   2254 C  CG  . HIS A 1 297 ? 73.090 -94.550  226.290 1.00 83.00  ? 297  HIS A CG  1 
ATOM   2255 N  ND1 . HIS A 1 297 ? 72.190 -95.326  225.598 1.00 82.86  ? 297  HIS A ND1 1 
ATOM   2256 C  CD2 . HIS A 1 297 ? 73.181 -93.381  225.614 1.00 81.54  ? 297  HIS A CD2 1 
ATOM   2257 C  CE1 . HIS A 1 297 ? 71.775 -94.666  224.534 1.00 82.81  ? 297  HIS A CE1 1 
ATOM   2258 N  NE2 . HIS A 1 297 ? 72.357 -93.480  224.523 1.00 81.42  ? 297  HIS A NE2 1 
ATOM   2259 N  N   . HIS A 1 298 ? 72.651 -95.655  230.752 1.00 90.22  ? 298  HIS A N   1 
ATOM   2260 C  CA  . HIS A 1 298 ? 72.891 -96.228  232.086 1.00 94.48  ? 298  HIS A CA  1 
ATOM   2261 C  C   . HIS A 1 298 ? 73.482 -97.642  232.038 1.00 98.86  ? 298  HIS A C   1 
ATOM   2262 O  O   . HIS A 1 298 ? 73.194 -98.432  231.136 1.00 100.09 ? 298  HIS A O   1 
ATOM   2263 C  CB  . HIS A 1 298 ? 71.597 -96.219  232.918 1.00 93.51  ? 298  HIS A CB  1 
ATOM   2264 C  CG  . HIS A 1 298 ? 71.020 -94.852  233.139 1.00 93.31  ? 298  HIS A CG  1 
ATOM   2265 N  ND1 . HIS A 1 298 ? 71.289 -94.100  234.269 1.00 94.93  ? 298  HIS A ND1 1 
ATOM   2266 C  CD2 . HIS A 1 298 ? 70.174 -94.105  232.383 1.00 92.56  ? 298  HIS A CD2 1 
ATOM   2267 C  CE1 . HIS A 1 298 ? 70.641 -92.948  234.194 1.00 92.99  ? 298  HIS A CE1 1 
ATOM   2268 N  NE2 . HIS A 1 298 ? 69.956 -92.926  233.061 1.00 91.65  ? 298  HIS A NE2 1 
ATOM   2269 N  N   . HIS A 1 299 ? 74.324 -97.965  233.006 1.00 102.46 ? 299  HIS A N   1 
ATOM   2270 C  CA  . HIS A 1 299 ? 74.862 -99.312  233.071 1.00 107.31 ? 299  HIS A CA  1 
ATOM   2271 C  C   . HIS A 1 299 ? 73.781 -100.339 233.444 1.00 108.74 ? 299  HIS A C   1 
ATOM   2272 O  O   . HIS A 1 299 ? 73.265 -101.061 232.572 1.00 109.80 ? 299  HIS A O   1 
ATOM   2273 C  CB  . HIS A 1 299 ? 76.063 -99.376  234.015 1.00 109.94 ? 299  HIS A CB  1 
ATOM   2274 C  CG  . HIS A 1 299 ? 77.383 -99.477  233.300 1.00 113.54 ? 299  HIS A CG  1 
ATOM   2275 N  ND1 . HIS A 1 299 ? 78.447 -98.636  233.566 1.00 115.35 ? 299  HIS A ND1 1 
ATOM   2276 C  CD2 . HIS A 1 299 ? 77.809 -100.322 232.319 1.00 114.91 ? 299  HIS A CD2 1 
ATOM   2277 C  CE1 . HIS A 1 299 ? 79.469 -98.962  232.786 1.00 115.57 ? 299  HIS A CE1 1 
ATOM   2278 N  NE2 . HIS A 1 299 ? 79.107 -99.980  232.021 1.00 116.11 ? 299  HIS A NE2 1 
ATOM   2279 N  N   . ILE B 1 23  ? 24.991 -41.370  207.270 1.00 145.30 ? 23   ILE B N   1 
ATOM   2280 C  CA  . ILE B 1 23  ? 24.388 -40.012  207.462 1.00 146.66 ? 23   ILE B CA  1 
ATOM   2281 C  C   . ILE B 1 23  ? 25.283 -38.884  206.894 1.00 147.35 ? 23   ILE B C   1 
ATOM   2282 O  O   . ILE B 1 23  ? 26.504 -39.046  206.776 1.00 147.22 ? 23   ILE B O   1 
ATOM   2283 C  CB  . ILE B 1 23  ? 24.041 -39.761  208.941 1.00 148.10 ? 23   ILE B CB  1 
ATOM   2284 C  CG1 . ILE B 1 23  ? 25.308 -39.489  209.753 1.00 148.24 ? 23   ILE B CG1 1 
ATOM   2285 C  CG2 . ILE B 1 23  ? 23.271 -40.946  209.507 1.00 147.11 ? 23   ILE B CG2 1 
ATOM   2286 C  CD1 . ILE B 1 23  ? 25.040 -38.891  211.121 1.00 149.36 ? 23   ILE B CD1 1 
ATOM   2287 N  N   . THR B 1 24  ? 24.673 -37.746  206.548 1.00 148.17 ? 24   THR B N   1 
ATOM   2288 C  CA  . THR B 1 24  ? 25.324 -36.738  205.689 1.00 148.15 ? 24   THR B CA  1 
ATOM   2289 C  C   . THR B 1 24  ? 26.467 -35.978  206.351 1.00 149.36 ? 24   THR B C   1 
ATOM   2290 O  O   . THR B 1 24  ? 26.426 -35.703  207.545 1.00 150.70 ? 24   THR B O   1 
ATOM   2291 C  CB  . THR B 1 24  ? 24.310 -35.684  205.178 1.00 148.84 ? 24   THR B CB  1 
ATOM   2292 O  OG1 . THR B 1 24  ? 23.692 -35.020  206.289 1.00 150.29 ? 24   THR B OG1 1 
ATOM   2293 C  CG2 . THR B 1 24  ? 23.246 -36.340  204.286 1.00 146.97 ? 24   THR B CG2 1 
ATOM   2294 N  N   . ARG B 1 25  ? 27.475 -35.626  205.559 1.00 148.96 ? 25   ARG B N   1 
ATOM   2295 C  CA  . ARG B 1 25  ? 28.533 -34.731  206.015 1.00 150.42 ? 25   ARG B CA  1 
ATOM   2296 C  C   . ARG B 1 25  ? 28.332 -33.374  205.340 1.00 151.47 ? 25   ARG B C   1 
ATOM   2297 O  O   . ARG B 1 25  ? 27.406 -33.216  204.539 1.00 151.00 ? 25   ARG B O   1 
ATOM   2298 C  CB  . ARG B 1 25  ? 29.918 -35.315  205.692 1.00 149.56 ? 25   ARG B CB  1 
ATOM   2299 C  CG  . ARG B 1 25  ? 30.185 -36.697  206.325 1.00 148.67 ? 25   ARG B CG  1 
ATOM   2300 C  CD  . ARG B 1 25  ? 31.616 -37.218  206.059 1.00 147.29 ? 25   ARG B CD  1 
ATOM   2301 N  NE  . ARG B 1 25  ? 31.928 -38.458  206.787 1.00 145.83 ? 25   ARG B NE  1 
ATOM   2302 C  CZ  . ARG B 1 25  ? 31.076 -39.463  206.994 1.00 144.46 ? 25   ARG B CZ  1 
ATOM   2303 N  NH1 . ARG B 1 25  ? 29.837 -39.413  206.516 1.00 144.14 ? 25   ARG B NH1 1 
ATOM   2304 N  NH2 . ARG B 1 25  ? 31.466 -40.531  207.674 1.00 143.32 ? 25   ARG B NH2 1 
ATOM   2305 N  N   . LEU B 1 26  ? 29.181 -32.394  205.659 1.00 153.09 ? 26   LEU B N   1 
ATOM   2306 C  CA  . LEU B 1 26  ? 29.063 -31.055  205.051 1.00 154.26 ? 26   LEU B CA  1 
ATOM   2307 C  C   . LEU B 1 26  ? 30.144 -30.770  204.012 1.00 153.75 ? 26   LEU B C   1 
ATOM   2308 O  O   . LEU B 1 26  ? 30.713 -29.676  203.986 1.00 154.91 ? 26   LEU B O   1 
ATOM   2309 C  CB  . LEU B 1 26  ? 29.087 -29.960  206.123 1.00 156.58 ? 26   LEU B CB  1 
ATOM   2310 C  CG  . LEU B 1 26  ? 27.931 -29.899  207.136 1.00 158.02 ? 26   LEU B CG  1 
ATOM   2311 C  CD1 . LEU B 1 26  ? 28.202 -28.834  208.221 1.00 160.86 ? 26   LEU B CD1 1 
ATOM   2312 C  CD2 . LEU B 1 26  ? 26.550 -29.714  206.461 1.00 156.99 ? 26   LEU B CD2 1 
ATOM   2313 N  N   . ASP B 1 35  ? 32.018 -40.026  190.721 1.00 207.37 ? 35   ASP B N   1 
ATOM   2314 C  CA  . ASP B 1 35  ? 32.682 -38.747  190.939 1.00 212.44 ? 35   ASP B CA  1 
ATOM   2315 C  C   . ASP B 1 35  ? 34.187 -38.840  190.638 1.00 207.70 ? 35   ASP B C   1 
ATOM   2316 O  O   . ASP B 1 35  ? 34.988 -38.152  191.278 1.00 211.57 ? 35   ASP B O   1 
ATOM   2317 C  CB  . ASP B 1 35  ? 32.448 -38.265  192.378 1.00 220.24 ? 35   ASP B CB  1 
ATOM   2318 N  N   . ASP B 1 36  ? 34.547 -39.683  189.655 1.00 199.99 ? 36   ASP B N   1 
ATOM   2319 C  CA  . ASP B 1 36  ? 35.954 -40.012  189.285 1.00 194.61 ? 36   ASP B CA  1 
ATOM   2320 C  C   . ASP B 1 36  ? 36.738 -40.770  190.377 1.00 193.40 ? 36   ASP B C   1 
ATOM   2321 O  O   . ASP B 1 36  ? 37.238 -41.868  190.131 1.00 187.38 ? 36   ASP B O   1 
ATOM   2322 C  CB  . ASP B 1 36  ? 36.731 -38.779  188.800 1.00 197.28 ? 36   ASP B CB  1 
ATOM   2323 N  N   . HIS B 1 37  ? 36.840 -40.175  191.571 1.00 199.74 ? 37   HIS B N   1 
ATOM   2324 C  CA  . HIS B 1 37  ? 37.435 -40.822  192.751 1.00 199.84 ? 37   HIS B CA  1 
ATOM   2325 C  C   . HIS B 1 37  ? 36.523 -41.959  193.231 1.00 197.78 ? 37   HIS B C   1 
ATOM   2326 O  O   . HIS B 1 37  ? 36.633 -42.410  194.372 1.00 200.00 ? 37   HIS B O   1 
ATOM   2327 C  CB  . HIS B 1 37  ? 37.653 -39.781  193.873 1.00 208.39 ? 37   HIS B CB  1 
ATOM   2328 C  CG  . HIS B 1 37  ? 38.549 -40.237  194.995 1.00 209.99 ? 37   HIS B CG  1 
ATOM   2329 N  ND1 . HIS B 1 37  ? 38.121 -40.313  196.310 1.00 216.05 ? 37   HIS B ND1 1 
ATOM   2330 C  CD2 . HIS B 1 37  ? 39.860 -40.595  195.007 1.00 207.04 ? 37   HIS B CD2 1 
ATOM   2331 C  CE1 . HIS B 1 37  ? 39.121 -40.713  197.077 1.00 215.82 ? 37   HIS B CE1 1 
ATOM   2332 N  NE2 . HIS B 1 37  ? 40.186 -40.895  196.311 1.00 210.57 ? 37   HIS B NE2 1 
ATOM   2333 N  N   . TYR B 1 38  ? 35.614 -42.406  192.360 1.00 193.88 ? 38   TYR B N   1 
ATOM   2334 C  CA  . TYR B 1 38  ? 34.747 -43.550  192.656 1.00 191.44 ? 38   TYR B CA  1 
ATOM   2335 C  C   . TYR B 1 38  ? 35.465 -44.874  192.346 1.00 183.98 ? 38   TYR B C   1 
ATOM   2336 O  O   . TYR B 1 38  ? 35.394 -45.365  191.219 1.00 179.21 ? 38   TYR B O   1 
ATOM   2337 C  CB  . TYR B 1 38  ? 33.437 -43.458  191.866 1.00 191.52 ? 38   TYR B CB  1 
ATOM   2338 N  N   . HIS B 1 39  ? 36.165 -45.427  193.347 1.00 183.56 ? 39   HIS B N   1 
ATOM   2339 C  CA  . HIS B 1 39  ? 36.909 -46.694  193.227 1.00 176.94 ? 39   HIS B CA  1 
ATOM   2340 C  C   . HIS B 1 39  ? 36.035 -47.910  193.527 1.00 174.59 ? 39   HIS B C   1 
ATOM   2341 O  O   . HIS B 1 39  ? 36.408 -48.778  194.323 1.00 174.40 ? 39   HIS B O   1 
ATOM   2342 C  CB  . HIS B 1 39  ? 38.132 -46.695  194.150 1.00 178.79 ? 39   HIS B CB  1 
ATOM   2343 C  CG  . HIS B 1 39  ? 39.429 -46.427  193.445 1.00 177.40 ? 39   HIS B CG  1 
ATOM   2344 N  ND1 . HIS B 1 39  ? 39.501 -45.766  192.229 1.00 176.99 ? 39   HIS B ND1 1 
ATOM   2345 C  CD2 . HIS B 1 39  ? 40.710 -46.720  193.796 1.00 177.68 ? 39   HIS B CD2 1 
ATOM   2346 C  CE1 . HIS B 1 39  ? 40.767 -45.678  191.854 1.00 174.77 ? 39   HIS B CE1 1 
ATOM   2347 N  NE2 . HIS B 1 39  ? 41.521 -46.247  192.789 1.00 175.33 ? 39   HIS B NE2 1 
ATOM   2348 N  N   . ASP B 1 40  ? 34.857 -47.942  192.905 1.00 172.89 ? 40   ASP B N   1 
ATOM   2349 C  CA  . ASP B 1 40  ? 34.038 -49.146  192.844 1.00 169.47 ? 40   ASP B CA  1 
ATOM   2350 C  C   . ASP B 1 40  ? 34.832 -50.194  192.073 1.00 161.65 ? 40   ASP B C   1 
ATOM   2351 O  O   . ASP B 1 40  ? 34.582 -51.401  192.186 1.00 159.81 ? 40   ASP B O   1 
ATOM   2352 C  CB  . ASP B 1 40  ? 32.726 -48.863  192.101 1.00 170.95 ? 40   ASP B CB  1 
ATOM   2353 C  CG  . ASP B 1 40  ? 31.655 -48.261  192.994 1.00 178.49 ? 40   ASP B CG  1 
ATOM   2354 O  OD1 . ASP B 1 40  ? 31.688 -48.507  194.221 1.00 191.43 ? 40   ASP B OD1 1 
ATOM   2355 O  OD2 . ASP B 1 40  ? 30.767 -47.554  192.459 1.00 182.26 ? 40   ASP B OD2 1 
ATOM   2356 N  N   . LEU B 1 41  ? 35.791 -49.703  191.287 1.00 156.67 ? 41   LEU B N   1 
ATOM   2357 C  CA  . LEU B 1 41  ? 36.635 -50.527  190.434 1.00 149.06 ? 41   LEU B CA  1 
ATOM   2358 C  C   . LEU B 1 41  ? 37.291 -51.651  191.222 1.00 146.69 ? 41   LEU B C   1 
ATOM   2359 O  O   . LEU B 1 41  ? 37.476 -52.762  190.712 1.00 142.74 ? 41   LEU B O   1 
ATOM   2360 C  CB  . LEU B 1 41  ? 37.702 -49.653  189.763 1.00 147.90 ? 41   LEU B CB  1 
ATOM   2361 C  CG  . LEU B 1 41  ? 37.257 -48.765  188.592 1.00 146.99 ? 41   LEU B CG  1 
ATOM   2362 C  CD1 . LEU B 1 41  ? 38.361 -47.797  188.165 1.00 146.61 ? 41   LEU B CD1 1 
ATOM   2363 C  CD2 . LEU B 1 41  ? 36.810 -49.620  187.413 1.00 141.80 ? 41   LEU B CD2 1 
ATOM   2364 N  N   . LEU B 1 42  ? 37.624 -51.353  192.475 1.00 148.66 ? 42   LEU B N   1 
ATOM   2365 C  CA  . LEU B 1 42  ? 38.310 -52.300  193.356 1.00 147.25 ? 42   LEU B CA  1 
ATOM   2366 C  C   . LEU B 1 42  ? 37.377 -53.322  194.005 1.00 147.36 ? 42   LEU B C   1 
ATOM   2367 O  O   . LEU B 1 42  ? 37.810 -54.408  194.383 1.00 146.40 ? 42   LEU B O   1 
ATOM   2368 C  CB  . LEU B 1 42  ? 39.072 -51.544  194.446 1.00 151.47 ? 42   LEU B CB  1 
ATOM   2369 C  CG  . LEU B 1 42  ? 40.206 -50.631  193.972 1.00 151.02 ? 42   LEU B CG  1 
ATOM   2370 C  CD1 . LEU B 1 42  ? 40.203 -49.325  194.748 1.00 156.63 ? 42   LEU B CD1 1 
ATOM   2371 C  CD2 . LEU B 1 42  ? 41.566 -51.341  194.062 1.00 149.38 ? 42   LEU B CD2 1 
ATOM   2372 N  N   . THR B 1 43  ? 36.096 -52.988  194.113 1.00 148.24 ? 43   THR B N   1 
ATOM   2373 C  CA  . THR B 1 43  ? 35.172 -53.786  194.924 1.00 149.70 ? 43   THR B CA  1 
ATOM   2374 C  C   . THR B 1 43  ? 34.149 -54.606  194.135 1.00 145.98 ? 43   THR B C   1 
ATOM   2375 O  O   . THR B 1 43  ? 33.724 -55.680  194.573 1.00 146.61 ? 43   THR B O   1 
ATOM   2376 C  CB  . THR B 1 43  ? 34.440 -52.887  195.928 1.00 156.00 ? 43   THR B CB  1 
ATOM   2377 O  OG1 . THR B 1 43  ? 34.040 -51.673  195.275 1.00 157.86 ? 43   THR B OG1 1 
ATOM   2378 C  CG2 . THR B 1 43  ? 35.358 -52.530  197.078 1.00 160.01 ? 43   THR B CG2 1 
ATOM   2379 N  N   . VAL B 1 44  ? 33.757 -54.089  192.978 1.00 134.65 ? 44   VAL B N   1 
ATOM   2380 C  CA  . VAL B 1 44  ? 32.795 -54.758  192.130 1.00 131.58 ? 44   VAL B CA  1 
ATOM   2381 C  C   . VAL B 1 44  ? 33.269 -56.151  191.765 1.00 127.43 ? 44   VAL B C   1 
ATOM   2382 O  O   . VAL B 1 44  ? 34.429 -56.487  191.912 1.00 124.52 ? 44   VAL B O   1 
ATOM   2383 C  CB  . VAL B 1 44  ? 32.558 -53.963  190.839 1.00 129.15 ? 44   VAL B CB  1 
ATOM   2384 C  CG1 . VAL B 1 44  ? 31.813 -52.674  191.137 1.00 133.01 ? 44   VAL B CG1 1 
ATOM   2385 C  CG2 . VAL B 1 44  ? 33.888 -53.672  190.153 1.00 123.25 ? 44   VAL B CG2 1 
ATOM   2386 N  N   . SER B 1 45  ? 32.348 -56.961  191.279 1.00 127.49 ? 45   SER B N   1 
ATOM   2387 C  CA  . SER B 1 45  ? 32.647 -58.326  190.908 1.00 125.53 ? 45   SER B CA  1 
ATOM   2388 C  C   . SER B 1 45  ? 33.506 -58.378  189.656 1.00 119.75 ? 45   SER B C   1 
ATOM   2389 O  O   . SER B 1 45  ? 33.489 -57.459  188.840 1.00 117.70 ? 45   SER B O   1 
ATOM   2390 C  CB  . SER B 1 45  ? 31.344 -59.074  190.635 1.00 128.91 ? 45   SER B CB  1 
ATOM   2391 O  OG  . SER B 1 45  ? 30.663 -58.506  189.517 1.00 129.36 ? 45   SER B OG  1 
ATOM   2392 N  N   . TRP B 1 46  ? 34.225 -59.475  189.479 1.00 117.72 ? 46   TRP B N   1 
ATOM   2393 C  CA  . TRP B 1 46  ? 35.074 -59.599  188.316 1.00 113.28 ? 46   TRP B CA  1 
ATOM   2394 C  C   . TRP B 1 46  ? 34.323 -59.340  186.999 1.00 111.84 ? 46   TRP B C   1 
ATOM   2395 O  O   . TRP B 1 46  ? 34.710 -58.439  186.231 1.00 108.95 ? 46   TRP B O   1 
ATOM   2396 C  CB  . TRP B 1 46  ? 35.862 -60.910  188.327 1.00 113.68 ? 46   TRP B CB  1 
ATOM   2397 C  CG  . TRP B 1 46  ? 37.065 -60.816  189.226 1.00 114.15 ? 46   TRP B CG  1 
ATOM   2398 C  CD1 . TRP B 1 46  ? 37.178 -61.310  190.488 1.00 117.69 ? 46   TRP B CD1 1 
ATOM   2399 C  CD2 . TRP B 1 46  ? 38.316 -60.149  188.948 1.00 111.68 ? 46   TRP B CD2 1 
ATOM   2400 N  NE1 . TRP B 1 46  ? 38.420 -61.015  191.009 1.00 117.11 ? 46   TRP B NE1 1 
ATOM   2401 C  CE2 . TRP B 1 46  ? 39.137 -60.308  190.084 1.00 113.38 ? 46   TRP B CE2 1 
ATOM   2402 C  CE3 . TRP B 1 46  ? 38.822 -59.448  187.847 1.00 108.19 ? 46   TRP B CE3 1 
ATOM   2403 C  CZ2 . TRP B 1 46  ? 40.425 -59.785  190.156 1.00 111.95 ? 46   TRP B CZ2 1 
ATOM   2404 C  CZ3 . TRP B 1 46  ? 40.115 -58.936  187.916 1.00 106.43 ? 46   TRP B CZ3 1 
ATOM   2405 C  CH2 . TRP B 1 46  ? 40.896 -59.105  189.064 1.00 109.19 ? 46   TRP B CH2 1 
ATOM   2406 N  N   . PRO B 1 47  ? 33.242 -60.113  186.744 1.00 114.12 ? 47   PRO B N   1 
ATOM   2407 C  CA  . PRO B 1 47  ? 32.387 -59.960  185.562 1.00 113.48 ? 47   PRO B CA  1 
ATOM   2408 C  C   . PRO B 1 47  ? 32.079 -58.494  185.294 1.00 111.53 ? 47   PRO B C   1 
ATOM   2409 O  O   . PRO B 1 47  ? 32.213 -58.017  184.150 1.00 108.86 ? 47   PRO B O   1 
ATOM   2410 C  CB  . PRO B 1 47  ? 31.094 -60.663  185.981 1.00 118.78 ? 47   PRO B CB  1 
ATOM   2411 C  CG  . PRO B 1 47  ? 31.537 -61.703  186.938 1.00 120.71 ? 47   PRO B CG  1 
ATOM   2412 C  CD  . PRO B 1 47  ? 32.725 -61.141  187.667 1.00 118.11 ? 47   PRO B CD  1 
ATOM   2413 N  N   . VAL B 1 48  ? 31.655 -57.795  186.350 1.00 112.79 ? 48   VAL B N   1 
ATOM   2414 C  CA  . VAL B 1 48  ? 31.328 -56.378  186.241 1.00 112.51 ? 48   VAL B CA  1 
ATOM   2415 C  C   . VAL B 1 48  ? 32.570 -55.564  185.911 1.00 107.52 ? 48   VAL B C   1 
ATOM   2416 O  O   . VAL B 1 48  ? 32.532 -54.675  185.055 1.00 106.40 ? 48   VAL B O   1 
ATOM   2417 C  CB  . VAL B 1 48  ? 30.634 -55.826  187.520 1.00 117.43 ? 48   VAL B CB  1 
ATOM   2418 C  CG1 . VAL B 1 48  ? 30.713 -54.298  187.572 1.00 117.14 ? 48   VAL B CG1 1 
ATOM   2419 C  CG2 . VAL B 1 48  ? 29.180 -56.271  187.557 1.00 122.00 ? 48   VAL B CG2 1 
ATOM   2420 N  N   . PHE B 1 49  ? 33.673 -55.891  186.582 1.00 104.66 ? 49   PHE B N   1 
ATOM   2421 C  CA  . PHE B 1 49  ? 34.939 -55.214  186.357 1.00 99.77  ? 49   PHE B CA  1 
ATOM   2422 C  C   . PHE B 1 49  ? 35.393 -55.374  184.905 1.00 96.38  ? 49   PHE B C   1 
ATOM   2423 O  O   . PHE B 1 49  ? 35.773 -54.394  184.256 1.00 94.63  ? 49   PHE B O   1 
ATOM   2424 C  CB  . PHE B 1 49  ? 35.998 -55.755  187.312 1.00 98.70  ? 49   PHE B CB  1 
ATOM   2425 C  CG  . PHE B 1 49  ? 37.371 -55.211  187.057 1.00 93.44  ? 49   PHE B CG  1 
ATOM   2426 C  CD1 . PHE B 1 49  ? 37.720 -53.930  187.487 1.00 91.27  ? 49   PHE B CD1 1 
ATOM   2427 C  CD2 . PHE B 1 49  ? 38.318 -55.969  186.382 1.00 87.77  ? 49   PHE B CD2 1 
ATOM   2428 C  CE1 . PHE B 1 49  ? 38.996 -53.422  187.247 1.00 87.35  ? 49   PHE B CE1 1 
ATOM   2429 C  CE2 . PHE B 1 49  ? 39.598 -55.462  186.147 1.00 84.21  ? 49   PHE B CE2 1 
ATOM   2430 C  CZ  . PHE B 1 49  ? 39.931 -54.188  186.580 1.00 82.94  ? 49   PHE B CZ  1 
ATOM   2431 N  N   . ILE B 1 50  ? 35.347 -56.599  184.390 1.00 95.91  ? 50   ILE B N   1 
ATOM   2432 C  CA  . ILE B 1 50  ? 35.732 -56.847  183.007 1.00 93.64  ? 50   ILE B CA  1 
ATOM   2433 C  C   . ILE B 1 50  ? 34.817 -56.096  182.027 1.00 94.50  ? 50   ILE B C   1 
ATOM   2434 O  O   . ILE B 1 50  ? 35.254 -55.617  180.982 1.00 92.73  ? 50   ILE B O   1 
ATOM   2435 C  CB  . ILE B 1 50  ? 35.730 -58.331  182.702 1.00 95.02  ? 50   ILE B CB  1 
ATOM   2436 C  CG1 . ILE B 1 50  ? 36.776 -59.043  183.567 1.00 95.01  ? 50   ILE B CG1 1 
ATOM   2437 C  CG2 . ILE B 1 50  ? 36.024 -58.555  181.239 1.00 94.39  ? 50   ILE B CG2 1 
ATOM   2438 C  CD1 . ILE B 1 50  ? 36.680 -60.554  183.513 1.00 99.06  ? 50   ILE B CD1 1 
ATOM   2439 N  N   . THR B 1 51  ? 33.547 -55.960  182.384 1.00 97.92  ? 51   THR B N   1 
ATOM   2440 C  CA  . THR B 1 51  ? 32.610 -55.240  181.543 1.00 99.57  ? 51   THR B CA  1 
ATOM   2441 C  C   . THR B 1 51  ? 32.963 -53.758  181.477 1.00 97.95  ? 51   THR B C   1 
ATOM   2442 O  O   . THR B 1 51  ? 32.951 -53.146  180.404 1.00 97.15  ? 51   THR B O   1 
ATOM   2443 C  CB  . THR B 1 51  ? 31.177 -55.449  182.056 1.00 105.22 ? 51   THR B CB  1 
ATOM   2444 O  OG1 . THR B 1 51  ? 30.859 -56.844  181.959 1.00 107.66 ? 51   THR B OG1 1 
ATOM   2445 C  CG2 . THR B 1 51  ? 30.159 -54.639  181.247 1.00 107.89 ? 51   THR B CG2 1 
ATOM   2446 N  N   . LEU B 1 52  ? 33.301 -53.181  182.623 1.00 97.60  ? 52   LEU B N   1 
ATOM   2447 C  CA  . LEU B 1 52  ? 33.690 -51.777  182.664 1.00 96.71  ? 52   LEU B CA  1 
ATOM   2448 C  C   . LEU B 1 52  ? 34.977 -51.522  181.894 1.00 91.98  ? 52   LEU B C   1 
ATOM   2449 O  O   . LEU B 1 52  ? 35.070 -50.557  181.142 1.00 91.62  ? 52   LEU B O   1 
ATOM   2450 C  CB  . LEU B 1 52  ? 33.820 -51.291  184.109 1.00 98.85  ? 52   LEU B CB  1 
ATOM   2451 C  CG  . LEU B 1 52  ? 32.486 -51.226  184.868 1.00 104.08 ? 52   LEU B CG  1 
ATOM   2452 C  CD1 . LEU B 1 52  ? 32.721 -51.238  186.360 1.00 105.79 ? 52   LEU B CD1 1 
ATOM   2453 C  CD2 . LEU B 1 52  ? 31.648 -50.016  184.471 1.00 106.76 ? 52   LEU B CD2 1 
ATOM   2454 N  N   . ILE B 1 53  ? 35.967 -52.388  182.079 1.00 88.76  ? 53   ILE B N   1 
ATOM   2455 C  CA  . ILE B 1 53  ? 37.215 -52.279  181.336 1.00 84.79  ? 53   ILE B CA  1 
ATOM   2456 C  C   . ILE B 1 53  ? 36.897 -52.363  179.848 1.00 84.38  ? 53   ILE B C   1 
ATOM   2457 O  O   . ILE B 1 53  ? 37.316 -51.519  179.038 1.00 82.65  ? 53   ILE B O   1 
ATOM   2458 C  CB  . ILE B 1 53  ? 38.203 -53.402  181.736 1.00 83.03  ? 53   ILE B CB  1 
ATOM   2459 C  CG1 . ILE B 1 53  ? 38.550 -53.278  183.208 1.00 84.54  ? 53   ILE B CG1 1 
ATOM   2460 C  CG2 . ILE B 1 53  ? 39.499 -53.309  180.957 1.00 79.48  ? 53   ILE B CG2 1 
ATOM   2461 C  CD1 . ILE B 1 53  ? 39.050 -51.879  183.590 1.00 85.00  ? 53   ILE B CD1 1 
ATOM   2462 N  N   . THR B 1 54  ? 36.132 -53.384  179.492 1.00 86.07  ? 54   THR B N   1 
ATOM   2463 C  CA  . THR B 1 54  ? 35.782 -53.586  178.106 1.00 86.92  ? 54   THR B CA  1 
ATOM   2464 C  C   . THR B 1 54  ? 35.049 -52.378  177.524 1.00 89.50  ? 54   THR B C   1 
ATOM   2465 O  O   . THR B 1 54  ? 35.373 -51.923  176.406 1.00 88.99  ? 54   THR B O   1 
ATOM   2466 C  CB  . THR B 1 54  ? 34.943 -54.837  177.941 1.00 89.25  ? 54   THR B CB  1 
ATOM   2467 O  OG1 . THR B 1 54  ? 35.753 -55.960  178.293 1.00 87.73  ? 54   THR B OG1 1 
ATOM   2468 C  CG2 . THR B 1 54  ? 34.518 -54.973  176.499 1.00 89.72  ? 54   THR B CG2 1 
ATOM   2469 N  N   . GLY B 1 55  ? 34.074 -51.852  178.275 1.00 92.70  ? 55   GLY B N   1 
ATOM   2470 C  CA  . GLY B 1 55  ? 33.313 -50.712  177.806 1.00 95.95  ? 55   GLY B CA  1 
ATOM   2471 C  C   . GLY B 1 55  ? 34.211 -49.503  177.656 1.00 94.92  ? 55   GLY B C   1 
ATOM   2472 O  O   . GLY B 1 55  ? 34.125 -48.752  176.680 1.00 95.85  ? 55   GLY B O   1 
ATOM   2473 N  N   . LEU B 1 56  ? 35.085 -49.297  178.626 1.00 93.65  ? 56   LEU B N   1 
ATOM   2474 C  CA  . LEU B 1 56  ? 35.917 -48.113  178.576 1.00 93.86  ? 56   LEU B CA  1 
ATOM   2475 C  C   . LEU B 1 56  ? 36.833 -48.224  177.362 1.00 90.20  ? 56   LEU B C   1 
ATOM   2476 O  O   . LEU B 1 56  ? 37.289 -47.228  176.794 1.00 90.07  ? 56   LEU B O   1 
ATOM   2477 C  CB  . LEU B 1 56  ? 36.714 -47.949  179.878 1.00 93.93  ? 56   LEU B CB  1 
ATOM   2478 C  CG  . LEU B 1 56  ? 37.892 -46.963  179.800 1.00 95.11  ? 56   LEU B CG  1 
ATOM   2479 C  CD1 . LEU B 1 56  ? 37.439 -45.529  179.503 1.00 99.26  ? 56   LEU B CD1 1 
ATOM   2480 C  CD2 . LEU B 1 56  ? 38.708 -47.000  181.089 1.00 97.96  ? 56   LEU B CD2 1 
ATOM   2481 N  N   . TYR B 1 57  ? 37.074 -49.455  176.942 1.00 87.75  ? 57   TYR B N   1 
ATOM   2482 C  CA  . TYR B 1 57  ? 37.981 -49.709  175.828 1.00 84.80  ? 57   TYR B CA  1 
ATOM   2483 C  C   . TYR B 1 57  ? 37.302 -49.529  174.461 1.00 86.03  ? 57   TYR B C   1 
ATOM   2484 O  O   . TYR B 1 57  ? 37.893 -48.984  173.519 1.00 84.75  ? 57   TYR B O   1 
ATOM   2485 C  CB  . TYR B 1 57  ? 38.568 -51.091  176.018 1.00 83.09  ? 57   TYR B CB  1 
ATOM   2486 C  CG  . TYR B 1 57  ? 39.191 -51.744  174.825 1.00 82.76  ? 57   TYR B CG  1 
ATOM   2487 C  CD1 . TYR B 1 57  ? 40.518 -51.473  174.451 1.00 80.77  ? 57   TYR B CD1 1 
ATOM   2488 C  CD2 . TYR B 1 57  ? 38.484 -52.696  174.108 1.00 85.16  ? 57   TYR B CD2 1 
ATOM   2489 C  CE1 . TYR B 1 57  ? 41.098 -52.102  173.363 1.00 79.39  ? 57   TYR B CE1 1 
ATOM   2490 C  CE2 . TYR B 1 57  ? 39.061 -53.336  173.029 1.00 86.54  ? 57   TYR B CE2 1 
ATOM   2491 C  CZ  . TYR B 1 57  ? 40.362 -53.033  172.663 1.00 83.29  ? 57   TYR B CZ  1 
ATOM   2492 O  OH  . TYR B 1 57  ? 40.881 -53.698  171.586 1.00 85.92  ? 57   TYR B OH  1 
ATOM   2493 N  N   . LEU B 1 58  ? 36.058 -49.979  174.358 1.00 88.30  ? 58   LEU B N   1 
ATOM   2494 C  CA  . LEU B 1 58  ? 35.262 -49.676  173.183 1.00 90.61  ? 58   LEU B CA  1 
ATOM   2495 C  C   . LEU B 1 58  ? 35.073 -48.160  173.034 1.00 92.68  ? 58   LEU B C   1 
ATOM   2496 O  O   . LEU B 1 58  ? 35.351 -47.576  171.983 1.00 92.64  ? 58   LEU B O   1 
ATOM   2497 C  CB  . LEU B 1 58  ? 33.917 -50.388  173.273 1.00 93.78  ? 58   LEU B CB  1 
ATOM   2498 C  CG  . LEU B 1 58  ? 34.103 -51.904  173.353 1.00 92.37  ? 58   LEU B CG  1 
ATOM   2499 C  CD1 . LEU B 1 58  ? 32.796 -52.634  173.131 1.00 96.43  ? 58   LEU B CD1 1 
ATOM   2500 C  CD2 . LEU B 1 58  ? 35.112 -52.347  172.335 1.00 89.14  ? 58   LEU B CD2 1 
ATOM   2501 N  N   . VAL B 1 59  ? 34.607 -47.515  174.092 1.00 95.08  ? 59   VAL B N   1 
ATOM   2502 C  CA  . VAL B 1 59  ? 34.343 -46.080  174.028 1.00 98.75  ? 59   VAL B CA  1 
ATOM   2503 C  C   . VAL B 1 59  ? 35.565 -45.252  173.606 1.00 96.82  ? 59   VAL B C   1 
ATOM   2504 O  O   . VAL B 1 59  ? 35.448 -44.301  172.833 1.00 99.45  ? 59   VAL B O   1 
ATOM   2505 C  CB  . VAL B 1 59  ? 33.805 -45.563  175.374 1.00 101.87 ? 59   VAL B CB  1 
ATOM   2506 C  CG1 . VAL B 1 59  ? 33.839 -44.027  175.424 1.00 105.08 ? 59   VAL B CG1 1 
ATOM   2507 C  CG2 . VAL B 1 59  ? 32.406 -46.099  175.604 1.00 105.49 ? 59   VAL B CG2 1 
ATOM   2508 N  N   . THR B 1 60  ? 36.736 -45.609  174.121 1.00 93.32  ? 60   THR B N   1 
ATOM   2509 C  CA  . THR B 1 60  ? 37.964 -44.857  173.828 1.00 91.62  ? 60   THR B CA  1 
ATOM   2510 C  C   . THR B 1 60  ? 38.359 -45.029  172.346 1.00 90.74  ? 60   THR B C   1 
ATOM   2511 O  O   . THR B 1 60  ? 38.878 -44.096  171.702 1.00 91.30  ? 60   THR B O   1 
ATOM   2512 C  CB  . THR B 1 60  ? 39.122 -45.272  174.786 1.00 88.40  ? 60   THR B CB  1 
ATOM   2513 O  OG1 . THR B 1 60  ? 38.687 -45.124  176.141 1.00 90.14  ? 60   THR B OG1 1 
ATOM   2514 C  CG2 . THR B 1 60  ? 40.330 -44.402  174.598 1.00 86.96  ? 60   THR B CG2 1 
ATOM   2515 N  N   . ASN B 1 61  ? 38.098 -46.215  171.801 1.00 89.43  ? 61   ASN B N   1 
ATOM   2516 C  CA  . ASN B 1 61  ? 38.303 -46.428  170.381 1.00 89.21  ? 61   ASN B CA  1 
ATOM   2517 C  C   . ASN B 1 61  ? 37.245 -45.697  169.551 1.00 93.37  ? 61   ASN B C   1 
ATOM   2518 O  O   . ASN B 1 61  ? 37.569 -45.125  168.509 1.00 94.26  ? 61   ASN B O   1 
ATOM   2519 C  CB  . ASN B 1 61  ? 38.421 -47.913  170.036 1.00 87.47  ? 61   ASN B CB  1 
ATOM   2520 C  CG  . ASN B 1 61  ? 39.848 -48.443  170.250 1.00 85.74  ? 61   ASN B CG  1 
ATOM   2521 O  OD1 . ASN B 1 61  ? 40.799 -48.017  169.582 1.00 85.90  ? 61   ASN B OD1 1 
ATOM   2522 N  ND2 . ASN B 1 61  ? 40.005 -49.355  171.205 1.00 85.96  ? 61   ASN B ND2 1 
ATOM   2523 N  N   . ALA B 1 62  ? 36.000 -45.690  170.032 1.00 96.47  ? 62   ALA B N   1 
ATOM   2524 C  CA  . ALA B 1 62  ? 34.937 -44.909  169.405 1.00 101.14 ? 62   ALA B CA  1 
ATOM   2525 C  C   . ALA B 1 62  ? 35.403 -43.479  169.299 1.00 102.71 ? 62   ALA B C   1 
ATOM   2526 O  O   . ALA B 1 62  ? 35.281 -42.868  168.245 1.00 105.75 ? 62   ALA B O   1 
ATOM   2527 C  CB  . ALA B 1 62  ? 33.661 -44.982  170.199 1.00 104.23 ? 62   ALA B CB  1 
ATOM   2528 N  N   . LEU B 1 63  ? 35.968 -42.943  170.373 1.00 101.73 ? 63   LEU B N   1 
ATOM   2529 C  CA  . LEU B 1 63  ? 36.412 -41.551  170.353 1.00 104.55 ? 63   LEU B CA  1 
ATOM   2530 C  C   . LEU B 1 63  ? 37.548 -41.300  169.358 1.00 102.35 ? 63   LEU B C   1 
ATOM   2531 O  O   . LEU B 1 63  ? 37.512 -40.334  168.591 1.00 105.66 ? 63   LEU B O   1 
ATOM   2532 C  CB  . LEU B 1 63  ? 36.806 -41.061  171.753 1.00 104.87 ? 63   LEU B CB  1 
ATOM   2533 C  CG  . LEU B 1 63  ? 35.643 -40.831  172.732 1.00 110.58 ? 63   LEU B CG  1 
ATOM   2534 C  CD1 . LEU B 1 63  ? 36.129 -40.423  174.133 1.00 110.08 ? 63   LEU B CD1 1 
ATOM   2535 C  CD2 . LEU B 1 63  ? 34.670 -39.791  172.150 1.00 117.19 ? 63   LEU B CD2 1 
ATOM   2536 N  N   . PHE B 1 64  ? 38.561 -42.156  169.363 1.00 97.27  ? 64   PHE B N   1 
ATOM   2537 C  CA  . PHE B 1 64  ? 39.622 -41.996  168.390 1.00 95.56  ? 64   PHE B CA  1 
ATOM   2538 C  C   . PHE B 1 64  ? 39.112 -42.126  166.944 1.00 98.39  ? 64   PHE B C   1 
ATOM   2539 O  O   . PHE B 1 64  ? 39.557 -41.404  166.059 1.00 99.76  ? 64   PHE B O   1 
ATOM   2540 C  CB  . PHE B 1 64  ? 40.789 -42.941  168.673 1.00 90.43  ? 64   PHE B CB  1 
ATOM   2541 C  CG  . PHE B 1 64  ? 41.770 -42.386  169.661 1.00 88.57  ? 64   PHE B CG  1 
ATOM   2542 C  CD1 . PHE B 1 64  ? 41.717 -42.750  171.006 1.00 86.15  ? 64   PHE B CD1 1 
ATOM   2543 C  CD2 . PHE B 1 64  ? 42.725 -41.469  169.260 1.00 88.35  ? 64   PHE B CD2 1 
ATOM   2544 C  CE1 . PHE B 1 64  ? 42.607 -42.221  171.925 1.00 84.21  ? 64   PHE B CE1 1 
ATOM   2545 C  CE2 . PHE B 1 64  ? 43.626 -40.934  170.182 1.00 88.99  ? 64   PHE B CE2 1 
ATOM   2546 C  CZ  . PHE B 1 64  ? 43.563 -41.319  171.523 1.00 86.12  ? 64   PHE B CZ  1 
ATOM   2547 N  N   . ALA B 1 65  ? 38.180 -43.043  166.700 1.00 99.60  ? 65   ALA B N   1 
ATOM   2548 C  CA  . ALA B 1 65  ? 37.697 -43.247  165.348 1.00 102.59 ? 65   ALA B CA  1 
ATOM   2549 C  C   . ALA B 1 65  ? 37.075 -41.937  164.838 1.00 108.53 ? 65   ALA B C   1 
ATOM   2550 O  O   . ALA B 1 65  ? 37.288 -41.521  163.688 1.00 110.46 ? 65   ALA B O   1 
ATOM   2551 C  CB  . ALA B 1 65  ? 36.703 -44.380  165.309 1.00 103.43 ? 65   ALA B CB  1 
ATOM   2552 N  N   . LEU B 1 66  ? 36.317 -41.287  165.713 1.00 111.68 ? 66   LEU B N   1 
ATOM   2553 C  CA  . LEU B 1 66  ? 35.701 -40.024  165.393 1.00 117.92 ? 66   LEU B CA  1 
ATOM   2554 C  C   . LEU B 1 66  ? 36.775 -39.016  165.089 1.00 118.06 ? 66   LEU B C   1 
ATOM   2555 O  O   . LEU B 1 66  ? 36.700 -38.316  164.084 1.00 122.33 ? 66   LEU B O   1 
ATOM   2556 C  CB  . LEU B 1 66  ? 34.855 -39.532  166.558 1.00 121.01 ? 66   LEU B CB  1 
ATOM   2557 C  CG  . LEU B 1 66  ? 33.655 -40.426  166.860 1.00 122.49 ? 66   LEU B CG  1 
ATOM   2558 C  CD1 . LEU B 1 66  ? 32.720 -39.745  167.844 1.00 126.24 ? 66   LEU B CD1 1 
ATOM   2559 C  CD2 . LEU B 1 66  ? 32.923 -40.792  165.568 1.00 125.22 ? 66   LEU B CD2 1 
ATOM   2560 N  N   . ALA B 1 67  ? 37.774 -38.941  165.957 1.00 114.65 ? 67   ALA B N   1 
ATOM   2561 C  CA  . ALA B 1 67  ? 38.852 -37.988  165.777 1.00 115.36 ? 67   ALA B CA  1 
ATOM   2562 C  C   . ALA B 1 67  ? 39.396 -38.131  164.362 1.00 115.66 ? 67   ALA B C   1 
ATOM   2563 O  O   . ALA B 1 67  ? 39.419 -37.156  163.587 1.00 120.50 ? 67   ALA B O   1 
ATOM   2564 C  CB  . ALA B 1 67  ? 39.941 -38.194  166.812 1.00 110.78 ? 67   ALA B CB  1 
ATOM   2565 N  N   . TYR B 1 68  ? 39.792 -39.354  163.999 1.00 112.26 ? 68   TYR B N   1 
ATOM   2566 C  CA  . TYR B 1 68  ? 40.262 -39.589  162.634 1.00 113.51 ? 68   TYR B CA  1 
ATOM   2567 C  C   . TYR B 1 68  ? 39.289 -39.099  161.550 1.00 119.76 ? 68   TYR B C   1 
ATOM   2568 O  O   . TYR B 1 68  ? 39.711 -38.526  160.544 1.00 122.19 ? 68   TYR B O   1 
ATOM   2569 C  CB  . TYR B 1 68  ? 40.592 -41.061  162.422 1.00 109.86 ? 68   TYR B CB  1 
ATOM   2570 C  CG  . TYR B 1 68  ? 41.792 -41.499  163.219 1.00 106.14 ? 68   TYR B CG  1 
ATOM   2571 C  CD1 . TYR B 1 68  ? 43.022 -40.886  163.039 1.00 105.99 ? 68   TYR B CD1 1 
ATOM   2572 C  CD2 . TYR B 1 68  ? 41.698 -42.523  164.152 1.00 103.41 ? 68   TYR B CD2 1 
ATOM   2573 C  CE1 . TYR B 1 68  ? 44.120 -41.284  163.761 1.00 103.60 ? 68   TYR B CE1 1 
ATOM   2574 C  CE2 . TYR B 1 68  ? 42.788 -42.921  164.881 1.00 100.19 ? 68   TYR B CE2 1 
ATOM   2575 C  CZ  . TYR B 1 68  ? 43.997 -42.300  164.690 1.00 99.96  ? 68   TYR B CZ  1 
ATOM   2576 O  OH  . TYR B 1 68  ? 45.093 -42.697  165.426 1.00 97.72  ? 68   TYR B OH  1 
ATOM   2577 N  N   . LEU B 1 69  ? 37.995 -39.334  161.748 1.00 122.95 ? 69   LEU B N   1 
ATOM   2578 C  CA  . LEU B 1 69  ? 37.004 -38.872  160.790 1.00 129.82 ? 69   LEU B CA  1 
ATOM   2579 C  C   . LEU B 1 69  ? 36.933 -37.342  160.751 1.00 135.52 ? 69   LEU B C   1 
ATOM   2580 O  O   . LEU B 1 69  ? 36.812 -36.747  159.682 1.00 139.84 ? 69   LEU B O   1 
ATOM   2581 C  CB  . LEU B 1 69  ? 35.636 -39.490  161.072 1.00 132.09 ? 69   LEU B CB  1 
ATOM   2582 C  CG  . LEU B 1 69  ? 35.620 -40.979  160.725 1.00 128.39 ? 69   LEU B CG  1 
ATOM   2583 C  CD1 . LEU B 1 69  ? 34.214 -41.564  160.725 1.00 132.10 ? 69   LEU B CD1 1 
ATOM   2584 C  CD2 . LEU B 1 69  ? 36.302 -41.213  159.393 1.00 126.17 ? 69   LEU B CD2 1 
ATOM   2585 N  N   . ALA B 1 70  ? 37.025 -36.710  161.916 1.00 135.99 ? 70   ALA B N   1 
ATOM   2586 C  CA  . ALA B 1 70  ? 37.117 -35.265  161.966 1.00 141.95 ? 70   ALA B CA  1 
ATOM   2587 C  C   . ALA B 1 70  ? 38.129 -34.732  160.939 1.00 142.89 ? 70   ALA B C   1 
ATOM   2588 O  O   . ALA B 1 70  ? 37.895 -33.705  160.285 1.00 149.91 ? 70   ALA B O   1 
ATOM   2589 C  CB  . ALA B 1 70  ? 37.458 -34.775  163.411 1.00 163.60 ? 70   ALA B CB  1 
ATOM   2590 N  N   . CYS B 1 71  ? 39.242 -35.451  160.775 1.00 137.65 ? 71   CYS B N   1 
ATOM   2591 C  CA  . CYS B 1 71  ? 40.285 -34.979  159.843 1.00 138.65 ? 71   CYS B CA  1 
ATOM   2592 C  C   . CYS B 1 71  ? 40.064 -35.348  158.378 1.00 141.43 ? 71   CYS B C   1 
ATOM   2593 O  O   . CYS B 1 71  ? 40.912 -35.040  157.548 1.00 142.16 ? 71   CYS B O   1 
ATOM   2594 C  CB  . CYS B 1 71  ? 41.641 -35.579  160.231 1.00 132.56 ? 71   CYS B CB  1 
ATOM   2595 S  SG  . CYS B 1 71  ? 41.831 -35.749  161.989 1.00 128.98 ? 71   CYS B SG  1 
ATOM   2596 N  N   . GLY B 1 72  ? 38.983 -36.058  158.062 1.00 137.39 ? 72   GLY B N   1 
ATOM   2597 C  CA  . GLY B 1 72  ? 38.731 -36.458  156.675 1.00 140.80 ? 72   GLY B CA  1 
ATOM   2598 C  C   . GLY B 1 72  ? 39.004 -37.926  156.388 1.00 136.29 ? 72   GLY B C   1 
ATOM   2599 O  O   . GLY B 1 72  ? 38.536 -38.811  157.115 1.00 132.36 ? 72   GLY B O   1 
ATOM   2600 N  N   . ASP B 1 73  ? 39.732 -38.188  155.299 1.00 210.54 ? 73   ASP B N   1 
ATOM   2601 C  CA  . ASP B 1 73  ? 40.175 -39.541  154.993 1.00 184.81 ? 73   ASP B CA  1 
ATOM   2602 C  C   . ASP B 1 73  ? 41.661 -39.629  155.264 1.00 158.74 ? 73   ASP B C   1 
ATOM   2603 O  O   . ASP B 1 73  ? 42.433 -39.810  154.328 1.00 154.00 ? 73   ASP B O   1 
ATOM   2604 C  CB  . ASP B 1 73  ? 39.952 -39.888  153.510 1.00 138.72 ? 73   ASP B CB  1 
ATOM   2605 C  CG  . ASP B 1 73  ? 38.523 -39.679  153.065 1.00 167.52 ? 73   ASP B CG  1 
ATOM   2606 O  OD1 . ASP B 1 73  ? 37.962 -40.598  152.429 1.00 169.57 ? 73   ASP B OD1 1 
ATOM   2607 O  OD2 . ASP B 1 73  ? 37.963 -38.598  153.336 1.00 192.95 ? 73   ASP B OD2 1 
ATOM   2608 N  N   . VAL B 1 74  ? 42.077 -39.491  156.518 1.00 126.77 ? 74   VAL B N   1 
ATOM   2609 C  CA  . VAL B 1 74  ? 43.504 -39.581  156.827 1.00 124.16 ? 74   VAL B CA  1 
ATOM   2610 C  C   . VAL B 1 74  ? 43.942 -41.028  157.118 1.00 119.07 ? 74   VAL B C   1 
ATOM   2611 O  O   . VAL B 1 74  ? 45.078 -41.276  157.536 1.00 117.33 ? 74   VAL B O   1 
ATOM   2612 C  CB  . VAL B 1 74  ? 43.936 -38.615  157.957 1.00 124.11 ? 74   VAL B CB  1 
ATOM   2613 C  CG1 . VAL B 1 74  ? 44.167 -37.206  157.424 1.00 129.32 ? 74   VAL B CG1 1 
ATOM   2614 C  CG2 . VAL B 1 74  ? 42.912 -38.612  159.068 1.00 122.21 ? 74   VAL B CG2 1 
ATOM   2615 N  N   . ILE B 1 75  ? 43.052 -41.984  156.868 1.00 117.06 ? 75   ILE B N   1 
ATOM   2616 C  CA  . ILE B 1 75  ? 43.451 -43.383  156.937 1.00 113.12 ? 75   ILE B CA  1 
ATOM   2617 C  C   . ILE B 1 75  ? 43.449 -44.022  155.557 1.00 115.80 ? 75   ILE B C   1 
ATOM   2618 O  O   . ILE B 1 75  ? 42.392 -44.159  154.943 1.00 117.97 ? 75   ILE B O   1 
ATOM   2619 C  CB  . ILE B 1 75  ? 42.525 -44.224  157.854 1.00 109.85 ? 75   ILE B CB  1 
ATOM   2620 C  CG1 . ILE B 1 75  ? 42.335 -43.561  159.223 1.00 106.64 ? 75   ILE B CG1 1 
ATOM   2621 C  CG2 . ILE B 1 75  ? 43.083 -45.641  157.996 1.00 106.36 ? 75   ILE B CG2 1 
ATOM   2622 C  CD1 . ILE B 1 75  ? 41.125 -44.074  159.986 1.00 102.13 ? 75   ILE B CD1 1 
ATOM   2623 N  N   . GLU B 1 76  ? 44.624 -44.428  155.076 1.00 116.13 ? 76   GLU B N   1 
ATOM   2624 C  CA  . GLU B 1 76  ? 44.716 -45.163  153.814 1.00 119.01 ? 76   GLU B CA  1 
ATOM   2625 C  C   . GLU B 1 76  ? 43.889 -46.454  153.854 1.00 117.26 ? 76   GLU B C   1 
ATOM   2626 O  O   . GLU B 1 76  ? 43.816 -47.124  154.886 1.00 114.16 ? 76   GLU B O   1 
ATOM   2627 C  CB  . GLU B 1 76  ? 46.178 -45.487  153.466 1.00 119.96 ? 76   GLU B CB  1 
ATOM   2628 C  CG  . GLU B 1 76  ? 46.989 -44.258  153.020 1.00 125.09 ? 76   GLU B CG  1 
ATOM   2629 C  CD  . GLU B 1 76  ? 48.081 -44.603  152.010 1.00 130.57 ? 76   GLU B CD  1 
ATOM   2630 O  OE1 . GLU B 1 76  ? 49.284 -44.502  152.366 1.00 131.79 ? 76   GLU B OE1 1 
ATOM   2631 O  OE2 . GLU B 1 76  ? 47.736 -44.968  150.859 1.00 134.28 ? 76   GLU B OE2 1 
ATOM   2632 N  N   . ASN B 1 77  ? 43.272 -46.794  152.725 1.00 120.38 ? 77   ASN B N   1 
ATOM   2633 C  CA  . ASN B 1 77  ? 42.543 -48.050  152.578 1.00 119.68 ? 77   ASN B CA  1 
ATOM   2634 C  C   . ASN B 1 77  ? 41.288 -48.201  153.419 1.00 118.09 ? 77   ASN B C   1 
ATOM   2635 O  O   . ASN B 1 77  ? 40.803 -49.326  153.628 1.00 117.15 ? 77   ASN B O   1 
ATOM   2636 C  CB  . ASN B 1 77  ? 43.458 -49.237  152.815 1.00 117.18 ? 77   ASN B CB  1 
ATOM   2637 C  CG  . ASN B 1 77  ? 44.433 -49.419  151.708 1.00 119.83 ? 77   ASN B CG  1 
ATOM   2638 O  OD1 . ASN B 1 77  ? 44.047 -49.600  150.551 1.00 125.94 ? 77   ASN B OD1 1 
ATOM   2639 N  ND2 . ASN B 1 77  ? 45.710 -49.359  152.035 1.00 116.77 ? 77   ASN B ND2 1 
ATOM   2640 N  N   . ALA B 1 78  ? 40.745 -47.072  153.871 1.00 118.38 ? 78   ALA B N   1 
ATOM   2641 C  CA  . ALA B 1 78  ? 39.483 -47.081  154.613 1.00 118.68 ? 78   ALA B CA  1 
ATOM   2642 C  C   . ALA B 1 78  ? 38.306 -46.430  153.852 1.00 124.63 ? 78   ALA B C   1 
ATOM   2643 O  O   . ALA B 1 78  ? 38.342 -45.242  153.526 1.00 127.44 ? 78   ALA B O   1 
ATOM   2644 C  CB  . ALA B 1 78  ? 39.672 -46.413  155.958 1.00 114.74 ? 78   ALA B CB  1 
ATOM   2645 N  N   . ARG B 1 79  ? 37.254 -47.196  153.576 1.00 127.82 ? 79   ARG B N   1 
ATOM   2646 C  CA  . ARG B 1 79  ? 36.068 -46.600  152.971 1.00 134.04 ? 79   ARG B CA  1 
ATOM   2647 C  C   . ARG B 1 79  ? 35.891 -45.189  153.539 1.00 134.31 ? 79   ARG B C   1 
ATOM   2648 O  O   . ARG B 1 79  ? 35.862 -45.005  154.751 1.00 130.41 ? 79   ARG B O   1 
ATOM   2649 C  CB  . ARG B 1 79  ? 34.833 -47.463  153.228 1.00 136.10 ? 79   ARG B CB  1 
ATOM   2650 C  CG  . ARG B 1 79  ? 34.860 -48.794  152.492 1.00 138.67 ? 79   ARG B CG  1 
ATOM   2651 C  CD  . ARG B 1 79  ? 33.774 -49.716  152.994 1.00 141.02 ? 79   ARG B CD  1 
ATOM   2652 N  NE  . ARG B 1 79  ? 34.033 -50.097  154.372 1.00 136.53 ? 79   ARG B NE  1 
ATOM   2653 C  CZ  . ARG B 1 79  ? 33.263 -50.912  155.079 1.00 138.62 ? 79   ARG B CZ  1 
ATOM   2654 N  NH1 . ARG B 1 79  ? 32.177 -51.432  154.529 1.00 144.29 ? 79   ARG B NH1 1 
ATOM   2655 N  NH2 . ARG B 1 79  ? 33.583 -51.211  156.342 1.00 134.33 ? 79   ARG B NH2 1 
ATOM   2656 N  N   . PRO B 1 80  ? 35.790 -44.173  152.661 1.00 139.88 ? 80   PRO B N   1 
ATOM   2657 C  CA  . PRO B 1 80  ? 35.708 -42.813  153.209 1.00 140.40 ? 80   PRO B CA  1 
ATOM   2658 C  C   . PRO B 1 80  ? 34.528 -42.626  154.186 1.00 140.69 ? 80   PRO B C   1 
ATOM   2659 O  O   . PRO B 1 80  ? 33.432 -43.142  153.951 1.00 155.83 ? 80   PRO B O   1 
ATOM   2660 C  CB  . PRO B 1 80  ? 35.526 -41.940  151.952 1.00 147.90 ? 80   PRO B CB  1 
ATOM   2661 C  CG  . PRO B 1 80  ? 36.039 -42.778  150.814 1.00 149.40 ? 80   PRO B CG  1 
ATOM   2662 C  CD  . PRO B 1 80  ? 35.701 -44.189  151.186 1.00 146.05 ? 80   PRO B CD  1 
ATOM   2663 N  N   . GLY B 1 81  ? 34.761 -41.900  155.274 1.00 137.28 ? 81   GLY B N   1 
ATOM   2664 C  CA  . GLY B 1 81  ? 33.684 -41.532  156.182 1.00 138.58 ? 81   GLY B CA  1 
ATOM   2665 C  C   . GLY B 1 81  ? 33.153 -42.686  157.007 1.00 135.61 ? 81   GLY B C   1 
ATOM   2666 O  O   . GLY B 1 81  ? 32.230 -42.502  157.802 1.00 137.60 ? 81   GLY B O   1 
ATOM   2667 N  N   . SER B 1 82  ? 33.740 -43.872  156.835 1.00 138.49 ? 82   SER B N   1 
ATOM   2668 C  CA  . SER B 1 82  ? 33.276 -45.089  157.507 1.00 134.07 ? 82   SER B CA  1 
ATOM   2669 C  C   . SER B 1 82  ? 33.716 -45.164  158.951 1.00 128.20 ? 82   SER B C   1 
ATOM   2670 O  O   . SER B 1 82  ? 34.914 -45.137  159.243 1.00 124.51 ? 82   SER B O   1 
ATOM   2671 C  CB  . SER B 1 82  ? 33.782 -46.335  156.784 1.00 132.70 ? 82   SER B CB  1 
ATOM   2672 O  OG  . SER B 1 82  ? 33.498 -47.498  157.540 1.00 129.24 ? 82   SER B OG  1 
ATOM   2673 N  N   . PHE B 1 83  ? 32.749 -45.277  159.854 1.00 127.46 ? 83   PHE B N   1 
ATOM   2674 C  CA  . PHE B 1 83  ? 33.075 -45.371  161.272 1.00 122.99 ? 83   PHE B CA  1 
ATOM   2675 C  C   . PHE B 1 83  ? 33.797 -46.680  161.601 1.00 117.57 ? 83   PHE B C   1 
ATOM   2676 O  O   . PHE B 1 83  ? 34.756 -46.704  162.371 1.00 114.08 ? 83   PHE B O   1 
ATOM   2677 C  CB  . PHE B 1 83  ? 31.825 -45.250  162.133 1.00 124.55 ? 83   PHE B CB  1 
ATOM   2678 C  CG  . PHE B 1 83  ? 32.108 -45.341  163.592 1.00 120.50 ? 83   PHE B CG  1 
ATOM   2679 C  CD1 . PHE B 1 83  ? 32.607 -44.249  164.281 1.00 120.14 ? 83   PHE B CD1 1 
ATOM   2680 C  CD2 . PHE B 1 83  ? 31.900 -46.531  164.276 1.00 117.33 ? 83   PHE B CD2 1 
ATOM   2681 C  CE1 . PHE B 1 83  ? 32.877 -44.337  165.627 1.00 117.17 ? 83   PHE B CE1 1 
ATOM   2682 C  CE2 . PHE B 1 83  ? 32.166 -46.623  165.622 1.00 112.53 ? 83   PHE B CE2 1 
ATOM   2683 C  CZ  . PHE B 1 83  ? 32.657 -45.526  166.297 1.00 113.32 ? 83   PHE B CZ  1 
ATOM   2684 N  N   . THR B 1 84  ? 33.321 -47.765  161.004 1.00 117.59 ? 84   THR B N   1 
ATOM   2685 C  CA  . THR B 1 84  ? 33.907 -49.078  161.182 1.00 113.36 ? 84   THR B CA  1 
ATOM   2686 C  C   . THR B 1 84  ? 35.403 -49.128  160.969 1.00 109.91 ? 84   THR B C   1 
ATOM   2687 O  O   . THR B 1 84  ? 36.161 -49.574  161.835 1.00 106.36 ? 84   THR B O   1 
ATOM   2688 C  CB  . THR B 1 84  ? 33.334 -50.032  160.164 1.00 116.40 ? 84   THR B CB  1 
ATOM   2689 O  OG1 . THR B 1 84  ? 32.057 -50.473  160.624 1.00 118.47 ? 84   THR B OG1 1 
ATOM   2690 C  CG2 . THR B 1 84  ? 34.265 -51.225  159.982 1.00 114.23 ? 84   THR B CG2 1 
ATOM   2691 N  N   . ASP B 1 85  ? 35.813 -48.713  159.783 1.00 111.57 ? 85   ASP B N   1 
ATOM   2692 C  CA  . ASP B 1 85  ? 37.193 -48.800  159.393 1.00 108.82 ? 85   ASP B CA  1 
ATOM   2693 C  C   . ASP B 1 85  ? 38.043 -47.879  160.266 1.00 104.68 ? 85   ASP B C   1 
ATOM   2694 O  O   . ASP B 1 85  ? 39.194 -48.188  160.567 1.00 101.56 ? 85   ASP B O   1 
ATOM   2695 C  CB  . ASP B 1 85  ? 37.324 -48.450  157.910 1.00 114.09 ? 85   ASP B CB  1 
ATOM   2696 C  CG  . ASP B 1 85  ? 36.516 -49.376  157.012 1.00 119.32 ? 85   ASP B CG  1 
ATOM   2697 O  OD1 . ASP B 1 85  ? 35.719 -50.184  157.544 1.00 121.49 ? 85   ASP B OD1 1 
ATOM   2698 O  OD2 . ASP B 1 85  ? 36.676 -49.298  155.777 1.00 125.31 ? 85   ASP B OD2 1 
ATOM   2699 N  N   . ALA B 1 86  ? 37.465 -46.759  160.679 1.00 104.65 ? 86   ALA B N   1 
ATOM   2700 C  CA  . ALA B 1 86  ? 38.176 -45.808  161.516 1.00 102.08 ? 86   ALA B CA  1 
ATOM   2701 C  C   . ALA B 1 86  ? 38.355 -46.380  162.929 1.00 97.08  ? 86   ALA B C   1 
ATOM   2702 O  O   . ALA B 1 86  ? 39.356 -46.127  163.603 1.00 94.68  ? 86   ALA B O   1 
ATOM   2703 C  CB  . ALA B 1 86  ? 37.435 -44.498  161.562 1.00 106.11 ? 86   ALA B CB  1 
ATOM   2704 N  N   . PHE B 1 87  ? 37.365 -47.154  163.354 1.00 95.26  ? 87   PHE B N   1 
ATOM   2705 C  CA  . PHE B 1 87  ? 37.371 -47.825  164.622 1.00 90.78  ? 87   PHE B CA  1 
ATOM   2706 C  C   . PHE B 1 87  ? 38.425 -48.933  164.666 1.00 87.37  ? 87   PHE B C   1 
ATOM   2707 O  O   . PHE B 1 87  ? 39.306 -48.955  165.544 1.00 84.74  ? 87   PHE B O   1 
ATOM   2708 C  CB  . PHE B 1 87  ? 35.999 -48.428  164.842 1.00 91.82  ? 87   PHE B CB  1 
ATOM   2709 C  CG  . PHE B 1 87  ? 35.864 -49.192  166.121 1.00 87.85  ? 87   PHE B CG  1 
ATOM   2710 C  CD1 . PHE B 1 87  ? 35.542 -48.534  167.304 1.00 87.46  ? 87   PHE B CD1 1 
ATOM   2711 C  CD2 . PHE B 1 87  ? 36.027 -50.568  166.142 1.00 84.68  ? 87   PHE B CD2 1 
ATOM   2712 C  CE1 . PHE B 1 87  ? 35.394 -49.237  168.500 1.00 86.15  ? 87   PHE B CE1 1 
ATOM   2713 C  CE2 . PHE B 1 87  ? 35.870 -51.289  167.332 1.00 82.61  ? 87   PHE B CE2 1 
ATOM   2714 C  CZ  . PHE B 1 87  ? 35.549 -50.621  168.512 1.00 82.42  ? 87   PHE B CZ  1 
ATOM   2715 N  N   . PHE B 1 88  ? 38.332 -49.867  163.729 1.00 87.37  ? 88   PHE B N   1 
ATOM   2716 C  CA  . PHE B 1 88  ? 39.290 -50.951  163.696 1.00 84.57  ? 88   PHE B CA  1 
ATOM   2717 C  C   . PHE B 1 88  ? 40.683 -50.416  163.472 1.00 82.83  ? 88   PHE B C   1 
ATOM   2718 O  O   . PHE B 1 88  ? 41.652 -50.990  163.971 1.00 81.43  ? 88   PHE B O   1 
ATOM   2719 C  CB  . PHE B 1 88  ? 38.912 -51.992  162.662 1.00 86.90  ? 88   PHE B CB  1 
ATOM   2720 C  CG  . PHE B 1 88  ? 37.624 -52.693  162.983 1.00 90.56  ? 88   PHE B CG  1 
ATOM   2721 C  CD1 . PHE B 1 88  ? 37.268 -52.930  164.305 1.00 89.33  ? 88   PHE B CD1 1 
ATOM   2722 C  CD2 . PHE B 1 88  ? 36.762 -53.114  161.979 1.00 95.91  ? 88   PHE B CD2 1 
ATOM   2723 C  CE1 . PHE B 1 88  ? 36.088 -53.580  164.621 1.00 91.62  ? 88   PHE B CE1 1 
ATOM   2724 C  CE2 . PHE B 1 88  ? 35.574 -53.769  162.284 1.00 97.22  ? 88   PHE B CE2 1 
ATOM   2725 C  CZ  . PHE B 1 88  ? 35.238 -53.999  163.610 1.00 96.25  ? 88   PHE B CZ  1 
ATOM   2726 N  N   . PHE B 1 89  ? 40.803 -49.303  162.752 1.00 83.57  ? 89   PHE B N   1 
ATOM   2727 C  CA  . PHE B 1 89  ? 42.112 -48.676  162.621 1.00 80.93  ? 89   PHE B CA  1 
ATOM   2728 C  C   . PHE B 1 89  ? 42.634 -48.235  163.983 1.00 78.76  ? 89   PHE B C   1 
ATOM   2729 O  O   . PHE B 1 89  ? 43.808 -48.442  164.324 1.00 77.21  ? 89   PHE B O   1 
ATOM   2730 C  CB  . PHE B 1 89  ? 42.099 -47.462  161.703 1.00 82.79  ? 89   PHE B CB  1 
ATOM   2731 C  CG  . PHE B 1 89  ? 43.416 -46.775  161.659 1.00 77.33  ? 89   PHE B CG  1 
ATOM   2732 C  CD1 . PHE B 1 89  ? 44.527 -47.437  161.145 1.00 72.01  ? 89   PHE B CD1 1 
ATOM   2733 C  CD2 . PHE B 1 89  ? 43.573 -45.510  162.214 1.00 74.00  ? 89   PHE B CD2 1 
ATOM   2734 C  CE1 . PHE B 1 89  ? 45.784 -46.816  161.133 1.00 73.58  ? 89   PHE B CE1 1 
ATOM   2735 C  CE2 . PHE B 1 89  ? 44.814 -44.861  162.209 1.00 73.08  ? 89   PHE B CE2 1 
ATOM   2736 C  CZ  . PHE B 1 89  ? 45.926 -45.514  161.681 1.00 73.90  ? 89   PHE B CZ  1 
ATOM   2737 N  N   . SER B 1 90  ? 41.757 -47.586  164.736 1.00 79.53  ? 90   SER B N   1 
ATOM   2738 C  CA  . SER B 1 90  ? 42.071 -47.142  166.073 1.00 78.70  ? 90   SER B CA  1 
ATOM   2739 C  C   . SER B 1 90  ? 42.513 -48.369  166.876 1.00 76.21  ? 90   SER B C   1 
ATOM   2740 O  O   . SER B 1 90  ? 43.638 -48.412  167.411 1.00 74.57  ? 90   SER B O   1 
ATOM   2741 C  CB  . SER B 1 90  ? 40.836 -46.516  166.709 1.00 80.48  ? 90   SER B CB  1 
ATOM   2742 O  OG  . SER B 1 90  ? 41.083 -46.195  168.071 1.00 80.72  ? 90   SER B OG  1 
ATOM   2743 N  N   . VAL B 1 91  ? 41.630 -49.374  166.926 1.00 75.81  ? 91   VAL B N   1 
ATOM   2744 C  CA  . VAL B 1 91  ? 41.938 -50.614  167.612 1.00 73.97  ? 91   VAL B CA  1 
ATOM   2745 C  C   . VAL B 1 91  ? 43.344 -51.122  167.305 1.00 72.89  ? 91   VAL B C   1 
ATOM   2746 O  O   . VAL B 1 91  ? 44.068 -51.470  168.207 1.00 72.63  ? 91   VAL B O   1 
ATOM   2747 C  CB  . VAL B 1 91  ? 40.928 -51.744  167.306 1.00 74.98  ? 91   VAL B CB  1 
ATOM   2748 C  CG1 . VAL B 1 91  ? 41.541 -53.097  167.694 1.00 73.66  ? 91   VAL B CG1 1 
ATOM   2749 C  CG2 . VAL B 1 91  ? 39.616 -51.526  168.057 1.00 76.59  ? 91   VAL B CG2 1 
ATOM   2750 N  N   . GLN B 1 92  ? 43.736 -51.171  166.042 1.00 73.97  ? 92   GLN B N   1 
ATOM   2751 C  CA  . GLN B 1 92  ? 45.008 -51.776  165.693 1.00 73.53  ? 92   GLN B CA  1 
ATOM   2752 C  C   . GLN B 1 92  ? 46.161 -50.882  166.068 1.00 72.69  ? 92   GLN B C   1 
ATOM   2753 O  O   . GLN B 1 92  ? 47.306 -51.322  166.100 1.00 72.52  ? 92   GLN B O   1 
ATOM   2754 C  CB  . GLN B 1 92  ? 45.060 -52.036  164.197 1.00 75.69  ? 92   GLN B CB  1 
ATOM   2755 C  CG  . GLN B 1 92  ? 43.906 -52.864  163.734 1.00 77.97  ? 92   GLN B CG  1 
ATOM   2756 C  CD  . GLN B 1 92  ? 43.872 -53.116  162.226 1.00 82.05  ? 92   GLN B CD  1 
ATOM   2757 O  OE1 . GLN B 1 92  ? 42.865 -53.584  161.730 1.00 84.54  ? 92   GLN B OE1 1 
ATOM   2758 N  NE2 . GLN B 1 92  ? 44.960 -52.817  161.508 1.00 81.96  ? 92   GLN B NE2 1 
ATOM   2759 N  N   . THR B 1 93  ? 45.850 -49.609  166.284 1.00 72.53  ? 93   THR B N   1 
ATOM   2760 C  CA  . THR B 1 93  ? 46.834 -48.624  166.649 1.00 72.46  ? 93   THR B CA  1 
ATOM   2761 C  C   . THR B 1 93  ? 47.011 -48.720  168.169 1.00 70.80  ? 93   THR B C   1 
ATOM   2762 O  O   . THR B 1 93  ? 48.126 -48.810  168.707 1.00 69.28  ? 93   THR B O   1 
ATOM   2763 C  CB  . THR B 1 93  ? 46.319 -47.213  166.252 1.00 75.31  ? 93   THR B CB  1 
ATOM   2764 O  OG1 . THR B 1 93  ? 46.111 -47.159  164.825 1.00 78.98  ? 93   THR B OG1 1 
ATOM   2765 C  CG2 . THR B 1 93  ? 47.291 -46.114  166.667 1.00 76.01  ? 93   THR B CG2 1 
ATOM   2766 N  N   . MET B 1 94  ? 45.888 -48.732  168.869 1.00 70.57  ? 94   MET B N   1 
ATOM   2767 C  CA  . MET B 1 94  ? 45.956 -48.660  170.310 1.00 69.78  ? 94   MET B CA  1 
ATOM   2768 C  C   . MET B 1 94  ? 46.506 -49.955  170.850 1.00 67.33  ? 94   MET B C   1 
ATOM   2769 O  O   . MET B 1 94  ? 47.357 -49.925  171.721 1.00 66.47  ? 94   MET B O   1 
ATOM   2770 C  CB  . MET B 1 94  ? 44.598 -48.338  170.916 1.00 71.63  ? 94   MET B CB  1 
ATOM   2771 C  CG  . MET B 1 94  ? 44.656 -47.964  172.412 1.00 74.27  ? 94   MET B CG  1 
ATOM   2772 S  SD  . MET B 1 94  ? 42.951 -47.842  173.061 1.00 80.50  ? 94   MET B SD  1 
ATOM   2773 C  CE  . MET B 1 94  ? 42.708 -49.577  173.468 1.00 76.50  ? 94   MET B CE  1 
ATOM   2774 N  N   . ALA B 1 95  ? 46.030 -51.095  170.344 1.00 65.46  ? 95   ALA B N   1 
ATOM   2775 C  CA  . ALA B 1 95  ? 46.613 -52.359  170.786 1.00 64.03  ? 95   ALA B CA  1 
ATOM   2776 C  C   . ALA B 1 95  ? 48.036 -52.497  170.224 1.00 64.11  ? 95   ALA B C   1 
ATOM   2777 O  O   . ALA B 1 95  ? 48.802 -53.372  170.633 1.00 64.26  ? 95   ALA B O   1 
ATOM   2778 C  CB  . ALA B 1 95  ? 45.748 -53.544  170.383 1.00 63.26  ? 95   ALA B CB  1 
ATOM   2779 N  N   . THR B 1 96  ? 48.384 -51.644  169.263 1.00 64.42  ? 96   THR B N   1 
ATOM   2780 C  CA  . THR B 1 96  ? 49.683 -51.756  168.590 1.00 64.87  ? 96   THR B CA  1 
ATOM   2781 C  C   . THR B 1 96  ? 49.788 -53.028  167.728 1.00 66.62  ? 96   THR B C   1 
ATOM   2782 O  O   . THR B 1 96  ? 50.857 -53.619  167.631 1.00 68.43  ? 96   THR B O   1 
ATOM   2783 C  CB  . THR B 1 96  ? 50.899 -51.786  169.617 1.00 64.84  ? 96   THR B CB  1 
ATOM   2784 O  OG1 . THR B 1 96  ? 51.159 -53.126  170.010 1.00 63.06  ? 96   THR B OG1 1 
ATOM   2785 C  CG2 . THR B 1 96  ? 50.637 -50.958  170.844 1.00 60.96  ? 96   THR B CG2 1 
ATOM   2786 N  N   . ILE B 1 97  ? 48.699 -53.477  167.121 1.00 67.73  ? 97   ILE B N   1 
ATOM   2787 C  CA  . ILE B 1 97  ? 48.799 -54.614  166.206 1.00 70.71  ? 97   ILE B CA  1 
ATOM   2788 C  C   . ILE B 1 97  ? 49.349 -54.213  164.824 1.00 74.01  ? 97   ILE B C   1 
ATOM   2789 O  O   . ILE B 1 97  ? 50.135 -54.956  164.186 1.00 76.64  ? 97   ILE B O   1 
ATOM   2790 C  CB  . ILE B 1 97  ? 47.436 -55.267  165.968 1.00 71.61  ? 97   ILE B CB  1 
ATOM   2791 C  CG1 . ILE B 1 97  ? 46.890 -55.822  167.284 1.00 69.23  ? 97   ILE B CG1 1 
ATOM   2792 C  CG2 . ILE B 1 97  ? 47.573 -56.383  164.976 1.00 73.61  ? 97   ILE B CG2 1 
ATOM   2793 C  CD1 . ILE B 1 97  ? 45.425 -56.075  167.296 1.00 68.57  ? 97   ILE B CD1 1 
ATOM   2794 N  N   . GLY B 1 98  ? 48.959 -53.020  164.382 1.00 74.60  ? 98   GLY B N   1 
ATOM   2795 C  CA  . GLY B 1 98  ? 49.580 -52.406  163.223 1.00 77.73  ? 98   GLY B CA  1 
ATOM   2796 C  C   . GLY B 1 98  ? 49.730 -53.304  162.016 1.00 81.98  ? 98   GLY B C   1 
ATOM   2797 O  O   . GLY B 1 98  ? 50.840 -53.450  161.457 1.00 84.12  ? 98   GLY B O   1 
ATOM   2798 N  N   . TYR B 1 99  ? 48.629 -53.925  161.594 1.00 83.86  ? 99   TYR B N   1 
ATOM   2799 C  CA  . TYR B 1 99  ? 48.697 -54.804  160.418 1.00 89.14  ? 99   TYR B CA  1 
ATOM   2800 C  C   . TYR B 1 99  ? 49.396 -54.090  159.249 1.00 92.94  ? 99   TYR B C   1 
ATOM   2801 O  O   . TYR B 1 99  ? 50.359 -54.597  158.686 1.00 95.93  ? 99   TYR B O   1 
ATOM   2802 C  CB  . TYR B 1 99  ? 47.310 -55.242  159.980 1.00 90.56  ? 99   TYR B CB  1 
ATOM   2803 C  CG  . TYR B 1 99  ? 46.674 -56.237  160.899 1.00 87.44  ? 99   TYR B CG  1 
ATOM   2804 C  CD1 . TYR B 1 99  ? 45.456 -55.954  161.495 1.00 83.75  ? 99   TYR B CD1 1 
ATOM   2805 C  CD2 . TYR B 1 99  ? 47.290 -57.462  161.175 1.00 87.00  ? 99   TYR B CD2 1 
ATOM   2806 C  CE1 . TYR B 1 99  ? 44.853 -56.864  162.350 1.00 83.52  ? 99   TYR B CE1 1 
ATOM   2807 C  CE2 . TYR B 1 99  ? 46.695 -58.384  162.033 1.00 85.83  ? 99   TYR B CE2 1 
ATOM   2808 C  CZ  . TYR B 1 99  ? 45.472 -58.066  162.615 1.00 84.58  ? 99   TYR B CZ  1 
ATOM   2809 O  OH  . TYR B 1 99  ? 44.826 -58.925  163.465 1.00 87.19  ? 99   TYR B OH  1 
ATOM   2810 N  N   . GLY B 1 100 ? 48.917 -52.907  158.896 1.00 93.54  ? 100  GLY B N   1 
ATOM   2811 C  CA  . GLY B 1 100 ? 49.643 -52.074  157.958 1.00 98.26  ? 100  GLY B CA  1 
ATOM   2812 C  C   . GLY B 1 100 ? 48.928 -51.879  156.637 1.00 103.84 ? 100  GLY B C   1 
ATOM   2813 O  O   . GLY B 1 100 ? 49.448 -51.231  155.746 1.00 107.17 ? 100  GLY B O   1 
ATOM   2814 N  N   . LYS B 1 101 ? 47.749 -52.478  156.519 1.00 103.55 ? 101  LYS B N   1 
ATOM   2815 C  CA  . LYS B 1 101 ? 46.815 -52.224  155.440 1.00 109.39 ? 101  LYS B CA  1 
ATOM   2816 C  C   . LYS B 1 101 ? 46.246 -50.830  155.687 1.00 107.72 ? 101  LYS B C   1 
ATOM   2817 O  O   . LYS B 1 101 ? 46.417 -49.929  154.880 1.00 110.83 ? 101  LYS B O   1 
ATOM   2818 C  CB  . LYS B 1 101 ? 45.710 -53.291  155.484 1.00 111.56 ? 101  LYS B CB  1 
ATOM   2819 C  CG  . LYS B 1 101 ? 44.432 -52.969  154.731 1.00 118.60 ? 101  LYS B CG  1 
ATOM   2820 C  CD  . LYS B 1 101 ? 44.404 -53.719  153.419 1.00 130.30 ? 101  LYS B CD  1 
ATOM   2821 C  CE  . LYS B 1 101 ? 42.981 -53.944  152.954 1.00 137.90 ? 101  LYS B CE  1 
ATOM   2822 N  NZ  . LYS B 1 101 ? 42.920 -54.137  151.464 1.00 148.98 ? 101  LYS B NZ  1 
ATOM   2823 N  N   . LEU B 1 102 ? 45.584 -50.649  156.822 1.00 103.87 ? 102  LEU B N   1 
ATOM   2824 C  CA  . LEU B 1 102 ? 45.161 -49.325  157.231 1.00 102.62 ? 102  LEU B CA  1 
ATOM   2825 C  C   . LEU B 1 102 ? 46.375 -48.622  157.816 1.00 99.66  ? 102  LEU B C   1 
ATOM   2826 O  O   . LEU B 1 102 ? 47.096 -49.189  158.632 1.00 97.05  ? 102  LEU B O   1 
ATOM   2827 C  CB  . LEU B 1 102 ? 44.028 -49.414  158.257 1.00 100.05 ? 102  LEU B CB  1 
ATOM   2828 C  CG  . LEU B 1 102 ? 42.779 -50.186  157.803 1.00 103.59 ? 102  LEU B CG  1 
ATOM   2829 C  CD1 . LEU B 1 102 ? 41.767 -50.338  158.910 1.00 100.72 ? 102  LEU B CD1 1 
ATOM   2830 C  CD2 . LEU B 1 102 ? 42.115 -49.529  156.589 1.00 108.91 ? 102  LEU B CD2 1 
ATOM   2831 N  N   . ILE B 1 103 ? 46.629 -47.400  157.382 1.00 101.62 ? 103  ILE B N   1 
ATOM   2832 C  CA  . ILE B 1 103 ? 47.705 -46.606  157.949 1.00 99.25  ? 103  ILE B CA  1 
ATOM   2833 C  C   . ILE B 1 103 ? 47.311 -45.149  157.934 1.00 101.03 ? 103  ILE B C   1 
ATOM   2834 O  O   . ILE B 1 103 ? 46.363 -44.774  157.260 1.00 104.65 ? 103  ILE B O   1 
ATOM   2835 C  CB  . ILE B 1 103 ? 49.015 -46.754  157.174 1.00 100.90 ? 103  ILE B CB  1 
ATOM   2836 C  CG1 . ILE B 1 103 ? 48.786 -46.435  155.691 1.00 107.45 ? 103  ILE B CG1 1 
ATOM   2837 C  CG2 . ILE B 1 103 ? 49.583 -48.144  157.374 1.00 98.74  ? 103  ILE B CG2 1 
ATOM   2838 C  CD1 . ILE B 1 103 ? 50.043 -45.929  154.951 1.00 110.47 ? 103  ILE B CD1 1 
ATOM   2839 N  N   . PRO B 1 104 ? 48.035 -44.325  158.703 1.00 99.24  ? 104  PRO B N   1 
ATOM   2840 C  CA  . PRO B 1 104 ? 47.740 -42.908  158.785 1.00 101.78 ? 104  PRO B CA  1 
ATOM   2841 C  C   . PRO B 1 104 ? 48.484 -42.117  157.695 1.00 106.20 ? 104  PRO B C   1 
ATOM   2842 O  O   . PRO B 1 104 ? 49.579 -42.512  157.270 1.00 105.40 ? 104  PRO B O   1 
ATOM   2843 C  CB  . PRO B 1 104 ? 48.294 -42.542  160.163 1.00 98.26  ? 104  PRO B CB  1 
ATOM   2844 C  CG  . PRO B 1 104 ? 49.490 -43.409  160.307 1.00 94.22  ? 104  PRO B CG  1 
ATOM   2845 C  CD  . PRO B 1 104 ? 49.124 -44.710  159.630 1.00 94.85  ? 104  PRO B CD  1 
ATOM   2846 N  N   . ILE B 1 105 ? 47.912 -41.000  157.260 1.00 111.04 ? 105  ILE B N   1 
ATOM   2847 C  CA  . ILE B 1 105 ? 48.612 -40.186  156.291 1.00 116.61 ? 105  ILE B CA  1 
ATOM   2848 C  C   . ILE B 1 105 ? 48.835 -38.733  156.693 1.00 119.40 ? 105  ILE B C   1 
ATOM   2849 O  O   . ILE B 1 105 ? 49.941 -38.212  156.531 1.00 120.53 ? 105  ILE B O   1 
ATOM   2850 C  CB  . ILE B 1 105 ? 48.002 -40.322  154.895 1.00 122.00 ? 105  ILE B CB  1 
ATOM   2851 C  CG1 . ILE B 1 105 ? 46.484 -40.518  155.016 1.00 123.17 ? 105  ILE B CG1 1 
ATOM   2852 C  CG2 . ILE B 1 105 ? 48.650 -41.513  154.201 1.00 122.04 ? 105  ILE B CG2 1 
ATOM   2853 C  CD1 . ILE B 1 105 ? 45.818 -41.010  153.751 1.00 126.82 ? 105  ILE B CD1 1 
ATOM   2854 N  N   . GLY B 1 106 ? 47.814 -38.078  157.226 1.00 121.26 ? 106  GLY B N   1 
ATOM   2855 C  CA  . GLY B 1 106 ? 48.014 -36.705  157.684 1.00 125.32 ? 106  GLY B CA  1 
ATOM   2856 C  C   . GLY B 1 106 ? 49.210 -36.600  158.626 1.00 122.38 ? 106  GLY B C   1 
ATOM   2857 O  O   . GLY B 1 106 ? 49.668 -37.609  159.163 1.00 117.56 ? 106  GLY B O   1 
ATOM   2858 N  N   . PRO B 1 107 ? 49.761 -35.386  158.807 1.00 126.38 ? 107  PRO B N   1 
ATOM   2859 C  CA  . PRO B 1 107 ? 50.506 -35.215  160.048 1.00 123.47 ? 107  PRO B CA  1 
ATOM   2860 C  C   . PRO B 1 107 ? 49.476 -35.208  161.173 1.00 121.74 ? 107  PRO B C   1 
ATOM   2861 O  O   . PRO B 1 107 ? 49.826 -35.383  162.340 1.00 119.40 ? 107  PRO B O   1 
ATOM   2862 C  CB  . PRO B 1 107 ? 51.152 -33.828  159.894 1.00 129.34 ? 107  PRO B CB  1 
ATOM   2863 C  CG  . PRO B 1 107 ? 51.165 -33.567  158.450 1.00 133.82 ? 107  PRO B CG  1 
ATOM   2864 C  CD  . PRO B 1 107 ? 49.932 -34.237  157.899 1.00 133.28 ? 107  PRO B CD  1 
ATOM   2865 N  N   . LEU B 1 108 ? 48.211 -35.011  160.811 1.00 123.69 ? 108  LEU B N   1 
ATOM   2866 C  CA  . LEU B 1 108 ? 47.114 -35.075  161.764 1.00 122.77 ? 108  LEU B CA  1 
ATOM   2867 C  C   . LEU B 1 108 ? 46.906 -36.513  162.254 1.00 115.85 ? 108  LEU B C   1 
ATOM   2868 O  O   . LEU B 1 108 ? 46.899 -36.777  163.455 1.00 113.37 ? 108  LEU B O   1 
ATOM   2869 C  CB  . LEU B 1 108 ? 45.827 -34.536  161.143 1.00 128.07 ? 108  LEU B CB  1 
ATOM   2870 C  CG  . LEU B 1 108 ? 45.806 -33.067  160.692 1.00 135.89 ? 108  LEU B CG  1 
ATOM   2871 C  CD1 . LEU B 1 108 ? 44.375 -32.628  160.417 1.00 139.77 ? 108  LEU B CD1 1 
ATOM   2872 C  CD2 . LEU B 1 108 ? 46.456 -32.145  161.713 1.00 137.26 ? 108  LEU B CD2 1 
ATOM   2873 N  N   . ALA B 1 109 ? 46.747 -37.441  161.324 1.00 113.28 ? 109  ALA B N   1 
ATOM   2874 C  CA  . ALA B 1 109 ? 46.619 -38.848  161.678 1.00 107.55 ? 109  ALA B CA  1 
ATOM   2875 C  C   . ALA B 1 109 ? 47.814 -39.378  162.518 1.00 102.73 ? 109  ALA B C   1 
ATOM   2876 O  O   . ALA B 1 109 ? 47.611 -39.996  163.571 1.00 99.53  ? 109  ALA B O   1 
ATOM   2877 C  CB  . ALA B 1 109 ? 46.378 -39.706  160.437 1.00 106.78 ? 109  ALA B CB  1 
ATOM   2878 N  N   . ASN B 1 110 ? 49.038 -39.122  162.060 1.00 102.14 ? 110  ASN B N   1 
ATOM   2879 C  CA  . ASN B 1 110 ? 50.219 -39.520  162.798 1.00 98.49  ? 110  ASN B CA  1 
ATOM   2880 C  C   . ASN B 1 110 ? 50.340 -38.876  164.167 1.00 98.76  ? 110  ASN B C   1 
ATOM   2881 O  O   . ASN B 1 110 ? 51.081 -39.368  165.025 1.00 96.05  ? 110  ASN B O   1 
ATOM   2882 C  CB  . ASN B 1 110 ? 51.480 -39.231  162.002 1.00 99.99  ? 110  ASN B CB  1 
ATOM   2883 C  CG  . ASN B 1 110 ? 51.644 -40.162  160.856 1.00 99.47  ? 110  ASN B CG  1 
ATOM   2884 O  OD1 . ASN B 1 110 ? 50.836 -40.156  159.941 1.00 105.26 ? 110  ASN B OD1 1 
ATOM   2885 N  ND2 . ASN B 1 110 ? 52.681 -40.984  160.891 1.00 95.42  ? 110  ASN B ND2 1 
ATOM   2886 N  N   . THR B 1 111 ? 49.640 -37.764  164.367 1.00 102.36 ? 111  THR B N   1 
ATOM   2887 C  CA  . THR B 1 111 ? 49.664 -37.115  165.666 1.00 103.35 ? 111  THR B CA  1 
ATOM   2888 C  C   . THR B 1 111 ? 48.736 -37.854  166.606 1.00 100.72 ? 111  THR B C   1 
ATOM   2889 O  O   . THR B 1 111 ? 49.079 -38.125  167.755 1.00 99.19  ? 111  THR B O   1 
ATOM   2890 C  CB  . THR B 1 111 ? 49.233 -35.655  165.588 1.00 109.70 ? 111  THR B CB  1 
ATOM   2891 O  OG1 . THR B 1 111 ? 50.392 -34.861  165.345 1.00 111.85 ? 111  THR B OG1 1 
ATOM   2892 C  CG2 . THR B 1 111 ? 48.626 -35.227  166.909 1.00 111.38 ? 111  THR B CG2 1 
ATOM   2893 N  N   . LEU B 1 112 ? 47.558 -38.190  166.096 1.00 100.52 ? 112  LEU B N   1 
ATOM   2894 C  CA  . LEU B 1 112 ? 46.581 -38.930  166.874 1.00 98.49  ? 112  LEU B CA  1 
ATOM   2895 C  C   . LEU B 1 112 ? 47.120 -40.319  167.208 1.00 92.49  ? 112  LEU B C   1 
ATOM   2896 O  O   . LEU B 1 112 ? 47.009 -40.781  168.347 1.00 91.42  ? 112  LEU B O   1 
ATOM   2897 C  CB  . LEU B 1 112 ? 45.246 -39.014  166.121 1.00 100.38 ? 112  LEU B CB  1 
ATOM   2898 C  CG  . LEU B 1 112 ? 44.467 -37.690  166.080 1.00 106.77 ? 112  LEU B CG  1 
ATOM   2899 C  CD1 . LEU B 1 112 ? 43.405 -37.677  164.967 1.00 109.26 ? 112  LEU B CD1 1 
ATOM   2900 C  CD2 . LEU B 1 112 ? 43.851 -37.375  167.446 1.00 107.56 ? 112  LEU B CD2 1 
ATOM   2901 N  N   . VAL B 1 113 ? 47.716 -40.966  166.211 1.00 89.08  ? 113  VAL B N   1 
ATOM   2902 C  CA  . VAL B 1 113 ? 48.392 -42.222  166.416 1.00 83.75  ? 113  VAL B CA  1 
ATOM   2903 C  C   . VAL B 1 113 ? 49.364 -42.144  167.588 1.00 82.73  ? 113  VAL B C   1 
ATOM   2904 O  O   . VAL B 1 113 ? 49.444 -43.074  168.404 1.00 79.80  ? 113  VAL B O   1 
ATOM   2905 C  CB  . VAL B 1 113 ? 49.184 -42.642  165.178 1.00 83.04  ? 113  VAL B CB  1 
ATOM   2906 C  CG1 . VAL B 1 113 ? 50.313 -43.607  165.582 1.00 79.97  ? 113  VAL B CG1 1 
ATOM   2907 C  CG2 . VAL B 1 113 ? 48.258 -43.276  164.130 1.00 82.39  ? 113  VAL B CG2 1 
ATOM   2908 N  N   . THR B 1 114 ? 50.127 -41.053  167.651 1.00 85.03  ? 114  THR B N   1 
ATOM   2909 C  CA  . THR B 1 114 ? 51.136 -40.894  168.680 1.00 84.63  ? 114  THR B CA  1 
ATOM   2910 C  C   . THR B 1 114 ? 50.428 -40.785  170.015 1.00 85.85  ? 114  THR B C   1 
ATOM   2911 O  O   . THR B 1 114 ? 50.847 -41.396  171.008 1.00 84.30  ? 114  THR B O   1 
ATOM   2912 C  CB  . THR B 1 114 ? 52.008 -39.663  168.436 1.00 88.39  ? 114  THR B CB  1 
ATOM   2913 O  OG1 . THR B 1 114 ? 52.956 -39.962  167.416 1.00 86.55  ? 114  THR B OG1 1 
ATOM   2914 C  CG2 . THR B 1 114 ? 52.781 -39.279  169.694 1.00 90.25  ? 114  THR B CG2 1 
ATOM   2915 N  N   . LEU B 1 115 ? 49.341 -40.026  170.026 1.00 89.02  ? 115  LEU B N   1 
ATOM   2916 C  CA  . LEU B 1 115 ? 48.516 -39.883  171.222 1.00 91.53  ? 115  LEU B CA  1 
ATOM   2917 C  C   . LEU B 1 115 ? 47.877 -41.227  171.614 1.00 87.47  ? 115  LEU B C   1 
ATOM   2918 O  O   . LEU B 1 115 ? 47.797 -41.570  172.787 1.00 87.75  ? 115  LEU B O   1 
ATOM   2919 C  CB  . LEU B 1 115 ? 47.430 -38.831  170.987 1.00 96.49  ? 115  LEU B CB  1 
ATOM   2920 C  CG  . LEU B 1 115 ? 47.034 -37.971  172.186 1.00 103.80 ? 115  LEU B CG  1 
ATOM   2921 C  CD1 . LEU B 1 115 ? 46.022 -36.887  171.830 1.00 110.65 ? 115  LEU B CD1 1 
ATOM   2922 C  CD2 . LEU B 1 115 ? 46.485 -38.841  173.275 1.00 104.60 ? 115  LEU B CD2 1 
ATOM   2923 N  N   . GLU B 1 116 ? 47.425 -41.988  170.628 1.00 84.19  ? 116  GLU B N   1 
ATOM   2924 C  CA  . GLU B 1 116 ? 46.692 -43.212  170.903 1.00 81.40  ? 116  GLU B CA  1 
ATOM   2925 C  C   . GLU B 1 116 ? 47.643 -44.287  171.409 1.00 78.27  ? 116  GLU B C   1 
ATOM   2926 O  O   . GLU B 1 116 ? 47.260 -45.213  172.128 1.00 77.20  ? 116  GLU B O   1 
ATOM   2927 C  CB  . GLU B 1 116 ? 45.950 -43.684  169.656 1.00 79.90  ? 116  GLU B CB  1 
ATOM   2928 C  CG  . GLU B 1 116 ? 44.722 -44.470  170.005 1.00 80.51  ? 116  GLU B CG  1 
ATOM   2929 C  CD  . GLU B 1 116 ? 43.985 -45.006  168.797 1.00 81.82  ? 116  GLU B CD  1 
ATOM   2930 O  OE1 . GLU B 1 116 ? 44.289 -44.566  167.669 1.00 82.81  ? 116  GLU B OE1 1 
ATOM   2931 O  OE2 . GLU B 1 116 ? 43.094 -45.874  168.972 1.00 82.53  ? 116  GLU B OE2 1 
ATOM   2932 N  N   . ALA B 1 117 ? 48.905 -44.147  171.043 1.00 77.63  ? 117  ALA B N   1 
ATOM   2933 C  CA  . ALA B 1 117 ? 49.914 -45.100  171.466 1.00 75.42  ? 117  ALA B CA  1 
ATOM   2934 C  C   . ALA B 1 117 ? 50.162 -44.910  172.947 1.00 77.20  ? 117  ALA B C   1 
ATOM   2935 O  O   . ALA B 1 117 ? 50.259 -45.867  173.694 1.00 76.53  ? 117  ALA B O   1 
ATOM   2936 C  CB  . ALA B 1 117 ? 51.197 -44.862  170.698 1.00 75.11  ? 117  ALA B CB  1 
ATOM   2937 N  N   . LEU B 1 118 ? 50.297 -43.659  173.359 1.00 80.86  ? 118  LEU B N   1 
ATOM   2938 C  CA  . LEU B 1 118 ? 50.465 -43.337  174.757 1.00 84.02  ? 118  LEU B CA  1 
ATOM   2939 C  C   . LEU B 1 118 ? 49.260 -43.879  175.534 1.00 85.01  ? 118  LEU B C   1 
ATOM   2940 O  O   . LEU B 1 118 ? 49.440 -44.541  176.553 1.00 85.87  ? 118  LEU B O   1 
ATOM   2941 C  CB  . LEU B 1 118 ? 50.611 -41.833  174.948 1.00 88.57  ? 118  LEU B CB  1 
ATOM   2942 C  CG  . LEU B 1 118 ? 51.121 -41.374  176.308 1.00 93.38  ? 118  LEU B CG  1 
ATOM   2943 C  CD1 . LEU B 1 118 ? 52.421 -42.067  176.656 1.00 91.69  ? 118  LEU B CD1 1 
ATOM   2944 C  CD2 . LEU B 1 118 ? 51.306 -39.877  176.349 1.00 97.76  ? 118  LEU B CD2 1 
ATOM   2945 N  N   . CYS B 1 119 ? 48.041 -43.651  175.049 1.00 85.03  ? 119  CYS B N   1 
ATOM   2946 C  CA  . CYS B 1 119 ? 46.865 -44.125  175.773 1.00 86.23  ? 119  CYS B CA  1 
ATOM   2947 C  C   . CYS B 1 119 ? 46.833 -45.610  175.959 1.00 82.59  ? 119  CYS B C   1 
ATOM   2948 O  O   . CYS B 1 119 ? 46.495 -46.095  177.016 1.00 83.86  ? 119  CYS B O   1 
ATOM   2949 C  CB  . CYS B 1 119 ? 45.585 -43.710  175.063 1.00 87.79  ? 119  CYS B CB  1 
ATOM   2950 S  SG  . CYS B 1 119 ? 45.449 -41.952  175.119 1.00 96.83  ? 119  CYS B SG  1 
ATOM   2951 N  N   . GLY B 1 120 ? 47.131 -46.355  174.909 1.00 78.94  ? 120  GLY B N   1 
ATOM   2952 C  CA  . GLY B 1 120 ? 47.107 -47.795  175.040 1.00 75.82  ? 120  GLY B CA  1 
ATOM   2953 C  C   . GLY B 1 120 ? 48.095 -48.202  176.112 1.00 76.47  ? 120  GLY B C   1 
ATOM   2954 O  O   . GLY B 1 120 ? 47.828 -49.112  176.903 1.00 76.42  ? 120  GLY B O   1 
ATOM   2955 N  N   . MET B 1 121 ? 49.246 -47.532  176.142 1.00 71.76  ? 121  MET B N   1 
ATOM   2956 C  CA  A MET B 1 121 ? 50.271 -47.872  177.115 0.48 71.61  ? 121  MET B CA  1 
ATOM   2957 C  CA  B MET B 1 121 ? 50.287 -47.834  177.125 0.52 71.28  ? 121  MET B CA  1 
ATOM   2958 C  C   . MET B 1 121 ? 49.825 -47.499  178.556 1.00 70.97  ? 121  MET B C   1 
ATOM   2959 O  O   . MET B 1 121 ? 49.907 -48.336  179.465 1.00 70.93  ? 121  MET B O   1 
ATOM   2960 C  CB  A MET B 1 121 ? 51.646 -47.302  176.698 0.48 73.11  ? 121  MET B CB  1 
ATOM   2961 C  CB  B MET B 1 121 ? 51.594 -47.102  176.784 0.52 72.54  ? 121  MET B CB  1 
ATOM   2962 C  CG  A MET B 1 121 ? 52.437 -48.248  175.756 0.48 76.70  ? 121  MET B CG  1 
ATOM   2963 C  CG  B MET B 1 121 ? 52.697 -47.302  177.812 0.52 73.74  ? 121  MET B CG  1 
ATOM   2964 S  SD  A MET B 1 121 ? 53.688 -47.550  174.603 0.48 83.10  ? 121  MET B SD  1 
ATOM   2965 S  SD  B MET B 1 121 ? 52.852 -46.022  179.091 0.52 77.44  ? 121  MET B SD  1 
ATOM   2966 C  CE  A MET B 1 121 ? 54.951 -48.830  174.707 0.48 84.95  ? 121  MET B CE  1 
ATOM   2967 C  CE  B MET B 1 121 ? 54.430 -45.279  178.606 0.52 77.40  ? 121  MET B CE  1 
ATOM   2968 N  N   . LEU B 1 122 ? 49.323 -46.278  178.771 1.00 71.61  ? 122  LEU B N   1 
ATOM   2969 C  CA  . LEU B 1 122 ? 48.809 -45.920  180.084 1.00 72.61  ? 122  LEU B CA  1 
ATOM   2970 C  C   . LEU B 1 122 ? 47.639 -46.845  180.455 1.00 71.85  ? 122  LEU B C   1 
ATOM   2971 O  O   . LEU B 1 122 ? 47.582 -47.365  181.573 1.00 72.60  ? 122  LEU B O   1 
ATOM   2972 C  CB  . LEU B 1 122 ? 48.383 -44.471  180.128 1.00 75.57  ? 122  LEU B CB  1 
ATOM   2973 C  CG  . LEU B 1 122 ? 49.423 -43.418  179.725 1.00 78.13  ? 122  LEU B CG  1 
ATOM   2974 C  CD1 . LEU B 1 122 ? 48.757 -42.033  179.684 1.00 83.87  ? 122  LEU B CD1 1 
ATOM   2975 C  CD2 . LEU B 1 122 ? 50.613 -43.375  180.672 1.00 78.18  ? 122  LEU B CD2 1 
ATOM   2976 N  N   . GLY B 1 123 ? 46.729 -47.086  179.514 1.00 70.88  ? 123  GLY B N   1 
ATOM   2977 C  CA  . GLY B 1 123 ? 45.571 -47.954  179.760 1.00 70.59  ? 123  GLY B CA  1 
ATOM   2978 C  C   . GLY B 1 123 ? 45.913 -49.358  180.243 1.00 69.06  ? 123  GLY B C   1 
ATOM   2979 O  O   . GLY B 1 123 ? 45.316 -49.868  181.190 1.00 69.93  ? 123  GLY B O   1 
ATOM   2980 N  N   . LEU B 1 124 ? 46.865 -50.002  179.580 1.00 67.98  ? 124  LEU B N   1 
ATOM   2981 C  CA  . LEU B 1 124 ? 47.378 -51.293  180.014 1.00 67.32  ? 124  LEU B CA  1 
ATOM   2982 C  C   . LEU B 1 124 ? 47.958 -51.141  181.411 1.00 67.24  ? 124  LEU B C   1 
ATOM   2983 O  O   . LEU B 1 124 ? 47.698 -51.938  182.312 1.00 66.74  ? 124  LEU B O   1 
ATOM   2984 C  CB  . LEU B 1 124 ? 48.497 -51.745  179.082 1.00 67.50  ? 124  LEU B CB  1 
ATOM   2985 C  CG  . LEU B 1 124 ? 49.212 -53.017  179.524 1.00 69.75  ? 124  LEU B CG  1 
ATOM   2986 C  CD1 . LEU B 1 124 ? 48.162 -54.057  179.817 1.00 71.57  ? 124  LEU B CD1 1 
ATOM   2987 C  CD2 . LEU B 1 124 ? 50.112 -53.513  178.412 1.00 74.56  ? 124  LEU B CD2 1 
ATOM   2988 N  N   . ALA B 1 125 ? 48.767 -50.099  181.574 1.00 68.12  ? 125  ALA B N   1 
ATOM   2989 C  CA  . ALA B 1 125 ? 49.476 -49.891  182.831 1.00 69.47  ? 125  ALA B CA  1 
ATOM   2990 C  C   . ALA B 1 125 ? 48.445 -49.742  183.917 1.00 70.32  ? 125  ALA B C   1 
ATOM   2991 O  O   . ALA B 1 125 ? 48.569 -50.353  184.965 1.00 72.21  ? 125  ALA B O   1 
ATOM   2992 C  CB  . ALA B 1 125 ? 50.400 -48.671  182.744 1.00 70.83  ? 125  ALA B CB  1 
ATOM   2993 N  N   . VAL B 1 126 ? 47.395 -48.966  183.665 1.00 70.85  ? 126  VAL B N   1 
ATOM   2994 C  CA  . VAL B 1 126 ? 46.307 -48.850  184.645 1.00 73.36  ? 126  VAL B CA  1 
ATOM   2995 C  C   . VAL B 1 126 ? 45.542 -50.151  184.832 1.00 72.02  ? 126  VAL B C   1 
ATOM   2996 O  O   . VAL B 1 126 ? 45.298 -50.592  185.947 1.00 74.59  ? 126  VAL B O   1 
ATOM   2997 C  CB  . VAL B 1 126 ? 45.285 -47.778  184.256 1.00 76.08  ? 126  VAL B CB  1 
ATOM   2998 C  CG1 . VAL B 1 126 ? 43.943 -48.096  184.886 1.00 78.59  ? 126  VAL B CG1 1 
ATOM   2999 C  CG2 . VAL B 1 126 ? 45.782 -46.369  184.680 1.00 80.19  ? 126  VAL B CG2 1 
ATOM   3000 N  N   . ALA B 1 127 ? 45.149 -50.779  183.743 1.00 69.19  ? 127  ALA B N   1 
ATOM   3001 C  CA  . ALA B 1 127 ? 44.356 -51.984  183.889 1.00 68.32  ? 127  ALA B CA  1 
ATOM   3002 C  C   . ALA B 1 127 ? 45.095 -53.008  184.730 1.00 67.27  ? 127  ALA B C   1 
ATOM   3003 O  O   . ALA B 1 127 ? 44.481 -53.800  185.423 1.00 68.66  ? 127  ALA B O   1 
ATOM   3004 C  CB  . ALA B 1 127 ? 44.004 -52.558  182.525 1.00 67.22  ? 127  ALA B CB  1 
ATOM   3005 N  N   . ALA B 1 128 ? 46.413 -53.013  184.655 1.00 66.13  ? 128  ALA B N   1 
ATOM   3006 C  CA  . ALA B 1 128 ? 47.169 -54.067  185.314 1.00 68.10  ? 128  ALA B CA  1 
ATOM   3007 C  C   . ALA B 1 128 ? 47.305 -53.700  186.789 1.00 71.15  ? 128  ALA B C   1 
ATOM   3008 O  O   . ALA B 1 128 ? 47.242 -54.550  187.664 1.00 72.66  ? 128  ALA B O   1 
ATOM   3009 C  CB  . ALA B 1 128 ? 48.524 -54.224  184.677 1.00 67.72  ? 128  ALA B CB  1 
ATOM   3010 N  N   . SER B 1 129 ? 47.481 -52.408  187.036 1.00 72.78  ? 129  SER B N   1 
ATOM   3011 C  CA  . SER B 1 129 ? 47.383 -51.862  188.361 1.00 77.09  ? 129  SER B CA  1 
ATOM   3012 C  C   . SER B 1 129 ? 46.120 -52.305  189.055 1.00 78.25  ? 129  SER B C   1 
ATOM   3013 O  O   . SER B 1 129 ? 46.195 -52.801  190.182 1.00 81.66  ? 129  SER B O   1 
ATOM   3014 C  CB  . SER B 1 129 ? 47.402 -50.336  188.308 1.00 79.41  ? 129  SER B CB  1 
ATOM   3015 O  OG  . SER B 1 129 ? 48.737 -49.865  188.290 1.00 82.76  ? 129  SER B OG  1 
ATOM   3016 N  N   . LEU B 1 130 ? 44.964 -52.111  188.419 1.00 76.32  ? 130  LEU B N   1 
ATOM   3017 C  CA  . LEU B 1 130 ? 43.684 -52.379  189.099 1.00 78.22  ? 130  LEU B CA  1 
ATOM   3018 C  C   . LEU B 1 130 ? 43.526 -53.861  189.374 1.00 77.88  ? 130  LEU B C   1 
ATOM   3019 O  O   . LEU B 1 130 ? 43.046 -54.252  190.440 1.00 80.82  ? 130  LEU B O   1 
ATOM   3020 C  CB  . LEU B 1 130 ? 42.489 -51.875  188.301 1.00 77.79  ? 130  LEU B CB  1 
ATOM   3021 C  CG  . LEU B 1 130 ? 42.401 -50.366  188.107 1.00 79.42  ? 130  LEU B CG  1 
ATOM   3022 C  CD1 . LEU B 1 130 ? 41.393 -50.039  187.047 1.00 79.76  ? 130  LEU B CD1 1 
ATOM   3023 C  CD2 . LEU B 1 130 ? 42.033 -49.672  189.410 1.00 86.71  ? 130  LEU B CD2 1 
ATOM   3024 N  N   . ILE B 1 131 ? 43.935 -54.683  188.414 1.00 74.98  ? 131  ILE B N   1 
ATOM   3025 C  CA  . ILE B 1 131 ? 43.898 -56.128  188.583 1.00 75.42  ? 131  ILE B CA  1 
ATOM   3026 C  C   . ILE B 1 131 ? 44.853 -56.611  189.699 1.00 79.34  ? 131  ILE B C   1 
ATOM   3027 O  O   . ILE B 1 131 ? 44.473 -57.401  190.594 1.00 81.15  ? 131  ILE B O   1 
ATOM   3028 C  CB  . ILE B 1 131 ? 44.316 -56.790  187.308 1.00 72.79  ? 131  ILE B CB  1 
ATOM   3029 C  CG1 . ILE B 1 131 ? 43.167 -56.720  186.316 1.00 72.35  ? 131  ILE B CG1 1 
ATOM   3030 C  CG2 . ILE B 1 131 ? 44.719 -58.191  187.562 1.00 72.48  ? 131  ILE B CG2 1 
ATOM   3031 C  CD1 . ILE B 1 131 ? 43.606 -56.872  184.895 1.00 69.64  ? 131  ILE B CD1 1 
ATOM   3032 N  N   . TYR B 1 132 ? 46.101 -56.156  189.652 1.00 80.01  ? 132  TYR B N   1 
ATOM   3033 C  CA  . TYR B 1 132 ? 46.991 -56.588  190.687 1.00 84.66  ? 132  TYR B CA  1 
ATOM   3034 C  C   . TYR B 1 132 ? 46.409 -56.216  192.064 1.00 89.09  ? 132  TYR B C   1 
ATOM   3035 O  O   . TYR B 1 132 ? 46.487 -57.005  193.020 1.00 92.71  ? 132  TYR B O   1 
ATOM   3036 C  CB  . TYR B 1 132 ? 48.413 -56.054  190.531 1.00 85.64  ? 132  TYR B CB  1 
ATOM   3037 C  CG  . TYR B 1 132 ? 49.245 -56.587  191.675 1.00 92.20  ? 132  TYR B CG  1 
ATOM   3038 C  CD1 . TYR B 1 132 ? 49.600 -57.932  191.733 1.00 96.38  ? 132  TYR B CD1 1 
ATOM   3039 C  CD2 . TYR B 1 132 ? 49.584 -55.784  192.739 1.00 98.40  ? 132  TYR B CD2 1 
ATOM   3040 C  CE1 . TYR B 1 132 ? 50.309 -58.448  192.802 1.00 101.95 ? 132  TYR B CE1 1 
ATOM   3041 C  CE2 . TYR B 1 132 ? 50.309 -56.276  193.810 1.00 105.87 ? 132  TYR B CE2 1 
ATOM   3042 C  CZ  . TYR B 1 132 ? 50.665 -57.610  193.831 1.00 108.32 ? 132  TYR B CZ  1 
ATOM   3043 O  OH  . TYR B 1 132 ? 51.371 -58.090  194.905 1.00 117.62 ? 132  TYR B OH  1 
ATOM   3044 N  N   . ALA B 1 133 ? 45.829 -55.021  192.167 1.00 89.79  ? 133  ALA B N   1 
ATOM   3045 C  CA  . ALA B 1 133 ? 45.319 -54.551  193.438 1.00 95.08  ? 133  ALA B CA  1 
ATOM   3046 C  C   . ALA B 1 133 ? 44.214 -55.477  193.836 1.00 97.07  ? 133  ALA B C   1 
ATOM   3047 O  O   . ALA B 1 133 ? 44.244 -56.038  194.919 1.00 101.50 ? 133  ALA B O   1 
ATOM   3048 C  CB  . ALA B 1 133 ? 44.797 -53.145  193.340 1.00 95.73  ? 133  ALA B CB  1 
ATOM   3049 N  N   . ARG B 1 134 ? 43.236 -55.641  192.953 1.00 95.28  ? 134  ARG B N   1 
ATOM   3050 C  CA  . ARG B 1 134 ? 42.057 -56.415  193.284 1.00 98.04  ? 134  ARG B CA  1 
ATOM   3051 C  C   . ARG B 1 134 ? 42.459 -57.779  193.820 1.00 100.38 ? 134  ARG B C   1 
ATOM   3052 O  O   . ARG B 1 134 ? 41.786 -58.331  194.681 1.00 104.08 ? 134  ARG B O   1 
ATOM   3053 C  CB  . ARG B 1 134 ? 41.136 -56.540  192.078 1.00 94.81  ? 134  ARG B CB  1 
ATOM   3054 C  CG  . ARG B 1 134 ? 40.223 -55.332  191.884 1.00 96.41  ? 134  ARG B CG  1 
ATOM   3055 C  CD  . ARG B 1 134 ? 39.546 -55.333  190.484 1.00 93.32  ? 134  ARG B CD  1 
ATOM   3056 N  NE  . ARG B 1 134 ? 38.708 -56.515  190.287 1.00 94.05  ? 134  ARG B NE  1 
ATOM   3057 C  CZ  . ARG B 1 134 ? 37.433 -56.613  190.679 1.00 96.87  ? 134  ARG B CZ  1 
ATOM   3058 N  NH1 . ARG B 1 134 ? 36.819 -55.594  191.273 1.00 99.07  ? 134  ARG B NH1 1 
ATOM   3059 N  NH2 . ARG B 1 134 ? 36.770 -57.735  190.459 1.00 97.10  ? 134  ARG B NH2 1 
ATOM   3060 N  N   . PHE B 1 135 ? 43.581 -58.288  193.325 1.00 100.40 ? 135  PHE B N   1 
ATOM   3061 C  CA  . PHE B 1 135 ? 44.136 -59.576  193.731 1.00 104.53 ? 135  PHE B CA  1 
ATOM   3062 C  C   . PHE B 1 135 ? 44.678 -59.544  195.150 1.00 110.76 ? 135  PHE B C   1 
ATOM   3063 O  O   . PHE B 1 135 ? 44.949 -60.587  195.741 1.00 114.28 ? 135  PHE B O   1 
ATOM   3064 C  CB  . PHE B 1 135 ? 45.304 -59.942  192.837 1.00 102.97 ? 135  PHE B CB  1 
ATOM   3065 C  CG  . PHE B 1 135 ? 44.916 -60.662  191.595 1.00 102.79 ? 135  PHE B CG  1 
ATOM   3066 C  CD1 . PHE B 1 135 ? 43.625 -60.620  191.132 1.00 103.02 ? 135  PHE B CD1 1 
ATOM   3067 C  CD2 . PHE B 1 135 ? 45.869 -61.350  190.859 1.00 105.81 ? 135  PHE B CD2 1 
ATOM   3068 C  CE1 . PHE B 1 135 ? 43.273 -61.284  189.959 1.00 104.07 ? 135  PHE B CE1 1 
ATOM   3069 C  CE2 . PHE B 1 135 ? 45.533 -62.001  189.690 1.00 106.27 ? 135  PHE B CE2 1 
ATOM   3070 C  CZ  . PHE B 1 135 ? 44.229 -61.974  189.239 1.00 104.99 ? 135  PHE B CZ  1 
ATOM   3071 N  N   . THR B 1 136 ? 44.864 -58.347  195.685 1.00 113.59 ? 136  THR B N   1 
ATOM   3072 C  CA  . THR B 1 136 ? 45.536 -58.217  196.956 1.00 120.79 ? 136  THR B CA  1 
ATOM   3073 C  C   . THR B 1 136 ? 44.700 -57.483  197.988 1.00 126.14 ? 136  THR B C   1 
ATOM   3074 O  O   . THR B 1 136 ? 45.239 -56.992  198.980 1.00 133.00 ? 136  THR B O   1 
ATOM   3075 C  CB  . THR B 1 136 ? 46.929 -57.542  196.814 1.00 122.12 ? 136  THR B CB  1 
ATOM   3076 O  OG1 . THR B 1 136 ? 46.776 -56.167  196.425 1.00 121.19 ? 136  THR B OG1 1 
ATOM   3077 C  CG2 . THR B 1 136 ? 47.786 -58.293  195.792 1.00 118.46 ? 136  THR B CG2 1 
ATOM   3078 N  N   . ARG B 1 137 ? 43.392 -57.399  197.764 1.00 91.53  ? 137  ARG B N   1 
ATOM   3079 C  CA  . ARG B 1 137 ? 42.498 -57.015  198.845 1.00 91.87  ? 137  ARG B CA  1 
ATOM   3080 C  C   . ARG B 1 137 ? 41.549 -58.181  199.163 1.00 90.03  ? 137  ARG B C   1 
ATOM   3081 O  O   . ARG B 1 137 ? 40.319 -58.067  199.006 1.00 89.90  ? 137  ARG B O   1 
ATOM   3082 C  CB  . ARG B 1 137 ? 41.728 -55.730  198.539 1.00 93.29  ? 137  ARG B CB  1 
ATOM   3083 C  CG  . ARG B 1 137 ? 40.494 -55.910  197.670 1.00 95.65  ? 137  ARG B CG  1 
ATOM   3084 C  CD  . ARG B 1 137 ? 39.492 -54.736  197.788 1.00 102.97 ? 137  ARG B CD  1 
ATOM   3085 N  NE  . ARG B 1 137 ? 40.139 -53.422  197.905 1.00 110.35 ? 137  ARG B NE  1 
ATOM   3086 C  CZ  . ARG B 1 137 ? 39.496 -52.274  198.150 1.00 115.86 ? 137  ARG B CZ  1 
ATOM   3087 N  NH1 . ARG B 1 137 ? 38.173 -52.261  198.294 1.00 117.44 ? 137  ARG B NH1 1 
ATOM   3088 N  NH2 . ARG B 1 137 ? 40.176 -51.131  198.250 1.00 119.72 ? 137  ARG B NH2 1 
ATOM   3089 N  N   . PRO B 1 138 ? 42.119 -59.306  199.626 1.00 82.60  ? 138  PRO B N   1 
ATOM   3090 C  CA  . PRO B 1 138 ? 41.348 -60.537  199.800 1.00 81.23  ? 138  PRO B CA  1 
ATOM   3091 C  C   . PRO B 1 138 ? 40.499 -60.491  201.063 1.00 77.65  ? 138  PRO B C   1 
ATOM   3092 O  O   . PRO B 1 138 ? 40.855 -59.792  202.011 1.00 76.71  ? 138  PRO B O   1 
ATOM   3093 C  CB  . PRO B 1 138 ? 42.429 -61.626  199.905 1.00 82.30  ? 138  PRO B CB  1 
ATOM   3094 C  CG  . PRO B 1 138 ? 43.798 -60.867  199.856 1.00 84.59  ? 138  PRO B CG  1 
ATOM   3095 C  CD  . PRO B 1 138 ? 43.480 -59.432  200.166 1.00 83.04  ? 138  PRO B CD  1 
ATOM   3096 N  N   . THR B 1 139 ? 39.376 -61.206  201.061 1.00 75.37  ? 139  THR B N   1 
ATOM   3097 C  CA  . THR B 1 139 ? 38.530 -61.317  202.258 1.00 71.99  ? 139  THR B CA  1 
ATOM   3098 C  C   . THR B 1 139 ? 39.162 -62.249  203.300 1.00 68.56  ? 139  THR B C   1 
ATOM   3099 O  O   . THR B 1 139 ? 39.971 -63.110  202.970 1.00 69.47  ? 139  THR B O   1 
ATOM   3100 C  CB  . THR B 1 139 ? 37.151 -61.890  201.904 1.00 72.76  ? 139  THR B CB  1 
ATOM   3101 O  OG1 . THR B 1 139 ? 37.330 -63.135  201.208 1.00 75.09  ? 139  THR B OG1 1 
ATOM   3102 C  CG2 . THR B 1 139 ? 36.387 -60.921  201.009 1.00 74.79  ? 139  THR B CG2 1 
ATOM   3103 N  N   . ALA B 1 140 ? 38.779 -62.092  204.555 1.00 63.89  ? 140  ALA B N   1 
ATOM   3104 C  CA  . ALA B 1 140 ? 39.362 -62.912  205.602 1.00 60.62  ? 140  ALA B CA  1 
ATOM   3105 C  C   . ALA B 1 140 ? 38.908 -64.370  205.557 1.00 59.32  ? 140  ALA B C   1 
ATOM   3106 O  O   . ALA B 1 140 ? 39.607 -65.213  206.081 1.00 59.62  ? 140  ALA B O   1 
ATOM   3107 C  CB  . ALA B 1 140 ? 39.078 -62.318  206.953 1.00 58.85  ? 140  ALA B CB  1 
ATOM   3108 N  N   . GLY B 1 141 ? 37.771 -64.662  204.914 1.00 57.81  ? 141  GLY B N   1 
ATOM   3109 C  CA  . GLY B 1 141 ? 37.144 -65.984  204.949 1.00 55.89  ? 141  GLY B CA  1 
ATOM   3110 C  C   . GLY B 1 141 ? 36.898 -66.487  206.356 1.00 53.55  ? 141  GLY B C   1 
ATOM   3111 O  O   . GLY B 1 141 ? 37.291 -67.595  206.712 1.00 54.00  ? 141  GLY B O   1 
ATOM   3112 N  N   . VAL B 1 142 ? 36.262 -65.667  207.178 1.00 51.41  ? 142  VAL B N   1 
ATOM   3113 C  CA  . VAL B 1 142 ? 36.094 -65.967  208.590 1.00 49.46  ? 142  VAL B CA  1 
ATOM   3114 C  C   . VAL B 1 142 ? 34.612 -65.969  208.950 1.00 49.17  ? 142  VAL B C   1 
ATOM   3115 O  O   . VAL B 1 142 ? 33.885 -65.043  208.638 1.00 49.72  ? 142  VAL B O   1 
ATOM   3116 C  CB  . VAL B 1 142 ? 36.873 -64.968  209.481 1.00 48.39  ? 142  VAL B CB  1 
ATOM   3117 C  CG1 . VAL B 1 142 ? 36.509 -65.132  210.959 1.00 47.67  ? 142  VAL B CG1 1 
ATOM   3118 C  CG2 . VAL B 1 142 ? 38.359 -65.173  209.312 1.00 48.26  ? 142  VAL B CG2 1 
ATOM   3119 N  N   . LEU B 1 143 ? 34.151 -67.034  209.586 1.00 49.10  ? 143  LEU B N   1 
ATOM   3120 C  CA  . LEU B 1 143 ? 32.755 -67.140  209.950 1.00 48.35  ? 143  LEU B CA  1 
ATOM   3121 C  C   . LEU B 1 143 ? 32.651 -66.743  211.388 1.00 46.42  ? 143  LEU B C   1 
ATOM   3122 O  O   . LEU B 1 143 ? 33.443 -67.200  212.218 1.00 45.06  ? 143  LEU B O   1 
ATOM   3123 C  CB  . LEU B 1 143 ? 32.316 -68.591  209.831 1.00 50.32  ? 143  LEU B CB  1 
ATOM   3124 C  CG  . LEU B 1 143 ? 30.819 -68.859  209.951 1.00 52.70  ? 143  LEU B CG  1 
ATOM   3125 C  CD1 . LEU B 1 143 ? 30.002 -68.066  208.925 1.00 52.49  ? 143  LEU B CD1 1 
ATOM   3126 C  CD2 . LEU B 1 143 ? 30.613 -70.337  209.750 1.00 53.49  ? 143  LEU B CD2 1 
ATOM   3127 N  N   . PHE B 1 144 ? 31.687 -65.878  211.668 1.00 45.49  ? 144  PHE B N   1 
ATOM   3128 C  CA  . PHE B 1 144 ? 31.333 -65.508  213.005 1.00 44.15  ? 144  PHE B CA  1 
ATOM   3129 C  C   . PHE B 1 144 ? 30.021 -66.230  213.455 1.00 44.88  ? 144  PHE B C   1 
ATOM   3130 O  O   . PHE B 1 144 ? 29.043 -66.290  212.711 1.00 45.33  ? 144  PHE B O   1 
ATOM   3131 C  CB  . PHE B 1 144 ? 31.099 -64.025  213.035 1.00 44.31  ? 144  PHE B CB  1 
ATOM   3132 C  CG  . PHE B 1 144 ? 32.325 -63.201  212.788 1.00 45.76  ? 144  PHE B CG  1 
ATOM   3133 C  CD1 . PHE B 1 144 ? 32.609 -62.733  211.522 1.00 47.45  ? 144  PHE B CD1 1 
ATOM   3134 C  CD2 . PHE B 1 144 ? 33.172 -62.862  213.830 1.00 44.42  ? 144  PHE B CD2 1 
ATOM   3135 C  CE1 . PHE B 1 144 ? 33.718 -61.969  211.299 1.00 48.78  ? 144  PHE B CE1 1 
ATOM   3136 C  CE2 . PHE B 1 144 ? 34.285 -62.117  213.605 1.00 44.19  ? 144  PHE B CE2 1 
ATOM   3137 C  CZ  . PHE B 1 144 ? 34.562 -61.659  212.354 1.00 47.22  ? 144  PHE B CZ  1 
ATOM   3138 N  N   . SER B 1 145 ? 29.990 -66.758  214.670 1.00 43.72  ? 145  SER B N   1 
ATOM   3139 C  CA  . SER B 1 145 ? 28.758 -67.350  215.140 1.00 44.94  ? 145  SER B CA  1 
ATOM   3140 C  C   . SER B 1 145 ? 27.631 -66.310  215.130 1.00 44.79  ? 145  SER B C   1 
ATOM   3141 O  O   . SER B 1 145 ? 27.852 -65.144  215.366 1.00 44.34  ? 145  SER B O   1 
ATOM   3142 C  CB  . SER B 1 145 ? 28.943 -67.950  216.541 1.00 44.75  ? 145  SER B CB  1 
ATOM   3143 O  OG  . SER B 1 145 ? 29.146 -66.931  217.489 1.00 44.12  ? 145  SER B OG  1 
ATOM   3144 N  N   . SER B 1 146 ? 26.413 -66.739  214.862 1.00 45.83  ? 146  SER B N   1 
ATOM   3145 C  CA  . SER B 1 146 ? 25.341 -65.804  214.679 1.00 46.19  ? 146  SER B CA  1 
ATOM   3146 C  C   . SER B 1 146 ? 24.922 -65.197  215.983 1.00 46.28  ? 146  SER B C   1 
ATOM   3147 O  O   . SER B 1 146 ? 24.081 -64.286  216.014 1.00 47.82  ? 146  SER B O   1 
ATOM   3148 C  CB  . SER B 1 146 ? 24.151 -66.518  214.074 1.00 48.08  ? 146  SER B CB  1 
ATOM   3149 O  OG  . SER B 1 146 ? 23.662 -67.471  214.994 1.00 50.44  ? 146  SER B OG  1 
ATOM   3150 N  N   . ARG B 1 147 ? 25.459 -65.717  217.077 1.00 45.19  ? 147  ARG B N   1 
ATOM   3151 C  CA  . ARG B 1 147 ? 25.000 -65.304  218.376 1.00 45.14  ? 147  ARG B CA  1 
ATOM   3152 C  C   . ARG B 1 147 ? 26.144 -65.345  219.371 1.00 44.31  ? 147  ARG B C   1 
ATOM   3153 O  O   . ARG B 1 147 ? 27.196 -65.950  219.110 1.00 42.21  ? 147  ARG B O   1 
ATOM   3154 C  CB  . ARG B 1 147 ? 23.950 -66.306  218.874 1.00 48.37  ? 147  ARG B CB  1 
ATOM   3155 C  CG  . ARG B 1 147 ? 22.654 -66.322  218.110 1.00 50.20  ? 147  ARG B CG  1 
ATOM   3156 C  CD  . ARG B 1 147 ? 21.850 -65.112  218.445 1.00 51.89  ? 147  ARG B CD  1 
ATOM   3157 N  NE  . ARG B 1 147 ? 20.624 -65.162  217.668 1.00 60.04  ? 147  ARG B NE  1 
ATOM   3158 C  CZ  . ARG B 1 147 ? 20.557 -65.008  216.345 1.00 60.91  ? 147  ARG B CZ  1 
ATOM   3159 N  NH1 . ARG B 1 147 ? 21.650 -64.758  215.626 1.00 60.13  ? 147  ARG B NH1 1 
ATOM   3160 N  NH2 . ARG B 1 147 ? 19.389 -65.101  215.742 1.00 60.68  ? 147  ARG B NH2 1 
ATOM   3161 N  N   . MET B 1 148 ? 25.921 -64.730  220.532 1.00 44.71  ? 148  MET B N   1 
ATOM   3162 C  CA  . MET B 1 148 ? 26.826 -64.931  221.663 1.00 45.39  ? 148  MET B CA  1 
ATOM   3163 C  C   . MET B 1 148 ? 26.088 -65.726  222.749 1.00 46.94  ? 148  MET B C   1 
ATOM   3164 O  O   . MET B 1 148 ? 24.859 -65.872  222.707 1.00 48.32  ? 148  MET B O   1 
ATOM   3165 C  CB  . MET B 1 148 ? 27.339 -63.595  222.230 1.00 44.48  ? 148  MET B CB  1 
ATOM   3166 C  CG  . MET B 1 148 ? 27.726 -62.524  221.160 1.00 46.21  ? 148  MET B CG  1 
ATOM   3167 S  SD  . MET B 1 148 ? 28.380 -61.025  221.943 1.00 46.70  ? 148  MET B SD  1 
ATOM   3168 C  CE  . MET B 1 148 ? 30.016 -61.605  222.392 1.00 40.43  ? 148  MET B CE  1 
ATOM   3169 N  N   . VAL B 1 149 ? 26.841 -66.231  223.717 1.00 46.72  ? 149  VAL B N   1 
ATOM   3170 C  CA  . VAL B 1 149 ? 26.247 -66.852  224.881 1.00 48.60  ? 149  VAL B CA  1 
ATOM   3171 C  C   . VAL B 1 149 ? 26.833 -66.221  226.133 1.00 49.04  ? 149  VAL B C   1 
ATOM   3172 O  O   . VAL B 1 149 ? 27.920 -65.648  226.094 1.00 49.64  ? 149  VAL B O   1 
ATOM   3173 C  CB  . VAL B 1 149 ? 26.471 -68.411  224.903 1.00 48.98  ? 149  VAL B CB  1 
ATOM   3174 C  CG1 . VAL B 1 149 ? 25.958 -69.015  223.643 1.00 49.26  ? 149  VAL B CG1 1 
ATOM   3175 C  CG2 . VAL B 1 149 ? 27.938 -68.756  225.067 1.00 47.13  ? 149  VAL B CG2 1 
ATOM   3176 N  N   . ILE B 1 150 ? 26.113 -66.309  227.242 1.00 50.87  ? 150  ILE B N   1 
ATOM   3177 C  CA  . ILE B 1 150 ? 26.731 -66.127  228.550 1.00 50.93  ? 150  ILE B CA  1 
ATOM   3178 C  C   . ILE B 1 150 ? 26.414 -67.385  229.347 1.00 53.35  ? 150  ILE B C   1 
ATOM   3179 O  O   . ILE B 1 150 ? 25.255 -67.751  229.499 1.00 55.28  ? 150  ILE B O   1 
ATOM   3180 C  CB  . ILE B 1 150 ? 26.255 -64.846  229.283 1.00 50.93  ? 150  ILE B CB  1 
ATOM   3181 C  CG1 . ILE B 1 150 ? 26.596 -63.614  228.424 1.00 48.43  ? 150  ILE B CG1 1 
ATOM   3182 C  CG2 . ILE B 1 150 ? 26.900 -64.752  230.646 1.00 48.68  ? 150  ILE B CG2 1 
ATOM   3183 C  CD1 . ILE B 1 150 ? 26.071 -62.256  228.936 1.00 44.14  ? 150  ILE B CD1 1 
ATOM   3184 N  N   . SER B 1 151 ? 27.456 -68.055  229.829 1.00 53.48  ? 151  SER B N   1 
ATOM   3185 C  CA  . SER B 1 151 ? 27.277 -69.267  230.573 1.00 55.39  ? 151  SER B CA  1 
ATOM   3186 C  C   . SER B 1 151 ? 28.559 -69.613  231.326 1.00 56.21  ? 151  SER B C   1 
ATOM   3187 O  O   . SER B 1 151 ? 29.617 -69.025  231.069 1.00 55.60  ? 151  SER B O   1 
ATOM   3188 C  CB  . SER B 1 151 ? 26.817 -70.382  229.630 1.00 56.23  ? 151  SER B CB  1 
ATOM   3189 O  OG  . SER B 1 151 ? 27.873 -71.006  228.923 1.00 54.59  ? 151  SER B OG  1 
ATOM   3190 N  N   . ASP B 1 152 ? 28.475 -70.546  232.261 1.00 58.15  ? 152  ASP B N   1 
ATOM   3191 C  CA  . ASP B 1 152 ? 29.605 -70.844  233.124 1.00 59.71  ? 152  ASP B CA  1 
ATOM   3192 C  C   . ASP B 1 152 ? 30.759 -71.517  232.423 1.00 59.06  ? 152  ASP B C   1 
ATOM   3193 O  O   . ASP B 1 152 ? 30.576 -72.525  231.730 1.00 59.55  ? 152  ASP B O   1 
ATOM   3194 C  CB  . ASP B 1 152 ? 29.180 -71.730  234.277 1.00 62.59  ? 152  ASP B CB  1 
ATOM   3195 C  CG  . ASP B 1 152 ? 28.394 -70.973  235.326 1.00 67.43  ? 152  ASP B CG  1 
ATOM   3196 O  OD1 . ASP B 1 152 ? 28.003 -69.808  235.051 1.00 69.42  ? 152  ASP B OD1 1 
ATOM   3197 O  OD2 . ASP B 1 152 ? 28.167 -71.547  236.422 1.00 74.24  ? 152  ASP B OD2 1 
ATOM   3198 N  N   . PHE B 1 153 ? 31.955 -70.964  232.621 1.00 57.76  ? 153  PHE B N   1 
ATOM   3199 C  CA  . PHE B 1 153 ? 33.181 -71.652  232.225 1.00 56.99  ? 153  PHE B CA  1 
ATOM   3200 C  C   . PHE B 1 153 ? 34.235 -71.508  233.322 1.00 57.92  ? 153  PHE B C   1 
ATOM   3201 O  O   . PHE B 1 153 ? 34.461 -70.412  233.837 1.00 57.35  ? 153  PHE B O   1 
ATOM   3202 C  CB  . PHE B 1 153 ? 33.687 -71.141  230.906 1.00 54.28  ? 153  PHE B CB  1 
ATOM   3203 C  CG  . PHE B 1 153 ? 35.012 -71.700  230.514 1.00 54.00  ? 153  PHE B CG  1 
ATOM   3204 C  CD1 . PHE B 1 153 ? 35.104 -72.964  229.977 1.00 52.64  ? 153  PHE B CD1 1 
ATOM   3205 C  CD2 . PHE B 1 153 ? 36.182 -70.945  230.695 1.00 54.46  ? 153  PHE B CD2 1 
ATOM   3206 C  CE1 . PHE B 1 153 ? 36.331 -73.489  229.600 1.00 53.94  ? 153  PHE B CE1 1 
ATOM   3207 C  CE2 . PHE B 1 153 ? 37.405 -71.456  230.335 1.00 53.90  ? 153  PHE B CE2 1 
ATOM   3208 C  CZ  . PHE B 1 153 ? 37.482 -72.736  229.774 1.00 54.81  ? 153  PHE B CZ  1 
ATOM   3209 N  N   . GLU B 1 154 ? 34.860 -72.621  233.703 1.00 59.27  ? 154  GLU B N   1 
ATOM   3210 C  CA  . GLU B 1 154 ? 35.738 -72.591  234.856 1.00 60.99  ? 154  GLU B CA  1 
ATOM   3211 C  C   . GLU B 1 154 ? 35.076 -71.849  236.013 1.00 61.91  ? 154  GLU B C   1 
ATOM   3212 O  O   . GLU B 1 154 ? 35.730 -71.033  236.655 1.00 62.99  ? 154  GLU B O   1 
ATOM   3213 C  CB  . GLU B 1 154 ? 37.046 -71.866  234.543 1.00 59.59  ? 154  GLU B CB  1 
ATOM   3214 C  CG  . GLU B 1 154 ? 37.891 -72.492  233.495 1.00 61.13  ? 154  GLU B CG  1 
ATOM   3215 C  CD  . GLU B 1 154 ? 38.273 -73.893  233.838 1.00 67.93  ? 154  GLU B CD  1 
ATOM   3216 O  OE1 . GLU B 1 154 ? 37.620 -74.521  234.687 1.00 73.43  ? 154  GLU B OE1 1 
ATOM   3217 O  OE2 . GLU B 1 154 ? 39.226 -74.402  233.240 1.00 72.80  ? 154  GLU B OE2 1 
ATOM   3218 N  N   . GLY B 1 155 ? 33.790 -72.085  236.263 1.00 62.60  ? 155  GLY B N   1 
ATOM   3219 C  CA  . GLY B 1 155 ? 33.127 -71.525  237.437 1.00 63.33  ? 155  GLY B CA  1 
ATOM   3220 C  C   . GLY B 1 155 ? 32.690 -70.063  237.425 1.00 62.01  ? 155  GLY B C   1 
ATOM   3221 O  O   . GLY B 1 155 ? 32.125 -69.595  238.407 1.00 64.65  ? 155  GLY B O   1 
ATOM   3222 N  N   . LYS B 1 156 ? 32.950 -69.330  236.346 1.00 58.78  ? 156  LYS B N   1 
ATOM   3223 C  CA  . LYS B 1 156 ? 32.458 -67.963  236.215 1.00 56.25  ? 156  LYS B CA  1 
ATOM   3224 C  C   . LYS B 1 156 ? 31.516 -67.902  235.034 1.00 53.62  ? 156  LYS B C   1 
ATOM   3225 O  O   . LYS B 1 156 ? 31.772 -68.556  234.033 1.00 52.38  ? 156  LYS B O   1 
ATOM   3226 C  CB  . LYS B 1 156 ? 33.611 -66.989  235.882 1.00 55.55  ? 156  LYS B CB  1 
ATOM   3227 C  CG  . LYS B 1 156 ? 34.696 -66.843  236.906 1.00 56.84  ? 156  LYS B CG  1 
ATOM   3228 C  CD  . LYS B 1 156 ? 35.564 -65.680  236.499 1.00 59.00  ? 156  LYS B CD  1 
ATOM   3229 C  CE  . LYS B 1 156 ? 36.491 -65.265  237.608 1.00 60.20  ? 156  LYS B CE  1 
ATOM   3230 N  NZ  . LYS B 1 156 ? 36.767 -66.463  238.428 1.00 63.05  ? 156  LYS B NZ  1 
ATOM   3231 N  N   . PRO B 1 157 ? 30.448 -67.092  235.134 1.00 52.64  ? 157  PRO B N   1 
ATOM   3232 C  CA  . PRO B 1 157 ? 29.718 -66.708  233.933 1.00 50.84  ? 157  PRO B CA  1 
ATOM   3233 C  C   . PRO B 1 157 ? 30.706 -66.106  232.938 1.00 49.50  ? 157  PRO B C   1 
ATOM   3234 O  O   . PRO B 1 157 ? 31.570 -65.329  233.334 1.00 48.40  ? 157  PRO B O   1 
ATOM   3235 C  CB  . PRO B 1 157 ? 28.773 -65.593  234.419 1.00 51.60  ? 157  PRO B CB  1 
ATOM   3236 C  CG  . PRO B 1 157 ? 28.683 -65.744  235.912 1.00 52.10  ? 157  PRO B CG  1 
ATOM   3237 C  CD  . PRO B 1 157 ? 29.944 -66.427  236.355 1.00 53.48  ? 157  PRO B CD  1 
ATOM   3238 N  N   . THR B 1 158 ? 30.562 -66.441  231.646 1.00 48.74  ? 158  THR B N   1 
ATOM   3239 C  CA  . THR B 1 158 ? 31.521 -66.027  230.630 1.00 46.36  ? 158  THR B CA  1 
ATOM   3240 C  C   . THR B 1 158 ? 30.806 -65.629  229.336 1.00 46.62  ? 158  THR B C   1 
ATOM   3241 O  O   . THR B 1 158 ? 29.904 -66.332  228.879 1.00 48.68  ? 158  THR B O   1 
ATOM   3242 C  CB  . THR B 1 158 ? 32.491 -67.176  230.382 1.00 45.61  ? 158  THR B CB  1 
ATOM   3243 O  OG1 . THR B 1 158 ? 33.168 -67.456  231.609 1.00 44.78  ? 158  THR B OG1 1 
ATOM   3244 C  CG2 . THR B 1 158 ? 33.483 -66.831  229.326 1.00 43.37  ? 158  THR B CG2 1 
ATOM   3245 N  N   . LEU B 1 159 ? 31.165 -64.489  228.753 1.00 45.55  ? 159  LEU B N   1 
ATOM   3246 C  CA  . LEU B 1 159 ? 30.559 -64.089  227.484 1.00 44.23  ? 159  LEU B CA  1 
ATOM   3247 C  C   . LEU B 1 159 ? 31.391 -64.706  226.381 1.00 43.27  ? 159  LEU B C   1 
ATOM   3248 O  O   . LEU B 1 159 ? 32.629 -64.631  226.405 1.00 41.96  ? 159  LEU B O   1 
ATOM   3249 C  CB  . LEU B 1 159 ? 30.570 -62.574  227.352 1.00 44.15  ? 159  LEU B CB  1 
ATOM   3250 C  CG  . LEU B 1 159 ? 30.143 -61.981  226.007 1.00 44.06  ? 159  LEU B CG  1 
ATOM   3251 C  CD1 . LEU B 1 159 ? 28.654 -62.190  225.774 1.00 41.81  ? 159  LEU B CD1 1 
ATOM   3252 C  CD2 . LEU B 1 159 ? 30.473 -60.492  226.028 1.00 44.78  ? 159  LEU B CD2 1 
ATOM   3253 N  N   . MET B 1 160 ? 30.731 -65.353  225.425 1.00 42.80  ? 160  MET B N   1 
ATOM   3254 C  CA  . MET B 1 160 ? 31.493 -66.040  224.397 1.00 42.03  ? 160  MET B CA  1 
ATOM   3255 C  C   . MET B 1 160 ? 30.830 -65.920  223.085 1.00 41.24  ? 160  MET B C   1 
ATOM   3256 O  O   . MET B 1 160 ? 29.641 -65.685  223.020 1.00 42.42  ? 160  MET B O   1 
ATOM   3257 C  CB  . MET B 1 160 ? 31.591 -67.528  224.667 1.00 43.21  ? 160  MET B CB  1 
ATOM   3258 C  CG  . MET B 1 160 ? 31.737 -67.931  226.083 1.00 44.32  ? 160  MET B CG  1 
ATOM   3259 S  SD  . MET B 1 160 ? 31.700 -69.765  226.129 1.00 47.85  ? 160  MET B SD  1 
ATOM   3260 C  CE  . MET B 1 160 ? 31.299 -70.061  227.865 1.00 41.42  ? 160  MET B CE  1 
ATOM   3261 N  N   . MET B 1 161 ? 31.622 -66.120  222.048 1.00 40.19  ? 161  MET B N   1 
ATOM   3262 C  CA  . MET B 1 161 ? 31.170 -66.234  220.667 1.00 39.82  ? 161  MET B CA  1 
ATOM   3263 C  C   . MET B 1 161 ? 32.305 -67.071  220.066 1.00 40.11  ? 161  MET B C   1 
ATOM   3264 O  O   . MET B 1 161 ? 33.234 -67.439  220.794 1.00 39.55  ? 161  MET B O   1 
ATOM   3265 C  CB  . MET B 1 161 ? 31.018 -64.868  219.996 1.00 39.14  ? 161  MET B CB  1 
ATOM   3266 C  CG  . MET B 1 161 ? 32.242 -63.894  220.083 1.00 38.70  ? 161  MET B CG  1 
ATOM   3267 S  SD  . MET B 1 161 ? 33.593 -64.361  218.979 1.00 41.09  ? 161  MET B SD  1 
ATOM   3268 C  CE  . MET B 1 161 ? 32.831 -64.257  217.394 1.00 36.67  ? 161  MET B CE  1 
ATOM   3269 N  N   . ARG B 1 162 ? 32.219 -67.445  218.790 1.00 40.56  ? 162  ARG B N   1 
ATOM   3270 C  CA  . ARG B 1 162 ? 33.303 -68.220  218.193 1.00 40.38  ? 162  ARG B CA  1 
ATOM   3271 C  C   . ARG B 1 162 ? 33.486 -67.883  216.736 1.00 40.64  ? 162  ARG B C   1 
ATOM   3272 O  O   . ARG B 1 162 ? 32.571 -67.315  216.090 1.00 40.27  ? 162  ARG B O   1 
ATOM   3273 C  CB  . ARG B 1 162 ? 33.125 -69.727  218.406 1.00 42.25  ? 162  ARG B CB  1 
ATOM   3274 C  CG  . ARG B 1 162 ? 31.892 -70.389  217.783 1.00 42.85  ? 162  ARG B CG  1 
ATOM   3275 C  CD  . ARG B 1 162 ? 31.869 -71.908  218.114 1.00 46.56  ? 162  ARG B CD  1 
ATOM   3276 N  NE  . ARG B 1 162 ? 30.602 -72.530  217.727 1.00 52.25  ? 162  ARG B NE  1 
ATOM   3277 C  CZ  . ARG B 1 162 ? 30.226 -73.784  217.996 1.00 54.29  ? 162  ARG B CZ  1 
ATOM   3278 N  NH1 . ARG B 1 162 ? 31.015 -74.618  218.658 1.00 52.73  ? 162  ARG B NH1 1 
ATOM   3279 N  NH2 . ARG B 1 162 ? 29.054 -74.212  217.567 1.00 56.26  ? 162  ARG B NH2 1 
ATOM   3280 N  N   . LEU B 1 163 ? 34.668 -68.224  216.223 1.00 41.14  ? 163  LEU B N   1 
ATOM   3281 C  CA  . LEU B 1 163 ? 35.049 -67.908  214.835 1.00 42.22  ? 163  LEU B CA  1 
ATOM   3282 C  C   . LEU B 1 163 ? 35.562 -69.147  214.163 1.00 43.53  ? 163  LEU B C   1 
ATOM   3283 O  O   . LEU B 1 163 ? 36.207 -69.988  214.808 1.00 44.10  ? 163  LEU B O   1 
ATOM   3284 C  CB  . LEU B 1 163 ? 36.239 -66.958  214.790 1.00 41.52  ? 163  LEU B CB  1 
ATOM   3285 C  CG  . LEU B 1 163 ? 36.307 -65.707  215.596 1.00 43.45  ? 163  LEU B CG  1 
ATOM   3286 C  CD1 . LEU B 1 163 ? 37.740 -65.446  215.896 1.00 46.99  ? 163  LEU B CD1 1 
ATOM   3287 C  CD2 . LEU B 1 163 ? 35.736 -64.617  214.744 1.00 46.44  ? 163  LEU B CD2 1 
ATOM   3288 N  N   . ALA B 1 164 ? 35.372 -69.217  212.856 1.00 45.16  ? 164  ALA B N   1 
ATOM   3289 C  CA  . ALA B 1 164 ? 35.893 -70.347  212.084 1.00 48.27  ? 164  ALA B CA  1 
ATOM   3290 C  C   . ALA B 1 164 ? 36.630 -69.850  210.855 1.00 49.58  ? 164  ALA B C   1 
ATOM   3291 O  O   . ALA B 1 164 ? 36.206 -68.895  210.210 1.00 49.19  ? 164  ALA B O   1 
ATOM   3292 C  CB  . ALA B 1 164 ? 34.736 -71.371  211.689 1.00 47.93  ? 164  ALA B CB  1 
ATOM   3293 N  N   . ASN B 1 165 ? 37.749 -70.502  210.564 1.00 52.41  ? 165  ASN B N   1 
ATOM   3294 C  CA  . ASN B 1 165 ? 38.491 -70.299  209.338 1.00 54.57  ? 165  ASN B CA  1 
ATOM   3295 C  C   . ASN B 1 165 ? 37.858 -71.122  208.229 1.00 57.43  ? 165  ASN B C   1 
ATOM   3296 O  O   . ASN B 1 165 ? 37.889 -72.344  208.289 1.00 59.76  ? 165  ASN B O   1 
ATOM   3297 C  CB  . ASN B 1 165 ? 39.941 -70.735  209.552 1.00 55.22  ? 165  ASN B CB  1 
ATOM   3298 C  CG  . ASN B 1 165 ? 40.794 -70.568  208.308 1.00 57.56  ? 165  ASN B CG  1 
ATOM   3299 O  OD1 . ASN B 1 165 ? 40.295 -70.250  207.237 1.00 58.08  ? 165  ASN B OD1 1 
ATOM   3300 N  ND2 . ASN B 1 165 ? 42.094 -70.779  208.450 1.00 61.18  ? 165  ASN B ND2 1 
ATOM   3301 N  N   . LEU B 1 166 ? 37.290 -70.457  207.223 1.00 58.24  ? 166  LEU B N   1 
ATOM   3302 C  CA  . LEU B 1 166 ? 36.568 -71.122  206.129 1.00 60.67  ? 166  LEU B CA  1 
ATOM   3303 C  C   . LEU B 1 166 ? 37.452 -71.620  204.989 1.00 63.82  ? 166  LEU B C   1 
ATOM   3304 O  O   . LEU B 1 166 ? 36.949 -71.978  203.923 1.00 65.36  ? 166  LEU B O   1 
ATOM   3305 C  CB  . LEU B 1 166 ? 35.579 -70.140  205.506 1.00 59.54  ? 166  LEU B CB  1 
ATOM   3306 C  CG  . LEU B 1 166 ? 34.371 -69.763  206.328 1.00 58.12  ? 166  LEU B CG  1 
ATOM   3307 C  CD1 . LEU B 1 166 ? 33.520 -68.731  205.619 1.00 56.50  ? 166  LEU B CD1 1 
ATOM   3308 C  CD2 . LEU B 1 166 ? 33.562 -71.026  206.627 1.00 59.01  ? 166  LEU B CD2 1 
ATOM   3309 N  N   . ARG B 1 167 ? 38.761 -71.602  205.188 1.00 65.28  ? 167  ARG B N   1 
ATOM   3310 C  CA  . ARG B 1 167 ? 39.697 -71.969  204.133 1.00 68.51  ? 167  ARG B CA  1 
ATOM   3311 C  C   . ARG B 1 167 ? 40.699 -72.929  204.735 1.00 70.34  ? 167  ARG B C   1 
ATOM   3312 O  O   . ARG B 1 167 ? 40.899 -72.951  205.950 1.00 69.48  ? 167  ARG B O   1 
ATOM   3313 C  CB  . ARG B 1 167 ? 40.430 -70.735  203.607 1.00 68.00  ? 167  ARG B CB  1 
ATOM   3314 C  CG  . ARG B 1 167 ? 39.656 -69.869  202.628 1.00 69.20  ? 167  ARG B CG  1 
ATOM   3315 C  CD  . ARG B 1 167 ? 40.522 -68.694  202.148 1.00 71.27  ? 167  ARG B CD  1 
ATOM   3316 N  NE  . ARG B 1 167 ? 39.739 -67.675  201.434 1.00 75.42  ? 167  ARG B NE  1 
ATOM   3317 C  CZ  . ARG B 1 167 ? 39.622 -66.393  201.802 1.00 74.47  ? 167  ARG B CZ  1 
ATOM   3318 N  NH1 . ARG B 1 167 ? 40.256 -65.944  202.878 1.00 74.55  ? 167  ARG B NH1 1 
ATOM   3319 N  NH2 . ARG B 1 167 ? 38.882 -65.550  201.089 1.00 72.62  ? 167  ARG B NH2 1 
ATOM   3320 N  N   . ILE B 1 168 ? 41.339 -73.724  203.898 1.00 73.96  ? 168  ILE B N   1 
ATOM   3321 C  CA  . ILE B 1 168 ? 42.318 -74.657  204.395 1.00 76.13  ? 168  ILE B CA  1 
ATOM   3322 C  C   . ILE B 1 168 ? 43.542 -73.897  204.851 1.00 75.53  ? 168  ILE B C   1 
ATOM   3323 O  O   . ILE B 1 168 ? 44.147 -74.250  205.854 1.00 75.28  ? 168  ILE B O   1 
ATOM   3324 C  CB  . ILE B 1 168 ? 42.739 -75.649  203.322 1.00 80.24  ? 168  ILE B CB  1 
ATOM   3325 C  CG1 . ILE B 1 168 ? 41.559 -76.545  202.945 1.00 82.83  ? 168  ILE B CG1 1 
ATOM   3326 C  CG2 . ILE B 1 168 ? 43.924 -76.496  203.821 1.00 82.48  ? 168  ILE B CG2 1 
ATOM   3327 C  CD1 . ILE B 1 168 ? 41.107 -77.458  204.090 1.00 83.96  ? 168  ILE B CD1 1 
ATOM   3328 N  N   . GLU B 1 169 ? 43.928 -72.846  204.130 1.00 75.50  ? 169  GLU B N   1 
ATOM   3329 C  CA  . GLU B 1 169 ? 45.111 -72.089  204.573 1.00 75.31  ? 169  GLU B CA  1 
ATOM   3330 C  C   . GLU B 1 169 ? 44.958 -71.488  205.969 1.00 71.80  ? 169  GLU B C   1 
ATOM   3331 O  O   . GLU B 1 169 ? 43.885 -71.099  206.412 1.00 69.05  ? 169  GLU B O   1 
ATOM   3332 C  CB  . GLU B 1 169 ? 45.511 -70.978  203.602 1.00 76.65  ? 169  GLU B CB  1 
ATOM   3333 C  CG  . GLU B 1 169 ? 45.819 -71.459  202.200 1.00 81.81  ? 169  GLU B CG  1 
ATOM   3334 C  CD  . GLU B 1 169 ? 44.581 -71.973  201.524 1.00 85.41  ? 169  GLU B CD  1 
ATOM   3335 O  OE1 . GLU B 1 169 ? 43.482 -71.386  201.695 1.00 86.76  ? 169  GLU B OE1 1 
ATOM   3336 O  OE2 . GLU B 1 169 ? 44.702 -72.983  200.829 1.00 91.09  ? 169  GLU B OE2 1 
ATOM   3337 N  N   . GLN B 1 170 ? 46.079 -71.378  206.641 1.00 71.40  ? 170  GLN B N   1 
ATOM   3338 C  CA  . GLN B 1 170 ? 46.069 -70.920  207.986 1.00 68.71  ? 170  GLN B CA  1 
ATOM   3339 C  C   . GLN B 1 170 ? 46.317 -69.443  208.088 1.00 65.97  ? 170  GLN B C   1 
ATOM   3340 O  O   . GLN B 1 170 ? 46.908 -68.836  207.207 1.00 67.12  ? 170  GLN B O   1 
ATOM   3341 C  CB  . GLN B 1 170 ? 47.112 -71.701  208.767 1.00 70.93  ? 170  GLN B CB  1 
ATOM   3342 C  CG  . GLN B 1 170 ? 46.609 -73.098  209.025 1.00 73.91  ? 170  GLN B CG  1 
ATOM   3343 C  CD  . GLN B 1 170 ? 47.681 -74.046  209.403 1.00 77.64  ? 170  GLN B CD  1 
ATOM   3344 O  OE1 . GLN B 1 170 ? 48.760 -74.051  208.813 1.00 81.54  ? 170  GLN B OE1 1 
ATOM   3345 N  NE2 . GLN B 1 170 ? 47.394 -74.880  210.392 1.00 79.64  ? 170  GLN B NE2 1 
ATOM   3346 N  N   . ILE B 1 171 ? 45.850 -68.872  209.179 1.00 61.63  ? 171  ILE B N   1 
ATOM   3347 C  CA  . ILE B 1 171 ? 46.050 -67.493  209.429 1.00 58.74  ? 171  ILE B CA  1 
ATOM   3348 C  C   . ILE B 1 171 ? 46.993 -67.420  210.622 1.00 58.84  ? 171  ILE B C   1 
ATOM   3349 O  O   . ILE B 1 171 ? 46.781 -68.063  211.646 1.00 57.78  ? 171  ILE B O   1 
ATOM   3350 C  CB  . ILE B 1 171 ? 44.714 -66.834  209.739 1.00 56.21  ? 171  ILE B CB  1 
ATOM   3351 C  CG1 . ILE B 1 171 ? 43.767 -67.035  208.550 1.00 55.23  ? 171  ILE B CG1 1 
ATOM   3352 C  CG2 . ILE B 1 171 ? 44.915 -65.351  210.071 1.00 55.03  ? 171  ILE B CG2 1 
ATOM   3353 C  CD1 . ILE B 1 171 ? 42.428 -66.311  208.673 1.00 49.52  ? 171  ILE B CD1 1 
ATOM   3354 N  N   . ILE B 1 172 ? 48.061 -66.656  210.495 1.00 59.38  ? 172  ILE B N   1 
ATOM   3355 C  CA  . ILE B 1 172 ? 49.035 -66.666  211.537 1.00 60.45  ? 172  ILE B CA  1 
ATOM   3356 C  C   . ILE B 1 172 ? 49.030 -65.326  212.255 1.00 59.41  ? 172  ILE B C   1 
ATOM   3357 O  O   . ILE B 1 172 ? 48.694 -64.286  211.682 1.00 58.87  ? 172  ILE B O   1 
ATOM   3358 C  CB  . ILE B 1 172 ? 50.453 -67.053  210.987 1.00 64.24  ? 172  ILE B CB  1 
ATOM   3359 C  CG1 . ILE B 1 172 ? 50.987 -65.942  210.098 1.00 65.74  ? 172  ILE B CG1 1 
ATOM   3360 C  CG2 . ILE B 1 172 ? 50.406 -68.403  210.202 1.00 62.74  ? 172  ILE B CG2 1 
ATOM   3361 C  CD1 . ILE B 1 172 ? 52.448 -65.652  210.318 1.00 70.49  ? 172  ILE B CD1 1 
ATOM   3362 N  N   . GLU B 1 173 ? 49.364 -65.361  213.535 1.00 59.02  ? 173  GLU B N   1 
ATOM   3363 C  CA  . GLU B 1 173 ? 49.281 -64.158  214.354 1.00 58.27  ? 173  GLU B CA  1 
ATOM   3364 C  C   . GLU B 1 173 ? 47.883 -63.526  214.316 1.00 55.31  ? 173  GLU B C   1 
ATOM   3365 O  O   . GLU B 1 173 ? 47.741 -62.326  214.147 1.00 54.92  ? 173  GLU B O   1 
ATOM   3366 C  CB  . GLU B 1 173 ? 50.341 -63.139  213.936 1.00 59.93  ? 173  GLU B CB  1 
ATOM   3367 C  CG  . GLU B 1 173 ? 51.724 -63.438  214.451 1.00 63.71  ? 173  GLU B CG  1 
ATOM   3368 C  CD  . GLU B 1 173 ? 52.752 -62.554  213.776 1.00 69.69  ? 173  GLU B CD  1 
ATOM   3369 O  OE1 . GLU B 1 173 ? 52.450 -62.103  212.647 1.00 72.10  ? 173  GLU B OE1 1 
ATOM   3370 O  OE2 . GLU B 1 173 ? 53.847 -62.313  214.344 1.00 71.18  ? 173  GLU B OE2 1 
ATOM   3371 N  N   . ALA B 1 174 ? 46.860 -64.358  214.479 1.00 53.49  ? 174  ALA B N   1 
ATOM   3372 C  CA  . ALA B 1 174 ? 45.492 -63.901  214.602 1.00 50.72  ? 174  ALA B CA  1 
ATOM   3373 C  C   . ALA B 1 174 ? 45.296 -63.224  215.945 1.00 50.07  ? 174  ALA B C   1 
ATOM   3374 O  O   . ALA B 1 174 ? 45.722 -63.787  216.959 1.00 49.54  ? 174  ALA B O   1 
ATOM   3375 C  CB  . ALA B 1 174 ? 44.534 -65.074  214.453 1.00 49.84  ? 174  ALA B CB  1 
ATOM   3376 N  N   . ASP B 1 175 ? 44.692 -62.015  215.930 1.00 49.13  ? 175  ASP B N   1 
ATOM   3377 C  CA  . ASP B 1 175 ? 44.264 -61.278  217.126 1.00 49.01  ? 175  ASP B CA  1 
ATOM   3378 C  C   . ASP B 1 175 ? 42.784 -61.099  217.053 1.00 46.90  ? 175  ASP B C   1 
ATOM   3379 O  O   . ASP B 1 175 ? 42.240 -60.836  215.968 1.00 47.43  ? 175  ASP B O   1 
ATOM   3380 C  CB  . ASP B 1 175 ? 44.787 -59.831  217.159 1.00 50.57  ? 175  ASP B CB  1 
ATOM   3381 C  CG  . ASP B 1 175 ? 46.245 -59.763  217.351 1.00 56.68  ? 175  ASP B CG  1 
ATOM   3382 O  OD1 . ASP B 1 175 ? 46.720 -60.033  218.490 1.00 62.74  ? 175  ASP B OD1 1 
ATOM   3383 O  OD2 . ASP B 1 175 ? 46.926 -59.443  216.359 1.00 61.64  ? 175  ASP B OD2 1 
ATOM   3384 N  N   . VAL B 1 176 ? 42.132 -61.147  218.202 1.00 44.51  ? 176  VAL B N   1 
ATOM   3385 C  CA  . VAL B 1 176 ? 40.749 -60.794  218.235 1.00 42.44  ? 176  VAL B CA  1 
ATOM   3386 C  C   . VAL B 1 176 ? 40.540 -59.850  219.352 1.00 42.31  ? 176  VAL B C   1 
ATOM   3387 O  O   . VAL B 1 176 ? 41.215 -59.923  220.363 1.00 43.11  ? 176  VAL B O   1 
ATOM   3388 C  CB  . VAL B 1 176 ? 39.783 -62.052  218.350 1.00 42.34  ? 176  VAL B CB  1 
ATOM   3389 C  CG1 . VAL B 1 176 ? 40.226 -62.950  219.447 1.00 40.90  ? 176  VAL B CG1 1 
ATOM   3390 C  CG2 . VAL B 1 176 ? 38.312 -61.588  218.570 1.00 37.93  ? 176  VAL B CG2 1 
ATOM   3391 N  N   . HIS B 1 177 ? 39.625 -58.924  219.159 1.00 42.52  ? 177  HIS B N   1 
ATOM   3392 C  CA  . HIS B 1 177 ? 39.228 -58.021  220.226 1.00 43.25  ? 177  HIS B CA  1 
ATOM   3393 C  C   . HIS B 1 177 ? 37.710 -58.111  220.410 1.00 42.51  ? 177  HIS B C   1 
ATOM   3394 O  O   . HIS B 1 177 ? 36.945 -58.163  219.424 1.00 41.61  ? 177  HIS B O   1 
ATOM   3395 C  CB  . HIS B 1 177 ? 39.617 -56.597  219.840 1.00 44.97  ? 177  HIS B CB  1 
ATOM   3396 C  CG  . HIS B 1 177 ? 41.023 -56.258  220.206 1.00 49.44  ? 177  HIS B CG  1 
ATOM   3397 N  ND1 . HIS B 1 177 ? 42.078 -56.443  219.335 1.00 49.96  ? 177  HIS B ND1 1 
ATOM   3398 C  CD2 . HIS B 1 177 ? 41.557 -55.806  221.372 1.00 49.53  ? 177  HIS B CD2 1 
ATOM   3399 C  CE1 . HIS B 1 177 ? 43.202 -56.088  219.942 1.00 54.19  ? 177  HIS B CE1 1 
ATOM   3400 N  NE2 . HIS B 1 177 ? 42.916 -55.714  221.180 1.00 53.10  ? 177  HIS B NE2 1 
ATOM   3401 N  N   . LEU B 1 178 ? 37.272 -58.109  221.659 1.00 42.39  ? 178  LEU B N   1 
ATOM   3402 C  CA  . LEU B 1 178 ? 35.859 -58.099  221.952 1.00 42.36  ? 178  LEU B CA  1 
ATOM   3403 C  C   . LEU B 1 178 ? 35.582 -56.836  222.712 1.00 42.74  ? 178  LEU B C   1 
ATOM   3404 O  O   . LEU B 1 178 ? 36.128 -56.634  223.816 1.00 43.37  ? 178  LEU B O   1 
ATOM   3405 C  CB  . LEU B 1 178 ? 35.514 -59.313  222.771 1.00 43.38  ? 178  LEU B CB  1 
ATOM   3406 C  CG  . LEU B 1 178 ? 34.053 -59.467  223.159 1.00 47.38  ? 178  LEU B CG  1 
ATOM   3407 C  CD1 . LEU B 1 178 ? 33.151 -58.983  222.002 1.00 49.98  ? 178  LEU B CD1 1 
ATOM   3408 C  CD2 . LEU B 1 178 ? 33.748 -60.932  223.549 1.00 48.64  ? 178  LEU B CD2 1 
ATOM   3409 N  N   . VAL B 1 179 ? 34.786 -55.949  222.107 1.00 42.17  ? 179  VAL B N   1 
ATOM   3410 C  CA  . VAL B 1 179 ? 34.637 -54.593  222.632 1.00 42.14  ? 179  VAL B CA  1 
ATOM   3411 C  C   . VAL B 1 179 ? 33.191 -54.288  222.926 1.00 42.92  ? 179  VAL B C   1 
ATOM   3412 O  O   . VAL B 1 179 ? 32.338 -54.419  222.054 1.00 42.11  ? 179  VAL B O   1 
ATOM   3413 C  CB  . VAL B 1 179 ? 35.143 -53.499  221.633 1.00 43.66  ? 179  VAL B CB  1 
ATOM   3414 C  CG1 . VAL B 1 179 ? 35.073 -52.117  222.261 1.00 42.54  ? 179  VAL B CG1 1 
ATOM   3415 C  CG2 . VAL B 1 179 ? 36.589 -53.781  221.132 1.00 42.31  ? 179  VAL B CG2 1 
ATOM   3416 N  N   . LEU B 1 180 ? 32.921 -53.874  224.154 1.00 44.05  ? 180  LEU B N   1 
ATOM   3417 C  CA  . LEU B 1 180 ? 31.595 -53.382  224.542 1.00 46.48  ? 180  LEU B CA  1 
ATOM   3418 C  C   . LEU B 1 180 ? 31.426 -51.901  224.220 1.00 48.95  ? 180  LEU B C   1 
ATOM   3419 O  O   . LEU B 1 180 ? 32.298 -51.067  224.560 1.00 50.64  ? 180  LEU B O   1 
ATOM   3420 C  CB  . LEU B 1 180 ? 31.370 -53.581  226.046 1.00 46.78  ? 180  LEU B CB  1 
ATOM   3421 C  CG  . LEU B 1 180 ? 30.186 -52.827  226.677 1.00 48.42  ? 180  LEU B CG  1 
ATOM   3422 C  CD1 . LEU B 1 180 ? 28.798 -53.417  226.232 1.00 46.76  ? 180  LEU B CD1 1 
ATOM   3423 C  CD2 . LEU B 1 180 ? 30.298 -52.791  228.215 1.00 45.56  ? 180  LEU B CD2 1 
ATOM   3424 N  N   . VAL B 1 181 ? 30.330 -51.560  223.554 1.00 50.37  ? 181  VAL B N   1 
ATOM   3425 C  CA  . VAL B 1 181 ? 29.974 -50.157  223.381 1.00 52.84  ? 181  VAL B CA  1 
ATOM   3426 C  C   . VAL B 1 181 ? 28.626 -49.938  224.025 1.00 55.40  ? 181  VAL B C   1 
ATOM   3427 O  O   . VAL B 1 181 ? 27.634 -50.582  223.692 1.00 54.89  ? 181  VAL B O   1 
ATOM   3428 C  CB  . VAL B 1 181 ? 29.936 -49.753  221.909 1.00 53.19  ? 181  VAL B CB  1 
ATOM   3429 C  CG1 . VAL B 1 181 ? 30.029 -48.240  221.753 1.00 54.18  ? 181  VAL B CG1 1 
ATOM   3430 C  CG2 . VAL B 1 181 ? 31.100 -50.414  221.179 1.00 51.90  ? 181  VAL B CG2 1 
ATOM   3431 N  N   . ARG B 1 182 ? 28.602 -49.057  225.008 1.00 58.86  ? 182  ARG B N   1 
ATOM   3432 C  CA  . ARG B 1 182 ? 27.342 -48.719  225.653 1.00 62.13  ? 182  ARG B CA  1 
ATOM   3433 C  C   . ARG B 1 182 ? 27.323 -47.258  226.078 1.00 65.01  ? 182  ARG B C   1 
ATOM   3434 O  O   . ARG B 1 182 ? 28.362 -46.584  226.102 1.00 65.29  ? 182  ARG B O   1 
ATOM   3435 C  CB  . ARG B 1 182 ? 27.105 -49.623  226.860 1.00 62.09  ? 182  ARG B CB  1 
ATOM   3436 C  CG  . ARG B 1 182 ? 27.879 -49.209  228.049 1.00 61.65  ? 182  ARG B CG  1 
ATOM   3437 C  CD  . ARG B 1 182 ? 27.558 -50.058  229.247 1.00 60.73  ? 182  ARG B CD  1 
ATOM   3438 N  NE  . ARG B 1 182 ? 28.682 -49.938  230.153 1.00 60.18  ? 182  ARG B NE  1 
ATOM   3439 C  CZ  . ARG B 1 182 ? 28.942 -50.763  231.147 1.00 61.54  ? 182  ARG B CZ  1 
ATOM   3440 N  NH1 . ARG B 1 182 ? 28.144 -51.813  231.379 1.00 59.48  ? 182  ARG B NH1 1 
ATOM   3441 N  NH2 . ARG B 1 182 ? 30.010 -50.523  231.900 1.00 61.21  ? 182  ARG B NH2 1 
ATOM   3442 N  N   . SER B 1 183 ? 26.139 -46.770  226.421 1.00 64.48  ? 183  SER B N   1 
ATOM   3443 C  CA  . SER B 1 183 ? 25.996 -45.357  226.794 1.00 67.31  ? 183  SER B CA  1 
ATOM   3444 C  C   . SER B 1 183 ? 26.158 -45.144  228.284 1.00 68.26  ? 183  SER B C   1 
ATOM   3445 O  O   . SER B 1 183 ? 25.566 -45.865  229.087 1.00 67.41  ? 183  SER B O   1 
ATOM   3446 C  CB  . SER B 1 183 ? 24.651 -44.842  226.324 1.00 69.90  ? 183  SER B CB  1 
ATOM   3447 O  OG  . SER B 1 183 ? 24.566 -44.995  224.927 1.00 70.58  ? 183  SER B OG  1 
ATOM   3448 N  N   . GLU B 1 184 ? 26.972 -44.157  228.647 1.00 70.37  ? 184  GLU B N   1 
ATOM   3449 C  CA  . GLU B 1 184 ? 27.259 -43.893  230.055 1.00 72.98  ? 184  GLU B CA  1 
ATOM   3450 C  C   . GLU B 1 184 ? 27.204 -42.398  230.372 1.00 77.56  ? 184  GLU B C   1 
ATOM   3451 O  O   . GLU B 1 184 ? 27.205 -41.549  229.463 1.00 79.36  ? 184  GLU B O   1 
ATOM   3452 C  CB  . GLU B 1 184 ? 28.616 -44.512  230.452 1.00 70.99  ? 184  GLU B CB  1 
ATOM   3453 C  CG  . GLU B 1 184 ? 28.740 -45.986  230.048 1.00 68.10  ? 184  GLU B CG  1 
ATOM   3454 C  CD  . GLU B 1 184 ? 30.032 -46.677  230.539 1.00 67.89  ? 184  GLU B CD  1 
ATOM   3455 O  OE1 . GLU B 1 184 ? 30.670 -46.179  231.488 1.00 70.79  ? 184  GLU B OE1 1 
ATOM   3456 O  OE2 . GLU B 1 184 ? 30.403 -47.733  229.975 1.00 63.39  ? 184  GLU B OE2 1 
ATOM   3457 N  N   . ILE B 1 185 ? 27.148 -42.065  231.659 1.00 80.90  ? 185  ILE B N   1 
ATOM   3458 C  CA  . ILE B 1 185 ? 27.041 -40.663  232.077 1.00 85.81  ? 185  ILE B CA  1 
ATOM   3459 C  C   . ILE B 1 185 ? 28.299 -40.172  232.801 1.00 87.04  ? 185  ILE B C   1 
ATOM   3460 O  O   . ILE B 1 185 ? 28.790 -40.849  233.694 1.00 86.79  ? 185  ILE B O   1 
ATOM   3461 C  CB  . ILE B 1 185 ? 25.834 -40.476  233.012 1.00 89.76  ? 185  ILE B CB  1 
ATOM   3462 C  CG1 . ILE B 1 185 ? 24.599 -41.170  232.414 1.00 89.60  ? 185  ILE B CG1 1 
ATOM   3463 C  CG2 . ILE B 1 185 ? 25.608 -38.980  233.313 1.00 93.32  ? 185  ILE B CG2 1 
ATOM   3464 C  CD1 . ILE B 1 185 ? 23.530 -41.602  233.444 1.00 92.10  ? 185  ILE B CD1 1 
ATOM   3465 N  N   . SER B 1 186 ? 28.816 -39.002  232.420 1.00 89.39  ? 186  SER B N   1 
ATOM   3466 C  CA  . SER B 1 186 ? 29.994 -38.422  233.083 1.00 91.32  ? 186  SER B CA  1 
ATOM   3467 C  C   . SER B 1 186 ? 29.585 -37.600  234.300 1.00 96.60  ? 186  SER B C   1 
ATOM   3468 O  O   . SER B 1 186 ? 28.415 -37.263  234.465 1.00 99.25  ? 186  SER B O   1 
ATOM   3469 C  CB  . SER B 1 186 ? 30.785 -37.533  232.121 1.00 91.75  ? 186  SER B CB  1 
ATOM   3470 O  OG  . SER B 1 186 ? 30.185 -36.250  231.979 1.00 95.35  ? 186  SER B OG  1 
ATOM   3471 N  N   . GLN B 1 187 ? 30.548 -37.269  235.152 1.00 98.89  ? 187  GLN B N   1 
ATOM   3472 C  CA  . GLN B 1 187 ? 30.249 -36.395  236.271 1.00 104.43 ? 187  GLN B CA  1 
ATOM   3473 C  C   . GLN B 1 187 ? 29.571 -35.138  235.780 1.00 108.15 ? 187  GLN B C   1 
ATOM   3474 O  O   . GLN B 1 187 ? 28.588 -34.697  236.359 1.00 112.71 ? 187  GLN B O   1 
ATOM   3475 C  CB  . GLN B 1 187 ? 31.512 -36.025  237.025 1.00 105.96 ? 187  GLN B CB  1 
ATOM   3476 C  CG  . GLN B 1 187 ? 32.126 -37.203  237.721 1.00 105.92 ? 187  GLN B CG  1 
ATOM   3477 C  CD  . GLN B 1 187 ? 33.208 -36.793  238.680 1.00 110.50 ? 187  GLN B CD  1 
ATOM   3478 O  OE1 . GLN B 1 187 ? 34.126 -37.572  238.954 1.00 111.17 ? 187  GLN B OE1 1 
ATOM   3479 N  NE2 . GLN B 1 187 ? 33.121 -35.561  239.192 1.00 114.39 ? 187  GLN B NE2 1 
ATOM   3480 N  N   . GLU B 1 188 ? 30.094 -34.563  234.702 1.00 107.77 ? 188  GLU B N   1 
ATOM   3481 C  CA  . GLU B 1 188 ? 29.579 -33.296  234.171 1.00 111.61 ? 188  GLU B CA  1 
ATOM   3482 C  C   . GLU B 1 188 ? 28.148 -33.451  233.653 1.00 113.27 ? 188  GLU B C   1 
ATOM   3483 O  O   . GLU B 1 188 ? 27.530 -32.489  233.217 1.00 117.30 ? 188  GLU B O   1 
ATOM   3484 C  CB  . GLU B 1 188 ? 30.508 -32.748  233.069 1.00 110.52 ? 188  GLU B CB  1 
ATOM   3485 C  CG  . GLU B 1 188 ? 31.972 -32.503  233.508 1.00 108.47 ? 188  GLU B CG  1 
ATOM   3486 C  CD  . GLU B 1 188 ? 32.794 -33.799  233.792 1.00 101.79 ? 188  GLU B CD  1 
ATOM   3487 O  OE1 . GLU B 1 188 ? 32.535 -34.876  233.176 1.00 93.72  ? 188  GLU B OE1 1 
ATOM   3488 O  OE2 . GLU B 1 188 ? 33.720 -33.711  234.639 1.00 100.71 ? 188  GLU B OE2 1 
ATOM   3489 N  N   . GLY B 1 189 ? 27.636 -34.681  233.701 1.00 111.21 ? 189  GLY B N   1 
ATOM   3490 C  CA  . GLY B 1 189 ? 26.287 -35.000  233.209 1.00 112.96 ? 189  GLY B CA  1 
ATOM   3491 C  C   . GLY B 1 189 ? 26.174 -35.398  231.738 1.00 110.77 ? 189  GLY B C   1 
ATOM   3492 O  O   . GLY B 1 189 ? 25.101 -35.798  231.286 1.00 110.83 ? 189  GLY B O   1 
ATOM   3493 N  N   . MET B 1 190 ? 27.268 -35.292  230.981 1.00 109.38 ? 190  MET B N   1 
ATOM   3494 C  CA  . MET B 1 190 ? 27.217 -35.591  229.542 1.00 108.79 ? 190  MET B CA  1 
ATOM   3495 C  C   . MET B 1 190 ? 27.091 -37.102  229.260 1.00 102.97 ? 190  MET B C   1 
ATOM   3496 O  O   . MET B 1 190 ? 27.848 -37.925  229.817 1.00 99.81  ? 190  MET B O   1 
ATOM   3497 C  CB  . MET B 1 190 ? 28.417 -35.000  228.787 1.00 109.75 ? 190  MET B CB  1 
ATOM   3498 C  CG  . MET B 1 190 ? 28.206 -34.943  227.267 1.00 114.73 ? 190  MET B CG  1 
ATOM   3499 S  SD  . MET B 1 190 ? 29.681 -35.262  226.246 1.00 121.34 ? 190  MET B SD  1 
ATOM   3500 C  CE  . MET B 1 190 ? 29.022 -34.883  224.594 1.00 123.80 ? 190  MET B CE  1 
ATOM   3501 N  N   . VAL B 1 191 ? 26.126 -37.455  228.409 1.00 101.88 ? 191  VAL B N   1 
ATOM   3502 C  CA  . VAL B 1 191 ? 25.871 -38.849  228.063 1.00 96.60  ? 191  VAL B CA  1 
ATOM   3503 C  C   . VAL B 1 191 ? 26.583 -39.184  226.759 1.00 93.61  ? 191  VAL B C   1 
ATOM   3504 O  O   . VAL B 1 191 ? 26.375 -38.505  225.749 1.00 97.06  ? 191  VAL B O   1 
ATOM   3505 C  CB  . VAL B 1 191 ? 24.348 -39.147  227.955 1.00 98.57  ? 191  VAL B CB  1 
ATOM   3506 C  CG1 . VAL B 1 191 ? 24.094 -40.344  227.042 1.00 94.61  ? 191  VAL B CG1 1 
ATOM   3507 C  CG2 . VAL B 1 191 ? 23.771 -39.387  229.343 1.00 99.16  ? 191  VAL B CG2 1 
ATOM   3508 N  N   . PHE B 1 192 ? 27.427 -40.216  226.785 1.00 87.45  ? 192  PHE B N   1 
ATOM   3509 C  CA  . PHE B 1 192 ? 28.297 -40.539  225.650 1.00 84.24  ? 192  PHE B CA  1 
ATOM   3510 C  C   . PHE B 1 192 ? 28.553 -42.055  225.539 1.00 78.97  ? 192  PHE B C   1 
ATOM   3511 O  O   . PHE B 1 192 ? 28.337 -42.819  226.493 1.00 76.39  ? 192  PHE B O   1 
ATOM   3512 C  CB  . PHE B 1 192 ? 29.626 -39.782  225.783 1.00 85.30  ? 192  PHE B CB  1 
ATOM   3513 C  CG  . PHE B 1 192 ? 30.489 -40.279  226.910 1.00 83.36  ? 192  PHE B CG  1 
ATOM   3514 C  CD1 . PHE B 1 192 ? 31.587 -41.113  226.647 1.00 81.02  ? 192  PHE B CD1 1 
ATOM   3515 C  CD2 . PHE B 1 192 ? 30.193 -39.950  228.238 1.00 83.96  ? 192  PHE B CD2 1 
ATOM   3516 C  CE1 . PHE B 1 192 ? 32.392 -41.622  227.681 1.00 79.16  ? 192  PHE B CE1 1 
ATOM   3517 C  CE2 . PHE B 1 192 ? 30.988 -40.458  229.294 1.00 84.04  ? 192  PHE B CE2 1 
ATOM   3518 C  CZ  . PHE B 1 192 ? 32.096 -41.297  229.005 1.00 81.78  ? 192  PHE B CZ  1 
ATOM   3519 N  N   . ARG B 1 193 ? 29.002 -42.480  224.362 1.00 77.07  ? 193  ARG B N   1 
ATOM   3520 C  CA  . ARG B 1 193 ? 29.304 -43.884  224.107 1.00 72.37  ? 193  ARG B CA  1 
ATOM   3521 C  C   . ARG B 1 193 ? 30.675 -44.218  224.632 1.00 70.42  ? 193  ARG B C   1 
ATOM   3522 O  O   . ARG B 1 193 ? 31.657 -43.627  224.214 1.00 72.30  ? 193  ARG B O   1 
ATOM   3523 C  CB  . ARG B 1 193 ? 29.252 -44.178  222.619 1.00 72.85  ? 193  ARG B CB  1 
ATOM   3524 C  CG  . ARG B 1 193 ? 27.869 -43.966  222.028 1.00 76.19  ? 193  ARG B CG  1 
ATOM   3525 C  CD  . ARG B 1 193 ? 26.843 -44.950  222.602 1.00 75.62  ? 193  ARG B CD  1 
ATOM   3526 N  NE  . ARG B 1 193 ? 26.741 -46.181  221.821 1.00 74.06  ? 193  ARG B NE  1 
ATOM   3527 C  CZ  . ARG B 1 193 ? 26.031 -47.245  222.203 1.00 72.75  ? 193  ARG B CZ  1 
ATOM   3528 N  NH1 . ARG B 1 193 ? 25.372 -47.224  223.352 1.00 74.57  ? 193  ARG B NH1 1 
ATOM   3529 N  NH2 . ARG B 1 193 ? 25.972 -48.326  221.447 1.00 68.23  ? 193  ARG B NH2 1 
ATOM   3530 N  N   . ARG B 1 194 ? 30.738 -45.152  225.570 1.00 68.51  ? 194  ARG B N   1 
ATOM   3531 C  CA  . ARG B 1 194 ? 32.005 -45.605  226.089 1.00 66.60  ? 194  ARG B CA  1 
ATOM   3532 C  C   . ARG B 1 194 ? 32.364 -46.988  225.515 1.00 62.26  ? 194  ARG B C   1 
ATOM   3533 O  O   . ARG B 1 194 ? 31.486 -47.831  225.230 1.00 60.37  ? 194  ARG B O   1 
ATOM   3534 C  CB  . ARG B 1 194 ? 31.980 -45.632  227.612 1.00 68.07  ? 194  ARG B CB  1 
ATOM   3535 C  CG  . ARG B 1 194 ? 33.356 -45.798  228.242 1.00 70.34  ? 194  ARG B CG  1 
ATOM   3536 C  CD  . ARG B 1 194 ? 33.323 -45.455  229.739 1.00 77.67  ? 194  ARG B CD  1 
ATOM   3537 N  NE  . ARG B 1 194 ? 34.566 -44.829  230.177 1.00 83.40  ? 194  ARG B NE  1 
ATOM   3538 C  CZ  . ARG B 1 194 ? 34.957 -43.619  229.769 1.00 87.26  ? 194  ARG B CZ  1 
ATOM   3539 N  NH1 . ARG B 1 194 ? 34.189 -42.949  228.917 1.00 89.78  ? 194  ARG B NH1 1 
ATOM   3540 N  NH2 . ARG B 1 194 ? 36.102 -43.082  230.185 1.00 85.81  ? 194  ARG B NH2 1 
ATOM   3541 N  N   . PHE B 1 195 ? 33.664 -47.181  225.323 1.00 59.61  ? 195  PHE B N   1 
ATOM   3542 C  CA  . PHE B 1 195 ? 34.232 -48.367  224.689 1.00 55.40  ? 195  PHE B CA  1 
ATOM   3543 C  C   . PHE B 1 195 ? 34.991 -49.101  225.761 1.00 54.63  ? 195  PHE B C   1 
ATOM   3544 O  O   . PHE B 1 195 ? 35.744 -48.486  226.540 1.00 56.04  ? 195  PHE B O   1 
ATOM   3545 C  CB  . PHE B 1 195 ? 35.211 -47.973  223.593 1.00 54.34  ? 195  PHE B CB  1 
ATOM   3546 C  CG  . PHE B 1 195 ? 34.560 -47.527  222.325 1.00 54.71  ? 195  PHE B CG  1 
ATOM   3547 C  CD1 . PHE B 1 195 ? 34.063 -46.222  222.189 1.00 60.61  ? 195  PHE B CD1 1 
ATOM   3548 C  CD2 . PHE B 1 195 ? 34.428 -48.397  221.260 1.00 52.22  ? 195  PHE B CD2 1 
ATOM   3549 C  CE1 . PHE B 1 195 ? 33.444 -45.813  220.979 1.00 59.73  ? 195  PHE B CE1 1 
ATOM   3550 C  CE2 . PHE B 1 195 ? 33.832 -48.002  220.068 1.00 53.48  ? 195  PHE B CE2 1 
ATOM   3551 C  CZ  . PHE B 1 195 ? 33.342 -46.723  219.924 1.00 56.41  ? 195  PHE B CZ  1 
ATOM   3552 N  N   . HIS B 1 196 ? 34.783 -50.411  225.835 1.00 51.99  ? 196  HIS B N   1 
ATOM   3553 C  CA  . HIS B 1 196 ? 35.573 -51.232  226.754 1.00 50.45  ? 196  HIS B CA  1 
ATOM   3554 C  C   . HIS B 1 196 ? 36.090 -52.451  226.018 1.00 48.34  ? 196  HIS B C   1 
ATOM   3555 O  O   . HIS B 1 196 ? 35.308 -53.236  225.492 1.00 47.67  ? 196  HIS B O   1 
ATOM   3556 C  CB  . HIS B 1 196 ? 34.734 -51.710  227.942 1.00 50.69  ? 196  HIS B CB  1 
ATOM   3557 C  CG  . HIS B 1 196 ? 33.995 -50.620  228.657 1.00 50.95  ? 196  HIS B CG  1 
ATOM   3558 N  ND1 . HIS B 1 196 ? 34.382 -50.147  229.897 1.00 51.18  ? 196  HIS B ND1 1 
ATOM   3559 C  CD2 . HIS B 1 196 ? 32.856 -49.964  228.341 1.00 49.71  ? 196  HIS B CD2 1 
ATOM   3560 C  CE1 . HIS B 1 196 ? 33.530 -49.221  230.295 1.00 48.72  ? 196  HIS B CE1 1 
ATOM   3561 N  NE2 . HIS B 1 196 ? 32.599 -49.088  229.367 1.00 52.59  ? 196  HIS B NE2 1 
ATOM   3562 N  N   . ASP B 1 197 ? 37.408 -52.584  225.973 1.00 47.82  ? 197  ASP B N   1 
ATOM   3563 C  CA  . ASP B 1 197 ? 38.068 -53.696  225.380 1.00 45.37  ? 197  ASP B CA  1 
ATOM   3564 C  C   . ASP B 1 197 ? 38.036 -54.755  226.427 1.00 45.41  ? 197  ASP B C   1 
ATOM   3565 O  O   . ASP B 1 197 ? 38.742 -54.631  227.425 1.00 46.38  ? 197  ASP B O   1 
ATOM   3566 C  CB  . ASP B 1 197 ? 39.509 -53.309  225.176 1.00 46.27  ? 197  ASP B CB  1 
ATOM   3567 C  CG  . ASP B 1 197 ? 40.277 -54.328  224.347 1.00 47.38  ? 197  ASP B CG  1 
ATOM   3568 O  OD1 . ASP B 1 197 ? 39.654 -55.205  223.672 1.00 46.79  ? 197  ASP B OD1 1 
ATOM   3569 O  OD2 . ASP B 1 197 ? 41.519 -54.226  224.356 1.00 47.73  ? 197  ASP B OD2 1 
ATOM   3570 N  N   . LEU B 1 198 ? 37.232 -55.804  226.222 1.00 44.14  ? 198  LEU B N   1 
ATOM   3571 C  CA  . LEU B 1 198 ? 37.024 -56.826  227.242 1.00 42.53  ? 198  LEU B CA  1 
ATOM   3572 C  C   . LEU B 1 198 ? 38.187 -57.801  227.320 1.00 42.33  ? 198  LEU B C   1 
ATOM   3573 O  O   . LEU B 1 198 ? 38.720 -58.250  226.305 1.00 40.94  ? 198  LEU B O   1 
ATOM   3574 C  CB  . LEU B 1 198 ? 35.705 -57.561  226.971 1.00 42.30  ? 198  LEU B CB  1 
ATOM   3575 C  CG  . LEU B 1 198 ? 34.457 -56.669  226.866 1.00 42.27  ? 198  LEU B CG  1 
ATOM   3576 C  CD1 . LEU B 1 198 ? 33.183 -57.423  226.538 1.00 43.70  ? 198  LEU B CD1 1 
ATOM   3577 C  CD2 . LEU B 1 198 ? 34.252 -55.965  228.159 1.00 43.74  ? 198  LEU B CD2 1 
ATOM   3578 N  N   . THR B 1 199 ? 38.595 -58.118  228.540 1.00 43.74  ? 199  THR B N   1 
ATOM   3579 C  CA  . THR B 1 199 ? 39.624 -59.129  228.790 1.00 44.81  ? 199  THR B CA  1 
ATOM   3580 C  C   . THR B 1 199 ? 39.184 -60.527  228.325 1.00 45.40  ? 199  THR B C   1 
ATOM   3581 O  O   . THR B 1 199 ? 38.080 -60.993  228.678 1.00 45.16  ? 199  THR B O   1 
ATOM   3582 C  CB  . THR B 1 199 ? 39.888 -59.231  230.278 1.00 45.96  ? 199  THR B CB  1 
ATOM   3583 O  OG1 . THR B 1 199 ? 40.357 -57.975  230.739 1.00 47.85  ? 199  THR B OG1 1 
ATOM   3584 C  CG2 . THR B 1 199 ? 40.956 -60.272  230.603 1.00 47.01  ? 199  THR B CG2 1 
ATOM   3585 N  N   . LEU B 1 200 ? 40.050 -61.192  227.552 1.00 44.86  ? 200  LEU B N   1 
ATOM   3586 C  CA  . LEU B 1 200 ? 39.749 -62.485  226.968 1.00 43.86  ? 200  LEU B CA  1 
ATOM   3587 C  C   . LEU B 1 200 ? 40.673 -63.530  227.613 1.00 45.85  ? 200  LEU B C   1 
ATOM   3588 O  O   . LEU B 1 200 ? 41.814 -63.194  227.964 1.00 46.20  ? 200  LEU B O   1 
ATOM   3589 C  CB  . LEU B 1 200 ? 39.971 -62.443  225.460 1.00 41.69  ? 200  LEU B CB  1 
ATOM   3590 C  CG  . LEU B 1 200 ? 39.128 -61.402  224.730 1.00 41.48  ? 200  LEU B CG  1 
ATOM   3591 C  CD1 . LEU B 1 200 ? 39.147 -61.526  223.201 1.00 37.57  ? 200  LEU B CD1 1 
ATOM   3592 C  CD2 . LEU B 1 200 ? 37.712 -61.409  225.249 1.00 38.23  ? 200  LEU B CD2 1 
ATOM   3593 N  N   . THR B 1 201 ? 40.208 -64.781  227.780 1.00 45.82  ? 201  THR B N   1 
ATOM   3594 C  CA  . THR B 1 201 ? 41.111 -65.781  228.317 1.00 47.73  ? 201  THR B CA  1 
ATOM   3595 C  C   . THR B 1 201 ? 42.293 -65.937  227.338 1.00 48.70  ? 201  THR B C   1 
ATOM   3596 O  O   . THR B 1 201 ? 43.423 -66.156  227.743 1.00 48.04  ? 201  THR B O   1 
ATOM   3597 C  CB  . THR B 1 201 ? 40.414 -67.136  228.564 1.00 48.21  ? 201  THR B CB  1 
ATOM   3598 O  OG1 . THR B 1 201 ? 39.884 -67.597  227.328 1.00 50.03  ? 201  THR B OG1 1 
ATOM   3599 C  CG2 . THR B 1 201 ? 39.252 -67.009  229.538 1.00 46.87  ? 201  THR B CG2 1 
ATOM   3600 N  N   . ARG B 1 202 ? 42.018 -65.827  226.044 1.00 48.97  ? 202  ARG B N   1 
ATOM   3601 C  CA  A ARG B 1 202 ? 43.072 -65.832  225.038 0.50 50.21  ? 202  ARG B CA  1 
ATOM   3602 C  CA  B ARG B 1 202 ? 43.067 -65.856  225.027 0.50 50.51  ? 202  ARG B CA  1 
ATOM   3603 C  C   . ARG B 1 202 ? 42.695 -64.859  223.928 1.00 49.62  ? 202  ARG B C   1 
ATOM   3604 O  O   . ARG B 1 202 ? 41.594 -64.898  223.403 1.00 48.22  ? 202  ARG B O   1 
ATOM   3605 C  CB  A ARG B 1 202 ? 43.269 -67.235  224.463 0.50 51.15  ? 202  ARG B CB  1 
ATOM   3606 C  CB  B ARG B 1 202 ? 43.200 -67.267  224.437 0.50 51.66  ? 202  ARG B CB  1 
ATOM   3607 C  CG  A ARG B 1 202 ? 44.236 -67.273  223.263 0.50 53.67  ? 202  ARG B CG  1 
ATOM   3608 C  CG  B ARG B 1 202 ? 43.967 -67.330  223.099 0.50 55.37  ? 202  ARG B CG  1 
ATOM   3609 C  CD  A ARG B 1 202 ? 44.683 -68.720  222.892 0.50 56.59  ? 202  ARG B CD  1 
ATOM   3610 C  CD  B ARG B 1 202 ? 44.427 -68.786  222.729 0.50 61.07  ? 202  ARG B CD  1 
ATOM   3611 N  NE  A ARG B 1 202 ? 46.076 -68.739  222.467 0.50 56.90  ? 202  ARG B NE  1 
ATOM   3612 N  NE  B ARG B 1 202 ? 43.334 -69.776  222.721 0.50 63.29  ? 202  ARG B NE  1 
ATOM   3613 C  CZ  A ARG B 1 202 ? 47.088 -68.723  223.324 0.50 58.68  ? 202  ARG B CZ  1 
ATOM   3614 C  CZ  B ARG B 1 202 ? 42.803 -70.322  221.627 0.50 63.76  ? 202  ARG B CZ  1 
ATOM   3615 N  NH1 A ARG B 1 202 ? 46.832 -68.711  224.618 0.50 60.69  ? 202  ARG B NH1 1 
ATOM   3616 N  NH1 B ARG B 1 202 ? 43.240 -69.993  220.422 0.50 64.29  ? 202  ARG B NH1 1 
ATOM   3617 N  NH2 A ARG B 1 202 ? 48.341 -68.711  222.906 0.50 60.23  ? 202  ARG B NH2 1 
ATOM   3618 N  NH2 B ARG B 1 202 ? 41.831 -71.209  221.735 0.50 64.70  ? 202  ARG B NH2 1 
ATOM   3619 N  N   . SER B 1 203 ? 43.602 -63.964  223.571 1.00 50.85  ? 203  SER B N   1 
ATOM   3620 C  CA  . SER B 1 203 ? 43.251 -63.010  222.564 1.00 51.40  ? 203  SER B CA  1 
ATOM   3621 C  C   . SER B 1 203 ? 44.147 -63.044  221.317 1.00 53.01  ? 203  SER B C   1 
ATOM   3622 O  O   . SER B 1 203 ? 43.792 -62.494  220.277 1.00 52.85  ? 203  SER B O   1 
ATOM   3623 C  CB  . SER B 1 203 ? 43.262 -61.631  223.167 1.00 51.30  ? 203  SER B CB  1 
ATOM   3624 O  OG  . SER B 1 203 ? 44.527 -61.148  222.941 1.00 52.88  ? 203  SER B OG  1 
ATOM   3625 N  N   . ARG B 1 204 ? 45.317 -63.667  221.429 1.00 55.47  ? 204  ARG B N   1 
ATOM   3626 C  CA  . ARG B 1 204 ? 46.227 -63.819  220.310 1.00 56.95  ? 204  ARG B CA  1 
ATOM   3627 C  C   . ARG B 1 204 ? 46.325 -65.301  220.088 1.00 58.26  ? 204  ARG B C   1 
ATOM   3628 O  O   . ARG B 1 204 ? 46.668 -66.006  220.999 1.00 60.16  ? 204  ARG B O   1 
ATOM   3629 C  CB  . ARG B 1 204 ? 47.607 -63.199  220.661 1.00 58.57  ? 204  ARG B CB  1 
ATOM   3630 C  CG  . ARG B 1 204 ? 48.849 -63.705  219.859 1.00 60.88  ? 204  ARG B CG  1 
ATOM   3631 C  CD  . ARG B 1 204 ? 48.759 -63.586  218.307 1.00 62.16  ? 204  ARG B CD  1 
ATOM   3632 N  NE  . ARG B 1 204 ? 48.769 -62.197  217.854 1.00 64.77  ? 204  ARG B NE  1 
ATOM   3633 C  CZ  . ARG B 1 204 ? 49.852 -61.576  217.393 1.00 69.53  ? 204  ARG B CZ  1 
ATOM   3634 N  NH1 . ARG B 1 204 ? 51.017 -62.228  217.327 1.00 73.40  ? 204  ARG B NH1 1 
ATOM   3635 N  NH2 . ARG B 1 204 ? 49.791 -60.302  217.012 1.00 67.28  ? 204  ARG B NH2 1 
ATOM   3636 N  N   . SER B 1 205 ? 45.960 -65.784  218.910 1.00 59.36  ? 205  SER B N   1 
ATOM   3637 C  CA  . SER B 1 205 ? 46.237 -67.172  218.493 1.00 61.47  ? 205  SER B CA  1 
ATOM   3638 C  C   . SER B 1 205 ? 47.386 -67.214  217.440 1.00 63.96  ? 205  SER B C   1 
ATOM   3639 O  O   . SER B 1 205 ? 47.300 -66.589  216.379 1.00 63.95  ? 205  SER B O   1 
ATOM   3640 C  CB  . SER B 1 205 ? 44.998 -67.816  217.899 1.00 60.01  ? 205  SER B CB  1 
ATOM   3641 O  OG  . SER B 1 205 ? 45.405 -68.964  217.188 1.00 61.96  ? 205  SER B OG  1 
ATOM   3642 N  N   . PRO B 1 206 ? 48.460 -67.967  217.711 1.00 66.33  ? 206  PRO B N   1 
ATOM   3643 C  CA  . PRO B 1 206 ? 49.630 -67.697  216.879 1.00 67.44  ? 206  PRO B CA  1 
ATOM   3644 C  C   . PRO B 1 206 ? 49.492 -68.444  215.539 1.00 67.76  ? 206  PRO B C   1 
ATOM   3645 O  O   . PRO B 1 206 ? 50.045 -68.002  214.496 1.00 68.66  ? 206  PRO B O   1 
ATOM   3646 C  CB  . PRO B 1 206 ? 50.788 -68.211  217.742 1.00 69.36  ? 206  PRO B CB  1 
ATOM   3647 C  CG  . PRO B 1 206 ? 50.098 -69.184  218.812 1.00 69.66  ? 206  PRO B CG  1 
ATOM   3648 C  CD  . PRO B 1 206 ? 48.616 -69.228  218.463 1.00 68.00  ? 206  PRO B CD  1 
ATOM   3649 N  N   . ILE B 1 207 ? 48.704 -69.517  215.556 1.00 66.01  ? 207  ILE B N   1 
ATOM   3650 C  CA  . ILE B 1 207 ? 48.279 -70.130  214.325 1.00 66.61  ? 207  ILE B CA  1 
ATOM   3651 C  C   . ILE B 1 207 ? 46.821 -70.526  214.414 1.00 65.06  ? 207  ILE B C   1 
ATOM   3652 O  O   . ILE B 1 207 ? 46.475 -71.358  215.241 1.00 66.01  ? 207  ILE B O   1 
ATOM   3653 C  CB  . ILE B 1 207 ? 49.113 -71.362  214.008 1.00 69.92  ? 207  ILE B CB  1 
ATOM   3654 C  CG1 . ILE B 1 207 ? 50.576 -70.958  213.783 1.00 71.96  ? 207  ILE B CG1 1 
ATOM   3655 C  CG2 . ILE B 1 207 ? 48.524 -72.121  212.812 1.00 70.37  ? 207  ILE B CG2 1 
ATOM   3656 C  CD1 . ILE B 1 207 ? 51.428 -72.081  213.264 1.00 77.50  ? 207  ILE B CD1 1 
ATOM   3657 N  N   . PHE B 1 208 ? 45.977 -69.932  213.560 1.00 63.71  ? 208  PHE B N   1 
ATOM   3658 C  CA  . PHE B 1 208 ? 44.510 -70.142  213.555 1.00 61.99  ? 208  PHE B CA  1 
ATOM   3659 C  C   . PHE B 1 208 ? 44.115 -70.972  212.361 1.00 63.09  ? 208  PHE B C   1 
ATOM   3660 O  O   . PHE B 1 208 ? 44.178 -70.492  211.235 1.00 63.61  ? 208  PHE B O   1 
ATOM   3661 C  CB  . PHE B 1 208 ? 43.796 -68.792  213.455 1.00 59.62  ? 208  PHE B CB  1 
ATOM   3662 C  CG  . PHE B 1 208 ? 42.288 -68.872  213.383 1.00 57.67  ? 208  PHE B CG  1 
ATOM   3663 C  CD1 . PHE B 1 208 ? 41.563 -69.550  214.338 1.00 58.11  ? 208  PHE B CD1 1 
ATOM   3664 C  CD2 . PHE B 1 208 ? 41.591 -68.208  212.394 1.00 57.81  ? 208  PHE B CD2 1 
ATOM   3665 C  CE1 . PHE B 1 208 ? 40.185 -69.583  214.297 1.00 56.03  ? 208  PHE B CE1 1 
ATOM   3666 C  CE2 . PHE B 1 208 ? 40.184 -68.240  212.346 1.00 55.89  ? 208  PHE B CE2 1 
ATOM   3667 C  CZ  . PHE B 1 208 ? 39.496 -68.923  213.301 1.00 55.36  ? 208  PHE B CZ  1 
ATOM   3668 N  N   . SER B 1 209 ? 43.710 -72.216  212.578 1.00 64.22  ? 209  SER B N   1 
ATOM   3669 C  CA  . SER B 1 209 ? 43.350 -73.066  211.425 1.00 66.11  ? 209  SER B CA  1 
ATOM   3670 C  C   . SER B 1 209 ? 41.898 -73.507  211.343 1.00 64.33  ? 209  SER B C   1 
ATOM   3671 O  O   . SER B 1 209 ? 41.383 -73.736  210.258 1.00 65.79  ? 209  SER B O   1 
ATOM   3672 C  CB  . SER B 1 209 ? 44.292 -74.281  211.287 1.00 68.85  ? 209  SER B CB  1 
ATOM   3673 O  OG  . SER B 1 209 ? 45.065 -74.448  212.457 1.00 72.37  ? 209  SER B OG  1 
ATOM   3674 N  N   . LEU B 1 210 ? 41.237 -73.655  212.475 1.00 62.03  ? 210  LEU B N   1 
ATOM   3675 C  CA  . LEU B 1 210 ? 39.899 -74.220  212.451 1.00 60.66  ? 210  LEU B CA  1 
ATOM   3676 C  C   . LEU B 1 210 ? 38.824 -73.359  213.124 1.00 57.89  ? 210  LEU B C   1 
ATOM   3677 O  O   . LEU B 1 210 ? 38.127 -72.571  212.491 1.00 56.59  ? 210  LEU B O   1 
ATOM   3678 C  CB  . LEU B 1 210 ? 39.930 -75.598  213.106 1.00 62.84  ? 210  LEU B CB  1 
ATOM   3679 C  CG  . LEU B 1 210 ? 40.959 -76.579  212.498 1.00 66.08  ? 210  LEU B CG  1 
ATOM   3680 C  CD1 . LEU B 1 210 ? 41.374 -77.654  213.490 1.00 66.18  ? 210  LEU B CD1 1 
ATOM   3681 C  CD2 . LEU B 1 210 ? 40.455 -77.197  211.207 1.00 67.35  ? 210  LEU B CD2 1 
ATOM   3682 N  N   . SER B 1 211 ? 38.677 -73.528  214.420 1.00 56.85  ? 211  SER B N   1 
ATOM   3683 C  CA  . SER B 1 211 ? 37.613 -72.863  215.136 1.00 54.86  ? 211  SER B CA  1 
ATOM   3684 C  C   . SER B 1 211 ? 38.211 -72.293  216.406 1.00 53.08  ? 211  SER B C   1 
ATOM   3685 O  O   . SER B 1 211 ? 39.169 -72.836  216.923 1.00 55.23  ? 211  SER B O   1 
ATOM   3686 C  CB  . SER B 1 211 ? 36.453 -73.827  215.441 1.00 55.55  ? 211  SER B CB  1 
ATOM   3687 O  OG  . SER B 1 211 ? 35.417 -73.153  216.140 1.00 54.80  ? 211  SER B OG  1 
ATOM   3688 N  N   . TRP B 1 212 ? 37.663 -71.197  216.907 1.00 50.09  ? 212  TRP B N   1 
ATOM   3689 C  CA  . TRP B 1 212 ? 38.262 -70.531  218.060 1.00 47.38  ? 212  TRP B CA  1 
ATOM   3690 C  C   . TRP B 1 212 ? 37.122 -69.966  218.851 1.00 45.90  ? 212  TRP B C   1 
ATOM   3691 O  O   . TRP B 1 212 ? 36.338 -69.170  218.338 1.00 44.28  ? 212  TRP B O   1 
ATOM   3692 C  CB  . TRP B 1 212 ? 39.199 -69.418  217.575 1.00 46.74  ? 212  TRP B CB  1 
ATOM   3693 C  CG  . TRP B 1 212 ? 39.833 -68.594  218.633 1.00 44.38  ? 212  TRP B CG  1 
ATOM   3694 C  CD1 . TRP B 1 212 ? 39.781 -68.793  219.991 1.00 43.50  ? 212  TRP B CD1 1 
ATOM   3695 C  CD2 . TRP B 1 212 ? 40.693 -67.467  218.428 1.00 44.42  ? 212  TRP B CD2 1 
ATOM   3696 N  NE1 . TRP B 1 212 ? 40.529 -67.840  220.635 1.00 41.89  ? 212  TRP B NE1 1 
ATOM   3697 C  CE2 . TRP B 1 212 ? 41.101 -67.015  219.711 1.00 41.81  ? 212  TRP B CE2 1 
ATOM   3698 C  CE3 . TRP B 1 212 ? 41.153 -66.786  217.284 1.00 41.65  ? 212  TRP B CE3 1 
ATOM   3699 C  CZ2 . TRP B 1 212 ? 41.938 -65.921  219.884 1.00 43.08  ? 212  TRP B CZ2 1 
ATOM   3700 C  CZ3 . TRP B 1 212 ? 41.993 -65.690  217.459 1.00 42.16  ? 212  TRP B CZ3 1 
ATOM   3701 C  CH2 . TRP B 1 212 ? 42.380 -65.266  218.749 1.00 41.40  ? 212  TRP B CH2 1 
ATOM   3702 N  N   . THR B 1 213 ? 36.976 -70.427  220.078 1.00 46.29  ? 213  THR B N   1 
ATOM   3703 C  CA  . THR B 1 213 ? 35.908 -69.912  220.922 1.00 46.56  ? 213  THR B CA  1 
ATOM   3704 C  C   . THR B 1 213 ? 36.508 -68.794  221.745 1.00 45.35  ? 213  THR B C   1 
ATOM   3705 O  O   . THR B 1 213 ? 37.457 -69.034  222.478 1.00 46.51  ? 213  THR B O   1 
ATOM   3706 C  CB  . THR B 1 213 ? 35.317 -71.026  221.824 1.00 47.80  ? 213  THR B CB  1 
ATOM   3707 O  OG1 . THR B 1 213 ? 34.710 -71.986  220.971 1.00 50.50  ? 213  THR B OG1 1 
ATOM   3708 C  CG2 . THR B 1 213 ? 34.207 -70.487  222.762 1.00 46.85  ? 213  THR B CG2 1 
ATOM   3709 N  N   . VAL B 1 214 ? 36.000 -67.580  221.572 1.00 43.57  ? 214  VAL B N   1 
ATOM   3710 C  CA  . VAL B 1 214 ? 36.540 -66.418  222.212 1.00 42.55  ? 214  VAL B CA  1 
ATOM   3711 C  C   . VAL B 1 214 ? 35.731 -66.196  223.461 1.00 43.38  ? 214  VAL B C   1 
ATOM   3712 O  O   . VAL B 1 214 ? 34.513 -66.223  223.411 1.00 44.53  ? 214  VAL B O   1 
ATOM   3713 C  CB  . VAL B 1 214 ? 36.390 -65.236  221.253 1.00 42.55  ? 214  VAL B CB  1 
ATOM   3714 C  CG1 . VAL B 1 214 ? 36.744 -63.882  221.908 1.00 38.78  ? 214  VAL B CG1 1 
ATOM   3715 C  CG2 . VAL B 1 214 ? 37.226 -65.504  220.001 1.00 42.18  ? 214  VAL B CG2 1 
ATOM   3716 N  N   . MET B 1 215 ? 36.384 -65.954  224.590 1.00 44.00  ? 215  MET B N   1 
ATOM   3717 C  CA  . MET B 1 215 ? 35.671 -65.925  225.878 1.00 44.43  ? 215  MET B CA  1 
ATOM   3718 C  C   . MET B 1 215 ? 36.116 -64.771  226.750 1.00 43.78  ? 215  MET B C   1 
ATOM   3719 O  O   . MET B 1 215 ? 37.336 -64.508  226.911 1.00 44.39  ? 215  MET B O   1 
ATOM   3720 C  CB  . MET B 1 215 ? 35.920 -67.228  226.662 1.00 46.07  ? 215  MET B CB  1 
ATOM   3721 C  CG  . MET B 1 215 ? 35.504 -68.502  225.930 1.00 48.02  ? 215  MET B CG  1 
ATOM   3722 S  SD  . MET B 1 215 ? 35.946 -69.940  226.944 1.00 54.74  ? 215  MET B SD  1 
ATOM   3723 C  CE  . MET B 1 215 ? 37.746 -69.828  226.916 1.00 53.08  ? 215  MET B CE  1 
ATOM   3724 N  N   . HIS B 1 216 ? 35.132 -64.124  227.357 1.00 42.08  ? 216  HIS B N   1 
ATOM   3725 C  CA  . HIS B 1 216 ? 35.389 -63.059  228.278 1.00 41.46  ? 216  HIS B CA  1 
ATOM   3726 C  C   . HIS B 1 216 ? 34.840 -63.420  229.660 1.00 42.45  ? 216  HIS B C   1 
ATOM   3727 O  O   . HIS B 1 216 ? 33.617 -63.403  229.858 1.00 42.70  ? 216  HIS B O   1 
ATOM   3728 C  CB  . HIS B 1 216 ? 34.667 -61.801  227.814 1.00 40.56  ? 216  HIS B CB  1 
ATOM   3729 C  CG  . HIS B 1 216 ? 34.671 -60.716  228.850 1.00 41.84  ? 216  HIS B CG  1 
ATOM   3730 N  ND1 . HIS B 1 216 ? 33.518 -60.197  229.398 1.00 45.12  ? 216  HIS B ND1 1 
ATOM   3731 C  CD2 . HIS B 1 216 ? 35.698 -60.094  229.480 1.00 41.33  ? 216  HIS B CD2 1 
ATOM   3732 C  CE1 . HIS B 1 216 ? 33.831 -59.272  230.291 1.00 45.66  ? 216  HIS B CE1 1 
ATOM   3733 N  NE2 . HIS B 1 216 ? 35.150 -59.203  230.371 1.00 43.49  ? 216  HIS B NE2 1 
ATOM   3734 N  N   . PRO B 1 217 ? 35.716 -63.763  230.614 1.00 42.76  ? 217  PRO B N   1 
ATOM   3735 C  CA  . PRO B 1 217 ? 35.195 -64.120  231.937 1.00 44.05  ? 217  PRO B CA  1 
ATOM   3736 C  C   . PRO B 1 217 ? 34.583 -62.929  232.606 1.00 45.25  ? 217  PRO B C   1 
ATOM   3737 O  O   . PRO B 1 217 ? 35.254 -61.912  232.757 1.00 45.94  ? 217  PRO B O   1 
ATOM   3738 C  CB  . PRO B 1 217 ? 36.454 -64.553  232.691 1.00 44.67  ? 217  PRO B CB  1 
ATOM   3739 C  CG  . PRO B 1 217 ? 37.348 -65.086  231.572 1.00 43.49  ? 217  PRO B CG  1 
ATOM   3740 C  CD  . PRO B 1 217 ? 36.487 -64.890  230.320 1.00 42.64  ? 217  PRO B CD  1 
ATOM   3741 N  N   . ILE B 1 218 ? 33.316 -63.012  233.001 1.00 46.40  ? 218  ILE B N   1 
ATOM   3742 C  CA  . ILE B 1 218 ? 32.703 -61.871  233.656 1.00 47.65  ? 218  ILE B CA  1 
ATOM   3743 C  C   . ILE B 1 218 ? 33.070 -61.892  235.138 1.00 51.23  ? 218  ILE B C   1 
ATOM   3744 O  O   . ILE B 1 218 ? 32.321 -62.362  235.980 1.00 53.10  ? 218  ILE B O   1 
ATOM   3745 C  CB  . ILE B 1 218 ? 31.197 -61.843  233.472 1.00 47.48  ? 218  ILE B CB  1 
ATOM   3746 C  CG1 . ILE B 1 218 ? 30.862 -61.802  231.985 1.00 46.62  ? 218  ILE B CG1 1 
ATOM   3747 C  CG2 . ILE B 1 218 ? 30.574 -60.656  234.227 1.00 46.76  ? 218  ILE B CG2 1 
ATOM   3748 C  CD1 . ILE B 1 218 ? 29.414 -62.156  231.649 1.00 43.98  ? 218  ILE B CD1 1 
ATOM   3749 N  N   . ASP B 1 219 ? 34.238 -61.371  235.463 1.00 52.94  ? 219  ASP B N   1 
ATOM   3750 C  CA  . ASP B 1 219 ? 34.662 -61.342  236.835 1.00 56.06  ? 219  ASP B CA  1 
ATOM   3751 C  C   . ASP B 1 219 ? 34.409 -59.951  237.452 1.00 58.15  ? 219  ASP B C   1 
ATOM   3752 O  O   . ASP B 1 219 ? 33.777 -59.098  236.838 1.00 57.37  ? 219  ASP B O   1 
ATOM   3753 C  CB  . ASP B 1 219 ? 36.140 -61.757  236.891 1.00 56.51  ? 219  ASP B CB  1 
ATOM   3754 C  CG  . ASP B 1 219 ? 37.058 -60.743  236.232 1.00 56.39  ? 219  ASP B CG  1 
ATOM   3755 O  OD1 . ASP B 1 219 ? 36.600 -59.632  235.886 1.00 57.47  ? 219  ASP B OD1 1 
ATOM   3756 O  OD2 . ASP B 1 219 ? 38.249 -61.057  236.065 1.00 58.59  ? 219  ASP B OD2 1 
ATOM   3757 N  N   . HIS B 1 220 ? 34.875 -59.734  238.681 1.00 61.82  ? 220  HIS B N   1 
ATOM   3758 C  CA  . HIS B 1 220 ? 34.665 -58.454  239.371 1.00 64.92  ? 220  HIS B CA  1 
ATOM   3759 C  C   . HIS B 1 220 ? 35.157 -57.283  238.532 1.00 64.22  ? 220  HIS B C   1 
ATOM   3760 O  O   . HIS B 1 220 ? 34.645 -56.195  238.640 1.00 65.46  ? 220  HIS B O   1 
ATOM   3761 C  CB  . HIS B 1 220 ? 35.316 -58.443  240.774 1.00 67.76  ? 220  HIS B CB  1 
ATOM   3762 C  CG  . HIS B 1 220 ? 34.425 -58.991  241.860 1.00 74.46  ? 220  HIS B CG  1 
ATOM   3763 N  ND1 . HIS B 1 220 ? 34.348 -60.338  242.165 1.00 77.77  ? 220  HIS B ND1 1 
ATOM   3764 C  CD2 . HIS B 1 220 ? 33.551 -58.373  242.697 1.00 79.76  ? 220  HIS B CD2 1 
ATOM   3765 C  CE1 . HIS B 1 220 ? 33.467 -60.528  243.132 1.00 78.77  ? 220  HIS B CE1 1 
ATOM   3766 N  NE2 . HIS B 1 220 ? 32.968 -59.352  243.473 1.00 81.16  ? 220  HIS B NE2 1 
ATOM   3767 N  N   . HIS B 1 221 ? 36.137 -57.507  237.674 1.00 63.39  ? 221  HIS B N   1 
ATOM   3768 C  CA  . HIS B 1 221 ? 36.704 -56.412  236.894 1.00 63.36  ? 221  HIS B CA  1 
ATOM   3769 C  C   . HIS B 1 221 ? 35.973 -56.141  235.603 1.00 60.80  ? 221  HIS B C   1 
ATOM   3770 O  O   . HIS B 1 221 ? 36.276 -55.175  234.917 1.00 61.77  ? 221  HIS B O   1 
ATOM   3771 C  CB  . HIS B 1 221 ? 38.177 -56.687  236.579 1.00 63.75  ? 221  HIS B CB  1 
ATOM   3772 C  CG  . HIS B 1 221 ? 39.015 -56.851  237.808 1.00 70.14  ? 221  HIS B CG  1 
ATOM   3773 N  ND1 . HIS B 1 221 ? 38.977 -55.946  238.855 1.00 75.60  ? 221  HIS B ND1 1 
ATOM   3774 C  CD2 . HIS B 1 221 ? 39.877 -57.830  238.183 1.00 72.21  ? 221  HIS B CD2 1 
ATOM   3775 C  CE1 . HIS B 1 221 ? 39.787 -56.361  239.818 1.00 77.35  ? 221  HIS B CE1 1 
ATOM   3776 N  NE2 . HIS B 1 221 ? 40.344 -57.499  239.436 1.00 74.87  ? 221  HIS B NE2 1 
ATOM   3777 N  N   . SER B 1 222 ? 35.045 -57.007  235.236 1.00 58.00  ? 222  SER B N   1 
ATOM   3778 C  CA  . SER B 1 222 ? 34.355 -56.862  233.971 1.00 54.55  ? 222  SER B CA  1 
ATOM   3779 C  C   . SER B 1 222 ? 33.369 -55.680  233.982 1.00 55.45  ? 222  SER B C   1 
ATOM   3780 O  O   . SER B 1 222 ? 32.658 -55.461  234.964 1.00 56.88  ? 222  SER B O   1 
ATOM   3781 C  CB  . SER B 1 222 ? 33.589 -58.131  233.686 1.00 52.93  ? 222  SER B CB  1 
ATOM   3782 O  OG  . SER B 1 222 ? 32.797 -57.908  232.561 1.00 50.51  ? 222  SER B OG  1 
ATOM   3783 N  N   . PRO B 1 223 ? 33.303 -54.913  232.886 1.00 53.99  ? 223  PRO B N   1 
ATOM   3784 C  CA  . PRO B 1 223 ? 32.296 -53.883  232.904 1.00 54.59  ? 223  PRO B CA  1 
ATOM   3785 C  C   . PRO B 1 223 ? 30.895 -54.431  232.747 1.00 55.67  ? 223  PRO B C   1 
ATOM   3786 O  O   . PRO B 1 223 ? 29.948 -53.645  232.751 1.00 56.66  ? 223  PRO B O   1 
ATOM   3787 C  CB  . PRO B 1 223 ? 32.637 -53.030  231.695 1.00 53.58  ? 223  PRO B CB  1 
ATOM   3788 C  CG  . PRO B 1 223 ? 33.440 -53.911  230.790 1.00 51.89  ? 223  PRO B CG  1 
ATOM   3789 C  CD  . PRO B 1 223 ? 34.174 -54.848  231.698 1.00 52.76  ? 223  PRO B CD  1 
ATOM   3790 N  N   . ILE B 1 224 ? 30.732 -55.740  232.533 1.00 55.18  ? 224  ILE B N   1 
ATOM   3791 C  CA  . ILE B 1 224 ? 29.368 -56.250  232.470 1.00 56.95  ? 224  ILE B CA  1 
ATOM   3792 C  C   . ILE B 1 224 ? 29.032 -57.023  233.718 1.00 59.30  ? 224  ILE B C   1 
ATOM   3793 O  O   . ILE B 1 224 ? 27.954 -57.575  233.839 1.00 60.62  ? 224  ILE B O   1 
ATOM   3794 C  CB  . ILE B 1 224 ? 28.986 -57.048  231.186 1.00 55.69  ? 224  ILE B CB  1 
ATOM   3795 C  CG1 . ILE B 1 224 ? 29.852 -58.295  230.991 1.00 54.36  ? 224  ILE B CG1 1 
ATOM   3796 C  CG2 . ILE B 1 224 ? 28.977 -56.140  229.932 1.00 54.27  ? 224  ILE B CG2 1 
ATOM   3797 C  CD1 . ILE B 1 224 ? 29.308 -59.158  229.891 1.00 48.60  ? 224  ILE B CD1 1 
ATOM   3798 N  N   . TYR B 1 225 ? 29.951 -57.020  234.671 1.00 60.74  ? 225  TYR B N   1 
ATOM   3799 C  CA  . TYR B 1 225 ? 29.699 -57.645  235.936 1.00 62.82  ? 225  TYR B CA  1 
ATOM   3800 C  C   . TYR B 1 225 ? 28.432 -57.047  236.533 1.00 65.85  ? 225  TYR B C   1 
ATOM   3801 O  O   . TYR B 1 225 ? 28.341 -55.840  236.764 1.00 66.97  ? 225  TYR B O   1 
ATOM   3802 C  CB  . TYR B 1 225 ? 30.877 -57.390  236.873 1.00 63.70  ? 225  TYR B CB  1 
ATOM   3803 C  CG  . TYR B 1 225 ? 30.776 -58.123  238.187 1.00 65.41  ? 225  TYR B CG  1 
ATOM   3804 C  CD1 . TYR B 1 225 ? 31.094 -59.466  238.252 1.00 64.91  ? 225  TYR B CD1 1 
ATOM   3805 C  CD2 . TYR B 1 225 ? 30.362 -57.478  239.358 1.00 68.26  ? 225  TYR B CD2 1 
ATOM   3806 C  CE1 . TYR B 1 225 ? 30.991 -60.172  239.412 1.00 67.04  ? 225  TYR B CE1 1 
ATOM   3807 C  CE2 . TYR B 1 225 ? 30.276 -58.179  240.558 1.00 70.14  ? 225  TYR B CE2 1 
ATOM   3808 C  CZ  . TYR B 1 225 ? 30.596 -59.544  240.563 1.00 70.75  ? 225  TYR B CZ  1 
ATOM   3809 O  OH  . TYR B 1 225 ? 30.548 -60.329  241.689 1.00 72.81  ? 225  TYR B OH  1 
ATOM   3810 N  N   . GLY B 1 226 ? 27.447 -57.894  236.784 1.00 67.35  ? 226  GLY B N   1 
ATOM   3811 C  CA  . GLY B 1 226 ? 26.268 -57.468  237.508 1.00 69.90  ? 226  GLY B CA  1 
ATOM   3812 C  C   . GLY B 1 226 ? 25.202 -57.039  236.548 1.00 70.61  ? 226  GLY B C   1 
ATOM   3813 O  O   . GLY B 1 226 ? 24.072 -56.807  236.935 1.00 73.86  ? 226  GLY B O   1 
ATOM   3814 N  N   . GLU B 1 227 ? 25.566 -56.928  235.287 1.00 69.14  ? 227  GLU B N   1 
ATOM   3815 C  CA  . GLU B 1 227 ? 24.641 -56.544  234.243 1.00 69.97  ? 227  GLU B CA  1 
ATOM   3816 C  C   . GLU B 1 227 ? 23.694 -57.695  233.906 1.00 70.13  ? 227  GLU B C   1 
ATOM   3817 O  O   . GLU B 1 227 ? 24.028 -58.869  234.065 1.00 69.47  ? 227  GLU B O   1 
ATOM   3818 C  CB  . GLU B 1 227 ? 25.442 -56.167  233.009 1.00 68.02  ? 227  GLU B CB  1 
ATOM   3819 C  CG  . GLU B 1 227 ? 25.168 -54.779  232.502 1.00 72.25  ? 227  GLU B CG  1 
ATOM   3820 C  CD  . GLU B 1 227 ? 25.448 -53.708  233.527 1.00 76.41  ? 227  GLU B CD  1 
ATOM   3821 O  OE1 . GLU B 1 227 ? 26.033 -53.992  234.583 1.00 80.88  ? 227  GLU B OE1 1 
ATOM   3822 O  OE2 . GLU B 1 227 ? 25.087 -52.556  233.280 1.00 80.38  ? 227  GLU B OE2 1 
ATOM   3823 N  N   . THR B 1 228 ? 22.501 -57.353  233.451 1.00 71.61  ? 228  THR B N   1 
ATOM   3824 C  CA  . THR B 1 228 ? 21.546 -58.349  233.004 1.00 72.45  ? 228  THR B CA  1 
ATOM   3825 C  C   . THR B 1 228 ? 21.126 -57.965  231.607 1.00 72.18  ? 228  THR B C   1 
ATOM   3826 O  O   . THR B 1 228 ? 21.504 -56.911  231.092 1.00 71.23  ? 228  THR B O   1 
ATOM   3827 C  CB  . THR B 1 228 ? 20.269 -58.364  233.867 1.00 75.58  ? 228  THR B CB  1 
ATOM   3828 O  OG1 . THR B 1 228 ? 19.655 -57.059  233.849 1.00 77.23  ? 228  THR B OG1 1 
ATOM   3829 C  CG2 . THR B 1 228 ? 20.586 -58.769  235.299 1.00 76.37  ? 228  THR B CG2 1 
ATOM   3830 N  N   . ASP B 1 229 ? 20.312 -58.804  231.000 1.00 73.33  ? 229  ASP B N   1 
ATOM   3831 C  CA  . ASP B 1 229 ? 19.772 -58.455  229.712 1.00 74.67  ? 229  ASP B CA  1 
ATOM   3832 C  C   . ASP B 1 229 ? 19.093 -57.085  229.767 1.00 76.40  ? 229  ASP B C   1 
ATOM   3833 O  O   . ASP B 1 229 ? 19.290 -56.249  228.884 1.00 75.21  ? 229  ASP B O   1 
ATOM   3834 C  CB  . ASP B 1 229 ? 18.807 -59.525  229.230 1.00 76.32  ? 229  ASP B CB  1 
ATOM   3835 C  CG  . ASP B 1 229 ? 18.319 -59.254  227.837 1.00 79.73  ? 229  ASP B CG  1 
ATOM   3836 O  OD1 . ASP B 1 229 ? 17.478 -58.336  227.661 1.00 85.02  ? 229  ASP B OD1 1 
ATOM   3837 O  OD2 . ASP B 1 229 ? 18.789 -59.948  226.910 1.00 82.98  ? 229  ASP B OD2 1 
ATOM   3838 N  N   . GLU B 1 230 ? 18.325 -56.841  230.826 1.00 79.34  ? 230  GLU B N   1 
ATOM   3839 C  CA  . GLU B 1 230 ? 17.602 -55.580  230.917 1.00 82.06  ? 230  GLU B CA  1 
ATOM   3840 C  C   . GLU B 1 230 ? 18.519 -54.367  231.026 1.00 80.22  ? 230  GLU B C   1 
ATOM   3841 O  O   . GLU B 1 230 ? 18.287 -53.350  230.374 1.00 80.57  ? 230  GLU B O   1 
ATOM   3842 C  CB  . GLU B 1 230 ? 16.583 -55.584  232.058 1.00 86.05  ? 230  GLU B CB  1 
ATOM   3843 C  CG  . GLU B 1 230 ? 15.582 -54.439  231.921 1.00 92.97  ? 230  GLU B CG  1 
ATOM   3844 C  CD  . GLU B 1 230 ? 14.640 -54.333  233.104 1.00 103.21 ? 230  GLU B CD  1 
ATOM   3845 O  OE1 . GLU B 1 230 ? 14.872 -55.049  234.110 1.00 106.61 ? 230  GLU B OE1 1 
ATOM   3846 O  OE2 . GLU B 1 230 ? 13.670 -53.531  233.038 1.00 108.14 ? 230  GLU B OE2 1 
ATOM   3847 N  N   . THR B 1 231 ? 19.552 -54.462  231.850 1.00 78.26  ? 231  THR B N   1 
ATOM   3848 C  CA  . THR B 1 231 ? 20.453 -53.330  231.989 1.00 77.50  ? 231  THR B CA  1 
ATOM   3849 C  C   . THR B 1 231 ? 21.223 -53.113  230.690 1.00 75.20  ? 231  THR B C   1 
ATOM   3850 O  O   . THR B 1 231 ? 21.454 -51.979  230.285 1.00 76.05  ? 231  THR B O   1 
ATOM   3851 C  CB  . THR B 1 231 ? 21.427 -53.465  233.193 1.00 77.19  ? 231  THR B CB  1 
ATOM   3852 O  OG1 . THR B 1 231 ? 22.420 -54.471  232.943 1.00 73.60  ? 231  THR B OG1 1 
ATOM   3853 C  CG2 . THR B 1 231 ? 20.677 -53.798  234.443 1.00 78.86  ? 231  THR B CG2 1 
ATOM   3854 N  N   . LEU B 1 232 ? 21.602 -54.190  230.020 1.00 72.19  ? 232  LEU B N   1 
ATOM   3855 C  CA  . LEU B 1 232 ? 22.304 -54.021  228.767 1.00 70.46  ? 232  LEU B CA  1 
ATOM   3856 C  C   . LEU B 1 232 ? 21.399 -53.354  227.746 1.00 71.94  ? 232  LEU B C   1 
ATOM   3857 O  O   . LEU B 1 232 ? 21.858 -52.558  226.937 1.00 71.93  ? 232  LEU B O   1 
ATOM   3858 C  CB  . LEU B 1 232 ? 22.905 -55.343  228.240 1.00 67.62  ? 232  LEU B CB  1 
ATOM   3859 C  CG  . LEU B 1 232 ? 24.030 -55.854  229.147 1.00 66.50  ? 232  LEU B CG  1 
ATOM   3860 C  CD1 . LEU B 1 232 ? 24.592 -57.207  228.719 1.00 64.70  ? 232  LEU B CD1 1 
ATOM   3861 C  CD2 . LEU B 1 232 ? 25.133 -54.825  229.261 1.00 66.12  ? 232  LEU B CD2 1 
ATOM   3862 N  N   . ARG B 1 233 ? 20.115 -53.676  227.761 1.00 74.10  ? 233  ARG B N   1 
ATOM   3863 C  CA  . ARG B 1 233 ? 19.210 -53.003  226.830 1.00 76.46  ? 233  ARG B CA  1 
ATOM   3864 C  C   . ARG B 1 233 ? 19.199 -51.511  227.099 1.00 78.12  ? 233  ARG B C   1 
ATOM   3865 O  O   . ARG B 1 233 ? 19.315 -50.703  226.185 1.00 78.16  ? 233  ARG B O   1 
ATOM   3866 C  CB  . ARG B 1 233 ? 17.793 -53.562  226.916 1.00 78.85  ? 233  ARG B CB  1 
ATOM   3867 C  CG  . ARG B 1 233 ? 17.697 -55.014  226.478 1.00 80.22  ? 233  ARG B CG  1 
ATOM   3868 C  CD  . ARG B 1 233 ? 16.298 -55.435  226.134 1.00 86.90  ? 233  ARG B CD  1 
ATOM   3869 N  NE  . ARG B 1 233 ? 16.344 -56.788  225.609 1.00 91.12  ? 233  ARG B NE  1 
ATOM   3870 C  CZ  . ARG B 1 233 ? 16.856 -57.115  224.422 1.00 92.31  ? 233  ARG B CZ  1 
ATOM   3871 N  NH1 . ARG B 1 233 ? 17.363 -56.186  223.627 1.00 92.63  ? 233  ARG B NH1 1 
ATOM   3872 N  NH2 . ARG B 1 233 ? 16.867 -58.381  224.029 1.00 93.31  ? 233  ARG B NH2 1 
ATOM   3873 N  N   . ASN B 1 234 ? 19.079 -51.157  228.369 1.00 79.68  ? 234  ASN B N   1 
ATOM   3874 C  CA  . ASN B 1 234 ? 18.965 -49.773  228.767 1.00 82.39  ? 234  ASN B CA  1 
ATOM   3875 C  C   . ASN B 1 234 ? 20.146 -48.932  228.373 1.00 80.75  ? 234  ASN B C   1 
ATOM   3876 O  O   . ASN B 1 234 ? 19.981 -47.802  227.921 1.00 83.04  ? 234  ASN B O   1 
ATOM   3877 C  CB  . ASN B 1 234 ? 18.733 -49.671  230.270 1.00 85.04  ? 234  ASN B CB  1 
ATOM   3878 C  CG  . ASN B 1 234 ? 17.368 -50.219  230.675 1.00 89.82  ? 234  ASN B CG  1 
ATOM   3879 O  OD1 . ASN B 1 234 ? 16.385 -50.086  229.928 1.00 95.34  ? 234  ASN B OD1 1 
ATOM   3880 N  ND2 . ASN B 1 234 ? 17.301 -50.846  231.846 1.00 91.70  ? 234  ASN B ND2 1 
ATOM   3881 N  N   . SER B 1 235 ? 21.345 -49.473  228.530 1.00 77.22  ? 235  SER B N   1 
ATOM   3882 C  CA  . SER B 1 235 ? 22.546 -48.730  228.175 1.00 74.72  ? 235  SER B CA  1 
ATOM   3883 C  C   . SER B 1 235 ? 22.837 -48.777  226.671 1.00 72.65  ? 235  SER B C   1 
ATOM   3884 O  O   . SER B 1 235 ? 23.874 -48.286  226.218 1.00 71.92  ? 235  SER B O   1 
ATOM   3885 C  CB  . SER B 1 235 ? 23.722 -49.282  228.965 1.00 72.85  ? 235  SER B CB  1 
ATOM   3886 O  OG  . SER B 1 235 ? 23.840 -50.688  228.751 1.00 70.52  ? 235  SER B OG  1 
ATOM   3887 N  N   . HIS B 1 236 ? 21.927 -49.370  225.906 1.00 71.88  ? 236  HIS B N   1 
ATOM   3888 C  CA  . HIS B 1 236 ? 22.121 -49.595  224.459 1.00 70.88  ? 236  HIS B CA  1 
ATOM   3889 C  C   . HIS B 1 236 ? 23.432 -50.321  224.156 1.00 67.04  ? 236  HIS B C   1 
ATOM   3890 O  O   . HIS B 1 236 ? 24.153 -49.973  223.227 1.00 65.38  ? 236  HIS B O   1 
ATOM   3891 C  CB  . HIS B 1 236 ? 22.043 -48.288  223.660 1.00 72.56  ? 236  HIS B CB  1 
ATOM   3892 C  CG  . HIS B 1 236 ? 20.806 -47.487  223.937 1.00 79.60  ? 236  HIS B CG  1 
ATOM   3893 N  ND1 . HIS B 1 236 ? 19.601 -47.721  223.298 1.00 82.62  ? 236  HIS B ND1 1 
ATOM   3894 C  CD2 . HIS B 1 236 ? 20.581 -46.464  224.799 1.00 82.81  ? 236  HIS B CD2 1 
ATOM   3895 C  CE1 . HIS B 1 236 ? 18.695 -46.873  223.750 1.00 85.31  ? 236  HIS B CE1 1 
ATOM   3896 N  NE2 . HIS B 1 236 ? 19.263 -46.102  224.662 1.00 85.49  ? 236  HIS B NE2 1 
ATOM   3897 N  N   . SER B 1 237 ? 23.730 -51.332  224.959 1.00 65.16  ? 237  SER B N   1 
ATOM   3898 C  CA  . SER B 1 237 ? 24.972 -52.076  224.814 1.00 62.20  ? 237  SER B CA  1 
ATOM   3899 C  C   . SER B 1 237 ? 25.089 -52.787  223.468 1.00 60.10  ? 237  SER B C   1 
ATOM   3900 O  O   . SER B 1 237 ? 24.133 -53.378  223.002 1.00 61.01  ? 237  SER B O   1 
ATOM   3901 C  CB  . SER B 1 237 ? 25.095 -53.073  225.968 1.00 61.33  ? 237  SER B CB  1 
ATOM   3902 O  OG  . SER B 1 237 ? 25.234 -52.390  227.211 1.00 63.67  ? 237  SER B OG  1 
ATOM   3903 N  N   . GLU B 1 238 ? 26.251 -52.711  222.829 1.00 58.15  ? 238  GLU B N   1 
ATOM   3904 C  CA  . GLU B 1 238 ? 26.551 -53.582  221.692 1.00 56.70  ? 238  GLU B CA  1 
ATOM   3905 C  C   . GLU B 1 238 ? 27.901 -54.208  221.837 1.00 52.87  ? 238  GLU B C   1 
ATOM   3906 O  O   . GLU B 1 238 ? 28.732 -53.704  222.588 1.00 52.89  ? 238  GLU B O   1 
ATOM   3907 C  CB  . GLU B 1 238 ? 26.586 -52.786  220.423 1.00 58.28  ? 238  GLU B CB  1 
ATOM   3908 C  CG  . GLU B 1 238 ? 25.255 -52.687  219.751 1.00 67.28  ? 238  GLU B CG  1 
ATOM   3909 C  CD  . GLU B 1 238 ? 25.312 -51.645  218.658 1.00 76.47  ? 238  GLU B CD  1 
ATOM   3910 O  OE1 . GLU B 1 238 ? 26.444 -51.487  218.120 1.00 78.36  ? 238  GLU B OE1 1 
ATOM   3911 O  OE2 . GLU B 1 238 ? 24.265 -50.995  218.359 1.00 80.48  ? 238  GLU B OE2 1 
ATOM   3912 N  N   . PHE B 1 239 ? 28.157 -55.270  221.091 1.00 49.69  ? 239  PHE B N   1 
ATOM   3913 C  CA  . PHE B 1 239 ? 29.469 -55.930  221.169 1.00 47.19  ? 239  PHE B CA  1 
ATOM   3914 C  C   . PHE B 1 239 ? 30.122 -56.064  219.816 1.00 47.15  ? 239  PHE B C   1 
ATOM   3915 O  O   . PHE B 1 239 ? 29.545 -56.707  218.915 1.00 48.58  ? 239  PHE B O   1 
ATOM   3916 C  CB  . PHE B 1 239 ? 29.341 -57.305  221.817 1.00 45.65  ? 239  PHE B CB  1 
ATOM   3917 C  CG  . PHE B 1 239 ? 28.933 -57.236  223.248 1.00 44.62  ? 239  PHE B CG  1 
ATOM   3918 C  CD1 . PHE B 1 239 ? 27.590 -57.158  223.599 1.00 43.21  ? 239  PHE B CD1 1 
ATOM   3919 C  CD2 . PHE B 1 239 ? 29.888 -57.160  224.235 1.00 42.58  ? 239  PHE B CD2 1 
ATOM   3920 C  CE1 . PHE B 1 239 ? 27.223 -57.033  224.914 1.00 45.92  ? 239  PHE B CE1 1 
ATOM   3921 C  CE2 . PHE B 1 239 ? 29.531 -57.056  225.563 1.00 44.83  ? 239  PHE B CE2 1 
ATOM   3922 C  CZ  . PHE B 1 239 ? 28.194 -57.001  225.911 1.00 45.93  ? 239  PHE B CZ  1 
ATOM   3923 N  N   . LEU B 1 240 ? 31.307 -55.468  219.653 1.00 45.99  ? 240  LEU B N   1 
ATOM   3924 C  CA  . LEU B 1 240 ? 32.095 -55.668  218.433 1.00 45.12  ? 240  LEU B CA  1 
ATOM   3925 C  C   . LEU B 1 240 ? 33.168 -56.730  218.600 1.00 43.11  ? 240  LEU B C   1 
ATOM   3926 O  O   . LEU B 1 240 ? 33.904 -56.767  219.590 1.00 41.39  ? 240  LEU B O   1 
ATOM   3927 C  CB  . LEU B 1 240 ? 32.834 -54.392  218.034 1.00 46.67  ? 240  LEU B CB  1 
ATOM   3928 C  CG  . LEU B 1 240 ? 32.116 -53.062  218.171 1.00 50.26  ? 240  LEU B CG  1 
ATOM   3929 C  CD1 . LEU B 1 240 ? 33.031 -51.902  217.713 1.00 52.01  ? 240  LEU B CD1 1 
ATOM   3930 C  CD2 . LEU B 1 240 ? 30.798 -53.105  217.376 1.00 51.79  ? 240  LEU B CD2 1 
ATOM   3931 N  N   . VAL B 1 241 ? 33.301 -57.556  217.580 1.00 42.74  ? 241  VAL B N   1 
ATOM   3932 C  CA  . VAL B 1 241 ? 34.432 -58.456  217.496 1.00 42.03  ? 241  VAL B CA  1 
ATOM   3933 C  C   . VAL B 1 241 ? 35.235 -57.962  216.333 1.00 42.07  ? 241  VAL B C   1 
ATOM   3934 O  O   . VAL B 1 241 ? 34.673 -57.699  215.286 1.00 42.60  ? 241  VAL B O   1 
ATOM   3935 C  CB  . VAL B 1 241 ? 33.977 -59.860  217.162 1.00 42.42  ? 241  VAL B CB  1 
ATOM   3936 C  CG1 . VAL B 1 241 ? 35.149 -60.847  217.304 1.00 41.34  ? 241  VAL B CG1 1 
ATOM   3937 C  CG2 . VAL B 1 241 ? 32.815 -60.238  218.058 1.00 42.62  ? 241  VAL B CG2 1 
ATOM   3938 N  N   . LEU B 1 242 ? 36.533 -57.783  216.530 1.00 41.97  ? 242  LEU B N   1 
ATOM   3939 C  CA  . LEU B 1 242 ? 37.436 -57.473  215.426 1.00 42.30  ? 242  LEU B CA  1 
ATOM   3940 C  C   . LEU B 1 242 ? 38.568 -58.462  215.351 1.00 42.16  ? 242  LEU B C   1 
ATOM   3941 O  O   . LEU B 1 242 ? 39.161 -58.860  216.371 1.00 41.65  ? 242  LEU B O   1 
ATOM   3942 C  CB  . LEU B 1 242 ? 37.968 -56.072  215.552 1.00 44.15  ? 242  LEU B CB  1 
ATOM   3943 C  CG  . LEU B 1 242 ? 36.732 -55.150  215.495 1.00 45.74  ? 242  LEU B CG  1 
ATOM   3944 C  CD1 . LEU B 1 242 ? 36.435 -54.680  216.913 1.00 47.50  ? 242  LEU B CD1 1 
ATOM   3945 C  CD2 . LEU B 1 242 ? 37.006 -54.003  214.575 1.00 47.03  ? 242  LEU B CD2 1 
ATOM   3946 N  N   . PHE B 1 243 ? 38.832 -58.900  214.130 1.00 42.34  ? 243  PHE B N   1 
ATOM   3947 C  CA  . PHE B 1 243 ? 39.748 -59.994  213.911 1.00 42.17  ? 243  PHE B CA  1 
ATOM   3948 C  C   . PHE B 1 243 ? 40.792 -59.555  212.909 1.00 43.15  ? 243  PHE B C   1 
ATOM   3949 O  O   . PHE B 1 243 ? 40.439 -58.973  211.894 1.00 43.57  ? 243  PHE B O   1 
ATOM   3950 C  CB  . PHE B 1 243 ? 38.993 -61.222  213.378 1.00 41.36  ? 243  PHE B CB  1 
ATOM   3951 C  CG  . PHE B 1 243 ? 39.900 -62.338  212.895 1.00 40.44  ? 243  PHE B CG  1 
ATOM   3952 C  CD1 . PHE B 1 243 ? 40.263 -63.370  213.722 1.00 41.05  ? 243  PHE B CD1 1 
ATOM   3953 C  CD2 . PHE B 1 243 ? 40.374 -62.346  211.610 1.00 41.49  ? 243  PHE B CD2 1 
ATOM   3954 C  CE1 . PHE B 1 243 ? 41.105 -64.425  213.277 1.00 43.47  ? 243  PHE B CE1 1 
ATOM   3955 C  CE2 . PHE B 1 243 ? 41.201 -63.366  211.166 1.00 46.00  ? 243  PHE B CE2 1 
ATOM   3956 C  CZ  . PHE B 1 243 ? 41.573 -64.422  212.016 1.00 43.24  ? 243  PHE B CZ  1 
ATOM   3957 N  N   . THR B 1 244 ? 42.054 -59.875  213.189 1.00 43.99  ? 244  THR B N   1 
ATOM   3958 C  CA  . THR B 1 244 ? 43.171 -59.601  212.270 1.00 47.10  ? 244  THR B CA  1 
ATOM   3959 C  C   . THR B 1 244 ? 44.110 -60.787  212.229 1.00 47.62  ? 244  THR B C   1 
ATOM   3960 O  O   . THR B 1 244 ? 44.246 -61.500  213.209 1.00 47.64  ? 244  THR B O   1 
ATOM   3961 C  CB  . THR B 1 244 ? 44.068 -58.452  212.743 1.00 47.26  ? 244  THR B CB  1 
ATOM   3962 O  OG1 . THR B 1 244 ? 43.266 -57.308  212.957 1.00 51.57  ? 244  THR B OG1 1 
ATOM   3963 C  CG2 . THR B 1 244 ? 44.966 -58.086  211.633 1.00 53.05  ? 244  THR B CG2 1 
ATOM   3964 N  N   . GLY B 1 245 ? 44.779 -60.983  211.110 1.00 48.40  ? 245  GLY B N   1 
ATOM   3965 C  CA  . GLY B 1 245 ? 45.794 -61.961  211.052 1.00 49.59  ? 245  GLY B CA  1 
ATOM   3966 C  C   . GLY B 1 245 ? 46.458 -61.901  209.700 1.00 52.69  ? 245  GLY B C   1 
ATOM   3967 O  O   . GLY B 1 245 ? 46.013 -61.206  208.781 1.00 51.95  ? 245  GLY B O   1 
ATOM   3968 N  N   . HIS B 1 246 ? 47.539 -62.649  209.575 1.00 55.24  ? 246  HIS B N   1 
ATOM   3969 C  CA  . HIS B 1 246 ? 48.198 -62.764  208.302 1.00 58.77  ? 246  HIS B CA  1 
ATOM   3970 C  C   . HIS B 1 246 ? 47.769 -64.067  207.657 1.00 59.81  ? 246  HIS B C   1 
ATOM   3971 O  O   . HIS B 1 246 ? 48.006 -65.144  208.194 1.00 60.19  ? 246  HIS B O   1 
ATOM   3972 C  CB  . HIS B 1 246 ? 49.694 -62.723  208.510 1.00 60.38  ? 246  HIS B CB  1 
ATOM   3973 C  CG  . HIS B 1 246 ? 50.475 -63.005  207.275 1.00 65.64  ? 246  HIS B CG  1 
ATOM   3974 N  ND1 . HIS B 1 246 ? 51.106 -62.014  206.549 1.00 68.06  ? 246  HIS B ND1 1 
ATOM   3975 C  CD2 . HIS B 1 246 ? 50.745 -64.174  206.638 1.00 68.08  ? 246  HIS B CD2 1 
ATOM   3976 C  CE1 . HIS B 1 246 ? 51.733 -62.563  205.521 1.00 68.46  ? 246  HIS B CE1 1 
ATOM   3977 N  NE2 . HIS B 1 246 ? 51.528 -63.869  205.551 1.00 69.28  ? 246  HIS B NE2 1 
ATOM   3978 N  N   . HIS B 1 247 ? 47.110 -63.972  206.514 1.00 61.65  ? 247  HIS B N   1 
ATOM   3979 C  CA  . HIS B 1 247 ? 46.620 -65.164  205.827 1.00 64.11  ? 247  HIS B CA  1 
ATOM   3980 C  C   . HIS B 1 247 ? 47.716 -65.747  204.977 1.00 67.62  ? 247  HIS B C   1 
ATOM   3981 O  O   . HIS B 1 247 ? 48.352 -65.036  204.228 1.00 69.81  ? 247  HIS B O   1 
ATOM   3982 C  CB  . HIS B 1 247 ? 45.423 -64.830  204.945 1.00 63.59  ? 247  HIS B CB  1 
ATOM   3983 C  CG  . HIS B 1 247 ? 44.377 -65.903  204.907 1.00 64.27  ? 247  HIS B CG  1 
ATOM   3984 N  ND1 . HIS B 1 247 ? 44.600 -67.140  204.349 1.00 66.09  ? 247  HIS B ND1 1 
ATOM   3985 C  CD2 . HIS B 1 247 ? 43.090 -65.909  205.340 1.00 63.69  ? 247  HIS B CD2 1 
ATOM   3986 C  CE1 . HIS B 1 247 ? 43.502 -67.870  204.461 1.00 67.29  ? 247  HIS B CE1 1 
ATOM   3987 N  NE2 . HIS B 1 247 ? 42.572 -67.146  205.059 1.00 62.98  ? 247  HIS B NE2 1 
ATOM   3988 N  N   . GLU B 1 248 ? 47.952 -67.040  205.103 1.00 70.47  ? 248  GLU B N   1 
ATOM   3989 C  CA  . GLU B 1 248 ? 48.935 -67.693  204.256 1.00 75.27  ? 248  GLU B CA  1 
ATOM   3990 C  C   . GLU B 1 248 ? 48.403 -67.782  202.833 1.00 77.81  ? 248  GLU B C   1 
ATOM   3991 O  O   . GLU B 1 248 ? 49.181 -67.747  201.876 1.00 80.75  ? 248  GLU B O   1 
ATOM   3992 C  CB  . GLU B 1 248 ? 49.307 -69.071  204.779 1.00 76.16  ? 248  GLU B CB  1 
ATOM   3993 C  CG  . GLU B 1 248 ? 49.998 -69.045  206.119 1.00 75.68  ? 248  GLU B CG  1 
ATOM   3994 C  CD  . GLU B 1 248 ? 50.484 -70.411  206.506 1.00 79.18  ? 248  GLU B CD  1 
ATOM   3995 O  OE1 . GLU B 1 248 ? 49.803 -71.405  206.128 1.00 79.98  ? 248  GLU B OE1 1 
ATOM   3996 O  OE2 . GLU B 1 248 ? 51.531 -70.488  207.187 1.00 79.91  ? 248  GLU B OE2 1 
ATOM   3997 N  N   . ALA B 1 249 ? 47.078 -67.847  202.691 1.00 77.64  ? 249  ALA B N   1 
ATOM   3998 C  CA  . ALA B 1 249 ? 46.466 -67.873  201.363 1.00 79.84  ? 249  ALA B CA  1 
ATOM   3999 C  C   . ALA B 1 249 ? 46.845 -66.639  200.501 1.00 81.56  ? 249  ALA B C   1 
ATOM   4000 O  O   . ALA B 1 249 ? 46.964 -66.735  199.282 1.00 83.99  ? 249  ALA B O   1 
ATOM   4001 C  CB  . ALA B 1 249 ? 44.944 -68.051  201.470 1.00 77.88  ? 249  ALA B CB  1 
ATOM   4002 N  N   . PHE B 1 250 ? 47.079 -65.492  201.131 1.00 81.16  ? 250  PHE B N   1 
ATOM   4003 C  CA  . PHE B 1 250 ? 47.370 -64.283  200.370 1.00 82.56  ? 250  PHE B CA  1 
ATOM   4004 C  C   . PHE B 1 250 ? 48.733 -63.685  200.692 1.00 83.48  ? 250  PHE B C   1 
ATOM   4005 O  O   . PHE B 1 250 ? 49.177 -62.762  200.011 1.00 85.53  ? 250  PHE B O   1 
ATOM   4006 C  CB  . PHE B 1 250 ? 46.259 -63.230  200.587 1.00 81.12  ? 250  PHE B CB  1 
ATOM   4007 C  CG  . PHE B 1 250 ? 44.872 -63.807  200.524 1.00 81.99  ? 250  PHE B CG  1 
ATOM   4008 C  CD1 . PHE B 1 250 ? 44.119 -63.981  201.685 1.00 82.86  ? 250  PHE B CD1 1 
ATOM   4009 C  CD2 . PHE B 1 250 ? 44.337 -64.232  199.317 1.00 84.95  ? 250  PHE B CD2 1 
ATOM   4010 C  CE1 . PHE B 1 250 ? 42.831 -64.553  201.634 1.00 82.52  ? 250  PHE B CE1 1 
ATOM   4011 C  CE2 . PHE B 1 250 ? 43.063 -64.797  199.254 1.00 85.95  ? 250  PHE B CE2 1 
ATOM   4012 C  CZ  . PHE B 1 250 ? 42.308 -64.960  200.412 1.00 83.64  ? 250  PHE B CZ  1 
ATOM   4013 N  N   . ALA B 1 251 ? 49.404 -64.172  201.730 1.00 82.54  ? 251  ALA B N   1 
ATOM   4014 C  CA  . ALA B 1 251 ? 50.616 -63.487  202.181 1.00 82.87  ? 251  ALA B CA  1 
ATOM   4015 C  C   . ALA B 1 251 ? 50.356 -61.985  202.422 1.00 81.46  ? 251  ALA B C   1 
ATOM   4016 O  O   . ALA B 1 251 ? 51.181 -61.142  202.101 1.00 83.57  ? 251  ALA B O   1 
ATOM   4017 C  CB  . ALA B 1 251 ? 51.751 -63.679  201.164 1.00 86.03  ? 251  ALA B CB  1 
ATOM   4018 N  N   . GLN B 1 252 ? 49.193 -61.654  202.967 1.00 78.55  ? 252  GLN B N   1 
ATOM   4019 C  CA  . GLN B 1 252 ? 48.855 -60.275  203.323 1.00 76.68  ? 252  GLN B CA  1 
ATOM   4020 C  C   . GLN B 1 252 ? 47.892 -60.372  204.514 1.00 72.67  ? 252  GLN B C   1 
ATOM   4021 O  O   . GLN B 1 252 ? 47.183 -61.382  204.666 1.00 70.55  ? 252  GLN B O   1 
ATOM   4022 C  CB  . GLN B 1 252 ? 48.152 -59.559  202.173 1.00 123.87 ? 252  GLN B CB  1 
ATOM   4023 C  CG  . GLN B 1 252 ? 48.447 -60.120  200.800 1.00 145.89 ? 252  GLN B CG  1 
ATOM   4024 C  CD  . GLN B 1 252 ? 47.336 -59.820  199.808 1.00 161.12 ? 252  GLN B CD  1 
ATOM   4025 O  OE1 . GLN B 1 252 ? 47.313 -60.368  198.702 1.00 177.13 ? 252  GLN B OE1 1 
ATOM   4026 N  NE2 . GLN B 1 252 ? 46.401 -58.949  200.204 1.00 152.16 ? 252  GLN B NE2 1 
ATOM   4027 N  N   . ASN B 1 253 ? 47.858 -59.325  205.339 1.00 70.17  ? 253  ASN B N   1 
ATOM   4028 C  CA  . ASN B 1 253 ? 46.977 -59.301  206.490 1.00 66.65  ? 253  ASN B CA  1 
ATOM   4029 C  C   . ASN B 1 253 ? 45.545 -59.207  206.073 1.00 64.23  ? 253  ASN B C   1 
ATOM   4030 O  O   . ASN B 1 253 ? 45.247 -58.598  205.054 1.00 65.64  ? 253  ASN B O   1 
ATOM   4031 C  CB  . ASN B 1 253 ? 47.303 -58.132  207.389 1.00 66.83  ? 253  ASN B CB  1 
ATOM   4032 C  CG  . ASN B 1 253 ? 48.672 -58.269  208.016 1.00 70.23  ? 253  ASN B CG  1 
ATOM   4033 O  OD1 . ASN B 1 253 ? 49.250 -59.364  208.048 1.00 74.68  ? 253  ASN B OD1 1 
ATOM   4034 N  ND2 . ASN B 1 253 ? 49.215 -57.157  208.499 1.00 71.75  ? 253  ASN B ND2 1 
ATOM   4035 N  N   . VAL B 1 254 ? 44.663 -59.831  206.847 1.00 60.39  ? 254  VAL B N   1 
ATOM   4036 C  CA  . VAL B 1 254 ? 43.241 -59.741  206.597 1.00 57.11  ? 254  VAL B CA  1 
ATOM   4037 C  C   . VAL B 1 254 ? 42.535 -59.230  207.837 1.00 54.00  ? 254  VAL B C   1 
ATOM   4038 O  O   . VAL B 1 254 ? 43.120 -59.213  208.925 1.00 53.33  ? 254  VAL B O   1 
ATOM   4039 C  CB  . VAL B 1 254 ? 42.660 -61.083  206.105 1.00 57.22  ? 254  VAL B CB  1 
ATOM   4040 C  CG1 . VAL B 1 254 ? 43.369 -61.483  204.843 1.00 58.03  ? 254  VAL B CG1 1 
ATOM   4041 C  CG2 . VAL B 1 254 ? 42.782 -62.182  207.181 1.00 54.61  ? 254  VAL B CG2 1 
ATOM   4042 N  N   . HIS B 1 255 ? 41.292 -58.796  207.662 1.00 51.47  ? 255  HIS B N   1 
ATOM   4043 C  CA  . HIS B 1 255 ? 40.547 -58.123  208.722 1.00 49.10  ? 255  HIS B CA  1 
ATOM   4044 C  C   . HIS B 1 255 ? 39.112 -58.549  208.565 1.00 47.01  ? 255  HIS B C   1 
ATOM   4045 O  O   . HIS B 1 255 ? 38.611 -58.642  207.447 1.00 47.20  ? 255  HIS B O   1 
ATOM   4046 C  CB  . HIS B 1 255 ? 40.610 -56.611  208.559 1.00 49.84  ? 255  HIS B CB  1 
ATOM   4047 C  CG  . HIS B 1 255 ? 41.995 -56.051  208.470 1.00 54.49  ? 255  HIS B CG  1 
ATOM   4048 N  ND1 . HIS B 1 255 ? 42.563 -55.292  209.483 1.00 56.00  ? 255  HIS B ND1 1 
ATOM   4049 C  CD2 . HIS B 1 255 ? 42.913 -56.086  207.465 1.00 57.53  ? 255  HIS B CD2 1 
ATOM   4050 C  CE1 . HIS B 1 255 ? 43.781 -54.918  209.118 1.00 58.07  ? 255  HIS B CE1 1 
ATOM   4051 N  NE2 . HIS B 1 255 ? 44.013 -55.377  207.895 1.00 59.23  ? 255  HIS B NE2 1 
ATOM   4052 N  N   . ALA B 1 256 ? 38.456 -58.838  209.671 1.00 44.59  ? 256  ALA B N   1 
ATOM   4053 C  CA  . ALA B 1 256 ? 37.024 -59.152  209.654 1.00 43.73  ? 256  ALA B CA  1 
ATOM   4054 C  C   . ALA B 1 256 ? 36.421 -58.655  210.961 1.00 43.06  ? 256  ALA B C   1 
ATOM   4055 O  O   . ALA B 1 256 ? 37.103 -58.549  211.976 1.00 41.93  ? 256  ALA B O   1 
ATOM   4056 C  CB  . ALA B 1 256 ? 36.815 -60.621  209.494 1.00 42.85  ? 256  ALA B CB  1 
ATOM   4057 N  N   . ARG B 1 257 ? 35.166 -58.258  210.936 1.00 44.77  ? 257  ARG B N   1 
ATOM   4058 C  CA  . ARG B 1 257 ? 34.505 -57.874  212.188 1.00 45.02  ? 257  ARG B CA  1 
ATOM   4059 C  C   . ARG B 1 257 ? 33.016 -58.185  212.134 1.00 44.73  ? 257  ARG B C   1 
ATOM   4060 O  O   . ARG B 1 257 ? 32.463 -58.476  211.078 1.00 44.54  ? 257  ARG B O   1 
ATOM   4061 C  CB  . ARG B 1 257 ? 34.721 -56.394  212.487 1.00 45.42  ? 257  ARG B CB  1 
ATOM   4062 C  CG  . ARG B 1 257 ? 34.059 -55.486  211.487 1.00 50.91  ? 257  ARG B CG  1 
ATOM   4063 C  CD  . ARG B 1 257 ? 34.631 -54.052  211.536 1.00 56.62  ? 257  ARG B CD  1 
ATOM   4064 N  NE  . ARG B 1 257 ? 34.621 -53.397  210.229 1.00 59.28  ? 257  ARG B NE  1 
ATOM   4065 C  CZ  . ARG B 1 257 ? 33.555 -52.798  209.747 1.00 63.34  ? 257  ARG B CZ  1 
ATOM   4066 N  NH1 . ARG B 1 257 ? 32.436 -52.799  210.457 1.00 65.14  ? 257  ARG B NH1 1 
ATOM   4067 N  NH2 . ARG B 1 257 ? 33.606 -52.186  208.580 1.00 68.20  ? 257  ARG B NH2 1 
ATOM   4068 N  N   . HIS B 1 258 ? 32.374 -58.071  213.279 1.00 44.85  ? 258  HIS B N   1 
ATOM   4069 C  CA  . HIS B 1 258 ? 30.972 -58.403  213.414 1.00 46.47  ? 258  HIS B CA  1 
ATOM   4070 C  C   . HIS B 1 258 ? 30.404 -57.658  214.642 1.00 46.53  ? 258  HIS B C   1 
ATOM   4071 O  O   . HIS B 1 258 ? 31.119 -57.377  215.613 1.00 47.43  ? 258  HIS B O   1 
ATOM   4072 C  CB  . HIS B 1 258 ? 30.857 -59.902  213.571 1.00 45.69  ? 258  HIS B CB  1 
ATOM   4073 C  CG  . HIS B 1 258 ? 29.461 -60.413  213.487 1.00 50.35  ? 258  HIS B CG  1 
ATOM   4074 N  ND1 . HIS B 1 258 ? 28.903 -60.855  212.307 1.00 54.12  ? 258  HIS B ND1 1 
ATOM   4075 C  CD2 . HIS B 1 258 ? 28.511 -60.577  214.441 1.00 51.18  ? 258  HIS B CD2 1 
ATOM   4076 C  CE1 . HIS B 1 258 ? 27.663 -61.255  212.533 1.00 53.76  ? 258  HIS B CE1 1 
ATOM   4077 N  NE2 . HIS B 1 258 ? 27.404 -61.099  213.820 1.00 52.76  ? 258  HIS B NE2 1 
ATOM   4078 N  N   . ALA B 1 259 ? 29.146 -57.276  214.612 1.00 46.25  ? 259  ALA B N   1 
ATOM   4079 C  CA  . ALA B 1 259 ? 28.648 -56.585  215.772 1.00 46.33  ? 259  ALA B CA  1 
ATOM   4080 C  C   . ALA B 1 259 ? 27.520 -57.400  216.317 1.00 46.62  ? 259  ALA B C   1 
ATOM   4081 O  O   . ALA B 1 259 ? 26.739 -57.937  215.553 1.00 47.51  ? 259  ALA B O   1 
ATOM   4082 C  CB  . ALA B 1 259 ? 28.172 -55.166  215.401 1.00 46.33  ? 259  ALA B CB  1 
ATOM   4083 N  N   . TYR B 1 260 ? 27.412 -57.491  217.629 1.00 46.64  ? 260  TYR B N   1 
ATOM   4084 C  CA  . TYR B 1 260 ? 26.244 -58.144  218.186 1.00 48.47  ? 260  TYR B CA  1 
ATOM   4085 C  C   . TYR B 1 260 ? 25.422 -57.191  219.044 1.00 50.38  ? 260  TYR B C   1 
ATOM   4086 O  O   . TYR B 1 260 ? 25.974 -56.521  219.907 1.00 49.03  ? 260  TYR B O   1 
ATOM   4087 C  CB  . TYR B 1 260 ? 26.620 -59.359  219.039 1.00 47.24  ? 260  TYR B CB  1 
ATOM   4088 C  CG  . TYR B 1 260 ? 27.385 -60.466  218.351 1.00 45.04  ? 260  TYR B CG  1 
ATOM   4089 C  CD1 . TYR B 1 260 ? 28.766 -60.469  218.376 1.00 40.77  ? 260  TYR B CD1 1 
ATOM   4090 C  CD2 . TYR B 1 260 ? 26.725 -61.550  217.737 1.00 43.73  ? 260  TYR B CD2 1 
ATOM   4091 C  CE1 . TYR B 1 260 ? 29.477 -61.467  217.774 1.00 40.83  ? 260  TYR B CE1 1 
ATOM   4092 C  CE2 . TYR B 1 260 ? 27.444 -62.592  217.141 1.00 41.14  ? 260  TYR B CE2 1 
ATOM   4093 C  CZ  . TYR B 1 260 ? 28.830 -62.536  217.170 1.00 43.07  ? 260  TYR B CZ  1 
ATOM   4094 O  OH  . TYR B 1 260 ? 29.616 -63.530  216.612 1.00 45.31  ? 260  TYR B OH  1 
ATOM   4095 N  N   . SER B 1 261 ? 24.106 -57.170  218.828 1.00 53.44  ? 261  SER B N   1 
ATOM   4096 C  CA  . SER B 1 261 ? 23.217 -56.522  219.783 1.00 57.59  ? 261  SER B CA  1 
ATOM   4097 C  C   . SER B 1 261 ? 22.859 -57.463  220.958 1.00 59.02  ? 261  SER B C   1 
ATOM   4098 O  O   . SER B 1 261 ? 23.045 -58.682  220.883 1.00 57.43  ? 261  SER B O   1 
ATOM   4099 C  CB  . SER B 1 261 ? 21.949 -56.065  219.091 1.00 59.08  ? 261  SER B CB  1 
ATOM   4100 O  OG  . SER B 1 261 ? 21.117 -57.201  218.882 1.00 64.56  ? 261  SER B OG  1 
ATOM   4101 N  N   . CYS B 1 262 ? 22.352 -56.862  222.033 1.00 62.34  ? 262  CYS B N   1 
ATOM   4102 C  CA  . CYS B 1 262 ? 21.763 -57.554  223.191 1.00 65.15  ? 262  CYS B CA  1 
ATOM   4103 C  C   . CYS B 1 262 ? 20.818 -58.663  222.851 1.00 66.80  ? 262  CYS B C   1 
ATOM   4104 O  O   . CYS B 1 262 ? 20.810 -59.695  223.521 1.00 67.75  ? 262  CYS B O   1 
ATOM   4105 C  CB  . CYS B 1 262 ? 20.952 -56.563  224.009 1.00 67.39  ? 262  CYS B CB  1 
ATOM   4106 S  SG  . CYS B 1 262 ? 22.013 -55.414  224.820 1.00 71.46  ? 262  CYS B SG  1 
ATOM   4107 N  N   . ASP B 1 263 ? 19.959 -58.424  221.872 1.00 68.45  ? 263  ASP B N   1 
ATOM   4108 C  CA  . ASP B 1 263 ? 19.081 -59.466  221.392 1.00 70.54  ? 263  ASP B CA  1 
ATOM   4109 C  C   . ASP B 1 263 ? 19.826 -60.742  221.122 1.00 67.08  ? 263  ASP B C   1 
ATOM   4110 O  O   . ASP B 1 263 ? 19.263 -61.810  221.197 1.00 68.27  ? 263  ASP B O   1 
ATOM   4111 C  CB  . ASP B 1 263 ? 18.450 -59.063  220.051 1.00 73.67  ? 263  ASP B CB  1 
ATOM   4112 C  CG  . ASP B 1 263 ? 17.529 -57.855  220.167 1.00 81.33  ? 263  ASP B CG  1 
ATOM   4113 O  OD1 . ASP B 1 263 ? 17.065 -57.569  221.312 1.00 87.47  ? 263  ASP B OD1 1 
ATOM   4114 O  OD2 . ASP B 1 263 ? 17.265 -57.208  219.110 1.00 87.12  ? 263  ASP B OD2 1 
ATOM   4115 N  N   . GLU B 1 264 ? 21.085 -60.634  220.738 1.00 63.62  ? 264  GLU B N   1 
ATOM   4116 C  CA  . GLU B 1 264 ? 21.763 -61.788  220.172 1.00 60.94  ? 264  GLU B CA  1 
ATOM   4117 C  C   . GLU B 1 264 ? 22.673 -62.461  221.153 1.00 58.57  ? 264  GLU B C   1 
ATOM   4118 O  O   . GLU B 1 264 ? 23.539 -63.257  220.777 1.00 57.68  ? 264  GLU B O   1 
ATOM   4119 C  CB  . GLU B 1 264 ? 22.483 -61.416  218.889 1.00 60.24  ? 264  GLU B CB  1 
ATOM   4120 C  CG  . GLU B 1 264 ? 21.551 -60.721  217.901 1.00 62.78  ? 264  GLU B CG  1 
ATOM   4121 C  CD  . GLU B 1 264 ? 22.290 -59.917  216.871 1.00 64.80  ? 264  GLU B CD  1 
ATOM   4122 O  OE1 . GLU B 1 264 ? 23.257 -59.189  217.231 1.00 65.23  ? 264  GLU B OE1 1 
ATOM   4123 O  OE2 . GLU B 1 264 ? 21.890 -59.995  215.691 1.00 68.09  ? 264  GLU B OE2 1 
ATOM   4124 N  N   . ILE B 1 265 ? 22.440 -62.178  222.427 1.00 57.79  ? 265  ILE B N   1 
ATOM   4125 C  CA  . ILE B 1 265 ? 23.103 -62.916  223.487 1.00 56.82  ? 265  ILE B CA  1 
ATOM   4126 C  C   . ILE B 1 265 ? 22.131 -63.953  224.071 1.00 58.14  ? 265  ILE B C   1 
ATOM   4127 O  O   . ILE B 1 265 ? 21.059 -63.590  224.536 1.00 60.15  ? 265  ILE B O   1 
ATOM   4128 C  CB  . ILE B 1 265 ? 23.580 -61.951  224.587 1.00 56.62  ? 265  ILE B CB  1 
ATOM   4129 C  CG1 . ILE B 1 265 ? 24.499 -60.885  223.983 1.00 55.00  ? 265  ILE B CG1 1 
ATOM   4130 C  CG2 . ILE B 1 265 ? 24.219 -62.717  225.737 1.00 54.38  ? 265  ILE B CG2 1 
ATOM   4131 C  CD1 . ILE B 1 265 ? 25.005 -59.882  225.007 1.00 54.58  ? 265  ILE B CD1 1 
ATOM   4132 N  N   . ILE B 1 266 ? 22.483 -65.232  224.025 1.00 56.92  ? 266  ILE B N   1 
ATOM   4133 C  CA  . ILE B 1 266 ? 21.645 -66.256  224.602 1.00 57.62  ? 266  ILE B CA  1 
ATOM   4134 C  C   . ILE B 1 266 ? 22.162 -66.511  226.007 1.00 57.68  ? 266  ILE B C   1 
ATOM   4135 O  O   . ILE B 1 266 ? 23.213 -67.136  226.178 1.00 56.12  ? 266  ILE B O   1 
ATOM   4136 C  CB  . ILE B 1 266 ? 21.762 -67.595  223.814 1.00 58.41  ? 266  ILE B CB  1 
ATOM   4137 C  CG1 . ILE B 1 266 ? 21.337 -67.432  222.367 1.00 57.28  ? 266  ILE B CG1 1 
ATOM   4138 C  CG2 . ILE B 1 266 ? 20.931 -68.723  224.475 1.00 60.02  ? 266  ILE B CG2 1 
ATOM   4139 C  CD1 . ILE B 1 266 ? 20.233 -66.485  222.177 1.00 58.87  ? 266  ILE B CD1 1 
ATOM   4140 N  N   . TRP B 1 267 ? 21.428 -66.055  227.017 1.00 58.96  ? 267  TRP B N   1 
ATOM   4141 C  CA  . TRP B 1 267 ? 21.834 -66.258  228.404 1.00 59.24  ? 267  TRP B CA  1 
ATOM   4142 C  C   . TRP B 1 267 ? 21.586 -67.682  228.844 1.00 60.32  ? 267  TRP B C   1 
ATOM   4143 O  O   . TRP B 1 267 ? 20.483 -68.180  228.735 1.00 63.21  ? 267  TRP B O   1 
ATOM   4144 C  CB  . TRP B 1 267 ? 21.069 -65.320  229.310 1.00 60.97  ? 267  TRP B CB  1 
ATOM   4145 C  CG  . TRP B 1 267 ? 21.402 -63.889  229.082 1.00 61.78  ? 267  TRP B CG  1 
ATOM   4146 C  CD1 . TRP B 1 267 ? 21.052 -63.113  227.996 1.00 62.04  ? 267  TRP B CD1 1 
ATOM   4147 C  CD2 . TRP B 1 267 ? 22.143 -63.043  229.962 1.00 62.39  ? 267  TRP B CD2 1 
ATOM   4148 N  NE1 . TRP B 1 267 ? 21.533 -61.835  228.163 1.00 62.35  ? 267  TRP B NE1 1 
ATOM   4149 C  CE2 . TRP B 1 267 ? 22.216 -61.767  229.355 1.00 62.51  ? 267  TRP B CE2 1 
ATOM   4150 C  CE3 . TRP B 1 267 ? 22.752 -63.237  231.218 1.00 63.92  ? 267  TRP B CE3 1 
ATOM   4151 C  CZ2 . TRP B 1 267 ? 22.882 -60.678  229.964 1.00 63.13  ? 267  TRP B CZ2 1 
ATOM   4152 C  CZ3 . TRP B 1 267 ? 23.424 -62.150  231.825 1.00 62.71  ? 267  TRP B CZ3 1 
ATOM   4153 C  CH2 . TRP B 1 267 ? 23.469 -60.891  231.199 1.00 62.22  ? 267  TRP B CH2 1 
ATOM   4154 N  N   . GLY B 1 268 ? 22.612 -68.336  229.349 1.00 59.11  ? 268  GLY B N   1 
ATOM   4155 C  CA  . GLY B 1 268 ? 22.535 -69.735  229.580 1.00 60.77  ? 268  GLY B CA  1 
ATOM   4156 C  C   . GLY B 1 268 ? 22.856 -70.622  228.397 1.00 61.22  ? 268  GLY B C   1 
ATOM   4157 O  O   . GLY B 1 268 ? 22.816 -71.838  228.543 1.00 64.31  ? 268  GLY B O   1 
ATOM   4158 N  N   . GLY B 1 269 ? 23.173 -70.081  227.225 1.00 59.31  ? 269  GLY B N   1 
ATOM   4159 C  CA  . GLY B 1 269 ? 23.471 -70.959  226.091 1.00 59.16  ? 269  GLY B CA  1 
ATOM   4160 C  C   . GLY B 1 269 ? 24.840 -71.606  226.180 1.00 59.05  ? 269  GLY B C   1 
ATOM   4161 O  O   . GLY B 1 269 ? 25.754 -71.063  226.811 1.00 59.11  ? 269  GLY B O   1 
ATOM   4162 N  N   . HIS B 1 270 ? 24.996 -72.766  225.567 1.00 60.03  ? 270  HIS B N   1 
ATOM   4163 C  CA  . HIS B 1 270 ? 26.299 -73.365  225.355 1.00 59.97  ? 270  HIS B CA  1 
ATOM   4164 C  C   . HIS B 1 270 ? 26.397 -73.759  223.882 1.00 60.12  ? 270  HIS B C   1 
ATOM   4165 O  O   . HIS B 1 270 ? 25.545 -74.506  223.382 1.00 62.09  ? 270  HIS B O   1 
ATOM   4166 C  CB  . HIS B 1 270 ? 26.480 -74.648  226.165 1.00 62.58  ? 270  HIS B CB  1 
ATOM   4167 C  CG  . HIS B 1 270 ? 26.134 -74.507  227.610 1.00 67.60  ? 270  HIS B CG  1 
ATOM   4168 N  ND1 . HIS B 1 270 ? 24.845 -74.657  228.083 1.00 72.05  ? 270  HIS B ND1 1 
ATOM   4169 C  CD2 . HIS B 1 270 ? 26.908 -74.232  228.691 1.00 68.43  ? 270  HIS B CD2 1 
ATOM   4170 C  CE1 . HIS B 1 270 ? 24.839 -74.442  229.389 1.00 73.88  ? 270  HIS B CE1 1 
ATOM   4171 N  NE2 . HIS B 1 270 ? 26.078 -74.193  229.783 1.00 69.72  ? 270  HIS B NE2 1 
ATOM   4172 N  N   . PHE B 1 271 ? 27.447 -73.299  223.201 1.00 57.37  ? 271  PHE B N   1 
ATOM   4173 C  CA  . PHE B 1 271 ? 27.744 -73.766  221.862 1.00 56.76  ? 271  PHE B CA  1 
ATOM   4174 C  C   . PHE B 1 271 ? 27.861 -75.280  221.804 1.00 59.08  ? 271  PHE B C   1 
ATOM   4175 O  O   . PHE B 1 271 ? 28.427 -75.883  222.685 1.00 59.88  ? 271  PHE B O   1 
ATOM   4176 C  CB  . PHE B 1 271 ? 29.032 -73.121  221.352 1.00 53.85  ? 271  PHE B CB  1 
ATOM   4177 C  CG  . PHE B 1 271 ? 28.862 -71.663  220.984 1.00 52.06  ? 271  PHE B CG  1 
ATOM   4178 C  CD1 . PHE B 1 271 ? 29.526 -70.651  221.712 1.00 49.35  ? 271  PHE B CD1 1 
ATOM   4179 C  CD2 . PHE B 1 271 ? 28.015 -71.296  219.937 1.00 47.37  ? 271  PHE B CD2 1 
ATOM   4180 C  CE1 . PHE B 1 271 ? 29.360 -69.308  221.379 1.00 46.58  ? 271  PHE B CE1 1 
ATOM   4181 C  CE2 . PHE B 1 271 ? 27.825 -69.975  219.617 1.00 46.15  ? 271  PHE B CE2 1 
ATOM   4182 C  CZ  . PHE B 1 271 ? 28.499 -68.966  220.325 1.00 46.27  ? 271  PHE B CZ  1 
ATOM   4183 N  N   . VAL B 1 272 ? 27.328 -75.883  220.751 1.00 60.68  ? 272  VAL B N   1 
ATOM   4184 C  CA  . VAL B 1 272 ? 27.507 -77.284  220.504 1.00 63.04  ? 272  VAL B CA  1 
ATOM   4185 C  C   . VAL B 1 272 ? 28.866 -77.577  219.930 1.00 63.63  ? 272  VAL B C   1 
ATOM   4186 O  O   . VAL B 1 272 ? 29.285 -76.953  218.979 1.00 62.45  ? 272  VAL B O   1 
ATOM   4187 C  CB  . VAL B 1 272 ? 26.490 -77.783  219.466 1.00 65.16  ? 272  VAL B CB  1 
ATOM   4188 C  CG1 . VAL B 1 272 ? 26.895 -79.179  218.954 1.00 64.67  ? 272  VAL B CG1 1 
ATOM   4189 C  CG2 . VAL B 1 272 ? 25.075 -77.747  220.048 1.00 65.46  ? 272  VAL B CG2 1 
ATOM   4190 N  N   . ASP B 1 273 ? 29.535 -78.574  220.475 1.00 67.11  ? 273  ASP B N   1 
ATOM   4191 C  CA  . ASP B 1 273 ? 30.825 -79.007  219.960 1.00 69.62  ? 273  ASP B CA  1 
ATOM   4192 C  C   . ASP B 1 273 ? 30.798 -79.188  218.440 1.00 70.59  ? 273  ASP B C   1 
ATOM   4193 O  O   . ASP B 1 273 ? 29.911 -79.861  217.902 1.00 73.28  ? 273  ASP B O   1 
ATOM   4194 C  CB  . ASP B 1 273 ? 31.294 -80.299  220.685 1.00 72.60  ? 273  ASP B CB  1 
ATOM   4195 C  CG  . ASP B 1 273 ? 32.819 -80.579  220.509 1.00 76.90  ? 273  ASP B CG  1 
ATOM   4196 O  OD1 . ASP B 1 273 ? 33.567 -79.698  219.990 1.00 78.66  ? 273  ASP B OD1 1 
ATOM   4197 O  OD2 . ASP B 1 273 ? 33.280 -81.691  220.895 1.00 84.04  ? 273  ASP B OD2 1 
ATOM   4198 N  N   . VAL B 1 274 ? 31.773 -78.586  217.759 1.00 69.74  ? 274  VAL B N   1 
ATOM   4199 C  CA  . VAL B 1 274 ? 31.943 -78.750  216.327 1.00 71.56  ? 274  VAL B CA  1 
ATOM   4200 C  C   . VAL B 1 274 ? 33.055 -79.759  216.011 1.00 74.81  ? 274  VAL B C   1 
ATOM   4201 O  O   . VAL B 1 274 ? 33.233 -80.164  214.874 1.00 75.46  ? 274  VAL B O   1 
ATOM   4202 C  CB  . VAL B 1 274 ? 32.259 -77.404  215.634 1.00 69.26  ? 274  VAL B CB  1 
ATOM   4203 C  CG1 . VAL B 1 274 ? 31.029 -76.506  215.593 1.00 66.63  ? 274  VAL B CG1 1 
ATOM   4204 C  CG2 . VAL B 1 274 ? 33.455 -76.710  216.315 1.00 67.23  ? 274  VAL B CG2 1 
ATOM   4205 N  N   . PHE B 1 275 ? 33.825 -80.140  217.022 1.00 73.38  ? 275  PHE B N   1 
ATOM   4206 C  CA  . PHE B 1 275 ? 34.877 -81.136  216.855 1.00 76.80  ? 275  PHE B CA  1 
ATOM   4207 C  C   . PHE B 1 275 ? 34.292 -82.496  217.206 1.00 81.18  ? 275  PHE B C   1 
ATOM   4208 O  O   . PHE B 1 275 ? 33.721 -82.679  218.290 1.00 83.61  ? 275  PHE B O   1 
ATOM   4209 C  CB  . PHE B 1 275 ? 36.032 -80.840  217.802 1.00 76.72  ? 275  PHE B CB  1 
ATOM   4210 C  CG  . PHE B 1 275 ? 36.732 -79.556  217.518 1.00 76.12  ? 275  PHE B CG  1 
ATOM   4211 C  CD1 . PHE B 1 275 ? 36.367 -78.386  218.171 1.00 76.81  ? 275  PHE B CD1 1 
ATOM   4212 C  CD2 . PHE B 1 275 ? 37.762 -79.508  216.591 1.00 78.80  ? 275  PHE B CD2 1 
ATOM   4213 C  CE1 . PHE B 1 275 ? 37.030 -77.163  217.913 1.00 75.24  ? 275  PHE B CE1 1 
ATOM   4214 C  CE2 . PHE B 1 275 ? 38.435 -78.299  216.322 1.00 78.75  ? 275  PHE B CE2 1 
ATOM   4215 C  CZ  . PHE B 1 275 ? 38.057 -77.120  216.989 1.00 76.47  ? 275  PHE B CZ  1 
ATOM   4216 N  N   . THR B 1 276 ? 34.436 -83.465  216.322 1.00 83.84  ? 276  THR B N   1 
ATOM   4217 C  CA  . THR B 1 276 ? 33.744 -84.715  216.517 1.00 88.22  ? 276  THR B CA  1 
ATOM   4218 C  C   . THR B 1 276 ? 34.630 -85.832  216.046 1.00 90.87  ? 276  THR B C   1 
ATOM   4219 O  O   . THR B 1 276 ? 35.524 -85.606  215.246 1.00 89.74  ? 276  THR B O   1 
ATOM   4220 C  CB  . THR B 1 276 ? 32.446 -84.729  215.696 1.00 89.25  ? 276  THR B CB  1 
ATOM   4221 O  OG1 . THR B 1 276 ? 32.763 -84.537  214.311 1.00 89.19  ? 276  THR B OG1 1 
ATOM   4222 C  CG2 . THR B 1 276 ? 31.502 -83.591  216.142 1.00 88.17  ? 276  THR B CG2 1 
ATOM   4223 N  N   . THR B 1 277 ? 34.386 -87.043  216.538 1.00 95.49  ? 277  THR B N   1 
ATOM   4224 C  CA  . THR B 1 277 ? 35.104 -88.215  216.018 1.00 99.44  ? 277  THR B CA  1 
ATOM   4225 C  C   . THR B 1 277 ? 34.339 -88.944  214.910 1.00 102.06 ? 277  THR B C   1 
ATOM   4226 O  O   . THR B 1 277 ? 33.130 -89.126  215.004 1.00 103.44 ? 277  THR B O   1 
ATOM   4227 C  CB  . THR B 1 277 ? 35.469 -89.195  217.133 1.00 103.15 ? 277  THR B CB  1 
ATOM   4228 O  OG1 . THR B 1 277 ? 36.399 -88.555  218.010 1.00 102.63 ? 277  THR B OG1 1 
ATOM   4229 C  CG2 . THR B 1 277 ? 36.113 -90.454  216.561 1.00 106.51 ? 277  THR B CG2 1 
ATOM   4230 N  N   . LEU B 1 278 ? 35.050 -89.349  213.860 1.00 103.65 ? 278  LEU B N   1 
ATOM   4231 C  CA  . LEU B 1 278 ? 34.422 -90.022  212.733 1.00 107.01 ? 278  LEU B CA  1 
ATOM   4232 C  C   . LEU B 1 278 ? 34.216 -91.522  212.956 1.00 113.39 ? 278  LEU B C   1 
ATOM   4233 O  O   . LEU B 1 278 ? 34.561 -92.066  214.019 1.00 114.92 ? 278  LEU B O   1 
ATOM   4234 C  CB  . LEU B 1 278 ? 35.214 -89.793  211.448 1.00 106.06 ? 278  LEU B CB  1 
ATOM   4235 C  CG  . LEU B 1 278 ? 34.917 -88.437  210.832 1.00 102.45 ? 278  LEU B CG  1 
ATOM   4236 C  CD1 . LEU B 1 278 ? 35.180 -88.434  209.328 1.00 102.81 ? 278  LEU B CD1 1 
ATOM   4237 C  CD2 . LEU B 1 278 ? 33.469 -88.083  211.129 1.00 101.53 ? 278  LEU B CD2 1 
ATOM   4238 N  N   . PRO B 1 279 ? 33.635 -92.195  211.944 1.00 117.43 ? 279  PRO B N   1 
ATOM   4239 C  CA  . PRO B 1 279 ? 33.485 -93.646  211.972 1.00 123.60 ? 279  PRO B CA  1 
ATOM   4240 C  C   . PRO B 1 279 ? 34.829 -94.304  212.308 1.00 125.78 ? 279  PRO B C   1 
ATOM   4241 O  O   . PRO B 1 279 ? 34.914 -95.104  213.244 1.00 128.77 ? 279  PRO B O   1 
ATOM   4242 C  CB  . PRO B 1 279 ? 33.069 -93.986  210.529 1.00 126.16 ? 279  PRO B CB  1 
ATOM   4243 C  CG  . PRO B 1 279 ? 32.464 -92.723  209.984 1.00 122.41 ? 279  PRO B CG  1 
ATOM   4244 C  CD  . PRO B 1 279 ? 33.202 -91.604  210.660 1.00 116.39 ? 279  PRO B CD  1 
ATOM   4245 N  N   . ASP B 1 280 ? 35.869 -93.933  211.555 1.00 124.66 ? 280  ASP B N   1 
ATOM   4246 C  CA  . ASP B 1 280 ? 37.212 -94.504  211.716 1.00 127.11 ? 280  ASP B CA  1 
ATOM   4247 C  C   . ASP B 1 280 ? 37.858 -94.147  213.066 1.00 125.16 ? 280  ASP B C   1 
ATOM   4248 O  O   . ASP B 1 280 ? 38.646 -94.915  213.617 1.00 128.83 ? 280  ASP B O   1 
ATOM   4249 C  CB  . ASP B 1 280 ? 38.136 -94.040  210.576 1.00 126.27 ? 280  ASP B CB  1 
ATOM   4250 C  CG  . ASP B 1 280 ? 37.373 -93.607  209.333 1.00 126.34 ? 280  ASP B CG  1 
ATOM   4251 O  OD1 . ASP B 1 280 ? 36.122 -93.574  209.368 1.00 127.41 ? 280  ASP B OD1 1 
ATOM   4252 O  OD2 . ASP B 1 280 ? 38.031 -93.290  208.318 1.00 126.66 ? 280  ASP B OD2 1 
ATOM   4253 N  N   . GLY B 1 281 ? 37.526 -92.979  213.597 1.00 120.05 ? 281  GLY B N   1 
ATOM   4254 C  CA  . GLY B 1 281 ? 38.250 -92.439  214.750 1.00 117.62 ? 281  GLY B CA  1 
ATOM   4255 C  C   . GLY B 1 281 ? 39.120 -91.263  214.315 1.00 112.83 ? 281  GLY B C   1 
ATOM   4256 O  O   . GLY B 1 281 ? 39.944 -90.769  215.077 1.00 111.85 ? 281  GLY B O   1 
ATOM   4257 N  N   . ARG B 1 282 ? 38.950 -90.846  213.063 1.00 110.32 ? 282  ARG B N   1 
ATOM   4258 C  CA  . ARG B 1 282 ? 39.531 -89.617  212.578 1.00 105.76 ? 282  ARG B CA  1 
ATOM   4259 C  C   . ARG B 1 282 ? 38.840 -88.480  213.300 1.00 101.15 ? 282  ARG B C   1 
ATOM   4260 O  O   . ARG B 1 282 ? 37.631 -88.553  213.569 1.00 100.95 ? 282  ARG B O   1 
ATOM   4261 C  CB  . ARG B 1 282 ? 39.261 -89.454  211.089 1.00 105.70 ? 282  ARG B CB  1 
ATOM   4262 C  CG  . ARG B 1 282 ? 40.192 -90.197  210.185 1.00 109.44 ? 282  ARG B CG  1 
ATOM   4263 C  CD  . ARG B 1 282 ? 39.824 -89.865  208.760 1.00 110.84 ? 282  ARG B CD  1 
ATOM   4264 N  NE  . ARG B 1 282 ? 38.547 -90.471  208.382 1.00 113.70 ? 282  ARG B NE  1 
ATOM   4265 C  CZ  . ARG B 1 282 ? 37.844 -90.147  207.297 1.00 113.46 ? 282  ARG B CZ  1 
ATOM   4266 N  NH1 . ARG B 1 282 ? 38.276 -89.198  206.472 1.00 111.09 ? 282  ARG B NH1 1 
ATOM   4267 N  NH2 . ARG B 1 282 ? 36.699 -90.771  207.038 1.00 115.03 ? 282  ARG B NH2 1 
ATOM   4268 N  N   . ARG B 1 283 ? 39.594 -87.427  213.611 1.00 97.20  ? 283  ARG B N   1 
ATOM   4269 C  CA  . ARG B 1 283 ? 38.991 -86.226  214.149 1.00 92.13  ? 283  ARG B CA  1 
ATOM   4270 C  C   . ARG B 1 283 ? 38.394 -85.416  212.989 1.00 87.79  ? 283  ARG B C   1 
ATOM   4271 O  O   . ARG B 1 283 ? 38.937 -85.382  211.877 1.00 88.01  ? 283  ARG B O   1 
ATOM   4272 C  CB  . ARG B 1 283 ? 40.009 -85.415  214.966 1.00 91.95  ? 283  ARG B CB  1 
ATOM   4273 C  CG  . ARG B 1 283 ? 39.373 -84.440  215.988 1.00 93.59  ? 283  ARG B CG  1 
ATOM   4274 C  CD  . ARG B 1 283 ? 38.705 -85.171  217.189 1.00 101.05 ? 283  ARG B CD  1 
ATOM   4275 N  NE  . ARG B 1 283 ? 37.676 -84.353  217.860 1.00 103.22 ? 283  ARG B NE  1 
ATOM   4276 C  CZ  . ARG B 1 283 ? 37.118 -84.642  219.042 1.00 106.19 ? 283  ARG B CZ  1 
ATOM   4277 N  NH1 . ARG B 1 283 ? 37.487 -85.730  219.707 1.00 111.38 ? 283  ARG B NH1 1 
ATOM   4278 N  NH2 . ARG B 1 283 ? 36.194 -83.844  219.572 1.00 104.56 ? 283  ARG B NH2 1 
ATOM   4279 N  N   . ALA B 1 284 ? 37.250 -84.793  213.234 1.00 83.24  ? 284  ALA B N   1 
ATOM   4280 C  CA  . ALA B 1 284 ? 36.587 -84.044  212.183 1.00 79.50  ? 284  ALA B CA  1 
ATOM   4281 C  C   . ALA B 1 284 ? 36.105 -82.718  212.726 1.00 74.60  ? 284  ALA B C   1 
ATOM   4282 O  O   . ALA B 1 284 ? 35.813 -82.593  213.907 1.00 72.57  ? 284  ALA B O   1 
ATOM   4283 C  CB  . ALA B 1 284 ? 35.420 -84.846  211.608 1.00 81.67  ? 284  ALA B CB  1 
ATOM   4284 N  N   . LEU B 1 285 ? 36.033 -81.722  211.857 1.00 71.66  ? 285  LEU B N   1 
ATOM   4285 C  CA  . LEU B 1 285 ? 35.374 -80.476  212.226 1.00 68.17  ? 285  LEU B CA  1 
ATOM   4286 C  C   . LEU B 1 285 ? 34.082 -80.331  211.442 1.00 67.86  ? 285  LEU B C   1 
ATOM   4287 O  O   . LEU B 1 285 ? 34.068 -80.379  210.223 1.00 69.02  ? 285  LEU B O   1 
ATOM   4288 C  CB  . LEU B 1 285 ? 36.285 -79.265  211.981 1.00 66.94  ? 285  LEU B CB  1 
ATOM   4289 C  CG  . LEU B 1 285 ? 35.619 -77.893  212.123 1.00 64.25  ? 285  LEU B CG  1 
ATOM   4290 C  CD1 . LEU B 1 285 ? 35.329 -77.614  213.589 1.00 61.94  ? 285  LEU B CD1 1 
ATOM   4291 C  CD2 . LEU B 1 285 ? 36.463 -76.775  211.493 1.00 65.09  ? 285  LEU B CD2 1 
ATOM   4292 N  N   . ASP B 1 286 ? 32.980 -80.147  212.127 1.00 72.61  ? 286  ASP B N   1 
ATOM   4293 C  CA  . ASP B 1 286 ? 31.737 -80.030  211.407 1.00 72.89  ? 286  ASP B CA  1 
ATOM   4294 C  C   . ASP B 1 286 ? 31.179 -78.634  211.573 1.00 69.41  ? 286  ASP B C   1 
ATOM   4295 O  O   . ASP B 1 286 ? 30.578 -78.311  212.588 1.00 68.56  ? 286  ASP B O   1 
ATOM   4296 C  CB  . ASP B 1 286 ? 30.762 -81.075  211.928 1.00 75.46  ? 286  ASP B CB  1 
ATOM   4297 C  CG  . ASP B 1 286 ? 29.428 -81.034  211.227 1.00 78.42  ? 286  ASP B CG  1 
ATOM   4298 O  OD1 . ASP B 1 286 ? 29.161 -80.111  210.417 1.00 76.58  ? 286  ASP B OD1 1 
ATOM   4299 O  OD2 . ASP B 1 286 ? 28.630 -81.947  211.517 1.00 83.16  ? 286  ASP B OD2 1 
ATOM   4300 N  N   . LEU B 1 287 ? 31.389 -77.790  210.580 1.00 67.76  ? 287  LEU B N   1 
ATOM   4301 C  CA  . LEU B 1 287 ? 30.912 -76.408  210.675 1.00 64.58  ? 287  LEU B CA  1 
ATOM   4302 C  C   . LEU B 1 287 ? 29.395 -76.244  210.576 1.00 64.72  ? 287  LEU B C   1 
ATOM   4303 O  O   . LEU B 1 287 ? 28.886 -75.159  210.798 1.00 63.20  ? 287  LEU B O   1 
ATOM   4304 C  CB  . LEU B 1 287 ? 31.622 -75.519  209.650 1.00 63.50  ? 287  LEU B CB  1 
ATOM   4305 C  CG  . LEU B 1 287 ? 33.080 -75.304  210.076 1.00 61.94  ? 287  LEU B CG  1 
ATOM   4306 C  CD1 . LEU B 1 287 ? 33.816 -74.423  209.122 1.00 59.72  ? 287  LEU B CD1 1 
ATOM   4307 C  CD2 . LEU B 1 287 ? 33.140 -74.719  211.471 1.00 59.53  ? 287  LEU B CD2 1 
ATOM   4308 N  N   . GLY B 1 288 ? 28.680 -77.308  210.239 1.00 66.73  ? 288  GLY B N   1 
ATOM   4309 C  CA  . GLY B 1 288 ? 27.226 -77.258  210.225 1.00 68.14  ? 288  GLY B CA  1 
ATOM   4310 C  C   . GLY B 1 288 ? 26.659 -77.039  211.617 1.00 67.90  ? 288  GLY B C   1 
ATOM   4311 O  O   . GLY B 1 288 ? 25.595 -76.471  211.771 1.00 68.51  ? 288  GLY B O   1 
ATOM   4312 N  N   . LYS B 1 289 ? 27.375 -77.486  212.643 1.00 67.16  ? 289  LYS B N   1 
ATOM   4313 C  CA  . LYS B 1 289 ? 26.947 -77.289  214.012 1.00 66.01  ? 289  LYS B CA  1 
ATOM   4314 C  C   . LYS B 1 289 ? 27.300 -75.901  214.551 1.00 62.36  ? 289  LYS B C   1 
ATOM   4315 O  O   . LYS B 1 289 ? 26.921 -75.541  215.662 1.00 61.21  ? 289  LYS B O   1 
ATOM   4316 C  CB  . LYS B 1 289 ? 27.598 -78.358  214.889 1.00 67.78  ? 289  LYS B CB  1 
ATOM   4317 C  CG  . LYS B 1 289 ? 27.213 -79.817  214.476 1.00 73.16  ? 289  LYS B CG  1 
ATOM   4318 C  CD  . LYS B 1 289 ? 27.138 -80.754  215.682 1.00 77.34  ? 289  LYS B CD  1 
ATOM   4319 C  CE  . LYS B 1 289 ? 27.396 -82.188  215.295 1.00 81.74  ? 289  LYS B CE  1 
ATOM   4320 N  NZ  . LYS B 1 289 ? 26.860 -82.366  213.920 1.00 88.32  ? 289  LYS B NZ  1 
ATOM   4321 N  N   . PHE B 1 290 ? 28.002 -75.119  213.737 1.00 59.93  ? 290  PHE B N   1 
ATOM   4322 C  CA  . PHE B 1 290 ? 28.680 -73.939  214.203 1.00 56.28  ? 290  PHE B CA  1 
ATOM   4323 C  C   . PHE B 1 290 ? 27.781 -72.886  214.858 1.00 55.72  ? 290  PHE B C   1 
ATOM   4324 O  O   . PHE B 1 290 ? 28.194 -72.277  215.843 1.00 54.26  ? 290  PHE B O   1 
ATOM   4325 C  CB  . PHE B 1 290 ? 29.456 -73.315  213.050 1.00 55.19  ? 290  PHE B CB  1 
ATOM   4326 C  CG  . PHE B 1 290 ? 30.350 -72.202  213.468 1.00 51.19  ? 290  PHE B CG  1 
ATOM   4327 C  CD1 . PHE B 1 290 ? 31.612 -72.465  213.996 1.00 50.43  ? 290  PHE B CD1 1 
ATOM   4328 C  CD2 . PHE B 1 290 ? 29.935 -70.890  213.363 1.00 49.41  ? 290  PHE B CD2 1 
ATOM   4329 C  CE1 . PHE B 1 290 ? 32.468 -71.421  214.396 1.00 46.69  ? 290  PHE B CE1 1 
ATOM   4330 C  CE2 . PHE B 1 290 ? 30.787 -69.841  213.753 1.00 47.36  ? 290  PHE B CE2 1 
ATOM   4331 C  CZ  . PHE B 1 290 ? 32.050 -70.123  214.274 1.00 44.62  ? 290  PHE B CZ  1 
ATOM   4332 N  N   . HIS B 1 291 ? 26.585 -72.645  214.312 1.00 55.79  ? 291  HIS B N   1 
ATOM   4333 C  CA  . HIS B 1 291 ? 25.679 -71.711  214.935 1.00 55.60  ? 291  HIS B CA  1 
ATOM   4334 C  C   . HIS B 1 291 ? 24.728 -72.343  215.961 1.00 58.38  ? 291  HIS B C   1 
ATOM   4335 O  O   . HIS B 1 291 ? 23.748 -71.696  216.408 1.00 58.49  ? 291  HIS B O   1 
ATOM   4336 C  CB  . HIS B 1 291 ? 24.873 -70.966  213.875 1.00 55.56  ? 291  HIS B CB  1 
ATOM   4337 C  CG  . HIS B 1 291 ? 25.724 -70.236  212.890 1.00 55.57  ? 291  HIS B CG  1 
ATOM   4338 N  ND1 . HIS B 1 291 ? 26.510 -69.145  213.241 1.00 51.92  ? 291  HIS B ND1 1 
ATOM   4339 C  CD2 . HIS B 1 291 ? 25.939 -70.455  211.572 1.00 52.20  ? 291  HIS B CD2 1 
ATOM   4340 C  CE1 . HIS B 1 291 ? 27.162 -68.728  212.172 1.00 52.01  ? 291  HIS B CE1 1 
ATOM   4341 N  NE2 . HIS B 1 291 ? 26.842 -69.509  211.152 1.00 53.17  ? 291  HIS B NE2 1 
ATOM   4342 N  N   . GLU B 1 292 ? 24.976 -73.597  216.334 1.00 60.12  ? 292  GLU B N   1 
ATOM   4343 C  CA  . GLU B 1 292 ? 24.065 -74.235  217.266 1.00 62.78  ? 292  GLU B CA  1 
ATOM   4344 C  C   . GLU B 1 292 ? 24.424 -73.994  218.714 1.00 61.88  ? 292  GLU B C   1 
ATOM   4345 O  O   . GLU B 1 292 ? 25.600 -74.062  219.116 1.00 61.04  ? 292  GLU B O   1 
ATOM   4346 C  CB  . GLU B 1 292 ? 23.955 -75.720  217.001 1.00 66.16  ? 292  GLU B CB  1 
ATOM   4347 C  CG  . GLU B 1 292 ? 22.883 -76.066  215.954 1.00 71.43  ? 292  GLU B CG  1 
ATOM   4348 C  CD  . GLU B 1 292 ? 22.995 -77.486  215.472 1.00 77.84  ? 292  GLU B CD  1 
ATOM   4349 O  OE1 . GLU B 1 292 ? 23.552 -78.327  216.218 1.00 79.77  ? 292  GLU B OE1 1 
ATOM   4350 O  OE2 . GLU B 1 292 ? 22.528 -77.759  214.342 1.00 84.05  ? 292  GLU B OE2 1 
ATOM   4351 N  N   . ILE B 1 293 ? 23.390 -73.702  219.490 1.00 62.27  ? 293  ILE B N   1 
ATOM   4352 C  CA  . ILE B 1 293 ? 23.515 -73.470  220.923 1.00 61.19  ? 293  ILE B CA  1 
ATOM   4353 C  C   . ILE B 1 293 ? 22.518 -74.314  221.759 1.00 63.58  ? 293  ILE B C   1 
ATOM   4354 O  O   . ILE B 1 293 ? 21.290 -74.333  221.524 1.00 63.63  ? 293  ILE B O   1 
ATOM   4355 C  CB  . ILE B 1 293 ? 23.333 -71.990  221.213 1.00 59.67  ? 293  ILE B CB  1 
ATOM   4356 C  CG1 . ILE B 1 293 ? 24.459 -71.205  220.515 1.00 58.36  ? 293  ILE B CG1 1 
ATOM   4357 C  CG2 . ILE B 1 293 ? 23.340 -71.762  222.697 1.00 59.19  ? 293  ILE B CG2 1 
ATOM   4358 C  CD1 . ILE B 1 293 ? 24.215 -69.750  220.396 1.00 56.45  ? 293  ILE B CD1 1 
ATOM   4359 N  N   . ALA B 1 294 ? 23.063 -75.035  222.724 1.00 64.40  ? 294  ALA B N   1 
ATOM   4360 C  CA  . ALA B 1 294 ? 22.235 -75.827  223.626 1.00 67.40  ? 294  ALA B CA  1 
ATOM   4361 C  C   . ALA B 1 294 ? 21.628 -74.911  224.677 1.00 67.38  ? 294  ALA B C   1 
ATOM   4362 O  O   . ALA B 1 294 ? 22.272 -74.028  225.186 1.00 65.23  ? 294  ALA B O   1 
ATOM   4363 C  CB  . ALA B 1 294 ? 23.041 -76.948  224.263 1.00 67.60  ? 294  ALA B CB  1 
ATOM   4364 N  N   . GLN B 1 295 ? 20.366 -75.130  224.986 1.00 70.93  ? 295  GLN B N   1 
ATOM   4365 C  CA  . GLN B 1 295 ? 19.673 -74.341  225.994 1.00 72.02  ? 295  GLN B CA  1 
ATOM   4366 C  C   . GLN B 1 295 ? 18.753 -75.237  226.829 1.00 76.25  ? 295  GLN B C   1 
ATOM   4367 O  O   . GLN B 1 295 ? 18.058 -76.099  226.285 1.00 78.77  ? 295  GLN B O   1 
ATOM   4368 C  CB  . GLN B 1 295 ? 18.847 -73.275  225.302 1.00 71.35  ? 295  GLN B CB  1 
ATOM   4369 C  CG  . GLN B 1 295 ? 19.351 -71.920  225.490 1.00 67.13  ? 295  GLN B CG  1 
ATOM   4370 C  CD  . GLN B 1 295 ? 18.404 -70.891  224.936 1.00 66.84  ? 295  GLN B CD  1 
ATOM   4371 O  OE1 . GLN B 1 295 ? 18.119 -70.867  223.727 1.00 67.46  ? 295  GLN B OE1 1 
ATOM   4372 N  NE2 . GLN B 1 295 ? 17.927 -70.008  225.803 1.00 64.84  ? 295  GLN B NE2 1 
ATOM   4373 N  N   . HIS B 1 296 ? 18.755 -75.028  228.137 1.00 77.90  ? 296  HIS B N   1 
ATOM   4374 C  CA  . HIS B 1 296 ? 17.917 -75.788  229.052 1.00 82.82  ? 296  HIS B CA  1 
ATOM   4375 C  C   . HIS B 1 296 ? 16.497 -75.245  228.988 1.00 86.03  ? 296  HIS B C   1 
ATOM   4376 O  O   . HIS B 1 296 ? 16.300 -74.063  228.830 1.00 84.37  ? 296  HIS B O   1 
ATOM   4377 C  CB  . HIS B 1 296 ? 18.480 -75.726  230.477 1.00 82.46  ? 296  HIS B CB  1 
ATOM   4378 C  CG  . HIS B 1 296 ? 17.635 -76.424  231.499 1.00 87.69  ? 296  HIS B CG  1 
ATOM   4379 N  ND1 . HIS B 1 296 ? 17.879 -77.720  231.918 1.00 90.26  ? 296  HIS B ND1 1 
ATOM   4380 C  CD2 . HIS B 1 296 ? 16.539 -76.012  232.179 1.00 90.24  ? 296  HIS B CD2 1 
ATOM   4381 C  CE1 . HIS B 1 296 ? 16.978 -78.068  232.819 1.00 91.91  ? 296  HIS B CE1 1 
ATOM   4382 N  NE2 . HIS B 1 296 ? 16.153 -77.053  232.994 1.00 92.73  ? 296  HIS B NE2 1 
ATOM   4383 N  N   . HIS B 1 297 ? 15.504 -76.126  229.074 1.00 92.01  ? 297  HIS B N   1 
ATOM   4384 C  CA  . HIS B 1 297 ? 14.095 -75.727  229.004 1.00 96.76  ? 297  HIS B CA  1 
ATOM   4385 C  C   . HIS B 1 297 ? 13.325 -76.196  230.254 1.00 102.44 ? 297  HIS B C   1 
ATOM   4386 O  O   . HIS B 1 297 ? 13.321 -77.389  230.563 1.00 104.57 ? 297  HIS B O   1 
ATOM   4387 C  CB  . HIS B 1 297 ? 13.436 -76.346  227.760 1.00 98.52  ? 297  HIS B CB  1 
ATOM   4388 C  CG  . HIS B 1 297 ? 13.960 -75.827  226.456 1.00 94.19  ? 297  HIS B CG  1 
ATOM   4389 N  ND1 . HIS B 1 297 ? 13.170 -75.134  225.564 1.00 93.45  ? 297  HIS B ND1 1 
ATOM   4390 C  CD2 . HIS B 1 297 ? 15.185 -75.913  225.885 1.00 90.75  ? 297  HIS B CD2 1 
ATOM   4391 C  CE1 . HIS B 1 297 ? 13.889 -74.802  224.505 1.00 90.48  ? 297  HIS B CE1 1 
ATOM   4392 N  NE2 . HIS B 1 297 ? 15.116 -75.262  224.675 1.00 89.21  ? 297  HIS B NE2 1 
ATOM   4393 N  N   . HIS B 1 298 ? 12.663 -75.274  230.963 1.00 106.09 ? 298  HIS B N   1 
ATOM   4394 C  CA  . HIS B 1 298 ? 11.937 -75.628  232.202 1.00 119.49 ? 298  HIS B CA  1 
ATOM   4395 C  C   . HIS B 1 298 ? 10.403 -75.674  232.076 1.00 127.25 ? 298  HIS B C   1 
ATOM   4396 O  O   . HIS B 1 298 ? 9.769  -74.724  231.615 1.00 117.39 ? 298  HIS B O   1 
ATOM   4397 C  CB  . HIS B 1 298 ? 12.354 -74.726  233.376 1.00 160.79 ? 298  HIS B CB  1 
ATOM   4398 C  CG  . HIS B 1 298 ? 12.952 -73.416  232.959 1.00 141.17 ? 298  HIS B CG  1 
ATOM   4399 N  ND1 . HIS B 1 298 ? 14.312 -73.172  232.999 1.00 135.62 ? 298  HIS B ND1 1 
ATOM   4400 C  CD2 . HIS B 1 298 ? 12.378 -72.275  232.499 1.00 128.78 ? 298  HIS B CD2 1 
ATOM   4401 C  CE1 . HIS B 1 298 ? 14.552 -71.941  232.576 1.00 116.69 ? 298  HIS B CE1 1 
ATOM   4402 N  NE2 . HIS B 1 298 ? 13.396 -71.375  232.268 1.00 112.20 ? 298  HIS B NE2 1 
ATOM   4403 N  N   . HIS B 1 299 ? 9.810  -76.787  232.505 1.00 121.61 ? 299  HIS B N   1 
ATOM   4404 C  CA  . HIS B 1 299 ? 8.353  -76.919  232.498 1.00 126.83 ? 299  HIS B CA  1 
ATOM   4405 C  C   . HIS B 1 299 ? 7.682  -75.577  232.809 1.00 127.45 ? 299  HIS B C   1 
ATOM   4406 O  O   . HIS B 1 299 ? 6.759  -75.154  232.103 1.00 129.57 ? 299  HIS B O   1 
ATOM   4407 C  CB  . HIS B 1 299 ? 7.893  -77.985  233.505 1.00 130.91 ? 299  HIS B CB  1 
HETATM 4408 K  K   . K   C 2 .   ? 52.785 -54.691  163.598 0.25 19.82  ? 1300 K   A K   1 
HETATM 4409 K  K   . K   D 2 .   ? 52.795 -54.698  159.819 0.25 33.06  ? 1301 K   A K   1 
HETATM 4410 CL CL  . CL  E 3 .   ? 69.634 -67.598  225.192 1.00 80.43  ? 1302 CL  A CL  1 
HETATM 4411 N  N1  A SPM F 4 .   ? 64.704 -56.695  218.109 0.52 42.08  ? 1303 SPM A N1  1 
HETATM 4412 N  N1  B SPM F 4 .   ? 65.626 -57.034  217.735 0.48 39.85  ? 1303 SPM A N1  1 
HETATM 4413 C  C2  A SPM F 4 .   ? 65.575 -56.462  219.247 0.52 42.12  ? 1303 SPM A C2  1 
HETATM 4414 C  C2  B SPM F 4 .   ? 65.354 -56.285  218.949 0.48 39.57  ? 1303 SPM A C2  1 
HETATM 4415 C  C3  A SPM F 4 .   ? 65.230 -57.401  220.393 0.52 42.11  ? 1303 SPM A C3  1 
HETATM 4416 C  C3  B SPM F 4 .   ? 65.141 -57.236  220.119 0.48 39.06  ? 1303 SPM A C3  1 
HETATM 4417 C  C4  A SPM F 4 .   ? 66.418 -58.287  220.757 0.52 42.72  ? 1303 SPM A C4  1 
HETATM 4418 C  C4  B SPM F 4 .   ? 66.377 -58.072  220.440 0.48 38.85  ? 1303 SPM A C4  1 
HETATM 4419 N  N5  A SPM F 4 .   ? 66.111 -59.223  221.839 0.52 43.50  ? 1303 SPM A N5  1 
HETATM 4420 N  N5  B SPM F 4 .   ? 66.189 -58.781  221.706 0.48 40.29  ? 1303 SPM A N5  1 
HETATM 4421 C  C6  A SPM F 4 .   ? 67.136 -60.057  222.451 0.52 40.76  ? 1303 SPM A C6  1 
HETATM 4422 C  C6  B SPM F 4 .   ? 67.096 -59.808  222.224 0.48 37.87  ? 1303 SPM A C6  1 
HETATM 4423 C  C7  A SPM F 4 .   ? 67.246 -59.786  223.945 0.52 40.60  ? 1303 SPM A C7  1 
HETATM 4424 C  C7  B SPM F 4 .   ? 67.115 -59.808  223.754 0.48 37.06  ? 1303 SPM A C7  1 
HETATM 4425 C  C8  A SPM F 4 .   ? 66.233 -60.593  224.746 0.52 41.45  ? 1303 SPM A C8  1 
HETATM 4426 C  C8  B SPM F 4 .   ? 66.180 -60.845  224.376 0.48 37.38  ? 1303 SPM A C8  1 
HETATM 4427 C  C9  A SPM F 4 .   ? 66.623 -60.668  226.226 0.52 42.42  ? 1303 SPM A C9  1 
HETATM 4428 C  C9  B SPM F 4 .   ? 65.600 -60.379  225.721 0.48 38.43  ? 1303 SPM A C9  1 
HETATM 4429 N  N10 A SPM F 4 .   ? 67.102 -59.406  226.766 0.52 41.46  ? 1303 SPM A N10 1 
HETATM 4430 N  N10 B SPM F 4 .   ? 66.229 -60.971  226.897 0.48 38.08  ? 1303 SPM A N10 1 
HETATM 4431 C  C11 A SPM F 4 .   ? 66.866 -59.157  228.168 0.52 41.69  ? 1303 SPM A C11 1 
HETATM 4432 C  C11 B SPM F 4 .   ? 66.811 -60.110  227.911 0.48 37.89  ? 1303 SPM A C11 1 
HETATM 4433 C  C12 A SPM F 4 .   ? 66.985 -60.459  228.971 0.52 42.65  ? 1303 SPM A C12 1 
HETATM 4434 C  C12 B SPM F 4 .   ? 67.543 -60.869  229.024 0.48 38.12  ? 1303 SPM A C12 1 
HETATM 4435 C  C13 A SPM F 4 .   ? 65.748 -60.699  229.847 0.52 42.41  ? 1303 SPM A C13 1 
HETATM 4436 C  C13 B SPM F 4 .   ? 66.722 -60.935  230.318 0.48 38.83  ? 1303 SPM A C13 1 
HETATM 4437 N  N14 A SPM F 4 .   ? 65.610 -59.620  230.815 0.52 40.97  ? 1303 SPM A N14 1 
HETATM 4438 N  N14 B SPM F 4 .   ? 66.270 -59.621  230.761 0.48 38.24  ? 1303 SPM A N14 1 
HETATM 4439 CL CL  . CL  G 3 .   ? 63.099 -61.831  224.617 1.00 56.59  ? 1304 CL  A CL  1 
HETATM 4440 CA CA  . CA  H 5 .   ? 52.794 -54.693  168.938 0.50 38.72  ? 1305 CA  A CA  1 
HETATM 4441 CL CL  . CL  I 3 .   ? 65.539 -72.400  201.371 1.00 104.70 ? 1306 CL  A CL  1 
HETATM 4442 O  O   . HOH J 6 .   ? 51.788 -83.060  216.609 1.00 85.04  ? 2001 HOH A O   1 
HETATM 4443 O  O   . HOH J 6 .   ? 53.565 -85.089  210.376 1.00 69.62  ? 2002 HOH A O   1 
HETATM 4444 O  O   . HOH J 6 .   ? 55.448 -75.779  207.439 1.00 83.15  ? 2003 HOH A O   1 
HETATM 4445 O  O   . HOH J 6 .   ? 53.527 -82.489  208.245 1.00 68.25  ? 2004 HOH A O   1 
HETATM 4446 O  O   . HOH J 6 .   ? 47.026 -84.041  207.374 1.00 95.74  ? 2005 HOH A O   1 
HETATM 4447 O  O   . HOH J 6 .   ? 42.772 -84.556  207.698 1.00 86.46  ? 2006 HOH A O   1 
HETATM 4448 O  O   . HOH J 6 .   ? 40.753 -86.567  210.063 1.00 89.49  ? 2007 HOH A O   1 
HETATM 4449 O  O   . HOH J 6 .   ? 43.666 -82.414  206.148 1.00 88.12  ? 2008 HOH A O   1 
HETATM 4450 O  O   . HOH J 6 .   ? 45.531 -63.791  146.078 1.00 138.16 ? 2009 HOH A O   1 
HETATM 4451 O  O   . HOH J 6 .   ? 44.842 -57.268  151.717 1.00 127.83 ? 2010 HOH A O   1 
HETATM 4452 O  O   . HOH J 6 .   ? 45.659 -64.724  149.357 1.00 128.79 ? 2011 HOH A O   1 
HETATM 4453 O  O   . HOH J 6 .   ? 30.386 -76.387  229.925 1.00 88.31  ? 2012 HOH A O   1 
HETATM 4454 O  O   . HOH J 6 .   ? 38.134 -79.985  221.611 1.00 102.62 ? 2013 HOH A O   1 
HETATM 4455 O  O   . HOH J 6 .   ? 52.493 -66.752  163.248 1.00 86.71  ? 2014 HOH A O   1 
HETATM 4456 O  O   . HOH J 6 .   ? 49.258 -60.373  160.598 1.00 87.37  ? 2015 HOH A O   1 
HETATM 4457 O  O   . HOH J 6 .   ? 66.443 -68.292  205.214 1.00 61.79  ? 2016 HOH A O   1 
HETATM 4458 O  O   . HOH J 6 .   ? 58.433 -70.540  204.941 1.00 80.90  ? 2017 HOH A O   1 
HETATM 4459 O  O   . HOH J 6 .   ? 61.128 -72.288  205.639 1.00 57.60  ? 2018 HOH A O   1 
HETATM 4460 O  O   . HOH J 6 .   ? 62.223 -77.985  209.364 1.00 53.62  ? 2019 HOH A O   1 
HETATM 4461 O  O   . HOH J 6 .   ? 62.676 -81.125  211.319 1.00 54.14  ? 2020 HOH A O   1 
HETATM 4462 O  O   . HOH J 6 .   ? 59.753 -82.861  214.377 1.00 51.93  ? 2021 HOH A O   1 
HETATM 4463 O  O   . HOH J 6 .   ? 66.266 -83.813  216.522 1.00 53.43  ? 2022 HOH A O   1 
HETATM 4464 O  O   . HOH J 6 .   ? 71.214 -78.381  227.732 1.00 89.70  ? 2023 HOH A O   1 
HETATM 4465 O  O   . HOH J 6 .   ? 66.408 -81.418  233.139 1.00 85.14  ? 2024 HOH A O   1 
HETATM 4466 O  O   . HOH J 6 .   ? 67.865 -79.704  237.324 1.00 116.75 ? 2025 HOH A O   1 
HETATM 4467 O  O   . HOH J 6 .   ? 66.596 -77.759  239.641 1.00 101.81 ? 2026 HOH A O   1 
HETATM 4468 O  O   . HOH J 6 .   ? 66.144 -72.880  232.588 1.00 65.19  ? 2027 HOH A O   1 
HETATM 4469 O  O   . HOH J 6 .   ? 73.081 -66.108  207.521 1.00 81.79  ? 2028 HOH A O   1 
HETATM 4470 O  O   . HOH J 6 .   ? 72.179 -60.519  205.607 1.00 74.81  ? 2029 HOH A O   1 
HETATM 4471 O  O   . HOH J 6 .   ? 66.449 -53.342  212.232 1.00 77.98  ? 2030 HOH A O   1 
HETATM 4472 O  O   . HOH J 6 .   ? 57.642 -66.056  223.066 1.00 58.13  ? 2031 HOH A O   1 
HETATM 4473 O  O   . HOH J 6 .   ? 55.184 -64.314  222.710 1.00 72.72  ? 2032 HOH A O   1 
HETATM 4474 O  O   . HOH J 6 .   ? 42.374 -81.050  232.900 1.00 73.76  ? 2033 HOH A O   1 
HETATM 4475 O  O   . HOH J 6 .   ? 33.156 -75.469  231.056 1.00 77.35  ? 2034 HOH A O   1 
HETATM 4476 O  O   . HOH J 6 .   ? 38.872 -73.249  237.793 1.00 78.91  ? 2035 HOH A O   1 
HETATM 4477 O  O   . HOH J 6 .   ? 29.753 -79.758  230.911 1.00 102.91 ? 2036 HOH A O   1 
HETATM 4478 O  O   . HOH J 6 .   ? 38.157 -77.085  222.142 1.00 89.92  ? 2037 HOH A O   1 
HETATM 4479 O  O   . HOH J 6 .   ? 47.245 -79.786  219.001 1.00 83.42  ? 2038 HOH A O   1 
HETATM 4480 O  O   . HOH J 6 .   ? 45.379 -69.419  227.293 1.00 79.51  ? 2039 HOH A O   1 
HETATM 4481 O  O   . HOH J 6 .   ? 48.269 -68.741  227.860 1.00 62.58  ? 2040 HOH A O   1 
HETATM 4482 O  O   . HOH J 6 .   ? 56.401 -68.628  223.664 1.00 48.17  ? 2041 HOH A O   1 
HETATM 4483 O  O   . HOH J 6 .   ? 57.232 -67.107  233.770 1.00 87.79  ? 2042 HOH A O   1 
HETATM 4484 O  O   . HOH J 6 .   ? 55.032 -70.407  230.883 1.00 46.78  ? 2043 HOH A O   1 
HETATM 4485 O  O   . HOH J 6 .   ? 58.318 -66.062  225.937 1.00 62.95  ? 2044 HOH A O   1 
HETATM 4486 O  O   . HOH J 6 .   ? 65.050 -68.850  224.234 1.00 49.23  ? 2045 HOH A O   1 
HETATM 4487 O  O   . HOH J 6 .   ? 60.888 -56.661  220.227 1.00 83.39  ? 2046 HOH A O   1 
HETATM 4488 O  O   . HOH J 6 .   ? 69.660 -65.908  218.084 1.00 66.69  ? 2047 HOH A O   1 
HETATM 4489 O  O   . HOH J 6 .   ? 71.587 -62.164  216.868 1.00 86.50  ? 2048 HOH A O   1 
HETATM 4490 O  O   . HOH J 6 .   ? 73.682 -63.194  213.865 1.00 102.59 ? 2049 HOH A O   1 
HETATM 4491 O  O   . HOH J 6 .   ? 72.227 -66.711  214.623 1.00 81.26  ? 2050 HOH A O   1 
HETATM 4492 O  O   . HOH J 6 .   ? 71.854 -74.155  218.335 1.00 60.77  ? 2051 HOH A O   1 
HETATM 4493 O  O   . HOH J 6 .   ? 71.147 -70.098  220.632 1.00 61.69  ? 2052 HOH A O   1 
HETATM 4494 O  O   . HOH J 6 .   ? 67.264 -68.728  223.140 1.00 52.08  ? 2053 HOH A O   1 
HETATM 4495 O  O   . HOH J 6 .   ? 59.192 -70.344  231.764 1.00 61.23  ? 2054 HOH A O   1 
HETATM 4496 O  O   . HOH J 6 .   ? 57.446 -70.281  233.454 1.00 62.60  ? 2055 HOH A O   1 
HETATM 4497 O  O   . HOH J 6 .   ? 51.226 -78.560  235.343 1.00 105.19 ? 2056 HOH A O   1 
HETATM 4498 O  O   . HOH J 6 .   ? 58.783 -80.383  236.614 1.00 70.25  ? 2057 HOH A O   1 
HETATM 4499 O  O   . HOH J 6 .   ? 49.507 -82.543  231.064 1.00 75.59  ? 2058 HOH A O   1 
HETATM 4500 O  O   . HOH J 6 .   ? 53.813 -89.948  235.856 1.00 73.34  ? 2059 HOH A O   1 
HETATM 4501 O  O   . HOH J 6 .   ? 58.923 -88.205  232.077 1.00 80.15  ? 2060 HOH A O   1 
HETATM 4502 O  O   . HOH J 6 .   ? 56.652 -90.875  232.217 1.00 81.67  ? 2061 HOH A O   1 
HETATM 4503 O  O   . HOH J 6 .   ? 49.777 -88.173  222.876 1.00 76.22  ? 2062 HOH A O   1 
HETATM 4504 O  O   . HOH J 6 .   ? 49.826 -86.260  219.721 1.00 95.28  ? 2063 HOH A O   1 
HETATM 4505 O  O   . HOH J 6 .   ? 51.135 -85.869  221.593 0.86 60.01  ? 2064 HOH A O   1 
HETATM 4506 O  O   . HOH J 6 .   ? 58.029 -60.460  213.397 1.00 86.92  ? 2065 HOH A O   1 
HETATM 4507 O  O   . HOH J 6 .   ? 65.136 -54.989  204.204 1.00 72.75  ? 2066 HOH A O   1 
HETATM 4508 O  O   . HOH J 6 .   ? 66.935 -56.481  202.655 1.00 88.24  ? 2067 HOH A O   1 
HETATM 4509 O  O   . HOH J 6 .   ? 56.707 -58.168  204.033 1.00 64.77  ? 2068 HOH A O   1 
HETATM 4510 O  O   . HOH J 6 .   ? 57.582 -67.083  204.783 1.00 46.33  ? 2069 HOH A O   1 
HETATM 4511 O  O   . HOH J 6 .   ? 54.300 -63.344  204.370 0.62 79.38  ? 2070 HOH A O   1 
HETATM 4512 O  O   . HOH J 6 .   ? 54.840 -62.582  209.035 1.00 86.49  ? 2071 HOH A O   1 
HETATM 4513 O  O   . HOH J 6 .   ? 57.139 -73.645  207.787 1.00 46.38  ? 2072 HOH A O   1 
HETATM 4514 O  O   . HOH J 6 .   ? 58.038 -77.609  209.936 1.00 60.58  ? 2073 HOH A O   1 
HETATM 4515 O  O   . HOH J 6 .   ? 58.971 -81.227  209.035 1.00 76.61  ? 2074 HOH A O   1 
HETATM 4516 O  O   . HOH J 6 .   ? 51.988 -88.849  217.792 1.00 76.26  ? 2075 HOH A O   1 
HETATM 4517 O  O   . HOH J 6 .   ? 56.986 -83.470  214.634 1.00 59.90  ? 2076 HOH A O   1 
HETATM 4518 O  O   . HOH J 6 .   ? 57.123 -86.770  226.517 1.00 55.72  ? 2077 HOH A O   1 
HETATM 4519 O  O   . HOH J 6 .   ? 62.824 -89.336  226.508 1.00 71.17  ? 2078 HOH A O   1 
HETATM 4520 O  O   . HOH J 6 .   ? 77.133 -82.320  224.120 0.97 71.62  ? 2079 HOH A O   1 
HETATM 4521 O  O   . HOH J 6 .   ? 69.619 -83.266  232.421 1.00 60.00  ? 2080 HOH A O   1 
HETATM 4522 O  O   . HOH J 6 .   ? 70.120 -78.960  225.154 1.00 51.44  ? 2081 HOH A O   1 
HETATM 4523 O  O   . HOH J 6 .   ? 77.982 -82.143  221.865 0.75 65.62  ? 2082 HOH A O   1 
HETATM 4524 O  O   . HOH J 6 .   ? 75.433 -75.603  218.810 1.00 102.87 ? 2083 HOH A O   1 
HETATM 4525 O  O   . HOH J 6 .   ? 67.022 -81.586  207.875 1.00 67.55  ? 2084 HOH A O   1 
HETATM 4526 O  O   . HOH J 6 .   ? 69.934 -89.227  221.202 1.00 71.02  ? 2085 HOH A O   1 
HETATM 4527 O  O   . HOH J 6 .   ? 65.966 -92.035  222.415 1.00 94.59  ? 2086 HOH A O   1 
HETATM 4528 O  O   . HOH J 6 .   ? 68.299 -94.012  226.662 1.00 49.69  ? 2087 HOH A O   1 
HETATM 4529 O  O   . HOH J 6 .   ? 77.574 -90.032  231.360 1.00 74.77  ? 2088 HOH A O   1 
HETATM 4530 O  O   . HOH J 6 .   ? 72.016 -91.537  222.514 1.00 68.30  ? 2089 HOH A O   1 
HETATM 4531 O  O   . HOH J 6 .   ? 70.144 -95.527  229.738 1.00 96.67  ? 2090 HOH A O   1 
HETATM 4532 O  O   . HOH J 6 .   ? 65.285 -57.391  231.138 1.00 52.71  ? 2091 HOH A O   1 
HETATM 4533 O  O   . HOH J 6 .   ? 67.576 -63.022  227.931 0.50 41.87  ? 2092 HOH A O   1 
HETATM 4534 O  O   . HOH J 6 .   ? 66.845 -59.386  232.998 1.00 73.95  ? 2093 HOH A O   1 
HETATM 4535 O  O   . HOH J 6 .   ? 68.237 -58.278  231.074 1.00 66.68  ? 2094 HOH A O   1 
HETATM 4536 O  O   . HOH K 6 .   ? 43.648 -55.134  157.947 1.00 90.80  ? 2001 HOH B O   1 
HETATM 4537 O  O   . HOH K 6 .   ? 27.861 -61.573  236.534 0.76 52.36  ? 2002 HOH B O   1 
HETATM 4538 O  O   . HOH K 6 .   ? 45.471 -53.015  158.467 1.00 87.68  ? 2003 HOH B O   1 
HETATM 4539 O  O   . HOH K 6 .   ? 47.815 -51.008  160.600 1.00 84.23  ? 2004 HOH B O   1 
HETATM 4540 O  O   . HOH K 6 .   ? 31.084 -56.695  208.036 1.00 87.97  ? 2005 HOH B O   1 
HETATM 4541 O  O   . HOH K 6 .   ? 39.868 -67.751  205.300 1.00 66.09  ? 2006 HOH B O   1 
HETATM 4542 O  O   . HOH K 6 .   ? 37.300 -60.031  204.824 1.00 83.08  ? 2007 HOH B O   1 
HETATM 4543 O  O   . HOH K 6 .   ? 35.740 -62.963  205.584 1.00 65.38  ? 2008 HOH B O   1 
HETATM 4544 O  O   . HOH K 6 .   ? 34.464 -62.651  207.703 1.00 85.82  ? 2009 HOH B O   1 
HETATM 4545 O  O   . HOH K 6 .   ? 31.856 -65.150  206.329 1.00 85.50  ? 2010 HOH B O   1 
HETATM 4546 O  O   . HOH K 6 .   ? 30.143 -64.718  209.452 1.00 46.65  ? 2011 HOH B O   1 
HETATM 4547 O  O   . HOH K 6 .   ? 24.949 -68.850  216.633 1.00 58.94  ? 2012 HOH B O   1 
HETATM 4548 O  O   . HOH K 6 .   ? 26.342 -68.176  233.908 1.00 64.41  ? 2013 HOH B O   1 
HETATM 4549 O  O   . HOH K 6 .   ? 30.113 -72.565  229.178 1.00 69.66  ? 2014 HOH B O   1 
HETATM 4550 O  O   . HOH K 6 .   ? 25.512 -71.661  232.705 1.00 65.95  ? 2015 HOH B O   1 
HETATM 4551 O  O   . HOH K 6 .   ? 28.444 -74.414  231.752 1.00 92.66  ? 2016 HOH B O   1 
HETATM 4552 O  O   . HOH K 6 .   ? 35.518 -68.001  232.985 1.00 63.72  ? 2017 HOH B O   1 
HETATM 4553 O  O   . HOH K 6 .   ? 38.188 -76.601  236.332 1.00 101.01 ? 2018 HOH B O   1 
HETATM 4554 O  O   . HOH K 6 .   ? 41.434 -76.869  233.933 1.00 118.85 ? 2019 HOH B O   1 
HETATM 4555 O  O   . HOH K 6 .   ? 37.887 -69.111  236.001 1.00 91.50  ? 2020 HOH B O   1 
HETATM 4556 O  O   . HOH K 6 .   ? 40.683 -73.219  201.543 1.00 78.42  ? 2021 HOH B O   1 
HETATM 4557 O  O   . HOH K 6 .   ? 43.749 -74.637  208.410 1.00 86.10  ? 2022 HOH B O   1 
HETATM 4558 O  O   . HOH K 6 .   ? 48.051 -59.490  212.470 1.00 87.76  ? 2023 HOH B O   1 
HETATM 4559 O  O   . HOH K 6 .   ? 45.607 -58.194  220.831 1.00 93.86  ? 2024 HOH B O   1 
HETATM 4560 O  O   . HOH K 6 .   ? 41.583 -58.892  223.595 1.00 54.26  ? 2025 HOH B O   1 
HETATM 4561 O  O   . HOH K 6 .   ? 41.859 -57.287  216.770 1.00 54.51  ? 2026 HOH B O   1 
HETATM 4562 O  O   . HOH K 6 .   ? 46.214 -55.504  222.361 1.00 91.55  ? 2027 HOH B O   1 
HETATM 4563 O  O   . HOH K 6 .   ? 43.130 -56.793  223.301 1.00 92.89  ? 2028 HOH B O   1 
HETATM 4564 O  O   . HOH K 6 .   ? 22.390 -34.450  232.309 1.00 116.06 ? 2029 HOH B O   1 
HETATM 4565 O  O   . HOH K 6 .   ? 26.368 -41.689  223.898 1.00 106.50 ? 2030 HOH B O   1 
HETATM 4566 O  O   . HOH K 6 .   ? 37.660 -42.083  232.277 1.00 98.53  ? 2031 HOH B O   1 
HETATM 4567 O  O   . HOH K 6 .   ? 37.988 -45.818  231.649 1.00 73.73  ? 2032 HOH B O   1 
HETATM 4568 O  O   . HOH K 6 .   ? 36.898 -46.305  226.811 0.50 44.82  ? 2033 HOH B O   1 
HETATM 4569 O  O   . HOH K 6 .   ? 35.297 -44.869  225.298 1.00 69.65  ? 2034 HOH B O   1 
HETATM 4570 O  O   . HOH K 6 .   ? 37.240 -53.698  229.778 1.00 54.36  ? 2035 HOH B O   1 
HETATM 4571 O  O   . HOH K 6 .   ? 39.067 -57.776  223.708 1.00 35.47  ? 2036 HOH B O   1 
HETATM 4572 O  O   . HOH K 6 .   ? 37.426 -56.811  231.038 1.00 41.45  ? 2037 HOH B O   1 
HETATM 4573 O  O   . HOH K 6 .   ? 42.124 -59.509  226.655 1.00 49.91  ? 2038 HOH B O   1 
HETATM 4574 O  O   . HOH K 6 .   ? 44.562 -65.291  230.118 1.00 84.84  ? 2039 HOH B O   1 
HETATM 4575 O  O   . HOH K 6 .   ? 39.241 -66.003  224.332 1.00 50.23  ? 2040 HOH B O   1 
HETATM 4576 O  O   . HOH K 6 .   ? 46.342 -64.323  224.275 1.00 46.52  ? 2041 HOH B O   1 
HETATM 4577 O  O   . HOH K 6 .   ? 43.073 -70.206  217.229 1.00 56.32  ? 2042 HOH B O   1 
HETATM 4578 O  O   . HOH K 6 .   ? 42.882 -73.300  215.303 1.00 50.71  ? 2043 HOH B O   1 
HETATM 4579 O  O   . HOH K 6 .   ? 34.686 -73.698  218.552 1.00 68.15  ? 2044 HOH B O   1 
HETATM 4580 O  O   . HOH K 6 .   ? 38.849 -72.285  220.946 1.00 75.41  ? 2045 HOH B O   1 
HETATM 4581 O  O   . HOH K 6 .   ? 39.737 -68.673  223.379 1.00 50.79  ? 2046 HOH B O   1 
HETATM 4582 O  O   . HOH K 6 .   ? 37.890 -60.794  232.494 0.73 49.44  ? 2047 HOH B O   1 
HETATM 4583 O  O   . HOH K 6 .   ? 29.612 -62.970  236.581 0.62 47.20  ? 2048 HOH B O   1 
HETATM 4584 O  O   . HOH K 6 .   ? 37.519 -58.795  233.695 0.81 53.73  ? 2049 HOH B O   1 
HETATM 4585 O  O   . HOH K 6 .   ? 39.685 -62.618  233.301 1.00 66.35  ? 2050 HOH B O   1 
HETATM 4586 O  O   . HOH K 6 .   ? 32.689 -53.931  237.130 1.00 80.29  ? 2051 HOH B O   1 
HETATM 4587 O  O   . HOH K 6 .   ? 25.185 -51.760  231.135 1.00 91.19  ? 2052 HOH B O   1 
HETATM 4588 O  O   . HOH K 6 .   ? 17.418 -56.267  235.367 1.00 93.66  ? 2053 HOH B O   1 
HETATM 4589 O  O   . HOH K 6 .   ? 18.197 -61.773  224.573 1.00 111.89 ? 2054 HOH B O   1 
HETATM 4590 O  O   . HOH K 6 .   ? 19.694 -61.275  231.827 1.00 88.97  ? 2055 HOH B O   1 
HETATM 4591 O  O   . HOH K 6 .   ? 21.049 -59.776  226.506 1.00 62.84  ? 2056 HOH B O   1 
HETATM 4592 O  O   . HOH K 6 .   ? 22.183 -53.937  221.274 1.00 109.02 ? 2057 HOH B O   1 
HETATM 4593 O  O   . HOH K 6 .   ? 25.064 -48.997  215.450 1.00 100.27 ? 2058 HOH B O   1 
HETATM 4594 O  O   . HOH K 6 .   ? 52.058 -66.332  203.554 1.00 82.71  ? 2059 HOH B O   1 
HETATM 4595 O  O   . HOH K 6 .   ? 40.672 -58.646  205.100 1.00 61.98  ? 2060 HOH B O   1 
HETATM 4596 O  O   . HOH K 6 .   ? 34.184 -58.231  208.337 1.00 53.52  ? 2061 HOH B O   1 
HETATM 4597 O  O   . HOH K 6 .   ? 30.137 -54.377  211.947 1.00 73.84  ? 2062 HOH B O   1 
HETATM 4598 O  O   . HOH K 6 .   ? 24.815 -62.006  214.273 1.00 64.89  ? 2063 HOH B O   1 
HETATM 4599 O  O   . HOH K 6 .   ? 30.516 -60.198  210.229 1.00 69.89  ? 2064 HOH B O   1 
HETATM 4600 O  O   . HOH K 6 .   ? 27.718 -57.123  211.507 1.00 81.98  ? 2065 HOH B O   1 
HETATM 4601 O  O   . HOH K 6 .   ? 24.268 -58.746  215.010 1.00 70.98  ? 2066 HOH B O   1 
HETATM 4602 O  O   . HOH K 6 .   ? 18.860 -65.261  226.383 1.00 67.36  ? 2067 HOH B O   1 
HETATM 4603 O  O   . HOH K 6 .   ? 19.657 -67.049  232.426 1.00 97.63  ? 2068 HOH B O   1 
HETATM 4604 O  O   . HOH K 6 .   ? 22.843 -66.811  233.247 1.00 63.75  ? 2069 HOH B O   1 
HETATM 4605 O  O   . HOH K 6 .   ? 29.299 -72.129  225.054 1.00 54.36  ? 2070 HOH B O   1 
HETATM 4606 O  O   . HOH K 6 .   ? 33.497 -77.243  219.522 1.00 63.66  ? 2071 HOH B O   1 
HETATM 4607 O  O   . HOH K 6 .   ? 25.896 -73.729  208.925 1.00 64.05  ? 2072 HOH B O   1 
HETATM 4608 O  O   . HOH K 6 .   ? 27.082 -69.452  208.183 1.00 72.88  ? 2073 HOH B O   1 
HETATM 4609 O  O   . HOH K 6 .   ? 19.235 -70.139  227.745 1.00 87.16  ? 2074 HOH B O   1 
HETATM 4610 O  O   . HOH K 6 .   ? 16.619 -68.309  222.038 1.00 70.84  ? 2075 HOH B O   1 
HETATM 4611 O  O   . HOH K 6 .   ? 16.256 -67.499  225.288 1.00 109.52 ? 2076 HOH B O   1 
HETATM 4612 O  O   . HOH K 6 .   ? 13.971 -70.674  225.625 1.00 61.55  ? 2077 HOH B O   1 
HETATM 4613 O  O   . HOH K 6 .   ? 20.671 -73.486  229.243 1.00 82.34  ? 2078 HOH B O   1 
HETATM 4614 O  O   . HOH K 6 .   ? 10.412 -73.270  225.078 1.00 132.36 ? 2079 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 12  ? 1.4513 1.2220 1.3487 -0.0865 -0.0478 0.0583  12   PRO A N   
2    C CA  . PRO A 12  ? 1.4783 1.2265 1.3526 -0.0909 -0.0496 0.0584  12   PRO A CA  
3    C C   . PRO A 12  ? 1.3853 1.1574 1.2862 -0.0833 -0.0503 0.0584  12   PRO A C   
4    O O   . PRO A 12  ? 1.4239 1.1816 1.3095 -0.0878 -0.0494 0.0581  12   PRO A O   
5    C CB  . PRO A 12  ? 1.5671 1.2801 1.4109 -0.0849 -0.0678 0.0609  12   PRO A CB  
6    C CG  . PRO A 12  ? 1.6341 1.3376 1.4674 -0.0872 -0.0687 0.0612  12   PRO A CG  
7    C CD  . PRO A 12  ? 1.5421 1.2884 1.4170 -0.0841 -0.0586 0.0601  12   PRO A CD  
8    N N   . ARG A 13  ? 1.2845 1.0906 1.2224 -0.0728 -0.0515 0.0588  13   ARG A N   
9    C CA  . ARG A 13  ? 1.2032 1.0302 1.1647 -0.0655 -0.0530 0.0589  13   ARG A CA  
10   C C   . ARG A 13  ? 1.1358 0.9890 1.1207 -0.0703 -0.0393 0.0566  13   ARG A C   
11   O O   . ARG A 13  ? 1.1071 0.9812 1.1125 -0.0700 -0.0335 0.0554  13   ARG A O   
12   C CB  . ARG A 13  ? 1.1639 1.0105 1.1501 -0.0520 -0.0627 0.0596  13   ARG A CB  
13   C CG  . ARG A 13  ? 1.1665 1.0005 1.1459 -0.0430 -0.0774 0.0593  13   ARG A CG  
14   C CD  . ARG A 13  ? 1.0941 0.9568 1.1061 -0.0326 -0.0810 0.0578  13   ARG A CD  
15   N NE  . ARG A 13  ? 1.1056 0.9591 1.1156 -0.0227 -0.0964 0.0548  13   ARG A NE  
16   C CZ  . ARG A 13  ? 1.0691 0.9227 1.0835 -0.0171 -0.1033 0.0524  13   ARG A CZ  
17   N NH1 . ARG A 13  ? 0.9887 0.8501 1.0079 -0.0208 -0.0956 0.0538  13   ARG A NH1 
18   N NH2 . ARG A 13  ? 1.0703 0.9167 1.0857 -0.0076 -0.1183 0.0474  13   ARG A NH2 
19   N N   . ILE A 14  ? 1.1129 0.9649 1.0958 -0.0739 -0.0352 0.0555  14   ILE A N   
20   C CA  . ILE A 14  ? 1.0587 0.9357 1.0656 -0.0773 -0.0238 0.0521  14   ILE A CA  
21   C C   . ILE A 14  ? 0.9804 0.8850 1.0185 -0.0661 -0.0280 0.0537  14   ILE A C   
22   O O   . ILE A 14  ? 0.9511 0.8780 1.0123 -0.0649 -0.0230 0.0518  14   ILE A O   
23   C CB  . ILE A 14  ? 1.1101 0.9757 1.1028 -0.0876 -0.0156 0.0488  14   ILE A CB  
24   C CG1 . ILE A 14  ? 1.1963 1.0345 1.1570 -0.1017 -0.0086 0.0459  14   ILE A CG1 
25   C CG2 . ILE A 14  ? 1.0761 0.9694 1.0974 -0.0892 -0.0059 0.0439  14   ILE A CG2 
26   C CD1 . ILE A 14  ? 1.2827 1.1003 1.2194 -0.1135 -0.0017 0.0429  14   ILE A CD1 
27   N N   . LEU A 15  ? 0.9486 0.8499 0.9860 -0.0582 -0.0376 0.0563  15   LEU A N   
28   C CA  . LEU A 15  ? 0.8783 0.8015 0.9406 -0.0486 -0.0420 0.0574  15   LEU A CA  
29   C C   . LEU A 15  ? 0.8623 0.7825 0.9242 -0.0411 -0.0519 0.0584  15   LEU A C   
30   O O   . LEU A 15  ? 0.8932 0.7918 0.9352 -0.0400 -0.0599 0.0586  15   LEU A O   
31   C CB  . LEU A 15  ? 0.8832 0.8077 0.9483 -0.0456 -0.0446 0.0576  15   LEU A CB  
32   C CG  . LEU A 15  ? 0.9043 0.8329 0.9715 -0.0526 -0.0350 0.0556  15   LEU A CG  
33   C CD1 . LEU A 15  ? 0.9305 0.8458 0.9847 -0.0533 -0.0378 0.0560  15   LEU A CD1 
34   C CD2 . LEU A 15  ? 0.8527 0.8073 0.9471 -0.0505 -0.0300 0.0543  15   LEU A CD2 
35   N N   . ASN A 16  ? 0.8159 0.7560 0.8988 -0.0363 -0.0519 0.0584  16   ASN A N   
36   C CA  . ASN A 16  ? 0.8065 0.7479 0.8938 -0.0289 -0.0608 0.0577  16   ASN A CA  
37   C C   . ASN A 16  ? 0.7815 0.7285 0.8778 -0.0227 -0.0668 0.0556  16   ASN A C   
38   O O   . ASN A 16  ? 0.7595 0.7143 0.8629 -0.0236 -0.0629 0.0560  16   ASN A O   
39   C CB  . ASN A 16  ? 0.8086 0.7697 0.9150 -0.0271 -0.0577 0.0576  16   ASN A CB  
40   C CG  . ASN A 16  ? 0.8216 0.7835 0.9260 -0.0328 -0.0506 0.0588  16   ASN A CG  
41   O OD1 . ASN A 16  ? 0.8854 0.8338 0.9754 -0.0353 -0.0517 0.0590  16   ASN A OD1 
42   N ND2 . ASN A 16  ? 0.7695 0.7464 0.8879 -0.0346 -0.0441 0.0587  16   ASN A ND2 
43   N N   . SER A 17  ? 0.7852 0.7288 0.8826 -0.0162 -0.0765 0.0524  17   SER A N   
44   C CA  . SER A 17  ? 0.7802 0.7291 0.8874 -0.0101 -0.0829 0.0480  17   SER A CA  
45   C C   . SER A 17  ? 0.7630 0.7333 0.8902 -0.0103 -0.0764 0.0472  17   SER A C   
46   O O   . SER A 17  ? 0.7543 0.7269 0.8860 -0.0078 -0.0789 0.0447  17   SER A O   
47   C CB  . SER A 17  ? 0.7959 0.7457 0.9096 -0.0033 -0.0925 0.0422  17   SER A CB  
48   O OG  . SER A 17  ? 0.8411 0.7670 0.9331 -0.0028 -0.1002 0.0430  17   SER A OG  
49   N N   . ASP A 18  ? 0.7600 0.7442 0.8974 -0.0133 -0.0688 0.0493  18   ASP A N   
50   C CA  . ASP A 18  ? 0.7810 0.7820 0.9337 -0.0143 -0.0632 0.0487  18   ASP A CA  
51   C C   . ASP A 18  ? 0.7781 0.7792 0.9281 -0.0184 -0.0570 0.0529  18   ASP A C   
52   O O   . ASP A 18  ? 0.7949 0.8065 0.9539 -0.0200 -0.0523 0.0537  18   ASP A O   
53   C CB  . ASP A 18  ? 0.7987 0.8107 0.9606 -0.0154 -0.0597 0.0484  18   ASP A CB  
54   C CG  . ASP A 18  ? 0.8195 0.8304 0.9773 -0.0194 -0.0544 0.0533  18   ASP A CG  
55   O OD1 . ASP A 18  ? 0.8167 0.8195 0.9654 -0.0219 -0.0525 0.0559  18   ASP A OD1 
56   O OD2 . ASP A 18  ? 0.8876 0.9059 1.0515 -0.0204 -0.0519 0.0536  18   ASP A OD2 
57   N N   . GLY A 19  ? 0.7808 0.7685 0.9169 -0.0208 -0.0570 0.0548  19   GLY A N   
58   C CA  . GLY A 19  ? 0.8095 0.7974 0.9440 -0.0248 -0.0513 0.0567  19   GLY A CA  
59   C C   . GLY A 19  ? 0.8205 0.8133 0.9580 -0.0293 -0.0445 0.0579  19   GLY A C   
60   O O   . GLY A 19  ? 0.8309 0.8244 0.9687 -0.0328 -0.0399 0.0576  19   GLY A O   
61   N N   . SER A 20  ? 0.8279 0.8245 0.9689 -0.0290 -0.0443 0.0582  20   SER A N   
62   C CA  . SER A 20  ? 0.8426 0.8447 0.9885 -0.0324 -0.0390 0.0580  20   SER A CA  
63   C C   . SER A 20  ? 0.8485 0.8396 0.9821 -0.0378 -0.0357 0.0570  20   SER A C   
64   O O   . SER A 20  ? 0.8450 0.8218 0.9634 -0.0384 -0.0388 0.0576  20   SER A O   
65   C CB  . SER A 20  ? 0.8548 0.8650 1.0089 -0.0303 -0.0401 0.0586  20   SER A CB  
66   O OG  . SER A 20  ? 0.8431 0.8470 0.9904 -0.0290 -0.0434 0.0588  20   SER A OG  
67   N N   . SER A 21  ? 0.8727 0.8696 1.0125 -0.0418 -0.0298 0.0543  21   SER A N   
68   C CA  . SER A 21  ? 0.8962 0.8842 1.0256 -0.0492 -0.0241 0.0513  21   SER A CA  
69   C C   . SER A 21  ? 0.9009 0.8833 1.0233 -0.0505 -0.0245 0.0519  21   SER A C   
70   O O   . SER A 21  ? 0.9052 0.8969 1.0380 -0.0466 -0.0268 0.0528  21   SER A O   
71   C CB  . SER A 21  ? 0.9064 0.9054 1.0490 -0.0532 -0.0174 0.0454  21   SER A CB  
72   O OG  . SER A 21  ? 0.9378 0.9276 1.0692 -0.0624 -0.0099 0.0408  21   SER A OG  
73   N N   . ASN A 22  ? 0.9229 0.8882 1.0257 -0.0567 -0.0222 0.0511  22   ASN A N   
74   C CA  . ASN A 22  ? 0.9520 0.9101 1.0462 -0.0584 -0.0227 0.0516  22   ASN A CA  
75   C C   . ASN A 22  ? 0.9691 0.9306 1.0659 -0.0665 -0.0134 0.0460  22   ASN A C   
76   O O   . ASN A 22  ? 1.0020 0.9597 1.0940 -0.0684 -0.0127 0.0459  22   ASN A O   
77   C CB  . ASN A 22  ? 0.9859 0.9190 1.0534 -0.0602 -0.0275 0.0539  22   ASN A CB  
78   C CG  . ASN A 22  ? 0.9991 0.9260 1.0605 -0.0574 -0.0327 0.0558  22   ASN A CG  
79   O OD1 . ASN A 22  ? 0.9818 0.9249 1.0604 -0.0532 -0.0331 0.0562  22   ASN A OD1 
80   N ND2 . ASN A 22  ? 1.0033 0.9050 1.0387 -0.0596 -0.0377 0.0570  22   ASN A ND2 
81   N N   . ILE A 23  ? 0.9721 0.9416 1.0780 -0.0714 -0.0062 0.0404  23   ILE A N   
82   C CA  . ILE A 23  ? 0.9966 0.9718 1.1086 -0.0797 0.0033  0.0320  23   ILE A CA  
83   C C   . ILE A 23  ? 0.9964 0.9894 1.1300 -0.0749 0.0019  0.0297  23   ILE A C   
84   O O   . ILE A 23  ? 0.9926 0.9958 1.1392 -0.0656 -0.0054 0.0340  23   ILE A O   
85   C CB  . ILE A 23  ? 1.0046 0.9865 1.1250 -0.0853 0.0106  0.0245  23   ILE A CB  
86   C CG1 . ILE A 23  ? 1.0508 1.0104 1.1440 -0.0950 0.0157  0.0242  23   ILE A CG1 
87   C CG2 . ILE A 23  ? 1.0073 1.0037 1.1456 -0.0909 0.0189  0.0132  23   ILE A CG2 
88   C CD1 . ILE A 23  ? 1.0158 0.9598 1.0916 -0.0891 0.0063  0.0336  23   ILE A CD1 
89   N N   . THR A 24  ? 1.0173 1.0123 1.1531 -0.0822 0.0092  0.0225  24   THR A N   
90   C CA  . THR A 24  ? 1.0196 1.0308 1.1761 -0.0783 0.0081  0.0185  24   THR A CA  
91   C C   . THR A 24  ? 1.0205 1.0489 1.2008 -0.0788 0.0113  0.0079  24   THR A C   
92   O O   . THR A 24  ? 1.0250 1.0526 1.2042 -0.0874 0.0200  -0.0001 24   THR A O   
93   C CB  . THR A 24  ? 1.0525 1.0576 1.2005 -0.0861 0.0142  0.0145  24   THR A CB  
94   O OG1 . THR A 24  ? 1.0649 1.0545 1.1928 -0.0838 0.0089  0.0241  24   THR A OG1 
95   C CG2 . THR A 24  ? 1.0576 1.0807 1.2294 -0.0828 0.0137  0.0079  24   THR A CG2 
96   N N   . ARG A 25  ? 1.0269 1.0694 1.2277 -0.0698 0.0041  0.0070  25   ARG A N   
97   C CA  A ARG A 25  ? 1.0466 1.1042 1.2708 -0.0675 0.0034  -0.0029 25   ARG A CA  
98   C CA  B ARG A 25  ? 1.0428 1.1003 1.2669 -0.0677 0.0036  -0.0031 25   ARG A CA  
99   C C   . ARG A 25  ? 1.0761 1.1469 1.3208 -0.0680 0.0046  -0.0150 25   ARG A C   
100  O O   . ARG A 25  ? 1.1016 1.1745 1.3506 -0.0621 -0.0018 -0.0120 25   ARG A O   
101  C CB  A ARG A 25  ? 1.0517 1.1124 1.2826 -0.0566 -0.0075 0.0037  25   ARG A CB  
102  C CB  B ARG A 25  ? 1.0449 1.1057 1.2758 -0.0571 -0.0070 0.0032  25   ARG A CB  
103  C CG  A ARG A 25  ? 1.0363 1.0903 1.2567 -0.0567 -0.0074 0.0095  25   ARG A CG  
104  C CG  B ARG A 25  ? 1.0076 1.0565 1.2197 -0.0548 -0.0101 0.0160  25   ARG A CG  
105  C CD  A ARG A 25  ? 1.0491 1.1024 1.2698 -0.0475 -0.0174 0.0182  25   ARG A CD  
106  C CD  B ARG A 25  ? 0.9825 1.0332 1.1985 -0.0514 -0.0131 0.0170  25   ARG A CD  
107  N NE  A ARG A 25  ? 1.0258 1.0698 1.2308 -0.0456 -0.0202 0.0287  25   ARG A NE  
108  N NE  B ARG A 25  ? 0.9813 1.0441 1.2183 -0.0492 -0.0149 0.0069  25   ARG A NE  
109  C CZ  A ARG A 25  ? 0.9877 1.0236 1.1798 -0.0452 -0.0209 0.0356  25   ARG A CZ  
110  C CZ  B ARG A 25  ? 0.9761 1.0418 1.2201 -0.0442 -0.0203 0.0069  25   ARG A CZ  
111  N NH1 A ARG A 25  ? 0.9660 1.0011 1.1572 -0.0468 -0.0189 0.0343  25   ARG A NH1 
112  N NH1 B ARG A 25  ? 0.9511 1.0094 1.1830 -0.0416 -0.0232 0.0167  25   ARG A NH1 
113  N NH2 A ARG A 25  ? 0.9711 1.0006 1.1526 -0.0430 -0.0241 0.0426  25   ARG A NH2 
114  N NH2 B ARG A 25  ? 0.9997 1.0755 1.2634 -0.0415 -0.0233 -0.0036 25   ARG A NH2 
115  N N   . LEU A 26  ? 1.0921 1.1719 1.3501 -0.0753 0.0130  -0.0297 26   LEU A N   
116  C CA  . LEU A 26  ? 1.1308 1.2257 1.4127 -0.0757 0.0141  -0.0447 26   LEU A CA  
117  C C   . LEU A 26  ? 1.1641 1.2734 1.4717 -0.0706 0.0095  -0.0565 26   LEU A C   
118  O O   . LEU A 26  ? 1.1592 1.2675 1.4645 -0.0733 0.0128  -0.0573 26   LEU A O   
119  C CB  . LEU A 26  ? 1.1328 1.2269 1.4100 -0.0906 0.0296  -0.0557 26   LEU A CB  
120  C CG  . LEU A 26  ? 1.1277 1.2069 1.3803 -0.0981 0.0357  -0.0485 26   LEU A CG  
121  C CD1 . LEU A 26  ? 1.1196 1.1866 1.3522 -0.1147 0.0510  -0.0537 26   LEU A CD1 
122  C CD2 . LEU A 26  ? 1.1154 1.1800 1.3467 -0.0903 0.0263  -0.0290 26   LEU A CD2 
123  N N   . GLY A 27  ? 1.2130 1.3345 1.5445 -0.0626 0.0006  -0.0658 27   GLY A N   
124  C CA  . GLY A 27  ? 1.2634 1.3983 1.6215 -0.0568 -0.0057 -0.0797 27   GLY A CA  
125  C C   . GLY A 27  ? 1.3192 1.4533 1.6864 -0.0419 -0.0246 -0.0762 27   GLY A C   
126  O O   . GLY A 27  ? 1.3464 1.4751 1.7101 -0.0351 -0.0331 -0.0698 27   GLY A O   
127  N N   . LEU A 34  ? 2.0560 1.9555 2.1937 0.0127  -0.1660 0.0313  34   LEU A N   
128  C CA  . LEU A 34  ? 2.0238 1.8922 2.1319 0.0115  -0.1764 0.0356  34   LEU A CA  
129  C C   . LEU A 34  ? 1.9926 1.8662 2.0981 0.0067  -0.1668 0.0398  34   LEU A C   
130  O O   . LEU A 34  ? 1.9527 1.8124 2.0335 -0.0017 -0.1602 0.0481  34   LEU A O   
131  C CB  . LEU A 34  ? 2.0558 1.9068 2.1653 0.0221  -0.1989 0.0263  34   LEU A CB  
132  N N   . ASP A 35  ? 2.0172 1.9115 2.1490 0.0115  -0.1653 0.0329  35   ASP A N   
133  C CA  . ASP A 35  ? 1.9954 1.8959 2.1280 0.0084  -0.1576 0.0356  35   ASP A CA  
134  C C   . ASP A 35  ? 1.9715 1.8905 2.1071 0.0001  -0.1379 0.0423  35   ASP A C   
135  O O   . ASP A 35  ? 1.9483 1.8709 2.0812 -0.0035 -0.1306 0.0457  35   ASP A O   
136  C CB  . ASP A 35  ? 2.0937 2.0109 2.2544 0.0159  -0.1621 0.0249  35   ASP A CB  
137  N N   . ASP A 36  ? 1.9811 1.9111 2.1224 -0.0020 -0.1305 0.0437  36   ASP A N   
138  C CA  . ASP A 36  ? 1.9663 1.9116 2.1098 -0.0087 -0.1143 0.0492  36   ASP A CA  
139  C C   . ASP A 36  ? 1.9142 1.8436 2.0319 -0.0165 -0.1101 0.0568  36   ASP A C   
140  O O   . ASP A 36  ? 1.8921 1.8295 2.0083 -0.0220 -0.0990 0.0604  36   ASP A O   
141  C CB  . ASP A 36  ? 2.0073 1.9689 2.1661 -0.0081 -0.1088 0.0470  36   ASP A CB  
142  C CG  . ASP A 36  ? 2.0097 1.9588 2.1542 -0.0098 -0.1121 0.0501  36   ASP A CG  
143  O OD1 . ASP A 36  ? 2.0045 1.9307 2.1307 -0.0088 -0.1232 0.0508  36   ASP A OD1 
144  O OD2 . ASP A 36  ? 2.0372 1.9975 2.1870 -0.0123 -0.1040 0.0517  36   ASP A OD2 
145  N N   . HIS A 37  ? 1.9001 1.8066 1.9974 -0.0173 -0.1190 0.0582  37   HIS A N   
146  C CA  . HIS A 37  ? 1.8565 1.7453 1.9268 -0.0266 -0.1144 0.0639  37   HIS A CA  
147  C C   . HIS A 37  ? 1.8204 1.6937 1.8729 -0.0311 -0.1148 0.0659  37   HIS A C   
148  O O   . HIS A 37  ? 1.7957 1.6556 1.8262 -0.0408 -0.1085 0.0693  37   HIS A O   
149  C CB  . HIS A 37  ? 1.8654 1.7311 1.9157 -0.0274 -0.1236 0.0647  37   HIS A CB  
150  N N   . TYR A 38  ? 1.8184 1.6941 1.8808 -0.0249 -0.1213 0.0630  38   TYR A N   
151  C CA  . TYR A 38  ? 1.7849 1.6489 1.8331 -0.0290 -0.1206 0.0648  38   TYR A CA  
152  C C   . TYR A 38  ? 1.7528 1.6393 1.8138 -0.0335 -0.1051 0.0663  38   TYR A C   
153  O O   . TYR A 38  ? 1.7250 1.6060 1.7711 -0.0428 -0.0961 0.0689  38   TYR A O   
154  C CB  . TYR A 38  ? 1.8109 1.6673 1.8638 -0.0206 -0.1344 0.0607  38   TYR A CB  
155  C CG  . TYR A 38  ? 1.8059 1.6550 1.8485 -0.0243 -0.1321 0.0625  38   TYR A CG  
156  C CD1 . TYR A 38  ? 1.7879 1.6107 1.7974 -0.0340 -0.1307 0.0669  38   TYR A CD1 
157  C CD2 . TYR A 38  ? 1.8313 1.6996 1.8964 -0.0193 -0.1302 0.0595  38   TYR A CD2 
158  C CE1 . TYR A 38  ? 1.7859 1.6021 1.7858 -0.0381 -0.1279 0.0682  38   TYR A CE1 
159  C CE2 . TYR A 38  ? 1.8224 1.6846 1.8785 -0.0226 -0.1280 0.0612  38   TYR A CE2 
160  C CZ  . TYR A 38  ? 1.8000 1.6365 1.8239 -0.0318 -0.1269 0.0656  38   TYR A CZ  
161  O OH  . TYR A 38  ? 1.7961 1.6260 1.8105 -0.0357 -0.1243 0.0669  38   TYR A OH  
162  N N   . HIS A 39  ? 1.7536 1.6642 1.8416 -0.0275 -0.1022 0.0635  39   HIS A N   
163  C CA  . HIS A 39  ? 1.7260 1.6565 1.8261 -0.0305 -0.0895 0.0644  39   HIS A CA  
164  C C   . HIS A 39  ? 1.6926 1.6303 1.7910 -0.0363 -0.0795 0.0663  39   HIS A C   
165  O O   . HIS A 39  ? 1.6879 1.6404 1.7950 -0.0388 -0.0700 0.0663  39   HIS A O   
166  C CB  . HIS A 39  ? 1.7687 1.7210 1.8951 -0.0240 -0.0881 0.0608  39   HIS A CB  
167  C CG  . HIS A 39  ? 1.7961 1.7456 1.9285 -0.0187 -0.0962 0.0571  39   HIS A CG  
168  N ND1 . HIS A 39  ? 1.8411 1.7899 1.9841 -0.0116 -0.1066 0.0513  39   HIS A ND1 
169  C CD2 . HIS A 39  ? 1.7921 1.7400 1.9229 -0.0191 -0.0959 0.0574  39   HIS A CD2 
170  C CE1 . HIS A 39  ? 1.8565 1.8036 2.0046 -0.0078 -0.1125 0.0476  39   HIS A CE1 
171  N NE2 . HIS A 39  ? 1.8221 1.7681 1.9620 -0.0123 -0.1060 0.0519  39   HIS A NE2 
172  N N   . ASP A 40  ? 1.6651 1.5912 1.7518 -0.0382 -0.0826 0.0672  40   ASP A N   
173  C CA  . ASP A 40  ? 1.6371 1.5705 1.7240 -0.0429 -0.0744 0.0679  40   ASP A CA  
174  C C   . ASP A 40  ? 1.5822 1.5012 1.6472 -0.0534 -0.0686 0.0687  40   ASP A C   
175  O O   . ASP A 40  ? 1.5697 1.4998 1.6388 -0.0586 -0.0585 0.0672  40   ASP A O   
176  C CB  . ASP A 40  ? 1.6678 1.5980 1.7559 -0.0392 -0.0804 0.0676  40   ASP A CB  
177  C CG  . ASP A 40  ? 1.7034 1.6540 1.8087 -0.0379 -0.0735 0.0670  40   ASP A CG  
178  O OD1 . ASP A 40  ? 1.7269 1.6933 1.8442 -0.0382 -0.0659 0.0664  40   ASP A OD1 
179  O OD2 . ASP A 40  ? 1.7364 1.6855 1.8421 -0.0363 -0.0764 0.0669  40   ASP A OD2 
180  N N   . LEU A 41  ? 1.5446 1.4375 1.5853 -0.0569 -0.0753 0.0699  41   LEU A N   
181  C CA  . LEU A 41  ? 1.4956 1.3710 1.5112 -0.0692 -0.0690 0.0699  41   LEU A CA  
182  C C   . LEU A 41  ? 1.4584 1.3425 1.4784 -0.0730 -0.0611 0.0681  41   LEU A C   
183  O O   . LEU A 41  ? 1.4356 1.3159 1.4444 -0.0837 -0.0513 0.0656  41   LEU A O   
184  C CB  . LEU A 41  ? 1.5028 1.3428 1.4869 -0.0719 -0.0802 0.0719  41   LEU A CB  
185  C CG  . LEU A 41  ? 1.5175 1.3444 1.4926 -0.0694 -0.0888 0.0731  41   LEU A CG  
186  C CD1 . LEU A 41  ? 1.5244 1.3185 1.4758 -0.0659 -0.1059 0.0744  41   LEU A CD1 
187  C CD2 . LEU A 41  ? 1.4999 1.3198 1.4589 -0.0811 -0.0788 0.0726  41   LEU A CD2 
188  N N   . LEU A 42  ? 1.4449 1.3416 1.4828 -0.0643 -0.0650 0.0685  42   LEU A N   
189  C CA  . LEU A 42  ? 1.4144 1.3216 1.4601 -0.0658 -0.0589 0.0671  42   LEU A CA  
190  C C   . LEU A 42  ? 1.3965 1.3293 1.4629 -0.0662 -0.0483 0.0640  42   LEU A C   
191  O O   . LEU A 42  ? 1.3815 1.3201 1.4493 -0.0714 -0.0407 0.0610  42   LEU A O   
192  C CB  . LEU A 42  ? 1.4354 1.3473 1.4935 -0.0561 -0.0670 0.0681  42   LEU A CB  
193  C CG  . LEU A 42  ? 1.4455 1.3326 1.4865 -0.0532 -0.0804 0.0694  42   LEU A CG  
194  C CD1 . LEU A 42  ? 1.4715 1.3694 1.5324 -0.0425 -0.0880 0.0679  42   LEU A CD1 
195  C CD2 . LEU A 42  ? 1.4117 1.2739 1.4241 -0.0625 -0.0799 0.0704  42   LEU A CD2 
196  N N   . THR A 43  ? 1.3961 1.3434 1.4785 -0.0607 -0.0485 0.0640  43   THR A N   
197  C CA  . THR A 43  ? 1.3902 1.3598 1.4923 -0.0590 -0.0415 0.0611  43   THR A CA  
198  C C   . THR A 43  ? 1.3740 1.3495 1.4772 -0.0642 -0.0348 0.0575  43   THR A C   
199  O O   . THR A 43  ? 1.3803 1.3701 1.4955 -0.0652 -0.0288 0.0527  43   THR A O   
200  C CB  . THR A 43  ? 1.4253 1.4086 1.5459 -0.0494 -0.0454 0.0626  43   THR A CB  
201  O OG1 . THR A 43  ? 1.4480 1.4321 1.5712 -0.0466 -0.0482 0.0637  43   THR A OG1 
202  C CG2 . THR A 43  ? 1.4329 1.4108 1.5535 -0.0449 -0.0519 0.0645  43   THR A CG2 
203  N N   . VAL A 44  ? 1.7079 1.2883 1.3079 -0.0042 0.1088  0.0087  44   VAL A N   
204  C CA  . VAL A 44  ? 1.6919 1.2493 1.2878 -0.0065 0.0990  0.0082  44   VAL A CA  
205  C C   . VAL A 44  ? 1.6429 1.2004 1.2405 0.0079  0.0894  0.0017  44   VAL A C   
206  O O   . VAL A 44  ? 1.6040 1.1722 1.2076 0.0127  0.0873  0.0006  44   VAL A O   
207  C CB  . VAL A 44  ? 1.6718 1.2387 1.2851 -0.0156 0.0980  0.0080  44   VAL A CB  
208  C CG1 . VAL A 44  ? 1.7243 1.2910 1.3322 -0.0362 0.1023  0.0199  44   VAL A CG1 
209  C CG2 . VAL A 44  ? 1.5809 1.1803 1.2228 -0.0122 0.1017  0.0027  44   VAL A CG2 
210  N N   . SER A 45  ? 1.6490 1.1970 1.2383 0.0157  0.0797  -0.0020 45   SER A N   
211  C CA  . SER A 45  ? 1.6111 1.1810 1.2045 0.0296  0.0710  -0.0053 45   SER A CA  
212  C C   . SER A 45  ? 1.5323 1.1467 1.1545 0.0276  0.0694  -0.0047 45   SER A C   
213  O O   . SER A 45  ? 1.5164 1.1350 1.1517 0.0206  0.0738  -0.0060 45   SER A O   
214  C CB  . SER A 45  ? 1.6704 1.2224 1.2387 0.0473  0.0593  -0.0126 45   SER A CB  
215  O OG  . SER A 45  ? 1.6976 1.2423 1.2639 0.0510  0.0534  -0.0188 45   SER A OG  
216  N N   . TRP A 46  ? 1.4884 1.1403 1.1200 0.0311  0.0613  0.0001  46   TRP A N   
217  C CA  . TRP A 46  ? 1.4240 1.1258 1.0820 0.0234  0.0570  0.0068  46   TRP A CA  
218  C C   . TRP A 46  ? 1.4217 1.1458 1.0864 0.0333  0.0590  -0.0009 46   TRP A C   
219  O O   . TRP A 46  ? 1.3886 1.1219 1.0718 0.0222  0.0624  0.0008  46   TRP A O   
220  C CB  . TRP A 46  ? 1.3985 1.1475 1.0642 0.0185  0.0442  0.0205  46   TRP A CB  
221  C CG  . TRP A 46  ? 1.3931 1.1148 1.0564 0.0012  0.0343  0.0307  46   TRP A CG  
222  C CD1 . TRP A 46  ? 1.4261 1.1214 1.0709 0.0042  0.0289  0.0317  46   TRP A CD1 
223  C CD2 . TRP A 46  ? 1.3648 1.0737 1.0381 -0.0173 0.0236  0.0382  46   TRP A CD2 
224  N NE1 . TRP A 46  ? 1.4228 1.0889 1.0637 -0.0095 0.0144  0.0385  46   TRP A NE1 
225  C CE2 . TRP A 46  ? 1.3869 1.0578 1.0430 -0.0217 0.0089  0.0419  46   TRP A CE2 
226  C CE3 . TRP A 46  ? 1.3262 1.0476 1.0173 -0.0281 0.0215  0.0409  46   TRP A CE3 
227  C CZ2 . TRP A 46  ? 1.3711 1.0102 1.0225 -0.0331 -0.0116 0.0462  46   TRP A CZ2 
228  C CZ3 . TRP A 46  ? 1.3278 1.0196 1.0166 -0.0416 0.0028  0.0465  46   TRP A CZ3 
229  C CH2 . TRP A 46  ? 1.3475 0.9960 1.0143 -0.0424 -0.0154 0.0481  46   TRP A CH2 
230  N N   . PRO A 47  ? 1.4670 1.1951 1.1122 0.0580  0.0537  -0.0116 47   PRO A N   
231  C CA  . PRO A 47  ? 1.4875 1.2208 1.1266 0.0755  0.0494  -0.0240 47   PRO A CA  
232  C C   . PRO A 47  ? 1.4862 1.1751 1.1292 0.0595  0.0548  -0.0259 47   PRO A C   
233  O O   . PRO A 47  ? 1.4621 1.1732 1.1205 0.0580  0.0555  -0.0277 47   PRO A O   
234  C CB  . PRO A 47  ? 1.5735 1.2724 1.1740 0.1046  0.0368  -0.0385 47   PRO A CB  
235  C CG  . PRO A 47  ? 1.5668 1.2942 1.1661 0.1088  0.0364  -0.0319 47   PRO A CG  
236  C CD  . PRO A 47  ? 1.5138 1.2382 1.1363 0.0754  0.0469  -0.0148 47   PRO A CD  
237  N N   . VAL A 48  ? 1.5193 1.1531 1.1483 0.0467  0.0584  -0.0237 48   VAL A N   
238  C CA  . VAL A 48  ? 1.5312 1.1351 1.1637 0.0285  0.0628  -0.0214 48   VAL A CA  
239  C C   . VAL A 48  ? 1.4508 1.0851 1.1160 0.0108  0.0758  -0.0141 48   VAL A C   
240  O O   . VAL A 48  ? 1.4407 1.0800 1.1199 0.0023  0.0783  -0.0144 48   VAL A O   
241  C CB  . VAL A 48  ? 1.6016 1.1553 1.2104 0.0162  0.0623  -0.0156 48   VAL A CB  
242  C CG1 . VAL A 48  ? 1.6223 1.1675 1.2405 -0.0083 0.0684  -0.0068 48   VAL A CG1 
243  C CG2 . VAL A 48  ? 1.6993 1.2060 1.2684 0.0327  0.0412  -0.0233 48   VAL A CG2 
244  N N   . PHE A 49  ? 1.4020 1.0508 1.0753 0.0070  0.0797  -0.0084 49   PHE A N   
245  C CA  . PHE A 49  ? 1.3419 1.0072 1.0366 -0.0044 0.0837  -0.0041 49   PHE A CA  
246  C C   . PHE A 49  ? 1.2968 0.9979 1.0129 -0.0063 0.0792  -0.0031 49   PHE A C   
247  O O   . PHE A 49  ? 1.2731 0.9795 1.0048 -0.0143 0.0826  -0.0037 49   PHE A O   
248  C CB  . PHE A 49  ? 1.3233 0.9873 1.0139 -0.0048 0.0775  0.0008  49   PHE A CB  
249  C CG  . PHE A 49  ? 1.2771 0.9464 0.9806 -0.0124 0.0705  0.0035  49   PHE A CG  
250  C CD1 . PHE A 49  ? 1.2738 0.9312 0.9768 -0.0105 0.0770  -0.0025 49   PHE A CD1 
251  C CD2 . PHE A 49  ? 1.2125 0.9019 0.9258 -0.0214 0.0537  0.0133  49   PHE A CD2 
252  C CE1 . PHE A 49  ? 1.2483 0.9034 0.9561 -0.0105 0.0650  -0.0040 49   PHE A CE1 
253  C CE2 . PHE A 49  ? 1.1843 0.8646 0.9021 -0.0291 0.0393  0.0162  49   PHE A CE2 
254  C CZ  . PHE A 49  ? 1.2107 0.8685 0.9236 -0.0203 0.0439  0.0048  49   PHE A CZ  
255  N N   . ILE A 50  ? 1.2893 1.0229 1.0054 0.0022  0.0714  -0.0008 50   ILE A N   
256  C CA  . ILE A 50  ? 1.2528 1.0361 0.9875 0.0012  0.0667  0.0031  50   ILE A CA  
257  C C   . ILE A 50  ? 1.2716 1.0483 1.0067 0.0093  0.0703  -0.0079 50   ILE A C   
258  O O   . ILE A 50  ? 1.2479 1.0403 1.0016 0.0001  0.0716  -0.0059 50   ILE A O   
259  C CB  . ILE A 50  ? 1.2519 1.0915 0.9853 0.0112  0.0582  0.0099  50   ILE A CB  
260  C CG1 . ILE A 50  ? 1.2205 1.0744 0.9618 -0.0098 0.0481  0.0288  50   ILE A CG1 
261  C CG2 . ILE A 50  ? 1.2324 1.1354 0.9790 0.0189  0.0555  0.0109  50   ILE A CG2 
262  C CD1 . ILE A 50  ? 1.2530 1.1557 0.9892 -0.0040 0.0401  0.0386  50   ILE A CD1 
263  N N   . THR A 51  ? 1.3294 1.0739 1.0401 0.0255  0.0677  -0.0191 51   THR A N   
264  C CA  . THR A 51  ? 1.3662 1.0899 1.0694 0.0322  0.0631  -0.0292 51   THR A CA  
265  C C   . THR A 51  ? 1.3510 1.0558 1.0714 0.0085  0.0717  -0.0244 51   THR A C   
266  O O   . THR A 51  ? 1.3417 1.0622 1.0764 0.0061  0.0712  -0.0265 51   THR A O   
267  C CB  . THR A 51  ? 1.4643 1.1335 1.1285 0.0488  0.0495  -0.0400 51   THR A CB  
268  O OG1 . THR A 51  ? 1.4830 1.1797 1.1295 0.0805  0.0391  -0.0494 51   THR A OG1 
269  C CG2 . THR A 51  ? 1.5065 1.1372 1.1569 0.0501  0.0366  -0.0479 51   THR A CG2 
270  N N   . LEU A 52  ? 1.3516 1.0310 1.0701 -0.0062 0.0795  -0.0181 52   LEU A N   
271  C CA  . LEU A 52  ? 1.3434 1.0207 1.0774 -0.0242 0.0881  -0.0136 52   LEU A CA  
272  C C   . LEU A 52  ? 1.2722 0.9849 1.0337 -0.0277 0.0912  -0.0127 52   LEU A C   
273  O O   . LEU A 52  ? 1.2627 0.9833 1.0392 -0.0354 0.0938  -0.0134 52   LEU A O   
274  C CB  . LEU A 52  ? 1.3651 1.0305 1.0917 -0.0326 0.0966  -0.0074 52   LEU A CB  
275  C CG  . LEU A 52  ? 1.4538 1.0816 1.1504 -0.0333 0.0905  -0.0046 52   LEU A CG  
276  C CD1 . LEU A 52  ? 1.4588 1.0830 1.1447 -0.0348 0.0981  0.0008  52   LEU A CD1 
277  C CD2 . LEU A 52  ? 1.5087 1.1132 1.1964 -0.0506 0.0834  0.0017  52   LEU A CD2 
278  N N   . ILE A 53  ? 1.2222 0.9536 0.9880 -0.0245 0.0873  -0.0091 53   ILE A N   
279  C CA  . ILE A 53  ? 1.1699 0.9231 0.9546 -0.0321 0.0825  -0.0045 53   ILE A CA  
280  C C   . ILE A 53  ? 1.1508 0.9344 0.9490 -0.0317 0.0793  -0.0046 53   ILE A C   
281  O O   . ILE A 53  ? 1.1334 0.9243 0.9471 -0.0387 0.0795  -0.0051 53   ILE A O   
282  C CB  . ILE A 53  ? 1.1481 0.9079 0.9290 -0.0353 0.0706  0.0046  53   ILE A CB  
283  C CG1 . ILE A 53  ? 1.1673 0.8933 0.9334 -0.0324 0.0709  0.0017  53   ILE A CG1 
284  C CG2 . ILE A 53  ? 1.1013 0.8816 0.8970 -0.0481 0.0563  0.0141  53   ILE A CG2 
285  C CD1 . ILE A 53  ? 1.1650 0.8807 0.9356 -0.0309 0.0721  -0.0049 53   ILE A CD1 
286  N N   . THR A 54  ? 1.1559 0.9606 0.9456 -0.0194 0.0757  -0.0059 54   THR A N   
287  C CA  . THR A 54  ? 1.1488 0.9900 0.9458 -0.0112 0.0721  -0.0087 54   THR A CA  
288  C C   . THR A 54  ? 1.1817 0.9932 0.9794 -0.0115 0.0753  -0.0187 54   THR A C   
289  O O   . THR A 54  ? 1.1620 0.9920 0.9766 -0.0176 0.0751  -0.0180 54   THR A O   
290  C CB  . THR A 54  ? 1.1792 1.0473 0.9584 0.0128  0.0665  -0.0142 54   THR A CB  
291  O OG1 . THR A 54  ? 1.1554 1.0573 0.9371 0.0075  0.0634  -0.0008 54   THR A OG1 
292  C CG2 . THR A 54  ? 1.1758 1.0952 0.9589 0.0288  0.0615  -0.0188 54   THR A CG2 
293  N N   . GLY A 55  ? 1.2350 1.0001 1.0134 -0.0090 0.0755  -0.0251 55   GLY A N   
294  C CA  . GLY A 55  ? 1.2799 1.0151 1.0568 -0.0170 0.0739  -0.0289 55   GLY A CA  
295  C C   . GLY A 55  ? 1.2481 0.9966 1.0516 -0.0354 0.0835  -0.0232 55   GLY A C   
296  O O   . GLY A 55  ? 1.2460 1.0025 1.0616 -0.0392 0.0816  -0.0256 55   GLY A O   
297  N N   . LEU A 56  ? 1.2209 0.9715 1.0304 -0.0430 0.0916  -0.0177 56   LEU A N   
298  C CA  . LEU A 56  ? 1.2109 0.9750 1.0395 -0.0520 0.0974  -0.0163 56   LEU A CA  
299  C C   . LEU A 56  ? 1.1582 0.9462 1.0043 -0.0515 0.0913  -0.0168 56   LEU A C   
300  O O   . LEU A 56  ? 1.1533 0.9508 1.0146 -0.0565 0.0924  -0.0186 56   LEU A O   
301  C CB  . LEU A 56  ? 1.2104 0.9728 1.0346 -0.0502 0.1021  -0.0148 56   LEU A CB  
302  C CG  . LEU A 56  ? 1.2305 1.0099 1.0681 -0.0484 0.1033  -0.0184 56   LEU A CG  
303  C CD1 . LEU A 56  ? 1.2843 1.0822 1.1351 -0.0573 0.1110  -0.0177 56   LEU A CD1 
304  C CD2 . LEU A 56  ? 1.2712 1.0481 1.0956 -0.0362 0.1034  -0.0218 56   LEU A CD2 
305  N N   . TYR A 57  ? 1.1233 0.9272 0.9667 -0.0471 0.0838  -0.0128 57   TYR A N   
306  C CA  . TYR A 57  ? 1.0869 0.9225 0.9445 -0.0515 0.0753  -0.0071 57   TYR A CA  
307  C C   . TYR A 57  ? 1.0956 0.9510 0.9593 -0.0459 0.0754  -0.0123 57   TYR A C   
308  O O   . TYR A 57  ? 1.0791 0.9490 0.9579 -0.0527 0.0725  -0.0107 57   TYR A O   
309  C CB  . TYR A 57  ? 1.0671 0.9281 0.9198 -0.0535 0.0658  0.0048  57   TYR A CB  
310  C CG  . TYR A 57  ? 1.0689 0.9793 0.9338 -0.0627 0.0547  0.0182  57   TYR A CG  
311  C CD1 . TYR A 57  ? 1.0663 0.9745 0.9397 -0.0819 0.0397  0.0303  57   TYR A CD1 
312  C CD2 . TYR A 57  ? 1.0849 1.0476 0.9484 -0.0511 0.0555  0.0199  57   TYR A CD2 
313  C CE1 . TYR A 57  ? 1.0443 1.0023 0.9273 -0.0971 0.0265  0.0487  57   TYR A CE1 
314  C CE2 . TYR A 57  ? 1.0710 1.0965 0.9458 -0.0610 0.0463  0.0361  57   TYR A CE2 
315  C CZ  . TYR A 57  ? 1.0533 1.0770 0.9392 -0.0878 0.0323  0.0530  57   TYR A CZ  
316  O OH  . TYR A 57  ? 1.0621 1.1539 0.9580 -0.1032 0.0208  0.0746  57   TYR A OH  
317  N N   . LEU A 58  ? 1.1316 0.9835 0.9792 -0.0306 0.0748  -0.0200 58   LEU A N   
318  C CA  . LEU A 58  ? 1.1642 1.0219 1.0096 -0.0200 0.0701  -0.0293 58   LEU A CA  
319  C C   . LEU A 58  ? 1.1870 1.0144 1.0419 -0.0332 0.0727  -0.0325 58   LEU A C   
320  O O   . LEU A 58  ? 1.1769 1.0204 1.0461 -0.0364 0.0711  -0.0336 58   LEU A O   
321  C CB  . LEU A 58  ? 1.2249 1.0671 1.0403 0.0050  0.0610  -0.0414 58   LEU A CB  
322  C CG  . LEU A 58  ? 1.2062 1.0938 1.0127 0.0224  0.0589  -0.0388 58   LEU A CG  
323  C CD1 . LEU A 58  ? 1.2653 1.1366 1.0358 0.0567  0.0459  -0.0557 58   LEU A CD1 
324  C CD2 . LEU A 58  ? 1.1422 1.1049 0.9682 0.0209  0.0589  -0.0285 58   LEU A CD2 
325  N N   . VAL A 59  ? 1.2261 1.0174 1.0733 -0.0425 0.0763  -0.0315 59   VAL A N   
326  C CA  . VAL A 59  ? 1.2645 1.0413 1.1211 -0.0587 0.0784  -0.0296 59   VAL A CA  
327  C C   . VAL A 59  ? 1.2267 1.0326 1.1104 -0.0662 0.0852  -0.0276 59   VAL A C   
328  O O   . VAL A 59  ? 1.2509 1.0620 1.1469 -0.0729 0.0836  -0.0290 59   VAL A O   
329  C CB  . VAL A 59  ? 1.2974 1.0540 1.1451 -0.0718 0.0835  -0.0222 59   VAL A CB  
330  C CG1 . VAL A 59  ? 1.3278 1.0899 1.1878 -0.0918 0.0851  -0.0152 59   VAL A CG1 
331  C CG2 . VAL A 59  ? 1.3548 1.0711 1.1706 -0.0666 0.0718  -0.0231 59   VAL A CG2 
332  N N   . THR A 60  ? 1.1862 1.0053 1.0755 -0.0643 0.0886  -0.0247 60   THR A N   
333  C CA  . THR A 60  ? 1.1615 0.9954 1.0675 -0.0672 0.0881  -0.0248 60   THR A CA  
334  C C   . THR A 60  ? 1.1457 0.9965 1.0635 -0.0684 0.0806  -0.0249 60   THR A C   
335  O O   . THR A 60  ? 1.1470 1.0055 1.0790 -0.0719 0.0799  -0.0277 60   THR A O   
336  C CB  . THR A 60  ? 1.1310 0.9597 1.0298 -0.0630 0.0823  -0.0222 60   THR A CB  
337  O OG1 . THR A 60  ? 1.1501 0.9672 1.0368 -0.0588 0.0902  -0.0235 60   THR A OG1 
338  C CG2 . THR A 60  ? 1.1163 0.9472 1.0231 -0.0614 0.0722  -0.0249 60   THR A CG2 
339  N N   . ASN A 61  ? 1.1345 0.9995 1.0459 -0.0644 0.0750  -0.0209 61   ASN A N   
340  C CA  . ASN A 61  ? 1.1308 1.0248 1.0506 -0.0640 0.0684  -0.0188 61   ASN A CA  
341  C C   . ASN A 61  ? 1.1814 1.0682 1.1021 -0.0587 0.0698  -0.0290 61   ASN A C   
342  O O   . ASN A 61  ? 1.1856 1.0846 1.1195 -0.0624 0.0669  -0.0299 61   ASN A O   
343  C CB  . ASN A 61  ? 1.1089 1.0394 1.0204 -0.0584 0.0630  -0.0103 61   ASN A CB  
344  C CG  . ASN A 61  ? 1.0706 1.0169 0.9862 -0.0746 0.0520  0.0073  61   ASN A CG  
345  O OD1 . ASN A 61  ? 1.0705 1.0269 0.9960 -0.0879 0.0413  0.0162  61   ASN A OD1 
346  N ND2 . ASN A 61  ? 1.0567 0.9992 0.9614 -0.0754 0.0503  0.0137  61   ASN A ND2 
347  N N   . ALA A 62  ? 1.2348 1.0946 1.1384 -0.0517 0.0699  -0.0357 62   ALA A N   
348  C CA  . ALA A 62  ? 1.3065 1.1446 1.2045 -0.0505 0.0629  -0.0435 62   ALA A CA  
349  C C   . ALA A 62  ? 1.3114 1.1505 1.2318 -0.0682 0.0676  -0.0404 62   ALA A C   
350  O O   . ALA A 62  ? 1.3363 1.1810 1.2651 -0.0693 0.0623  -0.0440 62   ALA A O   
351  C CB  . ALA A 62  ? 1.3696 1.1632 1.2407 -0.0478 0.0547  -0.0468 62   ALA A CB  
352  N N   . LEU A 63  ? 1.2987 1.1388 1.2275 -0.0785 0.0770  -0.0348 63   LEU A N   
353  C CA  . LEU A 63  ? 1.3163 1.1711 1.2646 -0.0895 0.0817  -0.0331 63   LEU A CA  
354  C C   . LEU A 63  ? 1.2863 1.1618 1.2516 -0.0858 0.0788  -0.0366 63   LEU A C   
355  O O   . LEU A 63  ? 1.3165 1.1991 1.2937 -0.0909 0.0760  -0.0387 63   LEU A O   
356  C CB  . LEU A 63  ? 1.3099 1.1752 1.2598 -0.0918 0.0916  -0.0292 63   LEU A CB  
357  C CG  . LEU A 63  ? 1.3726 1.2214 1.3078 -0.1037 0.0925  -0.0212 63   LEU A CG  
358  C CD1 . LEU A 63  ? 1.3672 1.2385 1.3025 -0.1053 0.1037  -0.0155 63   LEU A CD1 
359  C CD2 . LEU A 63  ? 1.4445 1.2858 1.3818 -0.1221 0.0832  -0.0152 63   LEU A CD2 
360  N N   . PHE A 64  ? 1.2392 1.1210 1.2036 -0.0797 0.0757  -0.0352 64   PHE A N   
361  C CA  . PHE A 64  ? 1.2216 1.1159 1.1970 -0.0802 0.0669  -0.0349 64   PHE A CA  
362  C C   . PHE A 64  ? 1.2428 1.1497 1.2223 -0.0806 0.0626  -0.0355 64   PHE A C   
363  O O   . PHE A 64  ? 1.2533 1.1677 1.2455 -0.0833 0.0592  -0.0384 64   PHE A O   
364  C CB  . PHE A 64  ? 1.1812 1.0722 1.1481 -0.0805 0.0555  -0.0274 64   PHE A CB  
365  C CG  . PHE A 64  ? 1.1785 1.0522 1.1400 -0.0741 0.0494  -0.0319 64   PHE A CG  
366  C CD1 . PHE A 64  ? 1.1772 1.0382 1.1256 -0.0678 0.0538  -0.0330 64   PHE A CD1 
367  C CD2 . PHE A 64  ? 1.1835 1.0528 1.1489 -0.0695 0.0366  -0.0375 64   PHE A CD2 
368  C CE1 . PHE A 64  ? 1.1784 1.0255 1.1160 -0.0540 0.0455  -0.0409 64   PHE A CE1 
369  C CE2 . PHE A 64  ? 1.2094 1.0615 1.1621 -0.0535 0.0260  -0.0467 64   PHE A CE2 
370  C CZ  . PHE A 64  ? 1.1996 1.0421 1.1376 -0.0442 0.0306  -0.0491 64   PHE A CZ  
371  N N   . ALA A 65  ? 1.2585 1.1710 1.2247 -0.0737 0.0616  -0.0346 65   ALA A N   
372  C CA  . ALA A 65  ? 1.2940 1.2231 1.2576 -0.0655 0.0558  -0.0388 65   ALA A CA  
373  C C   . ALA A 65  ? 1.3538 1.2637 1.3242 -0.0691 0.0541  -0.0470 65   ALA A C   
374  O O   . ALA A 65  ? 1.3669 1.2908 1.3467 -0.0691 0.0492  -0.0491 65   ALA A O   
375  C CB  . ALA A 65  ? 1.3133 1.2472 1.2540 -0.0473 0.0530  -0.0433 65   ALA A CB  
376  N N   . LEU A 66  ? 1.3984 1.2794 1.3636 -0.0755 0.0562  -0.0486 66   LEU A N   
377  C CA  . LEU A 66  ? 1.4661 1.3324 1.4377 -0.0869 0.0514  -0.0501 66   LEU A CA  
378  C C   . LEU A 66  ? 1.4508 1.3425 1.4492 -0.0959 0.0575  -0.0480 66   LEU A C   
379  O O   . LEU A 66  ? 1.4887 1.3844 1.4974 -0.1009 0.0519  -0.0503 66   LEU A O   
380  C CB  . LEU A 66  ? 1.5145 1.3543 1.4753 -0.1004 0.0500  -0.0441 66   LEU A CB  
381  C CG  . LEU A 66  ? 1.5724 1.3685 1.4992 -0.0924 0.0342  -0.0479 66   LEU A CG  
382  C CD1 . LEU A 66  ? 1.6226 1.3924 1.5397 -0.1147 0.0296  -0.0359 66   LEU A CD1 
383  C CD2 . LEU A 66  ? 1.6349 1.4074 1.5457 -0.0818 0.0133  -0.0581 66   LEU A CD2 
384  N N   . ALA A 67  ? 1.4073 1.3130 1.4130 -0.0948 0.0656  -0.0454 67   ALA A N   
385  C CA  . ALA A 67  ? 1.4057 1.3320 1.4294 -0.0946 0.0665  -0.0476 67   ALA A CA  
386  C C   . ALA A 67  ? 1.4022 1.3338 1.4319 -0.0913 0.0570  -0.0500 67   ALA A C   
387  O O   . ALA A 67  ? 1.4200 1.3635 1.4634 -0.0912 0.0538  -0.0537 67   ALA A O   
388  C CB  . ALA A 67  ? 1.3710 1.3009 1.3907 -0.0860 0.0693  -0.0483 67   ALA A CB  
389  N N   . TYR A 68  ? 1.3928 1.3233 1.4116 -0.0881 0.0520  -0.0468 68   TYR A N   
390  C CA  . TYR A 68  ? 1.3992 1.3452 1.4226 -0.0882 0.0424  -0.0446 68   TYR A CA  
391  C C   . TYR A 68  ? 1.4554 1.4043 1.4811 -0.0855 0.0401  -0.0512 68   TYR A C   
392  O O   . TYR A 68  ? 1.4663 1.4271 1.5013 -0.0868 0.0339  -0.0521 68   TYR A O   
393  C CB  . TYR A 68  ? 1.3652 1.3289 1.3772 -0.0881 0.0367  -0.0335 68   TYR A CB  
394  C CG  . TYR A 68  ? 1.3363 1.2907 1.3436 -0.0955 0.0287  -0.0237 68   TYR A CG  
395  C CD1 . TYR A 68  ? 1.3482 1.2884 1.3584 -0.1007 0.0139  -0.0220 68   TYR A CD1 
396  C CD2 . TYR A 68  ? 1.3070 1.2607 1.3022 -0.0956 0.0308  -0.0170 68   TYR A CD2 
397  C CE1 . TYR A 68  ? 1.3352 1.2524 1.3322 -0.1054 -0.0026 -0.0144 68   TYR A CE1 
398  C CE2 . TYR A 68  ? 1.2923 1.2298 1.2790 -0.1032 0.0180  -0.0076 68   TYR A CE2 
399  C CZ  . TYR A 68  ? 1.3049 1.2201 1.2903 -0.1079 -0.0007 -0.0066 68   TYR A CZ  
400  O OH  . TYR A 68  ? 1.3011 1.1863 1.2695 -0.1134 -0.0219 0.0012  68   TYR A OH  
401  N N   . LEU A 69  ? 1.5012 1.4325 1.5141 -0.0814 0.0410  -0.0561 69   LEU A N   
402  C CA  . LEU A 69  ? 1.5750 1.4931 1.5805 -0.0768 0.0310  -0.0640 69   LEU A CA  
403  C C   . LEU A 69  ? 1.6292 1.5371 1.6511 -0.0929 0.0290  -0.0639 69   LEU A C   
404  O O   . LEU A 69  ? 1.6861 1.5862 1.7076 -0.0931 0.0181  -0.0687 69   LEU A O   
405  C CB  . LEU A 69  ? 1.6155 1.5056 1.5914 -0.0642 0.0228  -0.0700 69   LEU A CB  
406  C CG  . LEU A 69  ? 1.5777 1.4928 1.5352 -0.0415 0.0224  -0.0724 69   LEU A CG  
407  C CD1 . LEU A 69  ? 1.6279 1.5094 1.5497 -0.0205 0.0084  -0.0840 69   LEU A CD1 
408  C CD2 . LEU A 69  ? 1.5504 1.5103 1.5121 -0.0307 0.0194  -0.0729 69   LEU A CD2 
409  N N   . ALA A 70  ? 1.6224 1.5374 1.6577 -0.1051 0.0385  -0.0578 70   ALA A N   
410  C CA  . ALA A 70  ? 1.6685 1.5987 1.7238 -0.1198 0.0389  -0.0546 70   ALA A CA  
411  C C   . ALA A 70  ? 1.6550 1.6097 1.7287 -0.1136 0.0390  -0.0597 70   ALA A C   
412  O O   . ALA A 70  ? 1.6956 1.6698 1.7868 -0.1211 0.0376  -0.0594 70   ALA A O   
413  C CB  . ALA A 70  ? 1.6591 1.6087 1.7216 -0.1287 0.0499  -0.0468 70   ALA A CB  
414  N N   . CYS A 71  ? 1.6153 1.5707 1.6836 -0.1019 0.0378  -0.0619 71   CYS A N   
415  C CA  . CYS A 71  ? 1.6120 1.5803 1.6909 -0.0977 0.0317  -0.0645 71   CYS A CA  
416  C C   . CYS A 71  ? 1.6400 1.6091 1.7162 -0.0963 0.0230  -0.0660 71   CYS A C   
417  O O   . CYS A 71  ? 1.6453 1.6237 1.7292 -0.0956 0.0156  -0.0666 71   CYS A O   
418  C CB  . CYS A 71  ? 1.5618 1.5262 1.6315 -0.0924 0.0275  -0.0603 71   CYS A CB  
419  S SG  . CYS A 71  ? 1.5547 1.5174 1.6236 -0.0834 0.0290  -0.0646 71   CYS A SG  
420  N N   . GLY A 72  ? 1.6087 1.6744 1.6539 0.0065  -0.0528 0.1056  72   GLY A N   
421  C CA  . GLY A 72  ? 1.6381 1.7182 1.6713 -0.0066 -0.0647 0.1027  72   GLY A CA  
422  C C   . GLY A 72  ? 1.6020 1.6550 1.6247 0.0003  -0.0600 0.0826  72   GLY A C   
423  O O   . GLY A 72  ? 1.5783 1.5968 1.5878 0.0040  -0.0587 0.0604  72   GLY A O   
424  N N   . ASP A 73  ? 1.6024 1.6775 1.6332 0.0005  -0.0586 0.0945  73   ASP A N   
425  C CA  . ASP A 73  ? 1.5746 1.6309 1.5958 0.0048  -0.0553 0.0782  73   ASP A CA  
426  C C   . ASP A 73  ? 1.5309 1.5823 1.5759 0.0216  -0.0391 0.0934  73   ASP A C   
427  O O   . ASP A 73  ? 1.5458 1.6231 1.6055 0.0215  -0.0384 0.1129  73   ASP A O   
428  C CB  . ASP A 73  ? 1.6222 1.7073 1.6299 -0.0126 -0.0658 0.0762  73   ASP A CB  
429  C CG  . ASP A 73  ? 1.7763 1.8708 1.7633 -0.0348 -0.0775 0.0639  73   ASP A CG  
430  O OD1 . ASP A 73  ? 1.9062 1.9964 1.8715 -0.0484 -0.0806 0.0405  73   ASP A OD1 
431  O OD2 . ASP A 73  ? 1.9421 2.0477 1.9349 -0.0401 -0.0816 0.0765  73   ASP A OD2 
432  N N   . VAL A 74  ? 1.4851 1.5039 1.5341 0.0335  -0.0249 0.0846  74   VAL A N   
433  C CA  . VAL A 74  ? 1.4525 1.4568 1.5236 0.0471  -0.0041 0.0939  74   VAL A CA  
434  C C   . VAL A 74  ? 1.4116 1.3836 1.4641 0.0463  0.0009  0.0705  74   VAL A C   
435  O O   . VAL A 74  ? 1.3955 1.3430 1.4579 0.0529  0.0206  0.0685  74   VAL A O   
436  C CB  . VAL A 74  ? 1.4502 1.4432 1.5410 0.0578  0.0154  0.1004  74   VAL A CB  
437  C CG1 . VAL A 74  ? 1.4835 1.5161 1.6125 0.0652  0.0186  0.1382  74   VAL A CG1 
438  C CG2 . VAL A 74  ? 1.4529 1.4351 1.5196 0.0498  0.0081  0.0807  74   VAL A CG2 
439  N N   . ILE A 75  ? 1.3981 1.3713 1.4253 0.0368  -0.0152 0.0533  75   ILE A N   
440  C CA  . ILE A 75  ? 1.3622 1.3166 1.3733 0.0343  -0.0142 0.0355  75   ILE A CA  
441  C C   . ILE A 75  ? 1.3778 1.3544 1.3855 0.0297  -0.0241 0.0384  75   ILE A C   
442  O O   . ILE A 75  ? 1.3966 1.3845 1.3901 0.0226  -0.0366 0.0274  75   ILE A O   
443  C CB  . ILE A 75  ? 1.3481 1.2883 1.3379 0.0287  -0.0221 0.0147  75   ILE A CB  
444  C CG1 . ILE A 75  ? 1.3398 1.2719 1.3307 0.0285  -0.0178 0.0147  75   ILE A CG1 
445  C CG2 . ILE A 75  ? 1.3226 1.2481 1.2994 0.0250  -0.0182 0.0016  75   ILE A CG2 
446  C CD1 . ILE A 75  ? 1.3266 1.2508 1.3022 0.0214  -0.0262 0.0020  75   ILE A CD1 
447  N N   . GLU A 76  ? 1.3701 1.3519 1.3921 0.0327  -0.0163 0.0527  76   GLU A N   
448  C CA  . GLU A 76  ? 1.3923 1.4010 1.4103 0.0257  -0.0254 0.0571  76   GLU A CA  
449  C C   . GLU A 76  ? 1.3827 1.3834 1.3759 0.0206  -0.0321 0.0310  76   GLU A C   
450  O O   . GLU A 76  ? 1.3546 1.3287 1.3388 0.0229  -0.0276 0.0168  76   GLU A O   
451  C CB  . GLU A 76  ? 1.3968 1.4068 1.4352 0.0294  -0.0151 0.0769  76   GLU A CB  
452  C CG  . GLU A 76  ? 1.4225 1.4488 1.4979 0.0371  -0.0069 0.1116  76   GLU A CG  
453  C CD  . GLU A 76  ? 1.4655 1.5083 1.5663 0.0378  -0.0022 0.1393  76   GLU A CD  
454  O OE1 . GLU A 76  ? 1.4636 1.4709 1.5836 0.0467  0.0172  0.1438  76   GLU A OE1 
455  O OE2 . GLU A 76  ? 1.5075 1.5990 1.6086 0.0268  -0.0168 0.1561  76   GLU A OE2 
456  N N   . ASN A 77  ? 1.4127 1.4409 1.3963 0.0121  -0.0413 0.0264  77   ASN A N   
457  C CA  . ASN A 77  ? 1.4159 1.4423 1.3835 0.0095  -0.0440 0.0043  77   ASN A CA  
458  C C   . ASN A 77  ? 1.4070 1.4119 1.3677 0.0127  -0.0458 -0.0144 77   ASN A C   
459  O O   . ASN A 77  ? 1.4088 1.4082 1.3653 0.0151  -0.0452 -0.0286 77   ASN A O   
460  C CB  . ASN A 77  ? 1.3932 1.4113 1.3606 0.0121  -0.0390 0.0047  77   ASN A CB  
461  C CG  . ASN A 77  ? 1.4199 1.4659 1.3938 0.0063  -0.0393 0.0215  77   ASN A CG  
462  O OD1 . ASN A 77  ? 1.4832 1.5640 1.4538 -0.0027 -0.0452 0.0246  77   ASN A OD1 
463  N ND2 . ASN A 77  ? 1.3938 1.4260 1.3762 0.0080  -0.0321 0.0323  77   ASN A ND2 
464  N N   . ALA A 78  ? 1.4034 1.4000 1.3673 0.0128  -0.0478 -0.0108 78   ALA A N   
465  C CA  . ALA A 78  ? 1.4155 1.3928 1.3771 0.0145  -0.0503 -0.0235 78   ALA A CA  
466  C C   . ALA A 78  ? 1.4871 1.4719 1.4428 0.0043  -0.0541 -0.0333 78   ALA A C   
467  O O   . ALA A 78  ? 1.5186 1.5261 1.4716 -0.0062 -0.0574 -0.0238 78   ALA A O   
468  C CB  . ALA A 78  ? 1.3700 1.3313 1.3373 0.0186  -0.0490 -0.0144 78   ALA A CB  
469  N N   . ARG A 79  ? 1.5266 1.4935 1.4823 0.0055  -0.0522 -0.0508 79   ARG A N   
470  C CA  . ARG A 79  ? 1.6058 1.5693 1.5544 -0.0071 -0.0516 -0.0655 79   ARG A CA  
471  C C   . ARG A 79  ? 1.6097 1.5684 1.5595 -0.0130 -0.0585 -0.0544 79   ARG A C   
472  O O   . ARG A 79  ? 1.5793 1.5183 1.5395 -0.0041 -0.0605 -0.0480 79   ARG A O   
473  C CB  . ARG A 79  ? 1.6455 1.5826 1.6032 -0.0007 -0.0430 -0.0852 79   ARG A CB  
474  C CG  . ARG A 79  ? 1.6610 1.6068 1.6214 0.0061  -0.0342 -0.0959 79   ARG A CG  
475  C CD  . ARG A 79  ? 1.6978 1.6183 1.6810 0.0199  -0.0241 -0.1052 79   ARG A CD  
476  N NE  . ARG A 79  ? 1.6498 1.5640 1.6513 0.0335  -0.0313 -0.0835 79   ARG A NE  
477  C CZ  . ARG A 79  ? 1.6711 1.5650 1.6976 0.0427  -0.0292 -0.0775 79   ARG A CZ  
478  N NH1 . ARG A 79  ? 1.7529 1.6214 1.7923 0.0429  -0.0174 -0.0938 79   ARG A NH1 
479  N NH2 . ARG A 79  ? 1.6082 1.5083 1.6477 0.0493  -0.0377 -0.0546 79   ARG A NH2 
480  N N   . PRO A 80  ? 1.6592 1.6425 1.5982 -0.0310 -0.0629 -0.0499 80   PRO A N   
481  C CA  . PRO A 80  ? 1.6606 1.6495 1.6024 -0.0376 -0.0701 -0.0341 80   PRO A CA  
482  C C   . PRO A 80  ? 1.8319 1.7870 1.7775 -0.0377 -0.0710 -0.0432 80   PRO A C   
483  O O   . PRO A 80  ? 2.1726 2.1050 2.1139 -0.0448 -0.0657 -0.0654 80   PRO A O   
484  C CB  . PRO A 80  ? 1.7282 1.7543 1.6547 -0.0639 -0.0745 -0.0322 80   PRO A CB  
485  C CG  . PRO A 80  ? 1.7382 1.7879 1.6576 -0.0671 -0.0708 -0.0367 80   PRO A CG  
486  C CD  . PRO A 80  ? 1.7238 1.7370 1.6461 -0.0507 -0.0615 -0.0595 80   PRO A CD  
487  N N   . GLY A 81  ? 1.6364 1.5885 1.5924 -0.0302 -0.0755 -0.0256 81   GLY A N   
488  C CA  . GLY A 81  ? 1.6564 1.5843 1.6183 -0.0327 -0.0789 -0.0271 81   GLY A CA  
489  C C   . GLY A 81  ? 1.6302 1.5292 1.6055 -0.0182 -0.0750 -0.0333 81   GLY A C   
490  O O   . GLY A 81  ? 1.6478 1.5292 1.6345 -0.0181 -0.0782 -0.0284 81   GLY A O   
491  N N   . SER A 82  ? 1.7078 1.5764 1.5797 0.0399  -0.1247 -0.1034 82   SER A N   
492  C CA  . SER A 82  ? 1.6765 1.5514 1.5587 0.0440  -0.1218 -0.1083 82   SER A CA  
493  C C   . SER A 82  ? 1.6128 1.4862 1.5002 0.0438  -0.1219 -0.0999 82   SER A C   
494  O O   . SER A 82  ? 1.5670 1.4421 1.4509 0.0403  -0.1183 -0.0942 82   SER A O   
495  C CB  . SER A 82  ? 1.6725 1.5587 1.5509 0.0414  -0.1136 -0.1172 82   SER A CB  
496  O OG  . SER A 82  ? 1.6555 1.5476 1.5501 0.0464  -0.1129 -0.1228 82   SER A OG  
497  N N   . PHE A 83  ? 1.6152 1.4843 1.5112 0.0457  -0.1276 -0.0996 83   PHE A N   
498  C CA  . PHE A 83  ? 1.5662 1.4330 1.4627 0.0414  -0.1282 -0.0925 83   PHE A CA  
499  C C   . PHE A 83  ? 1.5224 1.3970 1.4222 0.0431  -0.1241 -0.0949 83   PHE A C   
500  O O   . PHE A 83  ? 1.4752 1.3538 1.3707 0.0393  -0.1180 -0.0904 83   PHE A O   
501  C CB  . PHE A 83  ? 1.5947 1.4499 1.4943 0.0389  -0.1397 -0.0895 83   PHE A CB  
502  C CG  . PHE A 83  ? 1.5619 1.4122 1.4557 0.0293  -0.1417 -0.0818 83   PHE A CG  
503  C CD1 . PHE A 83  ? 1.5431 1.3930 1.4276 0.0187  -0.1353 -0.0778 83   PHE A CD1 
504  C CD2 . PHE A 83  ? 1.5532 1.3994 1.4524 0.0292  -0.1502 -0.0803 83   PHE A CD2 
505  C CE1 . PHE A 83  ? 1.5203 1.3665 1.3957 0.0058  -0.1352 -0.0726 83   PHE A CE1 
506  C CE2 . PHE A 83  ? 1.5164 1.3559 1.4056 0.0172  -0.1534 -0.0721 83   PHE A CE2 
507  C CZ  . PHE A 83  ? 1.5121 1.3518 1.3865 0.0043  -0.1448 -0.0683 83   PHE A CZ  
508  N N   . THR A 84  ? 1.5410 1.4190 1.4521 0.0486  -0.1271 -0.1041 84   THR A N   
509  C CA  . THR A 84  ? 1.5093 1.3967 1.4287 0.0507  -0.1231 -0.1099 84   THR A CA  
510  C C   . THR A 84  ? 1.4618 1.3579 1.3681 0.0470  -0.1111 -0.1072 84   THR A C   
511  O O   . THR A 84  ? 1.4150 1.3138 1.3213 0.0453  -0.1086 -0.1029 84   THR A O   
512  C CB  . THR A 84  ? 1.5599 1.4552 1.4963 0.0559  -0.1229 -0.1267 84   THR A CB  
513  O OG1 . THR A 84  ? 1.6001 1.4860 1.5567 0.0604  -0.1379 -0.1294 84   THR A OG1 
514  C CG2 . THR A 84  ? 1.5451 1.4542 1.4915 0.0565  -0.1150 -0.1367 84   THR A CG2 
515  N N   . ASP A 85  ? 1.4749 1.3737 1.3696 0.0443  -0.1059 -0.1088 85   ASP A N   
516  C CA  . ASP A 85  ? 1.4370 1.3410 1.3194 0.0391  -0.0988 -0.1050 85   ASP A CA  
517  C C   . ASP A 85  ? 1.3751 1.2743 1.2557 0.0368  -0.0996 -0.0936 85   ASP A C   
518  O O   . ASP A 85  ? 1.3363 1.2400 1.2150 0.0344  -0.0953 -0.0905 85   ASP A O   
519  C CB  . ASP A 85  ? 1.4902 1.3943 1.3575 0.0329  -0.0970 -0.1082 85   ASP A CB  
520  C CG  . ASP A 85  ? 1.5524 1.4676 1.4191 0.0298  -0.0898 -0.1237 85   ASP A CG  
521  O OD1 . ASP A 85  ? 1.5559 1.4791 1.4407 0.0351  -0.0873 -0.1329 85   ASP A OD1 
522  O OD2 . ASP A 85  ? 1.6225 1.5381 1.4716 0.0201  -0.0871 -0.1278 85   ASP A OD2 
523  N N   . ALA A 86  ? 1.3641 1.2556 1.2479 0.0367  -0.1043 -0.0897 86   ALA A N   
524  C CA  . ALA A 86  ? 1.3149 1.2048 1.2031 0.0330  -0.1031 -0.0843 86   ALA A CA  
525  C C   . ALA A 86  ? 1.2680 1.1597 1.1589 0.0302  -0.1001 -0.0827 86   ALA A C   
526  O O   . ALA A 86  ? 1.2343 1.1290 1.1290 0.0255  -0.0953 -0.0812 86   ALA A O   
527  C CB  . ALA A 86  ? 1.3374 1.2207 1.2308 0.0317  -0.1075 -0.0840 86   ALA A CB  
528  N N   . PHE A 87  ? 1.2672 1.1561 1.1576 0.0321  -0.1045 -0.0837 87   PHE A N   
529  C CA  . PHE A 87  ? 1.2250 1.1116 1.1147 0.0273  -0.1061 -0.0803 87   PHE A CA  
530  C C   . PHE A 87  ? 1.1881 1.0830 1.0792 0.0294  -0.1011 -0.0810 87   PHE A C   
531  O O   . PHE A 87  ? 1.1631 1.0591 1.0513 0.0235  -0.0976 -0.0773 87   PHE A O   
532  C CB  . PHE A 87  ? 1.2575 1.1345 1.1502 0.0281  -0.1183 -0.0800 87   PHE A CB  
533  C CG  . PHE A 87  ? 1.2366 1.1067 1.1267 0.0207  -0.1252 -0.0742 87   PHE A CG  
534  C CD1 . PHE A 87  ? 1.2356 1.0959 1.1126 0.0062  -0.1285 -0.0673 87   PHE A CD1 
535  C CD2 . PHE A 87  ? 1.2135 1.0865 1.1136 0.0258  -0.1290 -0.0762 87   PHE A CD2 
536  C CE1 . PHE A 87  ? 1.2267 1.0775 1.0956 -0.0047 -0.1372 -0.0602 87   PHE A CE1 
537  C CE2 . PHE A 87  ? 1.1888 1.0526 1.0864 0.0179  -0.1388 -0.0694 87   PHE A CE2 
538  C CZ  . PHE A 87  ? 1.1898 1.0412 1.0694 0.0018  -0.1438 -0.0601 87   PHE A CZ  
539  N N   . PHE A 88  ? 1.1871 1.0886 1.0817 0.0359  -0.0995 -0.0870 88   PHE A N   
540  C CA  . PHE A 88  ? 1.1484 1.0589 1.0436 0.0364  -0.0933 -0.0886 88   PHE A CA  
541  C C   . PHE A 88  ? 1.1145 1.0289 1.0023 0.0327  -0.0863 -0.0845 88   PHE A C   
542  O O   . PHE A 88  ? 1.0797 0.9996 0.9670 0.0311  -0.0818 -0.0828 88   PHE A O   
543  C CB  . PHE A 88  ? 1.1810 1.0997 1.0833 0.0408  -0.0916 -0.0995 88   PHE A CB  
544  C CG  . PHE A 88  ? 1.2142 1.1298 1.1344 0.0457  -0.1009 -0.1059 88   PHE A CG  
545  C CD1 . PHE A 88  ? 1.2016 1.1088 1.1281 0.0445  -0.1105 -0.0994 88   PHE A CD1 
546  C CD2 . PHE A 88  ? 1.2764 1.1960 1.2082 0.0497  -0.1019 -0.1189 88   PHE A CD2 
547  C CE1 . PHE A 88  ? 1.2321 1.1324 1.1787 0.0483  -0.1247 -0.1038 88   PHE A CE1 
548  C CE2 . PHE A 88  ? 1.3012 1.2171 1.2578 0.0552  -0.1136 -0.1265 88   PHE A CE2 
549  C CZ  . PHE A 88  ? 1.2943 1.1993 1.2594 0.0549  -0.1269 -0.1180 88   PHE A CZ  
550  N N   . PHE A 89  ? 1.1208 1.0314 1.0059 0.0313  -0.0877 -0.0829 89   PHE A N   
551  C CA  . PHE A 89  ? 1.0867 0.9980 0.9730 0.0278  -0.0860 -0.0790 89   PHE A CA  
552  C C   . PHE A 89  ? 1.0553 0.9681 0.9495 0.0242  -0.0820 -0.0776 89   PHE A C   
553  O O   . PHE A 89  ? 1.0244 0.9421 0.9212 0.0222  -0.0779 -0.0764 89   PHE A O   
554  C CB  . PHE A 89  ? 1.0982 1.0029 0.9873 0.0269  -0.0917 -0.0780 89   PHE A CB  
555  C CG  . PHE A 89  ? 1.0532 0.9567 0.9519 0.0238  -0.0944 -0.0750 89   PHE A CG  
556  C CD1 . PHE A 89  ? 1.0017 0.9060 0.8933 0.0210  -0.0960 -0.0713 89   PHE A CD1 
557  C CD2 . PHE A 89  ? 1.0262 0.9280 0.9442 0.0227  -0.0962 -0.0775 89   PHE A CD2 
558  C CE1 . PHE A 89  ? 0.9944 0.8952 0.8990 0.0181  -0.1025 -0.0680 89   PHE A CE1 
559  C CE2 . PHE A 89  ? 1.0154 0.9164 0.9519 0.0208  -0.1010 -0.0775 89   PHE A CE2 
560  C CZ  . PHE A 89  ? 0.9783 0.8773 0.9085 0.0190  -0.1059 -0.0717 89   PHE A CZ  
561  N N   . SER A 90  ? 1.0631 0.9718 0.9598 0.0211  -0.0829 -0.0787 90   SER A N   
562  C CA  . SER A 90  ? 1.0514 0.9616 0.9514 0.0123  -0.0776 -0.0799 90   SER A CA  
563  C C   . SER A 90  ? 1.0164 0.9295 0.9099 0.0094  -0.0746 -0.0772 90   SER A C   
564  O O   . SER A 90  ? 0.9876 0.9066 0.8859 0.0052  -0.0681 -0.0787 90   SER A O   
565  C CB  . SER A 90  ? 1.0839 0.9872 0.9789 0.0059  -0.0805 -0.0804 90   SER A CB  
566  O OG  . SER A 90  ? 1.1244 1.0305 1.0205 -0.0077 -0.0730 -0.0844 90   SER A OG  
567  N N   . VAL A 91  ? 1.0228 0.9313 0.9090 0.0120  -0.0808 -0.0743 91   VAL A N   
568  C CA  . VAL A 91  ? 1.0032 0.9132 0.8864 0.0108  -0.0810 -0.0716 91   VAL A CA  
569  C C   . VAL A 91  ? 0.9830 0.9027 0.8698 0.0142  -0.0737 -0.0725 91   VAL A C   
570  O O   . VAL A 91  ? 0.9755 0.8982 0.8610 0.0089  -0.0692 -0.0711 91   VAL A O   
571  C CB  . VAL A 91  ? 1.0219 0.9280 0.9084 0.0176  -0.0907 -0.0718 91   VAL A CB  
572  C CG1 . VAL A 91  ? 0.9833 0.8927 0.8723 0.0179  -0.0911 -0.0706 91   VAL A CG1 
573  C CG2 . VAL A 91  ? 1.0483 0.9411 0.9316 0.0121  -0.1024 -0.0685 91   VAL A CG2 
574  N N   . GLN A 92  ? 0.9962 0.9197 0.8853 0.0209  -0.0732 -0.0745 92   GLN A N   
575  C CA  . GLN A 92  ? 0.9814 0.9118 0.8705 0.0218  -0.0688 -0.0739 92   GLN A CA  
576  C C   . GLN A 92  ? 0.9638 0.8956 0.8603 0.0175  -0.0656 -0.0732 92   GLN A C   
577  O O   . GLN A 92  ? 0.9510 0.8874 0.8490 0.0165  -0.0626 -0.0718 92   GLN A O   
578  C CB  . GLN A 92  ? 1.0098 0.9412 0.8938 0.0245  -0.0705 -0.0756 92   GLN A CB  
579  C CG  . GLN A 92  ? 1.0327 0.9688 0.9148 0.0276  -0.0697 -0.0814 92   GLN A CG  
580  C CD  . GLN A 92  ? 1.0654 1.0026 0.9391 0.0259  -0.0696 -0.0859 92   GLN A CD  
581  O OE1 . GLN A 92  ? 1.0899 1.0314 0.9663 0.0277  -0.0685 -0.0948 92   GLN A OE1 
582  N NE2 . GLN A 92  ? 1.0588 0.9914 0.9239 0.0208  -0.0723 -0.0805 92   GLN A NE2 
583  N N   . THR A 93  ? 0.9669 0.8954 0.8716 0.0151  -0.0666 -0.0757 93   THR A N   
584  C CA  . THR A 93  ? 0.9546 0.8861 0.8768 0.0110  -0.0639 -0.0800 93   THR A CA  
585  C C   . THR A 93  ? 0.9270 0.8635 0.8502 0.0019  -0.0548 -0.0841 93   THR A C   
586  O O   . THR A 93  ? 0.9051 0.8477 0.8369 -0.0011 -0.0496 -0.0868 93   THR A O   
587  C CB  . THR A 93  ? 0.9836 0.9115 0.9191 0.0106  -0.0676 -0.0846 93   THR A CB  
588  O OG1 . THR A 93  ? 1.0401 0.9613 0.9700 0.0164  -0.0772 -0.0798 93   THR A OG1 
589  C CG2 . THR A 93  ? 0.9940 0.9267 0.9585 0.0072  -0.0660 -0.0930 93   THR A CG2 
590  N N   . MET A 94  ? 0.9263 0.8590 0.8386 -0.0045 -0.0538 -0.0845 94   MET A N   
591  C CA  . MET A 94  ? 0.8973 0.8322 0.8041 -0.0189 -0.0460 -0.0882 94   MET A CA  
592  C C   . MET A 94  ? 0.8654 0.8015 0.7621 -0.0196 -0.0452 -0.0826 94   MET A C   
593  O O   . MET A 94  ? 0.8504 0.7921 0.7488 -0.0293 -0.0370 -0.0871 94   MET A O   
594  C CB  . MET A 94  ? 0.9206 0.8469 0.8112 -0.0289 -0.0492 -0.0863 94   MET A CB  
595  C CG  . MET A 94  ? 0.9384 0.8642 0.8144 -0.0500 -0.0424 -0.0887 94   MET A CG  
596  S SD  . MET A 94  ? 1.0307 0.9421 0.8831 -0.0661 -0.0500 -0.0841 94   MET A SD  
597  C CE  . MET A 94  ? 1.0130 0.9088 0.8483 -0.0609 -0.0686 -0.0680 94   MET A CE  
598  N N   . ALA A 95  ? 0.8461 0.7780 0.7345 -0.0102 -0.0529 -0.0749 95   ALA A N   
599  C CA  . ALA A 95  ? 0.8192 0.7529 0.7018 -0.0107 -0.0524 -0.0709 95   ALA A CA  
600  C C   . ALA A 95  ? 0.8008 0.7437 0.6947 -0.0049 -0.0469 -0.0728 95   ALA A C   
601  O O   . ALA A 95  ? 0.7818 0.7282 0.6732 -0.0057 -0.0445 -0.0706 95   ALA A O   
602  C CB  . ALA A 95  ? 0.8208 0.7490 0.6984 -0.0032 -0.0623 -0.0658 95   ALA A CB  
603  N N   . THR A 96  ? 0.8067 0.7515 0.7130 0.0000  -0.0474 -0.0760 96   THR A N   
604  C CA  . THR A 96  ? 0.7962 0.7450 0.7123 0.0046  -0.0482 -0.0754 96   THR A CA  
605  C C   . THR A 96  ? 0.8135 0.7629 0.7177 0.0104  -0.0512 -0.0694 96   THR A C   
606  O O   . THR A 96  ? 0.8103 0.7633 0.7160 0.0101  -0.0500 -0.0675 96   THR A O   
607  C CB  . THR A 96  ? 0.7806 0.7360 0.7087 -0.0012 -0.0413 -0.0799 96   THR A CB  
608  O OG1 . THR A 96  ? 0.7396 0.6973 0.6557 -0.0011 -0.0391 -0.0748 96   THR A OG1 
609  C CG2 . THR A 96  ? 0.7497 0.7082 0.6837 -0.0125 -0.0330 -0.0891 96   THR A CG2 
610  N N   . ILE A 97  ? 0.8292 0.7762 0.7236 0.0142  -0.0543 -0.0686 97   ILE A N   
611  C CA  . ILE A 97  ? 0.8592 0.8101 0.7458 0.0172  -0.0545 -0.0680 97   ILE A CA  
612  C C   . ILE A 97  ? 0.8938 0.8427 0.7753 0.0155  -0.0582 -0.0663 97   ILE A C   
613  O O   . ILE A 97  ? 0.9045 0.8566 0.7778 0.0121  -0.0573 -0.0646 97   ILE A O   
614  C CB  . ILE A 97  ? 0.8852 0.8362 0.7698 0.0211  -0.0564 -0.0721 97   ILE A CB  
615  C CG1 . ILE A 97  ? 0.8635 0.8103 0.7519 0.0205  -0.0594 -0.0712 97   ILE A CG1 
616  C CG2 . ILE A 97  ? 0.8977 0.8572 0.7793 0.0217  -0.0530 -0.0769 97   ILE A CG2 
617  C CD1 . ILE A 97  ? 0.8765 0.8234 0.7716 0.0252  -0.0648 -0.0760 97   ILE A CD1 
618  N N   . GLY A 98  ? 0.9135 0.8558 0.7983 0.0156  -0.0637 -0.0661 98   GLY A N   
619  C CA  . GLY A 98  ? 0.9714 0.9070 0.8512 0.0114  -0.0719 -0.0622 98   GLY A CA  
620  C C   . GLY A 98  ? 1.0225 0.9594 0.8812 0.0049  -0.0718 -0.0610 98   GLY A C   
621  O O   . GLY A 98  ? 1.0342 0.9683 0.8857 -0.0023 -0.0762 -0.0554 98   GLY A O   
622  N N   . TYR A 99  ? 1.0459 0.9875 0.8958 0.0055  -0.0669 -0.0678 99   TYR A N   
623  C CA  . TYR A 99  ? 1.1106 1.0573 0.9415 -0.0038 -0.0627 -0.0719 99   TYR A CA  
624  C C   . TYR A 99  ? 1.1701 1.1048 0.9814 -0.0169 -0.0731 -0.0642 99   TYR A C   
625  O O   . TYR A 99  ? 1.1970 1.1298 0.9912 -0.0293 -0.0753 -0.0596 99   TYR A O   
626  C CB  . TYR A 99  ? 1.1329 1.0868 0.9645 -0.0014 -0.0564 -0.0844 99   TYR A CB  
627  C CG  . TYR A 99  ? 1.0931 1.0568 0.9440 0.0084  -0.0502 -0.0928 99   TYR A CG  
628  C CD1 . TYR A 99  ? 1.0837 1.0443 0.9493 0.0176  -0.0538 -0.0958 99   TYR A CD1 
629  C CD2 . TYR A 99  ? 1.0829 1.0571 0.9377 0.0074  -0.0434 -0.0971 99   TYR A CD2 
630  C CE1 . TYR A 99  ? 1.0709 1.0361 0.9549 0.0248  -0.0537 -0.1015 99   TYR A CE1 
631  C CE2 . TYR A 99  ? 1.0757 1.0562 0.9513 0.0159  -0.0419 -0.1040 99   TYR A CE2 
632  C CZ  . TYR A 99  ? 1.0733 1.0479 0.9633 0.0242  -0.0485 -0.1055 99   TYR A CZ  
633  O OH  . TYR A 99  ? 1.0886 1.0652 0.9996 0.0307  -0.0522 -0.1105 99   TYR A OH  
634  N N   . GLY A 100 ? 1.1907 1.1152 1.0040 -0.0155 -0.0819 -0.0616 100  GLY A N   
635  C CA  . GLY A 100 ? 1.2683 1.1774 1.0653 -0.0284 -0.0966 -0.0523 100  GLY A CA  
636  C C   . GLY A 100 ? 1.3416 1.2455 1.1200 -0.0365 -0.0991 -0.0553 100  GLY A C   
637  O O   . GLY A 100 ? 1.3820 1.2695 1.1544 -0.0434 -0.1151 -0.0463 100  GLY A O   
638  N N   . LYS A 101 ? 1.1778 1.3278 1.1310 0.0426  -0.0393 -0.0779 101  LYS A N   
639  C CA  . LYS A 101 ? 1.2416 1.4037 1.1965 0.0483  -0.0464 -0.0995 101  LYS A CA  
640  C C   . LYS A 101 ? 1.2298 1.3815 1.1995 0.0471  -0.0572 -0.1035 101  LYS A C   
641  O O   . LYS A 101 ? 1.2616 1.4207 1.2212 0.0497  -0.0648 -0.1049 101  LYS A O   
642  C CB  . LYS A 101 ? 1.2648 1.4288 1.2398 0.0503  -0.0443 -0.1166 101  LYS A CB  
643  C CG  . LYS A 101 ? 1.3243 1.5022 1.3044 0.0567  -0.0508 -0.1432 101  LYS A CG  
644  C CD  . LYS A 101 ? 1.4260 1.6266 1.3825 0.0619  -0.0422 -0.1537 101  LYS A CD  
645  C CE  . LYS A 101 ? 1.5016 1.7108 1.4809 0.0664  -0.0414 -0.1821 101  LYS A CE  
646  N NZ  . LYS A 101 ? 1.6079 1.8405 1.5613 0.0725  -0.0385 -0.2036 101  LYS A NZ  
647  N N   . LEU A 102 ? 1.1970 1.3311 1.1920 0.0426  -0.0582 -0.1038 102  LEU A N   
648  C CA  . LEU A 102 ? 1.1870 1.3108 1.2006 0.0407  -0.0656 -0.1068 102  LEU A CA  
649  C C   . LEU A 102 ? 1.1613 1.2760 1.1671 0.0360  -0.0618 -0.0885 102  LEU A C   
650  O O   . LEU A 102 ? 1.1348 1.2420 1.1306 0.0316  -0.0534 -0.0738 102  LEU A O   
651  C CB  . LEU A 102 ? 1.1591 1.2673 1.2013 0.0366  -0.0663 -0.1108 102  LEU A CB  
652  C CG  . LEU A 102 ? 1.2036 1.3212 1.2618 0.0417  -0.0708 -0.1305 102  LEU A CG  
653  C CD1 . LEU A 102 ? 1.1872 1.2894 1.2724 0.0369  -0.0710 -0.1289 102  LEU A CD1 
654  C CD2 . LEU A 102 ? 1.2572 1.3856 1.3278 0.0476  -0.0816 -0.1508 102  LEU A CD2 
655  N N   . ILE A 103 ? 1.1824 1.2984 1.1962 0.0371  -0.0689 -0.0906 103  ILE A N   
656  C CA  . ILE A 103 ? 1.1665 1.2744 1.1808 0.0329  -0.0654 -0.0756 103  ILE A CA  
657  C C   . ILE A 103 ? 1.1813 1.2865 1.2201 0.0332  -0.0735 -0.0816 103  ILE A C   
658  O O   . ILE A 103 ? 1.2239 1.3390 1.2704 0.0386  -0.0858 -0.0958 103  ILE A O   
659  C CB  . ILE A 103 ? 1.1888 1.3087 1.1792 0.0351  -0.0651 -0.0636 103  ILE A CB  
660  C CG1 . ILE A 103 ? 1.2520 1.3884 1.2350 0.0416  -0.0790 -0.0710 103  ILE A CG1 
661  C CG2 . ILE A 103 ? 1.1839 1.3093 1.1539 0.0355  -0.0569 -0.0586 103  ILE A CG2 
662  C CD1 . ILE A 103 ? 1.3066 1.4468 1.2835 0.0412  -0.0829 -0.0551 103  ILE A CD1 
663  N N   . PRO A 104 ? 1.1567 1.2485 1.2101 0.0273  -0.0664 -0.0720 104  PRO A N   
664  C CA  . PRO A 104 ? 1.1746 1.2617 1.2600 0.0266  -0.0712 -0.0776 104  PRO A CA  
665  C C   . PRO A 104 ? 1.2228 1.3235 1.3105 0.0322  -0.0860 -0.0784 104  PRO A C   
666  O O   . PRO A 104 ? 1.2283 1.3362 1.2952 0.0335  -0.0869 -0.0670 104  PRO A O   
667  C CB  . PRO A 104 ? 1.1371 1.2075 1.2322 0.0183  -0.0556 -0.0664 104  PRO A CB  
668  C CG  . PRO A 104 ? 1.1123 1.1842 1.1791 0.0171  -0.0493 -0.0536 104  PRO A CG  
669  C CD  . PRO A 104 ? 1.1149 1.1966 1.1571 0.0213  -0.0535 -0.0566 104  PRO A CD  
670  N N   . ILE A 105 ? 1.2642 1.3676 1.3787 0.0353  -0.0989 -0.0904 105  ILE A N   
671  C CA  . ILE A 105 ? 1.3206 1.4348 1.4399 0.0399  -0.1165 -0.0902 105  ILE A CA  
672  C C   . ILE A 105 ? 1.3287 1.4342 1.4913 0.0370  -0.1178 -0.0873 105  ILE A C   
673  O O   . ILE A 105 ? 1.3346 1.4414 1.5015 0.0362  -0.1203 -0.0751 105  ILE A O   
674  C CB  . ILE A 105 ? 1.3809 1.5091 1.4937 0.0473  -0.1366 -0.1077 105  ILE A CB  
675  C CG1 . ILE A 105 ? 1.3950 1.5357 1.4627 0.0509  -0.1350 -0.1104 105  ILE A CG1 
676  C CG2 . ILE A 105 ? 1.4237 1.5599 1.5449 0.0509  -0.1579 -0.1066 105  ILE A CG2 
677  C CD1 . ILE A 105 ? 1.4312 1.5846 1.4916 0.0575  -0.1506 -0.1329 105  ILE A CD1 
678  N N   . GLY A 106 ? 1.3321 1.4292 1.5315 0.0352  -0.1160 -0.0982 106  GLY A N   
679  C CA  . GLY A 106 ? 1.3511 1.4405 1.5982 0.0322  -0.1151 -0.0972 106  GLY A CA  
680  C C   . GLY A 106 ? 1.3153 1.3922 1.5683 0.0245  -0.0925 -0.0841 106  GLY A C   
681  O O   . GLY A 106 ? 1.2817 1.3523 1.5052 0.0203  -0.0761 -0.0778 106  GLY A O   
682  N N   . PRO A 107 ? 1.3295 1.4029 1.6225 0.0226  -0.0921 -0.0812 107  PRO A N   
683  C CA  . PRO A 107 ? 1.2990 1.3588 1.6075 0.0144  -0.0670 -0.0750 107  PRO A CA  
684  C C   . PRO A 107 ? 1.2784 1.3258 1.5935 0.0084  -0.0487 -0.0812 107  PRO A C   
685  O O   . PRO A 107 ? 1.2538 1.2892 1.5550 0.0008  -0.0260 -0.0760 107  PRO A O   
686  C CB  . PRO A 107 ? 1.3381 1.3979 1.7023 0.0146  -0.0727 -0.0762 107  PRO A CB  
687  C CG  . PRO A 107 ? 1.3785 1.4527 1.7399 0.0228  -0.1032 -0.0752 107  PRO A CG  
688  C CD  . PRO A 107 ? 1.3833 1.4649 1.7094 0.0276  -0.1151 -0.0837 107  PRO A CD  
689  N N   . LEU A 108 ? 1.2939 1.3437 1.6296 0.0114  -0.0594 -0.0919 108  LEU A N   
690  C CA  . LEU A 108 ? 1.2788 1.3175 1.6201 0.0058  -0.0445 -0.0952 108  LEU A CA  
691  C C   . LEU A 108 ? 1.2282 1.2633 1.5177 0.0036  -0.0372 -0.0893 108  LEU A C   
692  O O   . LEU A 108 ? 1.2122 1.2336 1.4895 -0.0047 -0.0166 -0.0827 108  LEU A O   
693  C CB  . LEU A 108 ? 1.3162 1.3593 1.6926 0.0104  -0.0604 -0.1082 108  LEU A CB  
694  C CG  . LEU A 108 ? 1.3716 1.4151 1.8089 0.0111  -0.0658 -0.1141 108  LEU A CG  
695  C CD1 . LEU A 108 ? 1.4088 1.4549 1.8866 0.0147  -0.0804 -0.1277 108  LEU A CD1 
696  C CD2 . LEU A 108 ? 1.3698 1.3999 1.8332 0.0015  -0.0369 -0.1075 108  LEU A CD2 
697  N N   . ALA A 109 ? 1.2082 1.2554 1.4672 0.0107  -0.0538 -0.0917 109  ALA A N   
698  C CA  . ALA A 109 ? 1.1620 1.2068 1.3782 0.0091  -0.0479 -0.0864 109  ALA A CA  
699  C C   . ALA A 109 ? 1.1223 1.1592 1.3123 0.0032  -0.0319 -0.0734 109  ALA A C   
700  O O   . ALA A 109 ? 1.0975 1.1232 1.2657 -0.0028 -0.0195 -0.0676 109  ALA A O   
701  C CB  . ALA A 109 ? 1.1699 1.2310 1.3606 0.0179  -0.0661 -0.0922 109  ALA A CB  
702  N N   . ASN A 110 ? 1.1152 1.1575 1.3090 0.0049  -0.0338 -0.0688 110  ASN A N   
703  C CA  . ASN A 110 ? 1.0816 1.1176 1.2548 0.0001  -0.0206 -0.0583 110  ASN A CA  
704  C C   . ASN A 110 ? 1.0796 1.0981 1.2649 -0.0098 0.0023  -0.0571 110  ASN A C   
705  O O   . ASN A 110 ? 1.0612 1.0709 1.2230 -0.0154 0.0152  -0.0510 110  ASN A O   
706  C CB  . ASN A 110 ? 1.0908 1.1375 1.2706 0.0046  -0.0299 -0.0527 110  ASN A CB  
707  C CG  . ASN A 110 ? 1.0821 1.1443 1.2307 0.0120  -0.0462 -0.0486 110  ASN A CG  
708  O OD1 . ASN A 110 ? 1.1062 1.1808 1.2591 0.0186  -0.0641 -0.0537 110  ASN A OD1 
709  N ND2 . ASN A 110 ? 1.0358 1.0972 1.1530 0.0105  -0.0396 -0.0401 110  ASN A ND2 
710  N N   . THR A 111 ? 1.1044 1.1178 1.3265 -0.0124 0.0079  -0.0636 111  THR A N   
711  C CA  . THR A 111 ? 1.1101 1.1071 1.3419 -0.0228 0.0328  -0.0631 111  THR A CA  
712  C C   . THR A 111 ? 1.0967 1.0817 1.2995 -0.0293 0.0415  -0.0594 111  THR A C   
713  O O   . THR A 111 ? 1.1001 1.0710 1.2798 -0.0385 0.0599  -0.0547 111  THR A O   
714  C CB  . THR A 111 ? 1.1521 1.1478 1.4388 -0.0243 0.0388  -0.0704 111  THR A CB  
715  O OG1 . THR A 111 ? 1.1539 1.1580 1.4714 -0.0199 0.0320  -0.0724 111  THR A OG1 
716  C CG2 . THR A 111 ? 1.1560 1.1346 1.4467 -0.0363 0.0686  -0.0698 111  THR A CG2 
717  N N   . LEU A 112 ? 1.0858 1.0759 1.2906 -0.0247 0.0269  -0.0620 112  LEU A N   
718  C CA  . LEU A 112 ? 1.0618 1.0414 1.2435 -0.0300 0.0305  -0.0569 112  LEU A CA  
719  C C   . LEU A 112 ? 1.0145 0.9909 1.1490 -0.0316 0.0303  -0.0492 112  LEU A C   
720  O O   . LEU A 112 ? 1.0099 0.9712 1.1188 -0.0405 0.0417  -0.0418 112  LEU A O   
721  C CB  . LEU A 112 ? 1.0716 1.0595 1.2712 -0.0234 0.0126  -0.0635 112  LEU A CB  
722  C CG  . LEU A 112 ? 1.1080 1.0914 1.3542 -0.0262 0.0180  -0.0680 112  LEU A CG  
723  C CD1 . LEU A 112 ? 1.1263 1.1165 1.3958 -0.0202 0.0003  -0.0761 112  LEU A CD1 
724  C CD2 . LEU A 112 ? 1.1024 1.0662 1.3412 -0.0394 0.0422  -0.0578 112  LEU A CD2 
725  N N   . VAL A 113 ? 0.9870 0.9773 1.1103 -0.0233 0.0169  -0.0503 113  VAL A N   
726  C CA  . VAL A 113 ? 0.9458 0.9345 1.0311 -0.0241 0.0160  -0.0432 113  VAL A CA  
727  C C   . VAL A 113 ? 0.9443 0.9185 1.0141 -0.0333 0.0338  -0.0380 113  VAL A C   
728  O O   . VAL A 113 ? 0.9288 0.8914 0.9676 -0.0395 0.0380  -0.0318 113  VAL A O   
729  C CB  . VAL A 113 ? 0.9305 0.9368 1.0099 -0.0148 0.0030  -0.0435 113  VAL A CB  
730  C CG1 . VAL A 113 ? 0.8779 0.8806 0.9263 -0.0172 0.0067  -0.0350 113  VAL A CG1 
731  C CG2 . VAL A 113 ? 0.9310 0.9509 1.0128 -0.0065 -0.0134 -0.0500 113  VAL A CG2 
732  N N   . THR A 114 ? 0.9549 0.9298 1.0485 -0.0344 0.0433  -0.0418 114  THR A N   
733  C CA  . THR A 114 ? 0.9600 0.9228 1.0431 -0.0427 0.0615  -0.0407 114  THR A CA  
734  C C   . THR A 114 ? 0.9848 0.9285 1.0484 -0.0542 0.0775  -0.0384 114  THR A C   
735  O O   . THR A 114 ? 0.9841 0.9153 1.0126 -0.0615 0.0853  -0.0346 114  THR A O   
736  C CB  . THR A 114 ? 0.9812 0.9480 1.1030 -0.0420 0.0699  -0.0470 114  THR A CB  
737  O OG1 . THR A 114 ? 0.9599 0.9421 1.0927 -0.0330 0.0546  -0.0455 114  THR A OG1 
738  C CG2 . THR A 114 ? 1.0000 0.9526 1.1143 -0.0520 0.0933  -0.0497 114  THR A CG2 
739  N N   . LEU A 115 ? 1.0043 0.9456 1.0906 -0.0560 0.0810  -0.0399 115  LEU A N   
740  C CA  . LEU A 115 ? 1.0330 0.9568 1.1048 -0.0675 0.0971  -0.0354 115  LEU A CA  
741  C C   . LEU A 115 ? 1.0138 0.9299 1.0476 -0.0701 0.0859  -0.0257 115  LEU A C   
742  O O   . LEU A 115 ? 1.0252 0.9246 1.0228 -0.0805 0.0956  -0.0188 115  LEU A O   
743  C CB  . LEU A 115 ? 1.0705 0.9962 1.1839 -0.0673 0.1002  -0.0380 115  LEU A CB  
744  C CG  . LEU A 115 ? 1.1385 1.0471 1.2431 -0.0795 0.1170  -0.0305 115  LEU A CG  
745  C CD1 . LEU A 115 ? 1.2100 1.1055 1.2976 -0.0910 0.1456  -0.0317 115  LEU A CD1 
746  C CD2 . LEU A 115 ? 1.1634 1.0768 1.3186 -0.0772 0.1162  -0.0333 115  LEU A CD2 
747  N N   . GLU A 116 ? 0.9850 0.9132 1.0270 -0.0606 0.0647  -0.0258 116  GLU A N   
748  C CA  . GLU A 116 ? 0.9721 0.8944 0.9890 -0.0620 0.0524  -0.0177 116  GLU A CA  
749  C C   . GLU A 116 ? 0.9590 0.8746 0.9361 -0.0653 0.0519  -0.0129 116  GLU A C   
750  O O   . GLU A 116 ? 0.9803 0.8821 0.9286 -0.0723 0.0488  -0.0039 116  GLU A O   
751  C CB  . GLU A 116 ? 0.9536 0.8926 0.9911 -0.0504 0.0318  -0.0226 116  GLU A CB  
752  C CG  . GLU A 116 ? 0.9403 0.8738 0.9641 -0.0514 0.0193  -0.0158 116  GLU A CG  
753  C CD  . GLU A 116 ? 0.9601 0.9082 1.0134 -0.0417 0.0032  -0.0238 116  GLU A CD  
754  O OE1 . GLU A 116 ? 0.9420 0.9070 1.0157 -0.0325 -0.0015 -0.0350 116  GLU A OE1 
755  O OE2 . GLU A 116 ? 0.9820 0.9244 1.0385 -0.0434 -0.0057 -0.0194 116  GLU A OE2 
756  N N   . ALA A 117 ? 0.9422 0.8669 0.9202 -0.0605 0.0533  -0.0181 117  ALA A N   
757  C CA  . ALA A 117 ? 0.9233 0.8424 0.8701 -0.0631 0.0523  -0.0148 117  ALA A CA  
758  C C   . ALA A 117 ? 0.9555 0.8537 0.8732 -0.0764 0.0689  -0.0126 117  ALA A C   
759  O O   . ALA A 117 ? 0.9608 0.8467 0.8438 -0.0823 0.0648  -0.0070 117  ALA A O   
760  C CB  . ALA A 117 ? 0.9096 0.8427 0.8710 -0.0558 0.0521  -0.0201 117  ALA A CB  
761  N N   . LEU A 118 ? 0.9853 0.8795 0.9173 -0.0814 0.0879  -0.0179 118  LEU A N   
762  C CA  . LEU A 118 ? 1.0322 0.9074 0.9341 -0.0946 0.1070  -0.0177 118  LEU A CA  
763  C C   . LEU A 118 ? 1.0558 0.9151 0.9272 -0.1035 0.1031  -0.0053 118  LEU A C   
764  O O   . LEU A 118 ? 1.0742 0.9177 0.9019 -0.1125 0.1038  -0.0004 118  LEU A O   
765  C CB  . LEU A 118 ? 1.0724 0.9477 1.0018 -0.0983 0.1312  -0.0268 118  LEU A CB  
766  C CG  . LEU A 118 ? 1.1200 0.9782 1.0182 -0.1116 0.1555  -0.0313 118  LEU A CG  
767  C CD1 . LEU A 118 ? 1.1086 0.9654 0.9840 -0.1109 0.1510  -0.0369 118  LEU A CD1 
768  C CD2 . LEU A 118 ? 1.1587 1.0192 1.0930 -0.1143 0.1810  -0.0420 118  LEU A CD2 
769  N N   . CYS A 119 ? 1.0587 0.9218 0.9539 -0.1009 0.0964  0.0001  119  CYS A N   
770  C CA  . CYS A 119 ? 1.0960 0.9438 0.9691 -0.1094 0.0908  0.0144  119  CYS A CA  
771  C C   . CYS A 119 ? 1.0740 0.9155 0.9161 -0.1096 0.0694  0.0230  119  CYS A C   
772  O O   . CYS A 119 ? 1.1074 0.9300 0.9118 -0.1207 0.0675  0.0347  119  CYS A O   
773  C CB  . CYS A 119 ? 1.1025 0.9574 1.0165 -0.1049 0.0843  0.0175  119  CYS A CB  
774  S SG  . CYS A 119 ? 1.1920 1.0561 1.1543 -0.1031 0.1055  0.0066  119  CYS A SG  
775  N N   . GLY A 120 ? 1.0249 0.8819 0.8835 -0.0977 0.0526  0.0181  120  GLY A N   
776  C CA  . GLY A 120 ? 0.9978 0.8500 0.8354 -0.0974 0.0329  0.0254  120  GLY A CA  
777  C C   . GLY A 120 ? 1.0117 0.8500 0.8069 -0.1056 0.0377  0.0257  120  GLY A C   
778  O O   . GLY A 120 ? 1.0307 0.8534 0.7943 -0.1128 0.0258  0.0356  120  GLY A O   
779  N N   . MET A 121 ? 0.8589 0.8380 0.7760 0.0919  -0.0140 -0.0092 121  MET A N   
780  C CA  A MET A 121 ? 0.8398 0.8262 0.7793 0.0722  -0.0096 0.0023  121  MET A CA  
781  C CA  B MET A 121 ? 0.8307 0.8156 0.7711 0.0716  -0.0100 0.0018  121  MET A CA  
782  C C   . MET A 121 ? 0.8329 0.7996 0.7788 0.0638  -0.0074 -0.0103 121  MET A C   
783  O O   . MET A 121 ? 0.8158 0.7887 0.7640 0.0592  -0.0033 -0.0059 121  MET A O   
784  C CB  A MET A 121 ? 0.8534 0.8352 0.8094 0.0609  -0.0192 0.0107  121  MET A CB  
785  C CB  B MET A 121 ? 0.8411 0.8153 0.7979 0.0609  -0.0194 0.0049  121  MET A CB  
786  C CG  A MET A 121 ? 0.8921 0.9125 0.8497 0.0594  -0.0232 0.0405  121  MET A CG  
787  C CG  B MET A 121 ? 0.8353 0.7963 0.8086 0.0478  -0.0304 0.0081  121  MET A CG  
788  S SD  A MET A 121 ? 0.9757 0.9855 0.9515 0.0432  -0.0451 0.0572  121  MET A SD  
789  S SD  B MET A 121 ? 0.8647 0.8073 0.8413 0.0541  -0.0311 -0.0196 121  MET A SD  
790  C CE  A MET A 121 ? 0.9544 1.0107 0.9508 0.0192  -0.0603 0.1098  121  MET A CE  
791  C CE  B MET A 121 ? 0.8488 0.7697 0.8333 0.0599  -0.0550 -0.0288 121  MET A CE  
792  N N   . LEU A 122 ? 0.8476 0.8006 0.7975 0.0612  -0.0112 -0.0209 122  LEU A N   
793  C CA  . LEU A 122 ? 0.8513 0.8073 0.8085 0.0526  -0.0094 -0.0234 122  LEU A CA  
794  C C   . LEU A 122 ? 0.8439 0.7920 0.7876 0.0537  -0.0110 -0.0212 122  LEU A C   
795  O O   . LEU A 122 ? 0.8366 0.7931 0.7834 0.0481  -0.0044 -0.0192 122  LEU A O   
796  C CB  . LEU A 122 ? 0.8751 0.8350 0.8433 0.0458  -0.0176 -0.0218 122  LEU A CB  
797  C CG  . LEU A 122 ? 0.8944 0.8704 0.8767 0.0493  -0.0162 -0.0262 122  LEU A CG  
798  C CD1 . LEU A 122 ? 0.9316 0.9319 0.9311 0.0399  -0.0231 -0.0163 122  LEU A CD1 
799  C CD2 . LEU A 122 ? 0.8752 0.8670 0.8611 0.0582  -0.0106 -0.0354 122  LEU A CD2 
800  N N   . GLY A 123 ? 0.8551 0.7835 0.7796 0.0662  -0.0243 -0.0250 123  GLY A N   
801  C CA  . GLY A 123 ? 0.8608 0.7731 0.7656 0.0763  -0.0353 -0.0289 123  GLY A CA  
802  C C   . GLY A 123 ? 0.8246 0.7625 0.7274 0.0817  -0.0183 -0.0250 123  GLY A C   
803  O O   . GLY A 123 ? 0.8354 0.7673 0.7359 0.0777  -0.0202 -0.0247 123  GLY A O   
804  N N   . LEU A 124 ? 0.7901 0.7589 0.6974 0.0866  -0.0054 -0.0165 124  LEU A N   
805  C CA  . LEU A 124 ? 0.7692 0.7688 0.6820 0.0851  0.0051  -0.0031 124  LEU A CA  
806  C C   . LEU A 124 ? 0.7533 0.7413 0.6838 0.0632  0.0087  -0.0014 124  LEU A C   
807  O O   . LEU A 124 ? 0.7482 0.7405 0.6773 0.0614  0.0114  0.0013  124  LEU A O   
808  C CB  . LEU A 124 ? 0.7530 0.7934 0.6758 0.0844  0.0093  0.0186  124  LEU A CB  
809  C CG  . LEU A 124 ? 0.7561 0.8332 0.6949 0.0726  0.0123  0.0448  124  LEU A CG  
810  C CD1 . LEU A 124 ? 0.7727 0.8800 0.6945 0.0947  0.0189  0.0436  124  LEU A CD1 
811  C CD2 . LEU A 124 ? 0.7849 0.9107 0.7398 0.0641  0.0080  0.0794  124  LEU A CD2 
812  N N   . ALA A 125 ? 0.7516 0.7278 0.6950 0.0523  0.0066  -0.0056 125  ALA A N   
813  C CA  . ALA A 125 ? 0.7550 0.7261 0.7076 0.0437  0.0056  -0.0093 125  ALA A CA  
814  C C   . ALA A 125 ? 0.7662 0.7383 0.7141 0.0409  0.0102  -0.0142 125  ALA A C   
815  O O   . ALA A 125 ? 0.7647 0.7386 0.7117 0.0379  0.0120  -0.0134 125  ALA A O   
816  C CB  . ALA A 125 ? 0.7764 0.7421 0.7362 0.0460  -0.0008 -0.0191 125  ALA A CB  
817  N N   . VAL A 126 ? 0.7865 0.7563 0.7329 0.0388  0.0069  -0.0150 126  VAL A N   
818  C CA  . VAL A 126 ? 0.8214 0.7953 0.7686 0.0284  0.0031  -0.0091 126  VAL A CA  
819  C C   . VAL A 126 ? 0.8268 0.7836 0.7604 0.0320  -0.0006 -0.0088 126  VAL A C   
820  O O   . VAL A 126 ? 0.8451 0.8083 0.7793 0.0254  0.0027  -0.0053 126  VAL A O   
821  C CB  . VAL A 126 ? 0.8588 0.8288 0.8121 0.0178  -0.0126 0.0000  126  VAL A CB  
822  C CG1 . VAL A 126 ? 0.9024 0.8744 0.8596 -0.0002 -0.0264 0.0165  126  VAL A CG1 
823  C CG2 . VAL A 126 ? 0.8640 0.8693 0.8347 0.0149  -0.0065 0.0036  126  VAL A CG2 
824  N N   . ALA A 127 ? 0.8302 0.7723 0.7488 0.0481  -0.0075 -0.0139 127  ALA A N   
825  C CA  . ALA A 127 ? 0.8443 0.7796 0.7468 0.0608  -0.0130 -0.0165 127  ALA A CA  
826  C C   . ALA A 127 ? 0.8187 0.7786 0.7298 0.0567  0.0034  -0.0094 127  ALA A C   
827  O O   . ALA A 127 ? 0.8339 0.7905 0.7399 0.0567  0.0013  -0.0087 127  ALA A O   
828  C CB  . ALA A 127 ? 0.8642 0.7980 0.7429 0.0924  -0.0229 -0.0262 127  ALA A CB  
829  N N   . ALA A 128 ? 0.7854 0.7637 0.7100 0.0517  0.0127  -0.0024 128  ALA A N   
830  C CA  . ALA A 128 ? 0.7748 0.7652 0.7098 0.0433  0.0160  0.0080  128  ALA A CA  
831  C C   . ALA A 128 ? 0.7992 0.7752 0.7359 0.0327  0.0155  0.0007  128  ALA A C   
832  O O   . ALA A 128 ? 0.8008 0.7770 0.7376 0.0288  0.0148  0.0046  128  ALA A O   
833  C CB  . ALA A 128 ? 0.7553 0.7564 0.7050 0.0367  0.0111  0.0213  128  ALA A CB  
834  N N   . SER A 129 ? 0.8229 0.7971 0.7607 0.0307  0.0158  -0.0075 129  SER A N   
835  C CA  . SER A 129 ? 0.8601 0.8447 0.7963 0.0276  0.0176  -0.0114 129  SER A CA  
836  C C   . SER A 129 ? 0.8687 0.8522 0.8000 0.0191  0.0171  -0.0039 129  SER A C   
837  O O   . SER A 129 ? 0.8814 0.8670 0.8087 0.0172  0.0182  -0.0033 129  SER A O   
838  C CB  . SER A 129 ? 0.8851 0.8940 0.8260 0.0294  0.0197  -0.0139 129  SER A CB  
839  O OG  . SER A 129 ? 0.9296 0.9346 0.8715 0.0423  0.0154  -0.0257 129  SER A OG  
840  N N   . LEU A 130 ? 0.8707 0.8432 0.8002 0.0148  0.0086  0.0011  130  LEU A N   
841  C CA  . LEU A 130 ? 0.8948 0.8555 0.8191 0.0053  -0.0035 0.0093  130  LEU A CA  
842  C C   . LEU A 130 ? 0.8791 0.8279 0.7937 0.0149  -0.0017 0.0042  130  LEU A C   
843  O O   . LEU A 130 ? 0.8951 0.8428 0.8074 0.0071  -0.0044 0.0092  130  LEU A O   
844  C CB  . LEU A 130 ? 0.9309 0.8628 0.8509 0.0023  -0.0286 0.0132  130  LEU A CB  
845  C CG  . LEU A 130 ? 0.9598 0.9140 0.8970 -0.0147 -0.0334 0.0281  130  LEU A CG  
846  C CD1 . LEU A 130 ? 1.0121 0.9242 0.9450 -0.0184 -0.0685 0.0323  130  LEU A CD1 
847  C CD2 . LEU A 130 ? 0.9773 0.9791 0.9301 -0.0373 -0.0309 0.0526  130  LEU A CD2 
848  N N   . ILE A 131 ? 0.8468 0.7975 0.7579 0.0312  0.0030  -0.0009 131  ILE A N   
849  C CA  . ILE A 131 ? 0.8424 0.8002 0.7486 0.0409  0.0045  0.0009  131  ILE A CA  
850  C C   . ILE A 131 ? 0.8474 0.8137 0.7638 0.0278  0.0119  0.0072  131  ILE A C   
851  O O   . ILE A 131 ? 0.8504 0.8135 0.7632 0.0257  0.0095  0.0094  131  ILE A O   
852  C CB  . ILE A 131 ? 0.8163 0.8013 0.7212 0.0605  0.0090  0.0042  131  ILE A CB  
853  C CG1 . ILE A 131 ? 0.8521 0.8238 0.7341 0.0868  -0.0054 -0.0096 131  ILE A CG1 
854  C CG2 . ILE A 131 ? 0.7946 0.8121 0.7055 0.0652  0.0140  0.0173  131  ILE A CG2 
855  C CD1 . ILE A 131 ? 0.7934 0.8100 0.6677 0.1156  0.0004  -0.0067 131  ILE A CD1 
856  N N   . TYR A 132 ? 0.8437 0.8142 0.7696 0.0222  0.0148  0.0075  132  TYR A N   
857  C CA  . TYR A 132 ? 0.8776 0.8431 0.8060 0.0164  0.0103  0.0079  132  TYR A CA  
858  C C   . TYR A 132 ? 0.9200 0.8860 0.8380 0.0136  0.0123  0.0013  132  TYR A C   
859  O O   . TYR A 132 ? 0.9396 0.9009 0.8535 0.0110  0.0089  0.0028  132  TYR A O   
860  C CB  . TYR A 132 ? 0.8826 0.8392 0.8163 0.0181  -0.0001 0.0039  132  TYR A CB  
861  C CG  . TYR A 132 ? 0.9497 0.8862 0.8781 0.0193  -0.0179 -0.0015 132  TYR A CG  
862  C CD1 . TYR A 132 ? 0.9853 0.9089 0.9258 0.0083  -0.0372 0.0157  132  TYR A CD1 
863  C CD2 . TYR A 132 ? 1.0263 0.9639 0.9369 0.0335  -0.0192 -0.0211 132  TYR A CD2 
864  C CE1 . TYR A 132 ? 1.0246 0.9166 0.9575 0.0101  -0.0637 0.0095  132  TYR A CE1 
865  C CE2 . TYR A 132 ? 1.0789 0.9938 0.9757 0.0439  -0.0411 -0.0323 132  TYR A CE2 
866  C CZ  . TYR A 132 ? 1.0848 0.9668 0.9920 0.0314  -0.0665 -0.0188 132  TYR A CZ  
867  O OH  . TYR A 132 ? 1.1800 1.0260 1.0712 0.0423  -0.0988 -0.0312 132  TYR A OH  
868  N N   . ALA A 133 ? 0.9409 0.9214 0.8570 0.0122  0.0164  -0.0003 133  ALA A N   
869  C CA  . ALA A 133 ? 0.9869 0.9912 0.8978 0.0061  0.0181  0.0052  133  ALA A CA  
870  C C   . ALA A 133 ? 1.0117 1.0013 0.9200 -0.0055 0.0118  0.0153  133  ALA A C   
871  O O   . ALA A 133 ? 1.0486 1.0495 0.9508 -0.0093 0.0119  0.0193  133  ALA A O   
872  C CB  . ALA A 133 ? 0.9937 1.0301 0.9121 -0.0004 0.0196  0.0154  133  ALA A CB  
873  N N   . ARG A 134 ? 1.0198 0.9837 0.9284 -0.0062 0.0028  0.0170  134  ARG A N   
874  C CA  . ARG A 134 ? 1.0662 1.0087 0.9679 -0.0103 -0.0109 0.0218  134  ARG A CA  
875  C C   . ARG A 134 ? 1.0704 1.0123 0.9696 -0.0034 -0.0042 0.0175  134  ARG A C   
876  O O   . ARG A 134 ? 1.1158 1.0512 1.0102 -0.0101 -0.0107 0.0223  134  ARG A O   
877  C CB  . ARG A 134 ? 1.0727 0.9845 0.9661 0.0016  -0.0298 0.0158  134  ARG A CB  
878  C CG  . ARG A 134 ? 1.1210 1.0201 1.0178 -0.0124 -0.0502 0.0257  134  ARG A CG  
879  C CD  . ARG A 134 ? 1.1467 1.0079 1.0287 0.0088  -0.0737 0.0119  134  ARG A CD  
880  N NE  . ARG A 134 ? 1.1813 1.0103 1.0418 0.0320  -0.0956 -0.0014 134  ARG A NE  
881  C CZ  . ARG A 134 ? 1.2467 1.0297 1.0975 0.0241  -0.1366 0.0032  134  ARG A CZ  
882  N NH1 . ARG A 134 ? 1.2681 1.0391 1.1343 -0.0139 -0.1603 0.0300  134  ARG A NH1 
883  N NH2 . ARG A 134 ? 1.2775 1.0321 1.1042 0.0551  -0.1579 -0.0153 134  ARG A NH2 
884  N N   . PHE A 135 ? 1.0504 1.0005 0.9559 0.0059  0.0043  0.0137  135  PHE A N   
885  C CA  . PHE A 135 ? 1.0630 1.0164 0.9733 0.0066  0.0042  0.0183  135  PHE A CA  
886  C C   . PHE A 135 ? 1.1012 1.0494 1.0061 -0.0002 0.0017  0.0152  135  PHE A C   
887  O O   . PHE A 135 ? 1.1213 1.0633 1.0264 -0.0029 -0.0039 0.0192  135  PHE A O   
888  C CB  . PHE A 135 ? 1.0402 1.0072 0.9648 0.0093  0.0042  0.0262  135  PHE A CB  
889  C CG  . PHE A 135 ? 1.0319 1.0281 0.9618 0.0221  0.0074  0.0363  135  PHE A CG  
890  C CD1 . PHE A 135 ? 1.0497 1.0447 0.9638 0.0399  0.0062  0.0264  135  PHE A CD1 
891  C CD2 . PHE A 135 ? 1.0362 1.0657 0.9853 0.0192  0.0057  0.0578  135  PHE A CD2 
892  C CE1 . PHE A 135 ? 1.0585 1.0909 0.9687 0.0658  0.0073  0.0298  135  PHE A CE1 
893  C CE2 . PHE A 135 ? 1.0394 1.1223 0.9919 0.0373  0.0117  0.0715  135  PHE A CE2 
894  C CZ  . PHE A 135 ? 1.0372 1.1242 0.9665 0.0663  0.0145  0.0533  135  PHE A CZ  
895  N N   . THR A 136 ? 1.1238 1.0814 1.0219 0.0016  0.0046  0.0077  136  THR A N   
896  C CA  . THR A 136 ? 1.1724 1.1381 1.0562 0.0083  0.0010  -0.0002 136  THR A CA  
897  C C   . THR A 136 ? 1.2161 1.2151 1.0917 0.0020  0.0075  0.0086  136  THR A C   
898  O O   . THR A 136 ? 1.2582 1.2971 1.1230 0.0140  0.0117  0.0049  136  THR A O   
899  C CB  . THR A 136 ? 1.1862 1.1569 1.0616 0.0274  -0.0045 -0.0167 136  THR A CB  
900  O OG1 . THR A 136 ? 1.1637 1.1700 1.0418 0.0292  0.0080  -0.0146 136  THR A OG1 
901  C CG2 . THR A 136 ? 1.1598 1.0957 1.0463 0.0273  -0.0205 -0.0179 136  THR A CG2 
902  N N   . ARG A 137 ? 1.0760 1.0659 0.9566 -0.0147 0.0043  0.0230  137  ARG A N   
903  C CA  . ARG A 137 ? 1.0648 1.0837 0.9419 -0.0295 0.0014  0.0418  137  ARG A CA  
904  C C   . ARG A 137 ? 1.0456 1.0287 0.9227 -0.0410 -0.0115 0.0483  137  ARG A C   
905  O O   . ARG A 137 ? 1.0639 1.0355 0.9458 -0.0578 -0.0279 0.0646  137  ARG A O   
906  C CB  . ARG A 137 ? 1.0760 1.1223 0.9653 -0.0460 -0.0027 0.0629  137  ARG A CB  
907  C CG  . ARG A 137 ? 1.1396 1.2252 1.0316 -0.0324 0.0099  0.0566  137  ARG A CG  
908  C CD  . ARG A 137 ? 1.2348 1.3201 1.1440 -0.0487 0.0010  0.0727  137  ARG A CD  
909  N NE  . ARG A 137 ? 1.2880 1.4265 1.2114 -0.0761 -0.0102 0.1126  137  ARG A NE  
910  C CZ  . ARG A 137 ? 1.3145 1.5353 1.2481 -0.0763 -0.0002 0.1318  137  ARG A CZ  
911  N NH1 . ARG A 137 ? 1.3011 1.5477 1.2263 -0.0444 0.0197  0.1056  137  ARG A NH1 
912  N NH2 . ARG A 137 ? 1.3356 1.6181 1.2895 -0.1087 -0.0146 0.1812  137  ARG A NH2 
913  N N   . PRO A 138 ? 0.9694 0.8949 0.9945 0.0141  0.0182  0.0126  138  PRO A N   
914  C CA  . PRO A 138 ? 0.9497 0.8774 0.9701 0.0163  0.0191  0.0112  138  PRO A CA  
915  C C   . PRO A 138 ? 0.9060 0.8379 0.9305 0.0149  0.0172  0.0103  138  PRO A C   
916  O O   . PRO A 138 ? 0.8854 0.8213 0.9183 0.0118  0.0173  0.0105  138  PRO A O   
917  C CB  . PRO A 138 ? 0.9541 0.8893 0.9776 0.0153  0.0256  0.0103  138  PRO A CB  
918  C CG  . PRO A 138 ? 0.9571 0.8957 0.9896 0.0112  0.0276  0.0103  138  PRO A CG  
919  C CD  . PRO A 138 ? 0.9692 0.9001 1.0005 0.0117  0.0237  0.0122  138  PRO A CD  
920  N N   . THR A 139 ? 0.8862 0.8165 0.9040 0.0177  0.0157  0.0096  139  THR A N   
921  C CA  . THR A 139 ? 0.8442 0.7783 0.8649 0.0170  0.0145  0.0087  139  THR A CA  
922  C C   . THR A 139 ? 0.8112 0.7563 0.8384 0.0156  0.0199  0.0072  139  THR A C   
923  O O   . THR A 139 ? 0.8179 0.7670 0.8448 0.0162  0.0242  0.0068  139  THR A O   
924  C CB  . THR A 139 ? 0.8606 0.7883 0.8704 0.0210  0.0114  0.0084  139  THR A CB  
925  O OG1 . THR A 139 ? 0.8654 0.7959 0.8698 0.0248  0.0155  0.0078  139  THR A OG1 
926  C CG2 . THR A 139 ? 0.8716 0.7870 0.8734 0.0221  0.0056  0.0099  139  THR A CG2 
927  N N   . ALA A 140 ? 0.7607 0.7108 0.7938 0.0136  0.0197  0.0064  140  ALA A N   
928  C CA  . ALA A 140 ? 0.7221 0.6821 0.7609 0.0120  0.0241  0.0048  140  ALA A CA  
929  C C   . ALA A 140 ? 0.7139 0.6781 0.7476 0.0154  0.0258  0.0039  140  ALA A C   
930  O O   . ALA A 140 ? 0.7135 0.6863 0.7507 0.0145  0.0297  0.0030  140  ALA A O   
931  C CB  . ALA A 140 ? 0.6962 0.6596 0.7417 0.0095  0.0234  0.0044  140  ALA A CB  
932  N N   . GLY A 141 ? 0.7032 0.6614 0.7283 0.0195  0.0228  0.0043  141  GLY A N   
933  C CA  . GLY A 141 ? 0.6873 0.6495 0.7071 0.0236  0.0244  0.0037  141  GLY A CA  
934  C C   . GLY A 141 ? 0.6686 0.6408 0.6947 0.0221  0.0262  0.0023  141  GLY A C   
935  O O   . GLY A 141 ? 0.6768 0.6585 0.7053 0.0226  0.0298  0.0017  141  GLY A O   
936  N N   . VAL A 142 ? 0.6428 0.6129 0.6717 0.0202  0.0236  0.0019  142  VAL A N   
937  C CA  . VAL A 142 ? 0.6236 0.6013 0.6570 0.0194  0.0248  0.0006  142  VAL A CA  
938  C C   . VAL A 142 ? 0.6264 0.5987 0.6530 0.0227  0.0215  0.0007  142  VAL A C   
939  O O   . VAL A 142 ? 0.6410 0.6037 0.6642 0.0223  0.0176  0.0017  142  VAL A O   
940  C CB  . VAL A 142 ? 0.6075 0.5871 0.6499 0.0145  0.0251  0.0003  142  VAL A CB  
941  C CG1 . VAL A 142 ? 0.5797 0.5649 0.6252 0.0140  0.0255  -0.0008 142  VAL A CG1 
942  C CG2 . VAL A 142 ? 0.6131 0.5973 0.6610 0.0113  0.0285  0.0000  142  VAL A CG2 
943  N N   . LEU A 143 ? 0.6154 0.5937 0.6399 0.0257  0.0230  -0.0002 143  LEU A N   
944  C CA  . LEU A 143 ? 0.6065 0.5793 0.6234 0.0293  0.0203  -0.0001 143  LEU A CA  
945  C C   . LEU A 143 ? 0.5927 0.5693 0.6153 0.0269  0.0202  -0.0010 143  LEU A C   
946  O O   . LEU A 143 ? 0.5806 0.5672 0.6105 0.0248  0.0230  -0.0021 143  LEU A O   
947  C CB  . LEU A 143 ? 0.6359 0.6132 0.6463 0.0351  0.0223  -0.0004 143  LEU A CB  
948  C CG  . LEU A 143 ? 0.6515 0.6223 0.6512 0.0405  0.0203  -0.0003 143  LEU A CG  
949  C CD1 . LEU A 143 ? 0.6185 0.5730 0.6079 0.0418  0.0159  0.0006  143  LEU A CD1 
950  C CD2 . LEU A 143 ? 0.6428 0.6209 0.6375 0.0467  0.0234  -0.0001 143  LEU A CD2 
951  N N   . PHE A 144 ? 0.5936 0.5616 0.6121 0.0271  0.0168  -0.0003 144  PHE A N   
952  C CA  . PHE A 144 ? 0.5757 0.5464 0.5985 0.0254  0.0168  -0.0007 144  PHE A CA  
953  C C   . PHE A 144 ? 0.5951 0.5639 0.6092 0.0304  0.0161  -0.0012 144  PHE A C   
954  O O   . PHE A 144 ? 0.6140 0.5739 0.6176 0.0342  0.0139  -0.0006 144  PHE A O   
955  C CB  . PHE A 144 ? 0.5659 0.5291 0.5915 0.0216  0.0136  0.0008  144  PHE A CB  
956  C CG  . PHE A 144 ? 0.5595 0.5257 0.5944 0.0171  0.0147  0.0014  144  PHE A CG  
957  C CD1 . PHE A 144 ? 0.5399 0.5005 0.5735 0.0162  0.0129  0.0026  144  PHE A CD1 
958  C CD2 . PHE A 144 ? 0.5199 0.4935 0.5638 0.0142  0.0175  0.0008  144  PHE A CD2 
959  C CE1 . PHE A 144 ? 0.5572 0.5201 0.5988 0.0126  0.0140  0.0033  144  PHE A CE1 
960  C CE2 . PHE A 144 ? 0.5354 0.5105 0.5866 0.0108  0.0187  0.0015  144  PHE A CE2 
961  C CZ  . PHE A 144 ? 0.5166 0.4864 0.5667 0.0101  0.0169  0.0029  144  PHE A CZ  
962  N N   . SER A 145 ? 0.5805 0.5566 0.5979 0.0307  0.0179  -0.0023 145  SER A N   
963  C CA  . SER A 145 ? 0.5918 0.5661 0.6008 0.0358  0.0174  -0.0026 145  SER A CA  
964  C C   . SER A 145 ? 0.6046 0.5662 0.6080 0.0351  0.0137  -0.0013 145  SER A C   
965  O O   . SER A 145 ? 0.5910 0.5500 0.6007 0.0302  0.0124  -0.0003 145  SER A O   
966  C CB  . SER A 145 ? 0.5895 0.5748 0.6036 0.0360  0.0200  -0.0040 145  SER A CB  
967  O OG  . SER A 145 ? 0.5704 0.5552 0.5910 0.0318  0.0197  -0.0039 145  SER A OG  
968  N N   . SER A 146 ? 0.6235 0.5769 0.6149 0.0400  0.0120  -0.0010 146  SER A N   
969  C CA  . SER A 146 ? 0.6275 0.5668 0.6122 0.0387  0.0079  0.0003  146  SER A CA  
970  C C   . SER A 146 ? 0.6268 0.5669 0.6158 0.0362  0.0078  0.0006  146  SER A C   
971  O O   . SER A 146 ? 0.6360 0.5670 0.6238 0.0330  0.0047  0.0023  146  SER A O   
972  C CB  . SER A 146 ? 0.6530 0.5813 0.6216 0.0449  0.0060  0.0004  146  SER A CB  
973  O OG  . SER A 146 ? 0.6881 0.6191 0.6517 0.0498  0.0078  -0.0002 146  SER A OG  
974  N N   . ARG A 147 ? 0.6141 0.5655 0.6086 0.0373  0.0113  -0.0006 147  ARG A N   
975  C CA  . ARG A 147 ? 0.6184 0.5707 0.6162 0.0357  0.0117  -0.0003 147  ARG A CA  
976  C C   . ARG A 147 ? 0.5966 0.5621 0.6062 0.0332  0.0152  -0.0015 147  ARG A C   
977  O O   . ARG A 147 ? 0.5872 0.5618 0.6011 0.0334  0.0173  -0.0029 147  ARG A O   
978  C CB  . ARG A 147 ? 0.6500 0.6001 0.6377 0.0416  0.0121  -0.0010 147  ARG A CB  
979  C CG  . ARG A 147 ? 0.6932 0.6292 0.6663 0.0454  0.0090  -0.0001 147  ARG A CG  
980  C CD  . ARG A 147 ? 0.7406 0.6640 0.7102 0.0421  0.0057  0.0017  147  ARG A CD  
981  N NE  . ARG A 147 ? 0.8395 0.7475 0.7937 0.0453  0.0024  0.0024  147  ARG A NE  
982  C CZ  . ARG A 147 ? 0.8518 0.7509 0.8009 0.0443  -0.0006 0.0030  147  ARG A CZ  
983  N NH1 . ARG A 147 ? 0.8157 0.7204 0.7744 0.0403  -0.0007 0.0032  147  ARG A NH1 
984  N NH2 . ARG A 147 ? 0.8766 0.7605 0.8098 0.0479  -0.0036 0.0034  147  ARG A NH2 
985  N N   . MET A 148 ? 0.5897 0.5558 0.6039 0.0308  0.0158  -0.0009 148  MET A N   
986  C CA  . MET A 148 ? 0.5814 0.5584 0.6035 0.0297  0.0191  -0.0024 148  MET A CA  
987  C C   . MET A 148 ? 0.5930 0.5719 0.6092 0.0342  0.0200  -0.0034 148  MET A C   
988  O O   . MET A 148 ? 0.6167 0.5876 0.6241 0.0373  0.0183  -0.0026 148  MET A O   
989  C CB  . MET A 148 ? 0.5588 0.5352 0.5893 0.0249  0.0196  -0.0008 148  MET A CB  
990  C CG  . MET A 148 ? 0.5737 0.5433 0.6069 0.0212  0.0172  0.0016  148  MET A CG  
991  S SD  . MET A 148 ? 0.5818 0.5547 0.6271 0.0162  0.0190  0.0037  148  MET A SD  
992  C CE  . MET A 148 ? 0.4344 0.4177 0.4848 0.0162  0.0228  0.0006  148  MET A CE  
993  N N   . VAL A 149 ? 0.5854 0.5741 0.6060 0.0345  0.0225  -0.0052 149  VAL A N   
994  C CA  . VAL A 149 ? 0.6034 0.5943 0.6195 0.0384  0.0233  -0.0061 149  VAL A CA  
995  C C   . VAL A 149 ? 0.5952 0.5904 0.6180 0.0355  0.0253  -0.0066 149  VAL A C   
996  O O   . VAL A 149 ? 0.5929 0.5920 0.6233 0.0316  0.0264  -0.0069 149  VAL A O   
997  C CB  . VAL A 149 ? 0.6178 0.6185 0.6315 0.0425  0.0242  -0.0081 149  VAL A CB  
998  C CG1 . VAL A 149 ? 0.6349 0.6320 0.6416 0.0461  0.0228  -0.0075 149  VAL A CG1 
999  C CG2 . VAL A 149 ? 0.5557 0.5675 0.5786 0.0389  0.0259  -0.0097 149  VAL A CG2 
1000 N N   . ILE A 150 ? 0.6184 0.6119 0.6376 0.0378  0.0258  -0.0064 150  ILE A N   
1001 C CA  . ILE A 150 ? 0.6219 0.6207 0.6453 0.0368  0.0280  -0.0075 150  ILE A CA  
1002 C C   . ILE A 150 ? 0.6611 0.6666 0.6795 0.0414  0.0284  -0.0097 150  ILE A C   
1003 O O   . ILE A 150 ? 0.6876 0.6895 0.6981 0.0459  0.0276  -0.0092 150  ILE A O   
1004 C CB  . ILE A 150 ? 0.6167 0.6081 0.6397 0.0360  0.0287  -0.0052 150  ILE A CB  
1005 C CG1 . ILE A 150 ? 0.5859 0.5721 0.6148 0.0313  0.0282  -0.0026 150  ILE A CG1 
1006 C CG2 . ILE A 150 ? 0.6052 0.6012 0.6302 0.0362  0.0311  -0.0064 150  ILE A CG2 
1007 C CD1 . ILE A 150 ? 0.5414 0.5228 0.5727 0.0297  0.0294  0.0001  150  ILE A CD1 
1008 N N   . SER A 151 ? 0.6783 0.6935 0.7012 0.0402  0.0293  -0.0119 151  SER A N   
1009 C CA  . SER A 151 ? 0.7180 0.7407 0.7374 0.0439  0.0294  -0.0138 151  SER A CA  
1010 C C   . SER A 151 ? 0.7314 0.7626 0.7566 0.0404  0.0302  -0.0161 151  SER A C   
1011 O O   . SER A 151 ? 0.7275 0.7580 0.7587 0.0356  0.0310  -0.0161 151  SER A O   
1012 C CB  . SER A 151 ? 0.7293 0.7566 0.7444 0.0481  0.0282  -0.0140 151  SER A CB  
1013 O OG  . SER A 151 ? 0.7314 0.7643 0.7518 0.0453  0.0280  -0.0144 151  SER A OG  
1014 N N   . ASP A 152 ? 0.7627 0.8013 0.7856 0.0428  0.0299  -0.0179 152  ASP A N   
1015 C CA  . ASP A 152 ? 0.7816 0.8260 0.8081 0.0395  0.0302  -0.0202 152  ASP A CA  
1016 C C   . ASP A 152 ? 0.7854 0.8376 0.8180 0.0350  0.0297  -0.0214 152  ASP A C   
1017 O O   . ASP A 152 ? 0.7948 0.8553 0.8281 0.0363  0.0287  -0.0215 152  ASP A O   
1018 C CB  . ASP A 152 ? 0.8109 0.8621 0.8329 0.0432  0.0292  -0.0217 152  ASP A CB  
1019 C CG  . ASP A 152 ? 0.8537 0.8975 0.8697 0.0467  0.0300  -0.0211 152  ASP A CG  
1020 O OD1 . ASP A 152 ? 0.8714 0.9054 0.8877 0.0455  0.0316  -0.0194 152  ASP A OD1 
1021 O OD2 . ASP A 152 ? 0.9422 0.9905 0.9533 0.0509  0.0291  -0.0222 152  ASP A OD2 
1022 N N   . PHE A 153 ? 0.7789 0.8285 0.8156 0.0299  0.0307  -0.0221 153  PHE A N   
1023 C CA  . PHE A 153 ? 0.7852 0.8421 0.8265 0.0252  0.0302  -0.0238 153  PHE A CA  
1024 C C   . PHE A 153 ? 0.8084 0.8641 0.8488 0.0224  0.0304  -0.0259 153  PHE A C   
1025 O O   . PHE A 153 ? 0.7985 0.8451 0.8378 0.0218  0.0322  -0.0254 153  PHE A O   
1026 C CB  . PHE A 153 ? 0.7664 0.8201 0.8125 0.0217  0.0311  -0.0226 153  PHE A CB  
1027 C CG  . PHE A 153 ? 0.7725 0.8322 0.8231 0.0163  0.0308  -0.0240 153  PHE A CG  
1028 C CD1 . PHE A 153 ? 0.7469 0.8182 0.7994 0.0161  0.0295  -0.0245 153  PHE A CD1 
1029 C CD2 . PHE A 153 ? 0.7442 0.7977 0.7969 0.0116  0.0322  -0.0245 153  PHE A CD2 
1030 C CE1 . PHE A 153 ? 0.7777 0.8543 0.8345 0.0104  0.0292  -0.0256 153  PHE A CE1 
1031 C CE2 . PHE A 153 ? 0.7446 0.8020 0.8004 0.0064  0.0320  -0.0258 153  PHE A CE2 
1032 C CZ  . PHE A 153 ? 0.7809 0.8498 0.8390 0.0053  0.0304  -0.0263 153  PHE A CZ  
1033 N N   . GLU A 154 ? 0.8402 0.9052 0.8808 0.0207  0.0285  -0.0280 154  GLU A N   
1034 C CA  . GLU A 154 ? 0.8687 0.9321 0.9066 0.0183  0.0280  -0.0303 154  GLU A CA  
1035 C C   . GLU A 154 ? 0.8771 0.9333 0.9090 0.0230  0.0291  -0.0300 154  GLU A C   
1036 O O   . GLU A 154 ? 0.8809 0.9288 0.9103 0.0220  0.0306  -0.0305 154  GLU A O   
1037 C CB  . GLU A 154 ? 0.8636 0.9198 0.9034 0.0128  0.0295  -0.0309 154  GLU A CB  
1038 C CG  . GLU A 154 ? 0.8703 0.9319 0.9158 0.0079  0.0290  -0.0310 154  GLU A CG  
1039 C CD  . GLU A 154 ? 0.9545 1.0276 1.0013 0.0046  0.0261  -0.0329 154  GLU A CD  
1040 O OE1 . GLU A 154 ? 0.9953 1.0758 1.0398 0.0073  0.0240  -0.0337 154  GLU A OE1 
1041 O OE2 . GLU A 154 ? 1.0051 1.0800 1.0553 -0.0009 0.0259  -0.0333 154  GLU A OE2 
1042 N N   . GLY A 155 ? 0.8837 0.9426 0.9127 0.0286  0.0285  -0.0290 155  GLY A N   
1043 C CA  . GLY A 155 ? 0.8918 0.9448 0.9144 0.0332  0.0293  -0.0287 155  GLY A CA  
1044 C C   . GLY A 155 ? 0.8748 0.9160 0.8970 0.0341  0.0322  -0.0263 155  GLY A C   
1045 O O   . GLY A 155 ? 0.9051 0.9407 0.9224 0.0376  0.0335  -0.0256 155  GLY A O   
1046 N N   . LYS A 156 ? 0.8385 0.8767 0.8660 0.0310  0.0333  -0.0248 156  LYS A N   
1047 C CA  . LYS A 156 ? 0.8011 0.8297 0.8296 0.0314  0.0357  -0.0220 156  LYS A CA  
1048 C C   . LYS A 156 ? 0.7625 0.7900 0.7928 0.0326  0.0351  -0.0196 156  LYS A C   
1049 O O   . LYS A 156 ? 0.7500 0.7824 0.7833 0.0310  0.0338  -0.0199 156  LYS A O   
1050 C CB  . LYS A 156 ? 0.8019 0.8263 0.8347 0.0269  0.0375  -0.0218 156  LYS A CB  
1051 C CG  . LYS A 156 ? 0.8404 0.8600 0.8697 0.0269  0.0393  -0.0227 156  LYS A CG  
1052 C CD  . LYS A 156 ? 0.8648 0.8776 0.8976 0.0244  0.0420  -0.0209 156  LYS A CD  
1053 C CE  . LYS A 156 ? 0.9137 0.9215 0.9421 0.0243  0.0440  -0.0223 156  LYS A CE  
1054 N NZ  . LYS A 156 ? 0.9403 0.9505 0.9679 0.0201  0.0423  -0.0256 156  LYS A NZ  
1055 N N   . PRO A 157 ? 0.7333 0.7536 0.7612 0.0352  0.0361  -0.0170 157  PRO A N   
1056 C CA  . PRO A 157 ? 0.6985 0.7150 0.7277 0.0352  0.0353  -0.0145 157  PRO A CA  
1057 C C   . PRO A 157 ? 0.6733 0.6888 0.7094 0.0306  0.0358  -0.0137 157  PRO A C   
1058 O O   . PRO A 157 ? 0.6675 0.6804 0.7069 0.0282  0.0377  -0.0132 157  PRO A O   
1059 C CB  . PRO A 157 ? 0.6978 0.7060 0.7243 0.0372  0.0366  -0.0117 157  PRO A CB  
1060 C CG  . PRO A 157 ? 0.7230 0.7318 0.7448 0.0401  0.0379  -0.0129 157  PRO A CG  
1061 C CD  . PRO A 157 ? 0.7412 0.7560 0.7650 0.0377  0.0379  -0.0160 157  PRO A CD  
1062 N N   . THR A 158 ? 0.6520 0.6692 0.6897 0.0298  0.0342  -0.0134 158  THR A N   
1063 C CA  . THR A 158 ? 0.6208 0.6379 0.6643 0.0257  0.0343  -0.0130 158  THR A CA  
1064 C C   . THR A 158 ? 0.6126 0.6257 0.6557 0.0261  0.0327  -0.0109 158  THR A C   
1065 O O   . THR A 158 ? 0.6105 0.6247 0.6489 0.0293  0.0311  -0.0112 158  THR A O   
1066 C CB  . THR A 158 ? 0.6321 0.6578 0.6775 0.0238  0.0338  -0.0158 158  THR A CB  
1067 O OG1 . THR A 158 ? 0.6569 0.6865 0.7007 0.0237  0.0344  -0.0181 158  THR A OG1 
1068 C CG2 . THR A 158 ? 0.5952 0.6200 0.6461 0.0193  0.0346  -0.0155 158  THR A CG2 
1069 N N   . LEU A 159 ? 0.5853 0.5933 0.6328 0.0232  0.0331  -0.0087 159  LEU A N   
1070 C CA  . LEU A 159 ? 0.5667 0.5696 0.6139 0.0228  0.0311  -0.0066 159  LEU A CA  
1071 C C   . LEU A 159 ? 0.5584 0.5657 0.6078 0.0213  0.0306  -0.0080 159  LEU A C   
1072 O O   . LEU A 159 ? 0.5525 0.5626 0.6067 0.0183  0.0321  -0.0088 159  LEU A O   
1073 C CB  . LEU A 159 ? 0.5546 0.5521 0.6070 0.0199  0.0316  -0.0035 159  LEU A CB  
1074 C CG  . LEU A 159 ? 0.5367 0.5289 0.5902 0.0182  0.0293  -0.0011 159  LEU A CG  
1075 C CD1 . LEU A 159 ? 0.5136 0.5005 0.5595 0.0210  0.0267  -0.0004 159  LEU A CD1 
1076 C CD2 . LEU A 159 ? 0.5024 0.4916 0.5622 0.0154  0.0301  0.0021  159  LEU A CD2 
1077 N N   . MET A 160 ? 0.5468 0.5538 0.5920 0.0235  0.0288  -0.0080 160  MET A N   
1078 C CA  . MET A 160 ? 0.5356 0.5473 0.5825 0.0224  0.0288  -0.0091 160  MET A CA  
1079 C C   . MET A 160 ? 0.5254 0.5311 0.5694 0.0232  0.0268  -0.0074 160  MET A C   
1080 O O   . MET A 160 ? 0.5321 0.5309 0.5709 0.0253  0.0250  -0.0060 160  MET A O   
1081 C CB  . MET A 160 ? 0.5523 0.5731 0.5968 0.0250  0.0291  -0.0112 160  MET A CB  
1082 C CG  . MET A 160 ? 0.5599 0.5859 0.6044 0.0256  0.0301  -0.0130 160  MET A CG  
1083 S SD  . MET A 160 ? 0.6048 0.6436 0.6479 0.0282  0.0298  -0.0150 160  MET A SD  
1084 C CE  . MET A 160 ? 0.5331 0.5757 0.5739 0.0300  0.0300  -0.0166 160  MET A CE  
1085 N N   . MET A 161 ? 0.5221 0.5295 0.5687 0.0213  0.0270  -0.0076 161  MET A N   
1086 C CA  . MET A 161 ? 0.5291 0.5314 0.5716 0.0227  0.0251  -0.0064 161  MET A CA  
1087 C C   . MET A 161 ? 0.5344 0.5435 0.5795 0.0218  0.0265  -0.0074 161  MET A C   
1088 O O   . MET A 161 ? 0.5332 0.5493 0.5836 0.0191  0.0285  -0.0088 161  MET A O   
1089 C CB  . MET A 161 ? 0.5302 0.5230 0.5739 0.0202  0.0232  -0.0040 161  MET A CB  
1090 C CG  . MET A 161 ? 0.5332 0.5267 0.5855 0.0156  0.0245  -0.0032 161  MET A CG  
1091 S SD  . MET A 161 ? 0.5974 0.5949 0.6527 0.0137  0.0259  -0.0042 161  MET A SD  
1092 C CE  . MET A 161 ? 0.5605 0.5504 0.6102 0.0152  0.0229  -0.0026 161  MET A CE  
1093 N N   . ARG A 162 ? 0.5458 0.5531 0.5864 0.0242  0.0257  -0.0068 162  ARG A N   
1094 C CA  . ARG A 162 ? 0.5551 0.5693 0.5989 0.0229  0.0275  -0.0075 162  ARG A CA  
1095 C C   . ARG A 162 ? 0.5561 0.5644 0.5984 0.0225  0.0267  -0.0061 162  ARG A C   
1096 O O   . ARG A 162 ? 0.5415 0.5402 0.5786 0.0240  0.0243  -0.0048 162  ARG A O   
1097 C CB  . ARG A 162 ? 0.5829 0.6073 0.6250 0.0262  0.0288  -0.0084 162  ARG A CB  
1098 C CG  . ARG A 162 ? 0.6161 0.6383 0.6494 0.0325  0.0279  -0.0075 162  ARG A CG  
1099 C CD  . ARG A 162 ? 0.7082 0.7431 0.7420 0.0354  0.0296  -0.0082 162  ARG A CD  
1100 N NE  . ARG A 162 ? 0.8027 0.8355 0.8272 0.0426  0.0291  -0.0072 162  ARG A NE  
1101 C CZ  . ARG A 162 ? 0.8457 0.8890 0.8688 0.0471  0.0304  -0.0071 162  ARG A CZ  
1102 N NH1 . ARG A 162 ? 0.8456 0.9029 0.8767 0.0443  0.0319  -0.0079 162  ARG A NH1 
1103 N NH2 . ARG A 162 ? 0.9040 0.9438 0.9174 0.0543  0.0302  -0.0059 162  ARG A NH2 
1104 N N   . LEU A 163 ? 0.5702 0.5839 0.6168 0.0201  0.0287  -0.0065 163  LEU A N   
1105 C CA  . LEU A 163 ? 0.5961 0.6046 0.6419 0.0192  0.0285  -0.0053 163  LEU A CA  
1106 C C   . LEU A 163 ? 0.6120 0.6280 0.6571 0.0208  0.0306  -0.0053 163  LEU A C   
1107 O O   . LEU A 163 ? 0.6215 0.6479 0.6708 0.0196  0.0326  -0.0064 163  LEU A O   
1108 C CB  . LEU A 163 ? 0.5962 0.6041 0.6492 0.0138  0.0296  -0.0054 163  LEU A CB  
1109 C CG  . LEU A 163 ? 0.6052 0.6066 0.6610 0.0116  0.0282  -0.0046 163  LEU A CG  
1110 C CD1 . LEU A 163 ? 0.6164 0.6197 0.6787 0.0074  0.0303  -0.0050 163  LEU A CD1 
1111 C CD2 . LEU A 163 ? 0.6729 0.6650 0.7251 0.0125  0.0254  -0.0026 163  LEU A CD2 
1112 N N   . ALA A 164 ? 0.6269 0.6377 0.6668 0.0232  0.0302  -0.0040 164  ALA A N   
1113 C CA  . ALA A 164 ? 0.6494 0.6674 0.6892 0.0246  0.0328  -0.0035 164  ALA A CA  
1114 C C   . ALA A 164 ? 0.6545 0.6667 0.6940 0.0230  0.0332  -0.0023 164  ALA A C   
1115 O O   . ALA A 164 ? 0.6462 0.6474 0.6818 0.0233  0.0307  -0.0016 164  ALA A O   
1116 C CB  . ALA A 164 ? 0.6605 0.6797 0.6919 0.0318  0.0328  -0.0026 164  ALA A CB  
1117 N N   . ASN A 165 ? 0.6751 0.6949 0.7185 0.0211  0.0363  -0.0020 165  ASN A N   
1118 C CA  . ASN A 165 ? 0.6916 0.7068 0.7339 0.0202  0.0373  -0.0008 165  ASN A CA  
1119 C C   . ASN A 165 ? 0.7174 0.7310 0.7515 0.0264  0.0378  0.0008  165  ASN A C   
1120 O O   . ASN A 165 ? 0.7334 0.7567 0.7674 0.0292  0.0401  0.0013  165  ASN A O   
1121 C CB  . ASN A 165 ? 0.6976 0.7211 0.7475 0.0151  0.0406  -0.0010 165  ASN A CB  
1122 C CG  . ASN A 165 ? 0.7199 0.7375 0.7684 0.0140  0.0419  0.0003  165  ASN A CG  
1123 O OD1 . ASN A 165 ? 0.7337 0.7426 0.7753 0.0178  0.0404  0.0014  165  ASN A OD1 
1124 N ND2 . ASN A 165 ? 0.7520 0.7734 0.8061 0.0088  0.0444  0.0001  165  ASN A ND2 
1125 N N   . LEU A 166 ? 0.7282 0.7297 0.7552 0.0287  0.0357  0.0017  166  LEU A N   
1126 C CA  . LEU A 166 ? 0.7555 0.7527 0.7724 0.0352  0.0360  0.0032  166  LEU A CA  
1127 C C   . LEU A 166 ? 0.7932 0.7928 0.8100 0.0354  0.0394  0.0048  166  LEU A C   
1128 O O   . LEU A 166 ? 0.8292 0.8255 0.8374 0.0412  0.0403  0.0064  166  LEU A O   
1129 C CB  . LEU A 166 ? 0.7383 0.7199 0.7457 0.0377  0.0315  0.0034  166  LEU A CB  
1130 C CG  . LEU A 166 ? 0.7287 0.7065 0.7331 0.0390  0.0282  0.0024  166  LEU A CG  
1131 C CD1 . LEU A 166 ? 0.7067 0.6688 0.7033 0.0394  0.0232  0.0028  166  LEU A CD1 
1132 C CD2 . LEU A 166 ? 0.6997 0.6822 0.6978 0.0454  0.0296  0.0026  166  LEU A CD2 
1133 N N   . ARG A 167 ? 0.7928 0.7972 0.8183 0.0295  0.0415  0.0046  167  ARG A N   
1134 C CA  . ARG A 167 ? 0.8207 0.8274 0.8461 0.0295  0.0450  0.0064  167  ARG A CA  
1135 C C   . ARG A 167 ? 0.8397 0.8615 0.8741 0.0257  0.0488  0.0065  167  ARG A C   
1136 O O   . ARG A 167 ? 0.8340 0.8627 0.8748 0.0224  0.0483  0.0049  167  ARG A O   
1137 C CB  . ARG A 167 ? 0.8220 0.8192 0.8479 0.0259  0.0441  0.0064  167  ARG A CB  
1138 C CG  . ARG A 167 ? 0.8354 0.8179 0.8526 0.0289  0.0397  0.0066  167  ARG A CG  
1139 C CD  . ARG A 167 ? 0.8623 0.8378 0.8817 0.0251  0.0390  0.0068  167  ARG A CD  
1140 N NE  . ARG A 167 ? 0.9162 0.8782 0.9278 0.0275  0.0345  0.0073  167  ARG A NE  
1141 C CZ  . ARG A 167 ? 0.9363 0.8925 0.9506 0.0246  0.0307  0.0068  167  ARG A CZ  
1142 N NH1 . ARG A 167 ? 0.9146 0.8769 0.9384 0.0199  0.0313  0.0057  167  ARG A NH1 
1143 N NH2 . ARG A 167 ? 0.9613 0.9060 0.9687 0.0263  0.0262  0.0076  167  ARG A NH2 
1144 N N   . ILE A 168 ? 0.8815 0.9084 0.9163 0.0262  0.0526  0.0086  168  ILE A N   
1145 C CA  . ILE A 168 ? 0.9061 0.9481 0.9498 0.0220  0.0563  0.0094  168  ILE A CA  
1146 C C   . ILE A 168 ? 0.8961 0.9373 0.9470 0.0136  0.0567  0.0081  168  ILE A C   
1147 O O   . ILE A 168 ? 0.9029 0.9542 0.9615 0.0084  0.0577  0.0074  168  ILE A O   
1148 C CB  . ILE A 168 ? 0.9478 0.9952 0.9895 0.0250  0.0606  0.0127  168  ILE A CB  
1149 C CG1 . ILE A 168 ? 0.9797 1.0293 1.0138 0.0341  0.0611  0.0144  168  ILE A CG1 
1150 C CG2 . ILE A 168 ? 0.9762 1.0394 1.0281 0.0193  0.0641  0.0138  168  ILE A CG2 
1151 C CD1 . ILE A 168 ? 1.0523 1.1043 1.0821 0.0386  0.0656  0.0180  168  ILE A CD1 
1152 N N   . GLU A 169 ? 0.8877 0.9165 0.9356 0.0124  0.0557  0.0078  169  GLU A N   
1153 C CA  . GLU A 169 ? 0.8840 0.9105 0.9375 0.0052  0.0561  0.0066  169  GLU A CA  
1154 C C   . GLU A 169 ? 0.8476 0.8733 0.9047 0.0026  0.0532  0.0040  169  GLU A C   
1155 O O   . GLU A 169 ? 0.8231 0.8455 0.8772 0.0063  0.0501  0.0031  169  GLU A O   
1156 C CB  . GLU A 169 ? 0.8985 0.9122 0.9477 0.0051  0.0560  0.0073  169  GLU A CB  
1157 C CG  . GLU A 169 ? 0.9696 0.9822 1.0141 0.0082  0.0590  0.0100  169  GLU A CG  
1158 C CD  . GLU A 169 ? 1.0380 1.0452 1.0734 0.0162  0.0572  0.0110  169  GLU A CD  
1159 O OE1 . GLU A 169 ? 1.0367 1.0424 1.0701 0.0189  0.0538  0.0097  169  GLU A OE1 
1160 O OE2 . GLU A 169 ? 1.1036 1.1074 1.1331 0.0199  0.0592  0.0132  169  GLU A OE2 
1161 N N   . GLN A 170 ? 0.8352 0.8631 0.8980 -0.0038 0.0542  0.0027  170  GLN A N   
1162 C CA  . GLN A 170 ? 0.8061 0.8340 0.8722 -0.0064 0.0521  0.0004  170  GLN A CA  
1163 C C   . GLN A 170 ? 0.7732 0.7894 0.8381 -0.0074 0.0505  -0.0003 170  GLN A C   
1164 O O   . GLN A 170 ? 0.7705 0.7794 0.8337 -0.0082 0.0515  0.0006  170  GLN A O   
1165 C CB  . GLN A 170 ? 0.8302 0.8665 0.9021 -0.0128 0.0538  -0.0005 170  GLN A CB  
1166 C CG  . GLN A 170 ? 0.8728 0.9231 0.9474 -0.0117 0.0544  0.0000  170  GLN A CG  
1167 C CD  . GLN A 170 ? 0.9558 1.0146 1.0348 -0.0172 0.0572  0.0009  170  GLN A CD  
1168 O OE1 . GLN A 170 ? 1.0158 1.0688 1.0950 -0.0218 0.0588  0.0011  170  GLN A OE1 
1169 N NE2 . GLN A 170 ? 1.0159 1.0888 1.0987 -0.0170 0.0577  0.0017  170  GLN A NE2 
1170 N N   . ILE A 171 ? 0.7346 0.7497 0.8007 -0.0071 0.0481  -0.0018 171  ILE A N   
1171 C CA  . ILE A 171 ? 0.7119 0.7182 0.7785 -0.0083 0.0470  -0.0022 171  ILE A CA  
1172 C C   . ILE A 171 ? 0.7190 0.7283 0.7895 -0.0134 0.0483  -0.0040 171  ILE A C   
1173 O O   . ILE A 171 ? 0.7185 0.7356 0.7911 -0.0141 0.0479  -0.0053 171  ILE A O   
1174 C CB  . ILE A 171 ? 0.6825 0.6852 0.7475 -0.0046 0.0435  -0.0022 171  ILE A CB  
1175 C CG1 . ILE A 171 ? 0.6894 0.6892 0.7489 0.0004  0.0418  -0.0007 171  ILE A CG1 
1176 C CG2 . ILE A 171 ? 0.6408 0.6358 0.7074 -0.0058 0.0425  -0.0021 171  ILE A CG2 
1177 C CD1 . ILE A 171 ? 0.6814 0.6760 0.7382 0.0037  0.0379  -0.0005 171  ILE A CD1 
1178 N N   . ILE A 172 ? 0.7198 0.7226 0.7906 -0.0166 0.0498  -0.0041 172  ILE A N   
1179 C CA  . ILE A 172 ? 0.7382 0.7419 0.8109 -0.0214 0.0510  -0.0059 172  ILE A CA  
1180 C C   . ILE A 172 ? 0.7353 0.7312 0.8078 -0.0208 0.0504  -0.0063 172  ILE A C   
1181 O O   . ILE A 172 ? 0.7316 0.7216 0.8033 -0.0177 0.0494  -0.0047 172  ILE A O   
1182 C CB  . ILE A 172 ? 0.7756 0.7780 0.8478 -0.0266 0.0540  -0.0058 172  ILE A CB  
1183 C CG1 . ILE A 172 ? 0.7733 0.7654 0.8426 -0.0257 0.0552  -0.0042 172  ILE A CG1 
1184 C CG2 . ILE A 172 ? 0.7561 0.7687 0.8298 -0.0275 0.0550  -0.0050 172  ILE A CG2 
1185 C CD1 . ILE A 172 ? 0.7923 0.7794 0.8600 -0.0307 0.0580  -0.0043 172  ILE A CD1 
1186 N N   . GLU A 173 ? 0.7551 0.7512 0.8282 -0.0237 0.0509  -0.0081 173  GLU A N   
1187 C CA  . GLU A 173 ? 0.7646 0.7534 0.8372 -0.0228 0.0510  -0.0082 173  GLU A CA  
1188 C C   . GLU A 173 ? 0.7228 0.7118 0.7970 -0.0181 0.0486  -0.0070 173  GLU A C   
1189 O O   . GLU A 173 ? 0.7202 0.7033 0.7947 -0.0161 0.0485  -0.0054 173  GLU A O   
1190 C CB  . GLU A 173 ? 0.7899 0.7694 0.8604 -0.0235 0.0530  -0.0070 173  GLU A CB  
1191 C CG  . GLU A 173 ? 0.9043 0.8818 0.9723 -0.0288 0.0555  -0.0081 173  GLU A CG  
1192 C CD  . GLU A 173 ? 1.0088 0.9767 1.0737 -0.0292 0.0576  -0.0067 173  GLU A CD  
1193 O OE1 . GLU A 173 ? 1.0456 1.0072 1.1100 -0.0258 0.0577  -0.0053 173  GLU A OE1 
1194 O OE2 . GLU A 173 ? 1.0548 1.0220 1.1179 -0.0328 0.0594  -0.0067 173  GLU A OE2 
1195 N N   . ALA A 174 ? 0.7016 0.6976 0.7766 -0.0165 0.0468  -0.0076 174  ALA A N   
1196 C CA  . ALA A 174 ? 0.6654 0.6618 0.7409 -0.0125 0.0442  -0.0065 174  ALA A CA  
1197 C C   . ALA A 174 ? 0.6555 0.6520 0.7323 -0.0120 0.0440  -0.0073 174  ALA A C   
1198 O O   . ALA A 174 ? 0.6548 0.6541 0.7314 -0.0142 0.0450  -0.0093 174  ALA A O   
1199 C CB  . ALA A 174 ? 0.6528 0.6559 0.7272 -0.0105 0.0428  -0.0067 174  ALA A CB  
1200 N N   . ASP A 175 ? 0.6404 0.6338 0.7183 -0.0093 0.0424  -0.0055 175  ASP A N   
1201 C CA  . ASP A 175 ? 0.6482 0.6418 0.7273 -0.0084 0.0424  -0.0057 175  ASP A CA  
1202 C C   . ASP A 175 ? 0.6134 0.6069 0.6931 -0.0054 0.0396  -0.0040 175  ASP A C   
1203 O O   . ASP A 175 ? 0.6071 0.5986 0.6862 -0.0042 0.0376  -0.0024 175  ASP A O   
1204 C CB  . ASP A 175 ? 0.6708 0.6588 0.7509 -0.0090 0.0446  -0.0048 175  ASP A CB  
1205 C CG  . ASP A 175 ? 0.7322 0.7156 0.8138 -0.0080 0.0442  -0.0021 175  ASP A CG  
1206 O OD1 . ASP A 175 ? 0.7703 0.7541 0.8532 -0.0061 0.0414  -0.0002 175  ASP A OD1 
1207 O OD2 . ASP A 175 ? 0.8694 0.8485 0.9502 -0.0092 0.0464  -0.0018 175  ASP A OD2 
1208 N N   . VAL A 176 ? 0.5863 0.5813 0.6665 -0.0044 0.0394  -0.0042 176  VAL A N   
1209 C CA  . VAL A 176 ? 0.5744 0.5691 0.6547 -0.0020 0.0368  -0.0026 176  VAL A CA  
1210 C C   . VAL A 176 ? 0.5701 0.5634 0.6530 -0.0014 0.0376  -0.0012 176  VAL A C   
1211 O O   . VAL A 176 ? 0.5637 0.5576 0.6466 -0.0020 0.0400  -0.0024 176  VAL A O   
1212 C CB  . VAL A 176 ? 0.5734 0.5725 0.6501 -0.0005 0.0354  -0.0044 176  VAL A CB  
1213 C CG1 . VAL A 176 ? 0.5889 0.5923 0.6653 -0.0009 0.0370  -0.0066 176  VAL A CG1 
1214 C CG2 . VAL A 176 ? 0.5833 0.5799 0.6584 0.0018  0.0325  -0.0027 176  VAL A CG2 
1215 N N   . HIS A 177 ? 0.5704 0.5613 0.6551 -0.0003 0.0354  0.0016  177  HIS A N   
1216 C CA  A HIS A 177 ? 0.5732 0.5637 0.6612 0.0003  0.0362  0.0038  177  HIS A CA  
1217 C CA  B HIS A 177 ? 0.5751 0.5654 0.6633 0.0003  0.0361  0.0039  177  HIS A CA  
1218 C CA  C HIS A 177 ? 0.5758 0.5663 0.6637 0.0003  0.0362  0.0037  177  HIS A CA  
1219 C C   . HIS A 177 ? 0.5707 0.5610 0.6572 0.0015  0.0333  0.0047  177  HIS A C   
1220 O O   . HIS A 177 ? 0.5814 0.5694 0.6665 0.0016  0.0300  0.0059  177  HIS A O   
1221 C CB  A HIS A 177 ? 0.5763 0.5644 0.6692 0.0000  0.0365  0.0073  177  HIS A CB  
1222 C CB  B HIS A 177 ? 0.5788 0.5666 0.6717 -0.0001 0.0360  0.0075  177  HIS A CB  
1223 C CB  C HIS A 177 ? 0.5819 0.5699 0.6746 0.0000  0.0365  0.0072  177  HIS A CB  
1224 C CG  A HIS A 177 ? 0.5776 0.5648 0.6715 -0.0002 0.0403  0.0070  177  HIS A CG  
1225 C CG  B HIS A 177 ? 0.5854 0.5735 0.6824 0.0006  0.0388  0.0098  177  HIS A CG  
1226 C CG  C HIS A 177 ? 0.5948 0.5811 0.6872 -0.0010 0.0377  0.0065  177  HIS A CG  
1227 N ND1 A HIS A 177 ? 0.5829 0.5705 0.6755 0.0002  0.0435  0.0055  177  HIS A ND1 
1228 N ND1 B HIS A 177 ? 0.5830 0.5707 0.6854 0.0008  0.0383  0.0141  177  HIS A ND1 
1229 N ND1 C HIS A 177 ? 0.6197 0.6058 0.7101 -0.0018 0.0410  0.0041  177  HIS A ND1 
1230 C CD2 A HIS A 177 ? 0.5917 0.5764 0.6868 -0.0007 0.0414  0.0080  177  HIS A CD2 
1231 C CD2 B HIS A 177 ? 0.5890 0.5778 0.6852 0.0015  0.0422  0.0087  177  HIS A CD2 
1232 C CD2 C HIS A 177 ? 0.6032 0.5872 0.6961 -0.0015 0.0358  0.0080  177  HIS A CD2 
1233 C CE1 A HIS A 177 ? 0.5920 0.5769 0.6844 0.0000  0.0464  0.0055  177  HIS A CE1 
1234 C CE1 B HIS A 177 ? 0.5787 0.5673 0.6838 0.0022  0.0417  0.0158  177  HIS A CE1 
1235 C CE1 C HIS A 177 ? 0.6341 0.6177 0.7241 -0.0028 0.0414  0.0042  177  HIS A CE1 
1236 N NE2 A HIS A 177 ? 0.6053 0.5886 0.6994 -0.0004 0.0453  0.0071  177  HIS A NE2 
1237 N NE2 B HIS A 177 ? 0.5858 0.5744 0.6866 0.0027  0.0441  0.0124  177  HIS A NE2 
1238 N NE2 C HIS A 177 ? 0.6183 0.6008 0.7098 -0.0023 0.0384  0.0065  177  HIS A NE2 
1239 N N   . LEU A 178 ? 0.5616 0.5536 0.6473 0.0026  0.0345  0.0041  178  LEU A N   
1240 C CA  . LEU A 178 ? 0.5518 0.5428 0.6355 0.0038  0.0321  0.0052  178  LEU A CA  
1241 C C   . LEU A 178 ? 0.5524 0.5427 0.6407 0.0038  0.0330  0.0087  178  LEU A C   
1242 O O   . LEU A 178 ? 0.5761 0.5681 0.6659 0.0045  0.0364  0.0085  178  LEU A O   
1243 C CB  . LEU A 178 ? 0.5559 0.5496 0.6345 0.0055  0.0327  0.0020  178  LEU A CB  
1244 C CG  . LEU A 178 ? 0.5833 0.5753 0.6583 0.0074  0.0307  0.0027  178  LEU A CG  
1245 C CD1 . LEU A 178 ? 0.5868 0.5741 0.6590 0.0073  0.0268  0.0043  178  LEU A CD1 
1246 C CD2 . LEU A 178 ? 0.5766 0.5721 0.6465 0.0096  0.0314  -0.0003 178  LEU A CD2 
1247 N N   . VAL A 179 ? 0.5367 0.5245 0.6272 0.0029  0.0301  0.0121  179  VAL A N   
1248 C CA  . VAL A 179 ? 0.5387 0.5271 0.6352 0.0024  0.0310  0.0164  179  VAL A CA  
1249 C C   . VAL A 179 ? 0.5450 0.5311 0.6401 0.0021  0.0284  0.0186  179  VAL A C   
1250 O O   . VAL A 179 ? 0.5456 0.5277 0.6372 0.0011  0.0242  0.0188  179  VAL A O   
1251 C CB  . VAL A 179 ? 0.5544 0.5429 0.6574 0.0006  0.0297  0.0201  179  VAL A CB  
1252 C CG1 . VAL A 179 ? 0.5640 0.5551 0.6743 0.0004  0.0314  0.0249  179  VAL A CG1 
1253 C CG2 . VAL A 179 ? 0.5470 0.5363 0.6504 0.0009  0.0320  0.0182  179  VAL A CG2 
1254 N N   . LEU A 180 ? 0.5401 0.5278 0.6370 0.0031  0.0310  0.0202  180  LEU A N   
1255 C CA  . LEU A 180 ? 0.5487 0.5339 0.6451 0.0024  0.0290  0.0231  180  LEU A CA  
1256 C C   . LEU A 180 ? 0.5672 0.5533 0.6719 -0.0004 0.0273  0.0288  180  LEU A C   
1257 O O   . LEU A 180 ? 0.5798 0.5703 0.6917 -0.0004 0.0300  0.0313  180  LEU A O   
1258 C CB  . LEU A 180 ? 0.5450 0.5320 0.6403 0.0047  0.0330  0.0229  180  LEU A CB  
1259 C CG  . LEU A 180 ? 0.5792 0.5642 0.6750 0.0041  0.0323  0.0266  180  LEU A CG  
1260 C CD1 . LEU A 180 ? 0.5646 0.5437 0.6520 0.0041  0.0284  0.0249  180  LEU A CD1 
1261 C CD2 . LEU A 180 ? 0.5363 0.5236 0.6329 0.0066  0.0371  0.0276  180  LEU A CD2 
1262 N N   . VAL A 181 ? 0.5807 0.5626 0.6841 -0.0030 0.0226  0.0310  181  VAL A N   
1263 C CA  . VAL A 181 ? 0.6039 0.5877 0.7158 -0.0063 0.0207  0.0370  181  VAL A CA  
1264 C C   . VAL A 181 ? 0.6292 0.6100 0.7393 -0.0076 0.0195  0.0395  181  VAL A C   
1265 O O   . VAL A 181 ? 0.6385 0.6121 0.7400 -0.0081 0.0159  0.0376  181  VAL A O   
1266 C CB  . VAL A 181 ? 0.6166 0.5972 0.7291 -0.0096 0.0149  0.0384  181  VAL A CB  
1267 C CG1 . VAL A 181 ? 0.6139 0.5991 0.7373 -0.0129 0.0135  0.0449  181  VAL A CG1 
1268 C CG2 . VAL A 181 ? 0.6011 0.5820 0.7119 -0.0081 0.0152  0.0349  181  VAL A CG2 
1269 N N   . ARG A 182 ? 0.6492 0.6348 0.7666 -0.0078 0.0227  0.0439  182  ARG A N   
1270 C CA  . ARG A 182 ? 0.6856 0.6684 0.8022 -0.0097 0.0217  0.0471  182  ARG A CA  
1271 C C   . ARG A 182 ? 0.7210 0.7101 0.8494 -0.0125 0.0226  0.0544  182  ARG A C   
1272 O O   . ARG A 182 ? 0.7115 0.7083 0.8489 -0.0116 0.0256  0.0569  182  ARG A O   
1273 C CB  . ARG A 182 ? 0.6832 0.6647 0.7933 -0.0057 0.0259  0.0442  182  ARG A CB  
1274 C CG  . ARG A 182 ? 0.7092 0.6973 0.8244 -0.0025 0.0324  0.0452  182  ARG A CG  
1275 C CD  . ARG A 182 ? 0.7469 0.7324 0.8538 0.0013  0.0357  0.0419  182  ARG A CD  
1276 N NE  . ARG A 182 ? 0.7711 0.7612 0.8800 0.0051  0.0417  0.0414  182  ARG A NE  
1277 C CZ  . ARG A 182 ? 0.7763 0.7650 0.8778 0.0090  0.0446  0.0372  182  ARG A CZ  
1278 N NH1 . ARG A 182 ? 0.7731 0.7571 0.8654 0.0099  0.0423  0.0334  182  ARG A NH1 
1279 N NH2 . ARG A 182 ? 0.7867 0.7785 0.8895 0.0121  0.0497  0.0369  182  ARG A NH2 
1280 N N   . SER A 183 ? 0.7043 0.8824 0.7550 0.0070  0.0000  -0.0124 183  SER A N   
1281 C CA  . SER A 183 ? 0.7389 0.9110 0.7888 0.0061  -0.0037 -0.0117 183  SER A CA  
1282 C C   . SER A 183 ? 0.7431 0.9052 0.7959 0.0019  -0.0033 -0.0098 183  SER A C   
1283 O O   . SER A 183 ? 0.7385 0.9011 0.7915 0.0044  -0.0049 -0.0125 183  SER A O   
1284 C CB  . SER A 183 ? 0.7614 0.9359 0.8178 0.0079  -0.0099 -0.0218 183  SER A CB  
1285 O OG  . SER A 183 ? 0.7906 0.9847 0.8452 0.0154  -0.0134 -0.0302 183  SER A OG  
1286 N N   . GLU A 184 ? 0.7596 0.9172 0.8123 0.0000  -0.0011 -0.0050 184  GLU A N   
1287 C CA  . GLU A 184 ? 0.7689 0.9229 0.8227 -0.0005 -0.0014 -0.0043 184  GLU A CA  
1288 C C   . GLU A 184 ? 0.8007 0.9478 0.8541 -0.0008 -0.0016 0.0009  184  GLU A C   
1289 O O   . GLU A 184 ? 0.8161 0.9649 0.8708 -0.0016 -0.0024 0.0003  184  GLU A O   
1290 C CB  . GLU A 184 ? 0.7550 0.9135 0.8179 -0.0038 0.0032  -0.0089 184  GLU A CB  
1291 C CG  . GLU A 184 ? 0.7585 0.9276 0.8320 -0.0047 0.0052  -0.0191 184  GLU A CG  
1292 C CD  . GLU A 184 ? 0.8156 0.9924 0.9151 -0.0103 0.0129  -0.0326 184  GLU A CD  
1293 O OE1 . GLU A 184 ? 0.8442 1.0169 0.9505 -0.0123 0.0157  -0.0331 184  GLU A OE1 
1294 O OE2 . GLU A 184 ? 0.7797 0.9678 0.8987 -0.0132 0.0174  -0.0455 184  GLU A OE2 
1295 N N   . ILE A 185 ? 0.8172 0.9624 0.8694 0.0030  -0.0005 0.0047  185  ILE A N   
1296 C CA  . ILE A 185 ? 0.8503 0.9887 0.9057 0.0030  0.0022  0.0110  185  ILE A CA  
1297 C C   . ILE A 185 ? 0.8507 0.9936 0.9012 0.0040  0.0016  0.0122  185  ILE A C   
1298 O O   . ILE A 185 ? 0.8483 1.0025 0.8951 0.0113  0.0004  0.0087  185  ILE A O   
1299 C CB  . ILE A 185 ? 0.8824 1.0138 0.9428 0.0113  0.0100  0.0197  185  ILE A CB  
1300 C CG1 . ILE A 185 ? 0.9003 1.0255 0.9726 0.0099  0.0126  0.0154  185  ILE A CG1 
1301 C CG2 . ILE A 185 ? 0.9104 1.0335 0.9820 0.0105  0.0178  0.0270  185  ILE A CG2 
1302 C CD1 . ILE A 185 ? 0.9476 1.0614 1.0281 0.0218  0.0268  0.0281  185  ILE A CD1 
1303 N N   . SER A 186 ? 0.8568 0.9965 0.9089 -0.0006 0.0019  0.0137  186  SER A N   
1304 C CA  . SER A 186 ? 0.8724 1.0148 0.9231 0.0004  0.0024  0.0137  186  SER A CA  
1305 C C   . SER A 186 ? 0.9164 1.0612 0.9639 0.0078  0.0040  0.0204  186  SER A C   
1306 O O   . SER A 186 ? 0.9342 1.0726 0.9856 0.0102  0.0092  0.0284  186  SER A O   
1307 C CB  . SER A 186 ? 0.8825 1.0207 0.9338 -0.0030 0.0046  0.0164  186  SER A CB  
1308 O OG  . SER A 186 ? 0.8788 1.0177 0.9300 -0.0028 0.0033  0.0194  186  SER A OG  
1309 N N   . GLN A 187 ? 0.9326 1.0871 0.9778 0.0125  0.0026  0.0168  187  GLN A N   
1310 C CA  . GLN A 187 ? 0.9801 1.1410 1.0193 0.0232  0.0055  0.0253  187  GLN A CA  
1311 C C   . GLN A 187 ? 1.0141 1.1607 1.0597 0.0169  0.0111  0.0360  187  GLN A C   
1312 O O   . GLN A 187 ? 1.0530 1.1977 1.1013 0.0244  0.0200  0.0481  187  GLN A O   
1313 C CB  . GLN A 187 ? 0.9919 1.1687 1.0312 0.0278  0.0012  0.0144  187  GLN A CB  
1314 C CG  . GLN A 187 ? 0.9921 1.1940 1.0385 0.0339  -0.0046 -0.0080 187  GLN A CG  
1315 C CD  . GLN A 187 ? 1.0434 1.2666 1.0984 0.0399  -0.0083 -0.0253 187  GLN A CD  
1316 O OE1 . GLN A 187 ? 1.1083 1.3281 1.1559 0.0432  -0.0068 -0.0152 187  GLN A OE1 
1317 N NE2 . GLN A 187 ? 1.0184 1.2662 1.0948 0.0410  -0.0127 -0.0550 187  GLN A NE2 
1318 N N   . GLU A 188 ? 1.0063 1.1467 1.0569 0.0061  0.0081  0.0309  188  GLU A N   
1319 C CA  . GLU A 188 ? 1.0380 1.1758 1.0996 0.0016  0.0110  0.0325  188  GLU A CA  
1320 C C   . GLU A 188 ? 1.0475 1.1816 1.1271 -0.0026 0.0150  0.0284  188  GLU A C   
1321 O O   . GLU A 188 ? 1.0774 1.2159 1.1776 -0.0077 0.0170  0.0200  188  GLU A O   
1322 C CB  . GLU A 188 ? 1.0366 1.1794 1.0943 -0.0008 0.0062  0.0276  188  GLU A CB  
1323 C CG  . GLU A 188 ? 1.0364 1.1787 1.0852 0.0025  0.0061  0.0304  188  GLU A CG  
1324 C CD  . GLU A 188 ? 0.9973 1.1375 1.0452 0.0028  0.0063  0.0253  188  GLU A CD  
1325 O OE1 . GLU A 188 ? 0.9572 1.0945 1.0069 0.0003  0.0073  0.0231  188  GLU A OE1 
1326 O OE2 . GLU A 188 ? 1.0009 1.1464 1.0510 0.0061  0.0061  0.0201  188  GLU A OE2 
1327 N N   . GLY A 189 ? 1.0270 1.1566 1.1039 0.0001  0.0165  0.0302  189  GLY A N   
1328 C CA  . GLY A 189 ? 1.0390 1.1631 1.1371 -0.0034 0.0220  0.0249  189  GLY A CA  
1329 C C   . GLY A 189 ? 1.0320 1.1677 1.1380 -0.0097 0.0130  0.0067  189  GLY A C   
1330 O O   . GLY A 189 ? 1.0542 1.1935 1.1891 -0.0142 0.0164  -0.0072 189  GLY A O   
1331 N N   . MET A 190 ? 1.0074 1.1520 1.0917 -0.0075 0.0040  0.0056  190  MET A N   
1332 C CA  . MET A 190 ? 1.0069 1.1684 1.0906 -0.0050 -0.0025 -0.0066 190  MET A CA  
1333 C C   . MET A 190 ? 0.9681 1.1256 1.0436 -0.0039 -0.0034 -0.0053 190  MET A C   
1334 O O   . MET A 190 ? 0.9330 1.0801 0.9965 -0.0039 -0.0013 0.0043  190  MET A O   
1335 C CB  . MET A 190 ? 1.0174 1.1908 1.0829 0.0027  -0.0051 -0.0022 190  MET A CB  
1336 C CG  . MET A 190 ? 1.0523 1.2457 1.1064 0.0144  -0.0078 -0.0057 190  MET A CG  
1337 S SD  . MET A 190 ? 1.1549 1.3546 1.1850 0.0313  0.0000  0.0123  190  MET A SD  
1338 C CE  . MET A 190 ? 1.1089 1.2772 1.1385 0.0233  0.0123  0.0283  190  MET A CE  
1339 N N   . VAL A 191 ? 0.9692 1.1402 1.0553 -0.0023 -0.0070 -0.0197 191  VAL A N   
1340 C CA  . VAL A 191 ? 0.9431 1.1137 1.0208 0.0000  -0.0083 -0.0192 191  VAL A CA  
1341 C C   . VAL A 191 ? 0.9305 1.1199 0.9901 0.0106  -0.0106 -0.0173 191  VAL A C   
1342 O O   . VAL A 191 ? 0.9544 1.1694 1.0133 0.0207  -0.0147 -0.0265 191  VAL A O   
1343 C CB  . VAL A 191 ? 0.9625 1.1362 1.0636 -0.0023 -0.0088 -0.0353 191  VAL A CB  
1344 C CG1 . VAL A 191 ? 0.9275 1.1096 1.0167 0.0029  -0.0126 -0.0376 191  VAL A CG1 
1345 C CG2 . VAL A 191 ? 0.9748 1.1232 1.0914 -0.0074 0.0016  -0.0267 191  VAL A CG2 
1346 N N   . PHE A 192 ? 0.8950 1.0757 0.9427 0.0115  -0.0056 -0.0057 192  PHE A N   
1347 C CA  . PHE A 192 ? 0.8852 1.0777 0.9189 0.0243  0.0008  0.0041  192  PHE A CA  
1348 C C   . PHE A 192 ? 0.8572 1.0413 0.8912 0.0221  0.0080  0.0101  192  PHE A C   
1349 O O   . PHE A 192 ? 0.8325 1.0022 0.8752 0.0106  0.0072  0.0068  192  PHE A O   
1350 C CB  . PHE A 192 ? 0.8863 1.0711 0.9145 0.0280  0.0101  0.0186  192  PHE A CB  
1351 C CG  . PHE A 192 ? 0.8584 1.0188 0.8968 0.0153  0.0174  0.0240  192  PHE A CG  
1352 C CD1 . PHE A 192 ? 0.8409 0.9916 0.8876 0.0163  0.0337  0.0338  192  PHE A CD1 
1353 C CD2 . PHE A 192 ? 0.8320 0.9833 0.8770 0.0046  0.0103  0.0169  192  PHE A CD2 
1354 C CE1 . PHE A 192 ? 0.8172 0.9539 0.8846 0.0041  0.0395  0.0280  192  PHE A CE1 
1355 C CE2 . PHE A 192 ? 0.8403 0.9818 0.8952 -0.0021 0.0143  0.0150  192  PHE A CE2 
1356 C CZ  . PHE A 192 ? 0.8182 0.9549 0.8874 -0.0036 0.0272  0.0162  192  PHE A CZ  
1357 N N   . ARG A 193 ? 0.8609 1.0594 0.8857 0.0366  0.0159  0.0185  193  ARG A N   
1358 C CA  . ARG A 193 ? 0.8462 1.0383 0.8764 0.0348  0.0261  0.0244  193  ARG A CA  
1359 C C   . ARG A 193 ? 0.8474 1.0217 0.8902 0.0330  0.0473  0.0403  193  ARG A C   
1360 O O   . ARG A 193 ? 0.8844 1.0592 0.9210 0.0457  0.0593  0.0558  193  ARG A O   
1361 C CB  . ARG A 193 ? 0.8518 1.0695 0.8692 0.0534  0.0276  0.0267  193  ARG A CB  
1362 C CG  . ARG A 193 ? 0.8634 1.1056 0.8771 0.0576  0.0075  0.0040  193  ARG A CG  
1363 C CD  . ARG A 193 ? 0.8724 1.1071 0.8960 0.0459  0.0005  -0.0083 193  ARG A CD  
1364 N NE  . ARG A 193 ? 0.8736 1.1117 0.8931 0.0522  0.0113  0.0022  193  ARG A NE  
1365 C CZ  . ARG A 193 ? 0.8552 1.0872 0.8821 0.0435  0.0084  -0.0050 193  ARG A CZ  
1366 N NH1 . ARG A 193 ? 0.8652 1.0863 0.9009 0.0317  -0.0030 -0.0192 193  ARG A NH1 
1367 N NH2 . ARG A 193 ? 0.8548 1.0920 0.8816 0.0491  0.0198  0.0037  193  ARG A NH2 
1368 N N   . ARG A 194 ? 0.8187 0.8287 0.9720 -0.0096 0.0292  0.0605  194  ARG A N   
1369 C CA  . ARG A 194 ? 0.8087 0.8209 0.9612 -0.0049 0.0345  0.0578  194  ARG A CA  
1370 C C   . ARG A 194 ? 0.7867 0.7923 0.9282 -0.0034 0.0338  0.0500  194  ARG A C   
1371 O O   . ARG A 194 ? 0.7770 0.7772 0.9105 -0.0038 0.0318  0.0465  194  ARG A O   
1372 C CB  . ARG A 194 ? 0.8229 0.8383 0.9768 -0.0012 0.0412  0.0596  194  ARG A CB  
1373 C CG  . ARG A 194 ? 0.8298 0.8422 0.9757 0.0032  0.0458  0.0539  194  ARG A CG  
1374 C CD  . ARG A 194 ? 0.9121 0.9277 1.0599 0.0073  0.0526  0.0568  194  ARG A CD  
1375 N NE  . ARG A 194 ? 0.9513 0.9725 1.1066 0.0098  0.0565  0.0610  194  ARG A NE  
1376 C CZ  . ARG A 194 ? 0.9949 1.0210 1.1554 0.0130  0.0620  0.0662  194  ARG A CZ  
1377 N NH1 . ARG A 194 ? 0.9981 1.0241 1.1574 0.0138  0.0642  0.0680  194  ARG A NH1 
1378 N NH2 . ARG A 194 ? 0.9706 1.0015 1.1370 0.0159  0.0654  0.0699  194  ARG A NH2 
1379 N N   . PHE A 195 ? 0.7680 0.7743 0.9091 -0.0015 0.0355  0.0476  195  PHE A N   
1380 C CA  . PHE A 195 ? 0.7366 0.7381 0.8688 -0.0003 0.0352  0.0410  195  PHE A CA  
1381 C C   . PHE A 195 ? 0.7147 0.7160 0.8423 0.0032  0.0408  0.0378  195  PHE A C   
1382 O O   . PHE A 195 ? 0.7163 0.7208 0.8480 0.0055  0.0453  0.0404  195  PHE A O   
1383 C CB  . PHE A 195 ? 0.7468 0.7486 0.8808 -0.0007 0.0340  0.0405  195  PHE A CB  
1384 C CG  . PHE A 195 ? 0.8033 0.8041 0.9400 -0.0043 0.0279  0.0430  195  PHE A CG  
1385 C CD1 . PHE A 195 ? 0.8608 0.8655 1.0059 -0.0068 0.0257  0.0492  195  PHE A CD1 
1386 C CD2 . PHE A 195 ? 0.8204 0.8165 0.9512 -0.0053 0.0241  0.0393  195  PHE A CD2 
1387 C CE1 . PHE A 195 ? 0.8741 0.8773 1.0211 -0.0107 0.0191  0.0516  195  PHE A CE1 
1388 C CE2 . PHE A 195 ? 0.8414 0.8352 0.9732 -0.0085 0.0180  0.0415  195  PHE A CE2 
1389 C CZ  . PHE A 195 ? 0.8747 0.8718 1.0144 -0.0114 0.0152  0.0475  195  PHE A CZ  
1390 N N   . HIS A 196 ? 0.6906 0.6883 0.8097 0.0040  0.0403  0.0324  196  HIS A N   
1391 C CA  . HIS A 196 ? 0.6835 0.6806 0.7974 0.0069  0.0448  0.0286  196  HIS A CA  
1392 C C   . HIS A 196 ? 0.6768 0.6718 0.7848 0.0065  0.0434  0.0231  196  HIS A C   
1393 O O   . HIS A 196 ? 0.6784 0.6717 0.7824 0.0053  0.0398  0.0209  196  HIS A O   
1394 C CB  . HIS A 196 ? 0.6758 0.6720 0.7851 0.0086  0.0461  0.0274  196  HIS A CB  
1395 C CG  . HIS A 196 ? 0.6841 0.6823 0.7986 0.0089  0.0476  0.0329  196  HIS A CG  
1396 N ND1 . HIS A 196 ? 0.7389 0.7386 0.8543 0.0119  0.0528  0.0347  196  HIS A ND1 
1397 C CD2 . HIS A 196 ? 0.6879 0.6866 0.8068 0.0063  0.0446  0.0372  196  HIS A CD2 
1398 C CE1 . HIS A 196 ? 0.7284 0.7304 0.8494 0.0114  0.0534  0.0402  196  HIS A CE1 
1399 N NE2 . HIS A 196 ? 0.7317 0.7333 0.8552 0.0076  0.0482  0.0418  196  HIS A NE2 
1400 N N   . ASP A 197 ? 0.6970 0.6918 0.8040 0.0075  0.0464  0.0212  197  ASP A N   
1401 C CA  . ASP A 197 ? 0.6989 0.6921 0.8009 0.0066  0.0454  0.0165  197  ASP A CA  
1402 C C   . ASP A 197 ? 0.6834 0.6765 0.7792 0.0080  0.0467  0.0127  197  ASP A C   
1403 O O   . ASP A 197 ? 0.7104 0.7033 0.8056 0.0100  0.0498  0.0135  197  ASP A O   
1404 C CB  . ASP A 197 ? 0.7219 0.7139 0.8247 0.0069  0.0482  0.0162  197  ASP A CB  
1405 C CG  . ASP A 197 ? 0.8009 0.7915 0.9003 0.0050  0.0464  0.0124  197  ASP A CG  
1406 O OD1 . ASP A 197 ? 0.8723 0.8632 0.9714 0.0035  0.0426  0.0120  197  ASP A OD1 
1407 O OD2 . ASP A 197 ? 0.8687 0.8573 0.9650 0.0049  0.0489  0.0100  197  ASP A OD2 
1408 N N   . LEU A 198 ? 0.6464 0.6397 0.7375 0.0072  0.0441  0.0092  198  LEU A N   
1409 C CA  . LEU A 198 ? 0.6067 0.6008 0.6921 0.0085  0.0446  0.0058  198  LEU A CA  
1410 C C   . LEU A 198 ? 0.5993 0.5940 0.6811 0.0077  0.0459  0.0016  198  LEU A C   
1411 O O   . LEU A 198 ? 0.5836 0.5788 0.6654 0.0058  0.0445  0.0001  198  LEU A O   
1412 C CB  . LEU A 198 ? 0.6057 0.6003 0.6882 0.0087  0.0410  0.0050  198  LEU A CB  
1413 C CG  . LEU A 198 ? 0.5870 0.5797 0.6716 0.0089  0.0391  0.0090  198  LEU A CG  
1414 C CD1 . LEU A 198 ? 0.5781 0.5695 0.6572 0.0095  0.0357  0.0075  198  LEU A CD1 
1415 C CD2 . LEU A 198 ? 0.5463 0.5389 0.6317 0.0106  0.0419  0.0112  198  LEU A CD2 
1416 N N   . THR A 199 ? 0.5848 0.5789 0.6631 0.0089  0.0484  -0.0001 199  THR A N   
1417 C CA  . THR A 199 ? 0.5814 0.5755 0.6561 0.0073  0.0489  -0.0038 199  THR A CA  
1418 C C   . THR A 199 ? 0.5756 0.5743 0.6476 0.0064  0.0459  -0.0070 199  THR A C   
1419 O O   . THR A 199 ? 0.5750 0.5758 0.6448 0.0083  0.0446  -0.0074 199  THR A O   
1420 C CB  . THR A 199 ? 0.6165 0.6071 0.6874 0.0084  0.0523  -0.0049 199  THR A CB  
1421 O OG1 . THR A 199 ? 0.6257 0.6168 0.6932 0.0109  0.0528  -0.0053 199  THR A OG1 
1422 C CG2 . THR A 199 ? 0.5935 0.5799 0.6672 0.0094  0.0555  -0.0016 199  THR A CG2 
1423 N N   . LEU A 200 ? 0.5617 0.5619 0.6337 0.0039  0.0451  -0.0089 200  LEU A N   
1424 C CA  . LEU A 200 ? 0.5569 0.5624 0.6273 0.0032  0.0427  -0.0111 200  LEU A CA  
1425 C C   . LEU A 200 ? 0.5843 0.5926 0.6512 0.0015  0.0431  -0.0147 200  LEU A C   
1426 O O   . LEU A 200 ? 0.5908 0.5955 0.6565 -0.0001 0.0449  -0.0156 200  LEU A O   
1427 C CB  . LEU A 200 ? 0.5390 0.5447 0.6118 0.0013  0.0417  -0.0105 200  LEU A CB  
1428 C CG  . LEU A 200 ? 0.5353 0.5377 0.6112 0.0025  0.0407  -0.0070 200  LEU A CG  
1429 C CD1 . LEU A 200 ? 0.4811 0.4835 0.5581 0.0011  0.0394  -0.0066 200  LEU A CD1 
1430 C CD2 . LEU A 200 ? 0.5157 0.5187 0.5901 0.0052  0.0387  -0.0059 200  LEU A CD2 
1431 N N   . THR A 201 ? 0.6074 0.6220 0.6723 0.0020  0.0412  -0.0167 201  THR A N   
1432 C CA  . THR A 201 ? 0.6366 0.6546 0.6993 -0.0007 0.0410  -0.0198 201  THR A CA  
1433 C C   . THR A 201 ? 0.6359 0.6534 0.7006 -0.0049 0.0415  -0.0202 201  THR A C   
1434 O O   . THR A 201 ? 0.6637 0.6797 0.7263 -0.0081 0.0420  -0.0221 201  THR A O   
1435 C CB  . THR A 201 ? 0.6482 0.6749 0.7095 0.0002  0.0387  -0.0214 201  THR A CB  
1436 O OG1 . THR A 201 ? 0.6834 0.7148 0.7472 0.0002  0.0376  -0.0205 201  THR A OG1 
1437 C CG2 . THR A 201 ? 0.6224 0.6490 0.6808 0.0047  0.0382  -0.0209 201  THR A CG2 
1438 N N   . ARG A 202 ? 0.6218 0.6394 0.6896 -0.0049 0.0412  -0.0184 202  ARG A N   
1439 C CA  . ARG A 202 ? 0.6280 0.6445 0.6973 -0.0085 0.0419  -0.0185 202  ARG A CA  
1440 C C   . ARG A 202 ? 0.6133 0.6267 0.6854 -0.0071 0.0420  -0.0157 202  ARG A C   
1441 O O   . ARG A 202 ? 0.6171 0.6336 0.6898 -0.0049 0.0404  -0.0147 202  ARG A O   
1442 C CB  . ARG A 202 ? 0.6385 0.6636 0.7083 -0.0109 0.0406  -0.0201 202  ARG A CB  
1443 C CG  . ARG A 202 ? 0.6507 0.6760 0.7227 -0.0136 0.0412  -0.0193 202  ARG A CG  
1444 C CD  . ARG A 202 ? 0.6853 0.7188 0.7580 -0.0176 0.0406  -0.0209 202  ARG A CD  
1445 N NE  . ARG A 202 ? 0.6767 0.7201 0.7510 -0.0153 0.0392  -0.0203 202  ARG A NE  
1446 C CZ  . ARG A 202 ? 0.6595 0.7048 0.7353 -0.0138 0.0394  -0.0184 202  ARG A CZ  
1447 N NH1 . ARG A 202 ? 0.6685 0.7065 0.7447 -0.0147 0.0407  -0.0171 202  ARG A NH1 
1448 N NH2 . ARG A 202 ? 0.6240 0.6783 0.7003 -0.0111 0.0385  -0.0178 202  ARG A NH2 
1449 N N   . SER A 203 ? 0.6107 0.6174 0.6836 -0.0082 0.0437  -0.0145 203  SER A N   
1450 C CA  . SER A 203 ? 0.6001 0.6040 0.6756 -0.0069 0.0433  -0.0118 203  SER A CA  
1451 C C   . SER A 203 ? 0.6179 0.6205 0.6941 -0.0093 0.0438  -0.0115 203  SER A C   
1452 O O   . SER A 203 ? 0.6101 0.6093 0.6879 -0.0084 0.0434  -0.0092 203  SER A O   
1453 C CB  . SER A 203 ? 0.5885 0.5866 0.6654 -0.0051 0.0445  -0.0094 203  SER A CB  
1454 O OG  . SER A 203 ? 0.6126 0.6063 0.6881 -0.0068 0.0470  -0.0101 203  SER A OG  
1455 N N   . ARG A 204 ? 0.6386 0.6444 0.7135 -0.0126 0.0443  -0.0137 204  ARG A N   
1456 C CA  A ARG A 204 ? 0.6407 0.6455 0.7158 -0.0154 0.0452  -0.0136 204  ARG A CA  
1457 C CA  B ARG A 204 ? 0.6482 0.6532 0.7234 -0.0152 0.0451  -0.0134 204  ARG A CA  
1458 C C   . ARG A 204 ? 0.6568 0.6702 0.7322 -0.0170 0.0443  -0.0147 204  ARG A C   
1459 O O   . ARG A 204 ? 0.6665 0.6861 0.7415 -0.0179 0.0435  -0.0165 204  ARG A O   
1460 C CB  A ARG A 204 ? 0.6552 0.6539 0.7281 -0.0188 0.0474  -0.0146 204  ARG A CB  
1461 C CB  B ARG A 204 ? 0.6687 0.6664 0.7421 -0.0181 0.0474  -0.0139 204  ARG A CB  
1462 C CG  A ARG A 204 ? 0.6389 0.6289 0.7115 -0.0169 0.0491  -0.0128 204  ARG A CG  
1463 C CG  B ARG A 204 ? 0.6813 0.6733 0.7554 -0.0178 0.0484  -0.0117 204  ARG A CG  
1464 C CD  A ARG A 204 ? 0.6237 0.6065 0.6922 -0.0193 0.0515  -0.0141 204  ARG A CD  
1465 C CD  B ARG A 204 ? 0.6931 0.6762 0.7653 -0.0181 0.0509  -0.0112 204  ARG A CD  
1466 N NE  A ARG A 204 ? 0.6543 0.6386 0.7199 -0.0203 0.0512  -0.0166 204  ARG A NE  
1467 N NE  B ARG A 204 ? 0.6757 0.6545 0.7496 -0.0159 0.0512  -0.0083 204  ARG A NE  
1468 C CZ  A ARG A 204 ? 0.6647 0.6432 0.7251 -0.0230 0.0525  -0.0185 204  ARG A CZ  
1469 C CZ  B ARG A 204 ? 0.6933 0.6681 0.7660 -0.0174 0.0523  -0.0077 204  ARG A CZ  
1470 N NH1 A ARG A 204 ? 0.6479 0.6182 0.7052 -0.0250 0.0545  -0.0183 204  ARG A NH1 
1471 N NH1 B ARG A 204 ? 0.7062 0.6806 0.7761 -0.0215 0.0534  -0.0096 204  ARG A NH1 
1472 N NH2 A ARG A 204 ? 0.6506 0.6304 0.7079 -0.0237 0.0516  -0.0208 204  ARG A NH2 
1473 N NH2 B ARG A 204 ? 0.6889 0.6602 0.7630 -0.0151 0.0522  -0.0050 204  ARG A NH2 
1474 N N   . SER A 205 ? 0.6553 0.6694 0.7315 -0.0173 0.0445  -0.0134 205  SER A N   
1475 C CA  . SER A 205 ? 0.6683 0.6907 0.7452 -0.0187 0.0443  -0.0138 205  SER A CA  
1476 C C   . SER A 205 ? 0.6924 0.7118 0.7693 -0.0222 0.0462  -0.0132 205  SER A C   
1477 O O   . SER A 205 ? 0.6956 0.7091 0.7720 -0.0207 0.0467  -0.0114 205  SER A O   
1478 C CB  . SER A 205 ? 0.6521 0.6784 0.7287 -0.0141 0.0429  -0.0123 205  SER A CB  
1479 O OG  . SER A 205 ? 0.6710 0.7063 0.7485 -0.0148 0.0432  -0.0123 205  SER A OG  
1480 N N   . PRO A 206 ? 0.7142 0.7371 0.7914 -0.0273 0.0471  -0.0145 206  PRO A N   
1481 C CA  . PRO A 206 ? 0.7354 0.7546 0.8121 -0.0314 0.0491  -0.0139 206  PRO A CA  
1482 C C   . PRO A 206 ? 0.7414 0.7650 0.8193 -0.0298 0.0497  -0.0118 206  PRO A C   
1483 O O   . PRO A 206 ? 0.7451 0.7620 0.8216 -0.0297 0.0511  -0.0104 206  PRO A O   
1484 C CB  . PRO A 206 ? 0.7696 0.7932 0.8465 -0.0374 0.0491  -0.0158 206  PRO A CB  
1485 C CG  . PRO A 206 ? 0.7582 0.7894 0.8360 -0.0360 0.0469  -0.0173 206  PRO A CG  
1486 C CD  . PRO A 206 ? 0.7253 0.7562 0.8033 -0.0294 0.0459  -0.0165 206  PRO A CD  
1487 N N   . ILE A 207 ? 0.7444 0.7789 0.8243 -0.0281 0.0488  -0.0114 207  ILE A N   
1488 C CA  . ILE A 207 ? 0.7517 0.7906 0.8319 -0.0253 0.0495  -0.0092 207  ILE A CA  
1489 C C   . ILE A 207 ? 0.7314 0.7744 0.8107 -0.0189 0.0477  -0.0087 207  ILE A C   
1490 O O   . ILE A 207 ? 0.7299 0.7825 0.8106 -0.0180 0.0468  -0.0092 207  ILE A O   
1491 C CB  . ILE A 207 ? 0.7827 0.8327 0.8660 -0.0293 0.0508  -0.0086 207  ILE A CB  
1492 C CG1 . ILE A 207 ? 0.8417 0.8868 0.9250 -0.0354 0.0530  -0.0084 207  ILE A CG1 
1493 C CG2 . ILE A 207 ? 0.7693 0.8252 0.8526 -0.0249 0.0518  -0.0061 207  ILE A CG2 
1494 C CD1 . ILE A 207 ? 0.9032 0.9481 0.9872 -0.0420 0.0526  -0.0105 207  ILE A CD1 
1495 N N   . PHE A 208 ? 0.7221 0.7572 0.7983 -0.0144 0.0468  -0.0076 208  PHE A N   
1496 C CA  . PHE A 208 ? 0.7124 0.7490 0.7862 -0.0086 0.0448  -0.0072 208  PHE A CA  
1497 C C   . PHE A 208 ? 0.7319 0.7724 0.8034 -0.0050 0.0456  -0.0052 208  PHE A C   
1498 O O   . PHE A 208 ? 0.7336 0.7669 0.8019 -0.0031 0.0458  -0.0038 208  PHE A O   
1499 C CB  . PHE A 208 ? 0.6898 0.7157 0.7612 -0.0062 0.0429  -0.0069 208  PHE A CB  
1500 C CG  . PHE A 208 ? 0.6903 0.7154 0.7581 -0.0007 0.0405  -0.0063 208  PHE A CG  
1501 C CD1 . PHE A 208 ? 0.6958 0.7283 0.7633 0.0013  0.0399  -0.0072 208  PHE A CD1 
1502 C CD2 . PHE A 208 ? 0.6897 0.7059 0.7536 0.0023  0.0387  -0.0049 208  PHE A CD2 
1503 C CE1 . PHE A 208 ? 0.7181 0.7484 0.7811 0.0064  0.0378  -0.0066 208  PHE A CE1 
1504 C CE2 . PHE A 208 ? 0.6923 0.7061 0.7516 0.0069  0.0363  -0.0044 208  PHE A CE2 
1505 C CZ  . PHE A 208 ? 0.6997 0.7200 0.7583 0.0091  0.0360  -0.0053 208  PHE A CZ  
1506 N N   . SER A 209 ? 0.7548 0.8067 0.8275 -0.0036 0.0461  -0.0050 209  SER A N   
1507 C CA  . SER A 209 ? 0.7909 0.8470 0.8615 0.0000  0.0477  -0.0027 209  SER A CA  
1508 C C   . SER A 209 ? 0.7894 0.8498 0.8560 0.0067  0.0466  -0.0021 209  SER A C   
1509 O O   . SER A 209 ? 0.8067 0.8659 0.8685 0.0117  0.0474  -0.0002 209  SER A O   
1510 C CB  . SER A 209 ? 0.8269 0.8937 0.9025 -0.0045 0.0504  -0.0018 209  SER A CB  
1511 O OG  . SER A 209 ? 0.8915 0.9710 0.9709 -0.0051 0.0500  -0.0024 209  SER A OG  
1512 N N   . LEU A 210 ? 0.7816 0.8457 0.8492 0.0074  0.0449  -0.0036 210  LEU A N   
1513 C CA  . LEU A 210 ? 0.7946 0.8615 0.8572 0.0145  0.0440  -0.0029 210  LEU A CA  
1514 C C   . LEU A 210 ? 0.7710 0.8286 0.8291 0.0172  0.0410  -0.0042 210  LEU A C   
1515 O O   . LEU A 210 ? 0.7735 0.8199 0.8256 0.0203  0.0396  -0.0035 210  LEU A O   
1516 C CB  . LEU A 210 ? 0.8175 0.9002 0.8842 0.0148  0.0449  -0.0028 210  LEU A CB  
1517 C CG  . LEU A 210 ? 0.8643 0.9588 0.9348 0.0141  0.0479  -0.0004 210  LEU A CG  
1518 C CD1 . LEU A 210 ? 0.8882 0.9990 0.9646 0.0126  0.0480  -0.0005 210  LEU A CD1 
1519 C CD2 . LEU A 210 ? 0.8928 0.9852 0.9563 0.0218  0.0493  0.0021  210  LEU A CD2 
1520 N N   . SER A 211 ? 0.7566 0.8191 0.8174 0.0159  0.0401  -0.0058 211  SER A N   
1521 C CA  . SER A 211 ? 0.7346 0.7899 0.7914 0.0186  0.0377  -0.0068 211  SER A CA  
1522 C C   . SER A 211 ? 0.7155 0.7710 0.7774 0.0135  0.0372  -0.0087 211  SER A C   
1523 O O   . SER A 211 ? 0.7369 0.8000 0.8042 0.0089  0.0384  -0.0096 211  SER A O   
1524 C CB  . SER A 211 ? 0.7520 0.8139 0.8050 0.0245  0.0373  -0.0065 211  SER A CB  
1525 O OG  . SER A 211 ? 0.7640 0.8171 0.8119 0.0273  0.0350  -0.0071 211  SER A OG  
1526 N N   . TRP A 212 ? 0.6748 0.7218 0.7346 0.0142  0.0354  -0.0093 212  TRP A N   
1527 C CA  . TRP A 212 ? 0.6379 0.6839 0.7017 0.0099  0.0354  -0.0109 212  TRP A CA  
1528 C C   . TRP A 212 ? 0.6262 0.6666 0.6868 0.0127  0.0337  -0.0111 212  TRP A C   
1529 O O   . TRP A 212 ? 0.6247 0.6562 0.6817 0.0149  0.0322  -0.0098 212  TRP A O   
1530 C CB  . TRP A 212 ? 0.6241 0.6635 0.6909 0.0053  0.0363  -0.0106 212  TRP A CB  
1531 C CG  . TRP A 212 ? 0.5947 0.6311 0.6644 0.0016  0.0366  -0.0119 212  TRP A CG  
1532 C CD1 . TRP A 212 ? 0.5598 0.6002 0.6301 0.0009  0.0365  -0.0136 212  TRP A CD1 
1533 C CD2 . TRP A 212 ? 0.5429 0.5713 0.6144 -0.0012 0.0374  -0.0114 212  TRP A CD2 
1534 N NE1 . TRP A 212 ? 0.5470 0.5817 0.6189 -0.0020 0.0373  -0.0142 212  TRP A NE1 
1535 C CE2 . TRP A 212 ? 0.4965 0.5241 0.5693 -0.0033 0.0379  -0.0128 212  TRP A CE2 
1536 C CE3 . TRP A 212 ? 0.5309 0.5526 0.6026 -0.0019 0.0376  -0.0099 212  TRP A CE3 
1537 C CZ2 . TRP A 212 ? 0.5139 0.5345 0.5881 -0.0054 0.0390  -0.0125 212  TRP A CZ2 
1538 C CZ3 . TRP A 212 ? 0.5221 0.5375 0.5959 -0.0044 0.0386  -0.0096 212  TRP A CZ3 
1539 C CH2 . TRP A 212 ? 0.5120 0.5268 0.5869 -0.0059 0.0394  -0.0108 212  TRP A CH2 
1540 N N   . THR A 213 ? 0.6270 0.6730 0.6883 0.0127  0.0336  -0.0125 213  THR A N   
1541 C CA  . THR A 213 ? 0.6213 0.6627 0.6796 0.0153  0.0324  -0.0127 213  THR A CA  
1542 C C   . THR A 213 ? 0.6142 0.6509 0.6760 0.0112  0.0330  -0.0133 213  THR A C   
1543 O O   . THR A 213 ? 0.6194 0.6607 0.6839 0.0081  0.0340  -0.0149 213  THR A O   
1544 C CB  . THR A 213 ? 0.6379 0.6880 0.6941 0.0185  0.0320  -0.0137 213  THR A CB  
1545 O OG1 . THR A 213 ? 0.6606 0.7149 0.7133 0.0230  0.0319  -0.0127 213  THR A OG1 
1546 C CG2 . THR A 213 ? 0.5936 0.6384 0.6460 0.0213  0.0310  -0.0139 213  THR A CG2 
1547 N N   . VAL A 214 ? 0.6028 0.6303 0.6641 0.0113  0.0325  -0.0118 214  VAL A N   
1548 C CA  . VAL A 214 ? 0.5942 0.6168 0.6586 0.0086  0.0334  -0.0117 214  VAL A CA  
1549 C C   . VAL A 214 ? 0.5978 0.6193 0.6601 0.0108  0.0331  -0.0118 214  VAL A C   
1550 O O   . VAL A 214 ? 0.6037 0.6237 0.6620 0.0143  0.0316  -0.0110 214  VAL A O   
1551 C CB  . VAL A 214 ? 0.5825 0.5973 0.6482 0.0078  0.0328  -0.0094 214  VAL A CB  
1552 C CG1 . VAL A 214 ? 0.5896 0.6004 0.6587 0.0058  0.0341  -0.0086 214  VAL A CG1 
1553 C CG2 . VAL A 214 ? 0.5937 0.6090 0.6607 0.0060  0.0333  -0.0092 214  VAL A CG2 
1554 N N   . MET A 215 ? 0.5937 0.6154 0.6578 0.0089  0.0346  -0.0128 215  MET A N   
1555 C CA  . MET A 215 ? 0.5858 0.6075 0.6473 0.0112  0.0347  -0.0133 215  MET A CA  
1556 C C   . MET A 215 ? 0.5852 0.6017 0.6483 0.0102  0.0365  -0.0125 215  MET A C   
1557 O O   . MET A 215 ? 0.5932 0.6085 0.6584 0.0075  0.0382  -0.0131 215  MET A O   
1558 C CB  . MET A 215 ? 0.5960 0.6257 0.6558 0.0114  0.0346  -0.0160 215  MET A CB  
1559 C CG  . MET A 215 ? 0.6271 0.6637 0.6855 0.0133  0.0332  -0.0164 215  MET A CG  
1560 S SD  . MET A 215 ? 0.6821 0.7299 0.7394 0.0137  0.0327  -0.0190 215  MET A SD  
1561 C CE  . MET A 215 ? 0.7025 0.7533 0.7641 0.0071  0.0336  -0.0208 215  MET A CE  
1562 N N   . HIS A 216 ? 0.5727 0.5856 0.6341 0.0127  0.0363  -0.0108 216  HIS A N   
1563 C CA  . HIS A 216 ? 0.5687 0.5774 0.6314 0.0127  0.0384  -0.0095 216  HIS A CA  
1564 C C   . HIS A 216 ? 0.5851 0.5948 0.6435 0.0154  0.0388  -0.0105 216  HIS A C   
1565 O O   . HIS A 216 ? 0.5849 0.5930 0.6408 0.0181  0.0378  -0.0092 216  HIS A O   
1566 C CB  . HIS A 216 ? 0.5484 0.5520 0.6138 0.0128  0.0378  -0.0057 216  HIS A CB  
1567 C CG  . HIS A 216 ? 0.5725 0.5729 0.6397 0.0135  0.0401  -0.0034 216  HIS A CG  
1568 N ND1 . HIS A 216 ? 0.5667 0.5645 0.6326 0.0154  0.0398  -0.0011 216  HIS A ND1 
1569 C CD2 . HIS A 216 ? 0.5216 0.5206 0.5911 0.0127  0.0431  -0.0028 216  HIS A CD2 
1570 C CE1 . HIS A 216 ? 0.5394 0.5354 0.6076 0.0157  0.0426  0.0010  216  HIS A CE1 
1571 N NE2 . HIS A 216 ? 0.5433 0.5399 0.6136 0.0144  0.0447  0.0000  216  HIS A NE2 
1572 N N   . PRO A 217 ? 0.5973 0.6089 0.6541 0.0148  0.0402  -0.0129 217  PRO A N   
1573 C CA  . PRO A 217 ? 0.6131 0.6252 0.6652 0.0177  0.0405  -0.0139 217  PRO A CA  
1574 C C   . PRO A 217 ? 0.6215 0.6277 0.6738 0.0196  0.0424  -0.0108 217  PRO A C   
1575 O O   . PRO A 217 ? 0.6307 0.6333 0.6865 0.0183  0.0445  -0.0089 217  PRO A O   
1576 C CB  . PRO A 217 ? 0.6263 0.6395 0.6765 0.0159  0.0415  -0.0168 217  PRO A CB  
1577 C CG  . PRO A 217 ? 0.6114 0.6280 0.6647 0.0121  0.0405  -0.0181 217  PRO A CG  
1578 C CD  . PRO A 217 ? 0.6013 0.6184 0.6575 0.0128  0.0393  -0.0159 217  PRO A CD  
1579 N N   . ILE A 218 ? 0.6336 0.6390 0.6825 0.0227  0.0419  -0.0099 218  ILE A N   
1580 C CA  . ILE A 218 ? 0.6503 0.6506 0.6997 0.0242  0.0438  -0.0065 218  ILE A CA  
1581 C C   . ILE A 218 ? 0.6953 0.6947 0.7407 0.0261  0.0462  -0.0079 218  ILE A C   
1582 O O   . ILE A 218 ? 0.7184 0.7185 0.7583 0.0289  0.0457  -0.0091 218  ILE A O   
1583 C CB  . ILE A 218 ? 0.6465 0.6447 0.6932 0.0264  0.0421  -0.0047 218  ILE A CB  
1584 C CG1 . ILE A 218 ? 0.6351 0.6336 0.6833 0.0248  0.0392  -0.0043 218  ILE A CG1 
1585 C CG2 . ILE A 218 ? 0.6160 0.6090 0.6646 0.0268  0.0441  -0.0003 218  ILE A CG2 
1586 C CD1 . ILE A 218 ? 0.6169 0.6110 0.6616 0.0265  0.0372  -0.0022 218  ILE A CD1 
1587 N N   . ASP A 219 ? 0.7177 0.7150 0.7649 0.0249  0.0488  -0.0077 219  ASP A N   
1588 C CA  . ASP A 219 ? 0.7562 0.7511 0.7983 0.0269  0.0512  -0.0089 219  ASP A CA  
1589 C C   . ASP A 219 ? 0.7665 0.7566 0.8105 0.0288  0.0550  -0.0045 219  ASP A C   
1590 O O   . ASP A 219 ? 0.7530 0.7427 0.8029 0.0280  0.0553  -0.0007 219  ASP A O   
1591 C CB  . ASP A 219 ? 0.7698 0.7648 0.8103 0.0244  0.0513  -0.0123 219  ASP A CB  
1592 C CG  . ASP A 219 ? 0.7985 0.7906 0.8442 0.0221  0.0532  -0.0103 219  ASP A CG  
1593 O OD1 . ASP A 219 ? 0.7962 0.7861 0.8465 0.0231  0.0553  -0.0060 219  ASP A OD1 
1594 O OD2 . ASP A 219 ? 0.8235 0.8156 0.8686 0.0193  0.0527  -0.0129 219  ASP A OD2 
1595 N N   . HIS A 220 ? 0.7965 0.7831 0.8353 0.0314  0.0579  -0.0050 220  HIS A N   
1596 C CA  A HIS A 220 ? 0.8069 0.7895 0.8471 0.0340  0.0622  -0.0006 220  HIS A CA  
1597 C CA  B HIS A 220 ? 0.8094 0.7919 0.8494 0.0340  0.0623  -0.0008 220  HIS A CA  
1598 C C   . HIS A 220 ? 0.7939 0.7765 0.8424 0.0320  0.0638  0.0030  220  HIS A C   
1599 O O   . HIS A 220 ? 0.7999 0.7823 0.8533 0.0329  0.0660  0.0079  220  HIS A O   
1600 C CB  A HIS A 220 ? 0.8374 0.8153 0.8698 0.0372  0.0654  -0.0020 220  HIS A CB  
1601 C CB  B HIS A 220 ? 0.8405 0.8184 0.8727 0.0364  0.0649  -0.0030 220  HIS A CB  
1602 C CG  A HIS A 220 ? 0.8652 0.8422 0.8899 0.0405  0.0650  -0.0036 220  HIS A CG  
1603 C CG  B HIS A 220 ? 0.8592 0.8378 0.8871 0.0338  0.0622  -0.0084 220  HIS A CG  
1604 N ND1 A HIS A 220 ? 0.8803 0.8586 0.8982 0.0404  0.0619  -0.0087 220  HIS A ND1 
1605 N ND1 B HIS A 220 ? 0.8650 0.8485 0.8904 0.0326  0.0580  -0.0121 220  HIS A ND1 
1606 C CD2 A HIS A 220 ? 0.8817 0.8567 0.9044 0.0441  0.0672  -0.0006 220  HIS A CD2 
1607 C CD2 B HIS A 220 ? 0.8783 0.8537 0.9041 0.0320  0.0629  -0.0105 220  HIS A CD2 
1608 C CE1 A HIS A 220 ? 0.9031 0.8803 0.9148 0.0441  0.0622  -0.0089 220  HIS A CE1 
1609 C CE1 B HIS A 220 ? 0.8716 0.8555 0.8944 0.0297  0.0561  -0.0160 220  HIS A CE1 
1610 N NE2 A HIS A 220 ? 0.9081 0.8828 0.9223 0.0464  0.0655  -0.0041 220  HIS A NE2 
1611 N NE2 B HIS A 220 ? 0.8853 0.8637 0.9079 0.0291  0.0589  -0.0152 220  HIS A NE2 
1612 N N   . HIS A 221 ? 0.7864 0.7697 0.8367 0.0291  0.0627  0.0009  221  HIS A N   
1613 C CA  . HIS A 221 ? 0.7752 0.7585 0.8329 0.0274  0.0640  0.0042  221  HIS A CA  
1614 C C   . HIS A 221 ? 0.7403 0.7273 0.8056 0.0248  0.0610  0.0067  221  HIS A C   
1615 O O   . HIS A 221 ? 0.7345 0.7220 0.8064 0.0236  0.0618  0.0101  221  HIS A O   
1616 C CB  . HIS A 221 ? 0.7845 0.7661 0.8405 0.0253  0.0638  0.0010  221  HIS A CB  
1617 C CG  . HIS A 221 ? 0.8575 0.8336 0.9055 0.0274  0.0667  -0.0010 221  HIS A CG  
1618 N ND1 . HIS A 221 ? 0.9353 0.9073 0.9815 0.0315  0.0714  0.0020  221  HIS A ND1 
1619 C CD2 . HIS A 221 ? 0.8976 0.8711 0.9383 0.0261  0.0655  -0.0059 221  HIS A CD2 
1620 C CE1 . HIS A 221 ? 0.9822 0.9482 1.0191 0.0330  0.0729  -0.0010 221  HIS A CE1 
1621 N NE2 . HIS A 221 ? 0.9855 0.9522 1.0191 0.0293  0.0692  -0.0060 221  HIS A NE2 
1622 N N   . SER A 222 ? 0.7101 0.6991 0.7737 0.0240  0.0574  0.0050  222  SER A N   
1623 C CA  . SER A 222 ? 0.6719 0.6627 0.7404 0.0216  0.0541  0.0068  222  SER A CA  
1624 C C   . SER A 222 ? 0.6700 0.6601 0.7437 0.0217  0.0548  0.0123  222  SER A C   
1625 O O   . SER A 222 ? 0.6969 0.6857 0.7685 0.0240  0.0566  0.0142  222  SER A O   
1626 C CB  . SER A 222 ? 0.6609 0.6532 0.7247 0.0216  0.0504  0.0036  222  SER A CB  
1627 O OG  . SER A 222 ? 0.6222 0.6144 0.6894 0.0198  0.0474  0.0056  222  SER A OG  
1628 N N   . PRO A 223 ? 0.6532 0.6442 0.7337 0.0191  0.0531  0.0153  223  PRO A N   
1629 C CA  . PRO A 223 ? 0.6496 0.6404 0.7349 0.0183  0.0526  0.0206  223  PRO A CA  
1630 C C   . PRO A 223 ? 0.6573 0.6458 0.7380 0.0179  0.0492  0.0201  223  PRO A C   
1631 O O   . PRO A 223 ? 0.6727 0.6597 0.7560 0.0169  0.0485  0.0243  223  PRO A O   
1632 C CB  . PRO A 223 ? 0.6308 0.6232 0.7237 0.0151  0.0507  0.0234  223  PRO A CB  
1633 C CG  . PRO A 223 ? 0.6256 0.6181 0.7160 0.0143  0.0494  0.0188  223  PRO A CG  
1634 C CD  . PRO A 223 ? 0.6300 0.6221 0.7143 0.0167  0.0521  0.0147  223  PRO A CD  
1635 N N   . ILE A 224 ? 0.6423 0.6302 0.7162 0.0187  0.0469  0.0153  224  ILE A N   
1636 C CA  . ILE A 224 ? 0.6541 0.6391 0.7224 0.0195  0.0443  0.0150  224  ILE A CA  
1637 C C   . ILE A 224 ? 0.6844 0.6691 0.7452 0.0233  0.0461  0.0122  224  ILE A C   
1638 O O   . ILE A 224 ? 0.6827 0.6652 0.7371 0.0250  0.0441  0.0109  224  ILE A O   
1639 C CB  . ILE A 224 ? 0.6513 0.6349 0.7169 0.0181  0.0397  0.0130  224  ILE A CB  
1640 C CG1 . ILE A 224 ? 0.6365 0.6238 0.6999 0.0187  0.0394  0.0082  224  ILE A CG1 
1641 C CG2 . ILE A 224 ? 0.6390 0.6210 0.7109 0.0144  0.0372  0.0166  224  ILE A CG2 
1642 C CD1 . ILE A 224 ? 0.6356 0.6218 0.6928 0.0198  0.0360  0.0058  224  ILE A CD1 
1643 N N   . TYR A 225 ? 0.6999 0.6862 0.7607 0.0250  0.0498  0.0113  225  TYR A N   
1644 C CA  . TYR A 225 ? 0.7255 0.7109 0.7792 0.0287  0.0516  0.0094  225  TYR A CA  
1645 C C   . TYR A 225 ? 0.7496 0.7314 0.8017 0.0301  0.0523  0.0131  225  TYR A C   
1646 O O   . TYR A 225 ? 0.7522 0.7331 0.8100 0.0287  0.0541  0.0180  225  TYR A O   
1647 C CB  . TYR A 225 ? 0.7425 0.7284 0.7962 0.0303  0.0557  0.0089  225  TYR A CB  
1648 C CG  . TYR A 225 ? 0.7619 0.7467 0.8071 0.0340  0.0569  0.0060  225  TYR A CG  
1649 C CD1 . TYR A 225 ? 0.7768 0.7641 0.8167 0.0344  0.0545  0.0008  225  TYR A CD1 
1650 C CD2 . TYR A 225 ? 0.7882 0.7700 0.8308 0.0371  0.0606  0.0085  225  TYR A CD2 
1651 C CE1 . TYR A 225 ? 0.7921 0.7790 0.8242 0.0377  0.0550  -0.0018 225  TYR A CE1 
1652 C CE2 . TYR A 225 ? 0.7994 0.7798 0.8334 0.0408  0.0614  0.0057  225  TYR A CE2 
1653 C CZ  . TYR A 225 ? 0.8280 0.8109 0.8567 0.0409  0.0584  0.0004  225  TYR A CZ  
1654 O OH  . TYR A 225 ? 0.8901 0.8722 0.9104 0.0444  0.0587  -0.0023 225  TYR A OH  
1655 N N   . GLY A 226 ? 0.7722 0.7521 0.8164 0.0327  0.0509  0.0112  226  GLY A N   
1656 C CA  . GLY A 226 ? 0.7900 0.7654 0.8311 0.0342  0.0519  0.0145  226  GLY A CA  
1657 C C   . GLY A 226 ? 0.7939 0.7654 0.8364 0.0313  0.0486  0.0174  226  GLY A C   
1658 O O   . GLY A 226 ? 0.8174 0.7841 0.8569 0.0317  0.0487  0.0203  226  GLY A O   
1659 N N   . GLU A 227 ? 0.7818 0.7546 0.8280 0.0283  0.0456  0.0167  227  GLU A N   
1660 C CA  . GLU A 227 ? 0.7914 0.7598 0.8389 0.0250  0.0420  0.0196  227  GLU A CA  
1661 C C   . GLU A 227 ? 0.8003 0.7640 0.8375 0.0273  0.0387  0.0168  227  GLU A C   
1662 O O   . GLU A 227 ? 0.8017 0.7683 0.8338 0.0305  0.0385  0.0125  227  GLU A O   
1663 C CB  . GLU A 227 ? 0.7667 0.7382 0.8215 0.0214  0.0403  0.0196  227  GLU A CB  
1664 C CG  . GLU A 227 ? 0.7918 0.7620 0.8544 0.0170  0.0389  0.0248  227  GLU A CG  
1665 C CD  . GLU A 227 ? 0.8177 0.7890 0.8859 0.0165  0.0425  0.0299  227  GLU A CD  
1666 O OE1 . GLU A 227 ? 0.8402 0.8154 0.9105 0.0189  0.0470  0.0299  227  GLU A OE1 
1667 O OE2 . GLU A 227 ? 0.8610 0.8289 0.9313 0.0134  0.0408  0.0343  227  GLU A OE2 
1668 N N   . THR A 228 ? 0.8206 0.7770 0.8544 0.0258  0.0362  0.0196  228  THR A N   
1669 C CA  . THR A 228 ? 0.8368 0.7872 0.8599 0.0283  0.0331  0.0173  228  THR A CA  
1670 C C   . THR A 228 ? 0.8543 0.7990 0.8771 0.0246  0.0287  0.0188  228  THR A C   
1671 O O   . THR A 228 ? 0.8545 0.7997 0.8857 0.0197  0.0277  0.0220  228  THR A O   
1672 C CB  . THR A 228 ? 0.8683 0.8113 0.8826 0.0309  0.0338  0.0189  228  THR A CB  
1673 O OG1 . THR A 228 ? 0.8683 0.8062 0.8867 0.0265  0.0337  0.0243  228  THR A OG1 
1674 C CG2 . THR A 228 ? 0.8399 0.7873 0.8521 0.0354  0.0378  0.0172  228  THR A CG2 
1675 N N   . ASP A 229 ? 0.8786 0.8176 0.8912 0.0273  0.0259  0.0166  229  ASP A N   
1676 C CA  . ASP A 229 ? 0.9081 0.8393 0.9177 0.0244  0.0214  0.0178  229  ASP A CA  
1677 C C   . ASP A 229 ? 0.9189 0.8438 0.9320 0.0191  0.0202  0.0231  229  ASP A C   
1678 O O   . ASP A 229 ? 0.9232 0.8461 0.9411 0.0142  0.0171  0.0254  229  ASP A O   
1679 C CB  . ASP A 229 ? 0.9438 0.8670 0.9391 0.0290  0.0193  0.0156  229  ASP A CB  
1680 C CG  . ASP A 229 ? 1.0209 0.9351 1.0111 0.0269  0.0146  0.0162  229  ASP A CG  
1681 O OD1 . ASP A 229 ? 1.1082 1.0140 1.0985 0.0220  0.0118  0.0199  229  ASP A OD1 
1682 O OD2 . ASP A 229 ? 1.1100 1.0255 1.0958 0.0299  0.0135  0.0132  229  ASP A OD2 
1683 N N   . GLU A 230 ? 0.9324 0.8547 0.9434 0.0199  0.0225  0.0252  230  GLU A N   
1684 C CA  . GLU A 230 ? 0.9569 0.8729 0.9704 0.0148  0.0211  0.0305  230  GLU A CA  
1685 C C   . GLU A 230 ? 0.9273 0.8521 0.9562 0.0100  0.0228  0.0341  230  GLU A C   
1686 O O   . GLU A 230 ? 0.9344 0.8568 0.9684 0.0044  0.0196  0.0378  230  GLU A O   
1687 C CB  . GLU A 230 ? 0.9902 0.9007 0.9968 0.0171  0.0235  0.0321  230  GLU A CB  
1688 C CG  . GLU A 230 ? 1.0684 0.9725 1.0778 0.0113  0.0223  0.0381  230  GLU A CG  
1689 C CD  . GLU A 230 ? 1.1632 1.0652 1.1695 0.0135  0.0265  0.0404  230  GLU A CD  
1690 O OE1 . GLU A 230 ? 1.1532 1.0645 1.1659 0.0161  0.0315  0.0404  230  GLU A OE1 
1691 O OE2 . GLU A 230 ? 1.2007 1.0909 1.1975 0.0125  0.0247  0.0424  230  GLU A OE2 
1692 N N   . THR A 231 ? 0.8940 0.8287 0.9296 0.0125  0.0275  0.0332  231  THR A N   
1693 C CA  . THR A 231 ? 0.8759 0.8189 0.9253 0.0092  0.0299  0.0369  231  THR A CA  
1694 C C   . THR A 231 ? 0.8558 0.8028 0.9120 0.0062  0.0272  0.0363  231  THR A C   
1695 O O   . THR A 231 ? 0.8603 0.8107 0.9268 0.0018  0.0266  0.0407  231  THR A O   
1696 C CB  . THR A 231 ? 0.8639 0.8147 0.9170 0.0131  0.0360  0.0361  231  THR A CB  
1697 O OG1 . THR A 231 ? 0.8462 0.8009 0.8958 0.0171  0.0367  0.0302  231  THR A OG1 
1698 C CG2 . THR A 231 ? 0.8665 0.8132 0.9135 0.0159  0.0388  0.0375  231  THR A CG2 
1699 N N   . LEU A 232 ? 0.8236 0.7704 0.8744 0.0087  0.0255  0.0312  232  LEU A N   
1700 C CA  . LEU A 232 ? 0.7955 0.7445 0.8511 0.0060  0.0226  0.0306  232  LEU A CA  
1701 C C   . LEU A 232 ? 0.8158 0.7570 0.8703 0.0011  0.0172  0.0339  232  LEU A C   
1702 O O   . LEU A 232 ? 0.8054 0.7495 0.8684 -0.0029 0.0153  0.0367  232  LEU A O   
1703 C CB  . LEU A 232 ? 0.7625 0.7126 0.8120 0.0096  0.0219  0.0249  232  LEU A CB  
1704 C CG  . LEU A 232 ? 0.7267 0.6849 0.7773 0.0135  0.0263  0.0211  232  LEU A CG  
1705 C CD1 . LEU A 232 ? 0.7179 0.6776 0.7644 0.0154  0.0246  0.0167  232  LEU A CD1 
1706 C CD2 . LEU A 232 ? 0.6627 0.6284 0.7242 0.0120  0.0297  0.0230  232  LEU A CD2 
1707 N N   . ARG A 233 ? 0.8509 0.7818 0.8941 0.0017  0.0145  0.0335  233  ARG A N   
1708 C CA  . ARG A 233 ? 0.8931 0.8142 0.9330 -0.0031 0.0087  0.0365  233  ARG A CA  
1709 C C   . ARG A 233 ? 0.9046 0.8286 0.9557 -0.0092 0.0084  0.0428  233  ARG A C   
1710 O O   . ARG A 233 ? 0.9113 0.8349 0.9678 -0.0142 0.0043  0.0454  233  ARG A O   
1711 C CB  . ARG A 233 ? 0.9312 0.8393 0.9561 -0.0013 0.0065  0.0356  233  ARG A CB  
1712 C CG  . ARG A 233 ? 0.9707 0.8728 0.9835 0.0030  0.0042  0.0307  233  ARG A CG  
1713 C CD  . ARG A 233 ? 1.0542 0.9426 1.0505 0.0060  0.0024  0.0297  233  ARG A CD  
1714 N NE  . ARG A 233 ? 1.0959 0.9827 1.0825 0.0118  0.0019  0.0248  233  ARG A NE  
1715 C CZ  . ARG A 233 ? 1.1136 0.9969 1.0972 0.0111  -0.0017 0.0236  233  ARG A CZ  
1716 N NH1 . ARG A 233 ? 1.1408 1.0211 1.1298 0.0047  -0.0057 0.0265  233  ARG A NH1 
1717 N NH2 . ARG A 233 ? 1.1169 0.9999 1.0922 0.0170  -0.0014 0.0196  233  ARG A NH2 
1718 N N   . ASN A 234 ? 0.9098 0.8372 0.9646 -0.0085 0.0127  0.0455  234  ASN A N   
1719 C CA  . ASN A 234 ? 0.9374 0.8686 1.0033 -0.0139 0.0131  0.0521  234  ASN A CA  
1720 C C   . ASN A 234 ? 0.9082 0.8516 0.9891 -0.0158 0.0145  0.0546  234  ASN A C   
1721 O O   . ASN A 234 ? 0.9313 0.8777 1.0218 -0.0214 0.0125  0.0603  234  ASN A O   
1722 C CB  . ASN A 234 ? 0.9634 0.8952 1.0289 -0.0120 0.0180  0.0546  234  ASN A CB  
1723 C CG  . ASN A 234 ? 1.0367 0.9550 1.0877 -0.0113 0.0159  0.0537  234  ASN A CG  
1724 O OD1 . ASN A 234 ? 1.1039 1.0115 1.1471 -0.0146 0.0100  0.0536  234  ASN A OD1 
1725 N ND2 . ASN A 234 ? 1.0784 0.9962 1.1246 -0.0068 0.0205  0.0530  234  ASN A ND2 
1726 N N   . SER A 235 ? 0.8666 0.8170 0.9497 -0.0115 0.0179  0.0507  235  SER A N   
1727 C CA  . SER A 235 ? 0.8395 0.7999 0.9352 -0.0129 0.0191  0.0528  235  SER A CA  
1728 C C   . SER A 235 ? 0.8267 0.7850 0.9221 -0.0154 0.0136  0.0512  235  SER A C   
1729 O O   . SER A 235 ? 0.8245 0.7898 0.9296 -0.0170 0.0136  0.0531  235  SER A O   
1730 C CB  . SER A 235 ? 0.8128 0.7812 0.9116 -0.0076 0.0255  0.0502  235  SER A CB  
1731 O OG  . SER A 235 ? 0.7988 0.7640 0.8873 -0.0031 0.0261  0.0436  235  SER A OG  
1732 N N   . HIS A 236 ? 0.8243 0.7721 0.9079 -0.0156 0.0089  0.0480  236  HIS A N   
1733 C CA  A HIS A 236 ? 0.8139 0.7577 0.8947 -0.0174 0.0036  0.0462  236  HIS A CA  
1734 C CA  B HIS A 236 ? 0.8215 0.7658 0.9032 -0.0177 0.0037  0.0466  236  HIS A CA  
1735 C C   . HIS A 236 ? 0.7735 0.7240 0.8565 -0.0137 0.0064  0.0421  236  HIS A C   
1736 O O   . HIS A 236 ? 0.7688 0.7225 0.8574 -0.0155 0.0046  0.0428  236  HIS A O   
1737 C CB  A HIS A 236 ? 0.8328 0.7769 0.9216 -0.0241 -0.0012 0.0516  236  HIS A CB  
1738 C CB  B HIS A 236 ? 0.8395 0.7866 0.9317 -0.0241 0.0000  0.0526  236  HIS A CB  
1739 C CG  A HIS A 236 ? 0.8438 0.7785 0.9245 -0.0262 -0.0081 0.0498  236  HIS A CG  
1740 C CG  B HIS A 236 ? 0.9158 0.8561 1.0064 -0.0294 -0.0039 0.0571  236  HIS A CG  
1741 N ND1 A HIS A 236 ? 0.8665 0.8026 0.9538 -0.0311 -0.0129 0.0530  236  HIS A ND1 
1742 N ND1 B HIS A 236 ? 0.9616 0.8885 1.0407 -0.0323 -0.0105 0.0563  236  HIS A ND1 
1743 C CD2 A HIS A 236 ? 0.8415 0.7654 0.9076 -0.0236 -0.0107 0.0452  236  HIS A CD2 
1744 C CD2 B HIS A 236 ? 0.9483 0.8926 1.0467 -0.0325 -0.0020 0.0628  236  HIS A CD2 
1745 C CE1 A HIS A 236 ? 0.8753 0.8007 0.9517 -0.0316 -0.0184 0.0502  236  HIS A CE1 
1746 C CE1 B HIS A 236 ? 0.9901 0.9126 1.0700 -0.0374 -0.0128 0.0611  236  HIS A CE1 
1747 N NE2 A HIS A 236 ? 0.8503 0.7682 0.9136 -0.0268 -0.0170 0.0456  236  HIS A NE2 
1748 N NE2 B HIS A 236 ? 0.9875 0.9210 1.0795 -0.0377 -0.0077 0.0653  236  HIS A NE2 
1749 N N   . SER A 237 ? 0.7413 0.6932 0.8190 -0.0085 0.0106  0.0379  237  SER A N   
1750 C CA  . SER A 237 ? 0.6865 0.6446 0.7656 -0.0051 0.0137  0.0338  237  SER A CA  
1751 C C   . SER A 237 ? 0.6694 0.6229 0.7415 -0.0044 0.0100  0.0302  237  SER A C   
1752 O O   . SER A 237 ? 0.6824 0.6277 0.7434 -0.0029 0.0074  0.0281  237  SER A O   
1753 C CB  . SER A 237 ? 0.6760 0.6366 0.7508 -0.0002 0.0185  0.0305  237  SER A CB  
1754 O OG  . SER A 237 ? 0.6625 0.6281 0.7441 -0.0001 0.0228  0.0336  237  SER A OG  
1755 N N   . GLU A 238 ? 0.6277 0.5860 0.7056 -0.0049 0.0103  0.0297  238  GLU A N   
1756 C CA  . GLU A 238 ? 0.6056 0.5611 0.6776 -0.0036 0.0081  0.0261  238  GLU A CA  
1757 C C   . GLU A 238 ? 0.5772 0.5405 0.6528 -0.0010 0.0126  0.0230  238  GLU A C   
1758 O O   . GLU A 238 ? 0.5579 0.5277 0.6407 -0.0008 0.0168  0.0241  238  GLU A O   
1759 C CB  . GLU A 238 ? 0.6163 0.5678 0.6901 -0.0075 0.0029  0.0287  238  GLU A CB  
1760 C CG  . GLU A 238 ? 0.6657 0.6077 0.7340 -0.0105 -0.0021 0.0314  238  GLU A CG  
1761 C CD  . GLU A 238 ? 0.7184 0.6548 0.7863 -0.0145 -0.0083 0.0336  238  GLU A CD  
1762 O OE1 . GLU A 238 ? 0.7497 0.6902 0.8226 -0.0149 -0.0086 0.0335  238  GLU A OE1 
1763 O OE2 . GLU A 238 ? 0.8100 0.7372 0.8719 -0.0174 -0.0133 0.0355  238  GLU A OE2 
1764 N N   . PHE A 239 ? 0.5566 0.5187 0.6264 0.0009  0.0120  0.0193  239  PHE A N   
1765 C CA  . PHE A 239 ? 0.5395 0.5082 0.6119 0.0026  0.0158  0.0164  239  PHE A CA  
1766 C C   . PHE A 239 ? 0.5547 0.5223 0.6271 0.0018  0.0138  0.0158  239  PHE A C   
1767 O O   . PHE A 239 ? 0.5653 0.5267 0.6305 0.0022  0.0101  0.0151  239  PHE A O   
1768 C CB  . PHE A 239 ? 0.5219 0.4926 0.5878 0.0064  0.0181  0.0123  239  PHE A CB  
1769 C CG  . PHE A 239 ? 0.5299 0.5015 0.5951 0.0077  0.0202  0.0127  239  PHE A CG  
1770 C CD1 . PHE A 239 ? 0.5415 0.5068 0.6010 0.0080  0.0178  0.0142  239  PHE A CD1 
1771 C CD2 . PHE A 239 ? 0.5285 0.5061 0.5981 0.0084  0.0245  0.0120  239  PHE A CD2 
1772 C CE1 . PHE A 239 ? 0.5853 0.5510 0.6441 0.0092  0.0199  0.0149  239  PHE A CE1 
1773 C CE2 . PHE A 239 ? 0.5324 0.5104 0.6009 0.0099  0.0266  0.0125  239  PHE A CE2 
1774 C CZ  . PHE A 239 ? 0.5534 0.5258 0.6169 0.0104  0.0245  0.0141  239  PHE A CZ  
1775 N N   . LEU A 240 ? 0.5578 0.5305 0.6374 0.0008  0.0163  0.0162  240  LEU A N   
1776 C CA  . LEU A 240 ? 0.5619 0.5336 0.6426 -0.0001 0.0147  0.0163  240  LEU A CA  
1777 C C   . LEU A 240 ? 0.5548 0.5310 0.6355 0.0012  0.0185  0.0129  240  LEU A C   
1778 O O   . LEU A 240 ? 0.5483 0.5291 0.6320 0.0018  0.0224  0.0119  240  LEU A O   
1779 C CB  . LEU A 240 ? 0.5701 0.5432 0.6595 -0.0029 0.0139  0.0207  240  LEU A CB  
1780 C CG  . LEU A 240 ? 0.6182 0.5912 0.7105 -0.0039 0.0127  0.0215  240  LEU A CG  
1781 C CD1 . LEU A 240 ? 0.6635 0.6290 0.7483 -0.0044 0.0073  0.0211  240  LEU A CD1 
1782 C CD2 . LEU A 240 ? 0.6071 0.5837 0.7092 -0.0059 0.0128  0.0262  240  LEU A CD2 
1783 N N   . VAL A 241 ? 0.5671 0.5413 0.6434 0.0019  0.0173  0.0111  241  VAL A N   
1784 C CA  . VAL A 241 ? 0.5616 0.5401 0.6376 0.0027  0.0207  0.0081  241  VAL A CA  
1785 C C   . VAL A 241 ? 0.5612 0.5381 0.6387 0.0016  0.0201  0.0088  241  VAL A C   
1786 O O   . VAL A 241 ? 0.5839 0.5558 0.6576 0.0017  0.0165  0.0097  241  VAL A O   
1787 C CB  . VAL A 241 ? 0.5729 0.5517 0.6414 0.0052  0.0204  0.0051  241  VAL A CB  
1788 C CG1 . VAL A 241 ? 0.5621 0.5471 0.6316 0.0053  0.0241  0.0023  241  VAL A CG1 
1789 C CG2 . VAL A 241 ? 0.5935 0.5714 0.6582 0.0069  0.0196  0.0049  241  VAL A CG2 
1790 N N   . LEU A 242 ? 0.5474 0.5276 0.6292 0.0008  0.0235  0.0083  242  LEU A N   
1791 C CA  . LEU A 242 ? 0.5426 0.5212 0.6250 0.0001  0.0236  0.0085  242  LEU A CA  
1792 C C   . LEU A 242 ? 0.5279 0.5097 0.6080 0.0003  0.0268  0.0053  242  LEU A C   
1793 O O   . LEU A 242 ? 0.5177 0.5032 0.5990 0.0000  0.0297  0.0037  242  LEU A O   
1794 C CB  . LEU A 242 ? 0.5514 0.5305 0.6405 -0.0010 0.0249  0.0112  242  LEU A CB  
1795 C CG  . LEU A 242 ? 0.5951 0.5722 0.6843 -0.0014 0.0256  0.0114  242  LEU A CG  
1796 C CD1 . LEU A 242 ? 0.6101 0.5824 0.6963 -0.0013 0.0210  0.0129  242  LEU A CD1 
1797 C CD2 . LEU A 242 ? 0.5759 0.5541 0.6710 -0.0017 0.0286  0.0135  242  LEU A CD2 
1798 N N   . PHE A 243 ? 0.5257 0.5058 0.6021 0.0007  0.0262  0.0045  243  PHE A N   
1799 C CA  . PHE A 243 ? 0.5181 0.5016 0.5930 0.0003  0.0292  0.0021  243  PHE A CA  
1800 C C   . PHE A 243 ? 0.5307 0.5112 0.6066 -0.0008 0.0301  0.0030  243  PHE A C   
1801 O O   . PHE A 243 ? 0.5505 0.5263 0.6252 -0.0001 0.0273  0.0050  243  PHE A O   
1802 C CB  . PHE A 243 ? 0.5093 0.4939 0.5783 0.0023  0.0280  0.0007  243  PHE A CB  
1803 C CG  . PHE A 243 ? 0.5190 0.5072 0.5869 0.0017  0.0307  -0.0007 243  PHE A CG  
1804 C CD1 . PHE A 243 ? 0.4901 0.4854 0.5588 0.0010  0.0331  -0.0029 243  PHE A CD1 
1805 C CD2 . PHE A 243 ? 0.5247 0.5095 0.5909 0.0017  0.0308  0.0000  243  PHE A CD2 
1806 C CE1 . PHE A 243 ? 0.5329 0.5323 0.6013 -0.0002 0.0354  -0.0039 243  PHE A CE1 
1807 C CE2 . PHE A 243 ? 0.5568 0.5453 0.6223 0.0008  0.0336  -0.0009 243  PHE A CE2 
1808 C CZ  . PHE A 243 ? 0.5487 0.5447 0.6156 -0.0004 0.0359  -0.0028 243  PHE A CZ  
1809 N N   . THR A 244 ? 0.5223 0.5047 0.5994 -0.0025 0.0336  0.0017  244  THR A N   
1810 C CA  . THR A 244 ? 0.5396 0.5184 0.6162 -0.0032 0.0346  0.0025  244  THR A CA  
1811 C C   . THR A 244 ? 0.5593 0.5410 0.6344 -0.0051 0.0378  0.0003  244  THR A C   
1812 O O   . THR A 244 ? 0.5569 0.5432 0.6325 -0.0064 0.0394  -0.0016 244  THR A O   
1813 C CB  . THR A 244 ? 0.5418 0.5176 0.6223 -0.0040 0.0360  0.0042  244  THR A CB  
1814 O OG1 . THR A 244 ? 0.5358 0.5137 0.6176 -0.0054 0.0393  0.0026  244  THR A OG1 
1815 C CG2 . THR A 244 ? 0.5251 0.4997 0.6090 -0.0028 0.0333  0.0070  244  THR A CG2 
1816 N N   . GLY A 245 ? 0.5801 0.5590 0.6531 -0.0054 0.0387  0.0008  245  GLY A N   
1817 C CA  . GLY A 245 ? 0.6086 0.5899 0.6807 -0.0080 0.0419  -0.0006 245  GLY A CA  
1818 C C   . GLY A 245 ? 0.6416 0.6185 0.7113 -0.0080 0.0429  0.0004  245  GLY A C   
1819 O O   . GLY A 245 ? 0.6422 0.6142 0.7106 -0.0059 0.0408  0.0023  245  GLY A O   
1820 N N   . HIS A 246 ? 0.6770 0.6556 0.7458 -0.0108 0.0458  -0.0005 246  HIS A N   
1821 C CA  . HIS A 246 ? 0.7102 0.6846 0.7762 -0.0110 0.0473  0.0006  246  HIS A CA  
1822 C C   . HIS A 246 ? 0.7292 0.7087 0.7931 -0.0098 0.0474  0.0007  246  HIS A C   
1823 O O   . HIS A 246 ? 0.7309 0.7176 0.7960 -0.0119 0.0490  -0.0004 246  HIS A O   
1824 C CB  . HIS A 246 ? 0.7348 0.7063 0.8009 -0.0150 0.0509  0.0000  246  HIS A CB  
1825 C CG  . HIS A 246 ? 0.7563 0.7226 0.8191 -0.0153 0.0527  0.0013  246  HIS A CG  
1826 N ND1 . HIS A 246 ? 0.7664 0.7249 0.8275 -0.0130 0.0522  0.0031  246  HIS A ND1 
1827 C CD2 . HIS A 246 ? 0.7922 0.7603 0.8532 -0.0174 0.0551  0.0014  246  HIS A CD2 
1828 C CE1 . HIS A 246 ? 0.7843 0.7391 0.8418 -0.0135 0.0542  0.0041  246  HIS A CE1 
1829 N NE2 . HIS A 246 ? 0.8096 0.7702 0.8672 -0.0163 0.0562  0.0031  246  HIS A NE2 
1830 N N   . HIS A 247 ? 0.7584 0.7342 0.8186 -0.0062 0.0455  0.0022  247  HIS A N   
1831 C CA  . HIS A 247 ? 0.7934 0.7727 0.8502 -0.0040 0.0460  0.0027  247  HIS A CA  
1832 C C   . HIS A 247 ? 0.8458 0.8245 0.9011 -0.0060 0.0497  0.0035  247  HIS A C   
1833 O O   . HIS A 247 ? 0.8635 0.8346 0.9165 -0.0057 0.0502  0.0048  247  HIS A O   
1834 C CB  . HIS A 247 ? 0.7802 0.7543 0.8318 0.0008  0.0424  0.0039  247  HIS A CB  
1835 C CG  . HIS A 247 ? 0.7959 0.7752 0.8442 0.0040  0.0421  0.0038  247  HIS A CG  
1836 N ND1 . HIS A 247 ? 0.8301 0.8152 0.8774 0.0043  0.0455  0.0043  247  HIS A ND1 
1837 C CD2 . HIS A 247 ? 0.7724 0.7523 0.8183 0.0072  0.0392  0.0035  247  HIS A CD2 
1838 C CE1 . HIS A 247 ? 0.8254 0.8148 0.8697 0.0081  0.0447  0.0043  247  HIS A CE1 
1839 N NE2 . HIS A 247 ? 0.7978 0.7834 0.8406 0.0100  0.0409  0.0037  247  HIS A NE2 
1840 N N   . GLU A 248 ? 0.8875 0.8747 0.9446 -0.0080 0.0523  0.0031  248  GLU A N   
1841 C CA  . GLU A 248 ? 0.9435 0.9315 0.9998 -0.0105 0.0560  0.0042  248  GLU A CA  
1842 C C   . GLU A 248 ? 0.9732 0.9581 1.0239 -0.0059 0.0564  0.0064  248  GLU A C   
1843 O O   . GLU A 248 ? 0.9982 0.9781 1.0464 -0.0067 0.0587  0.0078  248  GLU A O   
1844 C CB  . GLU A 248 ? 0.9570 0.9564 1.0177 -0.0144 0.0583  0.0036  248  GLU A CB  
1845 C CG  . GLU A 248 ? 0.9612 0.9615 1.0259 -0.0200 0.0585  0.0015  248  GLU A CG  
1846 C CD  . GLU A 248 ? 0.9966 1.0057 1.0647 -0.0255 0.0611  0.0014  248  GLU A CD  
1847 O OE1 . GLU A 248 ? 1.0227 1.0419 1.0924 -0.0243 0.0618  0.0025  248  GLU A OE1 
1848 O OE2 . GLU A 248 ? 1.0101 1.0160 1.0791 -0.0311 0.0622  0.0003  248  GLU A OE2 
1849 N N   . ALA A 249 ? 0.9741 0.9608 1.0218 -0.0009 0.0541  0.0067  249  ALA A N   
1850 C CA  . ALA A 249 ? 0.9933 0.9749 1.0337 0.0043  0.0539  0.0086  249  ALA A CA  
1851 C C   . ALA A 249 ? 1.0078 0.9776 1.0443 0.0049  0.0529  0.0095  249  ALA A C   
1852 O O   . ALA A 249 ? 1.0398 1.0059 1.0720 0.0061  0.0551  0.0112  249  ALA A O   
1853 C CB  . ALA A 249 ? 0.9797 0.9606 1.0156 0.0097  0.0504  0.0084  249  ALA A CB  
1854 N N   . PHE A 250 ? 0.9938 0.9581 1.0320 0.0039  0.0497  0.0086  250  PHE A N   
1855 C CA  . PHE A 250 ? 1.0007 0.9546 1.0355 0.0052  0.0478  0.0097  250  PHE A CA  
1856 C C   . PHE A 250 ? 1.0028 0.9541 1.0417 0.0010  0.0498  0.0095  250  PHE A C   
1857 O O   . PHE A 250 ? 1.0042 0.9477 1.0412 0.0020  0.0484  0.0105  250  PHE A O   
1858 C CB  . PHE A 250 ? 0.9866 0.9360 1.0202 0.0077  0.0422  0.0095  250  PHE A CB  
1859 C CG  . PHE A 250 ? 1.0069 0.9573 1.0355 0.0118  0.0398  0.0094  250  PHE A CG  
1860 C CD1 . PHE A 250 ? 1.0050 0.9596 1.0362 0.0118  0.0375  0.0082  250  PHE A CD1 
1861 C CD2 . PHE A 250 ? 1.0455 0.9916 1.0655 0.0162  0.0401  0.0107  250  PHE A CD2 
1862 C CE1 . PHE A 250 ? 1.0142 0.9684 1.0396 0.0159  0.0354  0.0081  250  PHE A CE1 
1863 C CE2 . PHE A 250 ? 1.0514 0.9969 1.0651 0.0206  0.0381  0.0107  250  PHE A CE2 
1864 C CZ  . PHE A 250 ? 1.0493 0.9986 1.0656 0.0205  0.0357  0.0093  250  PHE A CZ  
1865 N N   . ALA A 251 ? 1.0006 0.9581 1.0444 -0.0033 0.0528  0.0082  251  ALA A N   
1866 C CA  . ALA A 251 ? 1.0012 0.9551 1.0476 -0.0071 0.0547  0.0078  251  ALA A CA  
1867 C C   . ALA A 251 ? 0.9759 0.9244 1.0236 -0.0056 0.0514  0.0080  251  ALA A C   
1868 O O   . ALA A 251 ? 0.9982 0.9400 1.0449 -0.0058 0.0523  0.0090  251  ALA A O   
1869 C CB  . ALA A 251 ? 1.0328 0.9809 1.0753 -0.0081 0.0581  0.0093  251  ALA A CB  
1870 N N   . GLN A 252 ? 0.9375 0.8890 0.9873 -0.0038 0.0479  0.0075  252  GLN A N   
1871 C CA  . GLN A 252 ? 0.9152 0.8634 0.9677 -0.0030 0.0451  0.0081  252  GLN A CA  
1872 C C   . GLN A 252 ? 0.8649 0.8184 0.9215 -0.0031 0.0428  0.0071  252  GLN A C   
1873 O O   . GLN A 252 ? 0.8483 0.8075 0.9048 -0.0030 0.0426  0.0058  252  GLN A O   
1874 C CB  . GLN A 252 ? 0.9315 0.8731 0.9804 0.0004  0.0416  0.0102  252  GLN A CB  
1875 C CG  . GLN A 252 ? 0.9683 0.9093 1.0121 0.0035  0.0389  0.0105  252  GLN A CG  
1876 C CD  . GLN A 252 ? 1.0575 0.9908 1.0969 0.0064  0.0351  0.0125  252  GLN A CD  
1877 O OE1 . GLN A 252 ? 1.0836 1.0145 1.1260 0.0064  0.0325  0.0138  252  GLN A OE1 
1878 N NE2 . GLN A 252 ? 1.1032 1.0327 1.1352 0.0092  0.0347  0.0130  252  GLN A NE2 
1879 N N   . ASN A 253 ? 0.8335 0.7855 0.8937 -0.0030 0.0412  0.0078  253  ASN A N   
1880 C CA  . ASN A 253 ? 0.7938 0.7505 0.8579 -0.0031 0.0393  0.0071  253  ASN A CA  
1881 C C   . ASN A 253 ? 0.7557 0.7124 0.8183 -0.0006 0.0347  0.0078  253  ASN A C   
1882 O O   . ASN A 253 ? 0.7654 0.7171 0.8257 0.0012  0.0315  0.0097  253  ASN A O   
1883 C CB  . ASN A 253 ? 0.7926 0.7485 0.8613 -0.0038 0.0399  0.0079  253  ASN A CB  
1884 C CG  . ASN A 253 ? 0.8484 0.8039 0.9174 -0.0064 0.0445  0.0065  253  ASN A CG  
1885 O OD1 . ASN A 253 ? 0.8930 0.8509 0.9601 -0.0087 0.0468  0.0045  253  ASN A OD1 
1886 N ND2 . ASN A 253 ? 0.8664 0.8186 0.9371 -0.0060 0.0458  0.0077  253  ASN A ND2 
1887 N N   . VAL A 254 ? 0.7027 0.6644 0.7658 -0.0006 0.0341  0.0063  254  VAL A N   
1888 C CA  . VAL A 254 ? 0.6572 0.6180 0.7182 0.0014  0.0298  0.0068  254  VAL A CA  
1889 C C   . VAL A 254 ? 0.6255 0.5898 0.6912 0.0006  0.0288  0.0066  254  VAL A C   
1890 O O   . VAL A 254 ? 0.6185 0.5869 0.6880 -0.0011 0.0317  0.0054  254  VAL A O   
1891 C CB  . VAL A 254 ? 0.6629 0.6254 0.7182 0.0035  0.0299  0.0057  254  VAL A CB  
1892 C CG1 . VAL A 254 ? 0.6729 0.6311 0.7230 0.0048  0.0308  0.0065  254  VAL A CG1 
1893 C CG2 . VAL A 254 ? 0.6269 0.5977 0.6846 0.0020  0.0332  0.0035  254  VAL A CG2 
1894 N N   . HIS A 255 ? 0.6078 0.5698 0.6722 0.0019  0.0245  0.0077  255  HIS A N   
1895 C CA  A HIS A 255 ? 0.5916 0.5560 0.6601 0.0012  0.0233  0.0081  255  HIS A CA  
1896 C CA  B HIS A 255 ? 0.5885 0.5535 0.6566 0.0013  0.0237  0.0077  255  HIS A CA  
1897 C C   . HIS A 255 ? 0.5882 0.5504 0.6513 0.0031  0.0196  0.0079  255  HIS A C   
1898 O O   . HIS A 255 ? 0.6014 0.5580 0.6582 0.0047  0.0168  0.0084  255  HIS A O   
1899 C CB  A HIS A 255 ? 0.5920 0.5542 0.6655 0.0003  0.0214  0.0110  255  HIS A CB  
1900 C CB  B HIS A 255 ? 0.5800 0.5445 0.6545 0.0000  0.0229  0.0101  255  HIS A CB  
1901 C CG  A HIS A 255 ? 0.6048 0.5648 0.6789 0.0001  0.0233  0.0119  255  HIS A CG  
1902 C CG  B HIS A 255 ? 0.5716 0.5314 0.6454 0.0004  0.0178  0.0129  255  HIS A CG  
1903 N ND1 A HIS A 255 ? 0.6099 0.5714 0.6891 -0.0006 0.0264  0.0127  255  HIS A ND1 
1904 N ND1 B HIS A 255 ? 0.5973 0.5530 0.6702 0.0007  0.0164  0.0146  255  HIS A ND1 
1905 C CD2 A HIS A 255 ? 0.6000 0.5556 0.6693 0.0011  0.0228  0.0120  255  HIS A CD2 
1906 C CD2 B HIS A 255 ? 0.5567 0.5147 0.6300 0.0003  0.0135  0.0142  255  HIS A CD2 
1907 C CE1 A HIS A 255 ? 0.6052 0.5633 0.6828 -0.0003 0.0277  0.0133  255  HIS A CE1 
1908 C CE1 B HIS A 255 ? 0.5982 0.5503 0.6705 0.0006  0.0111  0.0168  255  HIS A CE1 
1909 N NE2 A HIS A 255 ? 0.5924 0.5471 0.6641 0.0006  0.0255  0.0129  255  HIS A NE2 
1910 N NE2 B HIS A 255 ? 0.5993 0.5525 0.6719 0.0001  0.0092  0.0167  255  HIS A NE2 
1911 N N   . ALA A 256 ? 0.5606 0.5259 0.6250 0.0030  0.0194  0.0072  256  ALA A N   
1912 C CA  . ALA A 256 ? 0.5614 0.5231 0.6199 0.0049  0.0157  0.0073  256  ALA A CA  
1913 C C   . ALA A 256 ? 0.5557 0.5189 0.6180 0.0038  0.0147  0.0081  256  ALA A C   
1914 O O   . ALA A 256 ? 0.5462 0.5149 0.6145 0.0025  0.0178  0.0076  256  ALA A O   
1915 C CB  . ALA A 256 ? 0.5472 0.5110 0.5993 0.0076  0.0174  0.0050  256  ALA A CB  
1916 N N   . ARG A 257 ? 0.5636 0.5214 0.6221 0.0041  0.0103  0.0094  257  ARG A N   
1917 C CA  . ARG A 257 ? 0.5612 0.5203 0.6234 0.0029  0.0095  0.0105  257  ARG A CA  
1918 C C   . ARG A 257 ? 0.5578 0.5118 0.6120 0.0046  0.0065  0.0101  257  ARG A C   
1919 O O   . ARG A 257 ? 0.5700 0.5173 0.6155 0.0065  0.0037  0.0097  257  ARG A O   
1920 C CB  . ARG A 257 ? 0.5720 0.5300 0.6408 0.0001  0.0070  0.0140  257  ARG A CB  
1921 C CG  . ARG A 257 ? 0.6313 0.5825 0.6964 -0.0002 0.0025  0.0156  257  ARG A CG  
1922 C CD  . ARG A 257 ? 0.7264 0.6787 0.7998 -0.0031 0.0003  0.0195  257  ARG A CD  
1923 N NE  . ARG A 257 ? 0.8222 0.7679 0.8914 -0.0034 -0.0044 0.0208  257  ARG A NE  
1924 C CZ  . ARG A 257 ? 0.8641 0.8019 0.9266 -0.0042 -0.0103 0.0217  257  ARG A CZ  
1925 N NH1 . ARG A 257 ? 0.8732 0.8085 0.9327 -0.0048 -0.0121 0.0217  257  ARG A NH1 
1926 N NH2 . ARG A 257 ? 0.8813 0.8126 0.9391 -0.0043 -0.0147 0.0227  257  ARG A NH2 
1927 N N   . HIS A 258 ? 0.5366 0.4928 0.5928 0.0042  0.0071  0.0103  258  HIS A N   
1928 C CA  . HIS A 258 ? 0.5524 0.5030 0.6003 0.0060  0.0045  0.0099  258  HIS A CA  
1929 C C   . HIS A 258 ? 0.5563 0.5088 0.6094 0.0041  0.0047  0.0116  258  HIS A C   
1930 O O   . HIS A 258 ? 0.5595 0.5190 0.6215 0.0027  0.0080  0.0121  258  HIS A O   
1931 C CB  . HIS A 258 ? 0.5370 0.4908 0.5791 0.0100  0.0075  0.0068  258  HIS A CB  
1932 C CG  . HIS A 258 ? 0.5777 0.5246 0.6090 0.0132  0.0051  0.0063  258  HIS A CG  
1933 N ND1 . HIS A 258 ? 0.6038 0.5426 0.6247 0.0159  0.0024  0.0060  258  HIS A ND1 
1934 C CD2 . HIS A 258 ? 0.6098 0.5560 0.6377 0.0147  0.0052  0.0059  258  HIS A CD2 
1935 C CE1 . HIS A 258 ? 0.5993 0.5323 0.6108 0.0189  0.0010  0.0056  258  HIS A CE1 
1936 N NE2 . HIS A 258 ? 0.6316 0.5691 0.6473 0.0182  0.0026  0.0055  258  HIS A NE2 
1937 N N   . ALA A 259 ? 0.5708 0.5166 0.6179 0.0043  0.0015  0.0125  259  ALA A N   
1938 C CA  . ALA A 259 ? 0.5676 0.5148 0.6190 0.0026  0.0018  0.0144  259  ALA A CA  
1939 C C   . ALA A 259 ? 0.5902 0.5319 0.6317 0.0053  0.0009  0.0131  259  ALA A C   
1940 O O   . ALA A 259 ? 0.6059 0.5398 0.6368 0.0076  -0.0017 0.0121  259  ALA A O   
1941 C CB  . ALA A 259 ? 0.5783 0.5221 0.6345 -0.0016 -0.0020 0.0184  259  ALA A CB  
1942 N N   . TYR A 260 ? 0.5884 0.5337 0.6326 0.0055  0.0033  0.0134  260  TYR A N   
1943 C CA  . TYR A 260 ? 0.6204 0.5606 0.6557 0.0082  0.0028  0.0125  260  TYR A CA  
1944 C C   . TYR A 260 ? 0.6491 0.5871 0.6876 0.0053  0.0019  0.0157  260  TYR A C   
1945 O O   . TYR A 260 ? 0.6297 0.5747 0.6786 0.0030  0.0045  0.0175  260  TYR A O   
1946 C CB  . TYR A 260 ? 0.6024 0.5503 0.6371 0.0121  0.0074  0.0094  260  TYR A CB  
1947 C CG  . TYR A 260 ? 0.5890 0.5418 0.6221 0.0148  0.0092  0.0065  260  TYR A CG  
1948 C CD1 . TYR A 260 ? 0.5226 0.4839 0.5644 0.0132  0.0122  0.0057  260  TYR A CD1 
1949 C CD2 . TYR A 260 ? 0.5485 0.4972 0.5709 0.0191  0.0081  0.0048  260  TYR A CD2 
1950 C CE1 . TYR A 260 ? 0.5471 0.5130 0.5877 0.0151  0.0139  0.0034  260  TYR A CE1 
1951 C CE2 . TYR A 260 ? 0.5489 0.5032 0.5705 0.0215  0.0101  0.0027  260  TYR A CE2 
1952 C CZ  . TYR A 260 ? 0.5549 0.5180 0.5860 0.0191  0.0129  0.0020  260  TYR A CZ  
1953 O OH  . TYR A 260 ? 0.5237 0.4925 0.5545 0.0209  0.0150  0.0002  260  TYR A OH  
1954 N N   . SER A 261 ? 0.6970 0.6249 0.7258 0.0058  -0.0012 0.0164  261  SER A N   
1955 C CA  . SER A 261 ? 0.7514 0.6766 0.7816 0.0035  -0.0016 0.0193  261  SER A CA  
1956 C C   . SER A 261 ? 0.7612 0.6888 0.7871 0.0078  0.0021  0.0172  261  SER A C   
1957 O O   . SER A 261 ? 0.7500 0.6811 0.7716 0.0123  0.0043  0.0137  261  SER A O   
1958 C CB  . SER A 261 ? 0.7854 0.6970 0.8068 0.0009  -0.0075 0.0214  261  SER A CB  
1959 O OG  . SER A 261 ? 0.8263 0.7292 0.8329 0.0057  -0.0088 0.0186  261  SER A OG  
1960 N N   . CYS A 262 ? 0.8026 0.7288 0.8298 0.0065  0.0028  0.0195  262  CYS A N   
1961 C CA  . CYS A 262 ? 0.8368 0.7644 0.8593 0.0107  0.0063  0.0178  262  CYS A CA  
1962 C C   . CYS A 262 ? 0.8549 0.7751 0.8630 0.0158  0.0049  0.0151  262  CYS A C   
1963 O O   . CYS A 262 ? 0.8510 0.7758 0.8557 0.0207  0.0080  0.0123  262  CYS A O   
1964 C CB  . CYS A 262 ? 0.8609 0.7843 0.8842 0.0082  0.0062  0.0214  262  CYS A CB  
1965 S SG  . CYS A 262 ? 0.9172 0.8503 0.9565 0.0039  0.0090  0.0252  262  CYS A SG  
1966 N N   . ASP A 263 ? 0.8858 0.7939 0.8850 0.0146  0.0002  0.0161  263  ASP A N   
1967 C CA  . ASP A 263 ? 0.9176 0.8164 0.9015 0.0198  -0.0013 0.0140  263  ASP A CA  
1968 C C   . ASP A 263 ? 0.8865 0.7933 0.8691 0.0251  0.0013  0.0103  263  ASP A C   
1969 O O   . ASP A 263 ? 0.9180 0.8212 0.8892 0.0311  0.0017  0.0084  263  ASP A O   
1970 C CB  . ASP A 263 ? 0.9585 0.8444 0.9344 0.0174  -0.0069 0.0151  263  ASP A CB  
1971 C CG  . ASP A 263 ? 1.0465 0.9226 1.0219 0.0115  -0.0108 0.0190  263  ASP A CG  
1972 O OD1 . ASP A 263 ? 1.1165 0.9873 1.0865 0.0123  -0.0101 0.0199  263  ASP A OD1 
1973 O OD2 . ASP A 263 ? 1.1328 1.0068 1.1133 0.0059  -0.0146 0.0212  263  ASP A OD2 
1974 N N   . GLU A 264 ? 0.8203 0.7374 0.8139 0.0231  0.0028  0.0097  264  GLU A N   
1975 C CA  . GLU A 264 ? 0.7807 0.7037 0.7725 0.0271  0.0043  0.0068  264  GLU A CA  
1976 C C   . GLU A 264 ? 0.7424 0.6790 0.7417 0.0288  0.0090  0.0048  264  GLU A C   
1977 O O   . GLU A 264 ? 0.7275 0.6724 0.7299 0.0303  0.0108  0.0028  264  GLU A O   
1978 C CB  . GLU A 264 ? 0.7699 0.6923 0.7656 0.0240  0.0023  0.0073  264  GLU A CB  
1979 C CG  . GLU A 264 ? 0.8026 0.7120 0.7936 0.0202  -0.0027 0.0100  264  GLU A CG  
1980 C CD  . GLU A 264 ? 0.8166 0.7231 0.8086 0.0179  -0.0057 0.0105  264  GLU A CD  
1981 O OE1 . GLU A 264 ? 0.8358 0.7490 0.8395 0.0137  -0.0052 0.0117  264  GLU A OE1 
1982 O OE2 . GLU A 264 ? 0.8569 0.7533 0.8368 0.0206  -0.0085 0.0099  264  GLU A OE2 
1983 N N   . ILE A 265 ? 0.7173 0.6557 0.7189 0.0286  0.0107  0.0054  265  ILE A N   
1984 C CA  . ILE A 265 ? 0.6926 0.6419 0.6978 0.0312  0.0146  0.0032  265  ILE A CA  
1985 C C   . ILE A 265 ? 0.7149 0.6618 0.7094 0.0372  0.0150  0.0020  265  ILE A C   
1986 O O   . ILE A 265 ? 0.7402 0.6785 0.7285 0.0377  0.0140  0.0035  265  ILE A O   
1987 C CB  . ILE A 265 ? 0.6833 0.6369 0.6976 0.0279  0.0168  0.0045  265  ILE A CB  
1988 C CG1 . ILE A 265 ? 0.6586 0.6138 0.6831 0.0224  0.0163  0.0064  265  ILE A CG1 
1989 C CG2 . ILE A 265 ? 0.6423 0.6065 0.6594 0.0305  0.0204  0.0019  265  ILE A CG2 
1990 C CD1 . ILE A 265 ? 0.6434 0.6042 0.6774 0.0199  0.0193  0.0078  265  ILE A CD1 
1991 N N   . ILE A 266 ? 0.6995 0.6540 0.6915 0.0417  0.0165  -0.0004 266  ILE A N   
1992 C CA  . ILE A 266 ? 0.7165 0.6712 0.6997 0.0477  0.0174  -0.0015 266  ILE A CA  
1993 C C   . ILE A 266 ? 0.7165 0.6812 0.7058 0.0479  0.0202  -0.0027 266  ILE A C   
1994 O O   . ILE A 266 ? 0.7128 0.6892 0.7084 0.0478  0.0219  -0.0046 266  ILE A O   
1995 C CB  . ILE A 266 ? 0.7268 0.6859 0.7046 0.0530  0.0176  -0.0031 266  ILE A CB  
1996 C CG1 . ILE A 266 ? 0.7228 0.6724 0.6951 0.0527  0.0150  -0.0021 266  ILE A CG1 
1997 C CG2 . ILE A 266 ? 0.7506 0.7086 0.7177 0.0602  0.0182  -0.0037 266  ILE A CG2 
1998 C CD1 . ILE A 266 ? 0.7346 0.6681 0.6991 0.0510  0.0119  0.0000  266  ILE A CD1 
1999 N N   . TRP A 267 ? 0.7167 0.6764 0.7041 0.0477  0.0207  -0.0015 267  TRP A N   
2000 C CA  . TRP A 267 ? 0.7222 0.6896 0.7129 0.0488  0.0233  -0.0027 267  TRP A CA  
2001 C C   . TRP A 267 ? 0.7449 0.7192 0.7295 0.0553  0.0240  -0.0049 267  TRP A C   
2002 O O   . TRP A 267 ? 0.7875 0.7554 0.7615 0.0603  0.0232  -0.0045 267  TRP A O   
2003 C CB  . TRP A 267 ? 0.7241 0.6833 0.7122 0.0481  0.0237  -0.0004 267  TRP A CB  
2004 C CG  . TRP A 267 ? 0.7297 0.6850 0.7256 0.0418  0.0233  0.0022  267  TRP A CG  
2005 C CD1 . TRP A 267 ? 0.7383 0.6850 0.7335 0.0384  0.0205  0.0044  267  TRP A CD1 
2006 C CD2 . TRP A 267 ? 0.7128 0.6727 0.7183 0.0382  0.0258  0.0032  267  TRP A CD2 
2007 N NE1 . TRP A 267 ? 0.7047 0.6518 0.7096 0.0329  0.0210  0.0070  267  TRP A NE1 
2008 C CE2 . TRP A 267 ? 0.6871 0.6422 0.6983 0.0330  0.0245  0.0063  267  TRP A CE2 
2009 C CE3 . TRP A 267 ? 0.7063 0.6736 0.7154 0.0393  0.0289  0.0018  267  TRP A CE3 
2010 C CZ2 . TRP A 267 ? 0.6780 0.6362 0.6988 0.0293  0.0267  0.0085  267  TRP A CZ2 
2011 C CZ3 . TRP A 267 ? 0.6662 0.6352 0.6839 0.0356  0.0311  0.0037  267  TRP A CZ3 
2012 C CH2 . TRP A 267 ? 0.6571 0.6220 0.6807 0.0309  0.0302  0.0071  267  TRP A CH2 
2013 N N   . GLY A 268 ? 0.7314 0.7185 0.7221 0.0553  0.0254  -0.0072 268  GLY A N   
2014 C CA  . GLY A 268 ? 0.7456 0.7407 0.7314 0.0612  0.0257  -0.0089 268  GLY A CA  
2015 C C   . GLY A 268 ? 0.7614 0.7635 0.7475 0.0630  0.0252  -0.0096 268  GLY A C   
2016 O O   . GLY A 268 ? 0.7919 0.8051 0.7780 0.0666  0.0257  -0.0110 268  GLY A O   
2017 N N   . GLY A 269 ? 0.7405 0.7368 0.7271 0.0607  0.0241  -0.0086 269  GLY A N   
2018 C CA  . GLY A 269 ? 0.7354 0.7380 0.7219 0.0628  0.0241  -0.0090 269  GLY A CA  
2019 C C   . GLY A 269 ? 0.7217 0.7378 0.7194 0.0588  0.0252  -0.0104 269  GLY A C   
2020 O O   . GLY A 269 ? 0.7107 0.7292 0.7159 0.0537  0.0259  -0.0112 269  GLY A O   
2021 N N   . HIS A 270 ? 0.7225 0.7470 0.7206 0.0611  0.0256  -0.0106 270  HIS A N   
2022 C CA  A HIS A 270 ? 0.7121 0.7490 0.7202 0.0569  0.0266  -0.0117 270  HIS A CA  
2023 C CA  B HIS A 270 ? 0.7085 0.7447 0.7166 0.0567  0.0266  -0.0117 270  HIS A CA  
2024 C C   . HIS A 270 ? 0.7165 0.7542 0.7239 0.0580  0.0268  -0.0106 270  HIS A C   
2025 O O   . HIS A 270 ? 0.7420 0.7772 0.7410 0.0643  0.0267  -0.0095 270  HIS A O   
2026 C CB  A HIS A 270 ? 0.7298 0.7813 0.7405 0.0590  0.0272  -0.0130 270  HIS A CB  
2027 C CB  B HIS A 270 ? 0.7187 0.7692 0.7306 0.0575  0.0272  -0.0132 270  HIS A CB  
2028 C CG  A HIS A 270 ? 0.7452 0.7956 0.7533 0.0603  0.0270  -0.0139 270  HIS A CG  
2029 C CG  B HIS A 270 ? 0.7471 0.8053 0.7533 0.0650  0.0274  -0.0126 270  HIS A CG  
2030 N ND1 A HIS A 270 ? 0.7747 0.8183 0.7729 0.0666  0.0266  -0.0131 270  HIS A ND1 
2031 N ND1 B HIS A 270 ? 0.7663 0.8224 0.7647 0.0708  0.0270  -0.0126 270  HIS A ND1 
2032 C CD2 A HIS A 270 ? 0.7433 0.7978 0.7564 0.0566  0.0272  -0.0155 270  HIS A CD2 
2033 C CD2 B HIS A 270 ? 0.7456 0.8142 0.7529 0.0678  0.0281  -0.0118 270  HIS A CD2 
2034 C CE1 A HIS A 270 ? 0.7818 0.8257 0.7797 0.0665  0.0266  -0.0141 270  HIS A CE1 
2035 C CE1 B HIS A 270 ? 0.7810 0.8459 0.7758 0.0773  0.0274  -0.0118 270  HIS A CE1 
2036 N NE2 A HIS A 270 ? 0.7536 0.8040 0.7603 0.0606  0.0270  -0.0156 270  HIS A NE2 
2037 N NE2 B HIS A 270 ? 0.7778 0.8508 0.7782 0.0756  0.0282  -0.0112 270  HIS A NE2 
2038 N N   . PHE A 271 ? 0.6991 0.7396 0.7144 0.0524  0.0273  -0.0109 271  PHE A N   
2039 C CA  . PHE A 271 ? 0.7121 0.7529 0.7263 0.0535  0.0277  -0.0097 271  PHE A CA  
2040 C C   . PHE A 271 ? 0.7553 0.8100 0.7696 0.0581  0.0291  -0.0095 271  PHE A C   
2041 O O   . PHE A 271 ? 0.7746 0.8406 0.7936 0.0573  0.0295  -0.0105 271  PHE A O   
2042 C CB  . PHE A 271 ? 0.6662 0.7064 0.6884 0.0467  0.0281  -0.0098 271  PHE A CB  
2043 C CG  . PHE A 271 ? 0.6265 0.6527 0.6473 0.0438  0.0266  -0.0092 271  PHE A CG  
2044 C CD1 . PHE A 271 ? 0.5980 0.6224 0.6255 0.0381  0.0267  -0.0098 271  PHE A CD1 
2045 C CD2 . PHE A 271 ? 0.6038 0.6185 0.6162 0.0469  0.0251  -0.0077 271  PHE A CD2 
2046 C CE1 . PHE A 271 ? 0.5281 0.5413 0.5554 0.0355  0.0254  -0.0086 271  PHE A CE1 
2047 C CE2 . PHE A 271 ? 0.5814 0.5839 0.5929 0.0437  0.0231  -0.0068 271  PHE A CE2 
2048 C CZ  . PHE A 271 ? 0.5844 0.5870 0.6042 0.0379  0.0233  -0.0070 271  PHE A CZ  
2049 N N   . VAL A 272 ? 0.7917 0.8453 0.8001 0.0632  0.0297  -0.0079 272  VAL A N   
2050 C CA  . VAL A 272 ? 0.8527 0.9202 0.8611 0.0683  0.0313  -0.0069 272  VAL A CA  
2051 C C   . VAL A 272 ? 0.8715 0.9501 0.8890 0.0642  0.0329  -0.0063 272  VAL A C   
2052 O O   . VAL A 272 ? 0.8503 0.9223 0.8696 0.0603  0.0330  -0.0061 272  VAL A O   
2053 C CB  . VAL A 272 ? 0.8838 0.9440 0.8793 0.0775  0.0316  -0.0050 272  VAL A CB  
2054 C CG1 . VAL A 272 ? 0.9133 0.9887 0.9103 0.0826  0.0340  -0.0032 272  VAL A CG1 
2055 C CG2 . VAL A 272 ? 0.8910 0.9432 0.8769 0.0827  0.0304  -0.0053 272  VAL A CG2 
2056 N N   . ASP A 273 ? 0.9282 1.0242 0.9515 0.0651  0.0342  -0.0059 273  ASP A N   
2057 C CA  . ASP A 273 ? 0.9715 1.0797 1.0031 0.0617  0.0359  -0.0047 273  ASP A CA  
2058 C C   . ASP A 273 ? 0.9867 1.0866 1.0129 0.0646  0.0373  -0.0029 273  ASP A C   
2059 O O   . ASP A 273 ? 1.0032 1.0967 1.0190 0.0726  0.0376  -0.0015 273  ASP A O   
2060 C CB  . ASP A 273 ? 1.4876 1.6146 1.5224 0.0658  0.0371  -0.0032 273  ASP A CB  
2061 C CG  . ASP A 273 ? 1.3703 1.5115 1.4147 0.0617  0.0389  -0.0017 273  ASP A CG  
2062 O OD1 . ASP A 273 ? 1.3148 1.4515 1.3644 0.0542  0.0390  -0.0026 273  ASP A OD1 
2063 O OD2 . ASP A 273 ? 1.4257 1.5827 1.4725 0.0659  0.0403  0.0005  273  ASP A OD2 
2064 N N   . VAL A 274 ? 0.9917 1.0909 1.0239 0.0585  0.0380  -0.0028 274  VAL A N   
2065 C CA  . VAL A 274 ? 1.0088 1.0967 1.0347 0.0607  0.0387  -0.0014 274  VAL A CA  
2066 C C   . VAL A 274 ? 1.0598 1.1588 1.0870 0.0641  0.0418  0.0013  274  VAL A C   
2067 O O   . VAL A 274 ? 1.0737 1.1649 1.0946 0.0675  0.0429  0.0028  274  VAL A O   
2068 C CB  . VAL A 274 ? 0.9680 1.0444 0.9971 0.0531  0.0375  -0.0028 274  VAL A CB  
2069 C CG1 . VAL A 274 ? 0.9554 1.0395 0.9932 0.0474  0.0394  -0.0022 274  VAL A CG1 
2070 C CG2 . VAL A 274 ? 0.9670 1.0257 0.9858 0.0564  0.0361  -0.0022 274  VAL A CG2 
2071 N N   . PHE A 275 ? 1.0888 1.1410 1.1479 0.0422  0.0462  0.0342  275  PHE A N   
2072 C CA  . PHE A 275 ? 1.1374 1.1775 1.1778 0.0378  0.0307  0.0297  275  PHE A CA  
2073 C C   . PHE A 275 ? 1.1782 1.2098 1.2309 0.0289  0.0375  0.0335  275  PHE A C   
2074 O O   . PHE A 275 ? 1.1974 1.2242 1.2639 0.0303  0.0559  0.0446  275  PHE A O   
2075 C CB  . PHE A 275 ? 1.1637 1.1916 1.1686 0.0474  0.0195  0.0328  275  PHE A CB  
2076 C CG  . PHE A 275 ? 1.1598 1.1891 1.1497 0.0573  0.0125  0.0276  275  PHE A CG  
2077 C CD1 . PHE A 275 ? 1.1620 1.1961 1.1400 0.0709  0.0145  0.0314  275  PHE A CD1 
2078 C CD2 . PHE A 275 ? 1.1779 1.2047 1.1612 0.0587  0.0047  0.0198  275  PHE A CD2 
2079 C CE1 . PHE A 275 ? 1.1758 1.2098 1.1384 0.0821  0.0081  0.0260  275  PHE A CE1 
2080 C CE2 . PHE A 275 ? 1.1780 1.2032 1.1428 0.0729  0.0001  0.0168  275  PHE A CE2 
2081 C CZ  . PHE A 275 ? 1.1704 1.1980 1.1263 0.0828  0.0014  0.0192  275  PHE A CZ  
2082 N N   . THR A 276 ? 1.2045 1.2325 1.2503 0.0229  0.0256  0.0265  276  THR A N   
2083 C CA  . THR A 276 ? 1.2400 1.2625 1.2946 0.0163  0.0291  0.0279  276  THR A CA  
2084 C C   . THR A 276 ? 1.2782 1.2936 1.3080 0.0167  0.0184  0.0302  276  THR A C   
2085 O O   . THR A 276 ? 1.2849 1.2958 1.2963 0.0195  0.0107  0.0289  276  THR A O   
2086 C CB  . THR A 276 ? 1.2268 1.2616 1.3094 0.0083  0.0277  0.0114  276  THR A CB  
2087 O OG1 . THR A 276 ? 1.2291 1.2672 1.3504 0.0020  0.0456  0.0072  276  THR A OG1 
2088 C CG2 . THR A 276 ? 1.2618 1.2927 1.3404 0.0050  0.0227  0.0095  276  THR A CG2 
2089 N N   . THR A 277 ? 1.3082 1.3224 1.3416 0.0134  0.0201  0.0318  277  THR A N   
2090 C CA  . THR A 277 ? 1.3433 1.3573 1.3631 0.0106  0.0118  0.0300  277  THR A CA  
2091 C C   . THR A 277 ? 1.3638 1.3806 1.3915 0.0055  0.0099  0.0257  277  THR A C   
2092 O O   . THR A 277 ? 1.3693 1.3880 1.4116 0.0051  0.0152  0.0244  277  THR A O   
2093 C CB  . THR A 277 ? 1.3770 1.3979 1.3879 0.0174  0.0125  0.0333  277  THR A CB  
2094 O OG1 . THR A 277 ? 1.3633 1.3884 1.3634 0.0264  0.0105  0.0324  277  THR A OG1 
2095 C CG2 . THR A 277 ? 1.4180 1.4460 1.4272 0.0102  0.0057  0.0261  277  THR A CG2 
2096 N N   . LEU A 278 ? 1.3872 1.4023 1.4048 0.0042  0.0050  0.0238  278  LEU A N   
2097 C CA  . LEU A 278 ? 1.4159 1.4380 1.4346 0.0055  0.0035  0.0211  278  LEU A CA  
2098 C C   . LEU A 278 ? 1.4636 1.4884 1.4812 0.0006  0.0050  0.0246  278  LEU A C   
2099 O O   . LEU A 278 ? 1.4766 1.5005 1.4922 -0.0037 0.0058  0.0256  278  LEU A O   
2100 C CB  . LEU A 278 ? 1.4219 1.4406 1.4243 0.0141  0.0030  0.0230  278  LEU A CB  
2101 C CG  . LEU A 278 ? 1.3858 1.4193 1.3898 0.0269  -0.0020 0.0129  278  LEU A CG  
2102 C CD1 . LEU A 278 ? 1.3431 1.3790 1.3635 0.0217  -0.0022 0.0073  278  LEU A CD1 
2103 C CD2 . LEU A 278 ? 1.4115 1.4371 1.3878 0.0435  0.0007  0.0207  278  LEU A CD2 
2104 N N   . PRO A 279 ? 1.4940 1.5283 1.5146 0.0034  0.0042  0.0224  279  PRO A N   
2105 C CA  . PRO A 279 ? 1.5482 1.5910 1.5688 0.0009  0.0056  0.0246  279  PRO A CA  
2106 C C   . PRO A 279 ? 1.5877 1.6302 1.6067 -0.0075 0.0097  0.0271  279  PRO A C   
2107 O O   . PRO A 279 ? 1.6171 1.6725 1.6426 -0.0109 0.0085  0.0224  279  PRO A O   
2108 C CB  . PRO A 279 ? 1.9538 2.0066 1.9723 0.0086  0.0041  0.0220  279  PRO A CB  
2109 C CG  . PRO A 279 ? 1.9650 2.0201 1.9928 0.0145  -0.0003 0.0108  279  PRO A CG  
2110 C CD  . PRO A 279 ? 1.6608 1.7055 1.6868 0.0118  0.0003  0.0129  279  PRO A CD  
2111 N N   . ASP A 280 ? 1.6027 1.6318 1.6154 -0.0088 0.0165  0.0322  280  ASP A N   
2112 C CA  . ASP A 280 ? 1.6510 1.6732 1.6729 -0.0211 0.0270  0.0318  280  ASP A CA  
2113 C C   . ASP A 280 ? 1.6476 1.6697 1.6799 -0.0292 0.0226  0.0196  280  ASP A C   
2114 O O   . ASP A 280 ? 1.6899 1.7213 1.7422 -0.0414 0.0267  0.0073  280  ASP A O   
2115 C CB  . ASP A 280 ? 1.6726 1.6698 1.6832 -0.0166 0.0429  0.0449  280  ASP A CB  
2116 C CG  . ASP A 280 ? 1.6339 1.6116 1.6272 -0.0057 0.0407  0.0484  280  ASP A CG  
2117 O OD1 . ASP A 280 ? 1.5885 1.5638 1.5872 -0.0112 0.0327  0.0395  280  ASP A OD1 
2118 O OD2 . ASP A 280 ? 1.6429 1.6121 1.6147 0.0126  0.0470  0.0598  280  ASP A OD2 
2119 N N   . GLY A 281 ? 1.6025 1.6193 1.6248 -0.0214 0.0146  0.0197  281  GLY A N   
2120 C CA  . GLY A 281 ? 1.6012 1.6222 1.6275 -0.0221 0.0092  0.0086  281  GLY A CA  
2121 C C   . GLY A 281 ? 1.5782 1.5756 1.5947 -0.0191 0.0108  0.0112  281  GLY A C   
2122 O O   . GLY A 281 ? 1.5666 1.5671 1.5830 -0.0161 0.0057  0.0022  281  GLY A O   
2123 N N   . ARG A 282 ? 1.5770 1.5549 1.5819 -0.0149 0.0174  0.0228  282  ARG A N   
2124 C CA  . ARG A 282 ? 1.5646 1.5214 1.5552 -0.0067 0.0197  0.0267  282  ARG A CA  
2125 C C   . ARG A 282 ? 1.5112 1.4816 1.4982 0.0019  0.0094  0.0246  282  ARG A C   
2126 O O   . ARG A 282 ? 1.4903 1.4792 1.4853 0.0021  0.0051  0.0237  282  ARG A O   
2127 C CB  . ARG A 282 ? 1.5748 1.5182 1.5478 0.0059  0.0284  0.0399  282  ARG A CB  
2128 C CG  . ARG A 282 ? 1.6173 1.5249 1.5749 0.0135  0.0432  0.0483  282  ARG A CG  
2129 C CD  . ARG A 282 ? 1.6447 1.5468 1.5746 0.0385  0.0519  0.0641  282  ARG A CD  
2130 N NE  . ARG A 282 ? 1.6746 1.5932 1.6070 0.0395  0.0549  0.0693  282  ARG A NE  
2131 C CZ  . ARG A 282 ? 1.6757 1.6129 1.5878 0.0644  0.0528  0.0749  282  ARG A CZ  
2132 N NH1 . ARG A 282 ? 1.6590 1.6053 1.5485 0.0909  0.0469  0.0739  282  ARG A NH1 
2133 N NH2 . ARG A 282 ? 1.6927 1.6463 1.6075 0.0659  0.0549  0.0779  282  ARG A NH2 
2134 N N   . ARG A 283 ? 1.4978 1.4564 1.4737 0.0102  0.0092  0.0250  283  ARG A N   
2135 C CA  . ARG A 283 ? 1.4521 1.4254 1.4283 0.0183  0.0035  0.0239  283  ARG A CA  
2136 C C   . ARG A 283 ? 1.4196 1.3968 1.3877 0.0307  0.0030  0.0256  283  ARG A C   
2137 O O   . ARG A 283 ? 1.4472 1.4070 1.3965 0.0408  0.0069  0.0298  283  ARG A O   
2138 C CB  . ARG A 283 ? 1.4554 1.4243 1.4266 0.0218  0.0012  0.0187  283  ARG A CB  
2139 C CG  . ARG A 283 ? 1.5012 1.4844 1.4803 0.0186  -0.0020 0.0114  283  ARG A CG  
2140 C CD  . ARG A 283 ? 1.5095 1.5125 1.4914 0.0273  -0.0005 0.0189  283  ARG A CD  
2141 N NE  . ARG A 283 ? 1.5546 1.5724 1.5288 0.0407  -0.0031 0.0145  283  ARG A NE  
2142 C CZ  . ARG A 283 ? 1.5653 1.5841 1.5295 0.0525  -0.0044 0.0133  283  ARG A CZ  
2143 N NH1 . ARG A 283 ? 1.5309 1.5365 1.4929 0.0512  -0.0030 0.0164  283  ARG A NH1 
2144 N NH2 . ARG A 283 ? 1.6041 1.6426 1.5580 0.0705  -0.0077 0.0078  283  ARG A NH2 
2145 N N   . ALA A 284 ? 1.3703 1.3716 1.3547 0.0319  0.0003  0.0204  284  ALA A N   
2146 C CA  . ALA A 284 ? 1.3285 1.3496 1.3141 0.0450  -0.0032 0.0122  284  ALA A CA  
2147 C C   . ALA A 284 ? 1.2771 1.3178 1.2841 0.0440  -0.0022 0.0049  284  ALA A C   
2148 O O   . ALA A 284 ? 1.2661 1.3062 1.2913 0.0335  0.0046  0.0084  284  ALA A O   
2149 C CB  . ALA A 284 ? 1.3339 1.3755 1.3308 0.0472  -0.0065 0.0032  284  ALA A CB  
2150 N N   . LEU A 285 ? 1.2478 1.3069 1.2514 0.0584  -0.0062 -0.0035 285  LEU A N   
2151 C CA  . LEU A 285 ? 1.1969 1.2814 1.2277 0.0569  -0.0028 -0.0129 285  LEU A CA  
2152 C C   . LEU A 285 ? 1.1701 1.2847 1.2454 0.0465  -0.0005 -0.0324 285  LEU A C   
2153 O O   . LEU A 285 ? 1.1805 1.3198 1.2586 0.0561  -0.0101 -0.0496 285  LEU A O   
2154 C CB  . LEU A 285 ? 1.1910 1.2923 1.2044 0.0783  -0.0092 -0.0197 285  LEU A CB  
2155 C CG  . LEU A 285 ? 1.1713 1.3092 1.2135 0.0808  -0.0065 -0.0332 285  LEU A CG  
2156 C CD1 . LEU A 285 ? 1.1646 1.2839 1.2098 0.0718  0.0051  -0.0172 285  LEU A CD1 
2157 C CD2 . LEU A 285 ? 1.1820 1.3409 1.1992 0.1087  -0.0160 -0.0415 285  LEU A CD2 
2158 N N   . ASP A 286 ? 1.1991 1.2821 1.2118 0.0724  0.0467  0.0068  286  ASP A N   
2159 C CA  . ASP A 286 ? 1.1927 1.2602 1.1901 0.0805  0.0455  0.0073  286  ASP A CA  
2160 C C   . ASP A 286 ? 1.1463 1.1962 1.1399 0.0764  0.0413  0.0047  286  ASP A C   
2161 O O   . ASP A 286 ? 1.1309 1.1785 1.1238 0.0759  0.0392  0.0031  286  ASP A O   
2162 C CB  . ASP A 286 ? 1.2257 1.2991 1.2169 0.0892  0.0462  0.0083  286  ASP A CB  
2163 C CG  . ASP A 286 ? 1.2655 1.3230 1.2388 0.0990  0.0459  0.0095  286  ASP A CG  
2164 O OD1 . ASP A 286 ? 1.2627 1.3031 1.2284 0.0981  0.0441  0.0089  286  ASP A OD1 
2165 O OD2 . ASP A 286 ? 1.3137 1.3754 1.2799 0.1078  0.0474  0.0110  286  ASP A OD2 
2166 N N   . LEU A 287 ? 1.1093 1.1475 1.1008 0.0733  0.0403  0.0046  287  LEU A N   
2167 C CA  . LEU A 287 ? 1.0646 1.0872 1.0534 0.0690  0.0363  0.0028  287  LEU A CA  
2168 C C   . LEU A 287 ? 1.0603 1.0687 1.0350 0.0752  0.0337  0.0027  287  LEU A C   
2169 O O   . LEU A 287 ? 1.0346 1.0294 1.0057 0.0723  0.0301  0.0017  287  LEU A O   
2170 C CB  . LEU A 287 ? 1.0642 1.0779 1.0533 0.0650  0.0357  0.0031  287  LEU A CB  
2171 C CG  . LEU A 287 ? 1.0493 1.0741 1.0523 0.0574  0.0377  0.0028  287  LEU A CG  
2172 C CD1 . LEU A 287 ? 1.0544 1.0705 1.0557 0.0554  0.0377  0.0036  287  LEU A CD1 
2173 C CD2 . LEU A 287 ? 1.0118 1.0391 1.0243 0.0503  0.0361  0.0006  287  LEU A CD2 
2174 N N   . GLY A 288 ? 1.0774 1.0892 1.0438 0.0839  0.0357  0.0041  288  GLY A N   
2175 C CA  . GLY A 288 ? 1.0740 1.0734 1.0261 0.0907  0.0337  0.0041  288  GLY A CA  
2176 C C   . GLY A 288 ? 1.0507 1.0546 1.0072 0.0888  0.0324  0.0026  288  GLY A C   
2177 O O   . GLY A 288 ? 1.0597 1.0503 1.0077 0.0898  0.0294  0.0018  288  GLY A O   
2178 N N   . LYS A 289 ? 1.0240 1.0463 0.9935 0.0858  0.0346  0.0022  289  LYS A N   
2179 C CA  . LYS A 289 ? 1.0018 1.0288 0.9759 0.0836  0.0334  0.0006  289  LYS A CA  
2180 C C   . LYS A 289 ? 0.9463 0.9681 0.9286 0.0742  0.0309  -0.0012 289  LYS A C   
2181 O O   . LYS A 289 ? 0.9370 0.9576 0.9204 0.0726  0.0295  -0.0025 289  LYS A O   
2182 C CB  . LYS A 289 ? 1.0151 1.0638 0.9992 0.0841  0.0362  0.0010  289  LYS A CB  
2183 C CG  . LYS A 289 ? 1.0861 1.1427 1.0635 0.0940  0.0391  0.0035  289  LYS A CG  
2184 C CD  . LYS A 289 ? 1.1353 1.2128 1.1215 0.0951  0.0407  0.0039  289  LYS A CD  
2185 C CE  . LYS A 289 ? 1.1888 1.2792 1.1737 0.1027  0.0443  0.0071  289  LYS A CE  
2186 N NZ  . LYS A 289 ? 1.2688 1.3451 1.2360 0.1133  0.0447  0.0085  289  LYS A NZ  
2187 N N   . PHE A 290 ? 0.8941 0.9125 0.8811 0.0688  0.0307  -0.0012 290  PHE A N   
2188 C CA  . PHE A 290 ? 0.8283 0.8446 0.8245 0.0602  0.0292  -0.0026 290  PHE A CA  
2189 C C   . PHE A 290 ? 0.7980 0.8027 0.7907 0.0586  0.0261  -0.0034 290  PHE A C   
2190 O O   . PHE A 290 ? 0.7724 0.7806 0.7732 0.0535  0.0258  -0.0045 290  PHE A O   
2191 C CB  . PHE A 290 ? 0.8230 0.8341 0.8215 0.0563  0.0291  -0.0020 290  PHE A CB  
2192 C CG  . PHE A 290 ? 0.7593 0.7695 0.7676 0.0480  0.0281  -0.0030 290  PHE A CG  
2193 C CD1 . PHE A 290 ? 0.7208 0.7432 0.7403 0.0431  0.0303  -0.0039 290  PHE A CD1 
2194 C CD2 . PHE A 290 ? 0.7396 0.7364 0.7454 0.0454  0.0249  -0.0030 290  PHE A CD2 
2195 C CE1 . PHE A 290 ? 0.7085 0.7291 0.7358 0.0363  0.0297  -0.0047 290  PHE A CE1 
2196 C CE2 . PHE A 290 ? 0.6954 0.6920 0.7102 0.0386  0.0244  -0.0035 290  PHE A CE2 
2197 C CZ  . PHE A 290 ? 0.6825 0.6905 0.7075 0.0344  0.0269  -0.0044 290  PHE A CZ  
2198 N N   . HIS A 291 ? 0.7913 0.7815 0.7715 0.0628  0.0238  -0.0026 291  HIS A N   
2199 C CA  . HIS A 291 ? 0.7733 0.7523 0.7493 0.0615  0.0208  -0.0029 291  HIS A CA  
2200 C C   . HIS A 291 ? 0.8025 0.7832 0.7724 0.0670  0.0213  -0.0032 291  HIS A C   
2201 O O   . HIS A 291 ? 0.8118 0.7816 0.7754 0.0672  0.0190  -0.0031 291  HIS A O   
2202 C CB  . HIS A 291 ? 0.7682 0.7289 0.7323 0.0628  0.0174  -0.0018 291  HIS A CB  
2203 C CG  . HIS A 291 ? 0.7465 0.7033 0.7141 0.0585  0.0163  -0.0013 291  HIS A CG  
2204 N ND1 . HIS A 291 ? 0.7002 0.6562 0.6775 0.0509  0.0148  -0.0013 291  HIS A ND1 
2205 C CD2 . HIS A 291 ? 0.7110 0.6638 0.6729 0.0612  0.0165  -0.0005 291  HIS A CD2 
2206 C CE1 . HIS A 291 ? 0.6714 0.6233 0.6490 0.0491  0.0140  -0.0007 291  HIS A CE1 
2207 N NE2 . HIS A 291 ? 0.6899 0.6398 0.6582 0.0550  0.0150  -0.0003 291  HIS A NE2 
2208 N N   . GLU A 292 ? 0.8152 0.8090 0.7861 0.0717  0.0241  -0.0033 292  GLU A N   
2209 C CA  . GLU A 292 ? 0.8485 0.8434 0.8129 0.0775  0.0244  -0.0034 292  GLU A CA  
2210 C C   . GLU A 292 ? 0.8259 0.8285 0.7994 0.0732  0.0246  -0.0048 292  GLU A C   
2211 O O   . GLU A 292 ? 0.8062 0.8202 0.7921 0.0676  0.0257  -0.0057 292  GLU A O   
2212 C CB  . GLU A 292 ? 0.8911 0.8967 0.8517 0.0854  0.0272  -0.0024 292  GLU A CB  
2213 C CG  . GLU A 292 ? 0.9488 0.9425 0.8939 0.0933  0.0271  -0.0009 292  GLU A CG  
2214 C CD  . GLU A 292 ? 1.0374 1.0442 0.9803 0.1015  0.0305  0.0005  292  GLU A CD  
2215 O OE1 . GLU A 292 ? 1.0531 1.0771 1.0055 0.1011  0.0322  0.0002  292  GLU A OE1 
2216 O OE2 . GLU A 292 ? 1.1049 1.1052 1.0365 0.1085  0.0315  0.0021  292  GLU A OE2 
2217 N N   . ILE A 293 ? 0.8289 0.8237 0.7948 0.0760  0.0234  -0.0049 293  ILE A N   
2218 C CA  . ILE A 293 ? 0.8072 0.8069 0.7791 0.0732  0.0235  -0.0060 293  ILE A CA  
2219 C C   . ILE A 293 ? 0.8327 0.8349 0.7968 0.0805  0.0242  -0.0060 293  ILE A C   
2220 O O   . ILE A 293 ? 0.8473 0.8371 0.7985 0.0857  0.0231  -0.0052 293  ILE A O   
2221 C CB  . ILE A 293 ? 0.7855 0.7724 0.7582 0.0673  0.0213  -0.0058 293  ILE A CB  
2222 C CG1 . ILE A 293 ? 0.7416 0.7313 0.7257 0.0597  0.0213  -0.0060 293  ILE A CG1 
2223 C CG2 . ILE A 293 ? 0.7561 0.7445 0.7305 0.0667  0.0216  -0.0064 293  ILE A CG2 
2224 C CD1 . ILE A 293 ? 0.7215 0.6983 0.7056 0.0548  0.0188  -0.0049 293  ILE A CD1 
2225 N N   . ALA A 294 ? 0.8269 0.8447 0.7985 0.0806  0.0257  -0.0070 294  ALA A N   
2226 C CA  . ALA A 294 ? 0.8479 0.8700 0.8144 0.0865  0.0262  -0.0073 294  ALA A CA  
2227 C C   . ALA A 294 ? 0.8417 0.8544 0.8055 0.0847  0.0251  -0.0078 294  ALA A C   
2228 O O   . ALA A 294 ? 0.8263 0.8386 0.7982 0.0778  0.0248  -0.0086 294  ALA A O   
2229 C CB  . ALA A 294 ? 0.8459 0.8883 0.8223 0.0860  0.0276  -0.0081 294  ALA A CB  
2230 N N   . GLN A 295 ? 0.8773 0.8823 0.8294 0.0912  0.0248  -0.0072 295  GLN A N   
2231 C CA  . GLN A 295 ? 0.8707 0.8696 0.8203 0.0905  0.0244  -0.0076 295  GLN A CA  
2232 C C   . GLN A 295 ? 0.9090 0.9121 0.8505 0.0988  0.0252  -0.0076 295  GLN A C   
2233 O O   . GLN A 295 ? 0.9400 0.9438 0.8729 0.1065  0.0257  -0.0067 295  GLN A O   
2234 C CB  . GLN A 295 ? 0.8727 0.8518 0.8139 0.0888  0.0227  -0.0064 295  GLN A CB  
2235 C CG  . GLN A 295 ? 0.8456 0.8195 0.7948 0.0803  0.0215  -0.0060 295  GLN A CG  
2236 C CD  . GLN A 295 ? 0.8486 0.8032 0.7884 0.0791  0.0192  -0.0044 295  GLN A CD  
2237 O OE1 . GLN A 295 ? 0.8352 0.7800 0.7679 0.0800  0.0175  -0.0035 295  GLN A OE1 
2238 N NE2 . GLN A 295 ? 0.8284 0.7769 0.7671 0.0773  0.0190  -0.0038 295  GLN A NE2 
2239 N N   . HIS A 296 ? 0.9133 0.9187 0.8569 0.0978  0.0254  -0.0084 296  HIS A N   
2240 C CA  . HIS A 296 ? 0.9566 0.9639 0.8917 0.1055  0.0259  -0.0084 296  HIS A CA  
2241 C C   . HIS A 296 ? 0.9923 0.9798 0.9123 0.1095  0.0253  -0.0070 296  HIS A C   
2242 O O   . HIS A 296 ? 0.9821 0.9563 0.9014 0.1041  0.0243  -0.0064 296  HIS A O   
2243 C CB  . HIS A 296 ? 0.9372 0.9517 0.8789 0.1026  0.0262  -0.0098 296  HIS A CB  
2244 C CG  . HIS A 296 ? 0.9817 0.9955 0.9138 0.1101  0.0266  -0.0097 296  HIS A CG  
2245 N ND1 . HIS A 296 ? 1.0056 1.0341 0.9373 0.1164  0.0270  -0.0100 296  HIS A ND1 
2246 C CD2 . HIS A 296 ? 1.0120 1.0122 0.9343 0.1125  0.0267  -0.0090 296  HIS A CD2 
2247 C CE1 . HIS A 296 ? 1.0301 1.0539 0.9518 0.1227  0.0272  -0.0098 296  HIS A CE1 
2248 N NE2 . HIS A 296 ? 1.0371 1.0433 0.9527 0.1204  0.0272  -0.0092 296  HIS A NE2 
2249 N N   . HIS A 297 ? 1.0511 1.0364 0.9587 0.1190  0.0258  -0.0062 297  HIS A N   
2250 C CA  . HIS A 297 ? 1.1056 1.0711 0.9970 0.1233  0.0252  -0.0048 297  HIS A CA  
2251 C C   . HIS A 297 ? 1.1590 1.1250 1.0432 0.1295  0.0261  -0.0049 297  HIS A C   
2252 O O   . HIS A 297 ? 1.1765 1.1559 1.0602 0.1363  0.0272  -0.0051 297  HIS A O   
2253 C CB  . HIS A 297 ? 1.1346 1.0928 1.0140 0.1301  0.0252  -0.0036 297  HIS A CB  
2254 C CG  . HIS A 297 ? 1.1064 1.0582 0.9891 0.1243  0.0238  -0.0033 297  HIS A CG  
2255 N ND1 . HIS A 297 ? 1.1153 1.0458 0.9869 0.1228  0.0218  -0.0023 297  HIS A ND1 
2256 C CD2 . HIS A 297 ? 1.0798 1.0430 0.9753 0.1192  0.0240  -0.0039 297  HIS A CD2 
2257 C CE1 . HIS A 297 ? 1.1130 1.0428 0.9904 0.1175  0.0207  -0.0023 297  HIS A CE1 
2258 N NE2 . HIS A 297 ? 1.0841 1.0333 0.9759 0.1154  0.0222  -0.0032 297  HIS A NE2 
2259 N N   . HIS A 298 ? 1.1990 1.1510 1.0778 0.1271  0.0257  -0.0044 298  HIS A N   
2260 C CA  . HIS A 298 ? 1.2549 1.2069 1.1280 0.1318  0.0267  -0.0045 298  HIS A CA  
2261 C C   . HIS A 298 ? 1.3203 1.2611 1.1745 0.1424  0.0271  -0.0033 298  HIS A C   
2262 O O   . HIS A 298 ? 1.3453 1.2699 1.1877 0.1442  0.0263  -0.0021 298  HIS A O   
2263 C CB  . HIS A 298 ? 1.2447 1.1872 1.1208 0.1247  0.0266  -0.0042 298  HIS A CB  
2264 C CG  . HIS A 298 ? 1.2328 1.1860 1.1263 0.1154  0.0266  -0.0053 298  HIS A CG  
2265 N ND1 . HIS A 298 ? 1.2461 1.2126 1.1482 0.1143  0.0276  -0.0068 298  HIS A ND1 
2266 C CD2 . HIS A 298 ? 1.2207 1.1725 1.1237 0.1072  0.0257  -0.0051 298  HIS A CD2 
2267 C CE1 . HIS A 298 ? 1.2153 1.1872 1.1307 0.1060  0.0275  -0.0074 298  HIS A CE1 
2268 N NE2 . HIS A 298 ? 1.2005 1.1643 1.1172 0.1016  0.0265  -0.0064 298  HIS A NE2 
2269 N N   . HIS A 299 ? 1.3646 1.3134 1.2149 0.1496  0.0283  -0.0036 299  HIS A N   
2270 C CA  . HIS A 299 ? 1.4360 1.3736 1.2675 0.1602  0.0290  -0.0023 299  HIS A CA  
2271 C C   . HIS A 299 ? 1.4662 1.3802 1.2851 0.1586  0.0286  -0.0012 299  HIS A C   
2272 O O   . HIS A 299 ? 1.4895 1.3850 1.2973 0.1583  0.0275  0.0000  299  HIS A O   
2273 C CB  . HIS A 299 ? 1.4643 1.4177 1.2952 0.1687  0.0302  -0.0027 299  HIS A CB  
2274 C CG  . HIS A 299 ? 1.5069 1.4720 1.3349 0.1777  0.0309  -0.0020 299  HIS A CG  
2275 N ND1 . HIS A 299 ? 1.5176 1.5075 1.3577 0.1793  0.0312  -0.0026 299  HIS A ND1 
2276 C CD2 . HIS A 299 ? 1.5322 1.4875 1.3461 0.1856  0.0316  -0.0004 299  HIS A CD2 
2277 C CE1 . HIS A 299 ? 1.5200 1.5163 1.3548 0.1880  0.0322  -0.0011 299  HIS A CE1 
2278 N NE2 . HIS A 299 ? 1.5393 1.5145 1.3578 0.1923  0.0326  0.0001  299  HIS A NE2 
2279 N N   . ILE B 23  ? 2.1346 1.6113 1.7747 0.1687  0.1790  -0.2425 23   ILE B N   
2280 C CA  . ILE B 23  ? 2.1727 1.6195 1.7801 0.1877  0.1634  -0.2504 23   ILE B CA  
2281 C C   . ILE B 23  ? 2.1949 1.6070 1.7966 0.1728  0.1366  -0.2550 23   ILE B C   
2282 O O   . ILE B 23  ? 2.1919 1.5964 1.8052 0.1536  0.1267  -0.2533 23   ILE B O   
2283 C CB  . ILE B 23  ? 2.2089 1.6398 1.7784 0.2195  0.1600  -0.2565 23   ILE B CB  
2284 C CG1 . ILE B 23  ? 2.2271 1.6266 1.7788 0.2184  0.1399  -0.2624 23   ILE B CG1 
2285 C CG2 . ILE B 23  ? 2.1806 1.6491 1.7597 0.2320  0.1864  -0.2493 23   ILE B CG2 
2286 C CD1 . ILE B 23  ? 2.2647 1.6379 1.7722 0.2512  0.1293  -0.2712 23   ILE B CD1 
2287 N N   . THR B 24  ? 2.2178 1.6096 1.8021 0.1816  0.1246  -0.2599 24   THR B N   
2288 C CA  . THR B 24  ? 2.2248 1.5915 1.8124 0.1635  0.1022  -0.2612 24   THR B CA  
2289 C C   . THR B 24  ? 2.2610 1.5867 1.8270 0.1628  0.0736  -0.2667 24   THR B C   
2290 O O   . THR B 24  ? 2.2963 1.5996 1.8297 0.1856  0.0650  -0.2741 24   THR B O   
2291 C CB  . THR B 24  ? 2.2425 1.5968 1.8158 0.1745  0.0959  -0.2652 24   THR B CB  
2292 O OG1 . THR B 24  ? 2.2829 1.6125 1.8148 0.2066  0.0874  -0.2744 24   THR B OG1 
2293 C CG2 . THR B 24  ? 2.1970 1.5910 1.7962 0.1704  0.1216  -0.2585 24   THR B CG2 
2294 N N   . ARG B 25  ? 2.2530 1.5694 1.8372 0.1369  0.0584  -0.2623 25   ARG B N   
2295 C CA  . ARG B 25  ? 2.2913 1.5664 1.8574 0.1334  0.0274  -0.2660 25   ARG B CA  
2296 C C   . ARG B 25  ? 2.3171 1.5643 1.8736 0.1307  0.0052  -0.2683 25   ARG B C   
2297 O O   . ARG B 25  ? 2.3032 1.5657 1.8681 0.1314  0.0160  -0.2671 25   ARG B O   
2298 C CB  . ARG B 25  ? 2.2677 1.5528 1.8619 0.1058  0.0245  -0.2574 25   ARG B CB  
2299 C CG  . ARG B 25  ? 2.2436 1.5562 1.8487 0.1069  0.0459  -0.2549 25   ARG B CG  
2300 C CD  . ARG B 25  ? 2.2151 1.5354 1.8455 0.0810  0.0411  -0.2468 25   ARG B CD  
2301 N NE  . ARG B 25  ? 2.1876 1.5287 1.8244 0.0837  0.0583  -0.2456 25   ARG B NE  
2302 C CZ  . ARG B 25  ? 2.1582 1.5296 1.8010 0.0945  0.0850  -0.2454 25   ARG B CZ  
2303 N NH1 . ARG B 25  ? 2.1487 1.5350 1.7928 0.1037  0.0986  -0.2461 25   ARG B NH1 
2304 N NH2 . ARG B 25  ? 2.1365 1.5239 1.7852 0.0956  0.0976  -0.2438 25   ARG B NH2 
2305 N N   . LEU B 26  ? 2.3569 1.5630 1.8965 0.1276  -0.0265 -0.2711 26   LEU B N   
2306 C CA  . LEU B 26  ? 2.3847 1.5610 1.9152 0.1243  -0.0510 -0.2727 26   LEU B CA  
2307 C C   . LEU B 26  ? 2.3676 1.5451 1.9291 0.0910  -0.0652 -0.2612 26   LEU B C   
2308 O O   . LEU B 26  ? 2.3981 1.5389 1.9488 0.0854  -0.0964 -0.2613 26   LEU B O   
2309 C CB  . LEU B 26  ? 2.4466 1.5705 1.9321 0.1474  -0.0809 -0.2845 26   LEU B CB  
2310 C CG  . LEU B 26  ? 2.4803 1.5961 1.9277 0.1850  -0.0727 -0.2968 26   LEU B CG  
2311 C CD1 . LEU B 26  ? 2.5498 1.6102 1.9519 0.2067  -0.1062 -0.3086 26   LEU B CD1 
2312 C CD2 . LEU B 26  ? 2.4609 1.5951 1.9089 0.1953  -0.0561 -0.2980 26   LEU B CD2 
2313 N N   . ASP B 35  ? 2.7656 2.3967 2.7165 -0.1058 0.1394  -0.1586 35   ASP B N   
2314 C CA  . ASP B 35  ? 2.8421 2.4464 2.7833 -0.1119 0.1147  -0.1540 35   ASP B CA  
2315 C C   . ASP B 35  ? 2.7723 2.3885 2.7306 -0.1288 0.1055  -0.1414 35   ASP B C   
2316 O O   . ASP B 35  ? 2.8320 2.4252 2.7815 -0.1329 0.0856  -0.1378 35   ASP B O   
2317 C CB  . ASP B 35  ? 2.9626 2.5309 2.8745 -0.0977 0.1038  -0.1632 35   ASP B CB  
2318 N N   . ASP B 36  ? 2.6546 2.3068 2.6370 -0.1377 0.1192  -0.1345 36   ASP B N   
2319 C CA  . ASP B 36  ? 2.5736 2.2458 2.5748 -0.1522 0.1151  -0.1217 36   ASP B CA  
2320 C C   . ASP B 36  ? 2.5611 2.2297 2.5572 -0.1504 0.1162  -0.1235 36   ASP B C   
2321 O O   . ASP B 36  ? 2.4711 2.1667 2.4815 -0.1533 0.1294  -0.1207 36   ASP B O   
2322 C CB  . ASP B 36  ? 2.6081 2.2720 2.6156 -0.1660 0.0927  -0.1085 36   ASP B CB  
2323 N N   . HIS B 37  ? 2.6598 2.2944 2.6349 -0.1447 0.1016  -0.1284 37   HIS B N   
2324 C CA  . HIS B 37  ? 2.6667 2.2932 2.6331 -0.1405 0.1021  -0.1320 37   HIS B CA  
2325 C C   . HIS B 37  ? 2.6397 2.2751 2.5999 -0.1261 0.1243  -0.1438 37   HIS B C   
2326 O O   . HIS B 37  ? 2.6761 2.2996 2.6233 -0.1178 0.1259  -0.1499 37   HIS B O   
2327 C CB  . HIS B 37  ? 2.7968 2.3815 2.7394 -0.1361 0.0791  -0.1352 37   HIS B CB  
2328 C CG  . HIS B 37  ? 2.8227 2.3977 2.7582 -0.1353 0.0743  -0.1357 37   HIS B CG  
2329 N ND1 . HIS B 37  ? 2.9164 2.4658 2.8267 -0.1195 0.0734  -0.1476 37   HIS B ND1 
2330 C CD2 . HIS B 37  ? 2.7764 2.3638 2.7262 -0.1479 0.0694  -0.1253 37   HIS B CD2 
2331 C CE1 . HIS B 37  ? 2.9150 2.4606 2.8244 -0.1228 0.0682  -0.1451 37   HIS B CE1 
2332 N NE2 . HIS B 37  ? 2.8330 2.4012 2.7663 -0.1402 0.0657  -0.1316 37   HIS B NE2 
2333 N N   . TYR B 38  ? 2.5800 2.2362 2.5502 -0.1233 0.1406  -0.1463 38   TYR B N   
2334 C CA  . TYR B 38  ? 2.5452 2.2140 2.5145 -0.1117 0.1614  -0.1550 38   TYR B CA  
2335 C C   . TYR B 38  ? 2.4344 2.1331 2.4227 -0.1180 0.1744  -0.1511 38   TYR B C   
2336 O O   . TYR B 38  ? 2.3591 2.0842 2.3655 -0.1233 0.1840  -0.1474 38   TYR B O   
2337 C CB  . TYR B 38  ? 2.5426 2.2195 2.5147 -0.1061 0.1718  -0.1591 38   TYR B CB  
2338 N N   . HIS B 39  ? 2.4326 2.1262 2.4156 -0.1164 0.1737  -0.1521 39   HIS B N   
2339 C CA  . HIS B 39  ? 2.3353 2.0540 2.3336 -0.1210 0.1847  -0.1491 39   HIS B CA  
2340 C C   . HIS B 39  ? 2.3015 2.0314 2.3006 -0.1104 0.2036  -0.1571 39   HIS B C   
2341 O O   . HIS B 39  ? 2.2988 2.0310 2.2965 -0.1073 0.2091  -0.1593 39   HIS B O   
2342 C CB  . HIS B 39  ? 2.3640 2.0719 2.3570 -0.1253 0.1740  -0.1455 39   HIS B CB  
2343 C CG  . HIS B 39  ? 2.3366 2.0583 2.3452 -0.1405 0.1642  -0.1327 39   HIS B CG  
2344 N ND1 . HIS B 39  ? 2.3233 2.0569 2.3443 -0.1494 0.1593  -0.1244 39   HIS B ND1 
2345 C CD2 . HIS B 39  ? 2.3366 2.0635 2.3509 -0.1482 0.1584  -0.1256 39   HIS B CD2 
2346 C CE1 . HIS B 39  ? 2.2862 2.0335 2.3205 -0.1616 0.1512  -0.1119 39   HIS B CE1 
2347 N NE2 . HIS B 39  ? 2.2959 2.0392 2.3264 -0.1612 0.1504  -0.1124 39   HIS B NE2 
2348 N N   . ASP B 40  ? 2.2769 2.0133 2.2788 -0.1052 0.2126  -0.1609 40   ASP B N   
2349 C CA  . ASP B 40  ? 2.2255 1.9784 2.2349 -0.0981 0.2301  -0.1657 40   ASP B CA  
2350 C C   . ASP B 40  ? 2.1109 1.8909 2.1399 -0.1063 0.2368  -0.1613 40   ASP B C   
2351 O O   . ASP B 40  ? 2.0809 1.8741 2.1170 -0.1023 0.2487  -0.1643 40   ASP B O   
2352 C CB  . ASP B 40  ? 2.2425 1.9988 2.2539 -0.0934 0.2362  -0.1685 40   ASP B CB  
2353 C CG  . ASP B 40  ? 2.3515 2.0863 2.3438 -0.0805 0.2354  -0.1744 40   ASP B CG  
2354 O OD1 . ASP B 40  ? 2.5236 2.2466 2.5031 -0.0724 0.2358  -0.1776 40   ASP B OD1 
2355 O OD2 . ASP B 40  ? 2.4016 2.1321 2.3911 -0.0777 0.2346  -0.1757 40   ASP B OD2 
2356 N N   . LEU B 41  ? 2.0423 1.8306 2.0798 -0.1171 0.2283  -0.1535 41   LEU B N   
2357 C CA  . LEU B 41  ? 1.9311 1.7465 1.9860 -0.1241 0.2331  -0.1481 41   LEU B CA  
2358 C C   . LEU B 41  ? 1.8989 1.7195 1.9548 -0.1223 0.2385  -0.1498 41   LEU B C   
2359 O O   . LEU B 41  ? 1.8379 1.6797 1.9058 -0.1221 0.2478  -0.1501 41   LEU B O   
2360 C CB  . LEU B 41  ? 1.9123 1.7334 1.9736 -0.1355 0.2207  -0.1372 41   LEU B CB  
2361 C CG  . LEU B 41  ? 1.8971 1.7235 1.9641 -0.1394 0.2170  -0.1331 41   LEU B CG  
2362 C CD1 . LEU B 41  ? 1.8895 1.7187 1.9621 -0.1511 0.2024  -0.1204 41   LEU B CD1 
2363 C CD2 . LEU B 41  ? 1.8179 1.6709 1.8987 -0.1372 0.2299  -0.1345 41   LEU B CD2 
2364 N N   . LEU B 42  ? 1.9353 1.7352 1.9776 -0.1203 0.2318  -0.1512 42   LEU B N   
2365 C CA  . LEU B 42  ? 1.9171 1.7191 1.9587 -0.1190 0.2354  -0.1524 42   LEU B CA  
2366 C C   . LEU B 42  ? 1.9194 1.7212 1.9583 -0.1085 0.2482  -0.1604 42   LEU B C   
2367 O O   . LEU B 42  ? 1.9024 1.7137 1.9463 -0.1076 0.2545  -0.1614 42   LEU B O   
2368 C CB  . LEU B 42  ? 1.9828 1.7620 2.0105 -0.1209 0.2220  -0.1504 42   LEU B CB  
2369 C CG  . LEU B 42  ? 1.9753 1.7549 2.0077 -0.1329 0.2072  -0.1400 42   LEU B CG  
2370 C CD1 . LEU B 42  ? 2.0627 1.8106 2.0777 -0.1325 0.1907  -0.1401 42   LEU B CD1 
2371 C CD2 . LEU B 42  ? 1.9461 1.7414 1.9882 -0.1398 0.2068  -0.1334 42   LEU B CD2 
2372 N N   . THR B 43  ? 1.9360 1.7283 1.9680 -0.1006 0.2519  -0.1653 43   THR B N   
2373 C CA  . THR B 43  ? 1.9564 1.7466 1.9846 -0.0901 0.2623  -0.1708 43   THR B CA  
2374 C C   . THR B 43  ? 1.8992 1.7065 1.9408 -0.0871 0.2741  -0.1727 43   THR B C   
2375 O O   . THR B 43  ? 1.9032 1.7175 1.9497 -0.0820 0.2831  -0.1748 43   THR B O   
2376 C CB  . THR B 43  ? 2.0511 1.8170 2.0591 -0.0804 0.2580  -0.1744 43   THR B CB  
2377 O OG1 . THR B 43  ? 2.0792 1.8362 2.0826 -0.0820 0.2503  -0.1737 43   THR B OG1 
2378 C CG2 . THR B 43  ? 2.1126 1.8606 2.1062 -0.0798 0.2484  -0.1743 43   THR B CG2 
2379 N N   . VAL B 44  ? 1.5476 2.0610 1.5075 -0.1597 0.0433  -0.1104 44   VAL B N   
2380 C CA  . VAL B 44  ? 1.5043 2.0290 1.4659 -0.1607 0.0465  -0.1158 44   VAL B CA  
2381 C C   . VAL B 44  ? 1.4660 1.9624 1.4132 -0.1719 0.0485  -0.1003 44   VAL B C   
2382 O O   . VAL B 44  ? 1.4391 1.9085 1.3836 -0.1697 0.0486  -0.0827 44   VAL B O   
2383 C CB  . VAL B 44  ? 1.4693 1.9933 1.4442 -0.1397 0.0447  -0.1218 44   VAL B CB  
2384 C CG1 . VAL B 44  ? 1.5053 2.0569 1.4912 -0.1257 0.0472  -0.1371 44   VAL B CG1 
2385 C CG2 . VAL B 44  ? 1.4063 1.8927 1.3838 -0.1260 0.0411  -0.1092 44   VAL B CG2 
2386 N N   . SER B 45  ? 1.4687 1.9709 1.4041 -0.1844 0.0512  -0.1048 45   SER B N   
2387 C CA  . SER B 45  ? 1.4655 1.9294 1.3745 -0.1972 0.0569  -0.0924 45   SER B CA  
2388 C C   . SER B 45  ? 1.4088 1.8279 1.3131 -0.1803 0.0604  -0.0820 45   SER B C   
2389 O O   . SER B 45  ? 1.3755 1.8007 1.2957 -0.1642 0.0561  -0.0882 45   SER B O   
2390 C CB  . SER B 45  ? 1.5095 1.9893 1.3990 -0.2208 0.0576  -0.1011 45   SER B CB  
2391 O OG  . SER B 45  ? 1.5066 2.0034 1.4049 -0.2148 0.0531  -0.1091 45   SER B OG  
2392 N N   . TRP B 46  ? 1.4071 1.7785 1.2871 -0.1829 0.0706  -0.0654 46   TRP B N   
2393 C CA  . TRP B 46  ? 1.3694 1.6936 1.2412 -0.1652 0.0787  -0.0537 46   TRP B CA  
2394 C C   . TRP B 46  ? 1.3568 1.6746 1.2177 -0.1672 0.0763  -0.0673 46   TRP B C   
2395 O O   . TRP B 46  ? 1.3139 1.6319 1.1936 -0.1477 0.0726  -0.0686 46   TRP B O   
2396 C CB  . TRP B 46  ? 1.4033 1.6713 1.2446 -0.1650 0.0958  -0.0322 46   TRP B CB  
2397 C CG  . TRP B 46  ? 1.3983 1.6747 1.2642 -0.1507 0.0969  -0.0091 46   TRP B CG  
2398 C CD1 . TRP B 46  ? 1.4377 1.7297 1.3042 -0.1625 0.0958  0.0007  46   TRP B CD1 
2399 C CD2 . TRP B 46  ? 1.3573 1.6340 1.2519 -0.1253 0.0970  0.0096  46   TRP B CD2 
2400 N NE1 . TRP B 46  ? 1.4175 1.7210 1.3110 -0.1473 0.0944  0.0262  46   TRP B NE1 
2401 C CE2 . TRP B 46  ? 1.3667 1.6628 1.2784 -0.1249 0.0951  0.0328  46   TRP B CE2 
2402 C CE3 . TRP B 46  ? 1.3131 1.5777 1.2198 -0.1051 0.0978  0.0109  46   TRP B CE3 
2403 C CZ2 . TRP B 46  ? 1.3343 1.6434 1.2758 -0.1070 0.0928  0.0590  46   TRP B CZ2 
2404 C CZ3 . TRP B 46  ? 1.2780 1.5520 1.2138 -0.0857 0.0970  0.0352  46   TRP B CZ3 
2405 C CH2 . TRP B 46  ? 1.2989 1.5974 1.2524 -0.0876 0.0941  0.0599  46   TRP B CH2 
2406 N N   . PRO B 47  ? 1.3975 1.7120 1.2264 -0.1938 0.0771  -0.0760 47   PRO B N   
2407 C CA  . PRO B 47  ? 1.3935 1.7100 1.2083 -0.2045 0.0720  -0.0860 47   PRO B CA  
2408 C C   . PRO B 47  ? 1.3364 1.7053 1.1958 -0.1858 0.0589  -0.0955 47   PRO B C   
2409 O O   . PRO B 47  ? 1.3074 1.6615 1.1673 -0.1754 0.0568  -0.0961 47   PRO B O   
2410 C CB  . PRO B 47  ? 1.4585 1.8030 1.2515 -0.2398 0.0675  -0.0933 47   PRO B CB  
2411 C CG  . PRO B 47  ? 1.5012 1.8145 1.2704 -0.2494 0.0782  -0.0847 47   PRO B CG  
2412 C CD  . PRO B 47  ? 1.4559 1.7715 1.2603 -0.2196 0.0806  -0.0753 47   PRO B CD  
2413 N N   . VAL B 48  ? 1.3229 1.7476 1.2150 -0.1817 0.0521  -0.1026 48   VAL B N   
2414 C CA  . VAL B 48  ? 1.2923 1.7608 1.2216 -0.1614 0.0438  -0.1113 48   VAL B CA  
2415 C C   . VAL B 48  ? 1.2338 1.6735 1.1777 -0.1343 0.0442  -0.1062 48   VAL B C   
2416 O O   . VAL B 48  ? 1.2136 1.6577 1.1711 -0.1185 0.0394  -0.1099 48   VAL B O   
2417 C CB  . VAL B 48  ? 1.3287 1.8523 1.2808 -0.1617 0.0420  -0.1199 48   VAL B CB  
2418 C CG1 . VAL B 48  ? 1.3080 1.8530 1.2898 -0.1340 0.0394  -0.1268 48   VAL B CG1 
2419 C CG2 . VAL B 48  ? 1.3716 1.9429 1.3207 -0.1840 0.0395  -0.1240 48   VAL B CG2 
2420 N N   . PHE B 49  ? 1.2075 1.6207 1.1483 -0.1305 0.0494  -0.0952 49   PHE B N   
2421 C CA  . PHE B 49  ? 1.1482 1.5396 1.1028 -0.1091 0.0492  -0.0853 49   PHE B CA  
2422 C C   . PHE B 49  ? 1.1225 1.4738 1.0657 -0.0991 0.0537  -0.0791 49   PHE B C   
2423 O O   . PHE B 49  ? 1.0955 1.4457 1.0540 -0.0818 0.0488  -0.0805 49   PHE B O   
2424 C CB  . PHE B 49  ? 1.1397 1.5172 1.0930 -0.1111 0.0538  -0.0676 49   PHE B CB  
2425 C CG  . PHE B 49  ? 1.0739 1.4347 1.0417 -0.0928 0.0534  -0.0507 49   PHE B CG  
2426 C CD1 . PHE B 49  ? 1.0329 1.4152 1.0195 -0.0861 0.0431  -0.0541 49   PHE B CD1 
2427 C CD2 . PHE B 49  ? 1.0180 1.3396 0.9772 -0.0830 0.0650  -0.0298 49   PHE B CD2 
2428 C CE1 . PHE B 49  ? 0.9830 1.3544 0.9816 -0.0741 0.0407  -0.0360 49   PHE B CE1 
2429 C CE2 . PHE B 49  ? 0.9689 1.2843 0.9462 -0.0660 0.0649  -0.0102 49   PHE B CE2 
2430 C CZ  . PHE B 49  ? 0.9365 1.2802 0.9345 -0.0638 0.0509  -0.0129 49   PHE B CZ  
2431 N N   . ILE B 50  ? 1.1402 1.4530 1.0508 -0.1111 0.0642  -0.0728 50   ILE B N   
2432 C CA  . ILE B 50  ? 1.1345 1.3997 1.0237 -0.1045 0.0720  -0.0678 50   ILE B CA  
2433 C C   . ILE B 50  ? 1.1371 1.4230 1.0304 -0.1069 0.0607  -0.0823 50   ILE B C   
2434 O O   . ILE B 50  ? 1.1220 1.3858 1.0153 -0.0937 0.0609  -0.0805 50   ILE B O   
2435 C CB  . ILE B 50  ? 1.1866 1.3966 1.0271 -0.1206 0.0885  -0.0602 50   ILE B CB  
2436 C CG1 . ILE B 50  ? 1.1941 1.3815 1.0340 -0.1113 0.1021  -0.0401 50   ILE B CG1 
2437 C CG2 . ILE B 50  ? 1.2077 1.3617 1.0167 -0.1165 0.0987  -0.0574 50   ILE B CG2 
2438 C CD1 . ILE B 50  ? 1.2824 1.4120 1.0693 -0.1270 0.1209  -0.0326 50   ILE B CD1 
2439 N N   . THR B 51  ? 1.1625 1.4960 1.0620 -0.1229 0.0509  -0.0942 51   THR B N   
2440 C CA  . THR B 51  ? 1.1694 1.5348 1.0789 -0.1242 0.0396  -0.1027 51   THR B CA  
2441 C C   . THR B 51  ? 1.1289 1.5165 1.0760 -0.0952 0.0326  -0.1063 51   THR B C   
2442 O O   . THR B 51  ? 1.1197 1.5014 1.0701 -0.0857 0.0276  -0.1070 51   THR B O   
2443 C CB  . THR B 51  ? 1.2207 1.6427 1.1343 -0.1460 0.0324  -0.1092 51   THR B CB  
2444 O OG1 . THR B 51  ? 1.2763 1.6689 1.1451 -0.1781 0.0381  -0.1057 51   THR B OG1 
2445 C CG2 . THR B 51  ? 1.2325 1.7017 1.1649 -0.1446 0.0204  -0.1121 51   THR B CG2 
2446 N N   . LEU B 52  ? 1.1103 1.5181 1.0799 -0.0834 0.0324  -0.1082 52   LEU B N   
2447 C CA  . LEU B 52  ? 1.0875 1.5054 1.0817 -0.0594 0.0274  -0.1120 52   LEU B CA  
2448 C C   . LEU B 52  ? 1.0432 1.4173 1.0342 -0.0455 0.0290  -0.1026 52   LEU B C   
2449 O O   . LEU B 52  ? 1.0361 1.4081 1.0367 -0.0304 0.0237  -0.1055 52   LEU B O   
2450 C CB  . LEU B 52  ? 1.1039 1.5422 1.1097 -0.0564 0.0283  -0.1158 52   LEU B CB  
2451 C CG  . LEU B 52  ? 1.1513 1.6382 1.1649 -0.0637 0.0289  -0.1260 52   LEU B CG  
2452 C CD1 . LEU B 52  ? 1.1714 1.6652 1.1830 -0.0700 0.0328  -0.1281 52   LEU B CD1 
2453 C CD2 . LEU B 52  ? 1.1687 1.6865 1.2011 -0.0443 0.0266  -0.1338 52   LEU B CD2 
2454 N N   . ILE B 53  ? 1.0177 1.3586 0.9961 -0.0494 0.0375  -0.0892 53   ILE B N   
2455 C CA  . ILE B 53  ? 0.9804 1.2837 0.9573 -0.0354 0.0423  -0.0758 53   ILE B CA  
2456 C C   . ILE B 53  ? 0.9890 1.2675 0.9495 -0.0345 0.0435  -0.0792 53   ILE B C   
2457 O O   . ILE B 53  ? 0.9674 1.2366 0.9362 -0.0201 0.0394  -0.0788 53   ILE B O   
2458 C CB  . ILE B 53  ? 0.9715 1.2460 0.9372 -0.0376 0.0558  -0.0559 53   ILE B CB  
2459 C CG1 . ILE B 53  ? 0.9758 1.2786 0.9576 -0.0418 0.0517  -0.0499 53   ILE B CG1 
2460 C CG2 . ILE B 53  ? 0.9365 1.1785 0.9047 -0.0200 0.0639  -0.0377 53   ILE B CG2 
2461 C CD1 . ILE B 53  ? 0.9673 1.2913 0.9708 -0.0329 0.0397  -0.0511 53   ILE B CD1 
2462 N N   . THR B 54  ? 1.0237 1.2899 0.9564 -0.0536 0.0484  -0.0823 54   THR B N   
2463 C CA  . THR B 54  ? 1.0523 1.2907 0.9594 -0.0607 0.0493  -0.0846 54   THR B CA  
2464 C C   . THR B 54  ? 1.0653 1.3410 0.9943 -0.0539 0.0333  -0.0944 54   THR B C   
2465 O O   . THR B 54  ? 1.0680 1.3210 0.9918 -0.0456 0.0317  -0.0929 54   THR B O   
2466 C CB  . THR B 54  ? 1.1011 1.3225 0.9675 -0.0903 0.0546  -0.0867 54   THR B CB  
2467 O OG1 . THR B 54  ? 1.1074 1.2790 0.9467 -0.0919 0.0736  -0.0754 54   THR B OG1 
2468 C CG2 . THR B 54  ? 1.1275 1.3204 0.9610 -0.1040 0.0530  -0.0889 54   THR B CG2 
2469 N N   . GLY B 55  ? 1.0789 1.4111 1.0321 -0.0554 0.0234  -0.1027 55   GLY B N   
2470 C CA  . GLY B 55  ? 1.0996 1.4703 1.0757 -0.0444 0.0114  -0.1084 55   GLY B CA  
2471 C C   . GLY B 55  ? 1.0851 1.4421 1.0793 -0.0176 0.0095  -0.1086 55   GLY B C   
2472 O O   . GLY B 55  ? 1.0962 1.4508 1.0948 -0.0073 0.0030  -0.1090 55   GLY B O   
2473 N N   . LEU B 56  ? 1.0692 1.4174 1.0714 -0.0089 0.0139  -0.1068 56   LEU B N   
2474 C CA  . LEU B 56  ? 1.0719 1.4080 1.0860 0.0107  0.0106  -0.1062 56   LEU B CA  
2475 C C   . LEU B 56  ? 1.0431 1.3380 1.0460 0.0152  0.0128  -0.0972 56   LEU B C   
2476 O O   . LEU B 56  ? 1.0429 1.3271 1.0519 0.0294  0.0077  -0.0971 56   LEU B O   
2477 C CB  . LEU B 56  ? 1.0713 1.4070 1.0904 0.0111  0.0131  -0.1027 56   LEU B CB  
2478 C CG  . LEU B 56  ? 1.0922 1.4067 1.1146 0.0228  0.0096  -0.0965 56   LEU B CG  
2479 C CD1 . LEU B 56  ? 1.1424 1.4606 1.1684 0.0379  0.0029  -0.1078 56   LEU B CD1 
2480 C CD2 . LEU B 56  ? 1.1274 1.4444 1.1501 0.0146  0.0102  -0.0882 56   LEU B CD2 
2481 N N   . TYR B 57  ? 1.0284 1.2956 1.0100 0.0030  0.0224  -0.0897 57   TYR B N   
2482 C CA  . TYR B 57  ? 1.0117 1.2332 0.9771 0.0081  0.0303  -0.0799 57   TYR B CA  
2483 C C   . TYR B 57  ? 1.0359 1.2470 0.9856 0.0032  0.0248  -0.0860 57   TYR B C   
2484 O O   . TYR B 57  ? 1.0285 1.2158 0.9757 0.0137  0.0242  -0.0826 57   TYR B O   
2485 C CB  . TYR B 57  ? 1.0089 1.1961 0.9519 0.0003  0.0479  -0.0677 57   TYR B CB  
2486 C CG  . TYR B 57  ? 1.0337 1.1645 0.9460 0.0019  0.0634  -0.0584 57   TYR B CG  
2487 C CD1 . TYR B 57  ? 1.0135 1.1211 0.9341 0.0211  0.0728  -0.0428 57   TYR B CD1 
2488 C CD2 . TYR B 57  ? 1.0893 1.1871 0.9591 -0.0179 0.0709  -0.0634 57   TYR B CD2 
2489 C CE1 . TYR B 57  ? 1.0251 1.0767 0.9144 0.0252  0.0919  -0.0334 57   TYR B CE1 
2490 C CE2 . TYR B 57  ? 1.1412 1.1752 0.9718 -0.0176 0.0893  -0.0557 57   TYR B CE2 
2491 C CZ  . TYR B 57  ? 1.1041 1.1146 0.9457 0.0063  0.1013  -0.0411 57   TYR B CZ  
2492 O OH  . TYR B 57  ? 1.1741 1.1175 0.9729 0.0081  0.1236  -0.0335 57   TYR B OH  
2493 N N   . LEU B 58  ? 1.0612 1.2938 1.0000 -0.0152 0.0195  -0.0929 58   LEU B N   
2494 C CA  . LEU B 58  ? 1.0919 1.3301 1.0206 -0.0234 0.0095  -0.0959 58   LEU B CA  
2495 C C   . LEU B 58  ? 1.0963 1.3669 1.0581 -0.0013 -0.0036 -0.0996 58   LEU B C   
2496 O O   . LEU B 58  ? 1.1035 1.3552 1.0610 0.0058  -0.0080 -0.0978 58   LEU B O   
2497 C CB  . LEU B 58  ? 1.1257 1.3956 1.0417 -0.0505 0.0037  -0.0984 58   LEU B CB  
2498 C CG  . LEU B 58  ? 1.1377 1.3624 1.0093 -0.0750 0.0182  -0.0955 58   LEU B CG  
2499 C CD1 . LEU B 58  ? 1.1901 1.4371 1.0364 -0.1104 0.0106  -0.0963 58   LEU B CD1 
2500 C CD2 . LEU B 58  ? 1.1340 1.2848 0.9680 -0.0737 0.0327  -0.0900 58   LEU B CD2 
2501 N N   . VAL B 59  ? 1.1027 1.4166 1.0931 0.0098  -0.0079 -0.1045 59   VAL B N   
2502 C CA  . VAL B 59  ? 1.1335 1.4705 1.1480 0.0326  -0.0163 -0.1079 59   VAL B CA  
2503 C C   . VAL B 59  ? 1.1227 1.4201 1.1357 0.0493  -0.0160 -0.1063 59   VAL B C   
2504 O O   . VAL B 59  ? 1.1549 1.4508 1.1727 0.0621  -0.0234 -0.1065 59   VAL B O   
2505 C CB  . VAL B 59  ? 1.1531 1.5283 1.1890 0.0432  -0.0146 -0.1139 59   VAL B CB  
2506 C CG1 . VAL B 59  ? 1.1889 1.5654 1.2383 0.0703  -0.0172 -0.1176 59   VAL B CG1 
2507 C CG2 . VAL B 59  ? 1.1787 1.6061 1.2232 0.0304  -0.0168 -0.1131 59   VAL B CG2 
2508 N N   . THR B 60  ? 1.0898 1.3589 1.0969 0.0485  -0.0079 -0.1020 60   THR B N   
2509 C CA  . THR B 60  ? 1.0782 1.3172 1.0855 0.0609  -0.0081 -0.0968 60   THR B CA  
2510 C C   . THR B 60  ? 1.0832 1.2893 1.0749 0.0599  -0.0071 -0.0912 60   THR B C   
2511 O O   . THR B 60  ? 1.0951 1.2855 1.0881 0.0712  -0.0123 -0.0898 60   THR B O   
2512 C CB  . THR B 60  ? 1.0404 1.2688 1.0494 0.0579  -0.0004 -0.0873 60   THR B CB  
2513 O OG1 . THR B 60  ? 1.0505 1.3063 1.0680 0.0551  -0.0018 -0.0935 60   THR B OG1 
2514 C CG2 . THR B 60  ? 1.0277 1.2368 1.0392 0.0669  -0.0032 -0.0788 60   THR B CG2 
2515 N N   . ASN B 61  ? 1.0787 1.2694 1.0497 0.0443  0.0002  -0.0885 61   ASN B N   
2516 C CA  . ASN B 61  ? 1.0959 1.2505 1.0429 0.0395  0.0027  -0.0850 61   ASN B CA  
2517 C C   . ASN B 61  ? 1.1405 1.3171 1.0899 0.0378  -0.0129 -0.0908 61   ASN B C   
2518 O O   . ASN B 61  ? 1.1614 1.3166 1.1034 0.0431  -0.0169 -0.0887 61   ASN B O   
2519 C CB  . ASN B 61  ? 1.0983 1.2152 1.0098 0.0215  0.0189  -0.0801 61   ASN B CB  
2520 C CG  . ASN B 61  ? 1.0902 1.1702 0.9970 0.0322  0.0385  -0.0668 61   ASN B CG  
2521 O OD1 . ASN B 61  ? 1.1004 1.1559 1.0072 0.0448  0.0435  -0.0588 61   ASN B OD1 
2522 N ND2 . ASN B 61  ? 1.0933 1.1741 0.9987 0.0281  0.0497  -0.0616 61   ASN B ND2 
2523 N N   . ALA B 62  ? 1.1599 1.3832 1.1221 0.0316  -0.0214 -0.0952 62   ALA B N   
2524 C CA  . ALA B 62  ? 1.2032 1.4621 1.1775 0.0344  -0.0363 -0.0951 62   ALA B CA  
2525 C C   . ALA B 62  ? 1.2184 1.4730 1.2108 0.0615  -0.0414 -0.0965 62   ALA B C   
2526 O O   . ALA B 62  ? 1.2603 1.5085 1.2492 0.0655  -0.0499 -0.0932 62   ALA B O   
2527 C CB  . ALA B 62  ? 1.2153 1.5343 1.2105 0.0310  -0.0414 -0.0959 62   ALA B CB  
2528 N N   . LEU B 63  ? 1.2019 1.4554 1.2079 0.0770  -0.0365 -0.1007 63   LEU B N   
2529 C CA  . LEU B 63  ? 1.2391 1.4804 1.2526 0.0990  -0.0407 -0.1026 63   LEU B CA  
2530 C C   . LEU B 63  ? 1.2313 1.4279 1.2295 0.0995  -0.0412 -0.0980 63   LEU B C   
2531 O O   . LEU B 63  ? 1.2767 1.4641 1.2739 0.1107  -0.0490 -0.0975 63   LEU B O   
2532 C CB  . LEU B 63  ? 1.2407 1.4830 1.2607 0.1083  -0.0352 -0.1079 63   LEU B CB  
2533 C CG  . LEU B 63  ? 1.2946 1.5776 1.3292 0.1162  -0.0330 -0.1137 63   LEU B CG  
2534 C CD1 . LEU B 63  ? 1.2930 1.5662 1.3232 0.1200  -0.0260 -0.1197 63   LEU B CD1 
2535 C CD2 . LEU B 63  ? 1.3683 1.6710 1.4135 0.1368  -0.0381 -0.1124 63   LEU B CD2 
2536 N N   . PHE B 64  ? 1.1798 1.3493 1.1664 0.0892  -0.0315 -0.0927 64   PHE B N   
2537 C CA  . PHE B 64  ? 1.1754 1.3064 1.1489 0.0906  -0.0290 -0.0858 64   PHE B CA  
2538 C C   . PHE B 64  ? 1.2215 1.3389 1.1776 0.0832  -0.0336 -0.0853 64   PHE B C   
2539 O O   . PHE B 64  ? 1.2482 1.3441 1.1978 0.0895  -0.0383 -0.0830 64   PHE B O   
2540 C CB  . PHE B 64  ? 1.1200 1.2286 1.0872 0.0851  -0.0136 -0.0753 64   PHE B CB  
2541 C CG  . PHE B 64  ? 1.0896 1.2040 1.0715 0.0920  -0.0136 -0.0690 64   PHE B CG  
2542 C CD1 . PHE B 64  ? 1.0477 1.1849 1.0404 0.0880  -0.0110 -0.0689 64   PHE B CD1 
2543 C CD2 . PHE B 64  ? 1.0922 1.1905 1.0740 0.0985  -0.0177 -0.0623 64   PHE B CD2 
2544 C CE1 . PHE B 64  ? 1.0183 1.1617 1.0194 0.0883  -0.0132 -0.0613 64   PHE B CE1 
2545 C CE2 . PHE B 64  ? 1.0951 1.2008 1.0853 0.0980  -0.0202 -0.0540 64   PHE B CE2 
2546 C CZ  . PHE B 64  ? 1.0482 1.1766 1.0472 0.0917  -0.0183 -0.0532 64   PHE B CZ  
2547 N N   . ALA B 65  ? 1.2368 1.3660 1.1814 0.0662  -0.0333 -0.0865 65   ALA B N   
2548 C CA  . ALA B 65  ? 1.2874 1.4022 1.2081 0.0517  -0.0388 -0.0843 65   ALA B CA  
2549 C C   . ALA B 65  ? 1.3485 1.4886 1.2863 0.0649  -0.0563 -0.0841 65   ALA B C   
2550 O O   . ALA B 65  ? 1.3856 1.5023 1.3087 0.0634  -0.0618 -0.0808 65   ALA B O   
2551 C CB  . ALA B 65  ? 1.2996 1.4280 1.2020 0.0257  -0.0384 -0.0843 65   ALA B CB  
2552 N N   . LEU B 66  ? 1.3638 1.5487 1.3307 0.0794  -0.0629 -0.0865 66   LEU B N   
2553 C CA  . LEU B 66  ? 1.4295 1.6374 1.4136 0.0984  -0.0751 -0.0840 66   LEU B CA  
2554 C C   . LEU B 66  ? 1.4467 1.6138 1.4249 0.1145  -0.0749 -0.0858 66   LEU B C   
2555 O O   . LEU B 66  ? 1.5060 1.6631 1.4787 0.1194  -0.0840 -0.0815 66   LEU B O   
2556 C CB  . LEU B 66  ? 1.4441 1.6974 1.4563 0.1160  -0.0745 -0.0861 66   LEU B CB  
2557 C CG  . LEU B 66  ? 1.4419 1.7474 1.4648 0.1001  -0.0765 -0.0817 66   LEU B CG  
2558 C CD1 . LEU B 66  ? 1.4629 1.8173 1.5162 0.1232  -0.0744 -0.0806 66   LEU B CD1 
2559 C CD2 . LEU B 66  ? 1.4740 1.7969 1.4866 0.0791  -0.0895 -0.0702 66   LEU B CD2 
2560 N N   . ALA B 67  ? 1.4106 1.5566 1.3888 0.1199  -0.0657 -0.0901 67   ALA B N   
2561 C CA  . ALA B 67  ? 1.4341 1.5445 1.4044 0.1303  -0.0665 -0.0898 67   ALA B CA  
2562 C C   . ALA B 67  ? 1.4543 1.5337 1.4063 0.1215  -0.0684 -0.0841 67   ALA B C   
2563 O O   . ALA B 67  ? 1.5220 1.5876 1.4686 0.1302  -0.0774 -0.0827 67   ALA B O   
2564 C CB  . ALA B 67  ? 1.3803 1.4779 1.3508 0.1277  -0.0573 -0.0897 67   ALA B CB  
2565 N N   . TYR B 68  ? 1.4210 1.4852 1.3591 0.1046  -0.0583 -0.0807 68   TYR B N   
2566 C CA  . TYR B 68  ? 1.4570 1.4854 1.3704 0.0949  -0.0561 -0.0758 68   TYR B CA  
2567 C C   . TYR B 68  ? 1.5358 1.5726 1.4417 0.0908  -0.0715 -0.0752 68   TYR B C   
2568 O O   . TYR B 68  ? 1.5800 1.5904 1.4722 0.0918  -0.0760 -0.0722 68   TYR B O   
2569 C CB  . TYR B 68  ? 1.4263 1.4306 1.3170 0.0777  -0.0387 -0.0726 68   TYR B CB  
2570 C CG  . TYR B 68  ? 1.3807 1.3730 1.2789 0.0846  -0.0220 -0.0665 68   TYR B CG  
2571 C CD1 . TYR B 68  ? 1.3832 1.3578 1.2859 0.0950  -0.0182 -0.0583 68   TYR B CD1 
2572 C CD2 . TYR B 68  ? 1.3415 1.3443 1.2432 0.0795  -0.0107 -0.0658 68   TYR B CD2 
2573 C CE1 . TYR B 68  ? 1.3493 1.3236 1.2633 0.1001  -0.0043 -0.0467 68   TYR B CE1 
2574 C CE2 . TYR B 68  ? 1.2990 1.2968 1.2108 0.0864  0.0037  -0.0556 68   TYR B CE2 
2575 C CZ  . TYR B 68  ? 1.2970 1.2840 1.2168 0.0967  0.0066  -0.0447 68   TYR B CZ  
2576 O OH  . TYR B 68  ? 1.2619 1.2544 1.1963 0.1025  0.0198  -0.0287 68   TYR B OH  
2577 N N   . LEU B 69  ? 1.5592 1.6370 1.4751 0.0851  -0.0799 -0.0753 69   LEU B N   
2578 C CA  . LEU B 69  ? 1.6397 1.7386 1.5543 0.0806  -0.0964 -0.0690 69   LEU B CA  
2579 C C   . LEU B 69  ? 1.7030 1.8096 1.6365 0.1080  -0.1065 -0.0672 69   LEU B C   
2580 O O   . LEU B 69  ? 1.7639 1.8612 1.6883 0.1079  -0.1172 -0.0610 69   LEU B O   
2581 C CB  . LEU B 69  ? 1.6472 1.7989 1.5724 0.0669  -0.1033 -0.0645 69   LEU B CB  
2582 C CG  . LEU B 69  ? 1.6193 1.7497 1.5091 0.0322  -0.0955 -0.0650 69   LEU B CG  
2583 C CD1 . LEU B 69  ? 1.6479 1.8310 1.5400 0.0092  -0.1070 -0.0571 69   LEU B CD1 
2584 C CD2 . LEU B 69  ? 1.6245 1.6973 1.4718 0.0152  -0.0923 -0.0636 69   LEU B CD2 
2585 N N   . ALA B 70  ? 1.6985 1.8158 1.6524 0.1301  -0.1020 -0.0725 70   ALA B N   
2586 C CA  . ALA B 70  ? 1.7757 1.8824 1.7351 0.1557  -0.1067 -0.0725 70   ALA B CA  
2587 C C   . ALA B 70  ? 1.8112 1.8698 1.7479 0.1527  -0.1103 -0.0712 70   ALA B C   
2588 O O   . ALA B 70  ? 1.9036 1.9546 1.8375 0.1656  -0.1197 -0.0665 70   ALA B O   
2589 C CB  . ALA B 70  ? 2.0491 2.1510 2.0160 0.1721  -0.0970 -0.0810 70   ALA B CB  
2590 N N   . CYS B 71  ? 1.7605 1.7880 1.6813 0.1368  -0.1012 -0.0732 71   CYS B N   
2591 C CA  . CYS B 71  ? 1.7943 1.7789 1.6948 0.1339  -0.1021 -0.0705 71   CYS B CA  
2592 C C   . CYS B 71  ? 1.8407 1.8119 1.7209 0.1178  -0.1075 -0.0651 71   CYS B C   
2593 O O   . CYS B 71  ? 1.8682 1.8033 1.7298 0.1142  -0.1066 -0.0627 71   CYS B O   
2594 C CB  . CYS B 71  ? 1.7271 1.6879 1.6215 0.1262  -0.0874 -0.0698 71   CYS B CB  
2595 S SG  . CYS B 71  ? 1.6678 1.6509 1.5819 0.1325  -0.0798 -0.0738 71   CYS B SG  
2596 N N   . GLY B 72  ? 1.7789 1.7310 1.7103 -0.0062 0.0151  0.0555  72   GLY B N   
2597 C CA  . GLY B 72  ? 1.8450 1.7662 1.7384 0.0058  0.0156  0.0596  72   GLY B CA  
2598 C C   . GLY B 72  ? 1.7741 1.7176 1.6865 0.0031  0.0065  0.0585  72   GLY B C   
2599 O O   . GLY B 72  ? 1.7033 1.6818 1.6437 0.0010  -0.0096 0.0571  72   GLY B O   
2600 N N   . ASP B 73  ? 2.7308 2.6462 2.6223 0.0034  0.0211  0.0590  73   ASP B N   
2601 C CA  . ASP B 73  ? 2.3923 2.3271 2.3023 -0.0005 0.0153  0.0576  73   ASP B CA  
2602 C C   . ASP B 73  ? 2.0484 1.9926 1.9901 -0.0173 0.0340  0.0484  73   ASP B C   
2603 O O   . ASP B 73  ? 2.0000 1.9202 1.9311 -0.0210 0.0525  0.0457  73   ASP B O   
2604 C CB  . ASP B 73  ? 1.8358 1.7336 1.7013 0.0141  0.0164  0.0612  73   ASP B CB  
2605 C CG  . ASP B 73  ? 2.2149 2.1014 2.0486 0.0380  -0.0058 0.0605  73   ASP B CG  
2606 O OD1 . ASP B 73  ? 2.2387 2.1338 2.0701 0.0501  -0.0235 0.0558  73   ASP B OD1 
2607 O OD2 . ASP B 73  ? 2.5485 2.4195 2.3629 0.0465  -0.0069 0.0606  73   ASP B OD2 
2608 N N   . VAL B 74  ? 1.6195 1.5968 1.6003 -0.0250 0.0290  0.0395  74   VAL B N   
2609 C CA  . VAL B 74  ? 1.5669 1.5619 1.5886 -0.0362 0.0404  0.0202  74   VAL B CA  
2610 C C   . VAL B 74  ? 1.4856 1.5103 1.5280 -0.0326 0.0218  0.0153  74   VAL B C   
2611 O O   . VAL B 74  ? 1.4434 1.4909 1.5234 -0.0354 0.0213  -0.0061 74   VAL B O   
2612 C CB  . VAL B 74  ? 1.5490 1.5629 1.6035 -0.0411 0.0429  0.0042  74   VAL B CB  
2613 C CG1 . VAL B 74  ? 1.6303 1.6082 1.6750 -0.0511 0.0765  -0.0004 74   VAL B CG1 
2614 C CG2 . VAL B 74  ? 1.5226 1.5524 1.5684 -0.0312 0.0186  0.0150  74   VAL B CG2 
2615 N N   . ILE B 75  ? 1.4684 1.4914 1.4877 -0.0249 0.0070  0.0309  75   ILE B N   
2616 C CA  . ILE B 75  ? 1.4104 1.4490 1.4387 -0.0215 -0.0045 0.0285  75   ILE B CA  
2617 C C   . ILE B 75  ? 1.4551 1.4773 1.4672 -0.0228 0.0025  0.0351  75   ILE B C   
2618 O O   . ILE B 75  ? 1.4957 1.5042 1.4823 -0.0172 -0.0016 0.0468  75   ILE B O   
2619 C CB  . ILE B 75  ? 1.3704 1.4161 1.3873 -0.0129 -0.0215 0.0374  75   ILE B CB  
2620 C CG1 . ILE B 75  ? 1.3269 1.3783 1.3464 -0.0083 -0.0277 0.0340  75   ILE B CG1 
2621 C CG2 . ILE B 75  ? 1.3243 1.3753 1.3414 -0.0071 -0.0296 0.0341  75   ILE B CG2 
2622 C CD1 . ILE B 75  ? 1.2792 1.3219 1.2793 -0.0034 -0.0321 0.0445  75   ILE B CD1 
2623 N N   . GLU B 76  ? 1.4524 1.4777 1.4822 -0.0283 0.0116  0.0234  76   GLU B N   
2624 C CA  . GLU B 76  ? 1.5000 1.5087 1.5129 -0.0286 0.0181  0.0294  76   GLU B CA  
2625 C C   . GLU B 76  ? 1.4781 1.4972 1.4801 -0.0205 -0.0016 0.0403  76   GLU B C   
2626 O O   . GLU B 76  ? 1.4291 1.4666 1.4415 -0.0167 -0.0149 0.0387  76   GLU B O   
2627 C CB  . GLU B 76  ? 1.4995 1.5156 1.5428 -0.0373 0.0316  0.0107  76   GLU B CB  
2628 C CG  . GLU B 76  ? 1.5678 1.5617 1.6233 -0.0504 0.0655  -0.0043 76   GLU B CG  
2629 C CD  . GLU B 76  ? 1.6373 1.6170 1.7065 -0.0611 0.0912  -0.0183 76   GLU B CD  
2630 O OE1 . GLU B 76  ? 1.6252 1.6307 1.7516 -0.0715 0.1021  -0.0499 76   GLU B OE1 
2631 O OE2 . GLU B 76  ? 1.7111 1.6544 1.7363 -0.0575 0.1000  -0.0017 76   GLU B OE2 
2632 N N   . ASN B 77  ? 1.5319 1.5329 1.5090 -0.0159 -0.0012 0.0487  77   ASN B N   
2633 C CA  . ASN B 77  ? 1.5198 1.5315 1.4958 -0.0109 -0.0149 0.0528  77   ASN B CA  
2634 C C   . ASN B 77  ? 1.4937 1.5176 1.4754 -0.0079 -0.0253 0.0538  77   ASN B C   
2635 O O   . ASN B 77  ? 1.4763 1.5088 1.4659 -0.0082 -0.0291 0.0527  77   ASN B O   
2636 C CB  . ASN B 77  ? 1.4780 1.5038 1.4702 -0.0143 -0.0169 0.0490  77   ASN B CB  
2637 C CG  . ASN B 77  ? 1.5158 1.5308 1.5064 -0.0178 -0.0061 0.0456  77   ASN B CG  
2638 O OD1 . ASN B 77  ? 1.6068 1.6030 1.5751 -0.0136 -0.0036 0.0510  77   ASN B OD1 
2639 N ND2 . ASN B 77  ? 1.4653 1.4910 1.4805 -0.0235 0.0003  0.0325  77   ASN B ND2 
2640 N N   . ALA B 78  ? 1.4997 1.5205 1.4778 -0.0063 -0.0254 0.0540  78   ALA B N   
2641 C CA  . ALA B 78  ? 1.4969 1.5280 1.4843 -0.0049 -0.0313 0.0513  78   ALA B CA  
2642 C C   . ALA B 78  ? 1.5765 1.6031 1.5558 0.0060  -0.0401 0.0447  78   ALA B C   
2643 O O   . ALA B 78  ? 1.6253 1.6342 1.5825 0.0130  -0.0397 0.0471  78   ALA B O   
2644 C CB  . ALA B 78  ? 1.4444 1.4787 1.4365 -0.0086 -0.0284 0.0531  78   ALA B CB  
2645 N N   . ARG B 79  ? 1.6062 1.6467 1.6036 0.0098  -0.0477 0.0321  79   ARG B N   
2646 C CA  . ARG B 79  ? 1.6841 1.7273 1.6813 0.0261  -0.0628 0.0162  79   ARG B CA  
2647 C C   . ARG B 79  ? 1.6953 1.7291 1.6785 0.0293  -0.0628 0.0208  79   ARG B C   
2648 O O   . ARG B 79  ? 1.6368 1.6805 1.6374 0.0163  -0.0537 0.0249  79   ARG B O   
2649 C CB  . ARG B 79  ? 1.6851 1.7570 1.7287 0.0230  -0.0658 -0.0076 79   ARG B CB  
2650 C CG  . ARG B 79  ? 1.7098 1.7904 1.7687 0.0223  -0.0666 -0.0169 79   ARG B CG  
2651 C CD  . ARG B 79  ? 1.7127 1.8185 1.8266 0.0109  -0.0567 -0.0429 79   ARG B CD  
2652 N NE  . ARG B 79  ? 1.6586 1.7531 1.7755 -0.0099 -0.0295 -0.0297 79   ARG B NE  
2653 C CZ  . ARG B 79  ? 1.6723 1.7697 1.8245 -0.0249 -0.0059 -0.0467 79   ARG B CZ  
2654 N NH1 . ARG B 79  ? 1.7179 1.8415 1.9227 -0.0252 -0.0066 -0.0828 79   ARG B NH1 
2655 N NH2 . ARG B 79  ? 1.6340 1.7030 1.7667 -0.0378 0.0204  -0.0311 79   ARG B NH2 
2656 N N   . PRO B 80  ? 1.7883 1.7948 1.7314 0.0492  -0.0716 0.0206  80   PRO B N   
2657 C CA  . PRO B 80  ? 1.8053 1.7979 1.7314 0.0512  -0.0680 0.0264  80   PRO B CA  
2658 C C   . PRO B 80  ? 1.7858 1.8092 1.7505 0.0484  -0.0759 0.0121  80   PRO B C   
2659 O O   . PRO B 80  ? 1.9600 2.0065 1.9540 0.0570  -0.0901 -0.0113 80   PRO B O   
2660 C CB  . PRO B 80  ? 1.9358 1.8826 1.8008 0.0805  -0.0769 0.0244  80   PRO B CB  
2661 C CG  . PRO B 80  ? 1.9683 1.8970 1.8109 0.0882  -0.0769 0.0256  80   PRO B CG  
2662 C CD  . PRO B 80  ? 1.8895 1.8679 1.7916 0.0741  -0.0839 0.0148  80   PRO B CD  
2663 N N   . GLY B 81  ? 1.7407 1.7652 1.7101 0.0361  -0.0651 0.0222  81   GLY B N   
2664 C CA  . GLY B 81  ? 1.7404 1.7858 1.7390 0.0338  -0.0688 0.0101  81   GLY B CA  
2665 C C   . GLY B 81  ? 1.6790 1.7499 1.7234 0.0174  -0.0590 -0.0004 81   GLY B C   
2666 O O   . GLY B 81  ? 1.6901 1.7749 1.7629 0.0121  -0.0549 -0.0134 81   GLY B O   
2667 N N   . SER B 82  ? 1.6649 1.8331 1.7638 0.0041  -0.0780 0.1620  82   SER B N   
2668 C CA  . SER B 82  ? 1.6316 1.7739 1.6884 0.0092  -0.0726 0.1289  82   SER B CA  
2669 C C   . SER B 82  ? 1.5710 1.6742 1.6257 0.0124  -0.0720 0.1061  82   SER B C   
2670 O O   . SER B 82  ? 1.5246 1.6262 1.5800 0.0133  -0.0719 0.1043  82   SER B O   
2671 C CB  . SER B 82  ? 1.6177 1.7865 1.6377 0.0118  -0.0681 0.1190  82   SER B CB  
2672 O OG  . SER B 82  ? 1.5923 1.7331 1.5849 0.0163  -0.0648 0.0902  82   SER B OG  
2673 N N   . PHE B 83  ? 1.5710 1.6490 1.6227 0.0142  -0.0716 0.0889  83   PHE B N   
2674 C CA  . PHE B 83  ? 1.5232 1.5775 1.5724 0.0173  -0.0710 0.0672  83   PHE B CA  
2675 C C   . PHE B 83  ? 1.4678 1.5188 1.4804 0.0200  -0.0664 0.0546  83   PHE B C   
2676 O O   . PHE B 83  ? 1.4260 1.4703 1.4379 0.0216  -0.0661 0.0466  83   PHE B O   
2677 C CB  . PHE B 83  ? 1.5460 1.5867 1.5995 0.0185  -0.0716 0.0524  83   PHE B CB  
2678 C CG  . PHE B 83  ? 1.4985 1.5305 1.5495 0.0215  -0.0710 0.0304  83   PHE B CG  
2679 C CD1 . PHE B 83  ? 1.4818 1.5137 1.5692 0.0226  -0.0755 0.0212  83   PHE B CD1 
2680 C CD2 . PHE B 83  ? 1.4700 1.5000 1.4877 0.0233  -0.0668 0.0196  83   PHE B CD2 
2681 C CE1 . PHE B 83  ? 1.4438 1.4795 1.5285 0.0259  -0.0749 -0.0016 83   PHE B CE1 
2682 C CE2 . PHE B 83  ? 1.4085 1.4428 1.4241 0.0255  -0.0663 0.0035  83   PHE B CE2 
2683 C CZ  . PHE B 83  ? 1.4066 1.4465 1.4526 0.0271  -0.0699 -0.0087 83   PHE B CZ  
2684 N N   . THR B 84  ? 1.4741 1.5315 1.4622 0.0208  -0.0638 0.0524  84   THR B N   
2685 C CA  . THR B 84  ? 1.4287 1.4839 1.3942 0.0233  -0.0615 0.0410  84   THR B CA  
2686 C C   . THR B 84  ? 1.3826 1.4464 1.3469 0.0241  -0.0612 0.0429  84   THR B C   
2687 O O   . THR B 84  ? 1.3434 1.3956 1.3019 0.0257  -0.0605 0.0345  84   THR B O   
2688 C CB  . THR B 84  ? 1.4662 1.5362 1.4200 0.0242  -0.0609 0.0379  84   THR B CB  
2689 O OG1 . THR B 84  ? 1.4982 1.5546 1.4485 0.0244  -0.0608 0.0318  84   THR B OG1 
2690 C CG2 . THR B 84  ? 1.4399 1.5158 1.3845 0.0272  -0.0606 0.0262  84   THR B CG2 
2691 N N   . ASP B 85  ? 1.3930 1.4829 1.3630 0.0226  -0.0619 0.0557  85   ASP B N   
2692 C CA  . ASP B 85  ? 1.3535 1.4593 1.3217 0.0232  -0.0616 0.0584  85   ASP B CA  
2693 C C   . ASP B 85  ? 1.3011 1.3906 1.2855 0.0223  -0.0630 0.0632  85   ASP B C   
2694 O O   . ASP B 85  ? 1.2643 1.3518 1.2426 0.0238  -0.0621 0.0581  85   ASP B O   
2695 C CB  . ASP B 85  ? 1.4037 1.5541 1.3771 0.0212  -0.0623 0.0751  85   ASP B CB  
2696 C CG  . ASP B 85  ? 1.4662 1.6416 1.4256 0.0231  -0.0613 0.0647  85   ASP B CG  
2697 O OD1 . ASP B 85  ? 1.5047 1.6558 1.4555 0.0254  -0.0608 0.0475  85   ASP B OD1 
2698 O OD2 . ASP B 85  ? 1.5253 1.7504 1.4853 0.0223  -0.0615 0.0737  85   ASP B OD2 
2699 N N   . ALA B 86  ? 1.2958 1.3749 1.3052 0.0202  -0.0658 0.0703  86   ALA B N   
2700 C CA  . ALA B 86  ? 1.2589 1.3259 1.2938 0.0200  -0.0686 0.0694  86   ALA B CA  
2701 C C   . ALA B 86  ? 1.2070 1.2548 1.2266 0.0234  -0.0665 0.0467  86   ALA B C   
2702 O O   . ALA B 86  ? 1.1757 1.2196 1.2020 0.0246  -0.0671 0.0407  86   ALA B O   
2703 C CB  . ALA B 86  ? 1.2968 1.3612 1.3735 0.0177  -0.0740 0.0783  86   ALA B CB  
2704 N N   . PHE B 87  ? 1.1925 1.2335 1.1934 0.0245  -0.0644 0.0366  87   PHE B N   
2705 C CA  . PHE B 87  ? 1.1427 1.1768 1.1297 0.0266  -0.0626 0.0218  87   PHE B CA  
2706 C C   . PHE B 87  ? 1.1059 1.1401 1.0733 0.0279  -0.0605 0.0208  87   PHE B C   
2707 O O   . PHE B 87  ? 1.0728 1.1070 1.0399 0.0290  -0.0602 0.0153  87   PHE B O   
2708 C CB  . PHE B 87  ? 1.1602 1.1920 1.1364 0.0265  -0.0616 0.0182  87   PHE B CB  
2709 C CG  . PHE B 87  ? 1.1127 1.1474 1.0776 0.0276  -0.0604 0.0099  87   PHE B CG  
2710 C CD1 . PHE B 87  ? 1.1006 1.1464 1.0759 0.0285  -0.0612 -0.0014 87   PHE B CD1 
2711 C CD2 . PHE B 87  ? 1.0780 1.1112 1.0281 0.0277  -0.0594 0.0136  87   PHE B CD2 
2712 C CE1 . PHE B 87  ? 1.0820 1.1443 1.0470 0.0289  -0.0601 -0.0050 87   PHE B CE1 
2713 C CE2 . PHE B 87  ? 1.0499 1.0926 0.9961 0.0275  -0.0593 0.0138  87   PHE B CE2 
2714 C CZ  . PHE B 87  ? 1.0400 1.1007 0.9906 0.0277  -0.0591 0.0065  87   PHE B CZ  
2715 N N   . PHE B 88  ? 1.1090 1.1465 1.0641 0.0281  -0.0597 0.0239  88   PHE B N   
2716 C CA  . PHE B 88  ? 1.0764 1.1147 1.0222 0.0297  -0.0592 0.0201  88   PHE B CA  
2717 C C   . PHE B 88  ? 1.0513 1.0954 1.0005 0.0300  -0.0591 0.0231  88   PHE B C   
2718 O O   . PHE B 88  ? 1.0358 1.0770 0.9808 0.0312  -0.0589 0.0191  88   PHE B O   
2719 C CB  . PHE B 88  ? 1.1045 1.1509 1.0464 0.0309  -0.0599 0.0160  88   PHE B CB  
2720 C CG  . PHE B 88  ? 1.1533 1.1918 1.0958 0.0308  -0.0609 0.0131  88   PHE B CG  
2721 C CD1 . PHE B 88  ? 1.1405 1.1693 1.0842 0.0298  -0.0610 0.0151  88   PHE B CD1 
2722 C CD2 . PHE B 88  ? 1.2176 1.2650 1.1613 0.0314  -0.0618 0.0090  88   PHE B CD2 
2723 C CE1 . PHE B 88  ? 1.1695 1.1950 1.1165 0.0291  -0.0623 0.0162  88   PHE B CE1 
2724 C CE2 . PHE B 88  ? 1.2357 1.2748 1.1832 0.0311  -0.0631 0.0070  88   PHE B CE2 
2725 C CZ  . PHE B 88  ? 1.2268 1.2537 1.1765 0.0297  -0.0635 0.0122  88   PHE B CZ  
2726 N N   . PHE B 89  ? 1.0534 1.1073 1.0144 0.0283  -0.0600 0.0332  89   PHE B N   
2727 C CA  . PHE B 89  ? 1.0149 1.0753 0.9847 0.0279  -0.0606 0.0393  89   PHE B CA  
2728 C C   . PHE B 89  ? 0.9894 1.0357 0.9670 0.0287  -0.0611 0.0314  89   PHE B C   
2729 O O   . PHE B 89  ? 0.9713 1.0171 0.9450 0.0298  -0.0605 0.0287  89   PHE B O   
2730 C CB  . PHE B 89  ? 1.0255 1.1023 1.0179 0.0248  -0.0631 0.0579  89   PHE B CB  
2731 C CG  . PHE B 89  ? 0.9489 1.0323 0.9568 0.0240  -0.0647 0.0668  89   PHE B CG  
2732 C CD1 . PHE B 89  ? 0.8816 0.9803 0.8738 0.0251  -0.0628 0.0668  89   PHE B CD1 
2733 C CD2 . PHE B 89  ? 0.8982 0.9726 0.9408 0.0225  -0.0688 0.0717  89   PHE B CD2 
2734 C CE1 . PHE B 89  ? 0.8947 0.9999 0.9008 0.0242  -0.0643 0.0760  89   PHE B CE1 
2735 C CE2 . PHE B 89  ? 0.8781 0.9576 0.9410 0.0217  -0.0712 0.0802  89   PHE B CE2 
2736 C CZ  . PHE B 89  ? 0.8905 0.9848 0.9324 0.0222  -0.0685 0.0840  89   PHE B CZ  
2737 N N   . SER B 90  ? 0.9969 1.0370 0.9876 0.0285  -0.0625 0.0258  90   SER B N   
2738 C CA  . SER B 90  ? 0.9836 1.0221 0.9844 0.0301  -0.0633 0.0125  90   SER B CA  
2739 C C   . SER B 90  ? 0.9598 0.9998 0.9359 0.0315  -0.0605 0.0068  90   SER B C   
2740 O O   . SER B 90  ? 0.9384 0.9813 0.9136 0.0325  -0.0602 0.0034  90   SER B O   
2741 C CB  . SER B 90  ? 1.0003 1.0407 1.0168 0.0304  -0.0652 0.0024  90   SER B CB  
2742 O OG  . SER B 90  ? 0.9967 1.0482 1.0220 0.0328  -0.0661 -0.0158 90   SER B OG  
2743 N N   . VAL B 91  ? 0.9601 0.9992 0.9212 0.0311  -0.0592 0.0082  91   VAL B N   
2744 C CA  . VAL B 91  ? 0.9398 0.9821 0.8883 0.0315  -0.0583 0.0093  91   VAL B CA  
2745 C C   . VAL B 91  ? 0.9285 0.9677 0.8733 0.0323  -0.0581 0.0117  91   VAL B C   
2746 O O   . VAL B 91  ? 0.9235 0.9691 0.8669 0.0326  -0.0580 0.0115  91   VAL B O   
2747 C CB  . VAL B 91  ? 0.9556 0.9943 0.8987 0.0306  -0.0588 0.0144  91   VAL B CB  
2748 C CG1 . VAL B 91  ? 0.9382 0.9781 0.8822 0.0306  -0.0601 0.0199  91   VAL B CG1 
2749 C CG2 . VAL B 91  ? 0.9728 1.0201 0.9172 0.0297  -0.0587 0.0132  91   VAL B CG2 
2750 N N   . GLN B 92  ? 0.9435 0.9792 0.8876 0.0326  -0.0583 0.0141  92   GLN B N   
2751 C CA  . GLN B 92  ? 0.9385 0.9753 0.8800 0.0338  -0.0584 0.0137  92   GLN B CA  
2752 C C   . GLN B 92  ? 0.9260 0.9646 0.8711 0.0340  -0.0579 0.0140  92   GLN B C   
2753 O O   . GLN B 92  ? 0.9245 0.9640 0.8669 0.0350  -0.0578 0.0133  92   GLN B O   
2754 C CB  . GLN B 92  ? 0.9632 1.0088 0.9037 0.0346  -0.0588 0.0131  92   GLN B CB  
2755 C CG  . GLN B 92  ? 0.9916 1.0378 0.9329 0.0351  -0.0600 0.0090  92   GLN B CG  
2756 C CD  . GLN B 92  ? 1.0362 1.1034 0.9778 0.0366  -0.0606 0.0037  92   GLN B CD  
2757 O OE1 . GLN B 92  ? 1.0654 1.1373 1.0094 0.0372  -0.0617 -0.0013 92   GLN B OE1 
2758 N NE2 . GLN B 92  ? 1.0292 1.1154 0.9694 0.0374  -0.0601 0.0042  92   GLN B NE2 
2759 N N   . THR B 93  ? 0.9198 0.9593 0.8766 0.0331  -0.0584 0.0140  93   THR B N   
2760 C CA  . THR B 93  ? 0.9136 0.9550 0.8842 0.0334  -0.0594 0.0123  93   THR B CA  
2761 C C   . THR B 93  ? 0.8910 0.9383 0.8605 0.0348  -0.0591 0.0011  93   THR B C   
2762 O O   . THR B 93  ? 0.8710 0.9223 0.8390 0.0357  -0.0587 -0.0017 93   THR B O   
2763 C CB  . THR B 93  ? 0.9402 0.9825 0.9384 0.0321  -0.0625 0.0159  93   THR B CB  
2764 O OG1 . THR B 93  ? 0.9846 1.0326 0.9836 0.0300  -0.0629 0.0314  93   THR B OG1 
2765 C CG2 . THR B 93  ? 0.9394 0.9834 0.9651 0.0325  -0.0656 0.0126  93   THR B CG2 
2766 N N   . MET B 94  ? 0.8856 0.9400 0.8554 0.0348  -0.0591 -0.0048 94   MET B N   
2767 C CA  . MET B 94  ? 0.8682 0.9435 0.8395 0.0361  -0.0590 -0.0161 94   MET B CA  
2768 C C   . MET B 94  ? 0.8403 0.9234 0.7944 0.0354  -0.0575 -0.0071 94   MET B C   
2769 O O   . MET B 94  ? 0.8236 0.9235 0.7781 0.0363  -0.0572 -0.0113 94   MET B O   
2770 C CB  . MET B 94  ? 0.8845 0.9750 0.8618 0.0363  -0.0597 -0.0251 94   MET B CB  
2771 C CG  . MET B 94  ? 0.9030 1.0311 0.8876 0.0385  -0.0602 -0.0428 94   MET B CG  
2772 S SD  . MET B 94  ? 0.9722 1.1266 0.9598 0.0387  -0.0607 -0.0524 94   MET B SD  
2773 C CE  . MET B 94  ? 0.9262 1.0938 0.8864 0.0352  -0.0580 -0.0267 94   MET B CE  
2774 N N   . ALA B 95  ? 0.8230 0.8961 0.7681 0.0339  -0.0573 0.0051  95   ALA B N   
2775 C CA  . ALA B 95  ? 0.8041 0.8827 0.7460 0.0329  -0.0579 0.0163  95   ALA B CA  
2776 C C   . ALA B 95  ? 0.8096 0.8754 0.7510 0.0341  -0.0579 0.0160  95   ALA B C   
2777 O O   . ALA B 95  ? 0.8092 0.8793 0.7530 0.0337  -0.0591 0.0235  95   ALA B O   
2778 C CB  . ALA B 95  ? 0.7956 0.8665 0.7412 0.0314  -0.0599 0.0272  95   ALA B CB  
2779 N N   . THR B 96  ? 0.8174 0.8709 0.7593 0.0352  -0.0573 0.0100  96   THR B N   
2780 C CA  . THR B 96  ? 0.8258 0.8722 0.7668 0.0362  -0.0573 0.0105  96   THR B CA  
2781 C C   . THR B 96  ? 0.8500 0.8900 0.7912 0.0368  -0.0588 0.0128  96   THR B C   
2782 O O   . THR B 96  ? 0.8723 0.9117 0.8159 0.0378  -0.0596 0.0123  96   THR B O   
2783 C CB  . THR B 96  ? 0.8224 0.8777 0.7633 0.0367  -0.0570 0.0097  96   THR B CB  
2784 O OG1 . THR B 96  ? 0.7986 0.8565 0.7406 0.0361  -0.0584 0.0177  96   THR B OG1 
2785 C CG2 . THR B 96  ? 0.7657 0.8397 0.7105 0.0369  -0.0565 0.0023  96   THR B CG2 
2786 N N   . ILE B 97  ? 0.8643 0.9015 0.8076 0.0366  -0.0598 0.0125  97   ILE B N   
2787 C CA  . ILE B 97  ? 0.8994 0.9357 0.8513 0.0383  -0.0625 0.0074  97   ILE B CA  
2788 C C   . ILE B 97  ? 0.9391 0.9859 0.8867 0.0401  -0.0616 0.0003  97   ILE B C   
2789 O O   . ILE B 97  ? 0.9674 1.0224 0.9220 0.0426  -0.0635 -0.0088 97   ILE B O   
2790 C CB  . ILE B 97  ? 0.9090 0.9429 0.8689 0.0379  -0.0646 0.0068  97   ILE B CB  
2791 C CG1 . ILE B 97  ? 0.8763 0.9090 0.8449 0.0355  -0.0664 0.0184  97   ILE B CG1 
2792 C CG2 . ILE B 97  ? 0.9274 0.9649 0.9046 0.0408  -0.0687 -0.0053 97   ILE B CG2 
2793 C CD1 . ILE B 97  ? 0.8667 0.8984 0.8399 0.0342  -0.0675 0.0217  97   ILE B CD1 
2794 N N   . GLY B 98  ? 0.9472 0.9995 0.8877 0.0386  -0.0594 0.0056  98   GLY B N   
2795 C CA  . GLY B 98  ? 0.9809 1.0526 0.9197 0.0388  -0.0586 0.0077  98   GLY B CA  
2796 C C   . GLY B 98  ? 1.0263 1.1215 0.9669 0.0416  -0.0601 -0.0038 98   GLY B C   
2797 O O   . GLY B 98  ? 1.0471 1.1610 0.9879 0.0434  -0.0602 -0.0084 98   GLY B O   
2798 N N   . TYR B 99  ? 1.0476 1.1466 0.9921 0.0426  -0.0615 -0.0116 99   TYR B N   
2799 C CA  . TYR B 99  ? 1.1017 1.2310 1.0539 0.0464  -0.0639 -0.0300 99   TYR B CA  
2800 C C   . TYR B 99  ? 1.1380 1.3104 1.0827 0.0464  -0.0621 -0.0258 99   TYR B C   
2801 O O   . TYR B 99  ? 1.1656 1.3644 1.1145 0.0496  -0.0633 -0.0395 99   TYR B O   
2802 C CB  . TYR B 99  ? 1.1163 1.2502 1.0741 0.0471  -0.0655 -0.0376 99   TYR B CB  
2803 C CG  . TYR B 99  ? 1.0820 1.1848 1.0555 0.0475  -0.0690 -0.0427 99   TYR B CG  
2804 C CD1 . TYR B 99  ? 1.0431 1.1264 1.0124 0.0446  -0.0680 -0.0313 99   TYR B CD1 
2805 C CD2 . TYR B 99  ? 1.0703 1.1667 1.0686 0.0505  -0.0741 -0.0567 99   TYR B CD2 
2806 C CE1 . TYR B 99  ? 1.0415 1.1036 1.0280 0.0442  -0.0716 -0.0307 99   TYR B CE1 
2807 C CE2 . TYR B 99  ? 1.0556 1.1279 1.0776 0.0498  -0.0787 -0.0541 99   TYR B CE2 
2808 C CZ  . TYR B 99  ? 1.0473 1.1046 1.0615 0.0464  -0.0771 -0.0395 99   TYR B CZ  
2809 O OH  . TYR B 99  ? 1.0778 1.1185 1.1163 0.0448  -0.0818 -0.0316 99   TYR B OH  
2810 N N   . GLY B 100 ? 1.1439 1.3278 1.0823 0.0425  -0.0600 -0.0052 100  GLY B N   
2811 C CA  . GLY B 100 ? 1.1898 1.4164 1.1270 0.0406  -0.0590 0.0096  100  GLY B CA  
2812 C C   . GLY B 100 ? 1.2428 1.5224 1.1801 0.0400  -0.0591 0.0142  100  GLY B C   
2813 O O   . GLY B 100 ? 1.2680 1.5967 1.2070 0.0378  -0.0588 0.0310  100  GLY B O   
2814 N N   . LYS B 101 ? 1.3743 1.3286 1.2314 -0.0554 -0.0934 0.0541  101  LYS B N   
2815 C CA  . LYS B 101 ? 1.4509 1.4077 1.2975 -0.0687 -0.1150 0.0654  101  LYS B CA  
2816 C C   . LYS B 101 ? 1.4116 1.3859 1.2951 -0.0690 -0.1184 0.0890  101  LYS B C   
2817 O O   . LYS B 101 ? 1.4507 1.4356 1.3248 -0.0739 -0.1227 0.1021  101  LYS B O   
2818 C CB  . LYS B 101 ? 1.4785 1.4241 1.3360 -0.0761 -0.1324 0.0618  101  LYS B CB  
2819 C CG  . LYS B 101 ? 1.5630 1.5139 1.4290 -0.0902 -0.1587 0.0791  101  LYS B CG  
2820 C CD  . LYS B 101 ? 1.7316 1.6707 1.5484 -0.1025 -0.1762 0.0658  101  LYS B CD  
2821 C CE  . LYS B 101 ? 1.8226 1.7610 1.6558 -0.1174 -0.2068 0.0783  101  LYS B CE  
2822 N NZ  . LYS B 101 ? 1.9821 1.9174 1.7609 -0.1319 -0.2278 0.0717  101  LYS B NZ  
2823 N N   . LEU B 102 ? 1.3465 1.3250 1.2748 -0.0632 -0.1152 0.0951  102  LEU B N   
2824 C CA  . LEU B 102 ? 1.3123 1.3054 1.2812 -0.0602 -0.1135 0.1124  102  LEU B CA  
2825 C C   . LEU B 102 ? 1.2732 1.2700 1.2431 -0.0490 -0.0939 0.1050  102  LEU B C   
2826 O O   . LEU B 102 ? 1.2445 1.2359 1.2067 -0.0401 -0.0797 0.0893  102  LEU B O   
2827 C CB  . LEU B 102 ? 1.2632 1.2603 1.2779 -0.0564 -0.1140 0.1191  102  LEU B CB  
2828 C CG  . LEU B 102 ? 1.3063 1.2996 1.3300 -0.0675 -0.1346 0.1284  102  LEU B CG  
2829 C CD1 . LEU B 102 ? 1.2516 1.2515 1.3235 -0.0615 -0.1304 0.1365  102  LEU B CD1 
2830 C CD2 . LEU B 102 ? 1.3708 1.3707 1.3963 -0.0813 -0.1566 0.1482  102  LEU B CD2 
2831 N N   . ILE B 103 ? 1.2905 1.2974 1.2732 -0.0501 -0.0946 0.1181  103  ILE B N   
2832 C CA  . ILE B 103 ? 1.2555 1.2661 1.2491 -0.0405 -0.0791 0.1130  103  ILE B CA  
2833 C C   . ILE B 103 ? 1.2590 1.2812 1.2982 -0.0408 -0.0831 0.1305  103  ILE B C   
2834 O O   . ILE B 103 ? 1.2970 1.3259 1.3530 -0.0496 -0.0978 0.1496  103  ILE B O   
2835 C CB  . ILE B 103 ? 1.2898 1.2990 1.2449 -0.0411 -0.0725 0.1087  103  ILE B CB  
2836 C CG1 . ILE B 103 ? 1.3767 1.3940 1.3118 -0.0530 -0.0857 0.1268  103  ILE B CG1 
2837 C CG2 . ILE B 103 ? 1.2786 1.2749 1.1980 -0.0379 -0.0644 0.0882  103  ILE B CG2 
2838 C CD1 . ILE B 103 ? 1.4188 1.4442 1.3343 -0.0521 -0.0766 0.1330  103  ILE B CD1 
2839 N N   . PRO B 104 ? 1.2276 1.2519 1.2911 -0.0315 -0.0714 0.1240  104  PRO B N   
2840 C CA  . PRO B 104 ? 1.2398 1.2725 1.3547 -0.0304 -0.0742 0.1373  104  PRO B CA  
2841 C C   . PRO B 104 ? 1.2926 1.3340 1.4082 -0.0364 -0.0788 0.1559  104  PRO B C   
2842 O O   . PRO B 104 ? 1.2950 1.3353 1.3741 -0.0364 -0.0726 0.1515  104  PRO B O   
2843 C CB  . PRO B 104 ? 1.1899 1.2188 1.3246 -0.0176 -0.0602 0.1163  104  PRO B CB  
2844 C CG  . PRO B 104 ? 1.1554 1.1781 1.2461 -0.0147 -0.0515 0.1014  104  PRO B CG  
2845 C CD  . PRO B 104 ? 1.1788 1.1970 1.2277 -0.0216 -0.0565 0.1028  104  PRO B CD  
2846 N N   . ILE B 105 ? 1.3352 1.3870 1.4966 -0.0410 -0.0884 0.1786  105  ILE B N   
2847 C CA  . ILE B 105 ? 1.3991 1.4630 1.5684 -0.0464 -0.0922 0.2008  105  ILE B CA  
2848 C C   . ILE B 105 ? 1.4102 1.4789 1.6475 -0.0417 -0.0911 0.2095  105  ILE B C   
2849 O O   . ILE B 105 ? 1.4208 1.4934 1.6654 -0.0397 -0.0861 0.2134  105  ILE B O   
2850 C CB  . ILE B 105 ? 1.4700 1.5468 1.6186 -0.0605 -0.1083 0.2284  105  ILE B CB  
2851 C CG1 . ILE B 105 ? 1.4781 1.5539 1.6477 -0.0654 -0.1213 0.2345  105  ILE B CG1 
2852 C CG2 . ILE B 105 ? 1.4967 1.5701 1.5701 -0.0640 -0.1049 0.2181  105  ILE B CG2 
2853 C CD1 . ILE B 105 ? 1.5325 1.6176 1.6682 -0.0805 -0.1403 0.2548  105  ILE B CD1 
2854 N N   . GLY B 106 ? 1.4157 1.4839 1.7073 -0.0394 -0.0952 0.2120  106  GLY B N   
2855 C CA  . GLY B 106 ? 1.4435 1.5129 1.8051 -0.0338 -0.0938 0.2150  106  GLY B CA  
2856 C C   . GLY B 106 ? 1.4113 1.4698 1.7685 -0.0235 -0.0813 0.1869  106  GLY B C   
2857 O O   . GLY B 106 ? 1.3704 1.4203 1.6761 -0.0191 -0.0725 0.1636  106  GLY B O   
2858 N N   . PRO B 107 ? 1.4427 1.5021 1.8570 -0.0206 -0.0823 0.1907  107  PRO B N   
2859 C CA  . PRO B 107 ? 1.4080 1.4541 1.8290 -0.0098 -0.0733 0.1570  107  PRO B CA  
2860 C C   . PRO B 107 ? 1.3835 1.4207 1.8213 -0.0011 -0.0677 0.1322  107  PRO B C   
2861 O O   . PRO B 107 ? 1.3613 1.3888 1.7864 0.0081  -0.0591 0.0999  107  PRO B O   
2862 C CB  . PRO B 107 ? 1.4588 1.5074 1.9481 -0.0100 -0.0791 0.1690  107  PRO B CB  
2863 C CG  . PRO B 107 ? 1.5067 1.5733 2.0043 -0.0212 -0.0879 0.2118  107  PRO B CG  
2864 C CD  . PRO B 107 ? 1.5073 1.5802 1.9766 -0.0273 -0.0923 0.2249  107  PRO B CD  
2865 N N   . LEU B 108 ? 1.3967 1.4397 1.8631 -0.0042 -0.0725 0.1492  108  LEU B N   
2866 C CA  . LEU B 108 ? 1.3809 1.4190 1.8646 0.0041  -0.0648 0.1307  108  LEU B CA  
2867 C C   . LEU B 108 ? 1.3165 1.3524 1.7326 0.0065  -0.0568 0.1146  108  LEU B C   
2868 O O   . LEU B 108 ? 1.2913 1.3215 1.6947 0.0170  -0.0449 0.0855  108  LEU B O   
2869 C CB  . LEU B 108 ? 1.4273 1.4742 1.9646 -0.0008 -0.0729 0.1587  108  LEU B CB  
2870 C CG  . LEU B 108 ? 1.4974 1.5484 2.1172 -0.0030 -0.0813 0.1791  108  LEU B CG  
2871 C CD1 . LEU B 108 ? 1.5247 1.5832 2.2026 -0.0051 -0.0863 0.2013  108  LEU B CD1 
2872 C CD2 . LEU B 108 ? 1.5055 1.5436 2.1660 0.0083  -0.0736 0.1482  108  LEU B CD2 
2873 N N   . ALA B 109 ? 1.2965 1.3376 1.6698 -0.0033 -0.0639 0.1338  109  ALA B N   
2874 C CA  . ALA B 109 ? 1.2444 1.2825 1.5593 -0.0023 -0.0583 0.1210  109  ALA B CA  
2875 C C   . ALA B 109 ? 1.1993 1.2303 1.4737 0.0048  -0.0478 0.0940  109  ALA B C   
2876 O O   . ALA B 109 ? 1.1655 1.1945 1.4215 0.0126  -0.0379 0.0739  109  ALA B O   
2877 C CB  . ALA B 109 ? 1.2459 1.2883 1.5228 -0.0151 -0.0699 0.1432  109  ALA B CB  
2878 N N   . ASN B 110 ? 1.1955 1.2254 1.4597 0.0019  -0.0500 0.0966  110  ASN B N   
2879 C CA  . ASN B 110 ? 1.1610 1.1853 1.3957 0.0077  -0.0423 0.0750  110  ASN B CA  
2880 C C   . ASN B 110 ? 1.1575 1.1777 1.4172 0.0183  -0.0360 0.0485  110  ASN B C   
2881 O O   . ASN B 110 ? 1.1335 1.1511 1.3646 0.0234  -0.0303 0.0285  110  ASN B O   
2882 C CB  . ASN B 110 ? 1.1810 1.2068 1.4113 0.0028  -0.0456 0.0867  110  ASN B CB  
2883 C CG  . ASN B 110 ? 1.1880 1.2174 1.3737 -0.0051 -0.0472 0.1032  110  ASN B CG  
2884 O OD1 . ASN B 110 ? 1.2591 1.2941 1.4459 -0.0127 -0.0549 0.1230  110  ASN B OD1 
2885 N ND2 . ASN B 110 ? 1.1509 1.1772 1.2972 -0.0038 -0.0405 0.0946  110  ASN B ND2 
2886 N N   . THR B 111 ? 1.1849 1.2051 1.4989 0.0215  -0.0375 0.0480  111  THR B N   
2887 C CA  . THR B 111 ? 1.1916 1.2070 1.5280 0.0323  -0.0310 0.0182  111  THR B CA  
2888 C C   . THR B 111 ? 1.1648 1.1842 1.4778 0.0399  -0.0194 0.0035  111  THR B C   
2889 O O   . THR B 111 ? 1.1536 1.1732 1.4418 0.0477  -0.0115 -0.0220 111  THR B O   
2890 C CB  . THR B 111 ? 1.2490 1.2613 1.6577 0.0344  -0.0349 0.0197  111  THR B CB  
2891 O OG1 . THR B 111 ? 1.2696 1.2771 1.7030 0.0316  -0.0433 0.0201  111  THR B OG1 
2892 C CG2 . THR B 111 ? 1.2652 1.2741 1.6924 0.0471  -0.0240 -0.0121 111  THR B CG2 
2893 N N   . LEU B 112 ? 1.1575 1.1823 1.4792 0.0369  -0.0192 0.0225  112  LEU B N   
2894 C CA  . LEU B 112 ? 1.1348 1.1662 1.4412 0.0435  -0.0079 0.0154  112  LEU B CA  
2895 C C   . LEU B 112 ? 1.0785 1.1124 1.3234 0.0425  -0.0047 0.0108  112  LEU B C   
2896 O O   . LEU B 112 ? 1.0697 1.1098 1.2940 0.0510  0.0065  -0.0062 112  LEU B O   
2897 C CB  . LEU B 112 ? 1.1473 1.1841 1.4823 0.0383  -0.0119 0.0416  112  LEU B CB  
2898 C CG  . LEU B 112 ? 1.2046 1.2417 1.6104 0.0422  -0.0113 0.0455  112  LEU B CG  
2899 C CD1 . LEU B 112 ? 1.2235 1.2664 1.6614 0.0324  -0.0226 0.0804  112  LEU B CD1 
2900 C CD2 . LEU B 112 ? 1.2076 1.2477 1.6314 0.0577  0.0072  0.0192  112  LEU B CD2 
2901 N N   . VAL B 113 ? 1.0455 1.0760 1.2630 0.0324  -0.0140 0.0266  113  VAL B N   
2902 C CA  . VAL B 113 ? 0.9947 1.0253 1.1620 0.0312  -0.0116 0.0225  113  VAL B CA  
2903 C C   . VAL B 113 ? 0.9870 1.0185 1.1379 0.0389  -0.0051 -0.0012 113  VAL B C   
2904 O O   . VAL B 113 ? 0.9578 0.9957 1.0785 0.0429  0.0016  -0.0087 113  VAL B O   
2905 C CB  . VAL B 113 ? 0.9951 1.0200 1.1399 0.0211  -0.0206 0.0371  113  VAL B CB  
2906 C CG1 . VAL B 113 ? 0.9704 0.9936 1.0745 0.0225  -0.0162 0.0268  113  VAL B CG1 
2907 C CG2 . VAL B 113 ? 0.9888 1.0141 1.1275 0.0122  -0.0283 0.0577  113  VAL B CG2 
2908 N N   . THR B 114 ? 1.0104 1.0367 1.1834 0.0401  -0.0090 -0.0111 114  THR B N   
2909 C CA  . THR B 114 ? 1.0098 1.0362 1.1692 0.0455  -0.0073 -0.0336 114  THR B CA  
2910 C C   . THR B 114 ? 1.0233 1.0576 1.1807 0.0559  0.0030  -0.0547 114  THR B C   
2911 O O   . THR B 114 ? 1.0123 1.0544 1.1360 0.0601  0.0075  -0.0677 114  THR B O   
2912 C CB  . THR B 114 ? 1.0490 1.0672 1.2420 0.0439  -0.0160 -0.0391 114  THR B CB  
2913 O OG1 . THR B 114 ? 1.0298 1.0451 1.2135 0.0357  -0.0223 -0.0208 114  THR B OG1 
2914 C CG2 . THR B 114 ? 1.0747 1.0924 1.2618 0.0500  -0.0165 -0.0677 114  THR B CG2 
2915 N N   . LEU B 115 ? 1.0512 1.0857 1.2455 0.0603  0.0075  -0.0562 115  LEU B N   
2916 C CA  . LEU B 115 ? 1.0795 1.1234 1.2747 0.0718  0.0213  -0.0754 115  LEU B CA  
2917 C C   . LEU B 115 ? 1.0346 1.0931 1.1954 0.0735  0.0309  -0.0643 115  LEU B C   
2918 O O   . LEU B 115 ? 1.0423 1.1138 1.1778 0.0817  0.0417  -0.0791 115  LEU B O   
2919 C CB  . LEU B 115 ? 1.1247 1.1656 1.3756 0.0761  0.0254  -0.0749 115  LEU B CB  
2920 C CG  . LEU B 115 ? 1.2107 1.2541 1.4791 0.0897  0.0381  -0.1070 115  LEU B CG  
2921 C CD1 . LEU B 115 ? 1.2770 1.3154 1.6118 0.0939  0.0421  -0.1045 115  LEU B CD1 
2922 C CD2 . LEU B 115 ? 1.2278 1.2893 1.4571 0.0986  0.0548  -0.1150 115  LEU B CD2 
2923 N N   . GLU B 116 ? 0.9936 1.0510 1.1542 0.0654  0.0261  -0.0375 116  GLU B N   
2924 C CA  . GLU B 116 ? 0.9607 1.0303 1.1017 0.0662  0.0332  -0.0243 116  GLU B CA  
2925 C C   . GLU B 116 ? 0.9343 1.0092 1.0303 0.0649  0.0329  -0.0267 116  GLU B C   
2926 O O   . GLU B 116 ? 0.9218 1.0115 0.9998 0.0687  0.0413  -0.0217 116  GLU B O   
2927 C CB  . GLU B 116 ? 0.9382 1.0026 1.0947 0.0565  0.0245  0.0027  116  GLU B CB  
2928 C CG  . GLU B 116 ? 0.9393 1.0167 1.1027 0.0595  0.0326  0.0161  116  GLU B CG  
2929 C CD  . GLU B 116 ? 0.9531 1.0248 1.1307 0.0484  0.0201  0.0416  116  GLU B CD  
2930 O OE1 . GLU B 116 ? 0.9675 1.0270 1.1516 0.0392  0.0066  0.0487  116  GLU B OE1 
2931 O OE2 . GLU B 116 ? 0.9573 1.0381 1.1402 0.0483  0.0230  0.0557  116  GLU B OE2 
2932 N N   . ALA B 117 ? 0.9341 0.9986 1.0169 0.0597  0.0233  -0.0318 117  ALA B N   
2933 C CA  . ALA B 117 ? 0.9163 0.9852 0.9638 0.0581  0.0219  -0.0325 117  ALA B CA  
2934 C C   . ALA B 117 ? 0.9398 1.0234 0.9699 0.0669  0.0292  -0.0521 117  ALA B C   
2935 O O   . ALA B 117 ? 0.9347 1.0333 0.9395 0.0688  0.0339  -0.0476 117  ALA B O   
2936 C CB  . ALA B 117 ? 0.9178 0.9731 0.9627 0.0511  0.0112  -0.0322 117  ALA B CB  
2937 N N   . LEU B 118 ? 0.9825 1.0624 1.0273 0.0717  0.0289  -0.0740 118  LEU B N   
2938 C CA  . LEU B 118 ? 1.0245 1.1178 1.0499 0.0803  0.0349  -0.0978 118  LEU B CA  
2939 C C   . LEU B 118 ? 1.0332 1.1474 1.0492 0.0888  0.0519  -0.0934 118  LEU B C   
2940 O O   . LEU B 118 ? 1.0485 1.1828 1.0314 0.0926  0.0576  -0.0952 118  LEU B O   
2941 C CB  . LEU B 118 ? 1.0774 1.1593 1.1285 0.0844  0.0318  -0.1246 118  LEU B CB  
2942 C CG  . LEU B 118 ? 1.1434 1.2344 1.1701 0.0912  0.0324  -0.1561 118  LEU B CG  
2943 C CD1 . LEU B 118 ? 1.1316 1.2280 1.1239 0.0848  0.0206  -0.1531 118  LEU B CD1 
2944 C CD2 . LEU B 118 ? 1.1930 1.2677 1.2536 0.0941  0.0265  -0.1840 118  LEU B CD2 
2945 N N   . CYS B 119 ? 1.0236 1.1361 1.0711 0.0914  0.0598  -0.0837 119  CYS B N   
2946 C CA  . CYS B 119 ? 1.0321 1.1662 1.0779 0.1001  0.0774  -0.0768 119  CYS B CA  
2947 C C   . CYS B 119 ? 0.9887 1.1386 1.0107 0.0968  0.0790  -0.0526 119  CYS B C   
2948 O O   . CYS B 119 ? 1.0031 1.1778 1.0054 0.1042  0.0919  -0.0512 119  CYS B O   
2949 C CB  . CYS B 119 ? 1.0383 1.1669 1.1301 0.1015  0.0828  -0.0645 119  CYS B CB  
2950 S SG  . CYS B 119 ? 1.1449 1.2600 1.2739 0.1085  0.0854  -0.0932 119  CYS B SG  
2951 N N   . GLY B 120 ? 0.9453 1.0820 0.9718 0.0858  0.0665  -0.0322 120  GLY B N   
2952 C CA  . GLY B 120 ? 0.9065 1.0554 0.9186 0.0823  0.0668  -0.0098 120  GLY B CA  
2953 C C   . GLY B 120 ? 0.9215 1.0865 0.8975 0.0847  0.0676  -0.0171 120  GLY B C   
2954 O O   . GLY B 120 ? 0.9170 1.1060 0.8805 0.0879  0.0755  -0.0027 120  GLY B O   
2955 N N   . MET B 121 ? 0.9439 0.9638 0.8187 -0.0264 0.0154  0.0206  121  MET B N   
2956 C CA  A MET B 121 ? 0.9337 0.9528 0.8341 -0.0067 0.0310  0.0174  121  MET B CA  
2957 C CA  B MET B 121 ? 0.9286 0.9489 0.8306 -0.0064 0.0309  0.0178  121  MET B CA  
2958 C C   . MET B 121 ? 0.9049 0.9451 0.8462 -0.0091 0.0182  0.0176  121  MET B C   
2959 O O   . MET B 121 ? 0.9063 0.9384 0.8501 -0.0073 0.0197  0.0124  121  MET B O   
2960 C CB  A MET B 121 ? 0.9414 0.9751 0.8610 0.0099  0.0483  0.0318  121  MET B CB  
2961 C CB  B MET B 121 ? 0.9301 0.9698 0.8563 0.0086  0.0449  0.0328  121  MET B CB  
2962 C CG  A MET B 121 ? 1.0151 1.0075 0.8915 0.0248  0.0827  0.0325  121  MET B CG  
2963 C CG  B MET B 121 ? 0.9250 0.9845 0.8921 0.0195  0.0518  0.0477  121  MET B CG  
2964 S SD  A MET B 121 ? 1.0911 1.0934 0.9727 0.0436  0.1099  0.0547  121  MET B SD  
2965 S SD  B MET B 121 ? 0.9484 1.0396 0.9541 0.0008  0.0278  0.0567  121  MET B SD  
2966 C CE  A MET B 121 ? 1.1229 1.0940 1.0104 0.0787  0.1643  0.0743  121  MET B CE  
2967 C CE  B MET B 121 ? 0.9242 1.0515 0.9651 0.0050  0.0329  0.0914  121  MET B CE  
2968 N N   . LEU B 122 ? 0.8987 0.9565 0.8655 -0.0133 0.0117  0.0248  122  LEU B N   
2969 C CA  . LEU B 122 ? 0.9075 0.9607 0.8907 -0.0166 0.0120  0.0222  122  LEU B CA  
2970 C C   . LEU B 122 ? 0.9004 0.9492 0.8802 -0.0200 0.0064  0.0194  122  LEU B C   
2971 O O   . LEU B 122 ? 0.9139 0.9524 0.8921 -0.0210 0.0078  0.0118  122  LEU B O   
2972 C CB  . LEU B 122 ? 0.9393 0.9907 0.9411 -0.0162 0.0213  0.0322  122  LEU B CB  
2973 C CG  . LEU B 122 ? 0.9703 1.0233 0.9750 -0.0178 0.0247  0.0376  122  LEU B CG  
2974 C CD1 . LEU B 122 ? 1.0420 1.0808 1.0638 -0.0147 0.0420  0.0491  122  LEU B CD1 
2975 C CD2 . LEU B 122 ? 0.9792 1.0213 0.9700 -0.0319 0.0203  0.0336  122  LEU B CD2 
2976 N N   . GLY B 123 ? 0.8855 0.9453 0.8622 -0.0276 -0.0039 0.0305  123  GLY B N   
2977 C CA  . GLY B 123 ? 0.8807 0.9436 0.8576 -0.0387 -0.0157 0.0373  123  GLY B CA  
2978 C C   . GLY B 123 ? 0.8811 0.9161 0.8265 -0.0416 -0.0172 0.0172  123  GLY B C   
2979 O O   . GLY B 123 ? 0.8875 0.9232 0.8461 -0.0420 -0.0189 0.0176  123  GLY B O   
2980 N N   . LEU B 124 ? 0.8901 0.8969 0.7956 -0.0408 -0.0100 0.0034  124  LEU B N   
2981 C CA  . LEU B 124 ? 0.9002 0.8742 0.7831 -0.0358 0.0010  -0.0097 124  LEU B CA  
2982 C C   . LEU B 124 ? 0.8781 0.8737 0.8028 -0.0215 0.0064  -0.0072 124  LEU B C   
2983 O O   . LEU B 124 ? 0.8712 0.8627 0.8019 -0.0222 0.0048  -0.0092 124  LEU B O   
2984 C CB  . LEU B 124 ? 0.9283 0.8643 0.7718 -0.0261 0.0256  -0.0158 124  LEU B CB  
2985 C CG  . LEU B 124 ? 0.9720 0.8719 0.8062 -0.0105 0.0520  -0.0190 124  LEU B CG  
2986 C CD1 . LEU B 124 ? 1.0161 0.8839 0.8191 -0.0302 0.0405  -0.0300 124  LEU B CD1 
2987 C CD2 . LEU B 124 ? 1.0687 0.9114 0.8529 0.0021  0.0912  -0.0212 124  LEU B CD2 
2988 N N   . ALA B 125 ? 0.8747 0.8916 0.8216 -0.0150 0.0100  -0.0001 125  ALA B N   
2989 C CA  . ALA B 125 ? 0.8792 0.9120 0.8482 -0.0164 0.0089  0.0072  125  ALA B CA  
2990 C C   . ALA B 125 ? 0.8921 0.9197 0.8600 -0.0260 0.0030  0.0009  125  ALA B C   
2991 O O   . ALA B 125 ? 0.9150 0.9438 0.8845 -0.0312 0.0002  0.0026  125  ALA B O   
2992 C CB  . ALA B 125 ? 0.8873 0.9364 0.8674 -0.0208 0.0079  0.0182  125  ALA B CB  
2993 N N   . VAL B 126 ? 0.8994 0.9230 0.8693 -0.0264 0.0053  0.0001  126  VAL B N   
2994 C CA  . VAL B 126 ? 0.9331 0.9471 0.9072 -0.0279 0.0123  0.0015  126  VAL B CA  
2995 C C   . VAL B 126 ? 0.9122 0.9322 0.8919 -0.0284 0.0034  0.0030  126  VAL B C   
2996 O O   . VAL B 126 ? 0.9474 0.9611 0.9253 -0.0304 0.0066  0.0013  126  VAL B O   
2997 C CB  . VAL B 126 ? 0.9604 0.9753 0.9548 -0.0204 0.0265  0.0159  126  VAL B CB  
2998 C CG1 . VAL B 126 ? 0.9837 1.0021 1.0000 -0.0147 0.0364  0.0311  126  VAL B CG1 
2999 C CG2 . VAL B 126 ? 1.0289 1.0116 1.0063 -0.0217 0.0480  0.0116  126  VAL B CG2 
3000 N N   . ALA B 127 ? 0.8753 0.9013 0.8522 -0.0326 -0.0087 0.0069  127  ALA B N   
3001 C CA  . ALA B 127 ? 0.8663 0.8894 0.8398 -0.0418 -0.0198 0.0100  127  ALA B CA  
3002 C C   . ALA B 127 ? 0.8615 0.8690 0.8252 -0.0377 -0.0154 -0.0021 127  ALA B C   
3003 O O   . ALA B 127 ? 0.8772 0.8843 0.8472 -0.0414 -0.0196 0.0009  127  ALA B O   
3004 C CB  . ALA B 127 ? 0.8665 0.8781 0.8094 -0.0612 -0.0360 0.0131  127  ALA B CB  
3005 N N   . ALA B 128 ? 0.8511 0.8531 0.8085 -0.0296 -0.0066 -0.0073 128  ALA B N   
3006 C CA  . ALA B 128 ? 0.8756 0.8730 0.8387 -0.0239 -0.0001 -0.0043 128  ALA B CA  
3007 C C   . ALA B 128 ? 0.9012 0.9213 0.8808 -0.0300 -0.0050 0.0031  128  ALA B C   
3008 O O   . ALA B 128 ? 0.9158 0.9404 0.9043 -0.0319 -0.0069 0.0093  128  ALA B O   
3009 C CB  . ALA B 128 ? 0.8716 0.8644 0.8369 -0.0107 0.0161  0.0034  128  ALA B CB  
3010 N N   . SER B 129 ? 0.9225 0.9473 0.8955 -0.0375 -0.0056 0.0024  129  SER B N   
3011 C CA  . SER B 129 ? 0.9846 1.0037 0.9407 -0.0537 -0.0058 0.0031  129  SER B CA  
3012 C C   . SER B 129 ? 1.0033 1.0117 0.9578 -0.0512 0.0001  -0.0003 129  SER B C   
3013 O O   . SER B 129 ? 1.0495 1.0585 0.9946 -0.0621 -0.0026 0.0040  129  SER B O   
3014 C CB  . SER B 129 ? 1.0299 1.0264 0.9607 -0.0624 0.0032  -0.0033 129  SER B CB  
3015 O OG  . SER B 129 ? 1.0708 1.0787 0.9949 -0.0789 -0.0079 0.0064  129  SER B OG  
3016 N N   . LEU B 130 ? 0.9752 0.9809 0.9435 -0.0397 0.0071  0.0000  130  LEU B N   
3017 C CA  . LEU B 130 ? 0.9960 1.0000 0.9758 -0.0355 0.0168  0.0088  130  LEU B CA  
3018 C C   . LEU B 130 ? 0.9830 1.0005 0.9752 -0.0383 0.0015  0.0121  130  LEU B C   
3019 O O   . LEU B 130 ? 1.0205 1.0370 1.0131 -0.0398 0.0073  0.0174  130  LEU B O   
3020 C CB  . LEU B 130 ? 0.9755 0.9926 0.9873 -0.0251 0.0240  0.0274  130  LEU B CB  
3021 C CG  . LEU B 130 ? 1.0024 1.0023 1.0128 -0.0158 0.0500  0.0321  130  LEU B CG  
3022 C CD1 . LEU B 130 ? 0.9787 1.0130 1.0387 -0.0076 0.0484  0.0638  130  LEU B CD1 
3023 C CD2 . LEU B 130 ? 1.1187 1.0733 1.1026 -0.0101 0.0899  0.0314  130  LEU B CD2 
3024 N N   . ILE B 131 ? 0.9448 0.9644 0.9394 -0.0393 -0.0123 0.0088  131  ILE B N   
3025 C CA  . ILE B 131 ? 0.9510 0.9656 0.9488 -0.0421 -0.0197 0.0104  131  ILE B CA  
3026 C C   . ILE B 131 ? 0.9960 1.0191 0.9993 -0.0408 -0.0163 0.0150  131  ILE B C   
3027 O O   . ILE B 131 ? 1.0133 1.0427 1.0270 -0.0434 -0.0186 0.0228  131  ILE B O   
3028 C CB  . ILE B 131 ? 0.9336 0.9213 0.9106 -0.0441 -0.0213 0.0027  131  ILE B CB  
3029 C CG1 . ILE B 131 ? 0.9345 0.9161 0.8982 -0.0614 -0.0363 0.0069  131  ILE B CG1 
3030 C CG2 . ILE B 131 ? 0.9387 0.9029 0.9120 -0.0416 -0.0144 0.0034  131  ILE B CG2 
3031 C CD1 . ILE B 131 ? 0.9280 0.8719 0.8460 -0.0714 -0.0359 -0.0042 131  ILE B CD1 
3032 N N   . TYR B 132 ? 1.0020 1.0335 1.0042 -0.0401 -0.0139 0.0184  132  TYR B N   
3033 C CA  . TYR B 132 ? 1.0484 1.1034 1.0650 -0.0469 -0.0176 0.0380  132  TYR B CA  
3034 C C   . TYR B 132 ? 1.1111 1.1680 1.1060 -0.0654 -0.0225 0.0382  132  TYR B C   
3035 O O   . TYR B 132 ? 1.1480 1.2213 1.1531 -0.0729 -0.0281 0.0538  132  TYR B O   
3036 C CB  . TYR B 132 ? 1.0492 1.1276 1.0770 -0.0514 -0.0199 0.0565  132  TYR B CB  
3037 C CG  . TYR B 132 ? 1.1106 1.2290 1.1635 -0.0665 -0.0310 0.0927  132  TYR B CG  
3038 C CD1 . TYR B 132 ? 1.1426 1.2771 1.2420 -0.0486 -0.0206 0.1186  132  TYR B CD1 
3039 C CD2 . TYR B 132 ? 1.1943 1.3272 1.2169 -0.1037 -0.0504 0.1036  132  TYR B CD2 
3040 C CE1 . TYR B 132 ? 1.1847 1.3686 1.3201 -0.0632 -0.0324 0.1633  132  TYR B CE1 
3041 C CE2 . TYR B 132 ? 1.2679 1.4451 1.3093 -0.1289 -0.0688 0.1451  132  TYR B CE2 
3042 C CZ  . TYR B 132 ? 1.2651 1.4774 1.3731 -0.1062 -0.0611 0.1788  132  TYR B CZ  
3043 O OH  . TYR B 132 ? 1.3537 1.6228 1.4925 -0.1323 -0.0811 0.2312  132  TYR B OH  
3044 N N   . ALA B 133 ? 1.1392 1.1721 1.1003 -0.0716 -0.0140 0.0233  133  ALA B N   
3045 C CA  . ALA B 133 ? 1.2277 1.2375 1.1474 -0.0884 -0.0042 0.0208  133  ALA B CA  
3046 C C   . ALA B 133 ? 1.2432 1.2590 1.1858 -0.0757 0.0011  0.0258  133  ALA B C   
3047 O O   . ALA B 133 ? 1.3010 1.3226 1.2330 -0.0884 -0.0023 0.0351  133  ALA B O   
3048 C CB  . ALA B 133 ? 1.2639 1.2289 1.1442 -0.0882 0.0202  0.0060  133  ALA B CB  
3049 N N   . ARG B 134 ? 1.2087 1.2280 1.1835 -0.0559 0.0058  0.0254  134  ARG B N   
3050 C CA  . ARG B 134 ? 1.2313 1.2608 1.2327 -0.0483 0.0085  0.0380  134  ARG B CA  
3051 C C   . ARG B 134 ? 1.2507 1.2971 1.2663 -0.0544 -0.0073 0.0452  134  ARG B C   
3052 O O   . ARG B 134 ? 1.2926 1.3456 1.3163 -0.0551 -0.0038 0.0563  134  ARG B O   
3053 C CB  . ARG B 134 ? 1.1746 1.2168 1.2108 -0.0401 0.0014  0.0473  134  ARG B CB  
3054 C CG  . ARG B 134 ? 1.1911 1.2319 1.2398 -0.0284 0.0248  0.0612  134  ARG B CG  
3055 C CD  . ARG B 134 ? 1.1314 1.1985 1.2157 -0.0310 0.0067  0.0801  134  ARG B CD  
3056 N NE  . ARG B 134 ? 1.1237 1.2144 1.2351 -0.0447 -0.0176 0.1014  134  ARG B NE  
3057 C CZ  . ARG B 134 ? 1.1329 1.2556 1.2921 -0.0411 -0.0119 0.1413  134  ARG B CZ  
3058 N NH1 . ARG B 134 ? 1.1493 1.2783 1.3362 -0.0165 0.0276  0.1649  134  ARG B NH1 
3059 N NH2 . ARG B 134 ? 1.1229 1.2655 1.3007 -0.0627 -0.0415 0.1616  134  ARG B NH2 
3060 N N   . PHE B 135 ? 1.2462 1.2990 1.2692 -0.0556 -0.0188 0.0442  135  PHE B N   
3061 C CA  . PHE B 135 ? 1.2858 1.3529 1.3329 -0.0554 -0.0253 0.0593  135  PHE B CA  
3062 C C   . PHE B 135 ? 1.3596 1.4501 1.3984 -0.0723 -0.0302 0.0767  135  PHE B C   
3063 O O   . PHE B 135 ? 1.3877 1.4998 1.4544 -0.0733 -0.0352 0.0982  135  PHE B O   
3064 C CB  . PHE B 135 ? 1.2622 1.3262 1.3239 -0.0459 -0.0218 0.0636  135  PHE B CB  
3065 C CG  . PHE B 135 ? 1.2749 1.2995 1.3312 -0.0363 -0.0145 0.0509  135  PHE B CG  
3066 C CD1 . PHE B 135 ? 1.2885 1.2964 1.3292 -0.0450 -0.0233 0.0392  135  PHE B CD1 
3067 C CD2 . PHE B 135 ? 1.3199 1.3192 1.3813 -0.0225 0.0041  0.0565  135  PHE B CD2 
3068 C CE1 . PHE B 135 ? 1.3258 1.2882 1.3402 -0.0524 -0.0236 0.0293  135  PHE B CE1 
3069 C CE2 . PHE B 135 ? 1.3583 1.2949 1.3844 -0.0222 0.0164  0.0395  135  PHE B CE2 
3070 C CZ  . PHE B 135 ? 1.3595 1.2755 1.3539 -0.0435 -0.0025 0.0238  135  PHE B CZ  
3071 N N   . THR B 136 ? 1.4143 1.4944 1.4072 -0.0907 -0.0284 0.0698  136  THR B N   
3072 C CA  . THR B 136 ? 1.5116 1.6049 1.4729 -0.1230 -0.0394 0.0877  136  THR B CA  
3073 C C   . THR B 136 ? 1.6174 1.6671 1.5081 -0.1406 -0.0222 0.0736  136  THR B C   
3074 O O   . THR B 136 ? 1.7313 1.7654 1.5566 -0.1807 -0.0290 0.0797  136  THR B O   
3075 C CB  . THR B 136 ? 1.5265 1.6373 1.4760 -0.1472 -0.0561 0.1023  136  THR B CB  
3076 O OG1 . THR B 136 ? 1.5479 1.6134 1.4434 -0.1544 -0.0449 0.0747  136  THR B OG1 
3077 C CG2 . THR B 136 ? 1.4427 1.5914 1.4667 -0.1213 -0.0589 0.1236  136  THR B CG2 
3078 N N   . ARG B 137 ? 1.1844 1.2102 1.0829 -0.1145 0.0025  0.0603  137  ARG B N   
3079 C CA  . ARG B 137 ? 1.2200 1.2048 1.0656 -0.1206 0.0318  0.0572  137  ARG B CA  
3080 C C   . ARG B 137 ? 1.1687 1.1841 1.0678 -0.1015 0.0328  0.0745  137  ARG B C   
3081 O O   . ARG B 137 ? 1.1620 1.1688 1.0850 -0.0767 0.0583  0.0794  137  ARG B O   
3082 C CB  . ARG B 137 ? 1.2685 1.1961 1.0798 -0.1049 0.0735  0.0412  137  ARG B CB  
3083 C CG  . ARG B 137 ? 1.2651 1.2162 1.1527 -0.0649 0.0880  0.0535  137  ARG B CG  
3084 C CD  . ARG B 137 ? 1.3824 1.2811 1.2486 -0.0434 0.1449  0.0574  137  ARG B CD  
3085 N NE  . ARG B 137 ? 1.5274 1.3550 1.3101 -0.0595 0.1693  0.0336  137  ARG B NE  
3086 C CZ  . ARG B 137 ? 1.6363 1.3899 1.3760 -0.0438 0.2318  0.0330  137  ARG B CZ  
3087 N NH1 . ARG B 137 ? 1.6399 1.3941 1.4280 -0.0058 0.2786  0.0633  137  ARG B NH1 
3088 N NH2 . ARG B 137 ? 1.7407 1.4166 1.3913 -0.0659 0.2517  0.0079  137  ARG B NH2 
3089 N N   . PRO B 138 ? 0.9991 1.0327 1.1063 0.0037  0.0091  0.0702  138  PRO B N   
3090 C CA  . PRO B 138 ? 0.9880 1.0152 1.0829 0.0019  0.0095  0.0675  138  PRO B CA  
3091 C C   . PRO B 138 ? 0.9431 0.9691 1.0381 -0.0007 0.0080  0.0639  138  PRO B C   
3092 O O   . PRO B 138 ? 0.9279 0.9561 1.0305 -0.0002 0.0069  0.0631  138  PRO B O   
3093 C CB  . PRO B 138 ? 1.0063 1.0278 1.0929 0.0050  0.0109  0.0676  138  PRO B CB  
3094 C CG  . PRO B 138 ? 1.0302 1.0573 1.1265 0.0085  0.0109  0.0704  138  PRO B CG  
3095 C CD  . PRO B 138 ? 1.0042 1.0377 1.1132 0.0066  0.0092  0.0708  138  PRO B CD  
3096 N N   . THR B 139 ? 0.9180 0.9409 1.0045 -0.0039 0.0080  0.0620  139  THR B N   
3097 C CA  . THR B 139 ? 0.8761 0.8979 0.9612 -0.0066 0.0068  0.0585  139  THR B CA  
3098 C C   . THR B 139 ? 0.8372 0.8522 0.9154 -0.0057 0.0068  0.0563  139  THR B C   
3099 O O   . THR B 139 ? 0.8530 0.8626 0.9238 -0.0035 0.0082  0.0570  139  THR B O   
3100 C CB  . THR B 139 ? 0.8886 0.9099 0.9658 -0.0107 0.0068  0.0574  139  THR B CB  
3101 O OG1 . THR B 139 ? 0.9247 0.9389 0.9891 -0.0112 0.0082  0.0576  139  THR B OG1 
3102 C CG2 . THR B 139 ? 0.9093 0.9386 0.9937 -0.0116 0.0065  0.0596  139  THR B CG2 
3103 N N   . ALA B 140 ? 0.7773 0.7925 0.8575 -0.0072 0.0055  0.0535  140  ALA B N   
3104 C CA  . ALA B 140 ? 0.7398 0.7492 0.8141 -0.0062 0.0055  0.0515  140  ALA B CA  
3105 C C   . ALA B 140 ? 0.7313 0.7320 0.7903 -0.0082 0.0064  0.0499  140  ALA B C   
3106 O O   . ALA B 140 ? 0.7396 0.7339 0.7917 -0.0063 0.0070  0.0492  140  ALA B O   
3107 C CB  . ALA B 140 ? 0.7144 0.7265 0.7950 -0.0074 0.0038  0.0490  140  ALA B CB  
3108 N N   . GLY B 141 ? 0.7141 0.7146 0.7676 -0.0120 0.0066  0.0497  141  GLY B N   
3109 C CA  . GLY B 141 ? 0.6976 0.6897 0.7360 -0.0153 0.0072  0.0479  141  GLY B CA  
3110 C C   . GLY B 141 ? 0.6706 0.6589 0.7049 -0.0169 0.0063  0.0448  141  GLY B C   
3111 O O   . GLY B 141 ? 0.6833 0.6622 0.7063 -0.0165 0.0072  0.0438  141  GLY B O   
3112 N N   . VAL B 142 ? 0.6383 0.6335 0.6813 -0.0186 0.0047  0.0434  142  VAL B N   
3113 C CA  . VAL B 142 ? 0.6150 0.6081 0.6561 -0.0198 0.0037  0.0406  142  VAL B CA  
3114 C C   . VAL B 142 ? 0.6107 0.6074 0.6498 -0.0251 0.0027  0.0387  142  VAL B C   
3115 O O   . VAL B 142 ? 0.6121 0.6175 0.6595 -0.0260 0.0020  0.0394  142  VAL B O   
3116 C CB  . VAL B 142 ? 0.5956 0.5937 0.6490 -0.0164 0.0027  0.0403  142  VAL B CB  
3117 C CG1 . VAL B 142 ? 0.5870 0.5844 0.6396 -0.0181 0.0015  0.0372  142  VAL B CG1 
3118 C CG2 . VAL B 142 ? 0.5950 0.5897 0.6486 -0.0116 0.0036  0.0420  142  VAL B CG2 
3119 N N   . LEU B 143 ? 0.6158 0.6061 0.6436 -0.0284 0.0026  0.0366  143  LEU B N   
3120 C CA  . LEU B 143 ? 0.6059 0.6001 0.6308 -0.0338 0.0016  0.0350  143  LEU B CA  
3121 C C   . LEU B 143 ? 0.5785 0.5759 0.6091 -0.0335 0.0004  0.0327  143  LEU B C   
3122 O O   . LEU B 143 ? 0.5643 0.5555 0.5920 -0.0315 0.0004  0.0316  143  LEU B O   
3123 C CB  . LEU B 143 ? 0.6397 0.6243 0.6477 -0.0384 0.0023  0.0340  143  LEU B CB  
3124 C CG  . LEU B 143 ? 0.6701 0.6590 0.6731 -0.0452 0.0015  0.0329  143  LEU B CG  
3125 C CD1 . LEU B 143 ? 0.6616 0.6613 0.6714 -0.0467 0.0012  0.0348  143  LEU B CD1 
3126 C CD2 . LEU B 143 ? 0.6901 0.6670 0.6750 -0.0497 0.0023  0.0321  143  LEU B CD2 
3127 N N   . PHE B 144 ? 0.5608 0.5680 0.5993 -0.0351 -0.0006 0.0322  144  PHE B N   
3128 C CA  . PHE B 144 ? 0.5412 0.5521 0.5841 -0.0355 -0.0018 0.0298  144  PHE B CA  
3129 C C   . PHE B 144 ? 0.5529 0.5651 0.5871 -0.0415 -0.0024 0.0282  144  PHE B C   
3130 O O   . PHE B 144 ? 0.5577 0.5749 0.5895 -0.0450 -0.0023 0.0292  144  PHE B O   
3131 C CB  . PHE B 144 ? 0.5352 0.5560 0.5922 -0.0329 -0.0025 0.0304  144  PHE B CB  
3132 C CG  . PHE B 144 ? 0.5507 0.5709 0.6168 -0.0278 -0.0023 0.0318  144  PHE B CG  
3133 C CD1 . PHE B 144 ? 0.5702 0.5923 0.6402 -0.0260 -0.0015 0.0346  144  PHE B CD1 
3134 C CD2 . PHE B 144 ? 0.5328 0.5513 0.6036 -0.0252 -0.0029 0.0303  144  PHE B CD2 
3135 C CE1 . PHE B 144 ? 0.5844 0.6065 0.6626 -0.0219 -0.0013 0.0361  144  PHE B CE1 
3136 C CE2 . PHE B 144 ? 0.5271 0.5458 0.6060 -0.0213 -0.0028 0.0317  144  PHE B CE2 
3137 C CZ  . PHE B 144 ? 0.5636 0.5841 0.6463 -0.0197 -0.0020 0.0346  144  PHE B CZ  
3138 N N   . SER B 145 ? 0.5407 0.5495 0.5706 -0.0428 -0.0029 0.0258  145  SER B N   
3139 C CA  . SER B 145 ? 0.5579 0.5692 0.5804 -0.0486 -0.0035 0.0244  145  SER B CA  
3140 C C   . SER B 145 ? 0.5482 0.5732 0.5801 -0.0494 -0.0043 0.0246  145  SER B C   
3141 O O   . SER B 145 ? 0.5366 0.5675 0.5805 -0.0452 -0.0046 0.0247  145  SER B O   
3142 C CB  . SER B 145 ? 0.5588 0.5649 0.5764 -0.0495 -0.0041 0.0219  145  SER B CB  
3143 O OG  . SER B 145 ? 0.5449 0.5572 0.5740 -0.0460 -0.0050 0.0206  145  SER B OG  
3144 N N   . SER B 146 ? 0.5618 0.5918 0.5877 -0.0549 -0.0045 0.0249  146  SER B N   
3145 C CA  . SER B 146 ? 0.5591 0.6028 0.5932 -0.0552 -0.0050 0.0257  146  SER B CA  
3146 C C   . SER B 146 ? 0.5558 0.6060 0.5964 -0.0539 -0.0059 0.0237  146  SER B C   
3147 O O   . SER B 146 ? 0.5689 0.6308 0.6173 -0.0528 -0.0062 0.0242  146  SER B O   
3148 C CB  . SER B 146 ? 0.5844 0.6327 0.6096 -0.0620 -0.0051 0.0267  146  SER B CB  
3149 O OG  . SER B 146 ? 0.6184 0.6638 0.6339 -0.0673 -0.0057 0.0247  146  SER B OG  
3150 N N   . ARG B 147 ? 0.5458 0.5888 0.5825 -0.0540 -0.0062 0.0214  147  ARG B N   
3151 C CA  . ARG B 147 ? 0.5419 0.5905 0.5828 -0.0535 -0.0071 0.0192  147  ARG B CA  
3152 C C   . ARG B 147 ? 0.5336 0.5740 0.5758 -0.0502 -0.0073 0.0172  147  ARG B C   
3153 O O   . ARG B 147 ? 0.5120 0.5420 0.5495 -0.0492 -0.0068 0.0176  147  ARG B O   
3154 C CB  . ARG B 147 ? 0.5855 0.6362 0.6160 -0.0603 -0.0075 0.0182  147  ARG B CB  
3155 C CG  . ARG B 147 ? 0.6058 0.6670 0.6345 -0.0647 -0.0076 0.0200  147  ARG B CG  
3156 C CD  . ARG B 147 ? 0.6188 0.6941 0.6586 -0.0617 -0.0079 0.0201  147  ARG B CD  
3157 N NE  . ARG B 147 ? 0.7188 0.8054 0.7567 -0.0657 -0.0079 0.0222  147  ARG B NE  
3158 C CZ  . ARG B 147 ? 0.7289 0.8175 0.7675 -0.0658 -0.0073 0.0248  147  ARG B CZ  
3159 N NH1 . ARG B 147 ? 0.7210 0.8011 0.7624 -0.0618 -0.0067 0.0257  147  ARG B NH1 
3160 N NH2 . ARG B 147 ? 0.7230 0.8230 0.7594 -0.0700 -0.0075 0.0267  147  ARG B NH2 
3161 N N   . MET B 148 ? 0.5351 0.5804 0.5831 -0.0486 -0.0080 0.0152  148  MET B N   
3162 C CA  . MET B 148 ? 0.5461 0.5847 0.5938 -0.0468 -0.0085 0.0130  148  MET B CA  
3163 C C   . MET B 148 ? 0.5680 0.6074 0.6080 -0.0512 -0.0091 0.0110  148  MET B C   
3164 O O   . MET B 148 ? 0.5838 0.6309 0.6211 -0.0551 -0.0093 0.0112  148  MET B O   
3165 C CB  . MET B 148 ? 0.5293 0.5714 0.5892 -0.0414 -0.0089 0.0120  148  MET B CB  
3166 C CG  . MET B 148 ? 0.5475 0.5917 0.6165 -0.0374 -0.0083 0.0141  148  MET B CG  
3167 S SD  . MET B 148 ? 0.5490 0.5950 0.6304 -0.0320 -0.0088 0.0126  148  MET B SD  
3168 C CE  . MET B 148 ? 0.4738 0.5095 0.5527 -0.0307 -0.0091 0.0120  148  MET B CE  
3169 N N   . VAL B 149 ? 0.5688 0.6009 0.6052 -0.0506 -0.0094 0.0093  149  VAL B N   
3170 C CA  . VAL B 149 ? 0.5943 0.6273 0.6247 -0.0542 -0.0101 0.0073  149  VAL B CA  
3171 C C   . VAL B 149 ? 0.5974 0.6311 0.6346 -0.0504 -0.0108 0.0050  149  VAL B C   
3172 O O   . VAL B 149 ? 0.6039 0.6344 0.6475 -0.0459 -0.0108 0.0051  149  VAL B O   
3173 C CB  . VAL B 149 ? 0.6078 0.6296 0.6234 -0.0584 -0.0098 0.0075  149  VAL B CB  
3174 C CG1 . VAL B 149 ? 0.6144 0.6344 0.6226 -0.0624 -0.0091 0.0096  149  VAL B CG1 
3175 C CG2 . VAL B 149 ? 0.5885 0.5995 0.6025 -0.0545 -0.0094 0.0075  149  VAL B CG2 
3176 N N   . ILE B 150 ? 0.6194 0.6580 0.6553 -0.0526 -0.0115 0.0030  150  ILE B N   
3177 C CA  . ILE B 150 ? 0.6199 0.6566 0.6582 -0.0503 -0.0122 0.0006  150  ILE B CA  
3178 C C   . ILE B 150 ? 0.6558 0.6884 0.6826 -0.0550 -0.0125 -0.0002 150  ILE B C   
3179 O O   . ILE B 150 ? 0.6800 0.7181 0.7023 -0.0595 -0.0126 -0.0004 150  ILE B O   
3180 C CB  . ILE B 150 ? 0.6133 0.6597 0.6619 -0.0475 -0.0127 -0.0012 150  ILE B CB  
3181 C CG1 . ILE B 150 ? 0.5774 0.6262 0.6363 -0.0430 -0.0123 0.0000  150  ILE B CG1 
3182 C CG2 . ILE B 150 ? 0.5852 0.6292 0.6351 -0.0458 -0.0135 -0.0037 150  ILE B CG2 
3183 C CD1 . ILE B 150 ? 0.5171 0.5742 0.5855 -0.0397 -0.0124 -0.0015 150  ILE B CD1 
3184 N N   . SER B 151 ? 0.6623 0.6853 0.6842 -0.0539 -0.0125 -0.0006 151  SER B N   
3185 C CA  . SER B 151 ? 0.6922 0.7096 0.7026 -0.0578 -0.0127 -0.0012 151  SER B CA  
3186 C C   . SER B 151 ? 0.7058 0.7152 0.7147 -0.0545 -0.0128 -0.0018 151  SER B C   
3187 O O   . SER B 151 ? 0.6962 0.7040 0.7120 -0.0497 -0.0127 -0.0013 151  SER B O   
3188 C CB  . SER B 151 ? 0.7089 0.7201 0.7072 -0.0627 -0.0119 0.0006  151  SER B CB  
3189 O OG  . SER B 151 ? 0.6939 0.6935 0.6867 -0.0607 -0.0110 0.0022  151  SER B OG  
3190 N N   . ASP B 152 ? 0.7348 0.7397 0.7346 -0.0572 -0.0131 -0.0027 152  ASP B N   
3191 C CA  . ASP B 152 ? 0.7570 0.7560 0.7556 -0.0539 -0.0133 -0.0033 152  ASP B CA  
3192 C C   . ASP B 152 ? 0.7542 0.7423 0.7472 -0.0511 -0.0123 -0.0012 152  ASP B C   
3193 O O   . ASP B 152 ? 0.7671 0.7467 0.7488 -0.0537 -0.0113 0.0003  152  ASP B O   
3194 C CB  . ASP B 152 ? 0.7973 0.7939 0.7867 -0.0575 -0.0137 -0.0045 152  ASP B CB  
3195 C CG  . ASP B 152 ? 0.8525 0.8603 0.8489 -0.0586 -0.0148 -0.0070 152  ASP B CG  
3196 O OD1 . ASP B 152 ? 0.8711 0.8881 0.8782 -0.0569 -0.0151 -0.0077 152  ASP B OD1 
3197 O OD2 . ASP B 152 ? 0.9410 0.9480 0.9316 -0.0608 -0.0153 -0.0082 152  ASP B OD2 
3198 N N   . PHE B 153 ? 0.7353 0.7235 0.7356 -0.0457 -0.0125 -0.0010 153  PHE B N   
3199 C CA  . PHE B 153 ? 0.7305 0.7093 0.7254 -0.0422 -0.0115 0.0009  153  PHE B CA  
3200 C C   . PHE B 153 ? 0.7408 0.7204 0.7393 -0.0383 -0.0122 0.0002  153  PHE B C   
3201 O O   . PHE B 153 ? 0.7270 0.7150 0.7370 -0.0366 -0.0133 -0.0011 153  PHE B O   
3202 C CB  . PHE B 153 ? 0.6944 0.6732 0.6948 -0.0393 -0.0107 0.0029  153  PHE B CB  
3203 C CG  . PHE B 153 ? 0.6947 0.6658 0.6911 -0.0348 -0.0097 0.0051  153  PHE B CG  
3204 C CD1 . PHE B 153 ? 0.6860 0.6456 0.6685 -0.0354 -0.0083 0.0068  153  PHE B CD1 
3205 C CD2 . PHE B 153 ? 0.6958 0.6712 0.7020 -0.0299 -0.0101 0.0056  153  PHE B CD2 
3206 C CE1 . PHE B 153 ? 0.7061 0.6586 0.6845 -0.0304 -0.0070 0.0090  153  PHE B CE1 
3207 C CE2 . PHE B 153 ? 0.6917 0.6615 0.6945 -0.0254 -0.0091 0.0080  153  PHE B CE2 
3208 C CZ  . PHE B 153 ? 0.7118 0.6701 0.7006 -0.0252 -0.0075 0.0097  153  PHE B CZ  
3209 N N   . GLU B 154 ? 0.7644 0.7351 0.7524 -0.0371 -0.0116 0.0013  154  GLU B N   
3210 C CA  . GLU B 154 ? 0.7849 0.7572 0.7752 -0.0340 -0.0123 0.0007  154  GLU B CA  
3211 C C   . GLU B 154 ? 0.7911 0.7726 0.7884 -0.0364 -0.0139 -0.0022 154  GLU B C   
3212 O O   . GLU B 154 ? 0.7996 0.7875 0.8062 -0.0338 -0.0150 -0.0033 154  GLU B O   
3213 C CB  . GLU B 154 ? 0.7627 0.7386 0.7626 -0.0286 -0.0124 0.0020  154  GLU B CB  
3214 C CG  . GLU B 154 ? 0.7866 0.7549 0.7810 -0.0250 -0.0108 0.0052  154  GLU B CG  
3215 C CD  . GLU B 154 ? 0.8811 0.8387 0.8612 -0.0237 -0.0096 0.0066  154  GLU B CD  
3216 O OE1 . GLU B 154 ? 0.9543 0.9088 0.9268 -0.0270 -0.0100 0.0052  154  GLU B OE1 
3217 O OE2 . GLU B 154 ? 0.9461 0.8979 0.9219 -0.0193 -0.0083 0.0092  154  GLU B OE2 
3218 N N   . GLY B 155 ? 0.8009 0.7836 0.7938 -0.0414 -0.0142 -0.0037 155  GLY B N   
3219 C CA  . GLY B 155 ? 0.8058 0.7968 0.8037 -0.0435 -0.0155 -0.0065 155  GLY B CA  
3220 C C   . GLY B 155 ? 0.7810 0.7828 0.7922 -0.0431 -0.0164 -0.0084 155  GLY B C   
3221 O O   . GLY B 155 ? 0.8112 0.8195 0.8258 -0.0444 -0.0173 -0.0109 155  GLY B O   
3222 N N   . LYS B 156 ? 0.7372 0.7405 0.7554 -0.0410 -0.0159 -0.0073 156  LYS B N   
3223 C CA  . LYS B 156 ? 0.6984 0.7105 0.7281 -0.0405 -0.0165 -0.0088 156  LYS B CA  
3224 C C   . LYS B 156 ? 0.6650 0.6783 0.6940 -0.0426 -0.0157 -0.0076 156  LYS B C   
3225 O O   . LYS B 156 ? 0.6532 0.6602 0.6766 -0.0427 -0.0147 -0.0052 156  LYS B O   
3226 C CB  . LYS B 156 ? 0.6858 0.6993 0.7253 -0.0362 -0.0168 -0.0083 156  LYS B CB  
3227 C CG  . LYS B 156 ? 0.7012 0.7151 0.7434 -0.0339 -0.0177 -0.0092 156  LYS B CG  
3228 C CD  . LYS B 156 ? 0.7240 0.7410 0.7767 -0.0309 -0.0181 -0.0089 156  LYS B CD  
3229 C CE  . LYS B 156 ? 0.7369 0.7567 0.7938 -0.0295 -0.0193 -0.0103 156  LYS B CE  
3230 N NZ  . LYS B 156 ? 0.7770 0.7933 0.8250 -0.0298 -0.0194 -0.0101 156  LYS B NZ  
3231 N N   . PRO B 157 ? 0.6480 0.6695 0.6824 -0.0439 -0.0160 -0.0091 157  PRO B N   
3232 C CA  . PRO B 157 ? 0.6234 0.6480 0.6603 -0.0447 -0.0153 -0.0077 157  PRO B CA  
3233 C C   . PRO B 157 ? 0.6051 0.6271 0.6483 -0.0409 -0.0149 -0.0059 157  PRO B C   
3234 O O   . PRO B 157 ? 0.5885 0.6114 0.6391 -0.0376 -0.0154 -0.0067 157  PRO B O   
3235 C CB  . PRO B 157 ? 0.6270 0.6617 0.6717 -0.0444 -0.0157 -0.0098 157  PRO B CB  
3236 C CG  . PRO B 157 ? 0.6334 0.6698 0.6764 -0.0452 -0.0166 -0.0124 157  PRO B CG  
3237 C CD  . PRO B 157 ? 0.6548 0.6834 0.6938 -0.0440 -0.0169 -0.0120 157  PRO B CD  
3238 N N   . THR B 158 ? 0.5974 0.6167 0.6378 -0.0416 -0.0139 -0.0035 158  THR B N   
3239 C CA  . THR B 158 ? 0.5666 0.5830 0.6117 -0.0383 -0.0134 -0.0014 158  THR B CA  
3240 C C   . THR B 158 ? 0.5681 0.5877 0.6156 -0.0390 -0.0126 0.0002  158  THR B C   
3241 O O   . THR B 158 ? 0.5966 0.6160 0.6370 -0.0426 -0.0122 0.0009  158  THR B O   
3242 C CB  . THR B 158 ? 0.5631 0.5700 0.5996 -0.0376 -0.0127 0.0002  158  THR B CB  
3243 O OG1 . THR B 158 ? 0.5537 0.5589 0.5888 -0.0365 -0.0134 -0.0011 158  THR B OG1 
3244 C CG2 . THR B 158 ? 0.5341 0.5387 0.5750 -0.0341 -0.0121 0.0025  158  THR B CG2 
3245 N N   . LEU B 159 ? 0.5501 0.5730 0.6076 -0.0358 -0.0126 0.0008  159  LEU B N   
3246 C CA  . LEU B 159 ? 0.5315 0.5574 0.5914 -0.0361 -0.0119 0.0028  159  LEU B CA  
3247 C C   . LEU B 159 ? 0.5230 0.5421 0.5790 -0.0352 -0.0110 0.0055  159  LEU B C   
3248 O O   . LEU B 159 ? 0.5070 0.5221 0.5653 -0.0322 -0.0110 0.0061  159  LEU B O   
3249 C CB  . LEU B 159 ? 0.5247 0.5563 0.5964 -0.0329 -0.0121 0.0024  159  LEU B CB  
3250 C CG  . LEU B 159 ? 0.5211 0.5559 0.5969 -0.0320 -0.0113 0.0048  159  LEU B CG  
3251 C CD1 . LEU B 159 ? 0.4916 0.5328 0.5641 -0.0350 -0.0110 0.0049  159  LEU B CD1 
3252 C CD2 . LEU B 159 ? 0.5256 0.5633 0.6123 -0.0283 -0.0115 0.0044  159  LEU B CD2 
3253 N N   . MET B 160 ? 0.5196 0.5374 0.5691 -0.0379 -0.0102 0.0071  160  MET B N   
3254 C CA  . MET B 160 ? 0.5140 0.5244 0.5582 -0.0371 -0.0092 0.0095  160  MET B CA  
3255 C C   . MET B 160 ? 0.5033 0.5162 0.5473 -0.0386 -0.0085 0.0115  160  MET B C   
3256 O O   . MET B 160 ? 0.5159 0.5353 0.5604 -0.0413 -0.0087 0.0111  160  MET B O   
3257 C CB  . MET B 160 ? 0.5365 0.5380 0.5670 -0.0397 -0.0087 0.0094  160  MET B CB  
3258 C CG  . MET B 160 ? 0.5522 0.5521 0.5797 -0.0402 -0.0095 0.0073  160  MET B CG  
3259 S SD  . MET B 160 ? 0.6070 0.5947 0.6162 -0.0437 -0.0086 0.0078  160  MET B SD  
3260 C CE  . MET B 160 ? 0.5259 0.5152 0.5324 -0.0458 -0.0098 0.0050  160  MET B CE  
3261 N N   . MET B 161 ? 0.4920 0.4999 0.5348 -0.0366 -0.0075 0.0137  161  MET B N   
3262 C CA  . MET B 161 ? 0.4880 0.4963 0.5285 -0.0380 -0.0067 0.0159  161  MET B CA  
3263 C C   . MET B 161 ? 0.4973 0.4957 0.5309 -0.0360 -0.0056 0.0176  161  MET B C   
3264 O O   . MET B 161 ? 0.4925 0.4858 0.5242 -0.0337 -0.0056 0.0170  161  MET B O   
3265 C CB  . MET B 161 ? 0.4726 0.4891 0.5253 -0.0355 -0.0068 0.0171  161  MET B CB  
3266 C CG  . MET B 161 ? 0.4636 0.4802 0.5265 -0.0304 -0.0070 0.0176  161  MET B CG  
3267 S SD  . MET B 161 ? 0.4971 0.5066 0.5575 -0.0276 -0.0058 0.0204  161  MET B SD  
3268 C CE  . MET B 161 ? 0.4404 0.4526 0.5000 -0.0291 -0.0049 0.0229  161  MET B CE  
3269 N N   . ARG B 162 ? 0.5055 0.5010 0.5344 -0.0368 -0.0045 0.0196  162  ARG B N   
3270 C CA  . ARG B 162 ? 0.5086 0.4947 0.5307 -0.0343 -0.0033 0.0213  162  ARG B CA  
3271 C C   . ARG B 162 ? 0.5108 0.4980 0.5354 -0.0329 -0.0023 0.0238  162  ARG B C   
3272 O O   . ARG B 162 ? 0.5023 0.4964 0.5311 -0.0351 -0.0026 0.0244  162  ARG B O   
3273 C CB  . ARG B 162 ? 0.5414 0.5167 0.5472 -0.0374 -0.0026 0.0206  162  ARG B CB  
3274 C CG  . ARG B 162 ? 0.5527 0.5266 0.5487 -0.0436 -0.0023 0.0207  162  ARG B CG  
3275 C CD  . ARG B 162 ? 0.6097 0.5707 0.5884 -0.0467 -0.0016 0.0199  162  ARG B CD  
3276 N NE  . ARG B 162 ? 0.6853 0.6456 0.6542 -0.0539 -0.0016 0.0196  162  ARG B NE  
3277 C CZ  . ARG B 162 ? 0.7198 0.6699 0.6730 -0.0586 -0.0012 0.0188  162  ARG B CZ  
3278 N NH1 . ARG B 162 ? 0.7067 0.6454 0.6513 -0.0563 -0.0006 0.0183  162  ARG B NH1 
3279 N NH2 . ARG B 162 ? 0.7469 0.6981 0.6925 -0.0657 -0.0015 0.0187  162  ARG B NH2 
3280 N N   . LEU B 163 ? 0.5198 0.5009 0.5422 -0.0290 -0.0012 0.0255  163  LEU B N   
3281 C CA  . LEU B 163 ? 0.5324 0.5142 0.5574 -0.0270 -0.0002 0.0282  163  LEU B CA  
3282 C C   . LEU B 163 ? 0.5571 0.5279 0.5687 -0.0263 0.0014  0.0294  163  LEU B C   
3283 O O   . LEU B 163 ? 0.5696 0.5325 0.5734 -0.0246 0.0019  0.0288  163  LEU B O   
3284 C CB  . LEU B 163 ? 0.5182 0.5043 0.5550 -0.0217 -0.0003 0.0296  163  LEU B CB  
3285 C CG  . LEU B 163 ? 0.5355 0.5299 0.5855 -0.0205 -0.0018 0.0286  163  LEU B CG  
3286 C CD1 . LEU B 163 ? 0.5786 0.5727 0.6337 -0.0161 -0.0017 0.0296  163  LEU B CD1 
3287 C CD2 . LEU B 163 ? 0.5677 0.5697 0.6268 -0.0210 -0.0020 0.0299  163  LEU B CD2 
3288 N N   . ALA B 164 ? 0.5788 0.5489 0.5879 -0.0270 0.0024  0.0312  164  ALA B N   
3289 C CA  . ALA B 164 ? 0.6263 0.5853 0.6221 -0.0259 0.0042  0.0324  164  ALA B CA  
3290 C C   . ALA B 164 ? 0.6403 0.6017 0.6416 -0.0220 0.0053  0.0352  164  ALA B C   
3291 O O   . ALA B 164 ? 0.6293 0.5995 0.6402 -0.0227 0.0047  0.0363  164  ALA B O   
3292 C CB  . ALA B 164 ? 0.6292 0.5814 0.6103 -0.0324 0.0046  0.0314  164  ALA B CB  
3293 N N   . ASN B 165 ? 0.6808 0.6345 0.6758 -0.0174 0.0069  0.0366  165  ASN B N   
3294 C CA  . ASN B 165 ? 0.7073 0.6616 0.7043 -0.0136 0.0082  0.0393  165  ASN B CA  
3295 C C   . ASN B 165 ? 0.7503 0.6972 0.7344 -0.0168 0.0095  0.0397  165  ASN B C   
3296 O O   . ASN B 165 ? 0.7890 0.7237 0.7577 -0.0175 0.0108  0.0389  165  ASN B O   
3297 C CB  . ASN B 165 ? 0.7180 0.6675 0.7126 -0.0071 0.0096  0.0407  165  ASN B CB  
3298 C CG  . ASN B 165 ? 0.7467 0.6972 0.7430 -0.0027 0.0111  0.0438  165  ASN B CG  
3299 O OD1 . ASN B 165 ? 0.7520 0.7051 0.7496 -0.0047 0.0114  0.0448  165  ASN B OD1 
3300 N ND2 . ASN B 165 ? 0.7930 0.7422 0.7894 0.0033  0.0122  0.0454  165  ASN B ND2 
3301 N N   . LEU B 166 ? 0.7564 0.7103 0.7462 -0.0189 0.0093  0.0409  166  LEU B N   
3302 C CA  . LEU B 166 ? 0.7926 0.7412 0.7711 -0.0229 0.0103  0.0413  166  LEU B CA  
3303 C C   . LEU B 166 ? 0.8371 0.7789 0.8087 -0.0188 0.0125  0.0434  166  LEU B C   
3304 O O   . LEU B 166 ? 0.8601 0.7990 0.8242 -0.0217 0.0133  0.0440  166  LEU B O   
3305 C CB  . LEU B 166 ? 0.7711 0.7315 0.7594 -0.0265 0.0091  0.0420  166  LEU B CB  
3306 C CG  . LEU B 166 ? 0.7495 0.7168 0.7418 -0.0316 0.0072  0.0400  166  LEU B CG  
3307 C CD1 . LEU B 166 ? 0.7216 0.7011 0.7240 -0.0337 0.0063  0.0414  166  LEU B CD1 
3308 C CD2 . LEU B 166 ? 0.7693 0.7273 0.7452 -0.0375 0.0073  0.0379  166  LEU B CD2 
3309 N N   . ARG B 167 ? 0.8551 0.7955 0.8296 -0.0121 0.0134  0.0447  167  ARG B N   
3310 C CA  . ARG B 167 ? 0.8993 0.8350 0.8688 -0.0072 0.0156  0.0471  167  ARG B CA  
3311 C C   . ARG B 167 ? 0.9292 0.8544 0.8888 -0.0021 0.0172  0.0469  167  ARG B C   
3312 O O   . ARG B 167 ? 0.9174 0.8429 0.8794 -0.0013 0.0163  0.0456  167  ARG B O   
3313 C CB  . ARG B 167 ? 0.8833 0.8312 0.8692 -0.0031 0.0154  0.0499  167  ARG B CB  
3314 C CG  . ARG B 167 ? 0.8928 0.8496 0.8866 -0.0065 0.0146  0.0510  167  ARG B CG  
3315 C CD  . ARG B 167 ? 0.9105 0.8779 0.9195 -0.0021 0.0145  0.0540  167  ARG B CD  
3316 N NE  . ARG B 167 ? 0.9565 0.9335 0.9752 -0.0051 0.0135  0.0551  167  ARG B NE  
3317 C CZ  . ARG B 167 ? 0.9360 0.9235 0.9699 -0.0053 0.0118  0.0556  167  ARG B CZ  
3318 N NH1 . ARG B 167 ? 0.9336 0.9237 0.9751 -0.0030 0.0109  0.0550  167  ARG B NH1 
3319 N NH2 . ARG B 167 ? 0.9076 0.9028 0.9487 -0.0076 0.0112  0.0568  167  ARG B NH2 
3320 N N   . ILE B 168 ? 0.9819 0.8980 0.9301 0.0016  0.0196  0.0483  168  ILE B N   
3321 C CA  . ILE B 168 ? 1.0162 0.9222 0.9543 0.0074  0.0214  0.0485  168  ILE B CA  
3322 C C   . ILE B 168 ? 1.0003 0.9167 0.9524 0.0139  0.0212  0.0507  168  ILE B C   
3323 O O   . ILE B 168 ? 0.9985 0.9125 0.9490 0.0173  0.0213  0.0503  168  ILE B O   
3324 C CB  . ILE B 168 ? 1.0775 0.9712 0.9998 0.0106  0.0244  0.0497  168  ILE B CB  
3325 C CG1 . ILE B 168 ? 1.1200 1.0014 1.0258 0.0035  0.0247  0.0474  168  ILE B CG1 
3326 C CG2 . ILE B 168 ? 1.1119 0.9967 1.0252 0.0185  0.0265  0.0506  168  ILE B CG2 
3327 C CD1 . ILE B 168 ? 1.1420 1.0121 1.0358 0.0005  0.0244  0.0447  168  ILE B CD1 
3328 N N   . GLU B 169 ? 0.9915 0.9198 0.9573 0.0156  0.0208  0.0530  169  GLU B N   
3329 C CA  . GLU B 169 ? 0.9811 0.9200 0.9603 0.0210  0.0204  0.0552  169  GLU B CA  
3330 C C   . GLU B 169 ? 0.9312 0.8766 0.9203 0.0189  0.0179  0.0534  169  GLU B C   
3331 O O   . GLU B 169 ? 0.8944 0.8419 0.8871 0.0130  0.0161  0.0511  169  GLU B O   
3332 C CB  . GLU B 169 ? 0.9895 0.9404 0.9822 0.0223  0.0202  0.0581  169  GLU B CB  
3333 C CG  . GLU B 169 ? 1.0591 1.0055 1.0436 0.0251  0.0226  0.0602  169  GLU B CG  
3334 C CD  . GLU B 169 ? 1.1111 1.0492 1.0849 0.0194  0.0228  0.0583  169  GLU B CD  
3335 O OE1 . GLU B 169 ? 1.1246 1.0673 1.1044 0.0131  0.0208  0.0567  169  GLU B OE1 
3336 O OE2 . GLU B 169 ? 1.1917 1.1187 1.1506 0.0213  0.0251  0.0585  169  GLU B OE2 
3337 N N   . GLN B 170 ? 0.9231 0.8727 0.9171 0.0240  0.0180  0.0547  170  GLN B N   
3338 C CA  . GLN B 170 ? 0.8846 0.8395 0.8865 0.0226  0.0160  0.0531  170  GLN B CA  
3339 C C   . GLN B 170 ? 0.8390 0.8082 0.8594 0.0216  0.0140  0.0542  170  GLN B C   
3340 O O   . GLN B 170 ? 0.8488 0.8248 0.8764 0.0238  0.0145  0.0569  170  GLN B O   
3341 C CB  . GLN B 170 ? 0.9160 0.8670 0.9117 0.0284  0.0171  0.0539  170  GLN B CB  
3342 C CG  . GLN B 170 ? 0.9652 0.9005 0.9423 0.0279  0.0185  0.0519  170  GLN B CG  
3343 C CD  . GLN B 170 ? 1.0177 0.9468 0.9852 0.0351  0.0205  0.0534  170  GLN B CD  
3344 O OE1 . GLN B 170 ? 1.0655 0.9981 1.0343 0.0415  0.0222  0.0566  170  GLN B OE1 
3345 N NE2 . GLN B 170 ? 1.0495 0.9694 1.0069 0.0344  0.0205  0.0514  170  GLN B NE2 
3346 N N   . ILE B 171 ? 0.7802 0.7536 0.8077 0.0181  0.0118  0.0519  171  ILE B N   
3347 C CA  . ILE B 171 ? 0.7342 0.7194 0.7779 0.0168  0.0099  0.0524  171  ILE B CA  
3348 C C   . ILE B 171 ? 0.7329 0.7221 0.7807 0.0194  0.0091  0.0524  171  ILE B C   
3349 O O   . ILE B 171 ? 0.7232 0.7074 0.7647 0.0190  0.0087  0.0502  171  ILE B O   
3350 C CB  . ILE B 171 ? 0.7001 0.6871 0.7485 0.0107  0.0080  0.0497  171  ILE B CB  
3351 C CG1 . ILE B 171 ? 0.6907 0.6740 0.7338 0.0081  0.0089  0.0499  171  ILE B CG1 
3352 C CG2 . ILE B 171 ? 0.6761 0.6740 0.7406 0.0095  0.0061  0.0500  171  ILE B CG2 
3353 C CD1 . ILE B 171 ? 0.6154 0.6023 0.6638 0.0026  0.0073  0.0479  171  ILE B CD1 
3354 N N   . ILE B 172 ? 0.7331 0.7318 0.7911 0.0221  0.0088  0.0550  172  ILE B N   
3355 C CA  . ILE B 172 ? 0.7441 0.7474 0.8051 0.0247  0.0081  0.0554  172  ILE B CA  
3356 C C   . ILE B 172 ? 0.7230 0.7357 0.7982 0.0211  0.0056  0.0544  172  ILE B C   
3357 O O   . ILE B 172 ? 0.7118 0.7291 0.7958 0.0183  0.0048  0.0549  172  ILE B O   
3358 C CB  . ILE B 172 ? 0.7914 0.7984 0.8511 0.0313  0.0100  0.0595  172  ILE B CB  
3359 C CG1 . ILE B 172 ? 0.8030 0.8201 0.8745 0.0311  0.0097  0.0624  172  ILE B CG1 
3360 C CG2 . ILE B 172 ? 0.7813 0.7770 0.8253 0.0352  0.0129  0.0603  172  ILE B CG2 
3361 C CD1 . ILE B 172 ? 0.8575 0.8850 0.9355 0.0350  0.0097  0.0657  172  ILE B CD1 
3362 N N   . GLU B 173 ? 0.7170 0.7317 0.7935 0.0211  0.0044  0.0530  173  GLU B N   
3363 C CA  . GLU B 173 ? 0.7013 0.7232 0.7895 0.0172  0.0019  0.0514  173  GLU B CA  
3364 C C   . GLU B 173 ? 0.6638 0.6830 0.7547 0.0121  0.0008  0.0485  173  GLU B C   
3365 O O   . GLU B 173 ? 0.6537 0.6783 0.7547 0.0095  -0.0003 0.0486  173  GLU B O   
3366 C CB  . GLU B 173 ? 0.7151 0.7474 0.8145 0.0179  0.0014  0.0546  173  GLU B CB  
3367 C CG  . GLU B 173 ? 0.7605 0.7993 0.8606 0.0218  0.0015  0.0569  173  GLU B CG  
3368 C CD  . GLU B 173 ? 0.8296 0.8787 0.9395 0.0224  0.0014  0.0606  173  GLU B CD  
3369 O OE1 . GLU B 173 ? 0.8592 0.9082 0.9717 0.0215  0.0020  0.0620  173  GLU B OE1 
3370 O OE2 . GLU B 173 ? 0.8439 0.9018 0.9586 0.0235  0.0006  0.0623  173  GLU B OE2 
3371 N N   . ALA B 174 ? 0.6466 0.6576 0.7279 0.0107  0.0013  0.0461  174  ALA B N   
3372 C CA  . ALA B 174 ? 0.6116 0.6209 0.6944 0.0061  0.0003  0.0434  174  ALA B CA  
3373 C C   . ALA B 174 ? 0.6002 0.6130 0.6892 0.0036  -0.0017 0.0406  174  ALA B C   
3374 O O   . ALA B 174 ? 0.5950 0.6067 0.6804 0.0047  -0.0020 0.0395  174  ALA B O   
3375 C CB  . ALA B 174 ? 0.6078 0.6079 0.6778 0.0050  0.0014  0.0418  174  ALA B CB  
3376 N N   . ASP B 175 ? 0.5839 0.6008 0.6820 0.0007  -0.0029 0.0395  175  ASP B N   
3377 C CA  . ASP B 175 ? 0.5798 0.5989 0.6832 -0.0019 -0.0048 0.0365  175  ASP B CA  
3378 C C   . ASP B 175 ? 0.5543 0.5713 0.6563 -0.0049 -0.0050 0.0343  175  ASP B C   
3379 O O   . ASP B 175 ? 0.5606 0.5777 0.6635 -0.0053 -0.0042 0.0357  175  ASP B O   
3380 C CB  . ASP B 175 ? 0.5935 0.6190 0.7088 -0.0028 -0.0060 0.0372  175  ASP B CB  
3381 C CG  . ASP B 175 ? 0.6683 0.6983 0.7869 -0.0008 -0.0062 0.0393  175  ASP B CG  
3382 O OD1 . ASP B 175 ? 0.7450 0.7761 0.8626 -0.0007 -0.0071 0.0379  175  ASP B OD1 
3383 O OD2 . ASP B 175 ? 0.7289 0.7619 0.8511 0.0005  -0.0055 0.0426  175  ASP B OD2 
3384 N N   . VAL B 176 ? 0.5248 0.5410 0.6254 -0.0069 -0.0060 0.0310  176  VAL B N   
3385 C CA  . VAL B 176 ? 0.4985 0.5147 0.5994 -0.0095 -0.0064 0.0290  176  VAL B CA  
3386 C C   . VAL B 176 ? 0.4936 0.5128 0.6010 -0.0109 -0.0079 0.0264  176  VAL B C   
3387 O O   . VAL B 176 ? 0.5034 0.5231 0.6114 -0.0106 -0.0088 0.0251  176  VAL B O   
3388 C CB  . VAL B 176 ? 0.5027 0.5138 0.5921 -0.0112 -0.0057 0.0276  176  VAL B CB  
3389 C CG1 . VAL B 176 ? 0.4876 0.4953 0.5707 -0.0108 -0.0060 0.0261  176  VAL B CG1 
3390 C CG2 . VAL B 176 ? 0.4457 0.4590 0.5363 -0.0142 -0.0063 0.0254  176  VAL B CG2 
3391 N N   . HIS B 177 ? 0.4938 0.5153 0.6061 -0.0121 -0.0082 0.0256  177  HIS B N   
3392 C CA  . HIS B 177 ? 0.5008 0.5243 0.6182 -0.0132 -0.0095 0.0227  177  HIS B CA  
3393 C C   . HIS B 177 ? 0.4923 0.5163 0.6066 -0.0148 -0.0093 0.0207  177  HIS B C   
3394 O O   . HIS B 177 ? 0.4810 0.5058 0.5941 -0.0150 -0.0085 0.0222  177  HIS B O   
3395 C CB  . HIS B 177 ? 0.5187 0.5444 0.6455 -0.0126 -0.0098 0.0238  177  HIS B CB  
3396 C CG  . HIS B 177 ? 0.5737 0.6002 0.7045 -0.0122 -0.0106 0.0246  177  HIS B CG  
3397 N ND1 . HIS B 177 ? 0.5795 0.6071 0.7115 -0.0108 -0.0100 0.0280  177  HIS B ND1 
3398 C CD2 . HIS B 177 ? 0.5736 0.6010 0.7072 -0.0131 -0.0119 0.0225  177  HIS B CD2 
3399 C CE1 . HIS B 177 ? 0.6311 0.6608 0.7668 -0.0110 -0.0110 0.0281  177  HIS B CE1 
3400 N NE2 . HIS B 177 ? 0.6171 0.6465 0.7537 -0.0126 -0.0122 0.0247  177  HIS B NE2 
3401 N N   . LEU B 178 ? 0.4909 0.5153 0.6041 -0.0159 -0.0102 0.0175  178  LEU B N   
3402 C CA  . LEU B 178 ? 0.4906 0.5170 0.6017 -0.0173 -0.0102 0.0157  178  LEU B CA  
3403 C C   . LEU B 178 ? 0.4924 0.5209 0.6102 -0.0168 -0.0110 0.0135  178  LEU B C   
3404 O O   . LEU B 178 ? 0.5003 0.5280 0.6194 -0.0170 -0.0120 0.0113  178  LEU B O   
3405 C CB  . LEU B 178 ? 0.5071 0.5316 0.6096 -0.0192 -0.0104 0.0138  178  LEU B CB  
3406 C CG  . LEU B 178 ? 0.5578 0.5853 0.6571 -0.0212 -0.0104 0.0120  178  LEU B CG  
3407 C CD1 . LEU B 178 ? 0.5888 0.6199 0.6904 -0.0211 -0.0096 0.0139  178  LEU B CD1 
3408 C CD2 . LEU B 178 ? 0.5783 0.6027 0.6670 -0.0237 -0.0102 0.0113  178  LEU B CD2 
3409 N N   . VAL B 179 ? 0.4830 0.5141 0.6050 -0.0159 -0.0105 0.0142  179  VAL B N   
3410 C CA  . VAL B 179 ? 0.4803 0.5120 0.6087 -0.0147 -0.0109 0.0126  179  VAL B CA  
3411 C C   . VAL B 179 ? 0.4892 0.5245 0.6168 -0.0143 -0.0105 0.0111  179  VAL B C   
3412 O O   . VAL B 179 ? 0.4782 0.5168 0.6049 -0.0140 -0.0097 0.0129  179  VAL B O   
3413 C CB  . VAL B 179 ? 0.4978 0.5284 0.6327 -0.0130 -0.0105 0.0152  179  VAL B CB  
3414 C CG1 . VAL B 179 ? 0.4823 0.5115 0.6224 -0.0118 -0.0109 0.0134  179  VAL B CG1 
3415 C CG2 . VAL B 179 ? 0.4809 0.5095 0.6170 -0.0132 -0.0107 0.0175  179  VAL B CG2 
3416 N N   . LEU B 180 ? 0.5033 0.5388 0.6315 -0.0142 -0.0112 0.0078  180  LEU B N   
3417 C CA  . LEU B 180 ? 0.5327 0.5721 0.6610 -0.0130 -0.0107 0.0062  180  LEU B CA  
3418 C C   . LEU B 180 ? 0.5623 0.6008 0.6966 -0.0100 -0.0102 0.0067  180  LEU B C   
3419 O O   . LEU B 180 ? 0.5841 0.6177 0.7220 -0.0094 -0.0107 0.0058  180  LEU B O   
3420 C CB  . LEU B 180 ? 0.5373 0.5772 0.6630 -0.0140 -0.0116 0.0024  180  LEU B CB  
3421 C CG  . LEU B 180 ? 0.5565 0.6001 0.6831 -0.0120 -0.0111 0.0003  180  LEU B CG  
3422 C CD1 . LEU B 180 ? 0.5340 0.5851 0.6573 -0.0125 -0.0103 0.0015  180  LEU B CD1 
3423 C CD2 . LEU B 180 ? 0.5211 0.5636 0.6462 -0.0127 -0.0120 -0.0036 180  LEU B CD2 
3424 N N   . VAL B 181 ? 0.5785 0.6216 0.7136 -0.0081 -0.0091 0.0082  181  VAL B N   
3425 C CA  . VAL B 181 ? 0.6087 0.6507 0.7483 -0.0045 -0.0084 0.0085  181  VAL B CA  
3426 C C   . VAL B 181 ? 0.6397 0.6872 0.7778 -0.0025 -0.0078 0.0067  181  VAL B C   
3427 O O   . VAL B 181 ? 0.6317 0.6865 0.7672 -0.0030 -0.0073 0.0078  181  VAL B O   
3428 C CB  . VAL B 181 ? 0.6119 0.6546 0.7545 -0.0029 -0.0074 0.0125  181  VAL B CB  
3429 C CG1 . VAL B 181 ? 0.6243 0.6626 0.7716 0.0005  -0.0068 0.0129  181  VAL B CG1 
3430 C CG2 . VAL B 181 ? 0.5964 0.6363 0.7391 -0.0054 -0.0079 0.0146  181  VAL B CG2 
3431 N N   . ARG B 182 ? 0.6843 0.7285 0.8235 -0.0005 -0.0078 0.0038  182  ARG B N   
3432 C CA  . ARG B 182 ? 0.7245 0.7738 0.8623 0.0021  -0.0070 0.0021  182  ARG B CA  
3433 C C   . ARG B 182 ? 0.7621 0.8057 0.9023 0.0062  -0.0063 0.0005  182  ARG B C   
3434 O O   . ARG B 182 ? 0.7678 0.8028 0.9102 0.0059  -0.0068 0.0000  182  ARG B O   
3435 C CB  . ARG B 182 ? 0.7243 0.7767 0.8579 -0.0005 -0.0079 -0.0010 182  ARG B CB  
3436 C CG  . ARG B 182 ? 0.7210 0.7667 0.8546 -0.0010 -0.0089 -0.0046 182  ARG B CG  
3437 C CD  . ARG B 182 ? 0.7096 0.7589 0.8389 -0.0032 -0.0096 -0.0075 182  ARG B CD  
3438 N NE  . ARG B 182 ? 0.7049 0.7473 0.8342 -0.0050 -0.0109 -0.0102 182  ARG B NE  
3439 C CZ  . ARG B 182 ? 0.7230 0.7661 0.8489 -0.0079 -0.0120 -0.0125 182  ARG B CZ  
3440 N NH1 . ARG B 182 ? 0.6961 0.7459 0.8179 -0.0096 -0.0119 -0.0125 182  ARG B NH1 
3441 N NH2 . ARG B 182 ? 0.7206 0.7579 0.8471 -0.0092 -0.0131 -0.0146 182  ARG B NH2 
3442 N N   . SER B 183 ? 0.7988 0.8055 0.8453 0.0289  -0.0443 -0.0545 183  SER B N   
3443 C CA  . SER B 183 ? 0.8365 0.8380 0.8829 0.0306  -0.0527 -0.0554 183  SER B CA  
3444 C C   . SER B 183 ? 0.8382 0.8570 0.8982 0.0311  -0.0445 -0.0580 183  SER B C   
3445 O O   . SER B 183 ? 0.8212 0.8500 0.8901 0.0286  -0.0379 -0.0624 183  SER B O   
3446 C CB  . SER B 183 ? 0.8685 0.8591 0.9280 0.0355  -0.0718 -0.0613 183  SER B CB  
3447 O OG  . SER B 183 ? 0.8961 0.8586 0.9267 0.0291  -0.0856 -0.0552 183  SER B OG  
3448 N N   . GLU B 184 ? 0.8678 0.8849 0.9208 0.0291  -0.0439 -0.0559 184  GLU B N   
3449 C CA  . GLU B 184 ? 0.8966 0.9242 0.9518 0.0244  -0.0375 -0.0575 184  GLU B CA  
3450 C C   . GLU B 184 ? 0.9539 0.9795 1.0134 0.0238  -0.0388 -0.0635 184  GLU B C   
3451 O O   . GLU B 184 ? 0.9828 0.9933 1.0391 0.0277  -0.0488 -0.0625 184  GLU B O   
3452 C CB  . GLU B 184 ? 0.8730 0.9025 0.9218 0.0215  -0.0378 -0.0488 184  GLU B CB  
3453 C CG  . GLU B 184 ? 0.8343 0.8629 0.8901 0.0240  -0.0399 -0.0454 184  GLU B CG  
3454 C CD  . GLU B 184 ? 0.8272 0.8555 0.8967 0.0242  -0.0497 -0.0409 184  GLU B CD  
3455 O OE1 . GLU B 184 ? 0.8660 0.8923 0.9311 0.0198  -0.0581 -0.0373 184  GLU B OE1 
3456 O OE2 . GLU B 184 ? 0.7629 0.7917 0.8536 0.0286  -0.0522 -0.0431 184  GLU B OE2 
3457 N N   . ILE B 185 ? 0.9933 1.0271 1.0534 0.0149  -0.0299 -0.0701 185  ILE B N   
3458 C CA  . ILE B 185 ? 1.0517 1.0860 1.1227 0.0131  -0.0278 -0.0803 185  ILE B CA  
3459 C C   . ILE B 185 ? 1.0744 1.1087 1.1237 0.0052  -0.0248 -0.0728 185  ILE B C   
3460 O O   . ILE B 185 ? 1.0775 1.1125 1.1076 -0.0057 -0.0229 -0.0669 185  ILE B O   
3461 C CB  . ILE B 185 ? 1.0893 1.1350 1.1858 0.0030  -0.0135 -0.1043 185  ILE B CB  
3462 C CG1 . ILE B 185 ? 1.0755 1.1262 1.2024 0.0095  -0.0160 -0.1159 185  ILE B CG1 
3463 C CG2 . ILE B 185 ? 1.1245 1.1719 1.2494 0.0036  -0.0119 -0.1213 185  ILE B CG2 
3464 C CD1 . ILE B 185 ? 1.0963 1.1614 1.2415 -0.0100 0.0085  -0.1436 185  ILE B CD1 
3465 N N   . SER B 186 ? 1.1063 1.1341 1.1560 0.0088  -0.0286 -0.0724 186  SER B N   
3466 C CA  . SER B 186 ? 1.1347 1.1651 1.1699 0.0012  -0.0254 -0.0687 186  SER B CA  
3467 C C   . SER B 186 ? 1.1989 1.2343 1.2368 -0.0107 -0.0148 -0.0818 186  SER B C   
3468 O O   . SER B 186 ? 1.2234 1.2617 1.2857 -0.0114 -0.0080 -0.0990 186  SER B O   
3469 C CB  . SER B 186 ? 1.1465 1.1648 1.1746 0.0044  -0.0293 -0.0652 186  SER B CB  
3470 O OG  . SER B 186 ? 1.1946 1.1988 1.2291 0.0061  -0.0331 -0.0723 186  SER B OG  
3471 N N   . GLN B 187 ? 1.2338 1.2707 1.2527 -0.0220 -0.0131 -0.0782 187  GLN B N   
3472 C CA  . GLN B 187 ? 1.3047 1.3435 1.3197 -0.0386 0.0003  -0.0929 187  GLN B CA  
3473 C C   . GLN B 187 ? 1.3403 1.3787 1.3900 -0.0290 0.0045  -0.1089 187  GLN B C   
3474 O O   . GLN B 187 ? 1.3874 1.4320 1.4631 -0.0373 0.0186  -0.1326 187  GLN B O   
3475 C CB  . GLN B 187 ? 1.3331 1.3700 1.3228 -0.0503 -0.0039 -0.0850 187  GLN B CB  
3476 C CG  . GLN B 187 ? 1.3457 1.3734 1.3051 -0.0622 -0.0191 -0.0704 187  GLN B CG  
3477 C CD  . GLN B 187 ? 1.4141 1.4350 1.3494 -0.0778 -0.0299 -0.0652 187  GLN B CD  
3478 O OE1 . GLN B 187 ? 1.4285 1.4399 1.3554 -0.0791 -0.0563 -0.0510 187  GLN B OE1 
3479 N NE2 . GLN B 187 ? 1.4637 1.4881 1.3945 -0.0893 -0.0134 -0.0784 187  GLN B NE2 
3480 N N   . GLU B 188 ? 1.3388 1.3655 1.3902 -0.0148 -0.0084 -0.0988 188  GLU B N   
3481 C CA  . GLU B 188 ? 1.3846 1.3955 1.4605 -0.0065 -0.0160 -0.1086 188  GLU B CA  
3482 C C   . GLU B 188 ? 1.3929 1.3994 1.5112 0.0052  -0.0271 -0.1213 188  GLU B C   
3483 O O   . GLU B 188 ? 1.4387 1.4274 1.5907 0.0145  -0.0435 -0.1315 188  GLU B O   
3484 C CB  . GLU B 188 ? 1.3889 1.3742 1.4361 -0.0032 -0.0291 -0.0925 188  GLU B CB  
3485 C CG  . GLU B 188 ? 1.3688 1.3628 1.3896 -0.0146 -0.0177 -0.0869 188  GLU B CG  
3486 C CD  . GLU B 188 ? 1.2802 1.2953 1.2920 -0.0178 -0.0139 -0.0789 188  GLU B CD  
3487 O OE1 . GLU B 188 ? 1.1772 1.1929 1.1906 -0.0115 -0.0188 -0.0730 188  GLU B OE1 
3488 O OE2 . GLU B 188 ? 1.2637 1.2919 1.2706 -0.0267 -0.0100 -0.0795 188  GLU B OE2 
3489 N N   . GLY B 189 ? 1.3615 1.3817 1.4820 0.0049  -0.0221 -0.1214 189  GLY B N   
3490 C CA  . GLY B 189 ? 1.3683 1.3892 1.5343 0.0154  -0.0322 -0.1360 189  GLY B CA  
3491 C C   . GLY B 189 ? 1.3531 1.3491 1.5063 0.0294  -0.0604 -0.1171 189  GLY B C   
3492 O O   . GLY B 189 ? 1.3421 1.3379 1.5309 0.0382  -0.0733 -0.1269 189  GLY B O   
3493 N N   . MET B 190 ? 1.3601 1.3337 1.4621 0.0270  -0.0682 -0.0938 190  MET B N   
3494 C CA  . MET B 190 ? 1.3731 1.3135 1.4468 0.0298  -0.0913 -0.0780 190  MET B CA  
3495 C C   . MET B 190 ? 1.2965 1.2534 1.3624 0.0302  -0.0829 -0.0728 190  MET B C   
3496 O O   . MET B 190 ? 1.2526 1.2335 1.3059 0.0247  -0.0617 -0.0691 190  MET B O   
3497 C CB  . MET B 190 ? 1.4153 1.3231 1.4315 0.0171  -0.0938 -0.0624 190  MET B CB  
3498 C CG  . MET B 190 ? 1.5110 1.3650 1.4829 0.0093  -0.1212 -0.0490 190  MET B CG  
3499 S SD  . MET B 190 ? 1.6286 1.4586 1.5228 -0.0193 -0.1013 -0.0388 190  MET B SD  
3500 C CE  . MET B 190 ? 1.7103 1.4560 1.5375 -0.0375 -0.1425 -0.0238 190  MET B CE  
3501 N N   . VAL B 191 ? 1.2846 1.2249 1.3614 0.0368  -0.1044 -0.0728 191  VAL B N   
3502 C CA  . VAL B 191 ? 1.2149 1.1681 1.2870 0.0372  -0.0978 -0.0694 191  VAL B CA  
3503 C C   . VAL B 191 ? 1.2065 1.1280 1.2223 0.0259  -0.1040 -0.0530 191  VAL B C   
3504 O O   . VAL B 191 ? 1.2755 1.1507 1.2613 0.0196  -0.1308 -0.0453 191  VAL B O   
3505 C CB  . VAL B 191 ? 1.2211 1.1800 1.3439 0.0481  -0.1141 -0.0845 191  VAL B CB  
3506 C CG1 . VAL B 191 ? 1.1798 1.1322 1.2825 0.0469  -0.1193 -0.0756 191  VAL B CG1 
3507 C CG2 . VAL B 191 ? 1.1989 1.1990 1.3697 0.0478  -0.0882 -0.1081 191  VAL B CG2 
3508 N N   . PHE B 192 ? 1.1270 1.0679 1.1279 0.0197  -0.0805 -0.0499 192  PHE B N   
3509 C CA  . PHE B 192 ? 1.1091 1.0272 1.0643 0.0023  -0.0736 -0.0445 192  PHE B CA  
3510 C C   . PHE B 192 ? 1.0302 0.9727 0.9973 0.0024  -0.0560 -0.0479 192  PHE B C   
3511 O O   . PHE B 192 ? 0.9752 0.9495 0.9775 0.0147  -0.0496 -0.0502 192  PHE B O   
3512 C CB  . PHE B 192 ? 1.1302 1.0451 1.0656 -0.0106 -0.0579 -0.0466 192  PHE B CB  
3513 C CG  . PHE B 192 ? 1.0789 1.0375 1.0508 -0.0034 -0.0383 -0.0530 192  PHE B CG  
3514 C CD1 . PHE B 192 ? 1.0408 1.0151 1.0223 -0.0115 -0.0196 -0.0619 192  PHE B CD1 
3515 C CD2 . PHE B 192 ? 1.0699 1.0503 1.0695 0.0084  -0.0410 -0.0531 192  PHE B CD2 
3516 C CE1 . PHE B 192 ? 0.9929 0.9999 1.0148 -0.0034 -0.0143 -0.0667 192  PHE B CE1 
3517 C CE2 . PHE B 192 ? 1.0549 1.0628 1.0754 0.0103  -0.0322 -0.0551 192  PHE B CE2 
3518 C CZ  . PHE B 192 ? 1.0182 1.0373 1.0518 0.0067  -0.0242 -0.0598 192  PHE B CZ  
3519 N N   . ARG B 193 ? 1.0246 0.9460 0.9575 -0.0158 -0.0481 -0.0498 193  ARG B N   
3520 C CA  . ARG B 193 ? 0.9527 0.8943 0.9027 -0.0174 -0.0306 -0.0574 193  ARG B CA  
3521 C C   . ARG B 193 ? 0.9075 0.8779 0.8901 -0.0187 -0.0087 -0.0696 193  ARG B C   
3522 O O   . ARG B 193 ? 0.9391 0.9009 0.9067 -0.0367 0.0061  -0.0802 193  ARG B O   
3523 C CB  . ARG B 193 ? 0.9869 0.8930 0.8881 -0.0425 -0.0269 -0.0606 193  ARG B CB  
3524 C CG  . ARG B 193 ? 1.0498 0.9221 0.9229 -0.0408 -0.0592 -0.0478 193  ARG B CG  
3525 C CD  . ARG B 193 ? 1.0156 0.9199 0.9377 -0.0167 -0.0660 -0.0474 193  ARG B CD  
3526 N NE  . ARG B 193 ? 0.9989 0.9027 0.9122 -0.0265 -0.0549 -0.0525 193  ARG B NE  
3527 C CZ  . ARG B 193 ? 0.9615 0.8913 0.9114 -0.0111 -0.0541 -0.0543 193  ARG B CZ  
3528 N NH1 . ARG B 193 ? 0.9619 0.9177 0.9535 0.0096  -0.0606 -0.0535 193  ARG B NH1 
3529 N NH2 . ARG B 193 ? 0.9079 0.8351 0.8491 -0.0212 -0.0434 -0.0598 193  ARG B NH2 
3530 N N   . ARG B 194 ? 0.8126 0.8301 0.9601 0.0039  -0.0078 0.0011  194  ARG B N   
3531 C CA  . ARG B 194 ? 0.7896 0.8039 0.9370 -0.0003 -0.0095 -0.0001 194  ARG B CA  
3532 C C   . ARG B 194 ? 0.7328 0.7528 0.8797 -0.0032 -0.0101 0.0020  194  ARG B C   
3533 O O   . ARG B 194 ? 0.7073 0.7341 0.8521 -0.0028 -0.0096 0.0029  194  ARG B O   
3534 C CB  . ARG B 194 ? 0.8095 0.8224 0.9541 -0.0013 -0.0104 -0.0047 194  ARG B CB  
3535 C CG  . ARG B 194 ? 0.8396 0.8485 0.9843 -0.0055 -0.0121 -0.0062 194  ARG B CG  
3536 C CD  . ARG B 194 ? 0.9344 0.9403 1.0765 -0.0060 -0.0128 -0.0109 194  ARG B CD  
3537 N NE  . ARG B 194 ? 1.0088 1.0080 1.1519 -0.0091 -0.0141 -0.0122 194  ARG B NE  
3538 C CZ  . ARG B 194 ? 1.0597 1.0512 1.2043 -0.0087 -0.0138 -0.0115 194  ARG B CZ  
3539 N NH1 . ARG B 194 ? 1.0919 1.0816 1.2374 -0.0048 -0.0121 -0.0095 194  ARG B NH1 
3540 N NH2 . ARG B 194 ? 1.0431 1.0290 1.1882 -0.0124 -0.0151 -0.0126 194  ARG B NH2 
3541 N N   . PHE B 195 ? 0.6998 0.7168 0.8482 -0.0060 -0.0111 0.0030  195  PHE B N   
3542 C CA  . PHE B 195 ? 0.6455 0.6661 0.7932 -0.0082 -0.0115 0.0054  195  PHE B CA  
3543 C C   . PHE B 195 ? 0.6366 0.6570 0.7819 -0.0109 -0.0129 0.0030  195  PHE B C   
3544 O O   . PHE B 195 ? 0.6554 0.6719 0.8019 -0.0122 -0.0139 0.0010  195  PHE B O   
3545 C CB  . PHE B 195 ? 0.6317 0.6497 0.7831 -0.0086 -0.0114 0.0089  195  PHE B CB  
3546 C CG  . PHE B 195 ? 0.6353 0.6545 0.7887 -0.0061 -0.0100 0.0121  195  PHE B CG  
3547 C CD1 . PHE B 195 ? 0.7105 0.7260 0.8661 -0.0034 -0.0092 0.0121  195  PHE B CD1 
3548 C CD2 . PHE B 195 ? 0.6026 0.6262 0.7552 -0.0063 -0.0095 0.0152  195  PHE B CD2 
3549 C CE1 . PHE B 195 ? 0.6982 0.7154 0.8556 -0.0007 -0.0079 0.0155  195  PHE B CE1 
3550 C CE2 . PHE B 195 ? 0.6174 0.6427 0.7718 -0.0041 -0.0082 0.0184  195  PHE B CE2 
3551 C CZ  . PHE B 195 ? 0.6544 0.6771 0.8115 -0.0013 -0.0075 0.0186  195  PHE B CZ  
3552 N N   . HIS B 196 ? 0.6031 0.6276 0.7445 -0.0120 -0.0130 0.0032  196  HIS B N   
3553 C CA  . HIS B 196 ? 0.5845 0.6089 0.7233 -0.0144 -0.0142 0.0016  196  HIS B CA  
3554 C C   . HIS B 196 ? 0.5581 0.5842 0.6943 -0.0153 -0.0140 0.0044  196  HIS B C   
3555 O O   . HIS B 196 ? 0.5500 0.5785 0.6827 -0.0151 -0.0132 0.0055  196  HIS B O   
3556 C CB  . HIS B 196 ? 0.5882 0.6148 0.7228 -0.0147 -0.0145 -0.0017 196  HIS B CB  
3557 C CG  . HIS B 196 ? 0.5914 0.6169 0.7273 -0.0131 -0.0143 -0.0046 196  HIS B CG  
3558 N ND1 . HIS B 196 ? 0.5953 0.6182 0.7311 -0.0140 -0.0153 -0.0080 196  HIS B ND1 
3559 C CD2 . HIS B 196 ? 0.5750 0.6019 0.7117 -0.0105 -0.0131 -0.0046 196  HIS B CD2 
3560 C CE1 . HIS B 196 ? 0.5644 0.5861 0.7005 -0.0118 -0.0146 -0.0101 196  HIS B CE1 
3561 N NE2 . HIS B 196 ? 0.6123 0.6366 0.7491 -0.0094 -0.0133 -0.0080 196  HIS B NE2 
3562 N N   . ASP B 197 ? 0.5514 0.5762 0.6891 -0.0163 -0.0147 0.0056  197  ASP B N   
3563 C CA  . ASP B 197 ? 0.5210 0.5468 0.6559 -0.0165 -0.0145 0.0082  197  ASP B CA  
3564 C C   . ASP B 197 ? 0.5232 0.5495 0.6525 -0.0176 -0.0150 0.0061  197  ASP B C   
3565 O O   . ASP B 197 ? 0.5353 0.5615 0.6652 -0.0185 -0.0162 0.0043  197  ASP B O   
3566 C CB  . ASP B 197 ? 0.5313 0.5565 0.6702 -0.0170 -0.0151 0.0100  197  ASP B CB  
3567 C CG  . ASP B 197 ? 0.5458 0.5721 0.6824 -0.0163 -0.0145 0.0133  197  ASP B CG  
3568 O OD1 . ASP B 197 ? 0.5398 0.5660 0.6718 -0.0156 -0.0134 0.0145  197  ASP B OD1 
3569 O OD2 . ASP B 197 ? 0.5490 0.5764 0.6881 -0.0166 -0.0151 0.0147  197  ASP B OD2 
3570 N N   . LEU B 198 ? 0.5089 0.5358 0.6322 -0.0177 -0.0143 0.0063  198  LEU B N   
3571 C CA  . LEU B 198 ? 0.4906 0.5175 0.6076 -0.0189 -0.0148 0.0042  198  LEU B CA  
3572 C C   . LEU B 198 ? 0.4897 0.5151 0.6032 -0.0188 -0.0149 0.0057  198  LEU B C   
3573 O O   . LEU B 198 ? 0.4729 0.4972 0.5854 -0.0178 -0.0141 0.0088  198  LEU B O   
3574 C CB  . LEU B 198 ? 0.4893 0.5172 0.6007 -0.0197 -0.0139 0.0041  198  LEU B CB  
3575 C CG  . LEU B 198 ? 0.4869 0.5178 0.6013 -0.0193 -0.0135 0.0030  198  LEU B CG  
3576 C CD1 . LEU B 198 ? 0.5060 0.5396 0.6149 -0.0206 -0.0128 0.0034  198  LEU B CD1 
3577 C CD2 . LEU B 198 ? 0.5044 0.5362 0.6210 -0.0192 -0.0144 -0.0004 198  LEU B CD2 
3578 N N   . THR B 199 ? 0.5082 0.5337 0.6197 -0.0194 -0.0159 0.0036  199  THR B N   
3579 C CA  . THR B 199 ? 0.5236 0.5481 0.6308 -0.0188 -0.0160 0.0049  199  THR B CA  
3580 C C   . THR B 199 ? 0.5352 0.5564 0.6333 -0.0187 -0.0149 0.0063  199  THR B C   
3581 O O   . THR B 199 ? 0.5341 0.5545 0.6272 -0.0203 -0.0147 0.0046  199  THR B O   
3582 C CB  . THR B 199 ? 0.5381 0.5638 0.6442 -0.0198 -0.0173 0.0022  199  THR B CB  
3583 O OG1 . THR B 199 ? 0.5588 0.5867 0.6723 -0.0203 -0.0185 0.0008  199  THR B OG1 
3584 C CG2 . THR B 199 ? 0.5531 0.5782 0.6547 -0.0186 -0.0174 0.0037  199  THR B CG2 
3585 N N   . LEU B 200 ? 0.5299 0.5491 0.6254 -0.0169 -0.0140 0.0094  200  LEU B N   
3586 C CA  . LEU B 200 ? 0.5219 0.5364 0.6079 -0.0166 -0.0127 0.0109  200  LEU B CA  
3587 C C   . LEU B 200 ? 0.5501 0.5621 0.6298 -0.0150 -0.0127 0.0115  200  LEU B C   
3588 O O   . LEU B 200 ? 0.5521 0.5671 0.6362 -0.0133 -0.0133 0.0123  200  LEU B O   
3589 C CB  . LEU B 200 ? 0.4945 0.5080 0.5814 -0.0152 -0.0115 0.0141  200  LEU B CB  
3590 C CG  . LEU B 200 ? 0.4888 0.5050 0.5820 -0.0163 -0.0114 0.0140  200  LEU B CG  
3591 C CD1 . LEU B 200 ? 0.4399 0.4548 0.5325 -0.0153 -0.0101 0.0171  200  LEU B CD1 
3592 C CD2 . LEU B 200 ? 0.4483 0.4652 0.5390 -0.0189 -0.0117 0.0114  200  LEU B CD2 
3593 N N   . THR B 201 ? 0.5551 0.5615 0.6240 -0.0156 -0.0119 0.0113  201  THR B N   
3594 C CA  . THR B 201 ? 0.5827 0.5859 0.6449 -0.0133 -0.0116 0.0124  201  THR B CA  
3595 C C   . THR B 201 ? 0.5948 0.5976 0.6578 -0.0095 -0.0105 0.0160  201  THR B C   
3596 O O   . THR B 201 ? 0.5857 0.5902 0.6490 -0.0067 -0.0106 0.0173  201  THR B O   
3597 C CB  . THR B 201 ? 0.5955 0.5912 0.6448 -0.0147 -0.0107 0.0118  201  THR B CB  
3598 O OG1 . THR B 201 ? 0.6220 0.6128 0.6658 -0.0153 -0.0093 0.0134  201  THR B OG1 
3599 C CG2 . THR B 201 ? 0.5783 0.5755 0.6268 -0.0186 -0.0118 0.0085  201  THR B CG2 
3600 N N   . ARG B 202 ? 0.5987 0.5999 0.6620 -0.0094 -0.0094 0.0177  202  ARG B N   
3601 C CA  A ARG B 202 ? 0.6136 0.6153 0.6786 -0.0059 -0.0083 0.0212  202  ARG B CA  
3602 C CA  B ARG B 202 ? 0.6176 0.6192 0.6823 -0.0059 -0.0083 0.0212  202  ARG B CA  
3603 C C   . ARG B 202 ? 0.6027 0.6074 0.6751 -0.0070 -0.0082 0.0220  202  ARG B C   
3604 O O   . ARG B 202 ? 0.5866 0.5889 0.6565 -0.0093 -0.0078 0.0212  202  ARG B O   
3605 C CB  A ARG B 202 ? 0.6326 0.6259 0.6850 -0.0035 -0.0064 0.0231  202  ARG B CB  
3606 C CB  B ARG B 202 ? 0.6392 0.6322 0.6912 -0.0036 -0.0063 0.0231  202  ARG B CB  
3607 C CG  A ARG B 202 ? 0.6640 0.6577 0.7175 0.0003  -0.0050 0.0268  202  ARG B CG  
3608 C CG  B ARG B 202 ? 0.6863 0.6788 0.7386 -0.0002 -0.0048 0.0266  202  ARG B CG  
3609 C CD  A ARG B 202 ? 0.7084 0.6932 0.7484 0.0040  -0.0029 0.0288  202  ARG B CD  
3610 C CD  B ARG B 202 ? 0.7660 0.7494 0.8047 0.0033  -0.0027 0.0286  202  ARG B CD  
3611 N NE  A ARG B 202 ? 0.7104 0.6987 0.7528 0.0093  -0.0020 0.0322  202  ARG B NE  
3612 N NE  B ARG B 202 ? 0.8015 0.7751 0.8278 0.0005  -0.0019 0.0270  202  ARG B NE  
3613 C CZ  A ARG B 202 ? 0.7303 0.7238 0.7755 0.0121  -0.0026 0.0330  202  ARG B CZ  
3614 C CZ  B ARG B 202 ? 0.8124 0.7792 0.8310 -0.0003 -0.0005 0.0279  202  ARG B CZ  
3615 N NH1 A ARG B 202 ? 0.7552 0.7499 0.8008 0.0100  -0.0040 0.0305  202  ARG B NH1 
3616 N NH1 B ARG B 202 ? 0.8173 0.7858 0.8393 0.0018  0.0004  0.0303  202  ARG B NH1 
3617 N NH2 A ARG B 202 ? 0.7474 0.7456 0.7952 0.0168  -0.0017 0.0364  202  ARG B NH2 
3618 N NH2 B ARG B 202 ? 0.8309 0.7891 0.8380 -0.0036 0.0000  0.0263  202  ARG B NH2 
3619 N N   . SER B 203 ? 0.6134 0.6238 0.6949 -0.0054 -0.0086 0.0238  203  SER B N   
3620 C CA  . SER B 203 ? 0.6171 0.6301 0.7056 -0.0064 -0.0085 0.0247  203  SER B CA  
3621 C C   . SER B 203 ? 0.6368 0.6507 0.7266 -0.0035 -0.0072 0.0285  203  SER B C   
3622 O O   . SER B 203 ? 0.6333 0.6479 0.7267 -0.0040 -0.0068 0.0297  203  SER B O   
3623 C CB  . SER B 203 ? 0.6104 0.6291 0.7095 -0.0083 -0.0102 0.0230  203  SER B CB  
3624 O OG  . SER B 203 ? 0.6270 0.6501 0.7320 -0.0065 -0.0104 0.0253  203  SER B OG  
3625 N N   . ARG B 204 ? 0.6688 0.6831 0.7558 -0.0001 -0.0067 0.0306  204  ARG B N   
3626 C CA  . ARG B 204 ? 0.6869 0.7024 0.7742 0.0031  -0.0053 0.0344  204  ARG B CA  
3627 C C   . ARG B 204 ? 0.7103 0.7183 0.7848 0.0061  -0.0035 0.0354  204  ARG B C   
3628 O O   . ARG B 204 ? 0.7368 0.7429 0.8060 0.0076  -0.0035 0.0347  204  ARG B O   
3629 C CB  . ARG B 204 ? 0.7020 0.7258 0.7973 0.0048  -0.0062 0.0363  204  ARG B CB  
3630 C CG  . ARG B 204 ? 0.7310 0.7573 0.8246 0.0096  -0.0046 0.0405  204  ARG B CG  
3631 C CD  . ARG B 204 ? 0.7475 0.7727 0.8415 0.0107  -0.0031 0.0431  204  ARG B CD  
3632 N NE  . ARG B 204 ? 0.7748 0.8060 0.8801 0.0080  -0.0042 0.0437  204  ARG B NE  
3633 C CZ  . ARG B 204 ? 0.8301 0.8688 0.9426 0.0092  -0.0043 0.0468  204  ARG B CZ  
3634 N NH1 . ARG B 204 ? 0.8789 0.9212 0.9888 0.0134  -0.0033 0.0497  204  ARG B NH1 
3635 N NH2 . ARG B 204 ? 0.7971 0.8400 0.9191 0.0062  -0.0053 0.0472  204  ARG B NH2 
3636 N N   . SER B 205 ? 0.7279 0.7308 0.7967 0.0069  -0.0018 0.0368  205  SER B N   
3637 C CA  . SER B 205 ? 0.7616 0.7562 0.8174 0.0103  0.0002  0.0383  205  SER B CA  
3638 C C   . SER B 205 ? 0.7919 0.7893 0.8489 0.0151  0.0018  0.0423  205  SER B C   
3639 O O   . SER B 205 ? 0.7891 0.7893 0.8513 0.0145  0.0021  0.0438  205  SER B O   
3640 C CB  . SER B 205 ? 0.7493 0.7352 0.7956 0.0075  0.0011  0.0369  205  SER B CB  
3641 O OG  . SER B 205 ? 0.7805 0.7583 0.8150 0.0111  0.0034  0.0389  205  SER B OG  
3642 N N   . PRO B 206 ? 0.8237 0.8206 0.8756 0.0202  0.0029  0.0443  206  PRO B N   
3643 C CA  . PRO B 206 ? 0.8342 0.8375 0.8907 0.0245  0.0039  0.0482  206  PRO B CA  
3644 C C   . PRO B 206 ? 0.8439 0.8396 0.8912 0.0270  0.0064  0.0501  206  PRO B C   
3645 O O   . PRO B 206 ? 0.8520 0.8526 0.9042 0.0290  0.0072  0.0529  206  PRO B O   
3646 C CB  . PRO B 206 ? 0.8579 0.8647 0.9126 0.0292  0.0041  0.0498  206  PRO B CB  
3647 C CG  . PRO B 206 ? 0.8685 0.8657 0.9123 0.0282  0.0040  0.0468  206  PRO B CG  
3648 C CD  . PRO B 206 ? 0.8515 0.8407 0.8912 0.0229  0.0038  0.0438  206  PRO B CD  
3649 N N   . ILE B 207 ? 0.8301 0.8137 0.8640 0.0264  0.0075  0.0483  207  ILE B N   
3650 C CA  . ILE B 207 ? 0.8435 0.8188 0.8683 0.0269  0.0095  0.0491  207  ILE B CA  
3651 C C   . ILE B 207 ? 0.8295 0.7958 0.8466 0.0213  0.0091  0.0458  207  ILE B C   
3652 O O   . ILE B 207 ? 0.8471 0.8058 0.8548 0.0206  0.0092  0.0439  207  ILE B O   
3653 C CB  . ILE B 207 ? 0.8924 0.8600 0.9042 0.0336  0.0122  0.0514  207  ILE B CB  
3654 C CG1 . ILE B 207 ? 0.9120 0.8902 0.9317 0.0395  0.0128  0.0552  207  ILE B CG1 
3655 C CG2 . ILE B 207 ? 0.9058 0.8621 0.9055 0.0334  0.0143  0.0516  207  ILE B CG2 
3656 C CD1 . ILE B 207 ? 0.9884 0.9601 0.9959 0.0470  0.0158  0.0580  207  ILE B CD1 
3657 N N   . PHE B 208 ? 0.8105 0.7784 0.8316 0.0173  0.0087  0.0454  208  PHE B N   
3658 C CA  . PHE B 208 ? 0.7924 0.7546 0.8081 0.0113  0.0081  0.0425  208  PHE B CA  
3659 C C   . PHE B 208 ? 0.8135 0.7664 0.8171 0.0111  0.0101  0.0433  208  PHE B C   
3660 O O   . PHE B 208 ? 0.8174 0.7739 0.8254 0.0115  0.0107  0.0452  208  PHE B O   
3661 C CB  . PHE B 208 ? 0.7546 0.7266 0.7840 0.0070  0.0061  0.0416  208  PHE B CB  
3662 C CG  . PHE B 208 ? 0.7322 0.7012 0.7578 0.0010  0.0055  0.0392  208  PHE B CG  
3663 C CD1 . PHE B 208 ? 0.7423 0.7057 0.7599 -0.0020 0.0049  0.0365  208  PHE B CD1 
3664 C CD2 . PHE B 208 ? 0.7310 0.7040 0.7615 -0.0015 0.0053  0.0398  208  PHE B CD2 
3665 C CE1 . PHE B 208 ? 0.7172 0.6796 0.7319 -0.0076 0.0042  0.0345  208  PHE B CE1 
3666 C CE2 . PHE B 208 ? 0.7079 0.6801 0.7354 -0.0069 0.0046  0.0379  208  PHE B CE2 
3667 C CZ  . PHE B 208 ? 0.7054 0.6727 0.7251 -0.0101 0.0041  0.0352  208  PHE B CZ  
3668 N N   . SER B 209 ? 0.8371 0.7777 0.8251 0.0102  0.0112  0.0420  209  SER B N   
3669 C CA  . SER B 209 ? 0.8689 0.7992 0.8436 0.0097  0.0132  0.0426  209  SER B CA  
3670 C C   . SER B 209 ? 0.8514 0.7752 0.8174 0.0024  0.0127  0.0401  209  SER B C   
3671 O O   . SER B 209 ? 0.8731 0.7932 0.8333 0.0001  0.0136  0.0405  209  SER B O   
3672 C CB  . SER B 209 ? 0.9122 0.8311 0.8727 0.0158  0.0158  0.0441  209  SER B CB  
3673 O OG  . SER B 209 ? 0.9558 0.8760 0.9177 0.0197  0.0155  0.0442  209  SER B OG  
3674 N N   . LEU B 210 ? 0.8230 0.7460 0.7877 -0.0013 0.0113  0.0375  210  LEU B N   
3675 C CA  . LEU B 210 ? 0.8111 0.7277 0.7658 -0.0084 0.0109  0.0354  210  LEU B CA  
3676 C C   . LEU B 210 ? 0.7692 0.6959 0.7343 -0.0141 0.0084  0.0333  210  LEU B C   
3677 O O   . LEU B 210 ? 0.7474 0.6822 0.7204 -0.0172 0.0076  0.0334  210  LEU B O   
3678 C CB  . LEU B 210 ? 0.8494 0.7513 0.7867 -0.0084 0.0120  0.0342  210  LEU B CB  
3679 C CG  . LEU B 210 ? 0.8988 0.7887 0.8233 -0.0022 0.0148  0.0362  210  LEU B CG  
3680 C CD1 . LEU B 210 ? 0.9080 0.7864 0.8199 0.0003  0.0158  0.0356  210  LEU B CD1 
3681 C CD2 . LEU B 210 ? 0.9220 0.8026 0.8342 -0.0049 0.0164  0.0365  210  LEU B CD2 
3682 N N   . SER B 211 ? 0.7563 0.6827 0.7210 -0.0152 0.0073  0.0314  211  SER B N   
3683 C CA  . SER B 211 ? 0.7258 0.6606 0.6981 -0.0204 0.0052  0.0292  211  SER B CA  
3684 C C   . SER B 211 ? 0.6979 0.6388 0.6799 -0.0175 0.0039  0.0284  211  SER B C   
3685 O O   . SER B 211 ? 0.7282 0.6641 0.7060 -0.0133 0.0047  0.0289  211  SER B O   
3686 C CB  . SER B 211 ? 0.7417 0.6687 0.7002 -0.0270 0.0051  0.0273  211  SER B CB  
3687 O OG  . SER B 211 ? 0.7264 0.6629 0.6927 -0.0316 0.0031  0.0254  211  SER B OG  
3688 N N   . TRP B 212 ? 0.6521 0.6041 0.6468 -0.0197 0.0021  0.0271  212  TRP B N   
3689 C CA  . TRP B 212 ? 0.6124 0.5707 0.6170 -0.0171 0.0008  0.0263  212  TRP B CA  
3690 C C   . TRP B 212 ? 0.5898 0.5546 0.5996 -0.0218 -0.0009 0.0237  212  TRP B C   
3691 O O   . TRP B 212 ? 0.5646 0.5363 0.5813 -0.0242 -0.0015 0.0237  212  TRP B O   
3692 C CB  . TRP B 212 ? 0.5970 0.5635 0.6152 -0.0129 0.0006  0.0282  212  TRP B CB  
3693 C CG  . TRP B 212 ? 0.5611 0.5348 0.5901 -0.0109 -0.0007 0.0274  212  TRP B CG  
3694 C CD1 . TRP B 212 ? 0.5503 0.5239 0.5783 -0.0117 -0.0017 0.0253  212  TRP B CD1 
3695 C CD2 . TRP B 212 ? 0.5546 0.5364 0.5966 -0.0079 -0.0012 0.0289  212  TRP B CD2 
3696 N NE1 . TRP B 212 ? 0.5236 0.5048 0.5630 -0.0095 -0.0029 0.0252  212  TRP B NE1 
3697 C CE2 . TRP B 212 ? 0.5181 0.5043 0.5662 -0.0074 -0.0027 0.0274  212  TRP B CE2 
3698 C CE3 . TRP B 212 ? 0.5159 0.5017 0.5648 -0.0060 -0.0007 0.0315  212  TRP B CE3 
3699 C CZ2 . TRP B 212 ? 0.5275 0.5215 0.5877 -0.0055 -0.0036 0.0282  212  TRP B CZ2 
3700 C CZ3 . TRP B 212 ? 0.5157 0.5093 0.5768 -0.0040 -0.0016 0.0324  212  TRP B CZ3 
3701 C CH2 . TRP B 212 ? 0.5030 0.5004 0.5695 -0.0039 -0.0031 0.0307  212  TRP B CH2 
3702 N N   . THR B 213 ? 0.5969 0.5594 0.6025 -0.0230 -0.0016 0.0218  213  THR B N   
3703 C CA  . THR B 213 ? 0.5965 0.5657 0.6068 -0.0271 -0.0031 0.0193  213  THR B CA  
3704 C C   . THR B 213 ? 0.5740 0.5514 0.5976 -0.0242 -0.0044 0.0185  213  THR B C   
3705 O O   . THR B 213 ? 0.5895 0.5649 0.6128 -0.0212 -0.0045 0.0185  213  THR B O   
3706 C CB  . THR B 213 ? 0.6186 0.5809 0.6164 -0.0308 -0.0032 0.0175  213  THR B CB  
3707 O OG1 . THR B 213 ? 0.6597 0.6141 0.6448 -0.0342 -0.0021 0.0182  213  THR B OG1 
3708 C CG2 . THR B 213 ? 0.6023 0.5726 0.6052 -0.0348 -0.0048 0.0150  213  THR B CG2 
3709 N N   . VAL B 214 ? 0.5447 0.5311 0.5797 -0.0250 -0.0053 0.0181  214  VAL B N   
3710 C CA  . VAL B 214 ? 0.5253 0.5187 0.5726 -0.0226 -0.0065 0.0173  214  VAL B CA  
3711 C C   . VAL B 214 ? 0.5341 0.5311 0.5827 -0.0252 -0.0078 0.0143  214  VAL B C   
3712 O O   . VAL B 214 ? 0.5487 0.5479 0.5951 -0.0287 -0.0079 0.0133  214  VAL B O   
3713 C CB  . VAL B 214 ? 0.5199 0.5195 0.5774 -0.0218 -0.0065 0.0187  214  VAL B CB  
3714 C CG1 . VAL B 214 ? 0.4656 0.4719 0.5357 -0.0203 -0.0078 0.0176  214  VAL B CG1 
3715 C CG2 . VAL B 214 ? 0.5168 0.5130 0.5727 -0.0192 -0.0052 0.0218  214  VAL B CG2 
3716 N N   . MET B 215 ? 0.5404 0.5387 0.5925 -0.0237 -0.0087 0.0129  215  MET B N   
3717 C CA  . MET B 215 ? 0.5452 0.5461 0.5968 -0.0261 -0.0098 0.0100  215  MET B CA  
3718 C C   . MET B 215 ? 0.5314 0.5382 0.5936 -0.0244 -0.0111 0.0083  215  MET B C   
3719 O O   . MET B 215 ? 0.5378 0.5446 0.6041 -0.0216 -0.0113 0.0092  215  MET B O   
3720 C CB  . MET B 215 ? 0.5719 0.5660 0.6123 -0.0267 -0.0096 0.0094  215  MET B CB  
3721 C CG  . MET B 215 ? 0.6037 0.5896 0.6311 -0.0288 -0.0083 0.0108  215  MET B CG  
3722 S SD  . MET B 215 ? 0.6963 0.6729 0.7105 -0.0287 -0.0079 0.0103  215  MET B SD  
3723 C CE  . MET B 215 ? 0.6743 0.6499 0.6926 -0.0222 -0.0075 0.0124  215  MET B CE  
3724 N N   . HIS B 216 ? 0.5069 0.5188 0.5729 -0.0264 -0.0119 0.0060  216  HIS B N   
3725 C CA  . HIS B 216 ? 0.4948 0.5112 0.5693 -0.0253 -0.0130 0.0039  216  HIS B CA  
3726 C C   . HIS B 216 ? 0.5082 0.5256 0.5789 -0.0273 -0.0139 0.0010  216  HIS B C   
3727 O O   . HIS B 216 ? 0.5109 0.5313 0.5799 -0.0296 -0.0139 -0.0002 216  HIS B O   
3728 C CB  . HIS B 216 ? 0.4789 0.5005 0.5616 -0.0251 -0.0131 0.0036  216  HIS B CB  
3729 C CG  . HIS B 216 ? 0.4915 0.5168 0.5812 -0.0245 -0.0142 0.0009  216  HIS B CG  
3730 N ND1 . HIS B 216 ? 0.5312 0.5607 0.6224 -0.0254 -0.0144 -0.0013 216  HIS B ND1 
3731 C CD2 . HIS B 216 ? 0.4834 0.5087 0.5783 -0.0231 -0.0151 0.0000  216  HIS B CD2 
3732 C CE1 . HIS B 216 ? 0.5356 0.5666 0.6323 -0.0244 -0.0153 -0.0036 216  HIS B CE1 
3733 N NE2 . HIS B 216 ? 0.5084 0.5368 0.6073 -0.0234 -0.0158 -0.0028 216  HIS B NE2 
3734 N N   . PRO B 217 ? 0.5132 0.5290 0.5824 -0.0264 -0.0145 0.0002  217  PRO B N   
3735 C CA  . PRO B 217 ? 0.5304 0.5472 0.5958 -0.0283 -0.0153 -0.0024 217  PRO B CA  
3736 C C   . PRO B 217 ? 0.5411 0.5640 0.6141 -0.0286 -0.0162 -0.0051 217  PRO B C   
3737 O O   . PRO B 217 ? 0.5465 0.5713 0.6273 -0.0268 -0.0168 -0.0057 217  PRO B O   
3738 C CB  . PRO B 217 ? 0.5395 0.5540 0.6034 -0.0265 -0.0158 -0.0022 217  PRO B CB  
3739 C CG  . PRO B 217 ? 0.5270 0.5370 0.5884 -0.0242 -0.0148 0.0011  217  PRO B CG  
3740 C CD  . PRO B 217 ? 0.5162 0.5260 0.5779 -0.0254 -0.0138 0.0023  217  PRO B CD  
3741 N N   . ILE B 218 ? 0.5555 0.5814 0.6259 -0.0308 -0.0162 -0.0068 218  ILE B N   
3742 C CA  . ILE B 218 ? 0.5674 0.5988 0.6443 -0.0305 -0.0167 -0.0094 218  ILE B CA  
3743 C C   . ILE B 218 ? 0.6126 0.6447 0.6890 -0.0307 -0.0178 -0.0122 218  ILE B C   
3744 O O   . ILE B 218 ? 0.6371 0.6712 0.7090 -0.0326 -0.0181 -0.0139 218  ILE B O   
3745 C CB  . ILE B 218 ? 0.5642 0.6004 0.6395 -0.0322 -0.0162 -0.0099 218  ILE B CB  
3746 C CG1 . ILE B 218 ? 0.5530 0.5891 0.6289 -0.0321 -0.0152 -0.0071 218  ILE B CG1 
3747 C CG2 . ILE B 218 ? 0.5510 0.5928 0.6325 -0.0309 -0.0166 -0.0127 218  ILE B CG2 
3748 C CD1 . ILE B 218 ? 0.5194 0.5603 0.5912 -0.0347 -0.0146 -0.0067 218  ILE B CD1 
3749 N N   . ASP B 219 ? 0.6331 0.6641 0.7142 -0.0289 -0.0186 -0.0125 219  ASP B N   
3750 C CA  . ASP B 219 ? 0.6723 0.7043 0.7531 -0.0292 -0.0197 -0.0149 219  ASP B CA  
3751 C C   . ASP B 219 ? 0.6954 0.7308 0.7833 -0.0286 -0.0204 -0.0179 219  ASP B C   
3752 O O   . ASP B 219 ? 0.6835 0.7203 0.7756 -0.0277 -0.0198 -0.0180 219  ASP B O   
3753 C CB  . ASP B 219 ? 0.6791 0.7084 0.7595 -0.0281 -0.0202 -0.0133 219  ASP B CB  
3754 C CG  . ASP B 219 ? 0.6748 0.7044 0.7632 -0.0264 -0.0204 -0.0121 219  ASP B CG  
3755 O OD1 . ASP B 219 ? 0.6861 0.7171 0.7803 -0.0261 -0.0203 -0.0130 219  ASP B OD1 
3756 O OD2 . ASP B 219 ? 0.7030 0.7315 0.7916 -0.0252 -0.0206 -0.0101 219  ASP B OD2 
3757 N N   . HIS B 220 ? 0.7413 0.7777 0.8297 -0.0289 -0.0215 -0.0204 220  HIS B N   
3758 C CA  . HIS B 220 ? 0.7781 0.8165 0.8718 -0.0284 -0.0221 -0.0236 220  HIS B CA  
3759 C C   . HIS B 220 ? 0.7675 0.8042 0.8682 -0.0270 -0.0219 -0.0227 220  HIS B C   
3760 O O   . HIS B 220 ? 0.7819 0.8188 0.8862 -0.0261 -0.0218 -0.0246 220  HIS B O   
3761 C CB  . HIS B 220 ? 0.8140 0.8533 0.9070 -0.0293 -0.0235 -0.0262 220  HIS B CB  
3762 C CG  . HIS B 220 ? 0.8998 0.9417 0.9876 -0.0305 -0.0236 -0.0286 220  HIS B CG  
3763 N ND1 . HIS B 220 ? 0.9440 0.9858 1.0249 -0.0318 -0.0236 -0.0275 220  HIS B ND1 
3764 C CD2 . HIS B 220 ? 0.9657 1.0105 1.0540 -0.0305 -0.0237 -0.0319 220  HIS B CD2 
3765 C CE1 . HIS B 220 ? 0.9568 1.0017 1.0343 -0.0330 -0.0237 -0.0299 220  HIS B CE1 
3766 N NE2 . HIS B 220 ? 0.9847 1.0319 1.0669 -0.0321 -0.0238 -0.0326 220  HIS B NE2 
3767 N N   . HIS B 221 ? 0.7572 0.7918 0.8593 -0.0266 -0.0219 -0.0197 221  HIS B N   
3768 C CA  . HIS B 221 ? 0.7552 0.7883 0.8639 -0.0257 -0.0219 -0.0186 221  HIS B CA  
3769 C C   . HIS B 221 ? 0.7225 0.7549 0.8328 -0.0244 -0.0205 -0.0165 221  HIS B C   
3770 O O   . HIS B 221 ? 0.7335 0.7643 0.8489 -0.0235 -0.0203 -0.0156 221  HIS B O   
3771 C CB  . HIS B 221 ? 0.7598 0.7922 0.8699 -0.0258 -0.0225 -0.0161 221  HIS B CB  
3772 C CG  . HIS B 221 ? 0.8405 0.8745 0.9497 -0.0270 -0.0239 -0.0178 221  HIS B CG  
3773 N ND1 . HIS B 221 ? 0.9088 0.9433 1.0201 -0.0282 -0.0250 -0.0214 221  HIS B ND1 
3774 C CD2 . HIS B 221 ? 0.8674 0.9027 0.9734 -0.0271 -0.0245 -0.0164 221  HIS B CD2 
3775 C CE1 . HIS B 221 ? 0.9308 0.9675 1.0405 -0.0293 -0.0262 -0.0221 221  HIS B CE1 
3776 N NE2 . HIS B 221 ? 0.9001 0.9376 1.0067 -0.0284 -0.0259 -0.0190 221  HIS B NE2 
3777 N N   . SER B 222 ? 0.6880 0.7217 0.7937 -0.0245 -0.0196 -0.0156 222  SER B N   
3778 C CA  . SER B 222 ? 0.6439 0.6779 0.7507 -0.0236 -0.0183 -0.0133 222  SER B CA  
3779 C C   . SER B 222 ? 0.6535 0.6892 0.7641 -0.0221 -0.0178 -0.0149 222  SER B C   
3780 O O   . SER B 222 ? 0.6712 0.7092 0.7806 -0.0221 -0.0180 -0.0179 222  SER B O   
3781 C CB  . SER B 222 ? 0.6253 0.6603 0.7252 -0.0249 -0.0176 -0.0120 222  SER B CB  
3782 O OG  . SER B 222 ? 0.5939 0.6303 0.6949 -0.0243 -0.0166 -0.0102 222  SER B OG  
3783 N N   . PRO B 223 ? 0.6337 0.6686 0.7487 -0.0205 -0.0170 -0.0130 223  PRO B N   
3784 C CA  . PRO B 223 ? 0.6400 0.6765 0.7576 -0.0184 -0.0163 -0.0143 223  PRO B CA  
3785 C C   . PRO B 223 ? 0.6530 0.6949 0.7670 -0.0184 -0.0154 -0.0140 223  PRO B C   
3786 O O   . PRO B 223 ? 0.6641 0.7088 0.7799 -0.0162 -0.0146 -0.0148 223  PRO B O   
3787 C CB  . PRO B 223 ? 0.6264 0.6603 0.7490 -0.0167 -0.0156 -0.0117 223  PRO B CB  
3788 C CG  . PRO B 223 ? 0.6056 0.6386 0.7272 -0.0180 -0.0157 -0.0084 223  PRO B CG  
3789 C CD  . PRO B 223 ? 0.6181 0.6505 0.7359 -0.0201 -0.0168 -0.0096 223  PRO B CD  
3790 N N   . ILE B 224 ? 0.6481 0.6916 0.7568 -0.0207 -0.0154 -0.0126 224  ILE B N   
3791 C CA  . ILE B 224 ? 0.6698 0.7192 0.7748 -0.0215 -0.0147 -0.0124 224  ILE B CA  
3792 C C   . ILE B 224 ? 0.7006 0.7520 0.8003 -0.0238 -0.0153 -0.0148 224  ILE B C   
3793 O O   . ILE B 224 ? 0.7169 0.7737 0.8127 -0.0253 -0.0150 -0.0148 224  ILE B O   
3794 C CB  . ILE B 224 ? 0.6543 0.7051 0.7563 -0.0230 -0.0139 -0.0089 224  ILE B CB  
3795 C CG1 . ILE B 224 ? 0.6409 0.6868 0.7375 -0.0255 -0.0143 -0.0075 224  ILE B CG1 
3796 C CG2 . ILE B 224 ? 0.6344 0.6852 0.7421 -0.0204 -0.0130 -0.0064 224  ILE B CG2 
3797 C CD1 . ILE B 224 ? 0.5692 0.6161 0.6611 -0.0275 -0.0135 -0.0047 224  ILE B CD1 
3798 N N   . TYR B 225 ? 0.7201 0.7680 0.8198 -0.0241 -0.0164 -0.0168 225  TYR B N   
3799 C CA  . TYR B 225 ? 0.7473 0.7970 0.8424 -0.0259 -0.0171 -0.0193 225  TYR B CA  
3800 C C   . TYR B 225 ? 0.7834 0.8392 0.8792 -0.0248 -0.0166 -0.0215 225  TYR B C   
3801 O O   . TYR B 225 ? 0.7960 0.8518 0.8965 -0.0219 -0.0163 -0.0231 225  TYR B O   
3802 C CB  . TYR B 225 ? 0.7592 0.8050 0.8558 -0.0258 -0.0182 -0.0213 225  TYR B CB  
3803 C CG  . TYR B 225 ? 0.7821 0.8294 0.8737 -0.0277 -0.0190 -0.0236 225  TYR B CG  
3804 C CD1 . TYR B 225 ? 0.7784 0.8240 0.8637 -0.0300 -0.0193 -0.0222 225  TYR B CD1 
3805 C CD2 . TYR B 225 ? 0.8171 0.8669 0.9096 -0.0270 -0.0194 -0.0271 225  TYR B CD2 
3806 C CE1 . TYR B 225 ? 0.8067 0.8533 0.8870 -0.0318 -0.0200 -0.0240 225  TYR B CE1 
3807 C CE2 . TYR B 225 ? 0.8419 0.8934 0.9297 -0.0289 -0.0202 -0.0291 225  TYR B CE2 
3808 C CZ  . TYR B 225 ? 0.8521 0.9021 0.9339 -0.0314 -0.0205 -0.0273 225  TYR B CZ  
3809 O OH  . TYR B 225 ? 0.8796 0.9306 0.9560 -0.0333 -0.0211 -0.0288 225  TYR B OH  
3810 N N   . GLY B 226 ? 0.8024 0.8635 0.8929 -0.0270 -0.0163 -0.0213 226  GLY B N   
3811 C CA  . GLY B 226 ? 0.8324 0.9006 0.9229 -0.0260 -0.0159 -0.0234 226  GLY B CA  
3812 C C   . GLY B 226 ? 0.8387 0.9128 0.9312 -0.0244 -0.0146 -0.0214 226  GLY B C   
3813 O O   . GLY B 226 ? 0.8775 0.9593 0.9696 -0.0235 -0.0140 -0.0222 226  GLY B O   
3814 N N   . GLU B 227 ? 0.8203 0.8915 0.9151 -0.0238 -0.0142 -0.0185 227  GLU B N   
3815 C CA  . GLU B 227 ? 0.8282 0.9051 0.9251 -0.0223 -0.0131 -0.0161 227  GLU B CA  
3816 C C   . GLU B 227 ? 0.8300 0.9135 0.9210 -0.0264 -0.0129 -0.0143 227  GLU B C   
3817 O O   . GLU B 227 ? 0.8247 0.9050 0.9097 -0.0306 -0.0136 -0.0140 227  GLU B O   
3818 C CB  . GLU B 227 ? 0.8041 0.8753 0.9048 -0.0210 -0.0128 -0.0136 227  GLU B CB  
3819 C CG  . GLU B 227 ? 0.8553 0.9275 0.9624 -0.0162 -0.0118 -0.0131 227  GLU B CG  
3820 C CD  . GLU B 227 ? 0.9081 0.9770 1.0181 -0.0131 -0.0119 -0.0165 227  GLU B CD  
3821 O OE1 . GLU B 227 ? 0.9664 1.0321 1.0745 -0.0147 -0.0130 -0.0191 227  GLU B OE1 
3822 O OE2 . GLU B 227 ? 0.9569 1.0260 1.0708 -0.0089 -0.0110 -0.0165 227  GLU B OE2 
3823 N N   . THR B 228 ? 0.8454 0.9379 0.9375 -0.0253 -0.0119 -0.0129 228  THR B N   
3824 C CA  . THR B 228 ? 0.8554 0.9552 0.9421 -0.0296 -0.0118 -0.0108 228  THR B CA  
3825 C C   . THR B 228 ? 0.8497 0.9532 0.9393 -0.0282 -0.0109 -0.0075 228  THR B C   
3826 O O   . THR B 228 ? 0.8365 0.9373 0.9324 -0.0236 -0.0103 -0.0070 228  THR B O   
3827 C CB  . THR B 228 ? 0.8919 1.0030 0.9767 -0.0301 -0.0115 -0.0120 228  THR B CB  
3828 O OG1 . THR B 228 ? 0.9086 1.0259 0.9997 -0.0242 -0.0104 -0.0122 228  THR B OG1 
3829 C CG2 . THR B 228 ? 0.9038 1.0122 0.9854 -0.0316 -0.0124 -0.0152 228  THR B CG2 
3830 N N   . ASP B 229 ? 0.8637 0.9737 0.9485 -0.0325 -0.0108 -0.0052 229  ASP B N   
3831 C CA  . ASP B 229 ? 0.8780 0.9934 0.9654 -0.0314 -0.0099 -0.0020 229  ASP B CA  
3832 C C   . ASP B 229 ? 0.8951 1.0182 0.9896 -0.0251 -0.0089 -0.0020 229  ASP B C   
3833 O O   . ASP B 229 ? 0.8786 1.0004 0.9783 -0.0211 -0.0081 -0.0003 229  ASP B O   
3834 C CB  . ASP B 229 ? 0.8985 1.0218 0.9792 -0.0374 -0.0101 0.0000  229  ASP B CB  
3835 C CG  . ASP B 229 ? 0.9392 1.0681 1.0220 -0.0369 -0.0093 0.0035  229  ASP B CG  
3836 O OD1 . ASP B 229 ? 1.0010 1.1403 1.0891 -0.0328 -0.0084 0.0046  229  ASP B OD1 
3837 O OD2 . ASP B 229 ? 0.9836 1.1065 1.0626 -0.0403 -0.0095 0.0053  229  ASP B OD2 
3838 N N   . GLU B 230 ? 0.9299 1.0605 1.0242 -0.0238 -0.0087 -0.0040 230  GLU B N   
3839 C CA  . GLU B 230 ? 0.9600 1.0979 1.0599 -0.0172 -0.0074 -0.0039 230  GLU B CA  
3840 C C   . GLU B 230 ? 0.9382 1.0658 1.0438 -0.0113 -0.0070 -0.0055 230  GLU B C   
3841 O O   . GLU B 230 ? 0.9406 1.0697 1.0509 -0.0061 -0.0058 -0.0039 230  GLU B O   
3842 C CB  . GLU B 230 ? 1.0076 1.1561 1.1057 -0.0167 -0.0072 -0.0057 230  GLU B CB  
3843 C CG  . GLU B 230 ? 1.0902 1.2491 1.1929 -0.0099 -0.0055 -0.0046 230  GLU B CG  
3844 C CD  . GLU B 230 ? 1.2170 1.3862 1.3183 -0.0084 -0.0051 -0.0065 230  GLU B CD  
3845 O OE1 . GLU B 230 ? 1.2621 1.4290 1.3594 -0.0125 -0.0061 -0.0090 230  GLU B OE1 
3846 O OE2 . GLU B 230 ? 1.2749 1.4549 1.3790 -0.0029 -0.0036 -0.0053 230  GLU B OE2 
3847 N N   . THR B 231 ? 0.9170 1.0343 1.0219 -0.0121 -0.0079 -0.0085 231  THR B N   
3848 C CA  . THR B 231 ? 0.9092 1.0166 1.0188 -0.0075 -0.0077 -0.0101 231  THR B CA  
3849 C C   . THR B 231 ? 0.8813 0.9821 0.9939 -0.0072 -0.0076 -0.0074 231  THR B C   
3850 O O   . THR B 231 ? 0.8918 0.9887 1.0090 -0.0025 -0.0068 -0.0069 231  THR B O   
3851 C CB  . THR B 231 ? 0.9086 1.0072 1.0167 -0.0089 -0.0089 -0.0139 231  THR B CB  
3852 O OG1 . THR B 231 ? 0.8663 0.9582 0.9717 -0.0137 -0.0101 -0.0133 231  THR B OG1 
3853 C CG2 . THR B 231 ? 0.9287 1.0341 1.0334 -0.0097 -0.0090 -0.0164 231  THR B CG2 
3854 N N   . LEU B 232 ? 0.8446 0.9439 0.9541 -0.0121 -0.0084 -0.0055 232  LEU B N   
3855 C CA  . LEU B 232 ? 0.8237 0.9175 0.9359 -0.0117 -0.0082 -0.0028 232  LEU B CA  
3856 C C   . LEU B 232 ? 0.8389 0.9402 0.9542 -0.0084 -0.0069 0.0002  232  LEU B C   
3857 O O   . LEU B 232 ? 0.8387 0.9357 0.9585 -0.0053 -0.0063 0.0018  232  LEU B O   
3858 C CB  . LEU B 232 ? 0.7907 0.8806 0.8980 -0.0172 -0.0090 -0.0014 232  LEU B CB  
3859 C CG  . LEU B 232 ? 0.7802 0.8613 0.8851 -0.0193 -0.0102 -0.0040 232  LEU B CG  
3860 C CD1 . LEU B 232 ? 0.7608 0.8375 0.8597 -0.0241 -0.0108 -0.0027 232  LEU B CD1 
3861 C CD2 . LEU B 232 ? 0.7762 0.8491 0.8868 -0.0159 -0.0103 -0.0050 232  LEU B CD2 
3862 N N   . ARG B 233 ? 0.8629 0.9763 0.9761 -0.0091 -0.0064 0.0012  233  ARG B N   
3863 C CA  . ARG B 233 ? 0.8888 1.0109 1.0052 -0.0055 -0.0051 0.0043  233  ARG B CA  
3864 C C   . ARG B 233 ? 0.9091 1.0285 1.0307 0.0018  -0.0039 0.0034  233  ARG B C   
3865 O O   . ARG B 233 ? 0.9088 1.0263 1.0343 0.0056  -0.0030 0.0057  233  ARG B O   
3866 C CB  . ARG B 233 ? 0.9152 1.0523 1.0284 -0.0075 -0.0048 0.0056  233  ARG B CB  
3867 C CG  . ARG B 233 ? 0.9338 1.0732 1.0408 -0.0153 -0.0058 0.0069  233  ARG B CG  
3868 C CD  . ARG B 233 ? 1.0140 1.1691 1.1185 -0.0177 -0.0054 0.0094  233  ARG B CD  
3869 N NE  . ARG B 233 ? 1.0699 1.2244 1.1677 -0.0256 -0.0064 0.0106  233  ARG B NE  
3870 C CZ  . ARG B 233 ? 1.0870 1.2364 1.1840 -0.0276 -0.0065 0.0129  233  ARG B CZ  
3871 N NH1 . ARG B 233 ? 1.0904 1.2355 1.1934 -0.0226 -0.0058 0.0144  233  ARG B NH1 
3872 N NH2 . ARG B 233 ? 1.1027 1.2504 1.1921 -0.0348 -0.0073 0.0137  233  ARG B NH2 
3873 N N   . ASN B 234 ? 0.9292 1.0478 1.0502 0.0038  -0.0039 0.0000  234  ASN B N   
3874 C CA  . ASN B 234 ? 0.9634 1.0789 1.0878 0.0109  -0.0026 -0.0012 234  ASN B CA  
3875 C C   . ASN B 234 ? 0.9461 1.0480 1.0738 0.0130  -0.0027 -0.0014 234  ASN B C   
3876 O O   . ASN B 234 ? 0.9748 1.0745 1.1055 0.0186  -0.0013 -0.0002 234  ASN B O   
3877 C CB  . ASN B 234 ? 0.9976 1.1136 1.1198 0.0119  -0.0028 -0.0053 234  ASN B CB  
3878 C CG  . ASN B 234 ? 1.0539 1.1853 1.1733 0.0112  -0.0023 -0.0048 234  ASN B CG  
3879 O OD1 . ASN B 234 ? 1.1198 1.2623 1.2403 0.0133  -0.0012 -0.0015 234  ASN B OD1 
3880 N ND2 . ASN B 234 ? 1.0784 1.2113 1.1942 0.0081  -0.0032 -0.0077 234  ASN B ND2 
3881 N N   . SER B 235 ? 0.9048 0.9974 1.0317 0.0085  -0.0041 -0.0028 235  SER B N   
3882 C CA  . SER B 235 ? 0.8762 0.9565 1.0062 0.0097  -0.0044 -0.0028 235  SER B CA  
3883 C C   . SER B 235 ? 0.8493 0.9291 0.9818 0.0092  -0.0041 0.0012  235  SER B C   
3884 O O   . SER B 235 ? 0.8424 0.9129 0.9774 0.0094  -0.0043 0.0018  235  SER B O   
3885 C CB  . SER B 235 ? 0.8557 0.9280 0.9841 0.0054  -0.0060 -0.0057 235  SER B CB  
3886 O OG  . SER B 235 ? 0.8262 0.9019 0.9513 0.0000  -0.0070 -0.0047 235  SER B OG  
3887 N N   . HIS B 236 ? 0.8364 0.9266 0.9679 0.0082  -0.0036 0.0041  236  HIS B N   
3888 C CA  . HIS B 236 ? 0.8231 0.9140 0.9560 0.0071  -0.0034 0.0081  236  HIS B CA  
3889 C C   . HIS B 236 ? 0.7775 0.8600 0.9097 0.0024  -0.0047 0.0081  236  HIS B C   
3890 O O   . HIS B 236 ? 0.7573 0.8344 0.8922 0.0030  -0.0046 0.0103  236  HIS B O   
3891 C CB  . HIS B 236 ? 0.8434 0.9322 0.9810 0.0128  -0.0021 0.0105  236  HIS B CB  
3892 C CG  . HIS B 236 ? 0.9298 1.0263 1.0681 0.0186  -0.0005 0.0107  236  HIS B CG  
3893 N ND1 . HIS B 236 ? 0.9638 1.0737 1.1018 0.0196  0.0002  0.0138  236  HIS B ND1 
3894 C CD2 . HIS B 236 ? 0.9715 1.0645 1.1102 0.0237  0.0003  0.0083  236  HIS B CD2 
3895 C CE1 . HIS B 236 ? 0.9958 1.1108 1.1345 0.0257  0.0017  0.0135  236  HIS B CE1 
3896 N NE2 . HIS B 236 ? 1.0016 1.1060 1.1405 0.0284  0.0018  0.0101  236  HIS B NE2 
3897 N N   . SER B 237 ? 0.7555 0.8369 0.8834 -0.0018 -0.0059 0.0058  237  SER B N   
3898 C CA  . SER B 237 ? 0.7210 0.7947 0.8475 -0.0056 -0.0070 0.0057  237  SER B CA  
3899 C C   . SER B 237 ? 0.6944 0.7693 0.8195 -0.0080 -0.0068 0.0093  237  SER B C   
3900 O O   . SER B 237 ? 0.7042 0.7871 0.8264 -0.0098 -0.0065 0.0109  237  SER B O   
3901 C CB  . SER B 237 ? 0.7119 0.7851 0.8332 -0.0094 -0.0080 0.0028  237  SER B CB  
3902 O OG  . SER B 237 ? 0.7420 0.8125 0.8647 -0.0073 -0.0083 -0.0006 237  SER B OG  
3903 N N   . GLU B 238 ? 0.6716 0.7392 0.7987 -0.0083 -0.0071 0.0106  238  GLU B N   
3904 C CA  . GLU B 238 ? 0.6541 0.7214 0.7787 -0.0111 -0.0070 0.0134  238  GLU B CA  
3905 C C   . GLU B 238 ? 0.6089 0.6681 0.7317 -0.0132 -0.0078 0.0128  238  GLU B C   
3906 O O   . GLU B 238 ? 0.6101 0.6639 0.7355 -0.0121 -0.0084 0.0109  238  GLU B O   
3907 C CB  . GLU B 238 ? 0.6724 0.7403 0.8017 -0.0083 -0.0061 0.0168  238  GLU B CB  
3908 C CG  . GLU B 238 ? 0.7832 0.8607 0.9122 -0.0074 -0.0052 0.0190  238  GLU B CG  
3909 C CD  . GLU B 238 ? 0.8977 0.9753 1.0323 -0.0036 -0.0043 0.0221  238  GLU B CD  
3910 O OE1 . GLU B 238 ? 0.9234 0.9937 1.0601 -0.0037 -0.0044 0.0231  238  GLU B OE1 
3911 O OE2 . GLU B 238 ? 0.9454 1.0304 1.0821 -0.0005 -0.0033 0.0235  238  GLU B OE2 
3912 N N   . PHE B 239 ? 0.5705 0.6287 0.6887 -0.0161 -0.0078 0.0146  239  PHE B N   
3913 C CA  . PHE B 239 ? 0.5421 0.5928 0.6581 -0.0174 -0.0083 0.0145  239  PHE B CA  
3914 C C   . PHE B 239 ? 0.5421 0.5904 0.6587 -0.0172 -0.0077 0.0178  239  PHE B C   
3915 O O   . PHE B 239 ? 0.5607 0.6117 0.6733 -0.0189 -0.0072 0.0198  239  PHE B O   
3916 C CB  . PHE B 239 ? 0.5258 0.5754 0.6333 -0.0211 -0.0088 0.0129  239  PHE B CB  
3917 C CG  . PHE B 239 ? 0.5124 0.5636 0.6191 -0.0215 -0.0095 0.0096  239  PHE B CG  
3918 C CD1 . PHE B 239 ? 0.4925 0.5511 0.5981 -0.0221 -0.0093 0.0087  239  PHE B CD1 
3919 C CD2 . PHE B 239 ? 0.4879 0.5343 0.5956 -0.0210 -0.0103 0.0074  239  PHE B CD2 
3920 C CE1 . PHE B 239 ? 0.5264 0.5868 0.6315 -0.0221 -0.0099 0.0056  239  PHE B CE1 
3921 C CE2 . PHE B 239 ? 0.5160 0.5640 0.6231 -0.0212 -0.0110 0.0042  239  PHE B CE2 
3922 C CZ  . PHE B 239 ? 0.5282 0.5829 0.6338 -0.0218 -0.0107 0.0033  239  PHE B CZ  
3923 N N   . LEU B 240 ? 0.5274 0.5710 0.6489 -0.0153 -0.0079 0.0185  240  LEU B N   
3924 C CA  . LEU B 240 ? 0.5170 0.5582 0.6389 -0.0150 -0.0074 0.0216  240  LEU B CA  
3925 C C   . LEU B 240 ? 0.4949 0.5311 0.6119 -0.0163 -0.0076 0.0216  240  LEU B C   
3926 O O   . LEU B 240 ? 0.4739 0.5073 0.5913 -0.0162 -0.0084 0.0196  240  LEU B O   
3927 C CB  . LEU B 240 ? 0.5345 0.5742 0.6646 -0.0123 -0.0073 0.0230  240  LEU B CB  
3928 C CG  . LEU B 240 ? 0.5772 0.6192 0.7129 -0.0100 -0.0071 0.0226  240  LEU B CG  
3929 C CD1 . LEU B 240 ? 0.5984 0.6369 0.7408 -0.0080 -0.0070 0.0243  240  LEU B CD1 
3930 C CD2 . LEU B 240 ? 0.5950 0.6433 0.7294 -0.0096 -0.0062 0.0244  240  LEU B CD2 
3931 N N   . VAL B 241 ? 0.4922 0.5271 0.6045 -0.0172 -0.0069 0.0239  241  VAL B N   
3932 C CA  . VAL B 241 ? 0.4864 0.5161 0.5942 -0.0172 -0.0067 0.0246  241  VAL B CA  
3933 C C   . VAL B 241 ? 0.4855 0.5148 0.5979 -0.0152 -0.0061 0.0278  241  VAL B C   
3934 O O   . VAL B 241 ? 0.4909 0.5228 0.6045 -0.0151 -0.0054 0.0298  241  VAL B O   
3935 C CB  . VAL B 241 ? 0.4958 0.5230 0.5930 -0.0197 -0.0061 0.0248  241  VAL B CB  
3936 C CG1 . VAL B 241 ? 0.4862 0.5070 0.5776 -0.0190 -0.0058 0.0252  241  VAL B CG1 
3937 C CG2 . VAL B 241 ? 0.4990 0.5284 0.5919 -0.0224 -0.0066 0.0222  241  VAL B CG2 
3938 N N   . LEU B 242 ? 0.4840 0.5111 0.5995 -0.0137 -0.0064 0.0283  242  LEU B N   
3939 C CA  . LEU B 242 ? 0.4869 0.5140 0.6060 -0.0120 -0.0057 0.0316  242  LEU B CA  
3940 C C   . LEU B 242 ? 0.4879 0.5116 0.6021 -0.0111 -0.0053 0.0327  242  LEU B C   
3941 O O   . LEU B 242 ? 0.4827 0.5047 0.5950 -0.0109 -0.0059 0.0311  242  LEU B O   
3942 C CB  . LEU B 242 ? 0.5066 0.5354 0.6354 -0.0108 -0.0064 0.0321  242  LEU B CB  
3943 C CG  . LEU B 242 ? 0.5247 0.5562 0.6571 -0.0109 -0.0064 0.0314  242  LEU B CG  
3944 C CD1 . LEU B 242 ? 0.5464 0.5777 0.6804 -0.0114 -0.0074 0.0278  242  LEU B CD1 
3945 C CD2 . LEU B 242 ? 0.5382 0.5709 0.6778 -0.0094 -0.0060 0.0341  242  LEU B CD2 
3946 N N   . PHE B 243 ? 0.4914 0.5142 0.6028 -0.0101 -0.0041 0.0355  243  PHE B N   
3947 C CA  . PHE B 243 ? 0.4928 0.5118 0.5975 -0.0087 -0.0033 0.0368  243  PHE B CA  
3948 C C   . PHE B 243 ? 0.5030 0.5239 0.6126 -0.0064 -0.0026 0.0402  243  PHE B C   
3949 O O   . PHE B 243 ? 0.5063 0.5296 0.6195 -0.0064 -0.0021 0.0421  243  PHE B O   
3950 C CB  . PHE B 243 ? 0.4877 0.5024 0.5813 -0.0101 -0.0022 0.0367  243  PHE B CB  
3951 C CG  . PHE B 243 ? 0.4805 0.4900 0.5660 -0.0080 -0.0008 0.0384  243  PHE B CG  
3952 C CD1 . PHE B 243 ? 0.4927 0.4969 0.5700 -0.0075 -0.0007 0.0370  243  PHE B CD1 
3953 C CD2 . PHE B 243 ? 0.4938 0.5034 0.5793 -0.0062 0.0003  0.0414  243  PHE B CD2 
3954 C CE1 . PHE B 243 ? 0.5280 0.5267 0.5968 -0.0048 0.0007  0.0386  243  PHE B CE1 
3955 C CE2 . PHE B 243 ? 0.5552 0.5598 0.6327 -0.0036 0.0017  0.0430  243  PHE B CE2 
3956 C CZ  . PHE B 243 ? 0.5251 0.5239 0.5939 -0.0027 0.0020  0.0416  243  PHE B CZ  
3957 N N   . THR B 244 ? 0.5138 0.5344 0.6232 -0.0042 -0.0025 0.0412  244  THR B N   
3958 C CA  . THR B 244 ? 0.5509 0.5742 0.6643 -0.0018 -0.0017 0.0448  244  THR B CA  
3959 C C   . THR B 244 ? 0.5610 0.5814 0.6667 0.0009  -0.0006 0.0460  244  THR B C   
3960 O O   . THR B 244 ? 0.5639 0.5816 0.6645 0.0012  -0.0009 0.0442  244  THR B O   
3961 C CB  . THR B 244 ? 0.5479 0.5762 0.6715 -0.0018 -0.0029 0.0455  244  THR B CB  
3962 O OG1 . THR B 244 ? 0.5998 0.6296 0.7299 -0.0040 -0.0040 0.0440  244  THR B OG1 
3963 C CG2 . THR B 244 ? 0.6187 0.6505 0.7465 0.0000  -0.0021 0.0494  244  THR B CG2 
3964 N N   . GLY B 245 ? 0.5708 0.5921 0.6758 0.0034  0.0007  0.0493  245  GLY B N   
3965 C CA  . GLY B 245 ? 0.5886 0.6080 0.6873 0.0070  0.0019  0.0509  245  GLY B CA  
3966 C C   . GLY B 245 ? 0.6268 0.6485 0.7265 0.0096  0.0034  0.0547  245  GLY B C   
3967 O O   . GLY B 245 ? 0.6152 0.6391 0.7195 0.0082  0.0035  0.0560  245  GLY B O   
3968 N N   . HIS B 246 ? 0.6607 0.6823 0.7559 0.0137  0.0047  0.0568  246  HIS B N   
3969 C CA  . HIS B 246 ? 0.7050 0.7284 0.7996 0.0167  0.0064  0.0604  246  HIS B CA  
3970 C C   . HIS B 246 ? 0.7257 0.7400 0.8066 0.0185  0.0084  0.0602  246  HIS B C   
3971 O O   . HIS B 246 ? 0.7357 0.7440 0.8069 0.0208  0.0093  0.0593  246  HIS B O   
3972 C CB  . HIS B 246 ? 0.7218 0.7519 0.8202 0.0205  0.0066  0.0632  246  HIS B CB  
3973 C CG  . HIS B 246 ? 0.7884 0.8206 0.8849 0.0246  0.0087  0.0671  246  HIS B CG  
3974 N ND1 . HIS B 246 ? 0.8128 0.8538 0.9193 0.0245  0.0084  0.0703  246  HIS B ND1 
3975 C CD2 . HIS B 246 ? 0.8249 0.8515 0.9102 0.0289  0.0110  0.0684  246  HIS B CD2 
3976 C CE1 . HIS B 246 ? 0.8191 0.8607 0.9212 0.0287  0.0106  0.0735  246  HIS B CE1 
3977 N NE2 . HIS B 246 ? 0.8368 0.8695 0.9259 0.0316  0.0122  0.0723  246  HIS B NE2 
3978 N N   . HIS B 247 ? 0.7501 0.7628 0.8295 0.0172  0.0092  0.0610  247  HIS B N   
3979 C CA  . HIS B 247 ? 0.7889 0.7923 0.8545 0.0179  0.0111  0.0606  247  HIS B CA  
3980 C C   . HIS B 247 ? 0.8352 0.8380 0.8959 0.0234  0.0133  0.0639  247  HIS B C   
3981 O O   . HIS B 247 ? 0.8577 0.8680 0.9265 0.0249  0.0136  0.0669  247  HIS B O   
3982 C CB  . HIS B 247 ? 0.7826 0.7852 0.8483 0.0139  0.0109  0.0601  247  HIS B CB  
3983 C CG  . HIS B 247 ? 0.7989 0.7917 0.8511 0.0114  0.0116  0.0577  247  HIS B CG  
3984 N ND1 . HIS B 247 ? 0.8296 0.8134 0.8679 0.0137  0.0137  0.0581  247  HIS B ND1 
3985 C CD2 . HIS B 247 ? 0.7930 0.7837 0.8431 0.0064  0.0104  0.0548  247  HIS B CD2 
3986 C CE1 . HIS B 247 ? 0.8509 0.8269 0.8789 0.0097  0.0137  0.0555  247  HIS B CE1 
3987 N NE2 . HIS B 247 ? 0.7923 0.7731 0.8275 0.0052  0.0116  0.0536  247  HIS B NE2 
3988 N N   . GLU B 248 ? 0.8787 0.8726 0.9260 0.0265  0.0150  0.0633  248  GLU B N   
3989 C CA  . GLU B 248 ? 0.9422 0.9344 0.9832 0.0323  0.0175  0.0664  248  GLU B CA  
3990 C C   . GLU B 248 ? 0.9768 0.9661 1.0135 0.0313  0.0188  0.0674  248  GLU B C   
3991 O O   . GLU B 248 ? 1.0127 1.0053 1.0501 0.0352  0.0204  0.0706  248  GLU B O   
3992 C CB  . GLU B 248 ? 0.9618 0.9437 0.9882 0.0365  0.0193  0.0655  248  GLU B CB  
3993 C CG  . GLU B 248 ? 0.9531 0.9389 0.9834 0.0385  0.0182  0.0652  248  GLU B CG  
3994 C CD  . GLU B 248 ? 1.0056 0.9815 1.0212 0.0437  0.0203  0.0651  248  GLU B CD  
3995 O OE1 . GLU B 248 ? 1.0250 0.9877 1.0260 0.0430  0.0218  0.0635  248  GLU B OE1 
3996 O OE2 . GLU B 248 ? 1.0122 0.9934 1.0304 0.0483  0.0205  0.0667  248  GLU B OE2 
3997 N N   . ALA B 249 ? 0.9776 0.9617 1.0104 0.0258  0.0181  0.0648  249  ALA B N   
3998 C CA  . ALA B 249 ? 1.0073 0.9896 1.0365 0.0240  0.0190  0.0657  249  ALA B CA  
3999 C C   . ALA B 249 ? 1.0205 1.0145 1.0636 0.0244  0.0186  0.0689  249  ALA B C   
4000 O O   . ALA B 249 ? 1.0523 1.0463 1.0926 0.0258  0.0201  0.0710  249  ALA B O   
4001 C CB  . ALA B 249 ? 0.9859 0.9631 1.0101 0.0175  0.0180  0.0626  249  ALA B CB  
4002 N N   . PHE B 250 ? 1.0076 1.0111 1.0649 0.0233  0.0166  0.0693  250  PHE B N   
4003 C CA  . PHE B 250 ? 1.0178 1.0313 1.0877 0.0230  0.0161  0.0723  250  PHE B CA  
4004 C C   . PHE B 250 ? 1.0234 1.0456 1.1028 0.0264  0.0158  0.0749  250  PHE B C   
4005 O O   . PHE B 250 ? 1.0434 1.0737 1.1324 0.0265  0.0157  0.0779  250  PHE B O   
4006 C CB  . PHE B 250 ? 0.9953 1.0126 1.0741 0.0176  0.0140  0.0708  250  PHE B CB  
4007 C CG  . PHE B 250 ? 1.0116 1.0220 1.0816 0.0137  0.0138  0.0679  250  PHE B CG  
4008 C CD1 . PHE B 250 ? 1.0242 1.0314 1.0924 0.0106  0.0124  0.0644  250  PHE B CD1 
4009 C CD2 . PHE B 250 ? 1.0524 1.0598 1.1154 0.0129  0.0151  0.0688  250  PHE B CD2 
4010 C CE1 . PHE B 250 ? 1.0246 1.0263 1.0842 0.0066  0.0123  0.0620  250  PHE B CE1 
4011 C CE2 . PHE B 250 ? 1.0698 1.0716 1.1241 0.0086  0.0149  0.0664  250  PHE B CE2 
4012 C CZ  . PHE B 250 ? 1.0419 1.0411 1.0947 0.0054  0.0135  0.0630  250  PHE B CZ  
4013 N N   . ALA B 251 ? 1.0126 1.0337 1.0897 0.0288  0.0158  0.0741  251  ALA B N   
4014 C CA  . ALA B 251 ? 1.0101 1.0411 1.0974 0.0309  0.0150  0.0764  251  ALA B CA  
4015 C C   . ALA B 251 ? 0.9849 1.0236 1.0865 0.0263  0.0127  0.0765  251  ALA B C   
4016 O O   . ALA B 251 ? 1.0055 1.0531 1.1165 0.0267  0.0123  0.0796  251  ALA B O   
4017 C CB  . ALA B 251 ? 1.0486 1.0845 1.1353 0.0360  0.0171  0.0807  251  ALA B CB  
4018 N N   . GLN B 252 ? 0.9488 0.9840 1.0515 0.0218  0.0111  0.0732  252  GLN B N   
4019 C CA  . GLN B 252 ? 0.9194 0.9600 1.0341 0.0178  0.0090  0.0728  252  GLN B CA  
4020 C C   . GLN B 252 ? 0.8708 0.9065 0.9835 0.0147  0.0075  0.0684  252  GLN B C   
4021 O O   . GLN B 252 ? 0.8500 0.8782 0.9523 0.0146  0.0082  0.0661  252  GLN B O   
4022 C CB  . GLN B 252 ? 1.5152 1.5572 1.6338 0.0159  0.0092  0.0743  252  GLN B CB  
4023 C CG  . GLN B 252 ? 1.7960 1.8377 1.9093 0.0187  0.0113  0.0772  252  GLN B CG  
4024 C CD  . GLN B 252 ? 1.9895 2.0298 2.1023 0.0163  0.0116  0.0774  252  GLN B CD  
4025 O OE1 . GLN B 252 ? 2.1949 2.2335 2.3016 0.0180  0.0133  0.0791  252  GLN B OE1 
4026 N NE2 . GLN B 252 ? 1.8737 1.9149 1.9926 0.0126  0.0099  0.0758  252  GLN B NE2 
4027 N N   . ASN B 253 ? 0.8348 0.8744 0.9567 0.0121  0.0056  0.0673  253  ASN B N   
4028 C CA  . ASN B 253 ? 0.7918 0.8277 0.9127 0.0093  0.0042  0.0633  253  ASN B CA  
4029 C C   . ASN B 253 ? 0.7630 0.7956 0.8817 0.0067  0.0041  0.0617  253  ASN B C   
4030 O O   . ASN B 253 ? 0.7789 0.8138 0.9014 0.0062  0.0045  0.0638  253  ASN B O   
4031 C CB  . ASN B 253 ? 0.7891 0.8298 0.9202 0.0072  0.0022  0.0626  253  ASN B CB  
4032 C CG  . ASN B 253 ? 0.8301 0.8750 0.9631 0.0091  0.0019  0.0638  253  ASN B CG  
4033 O OD1 . ASN B 253 ? 0.8893 0.9329 1.0151 0.0124  0.0031  0.0644  253  ASN B OD1 
4034 N ND2 . ASN B 253 ? 0.8444 0.8947 0.9868 0.0070  0.0004  0.0643  253  ASN B ND2 
4035 N N   . VAL B 254 ? 0.7182 0.7457 0.8304 0.0051  0.0037  0.0583  254  VAL B N   
4036 C CA  . VAL B 254 ? 0.6780 0.7037 0.7882 0.0022  0.0035  0.0567  254  VAL B CA  
4037 C C   . VAL B 254 ? 0.6373 0.6633 0.7510 -0.0002 0.0018  0.0534  254  VAL B C   
4038 O O   . VAL B 254 ? 0.6283 0.6544 0.7436 0.0001  0.0009  0.0519  254  VAL B O   
4039 C CB  . VAL B 254 ? 0.6857 0.7051 0.7831 0.0020  0.0049  0.0560  254  VAL B CB  
4040 C CG1 . VAL B 254 ? 0.6972 0.7162 0.7914 0.0048  0.0066  0.0593  254  VAL B CG1 
4041 C CG2 . VAL B 254 ? 0.6577 0.6710 0.7462 0.0023  0.0049  0.0534  254  VAL B CG2 
4042 N N   . HIS B 255 ? 0.6046 0.6314 0.7194 -0.0025 0.0014  0.0524  255  HIS B N   
4043 C CA  . HIS B 255 ? 0.5728 0.6009 0.6919 -0.0044 0.0000  0.0495  255  HIS B CA  
4044 C C   . HIS B 255 ? 0.5484 0.5757 0.6619 -0.0067 0.0001  0.0481  255  HIS B C   
4045 O O   . HIS B 255 ? 0.5511 0.5795 0.6626 -0.0070 0.0010  0.0499  255  HIS B O   
4046 C CB  . HIS B 255 ? 0.5770 0.6093 0.7070 -0.0043 -0.0006 0.0508  255  HIS B CB  
4047 C CG  . HIS B 255 ? 0.6333 0.6675 0.7695 -0.0028 -0.0008 0.0530  255  HIS B CG  
4048 N ND1 . HIS B 255 ? 0.6501 0.6853 0.7923 -0.0034 -0.0021 0.0517  255  HIS B ND1 
4049 C CD2 . HIS B 255 ? 0.6707 0.7068 0.8082 -0.0011 0.0001  0.0565  255  HIS B CD2 
4050 C CE1 . HIS B 255 ? 0.6740 0.7118 0.8206 -0.0024 -0.0020 0.0544  255  HIS B CE1 
4051 N NE2 . HIS B 255 ? 0.6892 0.7278 0.8334 -0.0008 -0.0006 0.0574  255  HIS B NE2 
4052 N N   . ALA B 256 ? 0.5193 0.5452 0.6297 -0.0084 -0.0006 0.0448  256  ALA B N   
4053 C CA  . ALA B 256 ? 0.5097 0.5364 0.6154 -0.0111 -0.0006 0.0434  256  ALA B CA  
4054 C C   . ALA B 256 ? 0.4995 0.5279 0.6085 -0.0122 -0.0019 0.0403  256  ALA B C   
4055 O O   . ALA B 256 ? 0.4851 0.5119 0.5961 -0.0115 -0.0027 0.0387  256  ALA B O   
4056 C CB  . ALA B 256 ? 0.5043 0.5258 0.5978 -0.0127 0.0000  0.0427  256  ALA B CB  
4057 N N   . ARG B 257 ? 0.5194 0.5518 0.6296 -0.0136 -0.0022 0.0397  257  ARG B N   
4058 C CA  . ARG B 257 ? 0.5214 0.5556 0.6335 -0.0144 -0.0032 0.0366  257  ARG B CA  
4059 C C   . ARG B 257 ? 0.5178 0.5560 0.6257 -0.0169 -0.0031 0.0358  257  ARG B C   
4060 O O   . ARG B 257 ? 0.5156 0.5560 0.6205 -0.0180 -0.0024 0.0378  257  ARG B O   
4061 C CB  . ARG B 257 ? 0.5221 0.5588 0.6447 -0.0123 -0.0037 0.0367  257  ARG B CB  
4062 C CG  . ARG B 257 ? 0.5884 0.6296 0.7160 -0.0111 -0.0032 0.0392  257  ARG B CG  
4063 C CD  . ARG B 257 ? 0.6578 0.6988 0.7947 -0.0087 -0.0034 0.0401  257  ARG B CD  
4064 N NE  . ARG B 257 ? 0.6894 0.7326 0.8304 -0.0073 -0.0026 0.0437  257  ARG B NE  
4065 C CZ  . ARG B 257 ? 0.7386 0.7862 0.8817 -0.0064 -0.0022 0.0448  257  ARG B CZ  
4066 N NH1 . ARG B 257 ? 0.7609 0.8115 0.9024 -0.0068 -0.0024 0.0426  257  ARG B NH1 
4067 N NH2 . ARG B 257 ? 0.7983 0.8478 0.9452 -0.0049 -0.0014 0.0482  257  ARG B NH2 
4068 N N   . HIS B 258 ? 0.5186 0.5585 0.6266 -0.0179 -0.0039 0.0331  258  HIS B N   
4069 C CA  . HIS B 258 ? 0.5389 0.5837 0.6427 -0.0205 -0.0040 0.0321  258  HIS B CA  
4070 C C   . HIS B 258 ? 0.5370 0.5853 0.6454 -0.0197 -0.0048 0.0296  258  HIS B C   
4071 O O   . HIS B 258 ? 0.5487 0.5935 0.6598 -0.0184 -0.0054 0.0276  258  HIS B O   
4072 C CB  . HIS B 258 ? 0.5343 0.5748 0.6267 -0.0241 -0.0039 0.0311  258  HIS B CB  
4073 C CG  . HIS B 258 ? 0.5936 0.6392 0.6803 -0.0279 -0.0040 0.0307  258  HIS B CG  
4074 N ND1 . HIS B 258 ? 0.6421 0.6899 0.7242 -0.0302 -0.0033 0.0329  258  HIS B ND1 
4075 C CD2 . HIS B 258 ? 0.6034 0.6530 0.6879 -0.0302 -0.0046 0.0285  258  HIS B CD2 
4076 C CE1 . HIS B 258 ? 0.6372 0.6905 0.7146 -0.0340 -0.0036 0.0322  258  HIS B CE1 
4077 N NE2 . HIS B 258 ? 0.6236 0.6782 0.7025 -0.0339 -0.0044 0.0296  258  HIS B NE2 
4078 N N   . ALA B 259 ? 0.5307 0.5862 0.6402 -0.0200 -0.0047 0.0296  259  ALA B N   
4079 C CA  . ALA B 259 ? 0.5295 0.5879 0.6428 -0.0187 -0.0053 0.0272  259  ALA B CA  
4080 C C   . ALA B 259 ? 0.5339 0.5970 0.6405 -0.0222 -0.0055 0.0256  259  ALA B C   
4081 O O   . ALA B 259 ? 0.5451 0.6127 0.6474 -0.0247 -0.0052 0.0273  259  ALA B O   
4082 C CB  . ALA B 259 ? 0.5251 0.5885 0.6467 -0.0149 -0.0048 0.0286  259  ALA B CB  
4083 N N   . TYR B 260 ? 0.5346 0.5971 0.6403 -0.0226 -0.0062 0.0226  260  TYR B N   
4084 C CA  . TYR B 260 ? 0.5577 0.6260 0.6577 -0.0259 -0.0065 0.0213  260  TYR B CA  
4085 C C   . TYR B 260 ? 0.5779 0.6530 0.6832 -0.0234 -0.0066 0.0197  260  TYR B C   
4086 O O   . TYR B 260 ? 0.5605 0.6321 0.6701 -0.0207 -0.0069 0.0177  260  TYR B O   
4087 C CB  . TYR B 260 ? 0.5468 0.6092 0.6387 -0.0295 -0.0071 0.0190  260  TYR B CB  
4088 C CG  . TYR B 260 ? 0.5240 0.5785 0.6086 -0.0318 -0.0068 0.0202  260  TYR B CG  
4089 C CD1 . TYR B 260 ? 0.4721 0.5186 0.5582 -0.0296 -0.0068 0.0202  260  TYR B CD1 
4090 C CD2 . TYR B 260 ? 0.5104 0.5654 0.5857 -0.0365 -0.0066 0.0213  260  TYR B CD2 
4091 C CE1 . TYR B 260 ? 0.4775 0.5169 0.5567 -0.0309 -0.0064 0.0214  260  TYR B CE1 
4092 C CE2 . TYR B 260 ? 0.4831 0.5294 0.5505 -0.0383 -0.0061 0.0222  260  TYR B CE2 
4093 C CZ  . TYR B 260 ? 0.5095 0.5480 0.5790 -0.0350 -0.0059 0.0222  260  TYR B CZ  
4094 O OH  . TYR B 260 ? 0.5434 0.5732 0.6050 -0.0358 -0.0053 0.0232  260  TYR B OH  
4095 N N   . SER B 261 ? 0.6136 0.6987 0.7179 -0.0244 -0.0063 0.0207  261  SER B N   
4096 C CA  . SER B 261 ? 0.6629 0.7551 0.7700 -0.0223 -0.0063 0.0190  261  SER B CA  
4097 C C   . SER B 261 ? 0.6830 0.7760 0.7836 -0.0263 -0.0070 0.0162  261  SER B C   
4098 O O   . SER B 261 ? 0.6666 0.7559 0.7595 -0.0312 -0.0075 0.0161  261  SER B O   
4099 C CB  . SER B 261 ? 0.6771 0.7813 0.7862 -0.0212 -0.0055 0.0215  261  SER B CB  
4100 O OG  . SER B 261 ? 0.7469 0.8573 0.8485 -0.0269 -0.0058 0.0222  261  SER B OG  
4101 N N   . CYS B 262 ? 0.7226 0.8199 0.8260 -0.0240 -0.0071 0.0140  262  CYS B N   
4102 C CA  . CYS B 262 ? 0.7587 0.8595 0.8569 -0.0272 -0.0077 0.0116  262  CYS B CA  
4103 C C   . CYS B 262 ? 0.7800 0.8876 0.8706 -0.0330 -0.0079 0.0129  262  CYS B C   
4104 O O   . CYS B 262 ? 0.7952 0.9003 0.8787 -0.0377 -0.0086 0.0113  262  CYS B O   
4105 C CB  . CYS B 262 ? 0.7830 0.8915 0.8859 -0.0231 -0.0073 0.0102  262  CYS B CB  
4106 S SG  . CYS B 262 ? 0.8355 0.9347 0.9448 -0.0176 -0.0074 0.0075  262  CYS B SG  
4107 N N   . ASP B 263 ? 0.7973 0.9141 0.8892 -0.0330 -0.0073 0.0158  263  ASP B N   
4108 C CA  . ASP B 263 ? 0.8240 0.9475 0.9084 -0.0393 -0.0075 0.0174  263  ASP B CA  
4109 C C   . ASP B 263 ? 0.7867 0.8993 0.8624 -0.0447 -0.0080 0.0171  263  ASP B C   
4110 O O   . ASP B 263 ? 0.8040 0.9186 0.8711 -0.0510 -0.0085 0.0172  263  ASP B O   
4111 C CB  . ASP B 263 ? 0.8600 0.9921 0.9471 -0.0385 -0.0068 0.0211  263  ASP B CB  
4112 C CG  . ASP B 263 ? 0.9502 1.0947 1.0449 -0.0329 -0.0060 0.0221  263  ASP B CG  
4113 O OD1 . ASP B 263 ? 1.0262 1.1752 1.1220 -0.0313 -0.0061 0.0200  263  ASP B OD1 
4114 O OD2 . ASP B 263 ? 1.0204 1.1700 1.1195 -0.0300 -0.0053 0.0252  263  ASP B OD2 
4115 N N   . GLU B 264 ? 0.7462 0.8474 0.8237 -0.0423 -0.0079 0.0171  264  GLU B N   
4116 C CA  . GLU B 264 ? 0.7183 0.8096 0.7874 -0.0465 -0.0080 0.0177  264  GLU B CA  
4117 C C   . GLU B 264 ? 0.6934 0.7739 0.7579 -0.0474 -0.0086 0.0151  264  GLU B C   
4118 O O   . GLU B 264 ? 0.6875 0.7576 0.7462 -0.0489 -0.0084 0.0154  264  GLU B O   
4119 C CB  . GLU B 264 ? 0.7097 0.7967 0.7822 -0.0439 -0.0074 0.0201  264  GLU B CB  
4120 C CG  . GLU B 264 ? 0.7365 0.8349 0.8137 -0.0428 -0.0068 0.0229  264  GLU B CG  
4121 C CD  . GLU B 264 ? 0.7610 0.8562 0.8449 -0.0383 -0.0061 0.0251  264  GLU B CD  
4122 O OE1 . GLU B 264 ? 0.7665 0.8553 0.8566 -0.0336 -0.0061 0.0241  264  GLU B OE1 
4123 O OE2 . GLU B 264 ? 0.8016 0.9011 0.8845 -0.0396 -0.0057 0.0279  264  GLU B OE2 
4124 N N   . ILE B 265 ? 0.6819 0.7652 0.7486 -0.0464 -0.0091 0.0126  265  ILE B N   
4125 C CA  . ILE B 265 ? 0.6742 0.7490 0.7355 -0.0479 -0.0097 0.0101  265  ILE B CA  
4126 C C   . ILE B 265 ? 0.6928 0.7713 0.7448 -0.0541 -0.0101 0.0094  265  ILE B C   
4127 O O   . ILE B 265 ? 0.7138 0.8035 0.7680 -0.0548 -0.0103 0.0090  265  ILE B O   
4128 C CB  . ILE B 265 ? 0.6691 0.7438 0.7384 -0.0430 -0.0100 0.0077  265  ILE B CB  
4129 C CG1 . ILE B 265 ? 0.6467 0.7179 0.7248 -0.0375 -0.0096 0.0086  265  ILE B CG1 
4130 C CG2 . ILE B 265 ? 0.6449 0.7122 0.7088 -0.0446 -0.0107 0.0052  265  ILE B CG2 
4131 C CD1 . ILE B 265 ? 0.6394 0.7095 0.7247 -0.0332 -0.0100 0.0062  265  ILE B CD1 
4132 N N   . ILE B 266 ? 0.6840 0.7534 0.7252 -0.0587 -0.0102 0.0093  266  ILE B N   
4133 C CA  . ILE B 266 ? 0.6955 0.7667 0.7268 -0.0652 -0.0107 0.0086  266  ILE B CA  
4134 C C   . ILE B 266 ? 0.6985 0.7645 0.7283 -0.0644 -0.0113 0.0059  266  ILE B C   
4135 O O   . ILE B 266 ? 0.6843 0.7382 0.7094 -0.0639 -0.0112 0.0054  266  ILE B O   
4136 C CB  . ILE B 266 ? 0.7130 0.7749 0.7314 -0.0709 -0.0104 0.0100  266  ILE B CB  
4137 C CG1 . ILE B 266 ? 0.6970 0.7632 0.7159 -0.0721 -0.0099 0.0127  266  ILE B CG1 
4138 C CG2 . ILE B 266 ? 0.7371 0.7993 0.7438 -0.0785 -0.0110 0.0092  266  ILE B CG2 
4139 C CD1 . ILE B 266 ? 0.7091 0.7913 0.7362 -0.0712 -0.0100 0.0137  266  ILE B CD1 
4140 N N   . TRP B 267 ? 0.7104 0.7857 0.7439 -0.0641 -0.0117 0.0043  267  TRP B N   
4141 C CA  . TRP B 267 ? 0.7156 0.7871 0.7479 -0.0635 -0.0123 0.0016  267  TRP B CA  
4142 C C   . TRP B 267 ? 0.7356 0.8016 0.7547 -0.0702 -0.0127 0.0014  267  TRP B C   
4143 O O   . TRP B 267 ? 0.7717 0.8445 0.7852 -0.0757 -0.0128 0.0022  267  TRP B O   
4144 C CB  . TRP B 267 ? 0.7310 0.8144 0.7708 -0.0611 -0.0126 0.0000  267  TRP B CB  
4145 C CG  . TRP B 267 ? 0.7363 0.8229 0.7881 -0.0541 -0.0122 0.0000  267  TRP B CG  
4146 C CD1 . TRP B 267 ? 0.7358 0.8280 0.7935 -0.0517 -0.0115 0.0020  267  TRP B CD1 
4147 C CD2 . TRP B 267 ? 0.7426 0.8264 0.8013 -0.0490 -0.0125 -0.0024 267  TRP B CD2 
4148 N NE1 . TRP B 267 ? 0.7363 0.8286 0.8039 -0.0452 -0.0113 0.0011  267  TRP B NE1 
4149 C CE2 . TRP B 267 ? 0.7399 0.8269 0.8081 -0.0437 -0.0119 -0.0016 267  TRP B CE2 
4150 C CE3 . TRP B 267 ? 0.7641 0.8430 0.8215 -0.0485 -0.0131 -0.0051 267  TRP B CE3 
4151 C CZ2 . TRP B 267 ? 0.7460 0.8306 0.8219 -0.0384 -0.0120 -0.0036 267  TRP B CZ2 
4152 C CZ3 . TRP B 267 ? 0.7466 0.8240 0.8121 -0.0432 -0.0133 -0.0070 267  TRP B CZ3 
4153 C CH2 . TRP B 267 ? 0.7365 0.8164 0.8109 -0.0384 -0.0127 -0.0064 267  TRP B CH2 
4154 N N   . GLY B 268 ? 0.7258 0.7799 0.7399 -0.0696 -0.0128 0.0004  268  GLY B N   
4155 C CA  . GLY B 268 ? 0.7542 0.8000 0.7546 -0.0755 -0.0129 0.0005  268  GLY B CA  
4156 C C   . GLY B 268 ? 0.7664 0.8019 0.7574 -0.0783 -0.0122 0.0026  268  GLY B C   
4157 O O   . GLY B 268 ? 0.8129 0.8395 0.7909 -0.0832 -0.0121 0.0027  268  GLY B O   
4158 N N   . GLY B 269 ? 0.7404 0.7762 0.7368 -0.0753 -0.0116 0.0042  269  GLY B N   
4159 C CA  . GLY B 269 ? 0.7451 0.7708 0.7317 -0.0780 -0.0108 0.0061  269  GLY B CA  
4160 C C   . GLY B 269 ? 0.7507 0.7611 0.7317 -0.0749 -0.0102 0.0060  269  GLY B C   
4161 O O   . GLY B 269 ? 0.7494 0.7586 0.7378 -0.0693 -0.0104 0.0050  269  GLY B O   
4162 N N   . HIS B 270 ? 0.7715 0.7703 0.7390 -0.0785 -0.0094 0.0071  270  HIS B N   
4163 C CA  . HIS B 270 ? 0.7775 0.7618 0.7393 -0.0748 -0.0085 0.0076  270  HIS B CA  
4164 C C   . HIS B 270 ? 0.7834 0.7617 0.7392 -0.0759 -0.0074 0.0096  270  HIS B C   
4165 O O   . HIS B 270 ? 0.8127 0.7887 0.7577 -0.0827 -0.0072 0.0102  270  HIS B O   
4166 C CB  . HIS B 270 ? 0.8192 0.7916 0.7667 -0.0778 -0.0083 0.0068  270  HIS B CB  
4167 C CG  . HIS B 270 ? 0.8800 0.8581 0.8302 -0.0786 -0.0094 0.0049  270  HIS B CG  
4168 N ND1 . HIS B 270 ? 0.9346 0.9207 0.8820 -0.0851 -0.0102 0.0041  270  HIS B ND1 
4169 C CD2 . HIS B 270 ? 0.8890 0.8667 0.8444 -0.0739 -0.0098 0.0036  270  HIS B CD2 
4170 C CE1 . HIS B 270 ? 0.9552 0.9455 0.9063 -0.0840 -0.0110 0.0024  270  HIS B CE1 
4171 N NE2 . HIS B 270 ? 0.9026 0.8876 0.8585 -0.0774 -0.0108 0.0019  270  HIS B NE2 
4172 N N   . PHE B 271 ? 0.7476 0.7228 0.7094 -0.0698 -0.0066 0.0108  271  PHE B N   
4173 C CA  . PHE B 271 ? 0.7446 0.7121 0.6997 -0.0700 -0.0054 0.0127  271  PHE B CA  
4174 C C   . PHE B 271 ? 0.7856 0.7372 0.7217 -0.0738 -0.0044 0.0128  271  PHE B C   
4175 O O   . PHE B 271 ? 0.8005 0.7438 0.7307 -0.0723 -0.0042 0.0119  271  PHE B O   
4176 C CB  . PHE B 271 ? 0.7053 0.6713 0.6693 -0.0622 -0.0047 0.0138  271  PHE B CB  
4177 C CG  . PHE B 271 ? 0.6725 0.6521 0.6531 -0.0592 -0.0053 0.0143  271  PHE B CG  
4178 C CD1 . PHE B 271 ? 0.6320 0.6174 0.6256 -0.0538 -0.0060 0.0135  271  PHE B CD1 
4179 C CD2 . PHE B 271 ? 0.6102 0.5968 0.5929 -0.0620 -0.0052 0.0156  271  PHE B CD2 
4180 C CE1 . PHE B 271 ? 0.5885 0.5849 0.5962 -0.0511 -0.0064 0.0139  271  PHE B CE1 
4181 C CE2 . PHE B 271 ? 0.5860 0.5844 0.5830 -0.0590 -0.0057 0.0162  271  PHE B CE2 
4182 C CZ  . PHE B 271 ? 0.5819 0.5846 0.5913 -0.0535 -0.0062 0.0153  271  PHE B CZ  
4183 N N   . VAL B 272 ? 0.8108 0.7577 0.7369 -0.0787 -0.0037 0.0138  272  VAL B N   
4184 C CA  . VAL B 272 ? 0.8527 0.7826 0.7598 -0.0820 -0.0025 0.0140  272  VAL B CA  
4185 C C   . VAL B 272 ? 0.8652 0.7832 0.7691 -0.0751 -0.0008 0.0152  272  VAL B C   
4186 O O   . VAL B 272 ? 0.8465 0.7682 0.7581 -0.0713 -0.0003 0.0166  272  VAL B O   
4187 C CB  . VAL B 272 ? 0.8831 0.8121 0.7803 -0.0899 -0.0024 0.0148  272  VAL B CB  
4188 C CG1 . VAL B 272 ? 0.8906 0.7991 0.7673 -0.0922 -0.0007 0.0152  272  VAL B CG1 
4189 C CG2 . VAL B 272 ? 0.8834 0.8233 0.7803 -0.0979 -0.0039 0.0139  272  VAL B CG2 
4190 N N   . ASP B 273 ? 0.9182 0.8216 0.8099 -0.0735 0.0000  0.0149  273  ASP B N   
4191 C CA  . ASP B 273 ? 0.9558 0.8470 0.8422 -0.0667 0.0019  0.0163  273  ASP B CA  
4192 C C   . ASP B 273 ? 0.9715 0.8580 0.8525 -0.0676 0.0032  0.0177  273  ASP B C   
4193 O O   . ASP B 273 ? 1.0115 0.8927 0.8802 -0.0750 0.0033  0.0175  273  ASP B O   
4194 C CB  . ASP B 273 ? 1.0050 0.8790 0.8745 -0.0663 0.0030  0.0159  273  ASP B CB  
4195 C CG  . ASP B 273 ? 1.0633 0.9277 0.9308 -0.0568 0.0049  0.0174  273  ASP B CG  
4196 O OD1 . ASP B 273 ? 1.0784 0.9509 0.9591 -0.0506 0.0051  0.0186  273  ASP B OD1 
4197 O OD2 . ASP B 273 ? 1.1640 1.0128 1.0161 -0.0555 0.0063  0.0176  273  ASP B OD2 
4198 N N   . VAL B 274 ? 0.9570 0.8460 0.8469 -0.0603 0.0040  0.0192  274  VAL B N   
4199 C CA  . VAL B 274 ? 0.9832 0.8674 0.8683 -0.0599 0.0054  0.0207  274  VAL B CA  
4200 C C   . VAL B 274 ? 1.0349 0.9014 0.9061 -0.0545 0.0078  0.0217  274  VAL B C   
4201 O O   . VAL B 274 ? 1.0484 0.9072 0.9114 -0.0542 0.0094  0.0228  274  VAL B O   
4202 C CB  . VAL B 274 ? 0.9430 0.8417 0.8467 -0.0554 0.0049  0.0221  274  VAL B CB  
4203 C CG1 . VAL B 274 ? 0.9009 0.8153 0.8154 -0.0609 0.0031  0.0215  274  VAL B CG1 
4204 C CG2 . VAL B 274 ? 0.9114 0.8150 0.8279 -0.0470 0.0048  0.0225  274  VAL B CG2 
4205 N N   . PHE B 275 ? 0.9524 0.9193 0.9162 0.0090  0.0343  -0.0059 275  PHE B N   
4206 C CA  . PHE B 275 ? 0.9971 0.9637 0.9572 0.0063  0.0233  -0.0052 275  PHE B CA  
4207 C C   . PHE B 275 ? 1.0561 1.0199 1.0082 0.0049  0.0273  0.0020  275  PHE B C   
4208 O O   . PHE B 275 ? 1.0982 1.0492 1.0291 0.0063  0.0373  0.0044  275  PHE B O   
4209 C CB  . PHE B 275 ? 1.0055 0.9608 0.9484 0.0087  0.0129  -0.0140 275  PHE B CB  
4210 C CG  . PHE B 275 ? 0.9929 0.9492 0.9498 0.0069  0.0101  -0.0234 275  PHE B CG  
4211 C CD1 . PHE B 275 ? 1.0082 0.9542 0.9561 0.0094  0.0151  -0.0294 275  PHE B CD1 
4212 C CD2 . PHE B 275 ? 1.0161 0.9814 0.9964 0.0019  0.0054  -0.0271 275  PHE B CD2 
4213 C CE1 . PHE B 275 ? 0.9845 0.9267 0.9473 0.0060  0.0137  -0.0388 275  PHE B CE1 
4214 C CE2 . PHE B 275 ? 1.0109 0.9736 1.0075 -0.0026 0.0077  -0.0358 275  PHE B CE2 
4215 C CZ  . PHE B 275 ? 0.9892 0.9391 0.9772 -0.0011 0.0110  -0.0414 275  PHE B CZ  
4216 N N   . THR B 276 ? 1.0828 1.0540 1.0485 0.0019  0.0220  0.0055  276  THR B N   
4217 C CA  . THR B 276 ? 1.1403 1.1069 1.1046 -0.0015 0.0279  0.0120  276  THR B CA  
4218 C C   . THR B 276 ? 1.1753 1.1383 1.1389 -0.0016 0.0159  0.0128  276  THR B C   
4219 O O   . THR B 276 ? 1.1546 1.1264 1.1286 0.0000  0.0061  0.0078  276  THR B O   
4220 C CB  . THR B 276 ? 1.1373 1.1211 1.1326 -0.0051 0.0351  0.0125  276  THR B CB  
4221 O OG1 . THR B 276 ? 1.1275 1.1230 1.1382 -0.0034 0.0234  0.0095  276  THR B OG1 
4222 C CG2 . THR B 276 ? 1.1191 1.1090 1.1218 -0.0024 0.0470  0.0098  276  THR B CG2 
4223 N N   . THR B 277 ? 1.2432 1.1904 1.1946 -0.0036 0.0191  0.0190  277  THR B N   
4224 C CA  . THR B 277 ? 1.2944 1.2360 1.2477 -0.0026 0.0076  0.0192  277  THR B CA  
4225 C C   . THR B 277 ? 1.3148 1.2672 1.2955 -0.0094 0.0098  0.0190  277  THR B C   
4226 O O   . THR B 277 ? 1.3271 1.2818 1.3212 -0.0164 0.0219  0.0215  277  THR B O   
4227 C CB  . THR B 277 ? 1.3636 1.2733 1.2821 0.0016  0.0057  0.0259  277  THR B CB  
4228 O OG1 . THR B 277 ? 1.3684 1.2692 1.2616 0.0114  -0.0052 0.0217  277  THR B OG1 
4229 C CG2 . THR B 277 ? 1.4070 1.3090 1.3308 0.0040  -0.0060 0.0256  277  THR B CG2 
4230 N N   . LEU B 278 ? 1.3291 1.2885 1.3205 -0.0070 -0.0016 0.0137  278  LEU B N   
4231 C CA  . LEU B 278 ? 1.3622 1.3292 1.3744 -0.0112 -0.0039 0.0103  278  LEU B CA  
4232 C C   . LEU B 278 ? 1.4495 1.3974 1.4611 -0.0155 -0.0036 0.0132  278  LEU B C   
4233 O O   . LEU B 278 ? 1.4844 1.4085 1.4734 -0.0140 -0.0006 0.0204  278  LEU B O   
4234 C CB  . LEU B 278 ? 1.3452 1.3226 1.3618 -0.0061 -0.0130 0.0028  278  LEU B CB  
4235 C CG  . LEU B 278 ? 1.2941 1.2848 1.3135 -0.0042 -0.0107 0.0010  278  LEU B CG  
4236 C CD1 . LEU B 278 ? 1.2986 1.2916 1.3158 0.0000  -0.0161 -0.0047 278  LEU B CD1 
4237 C CD2 . LEU B 278 ? 1.2757 1.2735 1.3084 -0.0077 -0.0060 0.0030  278  LEU B CD2 
4238 N N   . PRO B 279 ? 1.4917 1.4453 1.5248 -0.0199 -0.0080 0.0070  279  PRO B N   
4239 C CA  . PRO B 279 ? 1.5754 1.5086 1.6120 -0.0250 -0.0086 0.0074  279  PRO B CA  
4240 C C   . PRO B 279 ? 1.6184 1.5304 1.6303 -0.0157 -0.0163 0.0099  279  PRO B C   
4241 O O   . PRO B 279 ? 1.6722 1.5547 1.6657 -0.0161 -0.0122 0.0185  279  PRO B O   
4242 C CB  . PRO B 279 ? 1.5956 1.5423 1.6554 -0.0262 -0.0199 -0.0052 279  PRO B CB  
4243 C CG  . PRO B 279 ? 1.5359 1.5082 1.6067 -0.0240 -0.0218 -0.0094 279  PRO B CG  
4244 C CD  . PRO B 279 ? 1.4659 1.4407 1.5156 -0.0181 -0.0157 -0.0019 279  PRO B CD  
4245 N N   . ASP B 280 ? 1.5999 1.5252 1.6113 -0.0064 -0.0265 0.0021  280  ASP B N   
4246 C CA  . ASP B 280 ? 1.6383 1.5521 1.6391 0.0044  -0.0359 -0.0003 280  ASP B CA  
4247 C C   . ASP B 280 ? 1.6244 1.5269 1.6040 0.0114  -0.0383 0.0063  280  ASP B C   
4248 O O   . ASP B 280 ? 1.6825 1.5641 1.6483 0.0213  -0.0483 0.0072  280  ASP B O   
4249 C CB  . ASP B 280 ? 1.6168 1.5518 1.6288 0.0109  -0.0400 -0.0121 280  ASP B CB  
4250 C CG  . ASP B 280 ? 1.6105 1.5595 1.6301 0.0060  -0.0367 -0.0173 280  ASP B CG  
4251 O OD1 . ASP B 280 ? 1.6220 1.5715 1.6472 -0.0019 -0.0347 -0.0141 280  ASP B OD1 
4252 O OD2 . ASP B 280 ? 1.6116 1.5698 1.6309 0.0111  -0.0359 -0.0254 280  ASP B OD2 
4253 N N   . GLY B 281 ? 1.5575 1.4713 1.5323 0.0084  -0.0316 0.0097  281  GLY B N   
4254 C CA  . GLY B 281 ? 1.5361 1.4423 1.4903 0.0167  -0.0376 0.0113  281  GLY B CA  
4255 C C   . GLY B 281 ? 1.4597 1.3943 1.4329 0.0197  -0.0419 0.0004  281  GLY B C   
4256 O O   . GLY B 281 ? 1.4492 1.3840 1.4165 0.0270  -0.0515 -0.0041 281  GLY B O   
4257 N N   . ARG B 282 ? 1.4137 1.3691 1.4087 0.0141  -0.0351 -0.0044 282  ARG B N   
4258 C CA  . ARG B 282 ? 1.3442 1.3202 1.3540 0.0132  -0.0313 -0.0116 282  ARG B CA  
4259 C C   . ARG B 282 ? 1.2890 1.2653 1.2888 0.0091  -0.0251 -0.0065 282  ARG B C   
4260 O O   . ARG B 282 ? 1.2919 1.2614 1.2822 0.0048  -0.0183 0.0014  282  ARG B O   
4261 C CB  . ARG B 282 ? 1.3369 1.3228 1.3563 0.0095  -0.0231 -0.0142 282  ARG B CB  
4262 C CG  . ARG B 282 ? 1.3795 1.3686 1.4100 0.0142  -0.0247 -0.0232 282  ARG B CG  
4263 C CD  . ARG B 282 ? 1.3980 1.3896 1.4237 0.0119  -0.0152 -0.0249 282  ARG B CD  
4264 N NE  . ARG B 282 ? 1.4403 1.4234 1.4561 0.0098  -0.0201 -0.0209 282  ARG B NE  
4265 C CZ  . ARG B 282 ? 1.4413 1.4230 1.4466 0.0100  -0.0187 -0.0218 282  ARG B CZ  
4266 N NH1 . ARG B 282 ? 1.4152 1.3968 1.4089 0.0123  -0.0092 -0.0230 282  ARG B NH1 
4267 N NH2 . ARG B 282 ? 1.4623 1.4400 1.4682 0.0083  -0.0274 -0.0223 282  ARG B NH2 
4268 N N   . ARG B 283 ? 1.2339 1.2188 1.2406 0.0102  -0.0262 -0.0132 283  ARG B N   
4269 C CA  . ARG B 283 ? 1.1725 1.1569 1.1711 0.0069  -0.0195 -0.0107 283  ARG B CA  
4270 C C   . ARG B 283 ? 1.1116 1.1043 1.1193 0.0018  -0.0078 -0.0086 283  ARG B C   
4271 O O   . ARG B 283 ? 1.1089 1.1075 1.1274 0.0008  -0.0041 -0.0121 283  ARG B O   
4272 C CB  . ARG B 283 ? 1.1680 1.1546 1.1709 0.0098  -0.0276 -0.0209 283  ARG B CB  
4273 C CG  . ARG B 283 ? 1.1986 1.1756 1.1818 0.0097  -0.0246 -0.0193 283  ARG B CG  
4274 C CD  . ARG B 283 ? 1.3126 1.2675 1.2593 0.0151  -0.0269 -0.0114 283  ARG B CD  
4275 N NE  . ARG B 283 ? 1.3490 1.2956 1.2773 0.0135  -0.0145 -0.0075 283  ARG B NE  
4276 C CZ  . ARG B 283 ? 1.4065 1.3302 1.2978 0.0177  -0.0103 -0.0021 283  ARG B CZ  
4277 N NH1 . ARG B 283 ? 1.4893 1.3909 1.3518 0.0244  -0.0193 0.0019  283  ARG B NH1 
4278 N NH2 . ARG B 283 ? 1.3915 1.3103 1.2709 0.0165  0.0043  -0.0008 283  ARG B NH2 
4279 N N   . ALA B 284 ? 1.0574 1.0476 1.0576 0.0003  -0.0014 -0.0030 284  ALA B N   
4280 C CA  . ALA B 284 ? 1.0077 1.0010 1.0118 -0.0003 0.0049  -0.0007 284  ALA B CA  
4281 C C   . ALA B 284 ? 0.9477 0.9379 0.9485 0.0002  0.0107  -0.0003 284  ALA B C   
4282 O O   . ALA B 284 ? 0.9255 0.9123 0.9194 0.0008  0.0117  -0.0005 284  ALA B O   
4283 C CB  . ALA B 284 ? 1.0333 1.0294 1.0404 0.0000  0.0029  0.0029  284  ALA B CB  
4284 N N   . LEU B 285 ? 0.9121 0.8982 0.9124 0.0014  0.0154  0.0005  285  LEU B N   
4285 C CA  . LEU B 285 ? 0.8709 0.8508 0.8684 0.0041  0.0202  0.0012  285  LEU B CA  
4286 C C   . LEU B 285 ? 0.8663 0.8472 0.8645 0.0109  0.0181  0.0055  285  LEU B C   
4287 O O   . LEU B 285 ? 0.8855 0.8605 0.8761 0.0146  0.0148  0.0080  285  LEU B O   
4288 C CB  . LEU B 285 ? 0.8599 0.8275 0.8559 0.0014  0.0269  -0.0015 285  LEU B CB  
4289 C CG  . LEU B 285 ? 0.8321 0.7863 0.8227 0.0057  0.0319  -0.0003 285  LEU B CG  
4290 C CD1 . LEU B 285 ? 0.8014 0.7585 0.7932 0.0063  0.0311  -0.0063 285  LEU B CD1 
4291 C CD2 . LEU B 285 ? 0.8506 0.7848 0.8378 0.0015  0.0417  -0.0005 285  LEU B CD2 
4292 N N   . ASP B 286 ? 1.0154 0.8714 0.8721 -0.0565 0.0113  0.0250  286  ASP B N   
4293 C CA  . ASP B 286 ? 1.0176 0.8792 0.8725 -0.0650 0.0103  0.0247  286  ASP B CA  
4294 C C   . ASP B 286 ? 0.9594 0.8425 0.8353 -0.0656 0.0081  0.0249  286  ASP B C   
4295 O O   . ASP B 286 ? 0.9438 0.8349 0.8259 -0.0685 0.0064  0.0237  286  ASP B O   
4296 C CB  . ASP B 286 ? 1.0589 0.9109 0.8971 -0.0740 0.0098  0.0229  286  ASP B CB  
4297 C CG  . ASP B 286 ? 1.0953 0.9538 0.9305 -0.0837 0.0087  0.0227  286  ASP B CG  
4298 O OD1 . ASP B 286 ? 1.0632 0.9353 0.9108 -0.0834 0.0081  0.0239  286  ASP B OD1 
4299 O OD2 . ASP B 286 ? 1.1632 1.0132 0.9831 -0.0920 0.0084  0.0215  286  ASP B OD2 
4300 N N   . LEU B 287 ? 0.9319 0.8240 0.8187 -0.0627 0.0082  0.0266  287  LEU B N   
4301 C CA  . LEU B 287 ? 0.8785 0.7901 0.7850 -0.0624 0.0064  0.0270  287  LEU B CA  
4302 C C   . LEU B 287 ? 0.8771 0.7983 0.7836 -0.0712 0.0049  0.0264  287  LEU B C   
4303 O O   . LEU B 287 ? 0.8476 0.7844 0.7692 -0.0711 0.0034  0.0267  287  LEU B O   
4304 C CB  . LEU B 287 ? 0.8588 0.7770 0.7769 -0.0564 0.0071  0.0293  287  LEU B CB  
4305 C CG  . LEU B 287 ? 0.8380 0.7532 0.7622 -0.0474 0.0080  0.0300  287  LEU B CG  
4306 C CD1 . LEU B 287 ? 0.8037 0.7258 0.7394 -0.0418 0.0086  0.0323  287  LEU B CD1 
4307 C CD2 . LEU B 287 ? 0.8014 0.7239 0.7363 -0.0459 0.0064  0.0286  287  LEU B CD2 
4308 N N   . GLY B 288 ? 0.9113 0.8232 0.8007 -0.0787 0.0052  0.0258  288  GLY B N   
4309 C CA  . GLY B 288 ? 0.9264 0.8479 0.8146 -0.0877 0.0037  0.0253  288  GLY B CA  
4310 C C   . GLY B 288 ? 0.9190 0.8480 0.8126 -0.0898 0.0021  0.0238  288  GLY B C   
4311 O O   . GLY B 288 ? 0.9196 0.8630 0.8203 -0.0942 0.0006  0.0238  288  GLY B O   
4312 N N   . LYS B 289 ? 0.9141 0.8336 0.8041 -0.0864 0.0024  0.0226  289  LYS B N   
4313 C CA  . LYS B 289 ? 0.8957 0.8215 0.7906 -0.0878 0.0010  0.0211  289  LYS B CA  
4314 C C   . LYS B 289 ? 0.8376 0.7781 0.7536 -0.0810 0.0001  0.0212  289  LYS B C   
4315 O O   . LYS B 289 ? 0.8184 0.7663 0.7407 -0.0816 -0.0011 0.0199  289  LYS B O   
4316 C CB  . LYS B 289 ? 0.9280 0.8373 0.8099 -0.0868 0.0019  0.0198  289  LYS B CB  
4317 C CG  . LYS B 289 ? 1.0096 0.9019 0.8683 -0.0941 0.0029  0.0194  289  LYS B CG  
4318 C CD  . LYS B 289 ? 1.0701 0.9516 0.9168 -0.0970 0.0028  0.0179  289  LYS B CD  
4319 C CE  . LYS B 289 ? 1.1410 1.0001 0.9644 -0.0999 0.0046  0.0177  289  LYS B CE  
4320 N NZ  . LYS B 289 ? 1.2270 1.0849 1.0436 -0.1051 0.0050  0.0185  289  LYS B NZ  
4321 N N   . PHE B 290 ? 0.8022 0.7465 0.7284 -0.0750 0.0007  0.0228  290  PHE B N   
4322 C CA  . PHE B 290 ? 0.7471 0.7006 0.6907 -0.0677 0.0002  0.0230  290  PHE B CA  
4323 C C   . PHE B 290 ? 0.7301 0.6999 0.6870 -0.0690 -0.0014 0.0223  290  PHE B C   
4324 O O   . PHE B 290 ? 0.7071 0.6809 0.6735 -0.0649 -0.0021 0.0213  290  PHE B O   
4325 C CB  . PHE B 290 ? 0.7303 0.6853 0.6812 -0.0622 0.0011  0.0251  290  PHE B CB  
4326 C CG  . PHE B 290 ? 0.6721 0.6338 0.6390 -0.0549 0.0008  0.0255  290  PHE B CG  
4327 C CD1 . PHE B 290 ? 0.6654 0.6192 0.6315 -0.0493 0.0015  0.0253  290  PHE B CD1 
4328 C CD2 . PHE B 290 ? 0.6396 0.6157 0.6219 -0.0536 -0.0001 0.0261  290  PHE B CD2 
4329 C CE1 . PHE B 290 ? 0.6109 0.5714 0.5917 -0.0431 0.0010  0.0257  290  PHE B CE1 
4330 C CE2 . PHE B 290 ? 0.6073 0.5885 0.6036 -0.0472 -0.0005 0.0263  290  PHE B CE2 
4331 C CZ  . PHE B 290 ? 0.5754 0.5490 0.5708 -0.0424 0.0000  0.0261  290  PHE B CZ  
4332 N N   . HIS B 291 ? 0.7274 0.7070 0.6852 -0.0743 -0.0021 0.0229  291  HIS B N   
4333 C CA  . HIS B 291 ? 0.7161 0.7111 0.6852 -0.0752 -0.0035 0.0224  291  HIS B CA  
4334 C C   . HIS B 291 ? 0.7533 0.7498 0.7150 -0.0816 -0.0044 0.0207  291  HIS B C   
4335 O O   . HIS B 291 ? 0.7476 0.7580 0.7167 -0.0834 -0.0055 0.0204  291  HIS B O   
4336 C CB  . HIS B 291 ? 0.7092 0.7167 0.6851 -0.0765 -0.0037 0.0244  291  HIS B CB  
4337 C CG  . HIS B 291 ? 0.7064 0.7140 0.6907 -0.0704 -0.0028 0.0263  291  HIS B CG  
4338 N ND1 . HIS B 291 ? 0.6544 0.6657 0.6527 -0.0632 -0.0029 0.0264  291  HIS B ND1 
4339 C CD2 . HIS B 291 ? 0.6663 0.6704 0.6465 -0.0707 -0.0019 0.0282  291  HIS B CD2 
4340 C CE1 . HIS B 291 ? 0.6543 0.6647 0.6569 -0.0594 -0.0021 0.0284  291  HIS B CE1 
4341 N NE2 . HIS B 291 ? 0.6740 0.6801 0.6660 -0.0636 -0.0014 0.0295  291  HIS B NE2 
4342 N N   . GLU B 292 ? 0.7850 0.7675 0.7316 -0.0849 -0.0040 0.0196  292  GLU B N   
4343 C CA  . GLU B 292 ? 0.8210 0.8046 0.7597 -0.0916 -0.0049 0.0182  292  GLU B CA  
4344 C C   . GLU B 292 ? 0.8074 0.7918 0.7517 -0.0882 -0.0055 0.0163  292  GLU B C   
4345 O O   . GLU B 292 ? 0.7995 0.7749 0.7448 -0.0824 -0.0049 0.0158  292  GLU B O   
4346 C CB  . GLU B 292 ? 0.8755 0.8439 0.7941 -0.0982 -0.0042 0.0179  292  GLU B CB  
4347 C CG  . GLU B 292 ? 0.9435 0.9159 0.8544 -0.1062 -0.0043 0.0192  292  GLU B CG  
4348 C CD  . GLU B 292 ? 1.0376 0.9920 0.9278 -0.1118 -0.0033 0.0190  292  GLU B CD  
4349 O OE1 . GLU B 292 ? 1.0702 1.0104 0.9503 -0.1115 -0.0028 0.0178  292  GLU B OE1 
4350 O OE2 . GLU B 292 ? 1.1186 1.0727 1.0022 -0.1166 -0.0030 0.0202  292  GLU B OE2 
4351 N N   . ILE B 293 ? 0.8073 0.8033 0.7552 -0.0918 -0.0067 0.0154  293  ILE B N   
4352 C CA  . ILE B 293 ? 0.7912 0.7897 0.7438 -0.0897 -0.0075 0.0135  293  ILE B CA  
4353 C C   . ILE B 293 ? 0.8248 0.8240 0.7670 -0.0976 -0.0082 0.0124  293  ILE B C   
4354 O O   . ILE B 293 ? 0.8225 0.8321 0.7630 -0.1039 -0.0089 0.0131  293  ILE B O   
4355 C CB  . ILE B 293 ? 0.7608 0.7746 0.7314 -0.0844 -0.0081 0.0134  293  ILE B CB  
4356 C CG1 . ILE B 293 ? 0.7419 0.7532 0.7221 -0.0768 -0.0074 0.0144  293  ILE B CG1 
4357 C CG2 . ILE B 293 ? 0.7524 0.7693 0.7271 -0.0829 -0.0089 0.0112  293  ILE B CG2 
4358 C CD1 . ILE B 293 ? 0.7078 0.7328 0.7040 -0.0723 -0.0078 0.0148  293  ILE B CD1 
4359 N N   . ALA B 294 ? 0.8411 0.8296 0.7760 -0.0974 -0.0081 0.0110  294  ALA B N   
4360 C CA  . ALA B 294 ? 0.8825 0.8708 0.8075 -0.1045 -0.0089 0.0100  294  ALA B CA  
4361 C C   . ALA B 294 ? 0.8729 0.8771 0.8102 -0.1031 -0.0100 0.0088  294  ALA B C   
4362 O O   . ALA B 294 ? 0.8404 0.8482 0.7897 -0.0959 -0.0102 0.0080  294  ALA B O   
4363 C CB  . ALA B 294 ? 0.8953 0.8658 0.8073 -0.1045 -0.0082 0.0092  294  ALA B CB  
4364 N N   . GLN B 295 ? 0.9157 0.9296 0.8494 -0.1102 -0.0109 0.0088  295  GLN B N   
4365 C CA  . GLN B 295 ? 0.9210 0.9504 0.8650 -0.1093 -0.0118 0.0077  295  GLN B CA  
4366 C C   . GLN B 295 ? 0.9777 1.0085 0.9107 -0.1177 -0.0126 0.0072  295  GLN B C   
4367 O O   . GLN B 295 ? 1.0144 1.0430 0.9354 -0.1260 -0.0126 0.0083  295  GLN B O   
4368 C CB  . GLN B 295 ? 0.9029 0.9496 0.8583 -0.1082 -0.0120 0.0091  295  GLN B CB  
4369 C CG  . GLN B 295 ? 0.8417 0.8953 0.8133 -0.0992 -0.0119 0.0085  295  GLN B CG  
4370 C CD  . GLN B 295 ? 0.8288 0.8999 0.8107 -0.0981 -0.0121 0.0099  295  GLN B CD  
4371 O OE1 . GLN B 295 ? 0.8362 0.9097 0.8173 -0.0998 -0.0117 0.0119  295  GLN B OE1 
4372 N NE2 . GLN B 295 ? 0.7961 0.8796 0.7878 -0.0948 -0.0125 0.0088  295  GLN B NE2 
4373 N N   . HIS B 296 ? 0.9961 1.0306 0.9330 -0.1158 -0.0131 0.0055  296  HIS B N   
4374 C CA  . HIS B 296 ? 1.0606 1.0977 0.9884 -0.1232 -0.0138 0.0049  296  HIS B CA  
4375 C C   . HIS B 296 ? 1.0926 1.1502 1.0259 -0.1273 -0.0146 0.0058  296  HIS B C   
4376 O O   . HIS B 296 ? 1.0625 1.1332 1.0098 -0.1217 -0.0146 0.0059  296  HIS B O   
4377 C CB  . HIS B 296 ? 1.0562 1.0903 0.9866 -0.1192 -0.0142 0.0028  296  HIS B CB  
4378 C CG  . HIS B 296 ? 1.1240 1.1615 1.0461 -0.1263 -0.0149 0.0022  296  HIS B CG  
4379 N ND1 . HIS B 296 ? 1.1669 1.1893 1.0732 -0.1315 -0.0148 0.0021  296  HIS B ND1 
4380 C CD2 . HIS B 296 ? 1.1490 1.2036 1.0760 -0.1291 -0.0157 0.0019  296  HIS B CD2 
4381 C CE1 . HIS B 296 ? 1.1867 1.2166 1.0888 -0.1375 -0.0156 0.0017  296  HIS B CE1 
4382 N NE2 . HIS B 296 ? 1.1863 1.2361 1.1008 -0.1362 -0.0162 0.0016  296  HIS B NE2 
4383 N N   . HIS B 297 ? 1.1713 1.2316 1.0930 -0.1371 -0.0151 0.0066  297  HIS B N   
4384 C CA  . HIS B 297 ? 1.2231 1.3042 1.1489 -0.1419 -0.0158 0.0079  297  HIS B CA  
4385 C C   . HIS B 297 ? 1.2946 1.3824 1.2153 -0.1476 -0.0166 0.0071  297  HIS B C   
4386 O O   . HIS B 297 ? 1.3304 1.4064 1.2363 -0.1549 -0.0168 0.0070  297  HIS B O   
4387 C CB  . HIS B 297 ? 1.2485 1.3300 1.1647 -0.1502 -0.0158 0.0102  297  HIS B CB  
4388 C CG  . HIS B 297 ? 1.1928 1.2715 1.1145 -0.1454 -0.0151 0.0113  297  HIS B CG  
4389 N ND1 . HIS B 297 ? 1.1756 1.2704 1.1045 -0.1458 -0.0152 0.0133  297  HIS B ND1 
4390 C CD2 . HIS B 297 ? 1.1550 1.2172 1.0757 -0.1401 -0.0142 0.0109  297  HIS B CD2 
4391 C CE1 . HIS B 297 ? 1.1390 1.2270 1.0714 -0.1410 -0.0144 0.0140  297  HIS B CE1 
4392 N NE2 . HIS B 297 ? 1.1312 1.1996 1.0587 -0.1376 -0.0138 0.0125  297  HIS B NE2 
4393 N N   . HIS B 298 ? 1.3306 1.4369 1.2630 -0.1442 -0.0170 0.0067  298  HIS B N   
4394 C CA  . HIS B 298 ? 1.4990 1.6132 1.4278 -0.1489 -0.0177 0.0060  298  HIS B CA  
4395 C C   . HIS B 298 ? 1.5909 1.7255 1.5183 -0.1567 -0.0183 0.0080  298  HIS B C   
4396 O O   . HIS B 298 ? 1.4567 1.6087 1.3949 -0.1534 -0.0182 0.0093  298  HIS B O   
4397 C CB  . HIS B 298 ? 2.0165 2.1353 1.9572 -0.1400 -0.0176 0.0037  298  HIS B CB  
4398 C CG  . HIS B 298 ? 1.7620 1.8839 1.7178 -0.1293 -0.0170 0.0031  298  HIS B CG  
4399 N ND1 . HIS B 298 ? 1.6955 1.8025 1.6548 -0.1221 -0.0165 0.0016  298  HIS B ND1 
4400 C CD2 . HIS B 298 ? 1.5957 1.7337 1.5635 -0.1246 -0.0166 0.0040  298  HIS B CD2 
4401 C CE1 . HIS B 298 ? 1.4492 1.5626 1.4218 -0.1140 -0.0160 0.0015  298  HIS B CE1 
4402 N NE2 . HIS B 298 ? 1.3846 1.5161 1.3624 -0.1151 -0.0160 0.0029  298  HIS B NE2 
4403 N N   . HIS B 299 ? 1.5246 1.6574 1.4384 -0.1671 -0.0190 0.0086  299  HIS B N   
4404 C CA  . HIS B 299 ? 1.5849 1.7377 1.4963 -0.1755 -0.0198 0.0107  299  HIS B CA  
4405 C C   . HIS B 299 ? 1.5792 1.7559 1.5074 -0.1682 -0.0196 0.0110  299  HIS B C   
4406 O O   . HIS B 299 ? 1.5987 1.7929 1.5311 -0.1700 -0.0197 0.0133  299  HIS B O   
4407 C CB  . HIS B 299 ? 1.6417 1.7919 1.5403 -0.1848 -0.0206 0.0104  299  HIS B CB  
4442 O O   . HOH J .   ? 1.1246 0.9797 1.1267 -0.0395 -0.0738 0.0583  2001 HOH A O   
4443 O O   . HOH J .   ? 0.8744 0.8075 0.9630 -0.0139 -0.0837 0.0513  2002 HOH A O   
4444 O O   . HOH J .   ? 0.9824 1.0148 1.1621 -0.0196 -0.0503 0.0468  2003 HOH A O   
4445 O O   . HOH J .   ? 0.8240 0.8090 0.9598 -0.0151 -0.0671 0.0512  2004 HOH A O   
4446 O O   . HOH J .   ? 1.1782 1.1599 1.2994 -0.0400 -0.0376 0.0580  2005 HOH A O   
4447 O O   . HOH J .   ? 1.0561 1.0450 1.1840 -0.0599 -0.0147 0.0446  2006 HOH A O   
4448 O O   . HOH J .   ? 1.1205 1.0742 1.2052 -0.0890 0.0066  0.0323  2007 HOH A O   
4449 O O   . HOH J .   ? 1.0592 1.0721 1.2167 -0.0458 -0.0243 0.0486  2008 HOH A O   
4450 O O   . HOH J .   ? 1.6800 1.9341 1.6351 -0.0669 -0.0687 0.0624  2009 HOH A O   
4451 O O   . HOH J .   ? 1.5818 1.5899 1.6851 0.0312  0.0120  0.1395  2010 HOH A O   
4452 O O   . HOH J .   ? 1.6038 1.7248 1.5649 -0.0211 -0.0553 0.0237  2011 HOH A O   
4453 O O   . HOH J .   ? 1.1594 1.1011 1.0945 -0.0624 -0.0076 0.0048  2012 HOH A O   
4454 O O   . HOH J .   ? 1.1983 1.4913 1.2092 0.0780  -0.0120 -0.0211 2013 HOH A O   
4455 O O   . HOH J .   ? 1.1507 1.0870 1.0567 0.0387  -0.0797 -0.1008 2014 HOH A O   
4456 O O   . HOH J .   ? 1.1806 1.1013 1.0375 0.0085  -0.0841 -0.0655 2015 HOH A O   
4457 O O   . HOH J .   ? 0.7750 0.7619 0.8107 0.0172  0.0365  0.0029  2016 HOH A O   
4458 O O   . HOH J .   ? 1.0319 0.9741 1.0676 0.0111  0.0109  0.0085  2017 HOH A O   
4459 O O   . HOH J .   ? 0.7390 0.6869 0.7627 0.0182  0.0143  0.0050  2018 HOH A O   
4460 O O   . HOH J .   ? 0.6973 0.6393 0.7006 0.0278  0.0082  0.0024  2019 HOH A O   
4461 O O   . HOH J .   ? 0.7124 0.6451 0.6995 0.0344  0.0052  0.0018  2020 HOH A O   
4462 O O   . HOH J .   ? 0.6843 0.6081 0.6807 0.0240  -0.0003 0.0053  2021 HOH A O   
4463 O O   . HOH J .   ? 0.6977 0.6561 0.6760 0.0513  0.0146  -0.0026 2022 HOH A O   
4464 O O   . HOH J .   ? 1.1045 1.1660 1.1374 0.0407  0.0283  -0.0172 2023 HOH A O   
4465 O O   . HOH J .   ? 1.0679 1.0851 1.0818 0.0466  0.0315  -0.0139 2024 HOH A O   
4466 O O   . HOH J .   ? 1.4649 1.4966 1.4744 0.0485  0.0329  -0.0210 2025 HOH A O   
4467 O O   . HOH J .   ? 1.2789 1.3020 1.2871 0.0444  0.0367  -0.0230 2026 HOH A O   
4468 O O   . HOH J .   ? 0.7999 0.8319 0.8449 0.0181  0.0357  -0.0220 2027 HOH A O   
4469 O O   . HOH J .   ? 0.9969 1.0520 1.0587 0.0082  0.0528  0.0034  2028 HOH A O   
4470 O O   . HOH J .   ? 0.9120 0.9493 0.9811 -0.0139 0.0615  0.0052  2029 HOH A O   
4471 O O   . HOH J .   ? 0.9751 0.9498 1.0377 -0.0438 0.0612  -0.0089 2030 HOH A O   
4472 O O   . HOH J .   ? 0.7111 0.7035 0.7940 -0.0005 0.0449  -0.0027 2031 HOH A O   
4473 O O   . HOH J .   ? 0.8966 0.8812 0.9851 0.0006  0.0494  0.0030  2032 HOH A O   
4474 O O   . HOH J .   ? 0.8614 1.0361 0.9047 0.0237  -0.0038 -0.0050 2033 HOH A O   
4475 O O   . HOH J .   ? 0.9176 1.0593 0.9620 0.0027  0.0076  0.0260  2034 HOH A O   
4476 O O   . HOH J .   ? 0.8781 1.1251 0.9948 0.0224  -0.0088 -0.0833 2035 HOH A O   
4477 O O   . HOH J .   ? 1.2068 1.3785 1.3248 -0.0104 0.0049  -0.0106 2036 HOH A O   
4478 O O   . HOH J .   ? 1.0589 1.3086 1.0487 0.0869  0.0252  0.0380  2037 HOH A O   
4479 O O   . HOH J .   ? 1.0967 0.9711 1.1018 -0.0795 -0.0208 0.0505  2038 HOH A O   
4480 O O   . HOH J .   ? 0.9586 0.9672 1.0952 0.0132  0.0572  0.0444  2039 HOH A O   
4481 O O   . HOH J .   ? 0.7545 0.7525 0.8708 0.0138  0.0576  0.0303  2040 HOH A O   
4482 O O   . HOH J .   ? 0.5834 0.5772 0.6696 0.0031  0.0417  0.0019  2041 HOH A O   
4483 O O   . HOH J .   ? 1.0992 1.0822 1.1543 0.0156  0.0583  -0.0075 2042 HOH A O   
4484 O O   . HOH J .   ? 0.5694 0.5613 0.6465 0.0148  0.0529  0.0045  2043 HOH A O   
4485 O O   . HOH J .   ? 0.7739 0.7673 0.8503 0.0012  0.0479  -0.0064 2044 HOH A O   
4486 O O   . HOH J .   ? 0.5917 0.6179 0.6606 0.0006  0.0374  -0.0159 2045 HOH A O   
4488 O O   . HOH J .   ? 0.8019 0.8529 0.8790 -0.0097 0.0405  -0.0137 2047 HOH A O   
4489 O O   . HOH J .   ? 1.0477 1.1068 1.1319 -0.0266 0.0454  -0.0135 2048 HOH A O   
4490 O O   . HOH J .   ? 1.2446 1.3222 1.3311 -0.0196 0.0488  -0.0069 2049 HOH A O   
4491 O O   . HOH J .   ? 0.9810 1.0491 1.0572 -0.0028 0.0436  -0.0079 2050 HOH A O   
4492 O O   . HOH J .   ? 0.7316 0.7947 0.7825 0.0271  0.0338  -0.0098 2051 HOH A O   
4493 O O   . HOH J .   ? 0.7353 0.8036 0.8049 0.0059  0.0355  -0.0150 2052 HOH A O   
4494 O O   . HOH J .   ? 0.6231 0.6629 0.6927 -0.0005 0.0364  -0.0172 2053 HOH A O   
4495 O O   . HOH J .   ? 0.7556 0.7542 0.8165 0.0137  0.0480  -0.0088 2054 HOH A O   
4496 O O   . HOH J .   ? 0.7755 0.7674 0.8355 0.0179  0.0535  -0.0046 2055 HOH A O   
4497 O O   . HOH J .   ? 1.3117 1.2963 1.3885 0.0233  0.0561  0.0275  2056 HOH A O   
4498 O O   . HOH J .   ? 0.8842 0.8694 0.9153 0.0368  0.0459  0.0013  2057 HOH A O   
4499 O O   . HOH J .   ? 0.9388 0.9106 1.0226 0.0064  0.0364  0.0382  2058 HOH A O   
4500 O O   . HOH J .   ? 0.9504 0.8768 0.9594 0.0286  0.0375  0.0300  2059 HOH A O   
4501 O O   . HOH J .   ? 1.0362 0.9777 1.0314 0.0392  0.0277  0.0098  2060 HOH A O   
4502 O O   . HOH J .   ? 1.0674 0.9821 1.0533 0.0330  0.0245  0.0195  2061 HOH A O   
4503 O O   . HOH J .   ? 0.9819 0.8920 1.0218 -0.0132 -0.0062 0.0377  2062 HOH A O   
4504 O O   . HOH J .   ? 1.3361 1.0738 1.2103 -0.0738 -0.0710 0.0602  2063 HOH A O   
4505 O O   . HOH J .   ? 0.7707 0.6938 0.8152 -0.0071 -0.0032 0.0304  2064 HOH A O   
4506 O O   . HOH J .   ? 1.0838 1.0556 1.1630 -0.0089 0.0458  0.0012  2065 HOH A O   
4507 O O   . HOH J .   ? 0.9158 0.8785 0.9697 -0.0217 0.0625  0.0043  2066 HOH A O   
4508 O O   . HOH J .   ? 1.1084 1.0834 1.1606 -0.0168 0.0630  0.0067  2067 HOH A O   
4509 O O   . HOH J .   ? 0.8200 0.7606 0.8802 -0.0012 0.0416  0.0117  2068 HOH A O   
4510 O O   . HOH J .   ? 0.5869 0.5355 0.6376 0.0061  0.0183  0.0097  2069 HOH A O   
4511 O O   . HOH J .   ? 1.0012 0.9470 1.0678 0.0027  0.0218  0.0158  2070 HOH A O   
4512 O O   . HOH J .   ? 1.0810 1.0430 1.1619 -0.0016 0.0324  0.0117  2071 HOH A O   
4513 O O   . HOH J .   ? 0.5940 0.5355 0.6328 0.0086  0.0037  0.0094  2072 HOH A O   
4514 O O   . HOH J .   ? 0.7027 0.7193 0.8797 -0.0057 -0.0722 0.0331  2073 HOH A O   
4515 O O   . HOH J .   ? 1.0067 0.9112 0.9927 0.0222  -0.0088 0.0071  2074 HOH A O   
4516 O O   . HOH J .   ? 1.0070 0.8835 1.0068 -0.0078 -0.0225 0.0275  2075 HOH A O   
4517 O O   . HOH J .   ? 0.7742 0.6639 0.8379 0.0020  -0.1172 0.0401  2076 HOH A O   
4518 O O   . HOH J .   ? 0.7234 0.6585 0.7351 0.0228  0.0156  0.0131  2077 HOH A O   
4519 O O   . HOH J .   ? 0.9357 0.8677 0.9006 0.0513  0.0163  0.0019  2078 HOH A O   
4520 O O   . HOH J .   ? 0.8711 0.9688 0.8810 0.0768  0.0304  -0.0090 2079 HOH A O   
4522 O O   . HOH J .   ? 0.6262 0.6721 0.6560 0.0412  0.0282  -0.0138 2081 HOH A O   
4523 O O   . HOH J .   ? 0.7937 0.8962 0.8030 0.0807  0.0331  -0.0056 2082 HOH A O   
4524 O O   . HOH J .   ? 1.2546 1.3507 1.3030 0.0398  0.0356  -0.0078 2083 HOH A O   
4525 O O   . HOH J .   ? 0.8929 0.8262 0.8472 0.0584  0.0130  0.0015  2084 HOH A O   
4526 O O   . HOH J .   ? 0.9352 0.8936 0.8697 0.0849  0.0190  -0.0039 2085 HOH A O   
4527 O O   . HOH J .   ? 1.2578 1.1629 1.1732 0.0737  0.0106  0.0000  2086 HOH A O   
4529 O O   . HOH J .   ? 0.9443 1.0088 0.8876 0.1214  0.0272  -0.0100 2088 HOH A O   
4530 O O   . HOH J .   ? 0.9089 0.8675 0.8186 0.1053  0.0216  -0.0035 2089 HOH A O   
4531 O O   . HOH J .   ? 1.2877 1.2147 1.1704 0.1116  0.0227  -0.0028 2090 HOH A O   
4533 O O   . HOH J .   ? 0.5016 0.5272 0.5618 -0.0202 0.0394  -0.0278 2092 HOH A O   
4536 O O   . HOH K .   ? 1.1118 1.2198 1.1182 0.0269  -0.0592 -0.0241 2001 HOH B O   
4537 O O   . HOH K .   ? 0.6213 0.6758 0.6923 -0.0363 -0.0169 -0.0175 2002 HOH B O   
4538 O O   . HOH K .   ? 1.0717 1.2482 1.0113 0.0406  -0.0608 -0.0055 2003 HOH B O   
4539 O O   . HOH K .   ? 1.0443 1.1693 0.9865 0.0353  -0.0584 0.0260  2004 HOH B O   
4540 O O   . HOH K .   ? 1.0573 1.1121 1.1729 -0.0156 -0.0009 0.0456  2005 HOH B O   
4541 O O   . HOH K .   ? 0.8374 0.8125 0.8611 -0.0057 0.0102  0.0490  2006 HOH B O   
4542 O O   . HOH K .   ? 1.0109 1.0381 1.1076 -0.0095 0.0035  0.0533  2007 HOH B O   
4543 O O   . HOH K .   ? 0.8005 0.8152 0.8685 -0.0168 0.0039  0.0480  2008 HOH B O   
4544 O O   . HOH K .   ? 1.0571 1.0756 1.1279 -0.0204 0.0017  0.0432  2009 HOH B O   
4545 O O   . HOH K .   ? 1.0645 1.0782 1.1056 -0.0330 0.0026  0.0424  2010 HOH B O   
4546 O O   . HOH K .   ? 0.5677 0.5905 0.6140 -0.0375 -0.0003 0.0363  2011 HOH B O   
4547 O O   . HOH K .   ? 0.7369 0.7620 0.7403 -0.0673 -0.0057 0.0210  2012 HOH B O   
4548 O O   . HOH K .   ? 0.7976 0.8317 0.8177 -0.0574 -0.0149 -0.0075 2013 HOH B O   
4549 O O   . HOH K .   ? 0.8970 0.8737 0.8760 -0.0556 -0.0097 0.0035  2014 HOH B O   
4550 O O   . HOH K .   ? 0.8353 0.8499 0.8204 -0.0711 -0.0136 -0.0034 2015 HOH B O   
4551 O O   . HOH K .   ? 1.1966 1.1698 1.1543 -0.0670 -0.0110 0.0003  2016 HOH B O   
4552 O O   . HOH K .   ? 0.7958 0.7954 0.8297 -0.0310 -0.0141 -0.0008 2017 HOH B O   
4554 O O   . HOH K .   ? 1.5437 1.4765 1.4954 -0.0080 -0.0052 0.0145  2019 HOH B O   
4555 O O   . HOH K .   ? 1.1504 1.1476 1.1784 -0.0260 -0.0157 -0.0017 2020 HOH B O   
4556 O O   . HOH K .   ? 1.0363 0.9575 0.9855 -0.0016 0.0205  0.0507  2021 HOH B O   
4557 O O   . HOH K .   ? 1.1370 1.0480 1.0864 0.0144  0.0188  0.0464  2022 HOH B O   
4558 O O   . HOH K .   ? 1.0579 1.0950 1.1816 0.0062  -0.0015 0.0529  2023 HOH B O   
4559 O O   . HOH K .   ? 1.1354 1.1681 1.2628 -0.0075 -0.0109 0.0305  2024 HOH B O   
4560 O O   . HOH K .   ? 0.6411 0.6647 0.7557 -0.0131 -0.0122 0.0185  2025 HOH B O   
4561 O O   . HOH K .   ? 0.6391 0.6656 0.7664 -0.0084 -0.0073 0.0336  2026 HOH B O   
4562 O O   . HOH K .   ? 1.0990 1.1373 1.2421 -0.0131 -0.0145 0.0272  2027 HOH B O   
4563 O O   . HOH K .   ? 1.1234 1.1526 1.2533 -0.0134 -0.0136 0.0205  2028 HOH B O   
4564 O O   . HOH K .   ? 1.3340 1.3619 1.7137 0.0490  -0.0760 -0.2118 2029 HOH B O   
4565 O O   . HOH K .   ? 1.4102 1.2890 1.3471 0.0014  -0.1096 -0.0386 2030 HOH B O   
4566 O O   . HOH K .   ? 1.2087 1.1846 1.3502 -0.0195 -0.0179 -0.0190 2031 HOH B O   
4568 O O   . HOH K .   ? 0.5340 0.5699 0.5989 -0.0228 0.0381  -0.0273 2033 HOH B O   
4569 O O   . HOH K .   ? 0.8395 0.8951 0.9116 -0.0199 0.0363  -0.0250 2034 HOH B O   
4571 O O   . HOH K .   ? 0.4021 0.4262 0.5192 -0.0157 -0.0123 0.0147  2036 HOH B O   
4572 O O   . HOH K .   ? 0.4773 0.5055 0.5918 -0.0214 -0.0178 -0.0040 2037 HOH B O   
4573 O O   . HOH K .   ? 0.5870 0.6119 0.6974 -0.0147 -0.0147 0.0131  2038 HOH B O   
4574 O O   . HOH K .   ? 1.0450 1.0605 1.1179 -0.0070 -0.0137 0.0147  2039 HOH B O   
4575 O O   . HOH K .   ? 0.6186 0.6146 0.6750 -0.0157 -0.0080 0.0167  2040 HOH B O   
4576 O O   . HOH K .   ? 0.5552 0.5728 0.6393 0.0007  -0.0088 0.0277  2041 HOH B O   
4577 O O   . HOH K .   ? 0.7203 0.6828 0.7365 0.0031  0.0037  0.0347  2042 HOH B O   
4578 O O   . HOH K .   ? 0.6728 0.6043 0.6495 0.0057  0.0093  0.0368  2043 HOH B O   
4579 O O   . HOH K .   ? 0.8974 0.8329 0.8590 -0.0361 0.0012  0.0215  2044 HOH B O   
4580 O O   . HOH K .   ? 0.9767 0.9230 0.9653 -0.0160 0.0003  0.0231  2045 HOH B O   
4581 O O   . HOH K .   ? 0.6400 0.6183 0.6714 -0.0135 -0.0049 0.0199  2046 HOH B O   
4582 O O   . HOH K .   ? 0.5872 0.6119 0.6794 -0.0230 -0.0178 -0.0035 2047 HOH B O   
4583 O O   . HOH K .   ? 0.5621 0.6050 0.6260 -0.0375 -0.0175 -0.0158 2048 HOH B O   
4584 O O   . HOH K .   ? 0.6367 0.6657 0.7388 -0.0238 -0.0193 -0.0082 2049 HOH B O   
4585 O O   . HOH K .   ? 0.8055 0.8269 0.8883 -0.0212 -0.0180 -0.0012 2050 HOH B O   
4586 O O   . HOH K .   ? 0.9672 1.0042 1.0791 -0.0213 -0.0192 -0.0247 2051 HOH B O   
4587 O O   . HOH K .   ? 1.0926 1.1600 1.2122 -0.0059 -0.0097 -0.0113 2052 HOH B O   
4588 O O   . HOH K .   ? 1.1092 1.2485 1.2009 -0.0198 -0.0091 -0.0144 2053 HOH B O   
4589 O O   . HOH K .   ? 1.3534 1.4779 1.4198 -0.0513 -0.0096 0.0109  2054 HOH B O   
4590 O O   . HOH K .   ? 1.0668 1.1782 1.1353 -0.0444 -0.0121 -0.0056 2055 HOH B O   
4591 O O   . HOH K .   ? 0.7345 0.8364 0.8165 -0.0371 -0.0098 0.0045  2056 HOH B O   
4592 O O   . HOH K .   ? 1.3073 1.4080 1.4268 -0.0116 -0.0053 0.0164  2057 HOH B O   
4594 O O   . HOH K .   ? 1.0206 1.0388 1.0829 0.0422  0.0185  0.0756  2059 HOH B O   
4595 O O   . HOH K .   ? 0.7372 0.7668 0.8510 -0.0022 0.0034  0.0573  2060 HOH B O   
4596 O O   . HOH K .   ? 0.6291 0.6670 0.7375 -0.0143 -0.0004 0.0449  2061 HOH B O   
4597 O O   . HOH K .   ? 0.8727 0.9305 1.0021 -0.0114 -0.0031 0.0375  2062 HOH B O   
4598 O O   . HOH K .   ? 0.7761 0.8446 0.8448 -0.0426 -0.0051 0.0286  2063 HOH B O   
4599 O O   . HOH K .   ? 0.8410 0.8847 0.9297 -0.0251 -0.0019 0.0380  2064 HOH B O   
4600 O O   . HOH K .   ? 0.9794 1.0470 1.0885 -0.0210 -0.0030 0.0370  2065 HOH B O   
4601 O O   . HOH K .   ? 0.8395 0.9234 0.9338 -0.0308 -0.0050 0.0288  2066 HOH B O   
4602 O O   . HOH K .   ? 0.8058 0.9091 0.8442 -0.0671 -0.0115 0.0069  2067 HOH B O   
4605 O O   . HOH K .   ? 0.7026 0.6805 0.6821 -0.0581 -0.0075 0.0087  2070 HOH B O   
4606 O O   . HOH K .   ? 0.8674 0.7693 0.7820 -0.0474 0.0029  0.0190  2071 HOH B O   
4608 O O   . HOH K .   ? 0.9248 0.9304 0.9137 -0.0633 0.0004  0.0343  2073 HOH B O   
4609 O O   . HOH K .   ? 1.0828 1.1534 1.0752 -0.0896 -0.0129 0.0049  2074 HOH B O   
4610 O O   . HOH K .   ? 0.8589 0.9673 0.8652 -0.0925 -0.0112 0.0163  2075 HOH B O   
4611 O O   . HOH K .   ? 1.3422 1.4608 1.3580 -0.0870 -0.0121 0.0111  2076 HOH B O   
4613 O O   . HOH K .   ? 1.0462 1.0782 1.0041 -0.0990 -0.0129 0.0028  2078 HOH B O   
4614 O O   . HOH K .   ? 1.6430 1.7929 1.5930 -0.1466 -0.0160 0.0176  2079 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   MET 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   ALA 9   9   ?   ?   ?   A . n 
A 1 10  ARG 10  10  ?   ?   ?   A . n 
A 1 11  LYS 11  11  ?   ?   ?   A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  LEU 28  28  ?   ?   ?   A . n 
A 1 29  GLU 29  29  ?   ?   ?   A . n 
A 1 30  LYS 30  30  ?   ?   ?   A . n 
A 1 31  ARG 31  31  ?   ?   ?   A . n 
A 1 32  GLY 32  32  ?   ?   ?   A . n 
A 1 33  TRP 33  33  ?   ?   ?   A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  TRP 46  46  46  TRP TRP A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  TYR 57  57  57  TYR TYR A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 CYS 119 119 119 CYS CYS A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 MET 121 121 121 MET MET A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 TYR 132 132 132 TYR TYR A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 MET 161 161 161 MET MET A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 HIS 196 196 196 HIS HIS A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 HIS 220 220 220 HIS HIS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 HIS 236 236 236 HIS HIS A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 HIS 247 247 247 HIS HIS A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 GLN 252 252 252 GLN GLN A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 HIS 255 255 255 HIS HIS A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 TYR 260 260 260 TYR TYR A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 CYS 262 262 262 CYS CYS A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 ILE 266 266 266 ILE ILE A . n 
A 1 267 TRP 267 267 267 TRP TRP A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 HIS 270 270 270 HIS HIS A . n 
A 1 271 PHE 271 271 271 PHE PHE A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 HIS 291 291 291 HIS HIS A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 HIS 296 296 296 HIS HIS A . n 
A 1 297 HIS 297 297 297 HIS HIS A . n 
A 1 298 HIS 298 298 298 HIS HIS A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 HIS 300 300 ?   ?   ?   A . n 
A 1 301 HIS 301 301 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   THR 2   2   ?   ?   ?   B . n 
B 1 3   GLY 3   3   ?   ?   ?   B . n 
B 1 4   GLY 4   4   ?   ?   ?   B . n 
B 1 5   MET 5   5   ?   ?   ?   B . n 
B 1 6   LYS 6   6   ?   ?   ?   B . n 
B 1 7   PRO 7   7   ?   ?   ?   B . n 
B 1 8   PRO 8   8   ?   ?   ?   B . n 
B 1 9   ALA 9   9   ?   ?   ?   B . n 
B 1 10  ARG 10  10  ?   ?   ?   B . n 
B 1 11  LYS 11  11  ?   ?   ?   B . n 
B 1 12  PRO 12  12  ?   ?   ?   B . n 
B 1 13  ARG 13  13  ?   ?   ?   B . n 
B 1 14  ILE 14  14  ?   ?   ?   B . n 
B 1 15  LEU 15  15  ?   ?   ?   B . n 
B 1 16  ASN 16  16  ?   ?   ?   B . n 
B 1 17  SER 17  17  ?   ?   ?   B . n 
B 1 18  ASP 18  18  ?   ?   ?   B . n 
B 1 19  GLY 19  19  ?   ?   ?   B . n 
B 1 20  SER 20  20  ?   ?   ?   B . n 
B 1 21  SER 21  21  ?   ?   ?   B . n 
B 1 22  ASN 22  22  ?   ?   ?   B . n 
B 1 23  ILE 23  23  23  ILE ILE B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  ARG 25  25  25  ARG ARG B . n 
B 1 26  LEU 26  26  26  LEU LEU B . n 
B 1 27  GLY 27  27  ?   ?   ?   B . n 
B 1 28  LEU 28  28  ?   ?   ?   B . n 
B 1 29  GLU 29  29  ?   ?   ?   B . n 
B 1 30  LYS 30  30  ?   ?   ?   B . n 
B 1 31  ARG 31  31  ?   ?   ?   B . n 
B 1 32  GLY 32  32  ?   ?   ?   B . n 
B 1 33  TRP 33  33  ?   ?   ?   B . n 
B 1 34  LEU 34  34  ?   ?   ?   B . n 
B 1 35  ASP 35  35  35  ASP ASP B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  TYR 38  38  38  TYR TYR B . n 
B 1 39  HIS 39  39  39  HIS HIS B . n 
B 1 40  ASP 40  40  40  ASP ASP B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  THR 43  43  43  THR THR B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  SER 45  45  45  SER SER B . n 
B 1 46  TRP 46  46  46  TRP TRP B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  VAL 48  48  48  VAL VAL B . n 
B 1 49  PHE 49  49  49  PHE PHE B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  GLY 55  55  55  GLY GLY B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  TYR 57  57  57  TYR TYR B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  ASN 61  61  61  ASN ASN B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  TYR 68  68  68  TYR TYR B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  CYS 71  71  71  CYS CYS B . n 
B 1 72  GLY 72  72  72  GLY GLY B . n 
B 1 73  ASP 73  73  73  ASP ASP B . n 
B 1 74  VAL 74  74  74  VAL VAL B . n 
B 1 75  ILE 75  75  75  ILE ILE B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  ASN 77  77  77  ASN ASN B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  GLY 81  81  81  GLY GLY B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  PHE 83  83  83  PHE PHE B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  PHE 87  87  87  PHE PHE B . n 
B 1 88  PHE 88  88  88  PHE PHE B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  GLN 92  92  92  GLN GLN B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  MET 94  94  94  MET MET B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  GLY 98  98  98  GLY GLY B . n 
B 1 99  TYR 99  99  99  TYR TYR B . n 
B 1 100 GLY 100 100 100 GLY GLY B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 PRO 107 107 107 PRO PRO B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 ASN 110 110 110 ASN ASN B . n 
B 1 111 THR 111 111 111 THR THR B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 CYS 119 119 119 CYS CYS B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 MET 121 121 121 MET MET B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ILE 131 131 131 ILE ILE B . n 
B 1 132 TYR 132 132 132 TYR TYR B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 ARG 134 134 134 ARG ARG B . n 
B 1 135 PHE 135 135 135 PHE PHE B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 ARG 137 137 137 ARG ARG B . n 
B 1 138 PRO 138 138 138 PRO PRO B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 ALA 140 140 140 ALA ALA B . n 
B 1 141 GLY 141 141 141 GLY GLY B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 PHE 144 144 144 PHE PHE B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 ARG 147 147 147 ARG ARG B . n 
B 1 148 MET 148 148 148 MET MET B . n 
B 1 149 VAL 149 149 149 VAL VAL B . n 
B 1 150 ILE 150 150 150 ILE ILE B . n 
B 1 151 SER 151 151 151 SER SER B . n 
B 1 152 ASP 152 152 152 ASP ASP B . n 
B 1 153 PHE 153 153 153 PHE PHE B . n 
B 1 154 GLU 154 154 154 GLU GLU B . n 
B 1 155 GLY 155 155 155 GLY GLY B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 PRO 157 157 157 PRO PRO B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 MET 160 160 160 MET MET B . n 
B 1 161 MET 161 161 161 MET MET B . n 
B 1 162 ARG 162 162 162 ARG ARG B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 ASN 165 165 165 ASN ASN B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 ARG 167 167 167 ARG ARG B . n 
B 1 168 ILE 168 168 168 ILE ILE B . n 
B 1 169 GLU 169 169 169 GLU GLU B . n 
B 1 170 GLN 170 170 170 GLN GLN B . n 
B 1 171 ILE 171 171 171 ILE ILE B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 GLU 173 173 173 GLU GLU B . n 
B 1 174 ALA 174 174 174 ALA ALA B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 HIS 177 177 177 HIS HIS B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 VAL 181 181 181 VAL VAL B . n 
B 1 182 ARG 182 182 182 ARG ARG B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 GLU 184 184 184 GLU GLU B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 GLN 187 187 187 GLN GLN B . n 
B 1 188 GLU 188 188 188 GLU GLU B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 MET 190 190 190 MET MET B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 PHE 192 192 192 PHE PHE B . n 
B 1 193 ARG 193 193 193 ARG ARG B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 PHE 195 195 195 PHE PHE B . n 
B 1 196 HIS 196 196 196 HIS HIS B . n 
B 1 197 ASP 197 197 197 ASP ASP B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 THR 199 199 199 THR THR B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 ARG 202 202 202 ARG ARG B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 PRO 206 206 206 PRO PRO B . n 
B 1 207 ILE 207 207 207 ILE ILE B . n 
B 1 208 PHE 208 208 208 PHE PHE B . n 
B 1 209 SER 209 209 209 SER SER B . n 
B 1 210 LEU 210 210 210 LEU LEU B . n 
B 1 211 SER 211 211 211 SER SER B . n 
B 1 212 TRP 212 212 212 TRP TRP B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 MET 215 215 215 MET MET B . n 
B 1 216 HIS 216 216 216 HIS HIS B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 ASP 219 219 219 ASP ASP B . n 
B 1 220 HIS 220 220 220 HIS HIS B . n 
B 1 221 HIS 221 221 221 HIS HIS B . n 
B 1 222 SER 222 222 222 SER SER B . n 
B 1 223 PRO 223 223 223 PRO PRO B . n 
B 1 224 ILE 224 224 224 ILE ILE B . n 
B 1 225 TYR 225 225 225 TYR TYR B . n 
B 1 226 GLY 226 226 226 GLY GLY B . n 
B 1 227 GLU 227 227 227 GLU GLU B . n 
B 1 228 THR 228 228 228 THR THR B . n 
B 1 229 ASP 229 229 229 ASP ASP B . n 
B 1 230 GLU 230 230 230 GLU GLU B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 ARG 233 233 233 ARG ARG B . n 
B 1 234 ASN 234 234 234 ASN ASN B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 HIS 236 236 236 HIS HIS B . n 
B 1 237 SER 237 237 237 SER SER B . n 
B 1 238 GLU 238 238 238 GLU GLU B . n 
B 1 239 PHE 239 239 239 PHE PHE B . n 
B 1 240 LEU 240 240 240 LEU LEU B . n 
B 1 241 VAL 241 241 241 VAL VAL B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 PHE 243 243 243 PHE PHE B . n 
B 1 244 THR 244 244 244 THR THR B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 HIS 246 246 246 HIS HIS B . n 
B 1 247 HIS 247 247 247 HIS HIS B . n 
B 1 248 GLU 248 248 248 GLU GLU B . n 
B 1 249 ALA 249 249 249 ALA ALA B . n 
B 1 250 PHE 250 250 250 PHE PHE B . n 
B 1 251 ALA 251 251 251 ALA ALA B . n 
B 1 252 GLN 252 252 252 GLN GLN B . n 
B 1 253 ASN 253 253 253 ASN ASN B . n 
B 1 254 VAL 254 254 254 VAL VAL B . n 
B 1 255 HIS 255 255 255 HIS HIS B . n 
B 1 256 ALA 256 256 256 ALA ALA B . n 
B 1 257 ARG 257 257 257 ARG ARG B . n 
B 1 258 HIS 258 258 258 HIS HIS B . n 
B 1 259 ALA 259 259 259 ALA ALA B . n 
B 1 260 TYR 260 260 260 TYR TYR B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 CYS 262 262 262 CYS CYS B . n 
B 1 263 ASP 263 263 263 ASP ASP B . n 
B 1 264 GLU 264 264 264 GLU GLU B . n 
B 1 265 ILE 265 265 265 ILE ILE B . n 
B 1 266 ILE 266 266 266 ILE ILE B . n 
B 1 267 TRP 267 267 267 TRP TRP B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 GLY 269 269 269 GLY GLY B . n 
B 1 270 HIS 270 270 270 HIS HIS B . n 
B 1 271 PHE 271 271 271 PHE PHE B . n 
B 1 272 VAL 272 272 272 VAL VAL B . n 
B 1 273 ASP 273 273 273 ASP ASP B . n 
B 1 274 VAL 274 274 274 VAL VAL B . n 
B 1 275 PHE 275 275 275 PHE PHE B . n 
B 1 276 THR 276 276 276 THR THR B . n 
B 1 277 THR 277 277 277 THR THR B . n 
B 1 278 LEU 278 278 278 LEU LEU B . n 
B 1 279 PRO 279 279 279 PRO PRO B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 GLY 281 281 281 GLY GLY B . n 
B 1 282 ARG 282 282 282 ARG ARG B . n 
B 1 283 ARG 283 283 283 ARG ARG B . n 
B 1 284 ALA 284 284 284 ALA ALA B . n 
B 1 285 LEU 285 285 285 LEU LEU B . n 
B 1 286 ASP 286 286 286 ASP ASP B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 GLY 288 288 288 GLY GLY B . n 
B 1 289 LYS 289 289 289 LYS LYS B . n 
B 1 290 PHE 290 290 290 PHE PHE B . n 
B 1 291 HIS 291 291 291 HIS HIS B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 ILE 293 293 293 ILE ILE B . n 
B 1 294 ALA 294 294 294 ALA ALA B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 HIS 296 296 296 HIS HIS B . n 
B 1 297 HIS 297 297 297 HIS HIS B . n 
B 1 298 HIS 298 298 298 HIS HIS B . n 
B 1 299 HIS 299 299 299 HIS HIS B . n 
B 1 300 HIS 300 300 ?   ?   ?   B . n 
B 1 301 HIS 301 301 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 K   1  1300 1300 K   K   A . 
D 2 K   1  1301 1301 K   K   A . 
E 3 CL  1  1302 1302 CL  CL  A . 
F 4 SPM 1  1303 1303 SPM SPM A . 
G 3 CL  1  1304 1304 CL  CL  A . 
H 5 CA  1  1305 1305 CA  CA  A . 
I 3 CL  1  1306 1306 CL  CL  A . 
J 6 HOH 1  2001 2001 HOH HOH A . 
J 6 HOH 2  2002 2002 HOH HOH A . 
J 6 HOH 3  2003 2003 HOH HOH A . 
J 6 HOH 4  2004 2004 HOH HOH A . 
J 6 HOH 5  2005 2005 HOH HOH A . 
J 6 HOH 6  2006 2006 HOH HOH A . 
J 6 HOH 7  2007 2007 HOH HOH A . 
J 6 HOH 8  2008 2008 HOH HOH A . 
J 6 HOH 9  2009 2009 HOH HOH A . 
J 6 HOH 10 2010 2010 HOH HOH A . 
J 6 HOH 11 2011 2011 HOH HOH A . 
J 6 HOH 12 2012 2012 HOH HOH A . 
J 6 HOH 13 2013 2013 HOH HOH A . 
J 6 HOH 14 2014 2014 HOH HOH A . 
J 6 HOH 15 2015 2015 HOH HOH A . 
J 6 HOH 16 2016 2016 HOH HOH A . 
J 6 HOH 17 2017 2017 HOH HOH A . 
J 6 HOH 18 2018 2018 HOH HOH A . 
J 6 HOH 19 2019 2019 HOH HOH A . 
J 6 HOH 20 2020 2020 HOH HOH A . 
J 6 HOH 21 2021 2021 HOH HOH A . 
J 6 HOH 22 2022 2022 HOH HOH A . 
J 6 HOH 23 2023 2023 HOH HOH A . 
J 6 HOH 24 2024 2024 HOH HOH A . 
J 6 HOH 25 2025 2025 HOH HOH A . 
J 6 HOH 26 2026 2026 HOH HOH A . 
J 6 HOH 27 2027 2027 HOH HOH A . 
J 6 HOH 28 2028 2028 HOH HOH A . 
J 6 HOH 29 2029 2029 HOH HOH A . 
J 6 HOH 30 2030 2030 HOH HOH A . 
J 6 HOH 31 2031 2031 HOH HOH A . 
J 6 HOH 32 2032 2032 HOH HOH A . 
J 6 HOH 33 2033 2033 HOH HOH A . 
J 6 HOH 34 2034 2034 HOH HOH A . 
J 6 HOH 35 2035 2035 HOH HOH A . 
J 6 HOH 36 2036 2036 HOH HOH A . 
J 6 HOH 37 2037 2037 HOH HOH A . 
J 6 HOH 38 2038 2038 HOH HOH A . 
J 6 HOH 39 2039 2039 HOH HOH A . 
J 6 HOH 40 2040 2040 HOH HOH A . 
J 6 HOH 41 2041 2041 HOH HOH A . 
J 6 HOH 42 2042 2042 HOH HOH A . 
J 6 HOH 43 2043 2043 HOH HOH A . 
J 6 HOH 44 2044 2044 HOH HOH A . 
J 6 HOH 45 2045 2045 HOH HOH A . 
J 6 HOH 46 2046 2046 HOH HOH A . 
J 6 HOH 47 2047 2047 HOH HOH A . 
J 6 HOH 48 2048 2048 HOH HOH A . 
J 6 HOH 49 2049 2049 HOH HOH A . 
J 6 HOH 50 2050 2050 HOH HOH A . 
J 6 HOH 51 2051 2051 HOH HOH A . 
J 6 HOH 52 2052 2052 HOH HOH A . 
J 6 HOH 53 2053 2053 HOH HOH A . 
J 6 HOH 54 2054 2054 HOH HOH A . 
J 6 HOH 55 2055 2055 HOH HOH A . 
J 6 HOH 56 2056 2056 HOH HOH A . 
J 6 HOH 57 2057 2057 HOH HOH A . 
J 6 HOH 58 2058 2058 HOH HOH A . 
J 6 HOH 59 2059 2059 HOH HOH A . 
J 6 HOH 60 2060 2060 HOH HOH A . 
J 6 HOH 61 2061 2061 HOH HOH A . 
J 6 HOH 62 2062 2062 HOH HOH A . 
J 6 HOH 63 2063 2063 HOH HOH A . 
J 6 HOH 64 2064 2064 HOH HOH A . 
J 6 HOH 65 2065 2065 HOH HOH A . 
J 6 HOH 66 2066 2066 HOH HOH A . 
J 6 HOH 67 2067 2067 HOH HOH A . 
J 6 HOH 68 2068 2068 HOH HOH A . 
J 6 HOH 69 2069 2069 HOH HOH A . 
J 6 HOH 70 2070 2070 HOH HOH A . 
J 6 HOH 71 2071 2071 HOH HOH A . 
J 6 HOH 72 2072 2072 HOH HOH A . 
J 6 HOH 73 2073 2073 HOH HOH A . 
J 6 HOH 74 2074 2074 HOH HOH A . 
J 6 HOH 75 2075 2075 HOH HOH A . 
J 6 HOH 76 2076 2076 HOH HOH A . 
J 6 HOH 77 2077 2077 HOH HOH A . 
J 6 HOH 78 2078 2078 HOH HOH A . 
J 6 HOH 79 2079 2079 HOH HOH A . 
J 6 HOH 80 2080 2080 HOH HOH A . 
J 6 HOH 81 2081 2081 HOH HOH A . 
J 6 HOH 82 2082 2082 HOH HOH A . 
J 6 HOH 83 2083 2083 HOH HOH A . 
J 6 HOH 84 2084 2084 HOH HOH A . 
J 6 HOH 85 2085 2085 HOH HOH A . 
J 6 HOH 86 2086 2086 HOH HOH A . 
J 6 HOH 87 2087 2087 HOH HOH A . 
J 6 HOH 88 2088 2088 HOH HOH A . 
J 6 HOH 89 2089 2089 HOH HOH A . 
J 6 HOH 90 2090 2090 HOH HOH A . 
J 6 HOH 91 2091 2091 HOH HOH A . 
J 6 HOH 92 2092 2092 HOH HOH A . 
J 6 HOH 93 2093 2093 HOH HOH A . 
J 6 HOH 94 2094 2094 HOH HOH A . 
K 6 HOH 1  2001 2001 HOH HOH B . 
K 6 HOH 2  2002 2002 HOH HOH B . 
K 6 HOH 3  2003 2003 HOH HOH B . 
K 6 HOH 4  2004 2004 HOH HOH B . 
K 6 HOH 5  2005 2005 HOH HOH B . 
K 6 HOH 6  2006 2006 HOH HOH B . 
K 6 HOH 7  2007 2007 HOH HOH B . 
K 6 HOH 8  2008 2008 HOH HOH B . 
K 6 HOH 9  2009 2009 HOH HOH B . 
K 6 HOH 10 2010 2010 HOH HOH B . 
K 6 HOH 11 2011 2011 HOH HOH B . 
K 6 HOH 12 2012 2012 HOH HOH B . 
K 6 HOH 13 2013 2013 HOH HOH B . 
K 6 HOH 14 2014 2014 HOH HOH B . 
K 6 HOH 15 2015 2015 HOH HOH B . 
K 6 HOH 16 2016 2016 HOH HOH B . 
K 6 HOH 17 2017 2017 HOH HOH B . 
K 6 HOH 18 2018 2018 HOH HOH B . 
K 6 HOH 19 2019 2019 HOH HOH B . 
K 6 HOH 20 2020 2020 HOH HOH B . 
K 6 HOH 21 2021 2021 HOH HOH B . 
K 6 HOH 22 2022 2022 HOH HOH B . 
K 6 HOH 23 2023 2023 HOH HOH B . 
K 6 HOH 24 2024 2024 HOH HOH B . 
K 6 HOH 25 2025 2025 HOH HOH B . 
K 6 HOH 26 2026 2026 HOH HOH B . 
K 6 HOH 27 2027 2027 HOH HOH B . 
K 6 HOH 28 2028 2028 HOH HOH B . 
K 6 HOH 29 2029 2029 HOH HOH B . 
K 6 HOH 30 2030 2030 HOH HOH B . 
K 6 HOH 31 2031 2031 HOH HOH B . 
K 6 HOH 32 2032 2032 HOH HOH B . 
K 6 HOH 33 2033 2033 HOH HOH B . 
K 6 HOH 34 2034 2034 HOH HOH B . 
K 6 HOH 35 2035 2035 HOH HOH B . 
K 6 HOH 36 2036 2036 HOH HOH B . 
K 6 HOH 37 2037 2037 HOH HOH B . 
K 6 HOH 38 2038 2038 HOH HOH B . 
K 6 HOH 39 2039 2039 HOH HOH B . 
K 6 HOH 40 2040 2040 HOH HOH B . 
K 6 HOH 41 2041 2041 HOH HOH B . 
K 6 HOH 42 2042 2042 HOH HOH B . 
K 6 HOH 43 2043 2043 HOH HOH B . 
K 6 HOH 44 2044 2044 HOH HOH B . 
K 6 HOH 45 2045 2045 HOH HOH B . 
K 6 HOH 46 2046 2046 HOH HOH B . 
K 6 HOH 47 2047 2047 HOH HOH B . 
K 6 HOH 48 2048 2048 HOH HOH B . 
K 6 HOH 49 2049 2049 HOH HOH B . 
K 6 HOH 50 2050 2050 HOH HOH B . 
K 6 HOH 51 2051 2051 HOH HOH B . 
K 6 HOH 52 2052 2052 HOH HOH B . 
K 6 HOH 53 2053 2053 HOH HOH B . 
K 6 HOH 54 2054 2054 HOH HOH B . 
K 6 HOH 55 2055 2055 HOH HOH B . 
K 6 HOH 56 2056 2056 HOH HOH B . 
K 6 HOH 57 2057 2057 HOH HOH B . 
K 6 HOH 58 2058 2058 HOH HOH B . 
K 6 HOH 59 2059 2059 HOH HOH B . 
K 6 HOH 60 2060 2060 HOH HOH B . 
K 6 HOH 61 2061 2061 HOH HOH B . 
K 6 HOH 62 2062 2062 HOH HOH B . 
K 6 HOH 63 2063 2063 HOH HOH B . 
K 6 HOH 64 2064 2064 HOH HOH B . 
K 6 HOH 65 2065 2065 HOH HOH B . 
K 6 HOH 66 2066 2066 HOH HOH B . 
K 6 HOH 67 2067 2067 HOH HOH B . 
K 6 HOH 68 2068 2068 HOH HOH B . 
K 6 HOH 69 2069 2069 HOH HOH B . 
K 6 HOH 70 2070 2070 HOH HOH B . 
K 6 HOH 71 2071 2071 HOH HOH B . 
K 6 HOH 72 2072 2072 HOH HOH B . 
K 6 HOH 73 2073 2073 HOH HOH B . 
K 6 HOH 74 2074 2074 HOH HOH B . 
K 6 HOH 75 2075 2075 HOH HOH B . 
K 6 HOH 76 2076 2076 HOH HOH B . 
K 6 HOH 77 2077 2077 HOH HOH B . 
K 6 HOH 78 2078 2078 HOH HOH B . 
K 6 HOH 79 2079 2079 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 19690  ? 
1 MORE         -168.6 ? 
1 'SSA (A^2)'  49210  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_645 -x+1,-y-1,z -1.0000000000 0.0000000000 0.0000000000 105.6270000000 0.0000000000 -1.0000000000 
0.0000000000 -109.3850000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A K  1300 ? C K  . 
2 1 A K  1301 ? D K  . 
3 1 A CA 1305 ? H CA . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 1_555 65.6  ? 
2  O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_645 91.6  ? 
3  O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_645 136.8 ? 
4  O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 1_555 65.6  ? 
5  O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 1_555 128.8 ? 
6  O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 1_555 58.5  ? 
7  O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 2_645 138.2 ? 
8  O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 2_645 153.1 ? 
9  O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 2_645 65.5  ? 
10 O   ? B GLY 98 ? B GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? A ILE 97 ? A ILE 97 ? 2_645 72.6  ? 
11 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 1_555 77.7  ? 
12 O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 1_555 89.9  ? 
13 O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 1_555 122.0 ? 
14 O   ? B GLY 98 ? B GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 1_555 65.5  ? 
15 O   ? A ILE 97 ? A ILE 97 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 1_555 85.5  ? 
16 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 58.2  ? 
17 O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 71.9  ? 
18 O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 65.0  ? 
19 O   ? B GLY 98 ? B GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 94.9  ? 
20 O   ? A ILE 97 ? A ILE 97 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 127.7 ? 
21 O   ? B ILE 97 ? B ILE 97 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 135.9 ? 
22 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 2_645 120.6 ? 
23 O   ? A ILE 97 ? A ILE 97 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 2_645 84.3  ? 
24 O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 2_645 76.6  ? 
25 O   ? B GLY 98 ? B GLY 98 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 2_645 135.1 ? 
26 O   ? A ILE 97 ? A ILE 97 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 2_645 88.9  ? 
27 O   ? B ILE 97 ? B ILE 97 ? 1_555 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 2_645 155.3 ? 
28 O   ? B GLY 98 ? B GLY 98 ? 2_645 K  ? C K  . ? A K  1300 ? 1_555 O   ? B ILE 97 ? B ILE 97 ? 2_645 64.4  ? 
29 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 1_555 71.2  ? 
30 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_645 101.6 ? 
31 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? A GLY 98 ? A GLY 98 ? 2_645 152.9 ? 
32 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 2_645 153.9 ? 
33 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 2_645 126.6 ? 
34 O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? A TYR 99 ? A TYR 99 ? 2_645 70.7  ? 
35 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 1_555 72.9  ? 
36 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 1_555 132.5 ? 
37 O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 1_555 64.7  ? 
38 O   ? A TYR 99 ? A TYR 99 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 1_555 81.5  ? 
39 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 1_555 89.2  ? 
40 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 1_555 82.8  ? 
41 O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 1_555 123.8 ? 
42 O   ? A TYR 99 ? A TYR 99 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 1_555 76.0  ? 
43 O   ? B GLY 98 ? B GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 1_555 66.6  ? 
44 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 64.7  ? 
45 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 81.2  ? 
46 O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 72.3  ? 
47 O   ? A TYR 99 ? A TYR 99 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 131.2 ? 
48 O   ? B GLY 98 ? B GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 109.8 ? 
49 O   ? B TYR 99 ? B TYR 99 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B GLY 98 ? B GLY 98 ? 2_645 152.7 ? 
50 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 2_645 123.3 ? 
51 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 2_645 75.6  ? 
52 O   ? A GLY 98 ? A GLY 98 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 2_645 88.1  ? 
53 O   ? A TYR 99 ? A TYR 99 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 2_645 82.1  ? 
54 O   ? B GLY 98 ? B GLY 98 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 2_645 151.7 ? 
55 O   ? B TYR 99 ? B TYR 99 ? 1_555 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 2_645 130.5 ? 
56 O   ? B GLY 98 ? B GLY 98 ? 2_645 K  ? D K  . ? A K  1301 ? 1_555 O   ? B TYR 99 ? B TYR 99 ? 2_645 65.9  ? 
57 OG1 ? A THR 96 ? A THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? B THR 96 ? B THR 96 ? 2_645 81.8  ? 
58 OG1 ? A THR 96 ? A THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 2_645 164.0 ? 
59 OG1 ? B THR 96 ? B THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 2_645 114.0 ? 
60 OG1 ? A THR 96 ? A THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 2_645 134.0 ? 
61 OG1 ? B THR 96 ? B THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 2_645 78.5  ? 
62 O   ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? A THR 96 ? A THR 96 ? 2_645 56.1  ? 
63 OG1 ? A THR 96 ? A THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 1_555 89.1  ? 
64 OG1 ? B THR 96 ? B THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 1_555 166.4 ? 
65 O   ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 1_555 74.8  ? 
66 OG1 ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 1_555 114.9 ? 
67 OG1 ? A THR 96 ? A THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? B THR 96 ? B THR 96 ? 1_555 79.5  ? 
68 OG1 ? B THR 96 ? B THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? B THR 96 ? B THR 96 ? 1_555 129.6 ? 
69 O   ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? B THR 96 ? B THR 96 ? 1_555 91.3  ? 
70 OG1 ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? B THR 96 ? B THR 96 ? 1_555 81.8  ? 
71 O   ? B THR 96 ? B THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 OG1 ? B THR 96 ? B THR 96 ? 1_555 57.6  ? 
72 OG1 ? A THR 96 ? A THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 2_645 114.8 ? 
73 OG1 ? B THR 96 ? B THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 2_645 57.0  ? 
74 O   ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 2_645 74.6  ? 
75 OG1 ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 2_645 87.9  ? 
76 O   ? B THR 96 ? B THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 2_645 119.3 ? 
77 OG1 ? B THR 96 ? B THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 O   ? B THR 96 ? B THR 96 ? 2_645 165.7 ? 
78 OG1 ? A THR 96 ? A THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 1_555 56.6  ? 
79 OG1 ? B THR 96 ? B THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 1_555 91.1  ? 
80 O   ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 1_555 117.8 ? 
81 OG1 ? A THR 96 ? A THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 1_555 162.5 ? 
82 O   ? B THR 96 ? B THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 1_555 75.4  ? 
83 OG1 ? B THR 96 ? B THR 96 ? 1_555 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 1_555 115.5 ? 
84 O   ? B THR 96 ? B THR 96 ? 2_645 CA ? H CA . ? A CA 1305 ? 1_555 O   ? A THR 96 ? A THR 96 ? 1_555 74.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-06-09 
2 'Structure model' 1 1 2012-04-25 
3 'Structure model' 1 2 2019-01-30 
4 'Structure model' 1 3 2019-02-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Atomic model'              
2  2 'Structure model' 'Database references'       
3  2 'Structure model' 'Non-polymer description'   
4  2 'Structure model' Other                       
5  2 'Structure model' 'Refinement description'    
6  2 'Structure model' 'Version format compliance' 
7  3 'Structure model' 'Data collection'           
8  3 'Structure model' 'Experimental preparation'  
9  4 'Structure model' 'Data collection'           
10 4 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow 
2 4 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method' 
2 4 'Structure model' '_exptl_crystal_grow.temp'   
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 45.7151 -77.8281 204.3821 0.0190 0.0503 0.2010 -0.0305 -0.0383 0.0552  0.1462 1.7075 1.0552 
0.4983  0.3902  1.3411  0.0056  -0.0195 0.0504  0.0577  -0.0826 0.1340  0.0487  -0.0616 0.0770  
'X-RAY DIFFRACTION' 2  ? refined 47.0158 -71.0043 176.0112 0.2286 0.0379 0.0799 -0.0469 0.0845  -0.0183 3.4648 0.9008 8.0739 
-0.9597 5.1033  -1.1219 0.0050  0.2517  -0.0615 0.2190  -0.0631 0.1989  0.3500  0.2835  0.0580  
'X-RAY DIFFRACTION' 3  ? refined 42.2520 -67.3206 154.5670 0.0771 0.0775 0.0543 0.0091  -0.0527 0.0121  6.1866 1.9504 3.7547 
2.9694  -1.8686 -2.1894 -0.0336 0.6602  0.1174  -0.0766 0.3629  0.1850  0.1255  -0.2971 -0.3293 
'X-RAY DIFFRACTION' 4  ? refined 48.4201 -65.7080 164.1201 0.1914 0.1080 0.0790 0.0284  -0.0819 -0.0796 2.4106 3.0582 0.7720 
2.5813  1.3382  1.3430  0.1159  0.1003  -0.1163 -0.0629 -0.0181 0.0214  0.0988  0.1058  -0.0978 
'X-RAY DIFFRACTION' 5  ? refined 40.3444 -59.5661 164.4426 0.0624 0.0771 0.1698 -0.0092 -0.0087 -0.0538 3.3534 3.5366 0.0573 
0.4528  0.4209  0.1780  0.2088  0.2405  -0.2486 0.1377  -0.2042 0.6752  0.0333  0.0212  -0.0046 
'X-RAY DIFFRACTION' 6  ? refined 51.9403 -61.7454 188.2817 0.0793 0.0476 0.0060 0.0248  0.0145  -0.0024 7.0928 2.2720 8.1862 
-2.6606 7.6082  -3.0080 0.2073  -0.0802 -0.0351 -0.0218 -0.1574 0.0789  0.1948  -0.0746 -0.0499 
'X-RAY DIFFRACTION' 7  ? refined 62.2344 -75.1340 220.2313 0.0344 0.0330 0.0892 0.0148  0.0263  -0.0046 0.1212 0.5129 0.8256 
-0.1880 0.0026  -0.2887 0.0299  -0.0330 0.0348  -0.0355 0.0300  0.0623  0.0898  0.1279  -0.0599 
'X-RAY DIFFRACTION' 8  ? refined 37.7897 -78.9431 229.7489 0.0014 0.1462 0.0534 -0.0030 0.0006  0.0083  7.3102 2.1521 2.3498 
-3.8849 -2.9016 1.7868  0.0777  0.1788  -0.0733 -0.0375 -0.0036 0.0186  -0.0117 -0.0069 -0.0741 
'X-RAY DIFFRACTION' 9  ? refined 85.1541 -75.8257 210.3411 0.0286 0.0280 0.0264 0.0138  0.0031  0.0242  6.1668 2.9230 4.5459 
-4.2251 -2.6950 2.1552  0.0200  0.0716  -0.0379 -0.0443 -0.0612 0.0286  -0.3133 -0.1177 0.0412  
'X-RAY DIFFRACTION' 10 ? refined 33.3781 -42.8770 197.4337 0.5994 0.1780 0.4815 -0.0593 0.1483  -0.1843 0.9078 0.5717 0.9862 
-0.7181 0.9461  -0.7488 -0.4581 -0.0267 0.2616  0.4638  0.0959  -0.1688 -0.5749 -0.0249 0.3622  
'X-RAY DIFFRACTION' 11 ? refined 36.5666 -48.7602 175.8991 0.0580 0.3283 0.0403 0.0080  0.0142  -0.0954 1.0076 2.6075 5.5632 
1.5814  -1.3578 -2.8058 -0.1467 -0.2064 0.0679  -0.3094 -0.1243 0.0413  0.4011  -0.7263 0.2710  
'X-RAY DIFFRACTION' 12 ? refined 40.0023 -44.0161 154.6615 0.0847 0.0868 0.0450 -0.0024 -0.0197 0.0554  1.1559 7.0347 3.5309 
-2.8510 -2.0202 4.9826  0.1951  0.0451  0.0453  -0.5077 -0.1070 -0.1017 -0.3521 -0.0790 -0.0881 
'X-RAY DIFFRACTION' 13 ? refined 41.9499 -50.2361 164.0562 0.0997 0.1418 0.0503 0.0307  -0.0590 0.0220  7.5212 0.0020 0.1949 
-0.0146 1.1684  -0.0039 -0.0127 0.2361  0.2282  -0.0087 0.0013  0.0079  0.0336  0.0614  0.0114  
'X-RAY DIFFRACTION' 14 ? refined 47.9669 -42.0529 164.4215 0.0464 0.0738 0.2268 0.0163  -0.0277 0.0557  5.0050 3.3023 0.6632 
0.1007  0.4075  -1.4222 -0.1735 0.0016  0.8887  -0.0370 0.2769  0.4693  0.0074  -0.0919 -0.1034 
'X-RAY DIFFRACTION' 15 ? refined 45.6229 -53.5128 188.2469 0.0338 0.0516 0.0113 -0.0396 -0.0066 0.0013  4.6352 9.1156 7.7534 
3.9654  -3.6526 -8.4067 0.2005  -0.1264 -0.1293 0.1011  -0.1089 0.0976  -0.0960 0.1036  -0.0916 
'X-RAY DIFFRACTION' 16 ? refined 33.1343 -63.8792 220.4593 0.0318 0.0455 0.0962 -0.0284 -0.0071 0.0174  0.2011 0.0793 0.8242 
0.0199  -0.0693 -0.1626 -0.0030 -0.0013 0.1083  -0.0075 -0.0166 -0.0400 0.1381  -0.0906 0.0196  
'X-RAY DIFFRACTION' 17 ? refined 28.3693 -39.7609 229.8890 0.0506 0.0527 0.0931 0.0222  -0.0476 -0.0616 3.4443 9.1616 2.6260 
5.0393  1.4815  4.0532  -0.0569 -0.1377 0.2508  -0.3163 -0.1284 0.4452  -0.2631 0.0214  0.1852  
'X-RAY DIFFRACTION' 18 ? refined 36.2786 -86.9096 213.6158 0.0254 0.0050 0.0179 -0.0006 -0.0045 0.0050  2.4893 6.2881 2.8998 
-1.2295 -0.2587 1.8703  0.0420  -0.0944 -0.1204 0.3329  0.0906  0.0415  0.1624  -0.0110 -0.1326 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 12  ? ? A 43  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 44  ? ? A 71  ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 72  ? ? A 81  ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 82  ? ? A 100 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 101 ? ? A 120 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 121 ? ? A 137 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 138 ? ? A 182 ? ? ? ? 
'X-RAY DIFFRACTION' 8  7  A 194 ? ? A 274 ? ? ? ? 
'X-RAY DIFFRACTION' 9  7  A 286 ? ? A 299 ? ? ? ? 
'X-RAY DIFFRACTION' 10 8  A 183 ? ? A 193 ? ? ? ? 
'X-RAY DIFFRACTION' 11 9  A 275 ? ? A 285 ? ? ? ? 
'X-RAY DIFFRACTION' 12 10 B 12  ? ? B 43  ? ? ? ? 
'X-RAY DIFFRACTION' 13 11 B 44  ? ? B 71  ? ? ? ? 
'X-RAY DIFFRACTION' 14 12 B 72  ? ? B 81  ? ? ? ? 
'X-RAY DIFFRACTION' 15 13 B 82  ? ? B 100 ? ? ? ? 
'X-RAY DIFFRACTION' 16 14 B 101 ? ? B 120 ? ? ? ? 
'X-RAY DIFFRACTION' 17 15 B 121 ? ? B 137 ? ? ? ? 
'X-RAY DIFFRACTION' 18 16 B 138 ? ? B 182 ? ? ? ? 
'X-RAY DIFFRACTION' 19 16 B 194 ? ? B 274 ? ? ? ? 
'X-RAY DIFFRACTION' 20 16 B 286 ? ? B 299 ? ? ? ? 
'X-RAY DIFFRACTION' 21 17 B 183 ? ? B 193 ? ? ? ? 
'X-RAY DIFFRACTION' 22 18 B 275 ? ? B 285 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.5.0066 ? 1 ? ? ? ? 
MOSFLM 'data reduction' .        ? 2 ? ? ? ? 
SCALA  'data scaling'   .        ? 3 ? ? ? ? 
CNS    phasing          .        ? 4 ? ? ? ? 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
0   
;THIS ENTRY 2WLJ REFLECTS AN ALTERNATIVE MODELING OF THE
ORIGINAL STRUCTURAL DATA (R1XL4SF) DETERMINED BY
AUTHORS OF THE PDB ENTRY 1XL4:
J.M.GULBIS,A.KUO,B.SMITH,D.A.DOYLE,A.EDWARDS,C.ARROWSMITH,
M.SUNDSTROM
;
700 
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             2WLJ 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'RESIDUES 5-295 CORRESPOND TO GENBANK ACCESSION ZP_00055625' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CE1 A HIS 255 ? A O   A HOH 2071 ? ? 1.60 
2 1 CE1 A HIS 177 ? A O   A HOH 2032 ? ? 1.68 
3 1 ND1 A HIS 255 ? A O   A HOH 2071 ? ? 1.78 
4 1 NE2 A HIS 177 ? B OD1 A ASP 197  ? ? 1.98 
5 1 OG  A SER 90  ? ? OE2 A GLU 116  ? ? 2.15 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OD1 A ASP 286 ? ? 1_555 CD1 B LEU 26 ? ? 2_645 1.31 
2 1 CG  A ASP 286 ? ? 1_555 CD1 B LEU 26 ? ? 2_645 2.12 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             262 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             262 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.705 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.107 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A PRO 217 ? ? N A PRO 217 ? ? CD A PRO 217 ? ? 99.75  111.70 -11.95 1.40 N 
2 1 C  B HIS 216 ? ? N B PRO 217 ? ? CD B PRO 217 ? ? 114.68 128.40 -13.72 2.10 Y 
3 1 CA B PRO 217 ? ? N B PRO 217 ? ? CD B PRO 217 ? ? 100.93 111.70 -10.77 1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 39  ? ? -55.87  -0.91  
2  1 VAL A 44  ? ? -58.36  174.44 
3  1 ASP A 73  ? ? -112.24 76.00  
4  1 LYS A 101 ? ? -48.12  -70.15 
5  1 THR A 136 ? ? -104.79 45.72  
6  1 ARG A 137 ? ? -153.16 55.13  
7  1 LEU A 210 ? ? -122.58 -88.33 
8  1 LEU A 287 ? ? -65.84  0.85   
9  1 ASP B 36  ? ? 65.55   -57.76 
10 1 HIS B 37  ? ? -69.05  17.76  
11 1 HIS B 39  ? ? -87.38  48.55  
12 1 ASP B 73  ? ? -106.99 65.45  
13 1 ARG B 79  ? ? -35.39  125.91 
14 1 ARG B 137 ? ? -116.04 63.72  
15 1 LEU B 210 ? ? -125.48 -86.64 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 34  ? CG  ? A LEU 34  CG  
2  1 Y 1 A LEU 34  ? CD1 ? A LEU 34  CD1 
3  1 Y 1 A LEU 34  ? CD2 ? A LEU 34  CD2 
4  1 Y 1 A ASP 35  ? CG  ? A ASP 35  CG  
5  1 Y 1 A ASP 35  ? OD1 ? A ASP 35  OD1 
6  1 Y 1 A ASP 35  ? OD2 ? A ASP 35  OD2 
7  1 Y 1 A HIS 37  ? CG  ? A HIS 37  CG  
8  1 Y 1 A HIS 37  ? ND1 ? A HIS 37  ND1 
9  1 Y 1 A HIS 37  ? CD2 ? A HIS 37  CD2 
10 1 Y 1 A HIS 37  ? CE1 ? A HIS 37  CE1 
11 1 Y 1 A HIS 37  ? NE2 ? A HIS 37  NE2 
12 1 Y 1 B ASP 35  ? CG  ? B ASP 35  CG  
13 1 Y 1 B ASP 35  ? OD1 ? B ASP 35  OD1 
14 1 Y 1 B ASP 35  ? OD2 ? B ASP 35  OD2 
15 1 Y 1 B ASP 36  ? CG  ? B ASP 36  CG  
16 1 Y 1 B ASP 36  ? OD1 ? B ASP 36  OD1 
17 1 Y 1 B ASP 36  ? OD2 ? B ASP 36  OD2 
18 1 Y 1 B TYR 38  ? CG  ? B TYR 38  CG  
19 1 Y 1 B TYR 38  ? CD1 ? B TYR 38  CD1 
20 1 Y 1 B TYR 38  ? CD2 ? B TYR 38  CD2 
21 1 Y 1 B TYR 38  ? CE1 ? B TYR 38  CE1 
22 1 Y 1 B TYR 38  ? CE2 ? B TYR 38  CE2 
23 1 Y 1 B TYR 38  ? CZ  ? B TYR 38  CZ  
24 1 Y 1 B TYR 38  ? OH  ? B TYR 38  OH  
25 1 Y 1 B HIS 299 ? CG  ? B HIS 299 CG  
26 1 Y 1 B HIS 299 ? ND1 ? B HIS 299 ND1 
27 1 Y 1 B HIS 299 ? CD2 ? B HIS 299 CD2 
28 1 Y 1 B HIS 299 ? CE1 ? B HIS 299 CE1 
29 1 Y 1 B HIS 299 ? NE2 ? B HIS 299 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A GLY 3   ? A GLY 3   
4  1 Y 1 A GLY 4   ? A GLY 4   
5  1 Y 1 A MET 5   ? A MET 5   
6  1 Y 1 A LYS 6   ? A LYS 6   
7  1 Y 1 A PRO 7   ? A PRO 7   
8  1 Y 1 A PRO 8   ? A PRO 8   
9  1 Y 1 A ALA 9   ? A ALA 9   
10 1 Y 1 A ARG 10  ? A ARG 10  
11 1 Y 1 A LYS 11  ? A LYS 11  
12 1 Y 1 A LEU 28  ? A LEU 28  
13 1 Y 1 A GLU 29  ? A GLU 29  
14 1 Y 1 A LYS 30  ? A LYS 30  
15 1 Y 1 A ARG 31  ? A ARG 31  
16 1 Y 1 A GLY 32  ? A GLY 32  
17 1 Y 1 A TRP 33  ? A TRP 33  
18 1 Y 1 A HIS 300 ? A HIS 300 
19 1 Y 1 A HIS 301 ? A HIS 301 
20 1 Y 1 B MET 1   ? B MET 1   
21 1 Y 1 B THR 2   ? B THR 2   
22 1 Y 1 B GLY 3   ? B GLY 3   
23 1 Y 1 B GLY 4   ? B GLY 4   
24 1 Y 1 B MET 5   ? B MET 5   
25 1 Y 1 B LYS 6   ? B LYS 6   
26 1 Y 1 B PRO 7   ? B PRO 7   
27 1 Y 1 B PRO 8   ? B PRO 8   
28 1 Y 1 B ALA 9   ? B ALA 9   
29 1 Y 1 B ARG 10  ? B ARG 10  
30 1 Y 1 B LYS 11  ? B LYS 11  
31 1 Y 1 B PRO 12  ? B PRO 12  
32 1 Y 1 B ARG 13  ? B ARG 13  
33 1 Y 1 B ILE 14  ? B ILE 14  
34 1 Y 1 B LEU 15  ? B LEU 15  
35 1 Y 1 B ASN 16  ? B ASN 16  
36 1 Y 1 B SER 17  ? B SER 17  
37 1 Y 1 B ASP 18  ? B ASP 18  
38 1 Y 1 B GLY 19  ? B GLY 19  
39 1 Y 1 B SER 20  ? B SER 20  
40 1 Y 1 B SER 21  ? B SER 21  
41 1 Y 1 B ASN 22  ? B ASN 22  
42 1 Y 1 B GLY 27  ? B GLY 27  
43 1 Y 1 B LEU 28  ? B LEU 28  
44 1 Y 1 B GLU 29  ? B GLU 29  
45 1 Y 1 B LYS 30  ? B LYS 30  
46 1 Y 1 B ARG 31  ? B ARG 31  
47 1 Y 1 B GLY 32  ? B GLY 32  
48 1 Y 1 B TRP 33  ? B TRP 33  
49 1 Y 1 B LEU 34  ? B LEU 34  
50 1 Y 1 B HIS 300 ? B HIS 300 
51 1 Y 1 B HIS 301 ? B HIS 301 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'POTASSIUM ION' K   
3 'CHLORIDE ION'  CL  
4 SPERMINE        SPM 
5 'CALCIUM ION'   CA  
6 water           HOH 
#