data_2WLM
# 
_entry.id   2WLM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WLM         
PDBE  EBI-40211    
WWPDB D_1290040211 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1XL4 unspecified 'INTERMEDIATE GATING STRUCTURE 1 OF THE INWARDLY RECTIFYINGK+ CHANNEL KIRBAC3.1'                          
PDB 2WLN unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLO unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLJ unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLL unspecified 'POTASSIUM CHANNEL FROM BURKHOLDERIA PSEUDOMALLEI'                                                        
PDB 2WLI unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 1XL6 unspecified 'INTERMEDIATE GATING STRUCTURE 2 OF THE INWARDLY RECTIFYINGK+ CHANNEL KIRBAC3.1'                          
PDB 2WLH unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2WLK unspecified 'STRUCTURE OF THE ATP-SENSITIVE INWARD RECTIFIER POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM' 
PDB 2X6B unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2X6A unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
PDB 2X6C unspecified 'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM'                                                 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WLM 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-24 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Clarke, O.B.' 1 
'Caputo, A.T.' 2 
'Smith, B.J.'  3 
'Gulbis, J.M.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Domain Reorientation and Rotation of an Intracellular Assembly Regulate Conduction in Kir Potassium Channels.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            141 
_citation.page_first                1018 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20564790 
_citation.pdbx_database_id_DOI      10.1016/J.CELL.2010.05.003 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Clarke, O.B.'     1 ? 
primary 'Caputo, A.T.'     2 ? 
primary 'Hill, A.P.'       3 ? 
primary 'Vandenberg, J.I.' 4 ? 
primary 'Smith, B.J.'      5 ? 
primary 'Gulbis, J.M.'     6 ? 
# 
_cell.entry_id           2WLM 
_cell.length_a           99.261 
_cell.length_b           151.193 
_cell.length_c           294.757 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WLM 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'POTASSIUM CHANNEL' 33782.766 4 ? ? ? 'C-TERMINAL HEXAHISTIDINE TAG APPENDED' 
2 non-polymer syn 'POTASSIUM ION'     39.098    4 ? ? ? ?                                       
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        KIRBAC3.1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   GLY n 
1 4   GLY n 
1 5   MET n 
1 6   LYS n 
1 7   PRO n 
1 8   PRO n 
1 9   ALA n 
1 10  ARG n 
1 11  LYS n 
1 12  PRO n 
1 13  ARG n 
1 14  ILE n 
1 15  LEU n 
1 16  ASN n 
1 17  SER n 
1 18  ASP n 
1 19  GLY n 
1 20  SER n 
1 21  SER n 
1 22  ASN n 
1 23  ILE n 
1 24  THR n 
1 25  ARG n 
1 26  LEU n 
1 27  GLY n 
1 28  LEU n 
1 29  GLU n 
1 30  LYS n 
1 31  ARG n 
1 32  GLY n 
1 33  TRP n 
1 34  LEU n 
1 35  ASP n 
1 36  ASP n 
1 37  HIS n 
1 38  TYR n 
1 39  HIS n 
1 40  ASP n 
1 41  LEU n 
1 42  LEU n 
1 43  THR n 
1 44  VAL n 
1 45  SER n 
1 46  TRP n 
1 47  PRO n 
1 48  VAL n 
1 49  PHE n 
1 50  ILE n 
1 51  THR n 
1 52  LEU n 
1 53  ILE n 
1 54  THR n 
1 55  GLY n 
1 56  LEU n 
1 57  TYR n 
1 58  LEU n 
1 59  VAL n 
1 60  THR n 
1 61  ASN n 
1 62  ALA n 
1 63  LEU n 
1 64  PHE n 
1 65  ALA n 
1 66  LEU n 
1 67  ALA n 
1 68  TYR n 
1 69  LEU n 
1 70  ALA n 
1 71  CYS n 
1 72  GLY n 
1 73  ASP n 
1 74  VAL n 
1 75  ILE n 
1 76  GLU n 
1 77  ASN n 
1 78  ALA n 
1 79  ARG n 
1 80  PRO n 
1 81  GLY n 
1 82  SER n 
1 83  PHE n 
1 84  THR n 
1 85  ASP n 
1 86  ALA n 
1 87  PHE n 
1 88  PHE n 
1 89  PHE n 
1 90  SER n 
1 91  VAL n 
1 92  GLN n 
1 93  THR n 
1 94  MET n 
1 95  ALA n 
1 96  THR n 
1 97  ILE n 
1 98  GLY n 
1 99  TYR n 
1 100 GLY n 
1 101 LYS n 
1 102 LEU n 
1 103 ILE n 
1 104 PRO n 
1 105 ILE n 
1 106 GLY n 
1 107 PRO n 
1 108 LEU n 
1 109 ALA n 
1 110 ASN n 
1 111 THR n 
1 112 LEU n 
1 113 VAL n 
1 114 THR n 
1 115 LEU n 
1 116 GLU n 
1 117 ALA n 
1 118 LEU n 
1 119 CYS n 
1 120 GLY n 
1 121 MET n 
1 122 LEU n 
1 123 GLY n 
1 124 LEU n 
1 125 ALA n 
1 126 VAL n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ILE n 
1 132 TYR n 
1 133 ALA n 
1 134 ARG n 
1 135 PHE n 
1 136 THR n 
1 137 ARG n 
1 138 PRO n 
1 139 THR n 
1 140 ALA n 
1 141 GLY n 
1 142 VAL n 
1 143 LEU n 
1 144 PHE n 
1 145 SER n 
1 146 SER n 
1 147 ARG n 
1 148 MET n 
1 149 VAL n 
1 150 ILE n 
1 151 SER n 
1 152 ASP n 
1 153 PHE n 
1 154 GLU n 
1 155 GLY n 
1 156 LYS n 
1 157 PRO n 
1 158 THR n 
1 159 LEU n 
1 160 MET n 
1 161 MET n 
1 162 ARG n 
1 163 LEU n 
1 164 ALA n 
1 165 ASN n 
1 166 LEU n 
1 167 ARG n 
1 168 ILE n 
1 169 GLU n 
1 170 GLN n 
1 171 ILE n 
1 172 ILE n 
1 173 GLU n 
1 174 ALA n 
1 175 ASP n 
1 176 VAL n 
1 177 HIS n 
1 178 LEU n 
1 179 VAL n 
1 180 LEU n 
1 181 VAL n 
1 182 ARG n 
1 183 SER n 
1 184 GLU n 
1 185 ILE n 
1 186 SER n 
1 187 GLN n 
1 188 GLU n 
1 189 GLY n 
1 190 MET n 
1 191 VAL n 
1 192 PHE n 
1 193 ARG n 
1 194 ARG n 
1 195 PHE n 
1 196 HIS n 
1 197 ASP n 
1 198 LEU n 
1 199 THR n 
1 200 LEU n 
1 201 THR n 
1 202 ARG n 
1 203 SER n 
1 204 ARG n 
1 205 SER n 
1 206 PRO n 
1 207 ILE n 
1 208 PHE n 
1 209 SER n 
1 210 LEU n 
1 211 SER n 
1 212 TRP n 
1 213 THR n 
1 214 VAL n 
1 215 MET n 
1 216 HIS n 
1 217 PRO n 
1 218 ILE n 
1 219 ASP n 
1 220 HIS n 
1 221 HIS n 
1 222 SER n 
1 223 PRO n 
1 224 ILE n 
1 225 TYR n 
1 226 GLY n 
1 227 GLU n 
1 228 THR n 
1 229 ASP n 
1 230 GLU n 
1 231 THR n 
1 232 LEU n 
1 233 ARG n 
1 234 ASN n 
1 235 SER n 
1 236 HIS n 
1 237 SER n 
1 238 GLU n 
1 239 PHE n 
1 240 LEU n 
1 241 VAL n 
1 242 LEU n 
1 243 PHE n 
1 244 THR n 
1 245 GLY n 
1 246 HIS n 
1 247 HIS n 
1 248 GLU n 
1 249 ALA n 
1 250 PHE n 
1 251 ALA n 
1 252 GLN n 
1 253 ASN n 
1 254 VAL n 
1 255 HIS n 
1 256 ALA n 
1 257 ARG n 
1 258 HIS n 
1 259 ALA n 
1 260 TYR n 
1 261 SER n 
1 262 CYS n 
1 263 ASP n 
1 264 GLU n 
1 265 ILE n 
1 266 ILE n 
1 267 TRP n 
1 268 GLY n 
1 269 GLY n 
1 270 HIS n 
1 271 PHE n 
1 272 VAL n 
1 273 ASP n 
1 274 VAL n 
1 275 PHE n 
1 276 THR n 
1 277 THR n 
1 278 LEU n 
1 279 PRO n 
1 280 ASP n 
1 281 GLY n 
1 282 ARG n 
1 283 ARG n 
1 284 ALA n 
1 285 LEU n 
1 286 ASP n 
1 287 LEU n 
1 288 GLY n 
1 289 LYS n 
1 290 PHE n 
1 291 HIS n 
1 292 GLU n 
1 293 ILE n 
1 294 ALA n 
1 295 GLN n 
1 296 HIS n 
1 297 HIS n 
1 298 HIS n 
1 299 HIS n 
1 300 HIS n 
1 301 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MAGNETOSPIRILLUM MAGNETOTACTICUM' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     188 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)STAR' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET-30A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    2WLM 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          2WLM 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2WLM A 1   ? 4   ? 2WLM 1   ? 4   ? 1   4   
2  1 2WLM A 5   ? 295 ? 2WLM 5   ? 295 ? 5   295 
3  1 2WLM A 296 ? 301 ? 2WLM 296 ? 301 ? 296 301 
4  1 2WLM B 1   ? 4   ? 2WLM 1   ? 4   ? 1   4   
5  1 2WLM B 5   ? 295 ? 2WLM 5   ? 295 ? 5   295 
6  1 2WLM B 296 ? 301 ? 2WLM 296 ? 301 ? 296 301 
7  1 2WLM C 1   ? 4   ? 2WLM 1   ? 4   ? 1   4   
8  1 2WLM C 5   ? 295 ? 2WLM 5   ? 295 ? 5   295 
9  1 2WLM C 296 ? 301 ? 2WLM 296 ? 301 ? 296 301 
10 1 2WLM D 1   ? 4   ? 2WLM 1   ? 4   ? 1   4   
11 1 2WLM D 5   ? 295 ? 2WLM 5   ? 295 ? 5   295 
12 1 2WLM D 296 ? 301 ? 2WLM 296 ? 301 ? 296 301 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2WLM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.6 
_exptl_crystal.density_percent_sol   73 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PRECIPITANT 40 % PEG 200 0.2 M SODIUM CHLORIDE 0.1 M SODIUM PHOSPHATE PH 6.0 PROTEIN KIRBAC3.1, 8MG/ML 150MM KCL 20MM BACL2 4MM LDAO 0.05% TDM 0.2MM PI(4,5)P2 PROTEIN AND PRECIPITANT WERE COMBINED IN A 1:1 RATIO AND EQUILIBRATED AGAINST A RESERVOIR OF PRECIPITANT IN A SITTING DROP VAPOUR DIFFUSION SET UP.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-11-10 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SILICON CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.956608 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
_diffrn_source.pdbx_synchrotron_beamline   MX1 
_diffrn_source.pdbx_wavelength             0.956608 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WLM 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            3.60 
_reflns.number_obs                   25733 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.7 
_reflns.pdbx_Rmerge_I_obs            0.13 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.00 
_reflns.B_iso_Wilson_estimate        81.82 
_reflns.pdbx_redundancy              6.3 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.60 
_reflns_shell.d_res_low              3.73 
_reflns_shell.percent_possible_all   92.0 
_reflns_shell.Rmerge_I_obs           0.46 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.80 
_reflns_shell.pdbx_redundancy        6.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WLM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     24190 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.971 
_refine.ls_d_res_high                            3.61 
_refine.ls_percent_reflns_obs                    93.73 
_refine.ls_R_factor_obs                          0.2645 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2632 
_refine.ls_R_factor_R_free                       0.2881 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1233 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               0 
_refine.aniso_B[1][1]                            -8.6718 
_refine.aniso_B[2][2]                            -38.7497 
_refine.aniso_B[3][3]                            -21.7882 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.292 
_refine.solvent_model_param_bsol                 70.710 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
'BARIUM IN CRYSTALLISATION CONDITION PRECIPITATED OUT DUE TO PRESENCE OF PHOSPHATE, AND WAS NOT OBSERVED IN THE STRUCTURE.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1XL4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.08 
_refine.pdbx_overall_phase_error                 28.88 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8609 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8613 
_refine_hist.d_res_high                       3.61 
_refine_hist.d_res_low                        19.971 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 8820  'X-RAY DIFFRACTION' ? 
f_angle_d          1.035  ? ? 12004 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.403 ? ? 3015  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.066  ? ? 1403  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1518  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 778 ?     ? POSITIONAL 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 778 0.011 ? POSITIONAL 1 2 'X-RAY DIFFRACTION' ? ? ? 
3 C 778 0.012 ? POSITIONAL 1 3 'X-RAY DIFFRACTION' ? ? ? 
4 D 774 0.010 ? POSITIONAL 1 4 'X-RAY DIFFRACTION' ? ? ? 
1 A 881 ?     ? POSITIONAL 2 5 'X-RAY DIFFRACTION' ? ? ? 
2 B 881 0.064 ? POSITIONAL 2 6 'X-RAY DIFFRACTION' ? ? ? 
3 C 881 0.065 ? POSITIONAL 2 7 'X-RAY DIFFRACTION' ? ? ? 
4 D 881 0.066 ? POSITIONAL 2 8 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.6068 3.7503  2334 0.3310 83.00  0.0000 . . 0   . . 
'X-RAY DIFFRACTION' . 3.7503 3.9198  2440 0.3062 91.00  0.3541 . . 149 . . 
'X-RAY DIFFRACTION' . 3.9198 4.1247  2456 0.3119 91.00  0.3380 . . 145 . . 
'X-RAY DIFFRACTION' . 4.1247 4.3806  2365 0.2560 92.00  0.3171 . . 224 . . 
'X-RAY DIFFRACTION' . 4.3806 4.7147  2531 0.2476 92.00  0.2787 . . 102 . . 
'X-RAY DIFFRACTION' . 4.7147 5.1817  2498 0.2371 95.00  0.2471 . . 191 . . 
'X-RAY DIFFRACTION' . 5.1817 5.9144  2723 0.2575 99.00  0.3069 . . 133 . . 
'X-RAY DIFFRACTION' . 5.9144 7.3882  2768 0.2647 100.00 0.3046 . . 136 . . 
'X-RAY DIFFRACTION' . 7.3882 19.9717 2842 0.2289 100.00 0.2320 . . 153 . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
3 ? 1 
4 ? 1 
1 ? 2 
2 ? 2 
3 ? 2 
4 ? 2 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN A AND RESID 34:136' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN B AND RESID 34:136' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN C AND RESID 34:136' 
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN D AND RESID 34:136' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;CHAIN A AND (RESID 138:184 OR RESID 208:273 OR RESID 289:295) AND NOT ((RESID 154 OR RESID 173 OR RESID 175 OR RESID 177 OR RESID 184 OR RESID 194 OR RESID 195 OR RESID 197 OR RESID 200 OR RESID 202 OR RESID 220 OR RESID 225 OR RESID 230 OR RESID 233 OR RESID 236 OR RESID 238 OR RESID 242 OR RESID 248 OR RESID 252 OR RESID 263 OR RESID 292) AND SIDECHAIN)
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;CHAIN B AND (RESID 138:184 OR RESID 208:273 OR RESID 289:295) AND NOT ((RESID 154 OR RESID 173 OR RESID 175 OR RESID 177 OR RESID 184 OR RESID 194 OR RESID 195 OR RESID 197 OR RESID 200 OR RESID 202 OR RESID 220 OR RESID 225 OR RESID 230 OR RESID 233 OR RESID 236 OR RESID 238 OR RESID 242 OR RESID 248 OR RESID 252 OR RESID 263 OR RESID 292) AND SIDECHAIN)
;
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;CHAIN C AND (RESID 138:184 OR RESID 208:273 OR RESID 289:295) AND NOT ((RESID 154 OR RESID 173 OR RESID 175 OR RESID 177 OR RESID 184 OR RESID 194 OR RESID 195 OR RESID 197 OR RESID 200 OR RESID 202 OR RESID 220 OR RESID 225 OR RESID 230 OR RESID 233 OR RESID 236 OR RESID 238 OR RESID 242 OR RESID 248 OR RESID 252 OR RESID 263 OR RESID 292) AND SIDECHAIN)
;
4 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;CHAIN D AND (RESID 138:184 OR RESID 208:273 OR RESID 289:295) AND NOT ((RESID 154 OR RESID 173 OR RESID 175 OR RESID 177 OR RESID 184 OR RESID 194 OR RESID 195 OR RESID 197 OR RESID 200 OR RESID 202 OR RESID 220 OR RESID 225 OR RESID 230 OR RESID 233 OR RESID 236 OR RESID 238 OR RESID 242 OR RESID 248 OR RESID 252 OR RESID 263 OR RESID 292) AND SIDECHAIN)
;
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2WLM 
_struct.title                     'POTASSIUM CHANNEL FROM MAGNETOSPIRILLUM MAGNETOTACTICUM' 
_struct.pdbx_descriptor           'POTASSIUM CHANNEL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WLM 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'INTEGRAL MEMBRANE PROTEIN, IONIC CHANNEL, METAL TRANSPORT, ION TRANSPORT, TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 36  ? VAL A 44  ? ASP A 36  VAL A 44  1 ? 9  
HELX_P HELX_P2  2  SER A 45  ? GLY A 72  ? SER A 45  GLY A 72  1 ? 28 
HELX_P HELX_P3  3  SER A 82  ? ALA A 95  ? SER A 82  ALA A 95  1 ? 14 
HELX_P HELX_P4  4  ILE A 105 ? THR A 136 ? ILE A 105 THR A 136 1 ? 32 
HELX_P HELX_P5  5  THR A 228 ? SER A 235 ? THR A 228 SER A 235 1 ? 8  
HELX_P HELX_P6  6  GLY A 288 ? HIS A 291 ? GLY A 288 HIS A 291 5 ? 4  
HELX_P HELX_P7  7  ASP B 36  ? VAL B 44  ? ASP B 36  VAL B 44  1 ? 9  
HELX_P HELX_P8  8  SER B 45  ? GLY B 72  ? SER B 45  GLY B 72  1 ? 28 
HELX_P HELX_P9  9  SER B 82  ? ALA B 95  ? SER B 82  ALA B 95  1 ? 14 
HELX_P HELX_P10 10 ILE B 105 ? THR B 136 ? ILE B 105 THR B 136 1 ? 32 
HELX_P HELX_P11 11 THR B 228 ? SER B 235 ? THR B 228 SER B 235 1 ? 8  
HELX_P HELX_P12 12 GLY B 288 ? HIS B 291 ? GLY B 288 HIS B 291 5 ? 4  
HELX_P HELX_P13 13 ASP C 36  ? VAL C 44  ? ASP C 36  VAL C 44  1 ? 9  
HELX_P HELX_P14 14 SER C 45  ? GLY C 72  ? SER C 45  GLY C 72  1 ? 28 
HELX_P HELX_P15 15 SER C 82  ? ALA C 95  ? SER C 82  ALA C 95  1 ? 14 
HELX_P HELX_P16 16 ILE C 105 ? THR C 136 ? ILE C 105 THR C 136 1 ? 32 
HELX_P HELX_P17 17 THR C 228 ? SER C 235 ? THR C 228 SER C 235 1 ? 8  
HELX_P HELX_P18 18 GLY C 288 ? HIS C 291 ? GLY C 288 HIS C 291 5 ? 4  
HELX_P HELX_P19 19 ASP D 36  ? VAL D 44  ? ASP D 36  VAL D 44  1 ? 9  
HELX_P HELX_P20 20 SER D 45  ? GLY D 72  ? SER D 45  GLY D 72  1 ? 28 
HELX_P HELX_P21 21 SER D 82  ? ALA D 95  ? SER D 82  ALA D 95  1 ? 14 
HELX_P HELX_P22 22 ILE D 105 ? THR D 136 ? ILE D 105 THR D 136 1 ? 32 
HELX_P HELX_P23 23 THR D 228 ? SER D 235 ? THR D 228 SER D 235 1 ? 8  
HELX_P HELX_P24 24 GLY D 288 ? HIS D 291 ? GLY D 288 HIS D 291 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E K . K ? ? ? 1_555 D GLY 98 O   ? ? A K 1296 D GLY 98 1_555 ? ? ? ? ? ? ? 3.246 ? 
metalc2  metalc ? ? E K . K ? ? ? 1_555 D TYR 99 O   ? ? A K 1296 D TYR 99 1_555 ? ? ? ? ? ? ? 3.183 ? 
metalc3  metalc ? ? E K . K ? ? ? 1_555 C GLY 98 O   ? ? A K 1296 C GLY 98 1_555 ? ? ? ? ? ? ? 3.112 ? 
metalc4  metalc ? ? E K . K ? ? ? 1_555 A GLY 98 O   ? ? A K 1296 A GLY 98 1_555 ? ? ? ? ? ? ? 3.049 ? 
metalc5  metalc ? ? E K . K ? ? ? 1_555 B GLY 98 O   ? ? A K 1296 B GLY 98 1_555 ? ? ? ? ? ? ? 3.217 ? 
metalc6  metalc ? ? E K . K ? ? ? 1_555 B TYR 99 O   ? ? A K 1296 B TYR 99 1_555 ? ? ? ? ? ? ? 3.270 ? 
metalc7  metalc ? ? E K . K ? ? ? 1_555 C TYR 99 O   ? ? A K 1296 C TYR 99 1_555 ? ? ? ? ? ? ? 3.162 ? 
metalc8  metalc ? ? E K . K ? ? ? 1_555 A TYR 99 O   ? ? A K 1296 A TYR 99 1_555 ? ? ? ? ? ? ? 3.139 ? 
metalc9  metalc ? ? F K . K ? ? ? 1_555 B ILE 97 O   ? ? A K 1297 B ILE 97 1_555 ? ? ? ? ? ? ? 3.247 ? 
metalc10 metalc ? ? F K . K ? ? ? 1_555 A THR 96 O   ? ? A K 1297 A THR 96 1_555 ? ? ? ? ? ? ? 2.910 ? 
metalc11 metalc ? ? F K . K ? ? ? 1_555 B THR 96 O   ? ? A K 1297 B THR 96 1_555 ? ? ? ? ? ? ? 3.097 ? 
metalc12 metalc ? ? F K . K ? ? ? 1_555 C ILE 97 O   ? ? A K 1297 C ILE 97 1_555 ? ? ? ? ? ? ? 3.170 ? 
metalc13 metalc ? ? F K . K ? ? ? 1_555 A ILE 97 O   ? ? A K 1297 A ILE 97 1_555 ? ? ? ? ? ? ? 3.118 ? 
metalc14 metalc ? ? F K . K ? ? ? 1_555 D THR 96 O   ? ? A K 1297 D THR 96 1_555 ? ? ? ? ? ? ? 3.058 ? 
metalc15 metalc ? ? F K . K ? ? ? 1_555 D ILE 97 O   ? ? A K 1297 D ILE 97 1_555 ? ? ? ? ? ? ? 3.179 ? 
metalc16 metalc ? ? F K . K ? ? ? 1_555 C THR 96 O   ? ? A K 1297 C THR 96 1_555 ? ? ? ? ? ? ? 2.998 ? 
metalc17 metalc ? ? G K . K ? ? ? 1_555 B THR 96 OG1 ? ? A K 1298 B THR 96 1_555 ? ? ? ? ? ? ? 3.234 ? 
metalc18 metalc ? ? G K . K ? ? ? 1_555 C THR 96 O   ? ? A K 1298 C THR 96 1_555 ? ? ? ? ? ? ? 3.218 ? 
metalc19 metalc ? ? G K . K ? ? ? 1_555 C THR 96 OG1 ? ? A K 1298 C THR 96 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc20 metalc ? ? G K . K ? ? ? 1_555 A THR 96 O   ? ? A K 1298 A THR 96 1_555 ? ? ? ? ? ? ? 3.289 ? 
metalc21 metalc ? ? G K . K ? ? ? 1_555 A THR 96 OG1 ? ? A K 1298 A THR 96 1_555 ? ? ? ? ? ? ? 3.052 ? 
metalc22 metalc ? ? G K . K ? ? ? 1_555 D THR 96 O   ? ? A K 1298 D THR 96 1_555 ? ? ? ? ? ? ? 3.275 ? 
metalc23 metalc ? ? G K . K ? ? ? 1_555 D THR 96 OG1 ? ? A K 1298 D THR 96 1_555 ? ? ? ? ? ? ? 3.033 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 4 ? 
AC ? 3 ? 
AD ? 3 ? 
AE ? 4 ? 
AF ? 2 ? 
AG ? 3 ? 
BA ? 3 ? 
BB ? 4 ? 
BC ? 3 ? 
BD ? 7 ? 
BE ? 2 ? 
CA ? 3 ? 
CB ? 7 ? 
CC ? 7 ? 
CD ? 2 ? 
DA ? 7 ? 
DB ? 7 ? 
DC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? parallel      
BA 1 2 ? parallel      
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 5 6 ? anti-parallel 
BD 6 7 ? anti-parallel 
BE 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 5 6 ? parallel      
CB 6 7 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CC 3 4 ? anti-parallel 
CC 5 6 ? anti-parallel 
CC 6 7 ? anti-parallel 
CD 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 5 6 ? parallel      
DA 6 7 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DB 5 6 ? anti-parallel 
DB 6 7 ? anti-parallel 
DC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 24  ? LEU A 26  ? THR A 24  LEU A 26  
AA 2 ARG B 283 ? ASP B 286 ? ARG B 283 ASP B 286 
AA 3 PHE B 275 ? THR B 277 ? PHE B 275 THR B 277 
AB 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
AB 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 
AB 3 MET A 148 ? PHE A 153 ? MET A 148 PHE A 153 
AB 4 ILE A 265 ? TRP A 267 ? ILE A 265 TRP A 267 
AC 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
AC 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 
AC 3 SER A 211 ? PRO A 217 ? SER A 211 PRO A 217 
AD 1 VAL A 191 ? ASP A 197 ? VAL A 191 ASP A 197 
AD 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AD 3 ARG A 204 ? PHE A 208 ? ARG A 204 PHE A 208 
AE 1 VAL A 191 ? ASP A 197 ? VAL A 191 ASP A 197 
AE 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
AE 3 GLU A 238 ? HIS A 247 ? GLU A 238 HIS A 247 
AE 4 GLN A 252 ? SER A 261 ? GLN A 252 SER A 261 
AF 1 HIS A 270 ? PHE A 271 ? HIS A 270 PHE A 271 
AF 2 ILE A 293 ? ALA A 294 ? ILE A 293 ALA A 294 
AG 1 PHE A 275 ? THR A 277 ? PHE A 275 THR A 277 
AG 2 ARG A 283 ? ASP A 286 ? ARG A 283 ASP A 286 
AG 3 THR D 24  ? LEU D 26  ? THR D 24  LEU D 26  
BA 1 THR B 24  ? LEU B 26  ? THR B 24  LEU B 26  
BA 2 ARG C 283 ? ASP C 286 ? ARG C 283 ASP C 286 
BA 3 PHE C 275 ? THR C 277 ? PHE C 275 THR C 277 
BB 1 VAL B 142 ? PHE B 144 ? VAL B 142 PHE B 144 
BB 2 LYS B 156 ? ASN B 165 ? LYS B 156 ASN B 165 
BB 3 MET B 148 ? PHE B 153 ? MET B 148 PHE B 153 
BB 4 ILE B 265 ? TRP B 267 ? ILE B 265 TRP B 267 
BC 1 VAL B 142 ? PHE B 144 ? VAL B 142 PHE B 144 
BC 2 LYS B 156 ? ASN B 165 ? LYS B 156 ASN B 165 
BC 3 SER B 211 ? PRO B 217 ? SER B 211 PRO B 217 
BD 1 VAL B 191 ? ASP B 197 ? VAL B 191 ASP B 197 
BD 2 ILE B 171 ? ILE B 185 ? ILE B 171 ILE B 185 
BD 3 ARG B 204 ? PHE B 208 ? ARG B 204 PHE B 208 
BD 4 ILE B 171 ? ILE B 185 ? ILE B 171 ILE B 185 
BD 5 GLN B 252 ? SER B 261 ? GLN B 252 SER B 261 
BD 6 GLU B 238 ? HIS B 247 ? GLU B 238 HIS B 247 
BD 7 ILE B 171 ? ILE B 185 ? ILE B 171 ILE B 185 
BE 1 HIS B 270 ? PHE B 271 ? HIS B 270 PHE B 271 
BE 2 ILE B 293 ? ALA B 294 ? ILE B 293 ALA B 294 
CA 1 THR C 24  ? ARG C 25  ? THR C 24  ARG C 25  
CA 2 ARG D 283 ? LEU D 285 ? ARG D 283 LEU D 285 
CA 3 PHE D 275 ? THR D 277 ? PHE D 275 THR D 277 
CB 1 VAL C 142 ? PHE C 144 ? VAL C 142 PHE C 144 
CB 2 LYS C 156 ? ASN C 165 ? LYS C 156 ASN C 165 
CB 3 SER C 211 ? PRO C 217 ? SER C 211 PRO C 217 
CB 4 LYS C 156 ? ASN C 165 ? LYS C 156 ASN C 165 
CB 5 ILE C 265 ? TRP C 267 ? ILE C 265 TRP C 267 
CB 6 MET C 148 ? PHE C 153 ? MET C 148 PHE C 153 
CB 7 LYS C 156 ? ASN C 165 ? LYS C 156 ASN C 165 
CC 1 VAL C 191 ? ASP C 197 ? VAL C 191 ASP C 197 
CC 2 ILE C 171 ? ILE C 185 ? ILE C 171 ILE C 185 
CC 3 ARG C 204 ? PHE C 208 ? ARG C 204 PHE C 208 
CC 4 ILE C 171 ? ILE C 185 ? ILE C 171 ILE C 185 
CC 5 GLN C 252 ? SER C 261 ? GLN C 252 SER C 261 
CC 6 GLU C 238 ? HIS C 247 ? GLU C 238 HIS C 247 
CC 7 ILE C 171 ? ILE C 185 ? ILE C 171 ILE C 185 
CD 1 HIS C 270 ? PHE C 271 ? HIS C 270 PHE C 271 
CD 2 ILE C 293 ? ALA C 294 ? ILE C 293 ALA C 294 
DA 1 VAL D 142 ? PHE D 144 ? VAL D 142 PHE D 144 
DA 2 LYS D 156 ? ASN D 165 ? LYS D 156 ASN D 165 
DA 3 SER D 211 ? PRO D 217 ? SER D 211 PRO D 217 
DA 4 LYS D 156 ? ASN D 165 ? LYS D 156 ASN D 165 
DA 5 ILE D 265 ? TRP D 267 ? ILE D 265 TRP D 267 
DA 6 MET D 148 ? PHE D 153 ? MET D 148 PHE D 153 
DA 7 LYS D 156 ? ASN D 165 ? LYS D 156 ASN D 165 
DB 1 VAL D 191 ? ASP D 197 ? VAL D 191 ASP D 197 
DB 2 ILE D 171 ? ILE D 185 ? ILE D 171 ILE D 185 
DB 3 ARG D 204 ? PHE D 208 ? ARG D 204 PHE D 208 
DB 4 ILE D 171 ? ILE D 185 ? ILE D 171 ILE D 185 
DB 5 GLN D 252 ? SER D 261 ? GLN D 252 SER D 261 
DB 6 GLU D 238 ? HIS D 247 ? GLU D 238 HIS D 247 
DB 7 ILE D 171 ? ILE D 185 ? ILE D 171 ILE D 185 
DC 1 HIS D 270 ? PHE D 271 ? HIS D 270 PHE D 271 
DC 2 ILE D 293 ? ALA D 294 ? ILE D 293 ALA D 294 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 24  ? N THR A 24  O ARG B 283 ? O ARG B 283 
AA 2 3 N ALA B 284 ? N ALA B 284 O THR B 276 ? O THR B 276 
AB 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
AB 2 3 N MET A 160 ? N MET A 160 O VAL A 149 ? O VAL A 149 
AB 3 4 O MET A 148 ? O MET A 148 N ILE A 266 ? N ILE A 266 
AC 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
AC 2 3 N LEU A 163 ? N LEU A 163 O TRP A 212 ? O TRP A 212 
AD 1 2 N HIS A 196 ? N HIS A 196 O LEU A 180 ? O LEU A 180 
AD 2 3 N ALA A 174 ? N ALA A 174 O SER A 205 ? O SER A 205 
AE 1 2 N HIS A 196 ? N HIS A 196 O LEU A 180 ? O LEU A 180 
AE 2 3 N VAL A 181 ? N VAL A 181 O GLU A 238 ? O GLU A 238 
AE 3 4 N HIS A 247 ? N HIS A 247 O GLN A 252 ? O GLN A 252 
AF 1 2 N HIS A 270 ? N HIS A 270 O ALA A 294 ? O ALA A 294 
AG 1 2 N THR A 276 ? N THR A 276 O ALA A 284 ? O ALA A 284 
AG 2 3 N LEU A 285 ? N LEU A 285 O THR D 24  ? O THR D 24  
BA 1 2 N THR B 24  ? N THR B 24  O ARG C 283 ? O ARG C 283 
BA 2 3 N ALA C 284 ? N ALA C 284 O THR C 276 ? O THR C 276 
BB 1 2 N LEU B 143 ? N LEU B 143 O ALA B 164 ? O ALA B 164 
BB 2 3 N MET B 160 ? N MET B 160 O VAL B 149 ? O VAL B 149 
BB 3 4 O MET B 148 ? O MET B 148 N ILE B 266 ? N ILE B 266 
BC 1 2 N LEU B 143 ? N LEU B 143 O ALA B 164 ? O ALA B 164 
BC 2 3 N LEU B 163 ? N LEU B 163 O TRP B 212 ? O TRP B 212 
BD 1 2 N HIS B 196 ? N HIS B 196 O LEU B 180 ? O LEU B 180 
BD 2 3 N ALA B 174 ? N ALA B 174 O SER B 205 ? O SER B 205 
BD 3 4 N PHE B 208 ? N PHE B 208 O ILE B 171 ? O ILE B 171 
BD 5 6 N TYR B 260 ? N TYR B 260 O PHE B 239 ? O PHE B 239 
BD 6 7 N HIS B 246 ? N HIS B 246 O ILE B 172 ? O ILE B 172 
BE 1 2 N HIS B 270 ? N HIS B 270 O ALA B 294 ? O ALA B 294 
CA 1 2 N THR C 24  ? N THR C 24  O ARG D 283 ? O ARG D 283 
CA 2 3 N ALA D 284 ? N ALA D 284 O THR D 276 ? O THR D 276 
CB 1 2 N LEU C 143 ? N LEU C 143 O ALA C 164 ? O ALA C 164 
CB 2 3 N LEU C 163 ? N LEU C 163 O TRP C 212 ? O TRP C 212 
CB 3 4 N HIS C 216 ? N HIS C 216 O LEU C 159 ? O LEU C 159 
CB 5 6 N ILE C 266 ? N ILE C 266 O MET C 148 ? O MET C 148 
CB 6 7 N PHE C 153 ? N PHE C 153 O LYS C 156 ? O LYS C 156 
CC 1 2 N HIS C 196 ? N HIS C 196 O LEU C 180 ? O LEU C 180 
CC 2 3 N ALA C 174 ? N ALA C 174 O SER C 205 ? O SER C 205 
CC 3 4 N PHE C 208 ? N PHE C 208 O ILE C 171 ? O ILE C 171 
CC 5 6 N TYR C 260 ? N TYR C 260 O PHE C 239 ? O PHE C 239 
CC 6 7 N HIS C 246 ? N HIS C 246 O ILE C 172 ? O ILE C 172 
CD 1 2 N HIS C 270 ? N HIS C 270 O ALA C 294 ? O ALA C 294 
DA 1 2 N LEU D 143 ? N LEU D 143 O ALA D 164 ? O ALA D 164 
DA 2 3 N LEU D 163 ? N LEU D 163 O TRP D 212 ? O TRP D 212 
DA 3 4 N HIS D 216 ? N HIS D 216 O LEU D 159 ? O LEU D 159 
DA 5 6 N ILE D 266 ? N ILE D 266 O MET D 148 ? O MET D 148 
DA 6 7 N PHE D 153 ? N PHE D 153 O LYS D 156 ? O LYS D 156 
DB 1 2 N HIS D 196 ? N HIS D 196 O LEU D 180 ? O LEU D 180 
DB 2 3 N ALA D 174 ? N ALA D 174 O SER D 205 ? O SER D 205 
DB 3 4 N PHE D 208 ? N PHE D 208 O ILE D 171 ? O ILE D 171 
DB 5 6 N TYR D 260 ? N TYR D 260 O PHE D 239 ? O PHE D 239 
DB 6 7 N HIS D 246 ? N HIS D 246 O ILE D 172 ? O ILE D 172 
DC 1 2 N HIS D 270 ? N HIS D 270 O ALA D 294 ? O ALA D 294 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE K A 1296' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE K A 1297' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE K A 1298' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 GLY A 98 ? GLY A 98   . ? 1_555 ? 
2  AC1 8 TYR A 99 ? TYR A 99   . ? 1_555 ? 
3  AC1 8 GLY B 98 ? GLY B 98   . ? 1_555 ? 
4  AC1 8 TYR B 99 ? TYR B 99   . ? 1_555 ? 
5  AC1 8 GLY C 98 ? GLY C 98   . ? 1_555 ? 
6  AC1 8 TYR C 99 ? TYR C 99   . ? 1_555 ? 
7  AC1 8 GLY D 98 ? GLY D 98   . ? 1_555 ? 
8  AC1 8 TYR D 99 ? TYR D 99   . ? 1_555 ? 
9  AC2 9 THR A 96 ? THR A 96   . ? 1_555 ? 
10 AC2 9 ILE A 97 ? ILE A 97   . ? 1_555 ? 
11 AC2 9 K   G .  ? K   A 1298 . ? 1_555 ? 
12 AC2 9 THR B 96 ? THR B 96   . ? 1_555 ? 
13 AC2 9 ILE B 97 ? ILE B 97   . ? 1_555 ? 
14 AC2 9 THR C 96 ? THR C 96   . ? 1_555 ? 
15 AC2 9 ILE C 97 ? ILE C 97   . ? 1_555 ? 
16 AC2 9 THR D 96 ? THR D 96   . ? 1_555 ? 
17 AC2 9 ILE D 97 ? ILE D 97   . ? 1_555 ? 
18 AC3 5 THR A 96 ? THR A 96   . ? 1_555 ? 
19 AC3 5 K   F .  ? K   A 1297 . ? 1_555 ? 
20 AC3 5 THR B 96 ? THR B 96   . ? 1_555 ? 
21 AC3 5 THR C 96 ? THR C 96   . ? 1_555 ? 
22 AC3 5 THR D 96 ? THR D 96   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2WLM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WLM 
_atom_sites.fract_transf_matrix[1][1]   0.010074 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006614 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003393 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 20  ? -0.629  16.841  57.703 1.00 196.74 ? 20   SER A N   1 
ATOM   2    C CA  . SER A 1 20  ? 0.014   17.412  58.881 1.00 197.21 ? 20   SER A CA  1 
ATOM   3    C C   . SER A 1 20  ? 0.110   16.390  60.005 1.00 198.14 ? 20   SER A C   1 
ATOM   4    O O   . SER A 1 20  ? -0.876  15.740  60.352 1.00 198.22 ? 20   SER A O   1 
ATOM   5    C CB  . SER A 1 20  ? -0.746  18.649  59.362 1.00 20.00  ? 20   SER A CB  1 
ATOM   6    N N   . SER A 1 21  ? 1.303   16.250  60.571 1.00 150.91 ? 21   SER A N   1 
ATOM   7    C CA  . SER A 1 21  ? 1.524   15.309  61.661 1.00 151.60 ? 21   SER A CA  1 
ATOM   8    C C   . SER A 1 21  ? 2.255   15.968  62.818 1.00 152.21 ? 21   SER A C   1 
ATOM   9    O O   . SER A 1 21  ? 3.431   15.696  63.049 1.00 152.52 ? 21   SER A O   1 
ATOM   10   C CB  . SER A 1 21  ? 2.312   14.093  61.170 1.00 20.00  ? 21   SER A CB  1 
ATOM   11   N N   . ASN A 1 22  ? 1.557   16.832  63.546 1.00 168.47 ? 22   ASN A N   1 
ATOM   12   C CA  . ASN A 1 22  ? 2.150   17.506  64.690 1.00 169.33 ? 22   ASN A CA  1 
ATOM   13   C C   . ASN A 1 22  ? 2.493   16.499  65.776 1.00 169.85 ? 22   ASN A C   1 
ATOM   14   O O   . ASN A 1 22  ? 1.775   15.524  65.976 1.00 169.46 ? 22   ASN A O   1 
ATOM   15   C CB  . ASN A 1 22  ? 1.207   18.576  65.238 1.00 169.46 ? 22   ASN A CB  1 
ATOM   16   N N   . ILE A 1 23  ? 3.598   16.734  66.469 1.00 123.34 ? 23   ILE A N   1 
ATOM   17   C CA  . ILE A 1 23  ? 4.042   15.845  67.532 1.00 123.72 ? 23   ILE A CA  1 
ATOM   18   C C   . ILE A 1 23  ? 5.352   16.399  68.046 1.00 124.58 ? 23   ILE A C   1 
ATOM   19   O O   . ILE A 1 23  ? 5.878   17.349  67.475 1.00 124.83 ? 23   ILE A O   1 
ATOM   20   C CB  . ILE A 1 23  ? 4.293   14.427  67.017 1.00 123.00 ? 23   ILE A CB  1 
ATOM   21   C CG1 . ILE A 1 23  ? 3.117   13.516  67.360 1.00 122.73 ? 23   ILE A CG1 1 
ATOM   22   C CG2 . ILE A 1 23  ? 5.569   13.871  67.619 1.00 123.08 ? 23   ILE A CG2 1 
ATOM   23   C CD1 . ILE A 1 23  ? 3.529   12.105  67.701 1.00 123.11 ? 23   ILE A CD1 1 
ATOM   24   N N   . THR A 1 24  ? 5.895   15.819  69.111 1.00 151.60 ? 24   THR A N   1 
ATOM   25   C CA  . THR A 1 24  ? 7.170   16.329  69.626 1.00 152.42 ? 24   THR A CA  1 
ATOM   26   C C   . THR A 1 24  ? 8.321   15.338  69.518 1.00 151.80 ? 24   THR A C   1 
ATOM   27   O O   . THR A 1 24  ? 8.368   14.355  70.252 1.00 151.44 ? 24   THR A O   1 
ATOM   28   C CB  . THR A 1 24  ? 7.050   16.702  71.102 1.00 153.64 ? 24   THR A CB  1 
ATOM   29   O OG1 . THR A 1 24  ? 5.918   17.558  71.287 1.00 154.40 ? 24   THR A OG1 1 
ATOM   30   C CG2 . THR A 1 24  ? 8.305   17.415  71.570 1.00 154.77 ? 24   THR A CG2 1 
ATOM   31   N N   . ARG A 1 25  ? 9.265   15.620  68.626 1.00 132.27 ? 25   ARG A N   1 
ATOM   32   C CA  . ARG A 1 25  ? 10.405  14.727  68.390 1.00 131.69 ? 25   ARG A CA  1 
ATOM   33   C C   . ARG A 1 25  ? 11.563  14.897  69.395 1.00 132.47 ? 25   ARG A C   1 
ATOM   34   O O   . ARG A 1 25  ? 12.264  15.913  69.385 1.00 133.10 ? 25   ARG A O   1 
ATOM   35   C CB  . ARG A 1 25  ? 10.934  14.908  66.964 1.00 130.65 ? 25   ARG A CB  1 
ATOM   36   C CG  . ARG A 1 25  ? 9.940   14.583  65.870 1.00 129.77 ? 25   ARG A CG  1 
ATOM   37   C CD  . ARG A 1 25  ? 10.547  14.915  64.520 1.00 129.17 ? 25   ARG A CD  1 
ATOM   38   N NE  . ARG A 1 25  ? 9.779   14.372  63.405 1.00 128.65 ? 25   ARG A NE  1 
ATOM   39   C CZ  . ARG A 1 25  ? 10.117  13.277  62.730 1.00 127.98 ? 25   ARG A CZ  1 
ATOM   40   N NH1 . ARG A 1 25  ? 11.214  12.606  63.060 1.00 127.39 ? 25   ARG A NH1 1 
ATOM   41   N NH2 . ARG A 1 25  ? 9.362   12.857  61.723 1.00 127.82 ? 25   ARG A NH2 1 
ATOM   42   N N   . LEU A 1 26  ? 11.770  13.887  70.241 1.00 162.54 ? 26   LEU A N   1 
ATOM   43   C CA  . LEU A 1 26  ? 12.860  13.899  71.218 1.00 162.84 ? 26   LEU A CA  1 
ATOM   44   C C   . LEU A 1 26  ? 14.058  13.117  70.692 1.00 161.61 ? 26   LEU A C   1 
ATOM   45   O O   . LEU A 1 26  ? 14.101  11.888  70.798 1.00 160.57 ? 26   LEU A O   1 
ATOM   46   C CB  . LEU A 1 26  ? 12.386  13.304  72.542 1.00 163.04 ? 26   LEU A CB  1 
ATOM   47   C CG  . LEU A 1 26  ? 11.015  13.820  72.981 1.00 163.38 ? 26   LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 26  ? 10.435  12.977  74.098 1.00 162.58 ? 26   LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 26  ? 11.102  15.279  73.389 1.00 164.66 ? 26   LEU A CD2 1 
ATOM   50   N N   . GLY A 1 27  ? 15.024  13.835  70.115 1.00 154.54 ? 27   GLY A N   1 
ATOM   51   C CA  . GLY A 1 27  ? 16.216  13.204  69.551 1.00 152.95 ? 27   GLY A CA  1 
ATOM   52   C C   . GLY A 1 27  ? 16.922  14.091  68.547 1.00 152.21 ? 27   GLY A C   1 
ATOM   53   O O   . GLY A 1 27  ? 18.081  14.467  68.760 1.00 152.00 ? 27   GLY A O   1 
ATOM   54   N N   . TRP A 1 33  ? 22.631  20.634  64.793 1.00 155.30 ? 33   TRP A N   1 
ATOM   55   C CA  . TRP A 1 33  ? 22.954  22.019  64.459 1.00 158.46 ? 33   TRP A CA  1 
ATOM   56   C C   . TRP A 1 33  ? 23.554  22.151  63.057 1.00 153.97 ? 33   TRP A C   1 
ATOM   57   O O   . TRP A 1 33  ? 23.059  22.921  62.236 1.00 156.83 ? 33   TRP A O   1 
ATOM   58   C CB  . TRP A 1 33  ? 23.895  22.621  65.504 1.00 159.38 ? 33   TRP A CB  1 
ATOM   59   N N   . LEU A 1 34  ? 24.622  21.404  62.788 1.00 173.32 ? 34   LEU A N   1 
ATOM   60   C CA  . LEU A 1 34  ? 25.224  21.378  61.457 1.00 168.75 ? 34   LEU A CA  1 
ATOM   61   C C   . LEU A 1 34  ? 24.988  20.021  60.804 1.00 164.51 ? 34   LEU A C   1 
ATOM   62   O O   . LEU A 1 34  ? 25.413  19.773  59.674 1.00 160.65 ? 34   LEU A O   1 
ATOM   63   C CB  . LEU A 1 34  ? 26.723  21.665  61.540 1.00 165.40 ? 34   LEU A CB  1 
ATOM   64   C CG  . LEU A 1 34  ? 27.091  23.061  62.038 1.00 169.38 ? 34   LEU A CG  1 
ATOM   65   C CD1 . LEU A 1 34  ? 28.597  23.203  62.203 1.00 166.12 ? 34   LEU A CD1 1 
ATOM   66   C CD2 . LEU A 1 34  ? 26.550  24.115  61.089 1.00 171.93 ? 34   LEU A CD2 1 
ATOM   67   N N   . ASP A 1 35  ? 24.294  19.153  61.531 1.00 251.30 ? 35   ASP A N   1 
ATOM   68   C CA  . ASP A 1 35  ? 24.064  17.773  61.119 1.00 247.76 ? 35   ASP A CA  1 
ATOM   69   C C   . ASP A 1 35  ? 23.482  17.647  59.709 1.00 246.76 ? 35   ASP A C   1 
ATOM   70   O O   . ASP A 1 35  ? 24.009  16.912  58.874 1.00 242.25 ? 35   ASP A O   1 
ATOM   71   C CB  . ASP A 1 35  ? 23.140  17.088  62.130 1.00 250.09 ? 35   ASP A CB  1 
ATOM   72   C CG  . ASP A 1 35  ? 23.385  15.592  62.232 1.00 245.90 ? 35   ASP A CG  1 
ATOM   73   O OD1 . ASP A 1 35  ? 24.366  15.102  61.633 1.00 241.77 ? 35   ASP A OD1 1 
ATOM   74   O OD2 . ASP A 1 35  ? 22.598  14.905  62.920 1.00 247.09 ? 35   ASP A OD2 1 
ATOM   75   N N   . ASP A 1 36  ? 22.393  18.364  59.450 1.00 159.44 ? 36   ASP A N   1 
ATOM   76   C CA  . ASP A 1 36  ? 21.654  18.221  58.200 1.00 159.44 ? 36   ASP A CA  1 
ATOM   77   C C   . ASP A 1 36  ? 21.820  19.452  57.314 1.00 160.77 ? 36   ASP A C   1 
ATOM   78   O O   . ASP A 1 36  ? 20.838  20.053  56.884 1.00 165.61 ? 36   ASP A O   1 
ATOM   79   C CB  . ASP A 1 36  ? 20.173  17.997  58.508 1.00 164.70 ? 36   ASP A CB  1 
ATOM   80   C CG  . ASP A 1 36  ? 19.446  17.292  57.391 1.00 163.74 ? 36   ASP A CG  1 
ATOM   81   O OD1 . ASP A 1 36  ? 19.989  17.230  56.270 1.00 159.99 ? 36   ASP A OD1 1 
ATOM   82   O OD2 . ASP A 1 36  ? 18.330  16.802  57.641 1.00 166.90 ? 36   ASP A OD2 1 
ATOM   83   N N   . HIS A 1 37  ? 23.065  19.816  57.032 1.00 167.46 ? 37   HIS A N   1 
ATOM   84   C CA  . HIS A 1 37  ? 23.352  21.086  56.370 1.00 168.64 ? 37   HIS A CA  1 
ATOM   85   C C   . HIS A 1 37  ? 22.605  21.290  55.047 1.00 169.56 ? 37   HIS A C   1 
ATOM   86   O O   . HIS A 1 37  ? 21.968  22.323  54.842 1.00 174.65 ? 37   HIS A O   1 
ATOM   87   C CB  . HIS A 1 37  ? 24.867  21.289  56.199 1.00 161.55 ? 37   HIS A CB  1 
ATOM   88   C CG  . HIS A 1 37  ? 25.456  20.576  55.017 1.00 152.10 ? 37   HIS A CG  1 
ATOM   89   N ND1 . HIS A 1 37  ? 25.375  19.208  54.857 1.00 150.67 ? 37   HIS A ND1 1 
ATOM   90   C CD2 . HIS A 1 37  ? 26.152  21.041  53.958 1.00 139.03 ? 37   HIS A CD2 1 
ATOM   91   C CE1 . HIS A 1 37  ? 25.986  18.864  53.738 1.00 139.51 ? 37   HIS A CE1 1 
ATOM   92   N NE2 . HIS A 1 37  ? 26.468  19.957  53.170 1.00 131.38 ? 37   HIS A NE2 1 
ATOM   93   N N   . TYR A 1 38  ? 22.667  20.301  54.163 1.00 128.43 ? 38   TYR A N   1 
ATOM   94   C CA  . TYR A 1 38  ? 22.109  20.454  52.826 1.00 128.35 ? 38   TYR A CA  1 
ATOM   95   C C   . TYR A 1 38  ? 20.592  20.576  52.842 1.00 135.14 ? 38   TYR A C   1 
ATOM   96   O O   . TYR A 1 38  ? 20.023  21.457  52.196 1.00 139.27 ? 38   TYR A O   1 
ATOM   97   C CB  . TYR A 1 38  ? 22.530  19.295  51.931 1.00 120.31 ? 38   TYR A CB  1 
ATOM   98   C CG  . TYR A 1 38  ? 21.976  19.405  50.533 1.00 117.34 ? 38   TYR A CG  1 
ATOM   99   C CD1 . TYR A 1 38  ? 22.274  20.502  49.736 1.00 109.97 ? 38   TYR A CD1 1 
ATOM   100  C CD2 . TYR A 1 38  ? 21.152  18.417  50.011 1.00 119.45 ? 38   TYR A CD2 1 
ATOM   101  C CE1 . TYR A 1 38  ? 21.769  20.612  48.454 1.00 108.33 ? 38   TYR A CE1 1 
ATOM   102  C CE2 . TYR A 1 38  ? 20.643  18.516  48.733 1.00 116.88 ? 38   TYR A CE2 1 
ATOM   103  C CZ  . TYR A 1 38  ? 20.954  19.614  47.959 1.00 111.71 ? 38   TYR A CZ  1 
ATOM   104  O OH  . TYR A 1 38  ? 20.445  19.711  46.684 1.00 108.88 ? 38   TYR A OH  1 
ATOM   105  N N   . HIS A 1 39  ? 19.945  19.676  53.571 1.00 106.07 ? 39   HIS A N   1 
ATOM   106  C CA  . HIS A 1 39  ? 18.503  19.736  53.763 1.00 113.24 ? 39   HIS A CA  1 
ATOM   107  C C   . HIS A 1 39  ? 18.109  21.106  54.283 1.00 120.75 ? 39   HIS A C   1 
ATOM   108  O O   . HIS A 1 39  ? 17.286  21.805  53.691 1.00 126.66 ? 39   HIS A O   1 
ATOM   109  C CB  . HIS A 1 39  ? 18.071  18.660  54.759 1.00 113.40 ? 39   HIS A CB  1 
ATOM   110  C CG  . HIS A 1 39  ? 16.707  18.877  55.342 1.00 121.63 ? 39   HIS A CG  1 
ATOM   111  N ND1 . HIS A 1 39  ? 16.468  19.803  56.339 1.00 127.81 ? 39   HIS A ND1 1 
ATOM   112  C CD2 . HIS A 1 39  ? 15.529  18.282  55.087 1.00 125.20 ? 39   HIS A CD2 1 
ATOM   113  C CE1 . HIS A 1 39  ? 15.188  19.770  56.657 1.00 135.05 ? 39   HIS A CE1 1 
ATOM   114  N NE2 . HIS A 1 39  ? 14.590  18.859  55.915 1.00 133.60 ? 39   HIS A NE2 1 
ATOM   115  N N   . ASP A 1 40  ? 18.720  21.485  55.396 1.00 99.12  ? 40   ASP A N   1 
ATOM   116  C CA  . ASP A 1 40  ? 18.412  22.742  56.060 1.00 103.50 ? 40   ASP A CA  1 
ATOM   117  C C   . ASP A 1 40  ? 18.498  23.941  55.119 1.00 105.95 ? 40   ASP A C   1 
ATOM   118  O O   . ASP A 1 40  ? 17.650  24.832  55.159 1.00 114.62 ? 40   ASP A O   1 
ATOM   119  C CB  . ASP A 1 40  ? 19.334  22.940  57.264 1.00 101.88 ? 40   ASP A CB  1 
ATOM   120  C CG  . ASP A 1 40  ? 19.126  21.885  58.335 1.00 101.56 ? 40   ASP A CG  1 
ATOM   121  O OD1 . ASP A 1 40  ? 18.153  21.107  58.224 1.00 102.47 ? 40   ASP A OD1 1 
ATOM   122  O OD2 . ASP A 1 40  ? 19.936  21.834  59.286 1.00 102.48 ? 40   ASP A OD2 1 
ATOM   123  N N   . LEU A 1 41  ? 19.520  23.962  54.271 1.00 95.68  ? 41   LEU A N   1 
ATOM   124  C CA  . LEU A 1 41  ? 19.696  25.068  53.335 1.00 92.58  ? 41   LEU A CA  1 
ATOM   125  C C   . LEU A 1 41  ? 18.567  25.145  52.306 1.00 91.49  ? 41   LEU A C   1 
ATOM   126  O O   . LEU A 1 41  ? 18.163  26.232  51.903 1.00 88.51  ? 41   LEU A O   1 
ATOM   127  C CB  . LEU A 1 41  ? 21.058  24.981  52.642 1.00 89.10  ? 41   LEU A CB  1 
ATOM   128  C CG  . LEU A 1 41  ? 22.228  25.434  53.509 1.00 87.49  ? 41   LEU A CG  1 
ATOM   129  C CD1 . LEU A 1 41  ? 23.556  25.034  52.890 1.00 85.16  ? 41   LEU A CD1 1 
ATOM   130  C CD2 . LEU A 1 41  ? 22.152  26.933  53.724 1.00 87.84  ? 41   LEU A CD2 1 
ATOM   131  N N   . LEU A 1 42  ? 18.058  23.992  51.886 1.00 105.14 ? 42   LEU A N   1 
ATOM   132  C CA  . LEU A 1 42  ? 16.948  23.960  50.945 1.00 106.22 ? 42   LEU A CA  1 
ATOM   133  C C   . LEU A 1 42  ? 15.613  24.161  51.652 1.00 116.61 ? 42   LEU A C   1 
ATOM   134  O O   . LEU A 1 42  ? 14.611  24.485  51.016 1.00 117.71 ? 42   LEU A O   1 
ATOM   135  C CB  . LEU A 1 42  ? 16.918  22.631  50.187 1.00 105.99 ? 42   LEU A CB  1 
ATOM   136  C CG  . LEU A 1 42  ? 18.097  22.292  49.277 1.00 92.31  ? 42   LEU A CG  1 
ATOM   137  C CD1 . LEU A 1 42  ? 17.775  21.069  48.433 1.00 89.10  ? 42   LEU A CD1 1 
ATOM   138  C CD2 . LEU A 1 42  ? 18.440  23.475  48.392 1.00 83.50  ? 42   LEU A CD2 1 
ATOM   139  N N   . THR A 1 43  ? 15.604  23.966  52.966 1.00 94.86  ? 43   THR A N   1 
ATOM   140  C CA  . THR A 1 43  ? 14.363  23.954  53.735 1.00 102.63 ? 43   THR A CA  1 
ATOM   141  C C   . THR A 1 43  ? 14.041  25.324  54.320 1.00 105.83 ? 43   THR A C   1 
ATOM   142  O O   . THR A 1 43  ? 12.884  25.658  54.567 1.00 112.87 ? 43   THR A O   1 
ATOM   143  C CB  . THR A 1 43  ? 14.447  22.922  54.878 1.00 100.42 ? 43   THR A CB  1 
ATOM   144  O OG1 . THR A 1 43  ? 14.563  21.607  54.324 1.00 99.07  ? 43   THR A OG1 1 
ATOM   145  C CG2 . THR A 1 43  ? 13.213  22.979  55.764 1.00 108.99 ? 43   THR A CG2 1 
ATOM   146  N N   . VAL A 1 44  ? 15.083  26.114  54.536 1.00 103.62 ? 44   VAL A N   1 
ATOM   147  C CA  . VAL A 1 44  ? 14.961  27.430  55.141 1.00 110.95 ? 44   VAL A CA  1 
ATOM   148  C C   . VAL A 1 44  ? 14.130  28.398  54.292 1.00 118.57 ? 44   VAL A C   1 
ATOM   149  O O   . VAL A 1 44  ? 14.029  28.232  53.078 1.00 118.32 ? 44   VAL A O   1 
ATOM   150  C CB  . VAL A 1 44  ? 16.361  28.010  55.368 1.00 112.06 ? 44   VAL A CB  1 
ATOM   151  C CG1 . VAL A 1 44  ? 16.306  29.506  55.495 1.00 121.79 ? 44   VAL A CG1 1 
ATOM   152  C CG2 . VAL A 1 44  ? 16.996  27.368  56.588 1.00 106.62 ? 44   VAL A CG2 1 
ATOM   153  N N   . SER A 1 45  ? 13.530  29.402  54.932 1.00 115.97 ? 45   SER A N   1 
ATOM   154  C CA  . SER A 1 45  ? 12.767  30.428  54.214 1.00 124.64 ? 45   SER A CA  1 
ATOM   155  C C   . SER A 1 45  ? 13.702  31.346  53.433 1.00 130.20 ? 45   SER A C   1 
ATOM   156  O O   . SER A 1 45  ? 14.822  31.613  53.874 1.00 130.06 ? 45   SER A O   1 
ATOM   157  C CB  . SER A 1 45  ? 11.922  31.259  55.184 1.00 131.63 ? 45   SER A CB  1 
ATOM   158  O OG  . SER A 1 45  ? 12.713  32.225  55.856 1.00 133.71 ? 45   SER A OG  1 
ATOM   159  N N   . TRP A 1 46  ? 13.250  31.834  52.280 1.00 100.12 ? 46   TRP A N   1 
ATOM   160  C CA  . TRP A 1 46  ? 14.106  32.681  51.449 1.00 105.64 ? 46   TRP A CA  1 
ATOM   161  C C   . TRP A 1 46  ? 14.777  33.799  52.247 1.00 113.20 ? 46   TRP A C   1 
ATOM   162  O O   . TRP A 1 46  ? 15.995  33.956  52.176 1.00 112.63 ? 46   TRP A O   1 
ATOM   163  C CB  . TRP A 1 46  ? 13.357  33.232  50.232 1.00 112.36 ? 46   TRP A CB  1 
ATOM   164  C CG  . TRP A 1 46  ? 13.274  32.248  49.095 1.00 105.61 ? 46   TRP A CG  1 
ATOM   165  C CD1 . TRP A 1 46  ? 12.158  31.598  48.656 1.00 103.12 ? 46   TRP A CD1 1 
ATOM   166  C CD2 . TRP A 1 46  ? 14.357  31.793  48.265 1.00 100.99 ? 46   TRP A CD2 1 
ATOM   167  N NE1 . TRP A 1 46  ? 12.474  30.772  47.602 1.00 97.56  ? 46   TRP A NE1 1 
ATOM   168  C CE2 . TRP A 1 46  ? 13.816  30.873  47.343 1.00 96.04  ? 46   TRP A CE2 1 
ATOM   169  C CE3 . TRP A 1 46  ? 15.726  32.074  48.210 1.00 100.87 ? 46   TRP A CE3 1 
ATOM   170  C CZ2 . TRP A 1 46  ? 14.597  30.233  46.379 1.00 92.99  ? 46   TRP A CZ2 1 
ATOM   171  C CZ3 . TRP A 1 46  ? 16.500  31.438  47.250 1.00 95.60  ? 46   TRP A CZ3 1 
ATOM   172  C CH2 . TRP A 1 46  ? 15.932  30.529  46.349 1.00 92.77  ? 46   TRP A CH2 1 
ATOM   173  N N   . PRO A 1 47  ? 13.989  34.571  53.017 1.00 109.74 ? 47   PRO A N   1 
ATOM   174  C CA  . PRO A 1 47  ? 14.597  35.573  53.899 1.00 111.75 ? 47   PRO A CA  1 
ATOM   175  C C   . PRO A 1 47  ? 15.830  35.008  54.595 1.00 106.26 ? 47   PRO A C   1 
ATOM   176  O O   . PRO A 1 47  ? 16.940  35.509  54.401 1.00 107.50 ? 47   PRO A O   1 
ATOM   177  C CB  . PRO A 1 47  ? 13.502  35.826  54.933 1.00 109.57 ? 47   PRO A CB  1 
ATOM   178  C CG  . PRO A 1 47  ? 12.233  35.587  54.196 1.00 112.42 ? 47   PRO A CG  1 
ATOM   179  C CD  . PRO A 1 47  ? 12.519  34.545  53.139 1.00 110.33 ? 47   PRO A CD  1 
ATOM   180  N N   . VAL A 1 48  ? 15.629  33.962  55.392 1.00 97.46  ? 48   VAL A N   1 
ATOM   181  C CA  . VAL A 1 48  ? 16.719  33.339  56.137 1.00 92.44  ? 48   VAL A CA  1 
ATOM   182  C C   . VAL A 1 48  ? 17.876  32.887  55.239 1.00 91.19  ? 48   VAL A C   1 
ATOM   183  O O   . VAL A 1 48  ? 19.039  33.196  55.512 1.00 92.14  ? 48   VAL A O   1 
ATOM   184  C CB  . VAL A 1 48  ? 16.224  32.142  56.964 1.00 85.79  ? 48   VAL A CB  1 
ATOM   185  C CG1 . VAL A 1 48  ? 17.398  31.454  57.657 1.00 82.12  ? 48   VAL A CG1 1 
ATOM   186  C CG2 . VAL A 1 48  ? 15.174  32.581  57.968 1.00 86.62  ? 48   VAL A CG2 1 
ATOM   187  N N   . PHE A 1 49  ? 17.553  32.155  54.177 1.00 110.13 ? 49   PHE A N   1 
ATOM   188  C CA  . PHE A 1 49  ? 18.563  31.692  53.230 1.00 105.57 ? 49   PHE A CA  1 
ATOM   189  C C   . PHE A 1 49  ? 19.449  32.841  52.759 1.00 113.83 ? 49   PHE A C   1 
ATOM   190  O O   . PHE A 1 49  ? 20.676  32.744  52.792 1.00 111.37 ? 49   PHE A O   1 
ATOM   191  C CB  . PHE A 1 49  ? 17.896  31.008  52.034 1.00 102.10 ? 49   PHE A CB  1 
ATOM   192  C CG  . PHE A 1 49  ? 18.843  30.657  50.917 1.00 98.86  ? 49   PHE A CG  1 
ATOM   193  C CD1 . PHE A 1 49  ? 19.718  29.590  51.036 1.00 89.85  ? 49   PHE A CD1 1 
ATOM   194  C CD2 . PHE A 1 49  ? 18.841  31.382  49.739 1.00 105.24 ? 49   PHE A CD2 1 
ATOM   195  C CE1 . PHE A 1 49  ? 20.579  29.263  50.009 1.00 87.08  ? 49   PHE A CE1 1 
ATOM   196  C CE2 . PHE A 1 49  ? 19.698  31.058  48.709 1.00 102.40 ? 49   PHE A CE2 1 
ATOM   197  C CZ  . PHE A 1 49  ? 20.569  29.996  48.843 1.00 93.18  ? 49   PHE A CZ  1 
ATOM   198  N N   . ILE A 1 50  ? 18.820  33.930  52.329 1.00 108.74 ? 50   ILE A N   1 
ATOM   199  C CA  . ILE A 1 50  ? 19.547  35.108  51.870 1.00 118.60 ? 50   ILE A CA  1 
ATOM   200  C C   . ILE A 1 50  ? 20.420  35.678  52.984 1.00 118.40 ? 50   ILE A C   1 
ATOM   201  O O   . ILE A 1 50  ? 21.575  36.041  52.755 1.00 119.70 ? 50   ILE A O   1 
ATOM   202  C CB  . ILE A 1 50  ? 18.590  36.202  51.365 1.00 126.94 ? 50   ILE A CB  1 
ATOM   203  C CG1 . ILE A 1 50  ? 17.597  35.620  50.358 1.00 127.22 ? 50   ILE A CG1 1 
ATOM   204  C CG2 . ILE A 1 50  ? 19.371  37.333  50.732 1.00 134.68 ? 50   ILE A CG2 1 
ATOM   205  C CD1 . ILE A 1 50  ? 16.529  36.595  49.919 1.00 134.89 ? 50   ILE A CD1 1 
ATOM   206  N N   . THR A 1 51  ? 19.857  35.754  54.187 1.00 108.47 ? 51   THR A N   1 
ATOM   207  C CA  . THR A 1 51  ? 20.593  36.202  55.363 1.00 104.41 ? 51   THR A CA  1 
ATOM   208  C C   . THR A 1 51  ? 21.860  35.389  55.558 1.00 101.56 ? 51   THR A C   1 
ATOM   209  O O   . THR A 1 51  ? 22.954  35.946  55.649 1.00 102.30 ? 51   THR A O   1 
ATOM   210  C CB  . THR A 1 51  ? 19.751  36.053  56.630 1.00 100.03 ? 51   THR A CB  1 
ATOM   211  O OG1 . THR A 1 51  ? 18.573  36.856  56.511 1.00 102.79 ? 51   THR A OG1 1 
ATOM   212  C CG2 . THR A 1 51  ? 20.542  36.488  57.855 1.00 97.01  ? 51   THR A CG2 1 
ATOM   213  N N   . LEU A 1 52  ? 21.691  34.071  55.638 1.00 125.60 ? 52   LEU A N   1 
ATOM   214  C CA  . LEU A 1 52  ? 22.798  33.136  55.805 1.00 117.29 ? 52   LEU A CA  1 
ATOM   215  C C   . LEU A 1 52  ? 23.905  33.407  54.814 1.00 118.44 ? 52   LEU A C   1 
ATOM   216  O O   . LEU A 1 52  ? 25.076  33.534  55.175 1.00 118.00 ? 52   LEU A O   1 
ATOM   217  C CB  . LEU A 1 52  ? 22.307  31.713  55.585 1.00 106.47 ? 52   LEU A CB  1 
ATOM   218  C CG  . LEU A 1 52  ? 21.582  31.079  56.760 1.00 102.26 ? 52   LEU A CG  1 
ATOM   219  C CD1 . LEU A 1 52  ? 21.268  29.633  56.434 1.00 92.24  ? 52   LEU A CD1 1 
ATOM   220  C CD2 . LEU A 1 52  ? 22.450  31.186  58.003 1.00 101.84 ? 52   LEU A CD2 1 
ATOM   221  N N   . ILE A 1 53  ? 23.519  33.459  53.549 1.00 88.35  ? 53   ILE A N   1 
ATOM   222  C CA  . ILE A 1 53  ? 24.447  33.770  52.481 1.00 90.64  ? 53   ILE A CA  1 
ATOM   223  C C   . ILE A 1 53  ? 25.141  35.097  52.764 1.00 101.83 ? 53   ILE A C   1 
ATOM   224  O O   . ILE A 1 53  ? 26.367  35.166  52.813 1.00 101.24 ? 53   ILE A O   1 
ATOM   225  C CB  . ILE A 1 53  ? 23.719  33.820  51.135 1.00 92.69  ? 53   ILE A CB  1 
ATOM   226  C CG1 . ILE A 1 53  ? 23.394  32.399  50.678 1.00 87.13  ? 53   ILE A CG1 1 
ATOM   227  C CG2 . ILE A 1 53  ? 24.553  34.553  50.101 1.00 99.04  ? 53   ILE A CG2 1 
ATOM   228  C CD1 . ILE A 1 53  ? 22.828  32.327  49.295 1.00 88.21  ? 53   ILE A CD1 1 
ATOM   229  N N   . THR A 1 54  ? 24.349  36.145  52.963 1.00 111.70 ? 54   THR A N   1 
ATOM   230  C CA  . THR A 1 54  ? 24.884  37.450  53.330 1.00 113.09 ? 54   THR A CA  1 
ATOM   231  C C   . THR A 1 54  ? 25.889  37.334  54.476 1.00 108.39 ? 54   THR A C   1 
ATOM   232  O O   . THR A 1 54  ? 27.050  37.713  54.330 1.00 110.17 ? 54   THR A O   1 
ATOM   233  C CB  . THR A 1 54  ? 23.765  38.414  53.756 1.00 113.69 ? 54   THR A CB  1 
ATOM   234  O OG1 . THR A 1 54  ? 22.692  38.358  52.808 1.00 117.88 ? 54   THR A OG1 1 
ATOM   235  C CG2 . THR A 1 54  ? 24.296  39.836  53.845 1.00 117.06 ? 54   THR A CG2 1 
ATOM   236  N N   . GLY A 1 55  ? 25.434  36.818  55.615 1.00 137.98 ? 55   GLY A N   1 
ATOM   237  C CA  . GLY A 1 55  ? 26.307  36.601  56.753 1.00 134.40 ? 55   GLY A CA  1 
ATOM   238  C C   . GLY A 1 55  ? 27.625  35.994  56.315 1.00 135.01 ? 55   GLY A C   1 
ATOM   239  O O   . GLY A 1 55  ? 28.687  36.582  56.507 1.00 136.48 ? 55   GLY A O   1 
ATOM   240  N N   . LEU A 1 56  ? 27.549  34.814  55.710 1.00 129.93 ? 56   LEU A N   1 
ATOM   241  C CA  . LEU A 1 56  ? 28.729  34.131  55.195 1.00 125.28 ? 56   LEU A CA  1 
ATOM   242  C C   . LEU A 1 56  ? 29.602  35.082  54.374 1.00 132.52 ? 56   LEU A C   1 
ATOM   243  O O   . LEU A 1 56  ? 30.816  35.162  54.567 1.00 132.03 ? 56   LEU A O   1 
ATOM   244  C CB  . LEU A 1 56  ? 28.299  32.933  54.346 1.00 115.83 ? 56   LEU A CB  1 
ATOM   245  C CG  . LEU A 1 56  ? 29.414  32.101  53.716 1.00 108.09 ? 56   LEU A CG  1 
ATOM   246  C CD1 . LEU A 1 56  ? 30.603  32.001  54.655 1.00 106.37 ? 56   LEU A CD1 1 
ATOM   247  C CD2 . LEU A 1 56  ? 28.908  30.718  53.341 1.00 97.45  ? 56   LEU A CD2 1 
ATOM   248  N N   . TYR A 1 57  ? 28.956  35.804  53.468 1.00 100.97 ? 57   TYR A N   1 
ATOM   249  C CA  . TYR A 1 57  ? 29.600  36.771  52.592 1.00 109.56 ? 57   TYR A CA  1 
ATOM   250  C C   . TYR A 1 57  ? 30.398  37.805  53.383 1.00 111.13 ? 57   TYR A C   1 
ATOM   251  O O   . TYR A 1 57  ? 31.620  37.900  53.250 1.00 112.84 ? 57   TYR A O   1 
ATOM   252  C CB  . TYR A 1 57  ? 28.512  37.443  51.753 1.00 115.95 ? 57   TYR A CB  1 
ATOM   253  C CG  . TYR A 1 57  ? 28.972  38.526  50.812 1.00 123.29 ? 57   TYR A CG  1 
ATOM   254  C CD1 . TYR A 1 57  ? 30.034  38.321  49.943 1.00 127.54 ? 57   TYR A CD1 1 
ATOM   255  C CD2 . TYR A 1 57  ? 28.312  39.748  50.766 1.00 126.58 ? 57   TYR A CD2 1 
ATOM   256  C CE1 . TYR A 1 57  ? 30.441  39.312  49.075 1.00 134.92 ? 57   TYR A CE1 1 
ATOM   257  C CE2 . TYR A 1 57  ? 28.709  40.744  49.902 1.00 133.91 ? 57   TYR A CE2 1 
ATOM   258  C CZ  . TYR A 1 57  ? 29.774  40.522  49.059 1.00 138.14 ? 57   TYR A CZ  1 
ATOM   259  O OH  . TYR A 1 57  ? 30.170  41.519  48.198 1.00 146.03 ? 57   TYR A OH  1 
ATOM   260  N N   . LEU A 1 58  ? 29.698  38.577  54.208 1.00 113.08 ? 58   LEU A N   1 
ATOM   261  C CA  . LEU A 1 58  ? 30.337  39.579  55.049 1.00 113.28 ? 58   LEU A CA  1 
ATOM   262  C C   . LEU A 1 58  ? 31.445  38.941  55.868 1.00 110.24 ? 58   LEU A C   1 
ATOM   263  O O   . LEU A 1 58  ? 32.607  39.329  55.767 1.00 112.84 ? 58   LEU A O   1 
ATOM   264  C CB  . LEU A 1 58  ? 29.306  40.232  55.967 1.00 111.40 ? 58   LEU A CB  1 
ATOM   265  C CG  . LEU A 1 58  ? 28.105  40.802  55.216 1.00 114.52 ? 58   LEU A CG  1 
ATOM   266  C CD1 . LEU A 1 58  ? 27.307  41.727  56.108 1.00 113.96 ? 58   LEU A CD1 1 
ATOM   267  C CD2 . LEU A 1 58  ? 28.568  41.536  53.970 1.00 121.24 ? 58   LEU A CD2 1 
ATOM   268  N N   . VAL A 1 59  ? 31.074  37.952  56.673 1.00 119.95 ? 59   VAL A N   1 
ATOM   269  C CA  . VAL A 1 59  ? 32.035  37.209  57.475 1.00 117.51 ? 59   VAL A CA  1 
ATOM   270  C C   . VAL A 1 59  ? 33.346  36.969  56.731 1.00 120.23 ? 59   VAL A C   1 
ATOM   271  O O   . VAL A 1 59  ? 34.382  37.507  57.113 1.00 122.20 ? 59   VAL A O   1 
ATOM   272  C CB  . VAL A 1 59  ? 31.458  35.856  57.937 1.00 111.95 ? 59   VAL A CB  1 
ATOM   273  C CG1 . VAL A 1 59  ? 32.542  35.006  58.583 1.00 105.56 ? 59   VAL A CG1 1 
ATOM   274  C CG2 . VAL A 1 59  ? 30.301  36.078  58.898 1.00 110.36 ? 59   VAL A CG2 1 
ATOM   275  N N   . THR A 1 60  ? 33.305  36.175  55.664 1.00 114.17 ? 60   THR A N   1 
ATOM   276  C CA  . THR A 1 60  ? 34.537  35.802  54.964 1.00 112.70 ? 60   THR A CA  1 
ATOM   277  C C   . THR A 1 60  ? 35.386  37.003  54.522 1.00 122.31 ? 60   THR A C   1 
ATOM   278  O O   . THR A 1 60  ? 36.615  36.960  54.612 1.00 122.15 ? 60   THR A O   1 
ATOM   279  C CB  . THR A 1 60  ? 34.275  34.888  53.747 1.00 106.42 ? 60   THR A CB  1 
ATOM   280  O OG1 . THR A 1 60  ? 33.804  35.673  52.646 1.00 114.71 ? 60   THR A OG1 1 
ATOM   281  C CG2 . THR A 1 60  ? 33.260  33.817  54.089 1.00 97.13  ? 60   THR A CG2 1 
ATOM   282  N N   . ASN A 1 61  ? 34.739  38.063  54.041 1.00 106.12 ? 61   ASN A N   1 
ATOM   283  C CA  . ASN A 1 61  ? 35.457  39.286  53.683 1.00 111.43 ? 61   ASN A CA  1 
ATOM   284  C C   . ASN A 1 61  ? 36.188  39.905  54.870 1.00 110.56 ? 61   ASN A C   1 
ATOM   285  O O   . ASN A 1 61  ? 37.328  40.356  54.747 1.00 113.98 ? 61   ASN A O   1 
ATOM   286  C CB  . ASN A 1 61  ? 34.507  40.318  53.088 1.00 115.13 ? 61   ASN A CB  1 
ATOM   287  C CG  . ASN A 1 61  ? 34.289  40.121  51.611 1.00 120.14 ? 61   ASN A CG  1 
ATOM   288  O OD1 . ASN A 1 61  ? 35.223  40.195  50.811 1.00 124.81 ? 61   ASN A OD1 1 
ATOM   289  N ND2 . ASN A 1 61  ? 33.044  39.883  51.234 1.00 119.94 ? 61   ASN A ND2 1 
ATOM   290  N N   . ALA A 1 62  ? 35.513  39.945  56.013 1.00 121.28 ? 62   ALA A N   1 
ATOM   291  C CA  . ALA A 1 62  ? 36.135  40.398  57.243 1.00 120.92 ? 62   ALA A CA  1 
ATOM   292  C C   . ALA A 1 62  ? 37.377  39.556  57.509 1.00 120.45 ? 62   ALA A C   1 
ATOM   293  O O   . ALA A 1 62  ? 38.464  40.089  57.723 1.00 123.70 ? 62   ALA A O   1 
ATOM   294  C CB  . ALA A 1 62  ? 35.160  40.294  58.396 1.00 117.08 ? 62   ALA A CB  1 
ATOM   295  N N   . LEU A 1 63  ? 37.212  38.236  57.485 1.00 116.78 ? 63   LEU A N   1 
ATOM   296  C CA  . LEU A 1 63  ? 38.339  37.326  57.655 1.00 112.77 ? 63   LEU A CA  1 
ATOM   297  C C   . LEU A 1 63  ? 39.481  37.709  56.726 1.00 117.15 ? 63   LEU A C   1 
ATOM   298  O O   . LEU A 1 63  ? 40.616  37.895  57.160 1.00 119.11 ? 63   LEU A O   1 
ATOM   299  C CB  . LEU A 1 63  ? 37.915  35.881  57.390 1.00 102.09 ? 63   LEU A CB  1 
ATOM   300  C CG  . LEU A 1 63  ? 37.066  35.209  58.470 1.00 96.28  ? 63   LEU A CG  1 
ATOM   301  C CD1 . LEU A 1 63  ? 36.579  33.854  57.987 1.00 89.87  ? 63   LEU A CD1 1 
ATOM   302  C CD2 . LEU A 1 63  ? 37.856  35.080  59.763 1.00 95.61  ? 63   LEU A CD2 1 
ATOM   303  N N   . PHE A 1 64  ? 39.172  37.832  55.441 1.00 126.61 ? 64   PHE A N   1 
ATOM   304  C CA  . PHE A 1 64  ? 40.180  38.211  54.459 1.00 131.84 ? 64   PHE A CA  1 
ATOM   305  C C   . PHE A 1 64  ? 40.820  39.556  54.780 1.00 140.11 ? 64   PHE A C   1 
ATOM   306  O O   . PHE A 1 64  ? 42.041  39.681  54.754 1.00 143.18 ? 64   PHE A O   1 
ATOM   307  C CB  . PHE A 1 64  ? 39.608  38.198  53.040 1.00 134.27 ? 64   PHE A CB  1 
ATOM   308  C CG  . PHE A 1 64  ? 39.920  36.942  52.276 1.00 123.54 ? 64   PHE A CG  1 
ATOM   309  C CD1 . PHE A 1 64  ? 39.041  35.870  52.274 1.00 112.60 ? 64   PHE A CD1 1 
ATOM   310  C CD2 . PHE A 1 64  ? 41.107  36.828  51.570 1.00 122.36 ? 64   PHE A CD2 1 
ATOM   311  C CE1 . PHE A 1 64  ? 39.338  34.710  51.571 1.00 101.25 ? 64   PHE A CE1 1 
ATOM   312  C CE2 . PHE A 1 64  ? 41.409  35.673  50.866 1.00 110.57 ? 64   PHE A CE2 1 
ATOM   313  C CZ  . PHE A 1 64  ? 40.524  34.613  50.866 1.00 100.23 ? 64   PHE A CZ  1 
ATOM   314  N N   . ALA A 1 65  ? 39.999  40.555  55.086 1.00 126.86 ? 65   ALA A N   1 
ATOM   315  C CA  . ALA A 1 65  ? 40.515  41.852  55.510 1.00 130.70 ? 65   ALA A CA  1 
ATOM   316  C C   . ALA A 1 65  ? 41.605  41.675  56.565 1.00 130.58 ? 65   ALA A C   1 
ATOM   317  O O   . ALA A 1 65  ? 42.715  42.180  56.410 1.00 135.05 ? 65   ALA A O   1 
ATOM   318  C CB  . ALA A 1 65  ? 39.391  42.727  56.045 1.00 129.82 ? 65   ALA A CB  1 
ATOM   319  N N   . LEU A 1 66  ? 41.282  40.952  57.633 1.00 148.12 ? 66   LEU A N   1 
ATOM   320  C CA  . LEU A 1 66  ? 42.249  40.662  58.688 1.00 148.61 ? 66   LEU A CA  1 
ATOM   321  C C   . LEU A 1 66  ? 43.532  40.079  58.122 1.00 150.92 ? 66   LEU A C   1 
ATOM   322  O O   . LEU A 1 66  ? 44.626  40.495  58.494 1.00 154.84 ? 66   LEU A O   1 
ATOM   323  C CB  . LEU A 1 66  ? 41.658  39.700  59.717 1.00 143.80 ? 66   LEU A CB  1 
ATOM   324  C CG  . LEU A 1 66  ? 40.918  40.345  60.886 1.00 143.29 ? 66   LEU A CG  1 
ATOM   325  C CD1 . LEU A 1 66  ? 39.957  41.405  60.385 1.00 143.94 ? 66   LEU A CD1 1 
ATOM   326  C CD2 . LEU A 1 66  ? 40.192  39.294  61.709 1.00 138.65 ? 66   LEU A CD2 1 
ATOM   327  N N   . ALA A 1 67  ? 43.392  39.105  57.232 1.00 139.75 ? 67   ALA A N   1 
ATOM   328  C CA  . ALA A 1 67  ? 44.543  38.528  56.556 1.00 137.43 ? 67   ALA A CA  1 
ATOM   329  C C   . ALA A 1 67  ? 45.406  39.633  55.959 1.00 148.21 ? 67   ALA A C   1 
ATOM   330  O O   . ALA A 1 67  ? 46.630  39.624  56.098 1.00 149.87 ? 67   ALA A O   1 
ATOM   331  C CB  . ALA A 1 67  ? 44.089  37.566  55.477 1.00 130.69 ? 67   ALA A CB  1 
ATOM   332  N N   . TYR A 1 68  ? 44.761  40.593  55.304 1.00 126.71 ? 68   TYR A N   1 
ATOM   333  C CA  . TYR A 1 68  ? 45.478  41.719  54.714 1.00 133.10 ? 68   TYR A CA  1 
ATOM   334  C C   . TYR A 1 68  ? 46.188  42.560  55.763 1.00 135.56 ? 68   TYR A C   1 
ATOM   335  O O   . TYR A 1 68  ? 47.409  42.692  55.742 1.00 139.61 ? 68   TYR A O   1 
ATOM   336  C CB  . TYR A 1 68  ? 44.544  42.573  53.857 1.00 135.27 ? 68   TYR A CB  1 
ATOM   337  C CG  . TYR A 1 68  ? 44.245  41.923  52.531 1.00 136.28 ? 68   TYR A CG  1 
ATOM   338  C CD1 . TYR A 1 68  ? 42.955  41.550  52.192 1.00 133.30 ? 68   TYR A CD1 1 
ATOM   339  C CD2 . TYR A 1 68  ? 45.268  41.647  51.632 1.00 140.81 ? 68   TYR A CD2 1 
ATOM   340  C CE1 . TYR A 1 68  ? 42.689  40.943  50.988 1.00 135.25 ? 68   TYR A CE1 1 
ATOM   341  C CE2 . TYR A 1 68  ? 45.010  41.039  50.427 1.00 142.74 ? 68   TYR A CE2 1 
ATOM   342  C CZ  . TYR A 1 68  ? 43.720  40.690  50.110 1.00 140.13 ? 68   TYR A CZ  1 
ATOM   343  O OH  . TYR A 1 68  ? 43.458  40.082  48.908 1.00 135.75 ? 68   TYR A OH  1 
ATOM   344  N N   . LEU A 1 69  ? 45.421  43.107  56.694 1.00 154.75 ? 69   LEU A N   1 
ATOM   345  C CA  . LEU A 1 69  ? 45.997  43.844  57.801 1.00 157.55 ? 69   LEU A CA  1 
ATOM   346  C C   . LEU A 1 69  ? 47.135  43.059  58.420 1.00 158.14 ? 69   LEU A C   1 
ATOM   347  O O   . LEU A 1 69  ? 48.200  43.603  58.695 1.00 163.23 ? 69   LEU A O   1 
ATOM   348  C CB  . LEU A 1 69  ? 44.935  44.102  58.858 1.00 154.49 ? 69   LEU A CB  1 
ATOM   349  C CG  . LEU A 1 69  ? 43.844  45.043  58.372 1.00 154.76 ? 69   LEU A CG  1 
ATOM   350  C CD1 . LEU A 1 69  ? 42.977  45.488  59.528 1.00 153.10 ? 69   LEU A CD1 1 
ATOM   351  C CD2 . LEU A 1 69  ? 44.495  46.231  57.702 1.00 161.29 ? 69   LEU A CD2 1 
ATOM   352  N N   . ALA A 1 70  ? 46.899  41.773  58.644 1.00 151.70 ? 70   ALA A N   1 
ATOM   353  C CA  . ALA A 1 70  ? 47.890  40.915  59.272 1.00 152.10 ? 70   ALA A CA  1 
ATOM   354  C C   . ALA A 1 70  ? 49.256  41.106  58.632 1.00 157.43 ? 70   ALA A C   1 
ATOM   355  O O   . ALA A 1 70  ? 50.266  41.175  59.326 1.00 161.08 ? 70   ALA A O   1 
ATOM   356  C CB  . ALA A 1 70  ? 47.466  39.472  59.179 1.00 142.43 ? 70   ALA A CB  1 
ATOM   357  N N   . CYS A 1 71  ? 49.283  41.187  57.306 1.00 162.51 ? 71   CYS A N   1 
ATOM   358  C CA  . CYS A 1 71  ? 50.514  41.492  56.586 1.00 168.27 ? 71   CYS A CA  1 
ATOM   359  C C   . CYS A 1 71  ? 50.965  42.916  56.890 1.00 173.85 ? 71   CYS A C   1 
ATOM   360  O O   . CYS A 1 71  ? 52.151  43.187  57.041 1.00 178.86 ? 71   CYS A O   1 
ATOM   361  C CB  . CYS A 1 71  ? 50.321  41.294  55.082 1.00 169.09 ? 71   CYS A CB  1 
ATOM   362  S SG  . CYS A 1 71  ? 49.910  39.602  54.620 1.00 153.17 ? 71   CYS A SG  1 
ATOM   363  N N   . GLY A 1 72  ? 50.002  43.825  56.973 1.00 205.52 ? 72   GLY A N   1 
ATOM   364  C CA  . GLY A 1 72  ? 50.270  45.187  57.385 1.00 215.84 ? 72   GLY A CA  1 
ATOM   365  C C   . GLY A 1 72  ? 50.519  46.130  56.228 1.00 220.59 ? 72   GLY A C   1 
ATOM   366  O O   . GLY A 1 72  ? 51.538  46.034  55.550 1.00 219.80 ? 72   GLY A O   1 
ATOM   367  N N   . ASP A 1 73  ? 49.576  47.036  55.994 1.00 190.78 ? 73   ASP A N   1 
ATOM   368  C CA  . ASP A 1 73  ? 49.769  48.116  55.032 1.00 197.83 ? 73   ASP A CA  1 
ATOM   369  C C   . ASP A 1 73  ? 50.181  47.618  53.654 1.00 192.01 ? 73   ASP A C   1 
ATOM   370  O O   . ASP A 1 73  ? 51.131  48.127  53.065 1.00 194.29 ? 73   ASP A O   1 
ATOM   371  C CB  . ASP A 1 73  ? 50.835  49.085  55.544 1.00 208.15 ? 73   ASP A CB  1 
ATOM   372  C CG  . ASP A 1 73  ? 50.432  49.773  56.829 1.00 215.92 ? 73   ASP A CG  1 
ATOM   373  O OD1 . ASP A 1 73  ? 49.284  49.584  57.277 1.00 213.59 ? 73   ASP A OD1 1 
ATOM   374  O OD2 . ASP A 1 73  ? 51.269  50.508  57.390 1.00 224.92 ? 73   ASP A OD2 1 
ATOM   375  N N   . VAL A 1 74  ? 49.471  46.625  53.139 1.00 148.89 ? 74   VAL A N   1 
ATOM   376  C CA  . VAL A 1 74  ? 49.821  46.063  51.844 1.00 143.13 ? 74   VAL A CA  1 
ATOM   377  C C   . VAL A 1 74  ? 48.846  46.454  50.749 1.00 144.02 ? 74   VAL A C   1 
ATOM   378  O O   . VAL A 1 74  ? 48.843  45.858  49.677 1.00 135.50 ? 74   VAL A O   1 
ATOM   379  C CB  . VAL A 1 74  ? 49.933  44.530  51.898 1.00 132.10 ? 74   VAL A CB  1 
ATOM   380  C CG1 . VAL A 1 74  ? 51.379  44.114  52.053 1.00 130.65 ? 74   VAL A CG1 1 
ATOM   381  C CG2 . VAL A 1 74  ? 49.090  43.974  53.026 1.00 129.60 ? 74   VAL A CG2 1 
ATOM   382  N N   . ILE A 1 75  ? 48.020  47.455  51.016 1.00 137.25 ? 75   ILE A N   1 
ATOM   383  C CA  . ILE A 1 75  ? 47.072  47.910  50.013 1.00 137.72 ? 75   ILE A CA  1 
ATOM   384  C C   . ILE A 1 75  ? 47.216  49.387  49.699 1.00 142.98 ? 75   ILE A C   1 
ATOM   385  O O   . ILE A 1 75  ? 47.106  50.243  50.572 1.00 130.72 ? 75   ILE A O   1 
ATOM   386  C CB  . ILE A 1 75  ? 45.628  47.604  50.411 1.00 136.48 ? 75   ILE A CB  1 
ATOM   387  C CG1 . ILE A 1 75  ? 45.408  46.095  50.419 1.00 131.64 ? 75   ILE A CG1 1 
ATOM   388  C CG2 . ILE A 1 75  ? 44.661  48.271  49.447 1.00 140.78 ? 75   ILE A CG2 1 
ATOM   389  C CD1 . ILE A 1 75  ? 44.212  45.681  51.215 1.00 129.90 ? 75   ILE A CD1 1 
ATOM   390  N N   . GLU A 1 76  ? 47.467  49.665  48.428 1.00 174.91 ? 76   GLU A N   1 
ATOM   391  C CA  . GLU A 1 76  ? 47.554  51.022  47.935 1.00 180.00 ? 76   GLU A CA  1 
ATOM   392  C C   . GLU A 1 76  ? 46.377  51.846  48.433 1.00 191.05 ? 76   GLU A C   1 
ATOM   393  O O   . GLU A 1 76  ? 45.252  51.355  48.513 1.00 191.82 ? 76   GLU A O   1 
ATOM   394  C CB  . GLU A 1 76  ? 47.558  51.016  46.408 1.00 171.90 ? 76   GLU A CB  1 
ATOM   395  C CG  . GLU A 1 76  ? 48.124  52.276  45.802 1.00 170.42 ? 76   GLU A CG  1 
ATOM   396  C CD  . GLU A 1 76  ? 49.548  52.525  46.252 1.00 167.76 ? 76   GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 76  ? 50.372  51.593  46.140 1.00 162.34 ? 76   GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 76  ? 49.844  53.645  46.720 1.00 171.41 ? 76   GLU A OE2 1 
ATOM   399  N N   . ASN A 1 77  ? 46.648  53.099  48.775 1.00 141.46 ? 77   ASN A N   1 
ATOM   400  C CA  . ASN A 1 77  ? 45.599  54.055  49.116 1.00 135.85 ? 77   ASN A CA  1 
ATOM   401  C C   . ASN A 1 77  ? 44.655  53.606  50.225 1.00 136.41 ? 77   ASN A C   1 
ATOM   402  O O   . ASN A 1 77  ? 43.494  54.012  50.265 1.00 142.83 ? 77   ASN A O   1 
ATOM   403  C CB  . ASN A 1 77  ? 44.803  54.423  47.867 1.00 135.36 ? 77   ASN A CB  1 
ATOM   404  C CG  . ASN A 1 77  ? 45.588  55.303  46.923 1.00 138.99 ? 77   ASN A CG  1 
ATOM   405  O OD1 . ASN A 1 77  ? 45.821  56.479  47.205 1.00 142.30 ? 77   ASN A OD1 1 
ATOM   406  N ND2 . ASN A 1 77  ? 46.003  54.741  45.795 1.00 135.46 ? 77   ASN A ND2 1 
ATOM   407  N N   . ALA A 1 78  ? 45.157  52.771  51.124 1.00 207.54 ? 78   ALA A N   1 
ATOM   408  C CA  . ALA A 1 78  ? 44.376  52.343  52.271 1.00 209.42 ? 78   ALA A CA  1 
ATOM   409  C C   . ALA A 1 78  ? 44.854  53.089  53.505 1.00 218.22 ? 78   ALA A C   1 
ATOM   410  O O   . ALA A 1 78  ? 46.052  53.142  53.780 1.00 220.18 ? 78   ALA A O   1 
ATOM   411  C CB  . ALA A 1 78  ? 44.509  50.844  52.474 1.00 196.09 ? 78   ALA A CB  1 
ATOM   412  N N   . ARG A 1 79  ? 43.919  53.684  54.237 1.00 149.80 ? 79   ARG A N   1 
ATOM   413  C CA  . ARG A 1 79  ? 44.256  54.281  55.516 1.00 157.69 ? 79   ARG A CA  1 
ATOM   414  C C   . ARG A 1 79  ? 44.968  53.219  56.337 1.00 149.09 ? 79   ARG A C   1 
ATOM   415  O O   . ARG A 1 79  ? 44.472  52.102  56.471 1.00 147.30 ? 79   ARG A O   1 
ATOM   416  C CB  . ARG A 1 79  ? 43.000  54.780  56.231 1.00 162.85 ? 79   ARG A CB  1 
ATOM   417  C CG  . ARG A 1 79  ? 42.261  55.860  55.461 1.00 172.21 ? 79   ARG A CG  1 
ATOM   418  C CD  . ARG A 1 79  ? 41.215  56.553  56.315 1.00 180.07 ? 79   ARG A CD  1 
ATOM   419  N NE  . ARG A 1 79  ? 39.972  55.792  56.400 1.00 172.32 ? 79   ARG A NE  1 
ATOM   420  C CZ  . ARG A 1 79  ? 39.660  54.974  57.401 1.00 166.00 ? 79   ARG A CZ  1 
ATOM   421  N NH1 . ARG A 1 79  ? 40.503  54.804  58.413 1.00 165.96 ? 79   ARG A NH1 1 
ATOM   422  N NH2 . ARG A 1 79  ? 38.503  54.323  57.392 1.00 160.42 ? 79   ARG A NH2 1 
ATOM   423  N N   . PRO A 1 80  ? 46.155  53.556  56.858 1.00 158.26 ? 80   PRO A N   1 
ATOM   424  C CA  . PRO A 1 80  ? 46.983  52.616  57.619 1.00 151.39 ? 80   PRO A CA  1 
ATOM   425  C C   . PRO A 1 80  ? 46.203  51.910  58.725 1.00 146.22 ? 80   PRO A C   1 
ATOM   426  O O   . PRO A 1 80  ? 45.486  52.554  59.490 1.00 153.02 ? 80   PRO A O   1 
ATOM   427  C CB  . PRO A 1 80  ? 48.065  53.519  58.213 1.00 162.51 ? 80   PRO A CB  1 
ATOM   428  C CG  . PRO A 1 80  ? 48.201  54.617  57.219 1.00 172.06 ? 80   PRO A CG  1 
ATOM   429  C CD  . PRO A 1 80  ? 46.811  54.865  56.699 1.00 171.94 ? 80   PRO A CD  1 
ATOM   430  N N   . GLY A 1 81  ? 46.342  50.589  58.786 1.00 260.08 ? 81   GLY A N   1 
ATOM   431  C CA  . GLY A 1 81  ? 45.692  49.782  59.802 1.00 255.17 ? 81   GLY A CA  1 
ATOM   432  C C   . GLY A 1 81  ? 44.219  50.081  60.012 1.00 257.72 ? 81   GLY A C   1 
ATOM   433  O O   . GLY A 1 81  ? 43.754  50.124  61.151 1.00 260.74 ? 81   GLY A O   1 
ATOM   434  N N   . SER A 1 82  ? 43.478  50.289  58.926 1.00 133.48 ? 82   SER A N   1 
ATOM   435  C CA  . SER A 1 82  ? 42.035  50.498  59.037 1.00 131.85 ? 82   SER A CA  1 
ATOM   436  C C   . SER A 1 82  ? 41.271  49.334  58.428 1.00 129.82 ? 82   SER A C   1 
ATOM   437  O O   . SER A 1 82  ? 41.408  49.027  57.242 1.00 129.91 ? 82   SER A O   1 
ATOM   438  C CB  . SER A 1 82  ? 41.596  51.807  58.384 1.00 133.29 ? 82   SER A CB  1 
ATOM   439  O OG  . SER A 1 82  ? 40.895  51.562  57.176 1.00 131.55 ? 82   SER A OG  1 
ATOM   440  N N   . PHE A 1 83  ? 40.460  48.694  59.260 1.00 154.98 ? 83   PHE A N   1 
ATOM   441  C CA  . PHE A 1 83  ? 39.719  47.508  58.866 1.00 153.60 ? 83   PHE A CA  1 
ATOM   442  C C   . PHE A 1 83  ? 38.737  47.789  57.738 1.00 153.20 ? 83   PHE A C   1 
ATOM   443  O O   . PHE A 1 83  ? 38.631  47.008  56.795 1.00 153.43 ? 83   PHE A O   1 
ATOM   444  C CB  . PHE A 1 83  ? 38.963  46.943  60.066 1.00 152.91 ? 83   PHE A CB  1 
ATOM   445  C CG  . PHE A 1 83  ? 38.081  45.781  59.728 1.00 151.80 ? 83   PHE A CG  1 
ATOM   446  C CD1 . PHE A 1 83  ? 38.626  44.539  59.455 1.00 152.61 ? 83   PHE A CD1 1 
ATOM   447  C CD2 . PHE A 1 83  ? 36.704  45.930  59.678 1.00 152.23 ? 83   PHE A CD2 1 
ATOM   448  C CE1 . PHE A 1 83  ? 37.814  43.466  59.140 1.00 152.62 ? 83   PHE A CE1 1 
ATOM   449  C CE2 . PHE A 1 83  ? 35.886  44.863  59.366 1.00 151.33 ? 83   PHE A CE2 1 
ATOM   450  C CZ  . PHE A 1 83  ? 36.442  43.627  59.097 1.00 151.31 ? 83   PHE A CZ  1 
ATOM   451  N N   . THR A 1 84  ? 38.015  48.900  57.844 1.00 151.59 ? 84   THR A N   1 
ATOM   452  C CA  . THR A 1 84  ? 37.046  49.280  56.825 1.00 152.32 ? 84   THR A CA  1 
ATOM   453  C C   . THR A 1 84  ? 37.698  49.196  55.457 1.00 152.23 ? 84   THR A C   1 
ATOM   454  O O   . THR A 1 84  ? 37.293  48.405  54.608 1.00 152.91 ? 84   THR A O   1 
ATOM   455  C CB  . THR A 1 84  ? 36.559  50.718  57.030 1.00 155.16 ? 84   THR A CB  1 
ATOM   456  O OG1 . THR A 1 84  ? 36.224  50.920  58.406 1.00 156.66 ? 84   THR A OG1 1 
ATOM   457  C CG2 . THR A 1 84  ? 35.339  50.996  56.165 1.00 156.24 ? 84   THR A CG2 1 
ATOM   458  N N   . ASP A 1 85  ? 38.714  50.026  55.252 1.00 159.77 ? 85   ASP A N   1 
ATOM   459  C CA  . ASP A 1 85  ? 39.443  50.044  53.993 1.00 161.71 ? 85   ASP A CA  1 
ATOM   460  C C   . ASP A 1 85  ? 39.783  48.629  53.528 1.00 162.74 ? 85   ASP A C   1 
ATOM   461  O O   . ASP A 1 85  ? 39.487  48.251  52.394 1.00 165.30 ? 85   ASP A O   1 
ATOM   462  C CB  . ASP A 1 85  ? 40.712  50.890  54.125 1.00 162.92 ? 85   ASP A CB  1 
ATOM   463  C CG  . ASP A 1 85  ? 40.410  52.360  54.349 1.00 163.79 ? 85   ASP A CG  1 
ATOM   464  O OD1 . ASP A 1 85  ? 39.348  52.666  54.934 1.00 162.83 ? 85   ASP A OD1 1 
ATOM   465  O OD2 . ASP A 1 85  ? 41.230  53.210  53.940 1.00 165.80 ? 85   ASP A OD2 1 
ATOM   466  N N   . ALA A 1 86  ? 40.394  47.847  54.412 1.00 181.32 ? 86   ALA A N   1 
ATOM   467  C CA  . ALA A 1 86  ? 40.755  46.470  54.093 1.00 183.11 ? 86   ALA A CA  1 
ATOM   468  C C   . ALA A 1 86  ? 39.528  45.648  53.705 1.00 183.15 ? 86   ALA A C   1 
ATOM   469  O O   . ALA A 1 86  ? 39.538  44.940  52.699 1.00 186.46 ? 86   ALA A O   1 
ATOM   470  C CB  . ALA A 1 86  ? 41.482  45.828  55.264 1.00 182.31 ? 86   ALA A CB  1 
ATOM   471  N N   . PHE A 1 87  ? 38.475  45.746  54.511 1.00 104.70 ? 87   PHE A N   1 
ATOM   472  C CA  . PHE A 1 87  ? 37.231  45.032  54.249 1.00 104.83 ? 87   PHE A CA  1 
ATOM   473  C C   . PHE A 1 87  ? 36.685  45.349  52.861 1.00 105.52 ? 87   PHE A C   1 
ATOM   474  O O   . PHE A 1 87  ? 36.484  44.450  52.042 1.00 108.85 ? 87   PHE A O   1 
ATOM   475  C CB  . PHE A 1 87  ? 36.183  45.379  55.305 1.00 105.36 ? 87   PHE A CB  1 
ATOM   476  C CG  . PHE A 1 87  ? 34.831  44.786  55.028 1.00 102.56 ? 87   PHE A CG  1 
ATOM   477  C CD1 . PHE A 1 87  ? 34.530  43.489  55.431 1.00 102.50 ? 87   PHE A CD1 1 
ATOM   478  C CD2 . PHE A 1 87  ? 33.860  45.517  54.358 1.00 103.80 ? 87   PHE A CD2 1 
ATOM   479  C CE1 . PHE A 1 87  ? 33.284  42.934  55.176 1.00 103.66 ? 87   PHE A CE1 1 
ATOM   480  C CE2 . PHE A 1 87  ? 32.609  44.966  54.099 1.00 102.90 ? 87   PHE A CE2 1 
ATOM   481  C CZ  . PHE A 1 87  ? 32.322  43.674  54.510 1.00 102.83 ? 87   PHE A CZ  1 
ATOM   482  N N   . PHE A 1 88  ? 36.440  46.631  52.603 1.00 140.97 ? 88   PHE A N   1 
ATOM   483  C CA  . PHE A 1 88  ? 35.928  47.057  51.306 1.00 144.39 ? 88   PHE A CA  1 
ATOM   484  C C   . PHE A 1 88  ? 36.846  46.649  50.168 1.00 149.17 ? 88   PHE A C   1 
ATOM   485  O O   . PHE A 1 88  ? 36.375  46.232  49.119 1.00 149.84 ? 88   PHE A O   1 
ATOM   486  C CB  . PHE A 1 88  ? 35.671  48.562  51.275 1.00 143.88 ? 88   PHE A CB  1 
ATOM   487  C CG  . PHE A 1 88  ? 34.412  48.964  51.976 1.00 142.48 ? 88   PHE A CG  1 
ATOM   488  C CD1 . PHE A 1 88  ? 34.459  49.708  53.139 1.00 140.57 ? 88   PHE A CD1 1 
ATOM   489  C CD2 . PHE A 1 88  ? 33.179  48.579  51.480 1.00 144.25 ? 88   PHE A CD2 1 
ATOM   490  C CE1 . PHE A 1 88  ? 33.300  50.075  53.790 1.00 141.96 ? 88   PHE A CE1 1 
ATOM   491  C CE2 . PHE A 1 88  ? 32.014  48.938  52.128 1.00 144.63 ? 88   PHE A CE2 1 
ATOM   492  C CZ  . PHE A 1 88  ? 32.074  49.690  53.284 1.00 143.70 ? 88   PHE A CZ  1 
ATOM   493  N N   . PHE A 1 89  ? 38.154  46.760  50.371 1.00 99.54  ? 89   PHE A N   1 
ATOM   494  C CA  . PHE A 1 89  ? 39.089  46.258  49.375 1.00 103.39 ? 89   PHE A CA  1 
ATOM   495  C C   . PHE A 1 89  ? 38.812  44.787  49.116 1.00 105.43 ? 89   PHE A C   1 
ATOM   496  O O   . PHE A 1 89  ? 38.728  44.342  47.971 1.00 105.90 ? 89   PHE A O   1 
ATOM   497  C CB  . PHE A 1 89  ? 40.532  46.412  49.834 1.00 102.84 ? 89   PHE A CB  1 
ATOM   498  C CG  . PHE A 1 89  ? 41.508  45.706  48.947 1.00 108.39 ? 89   PHE A CG  1 
ATOM   499  C CD1 . PHE A 1 89  ? 41.696  46.125  47.642 1.00 112.52 ? 89   PHE A CD1 1 
ATOM   500  C CD2 . PHE A 1 89  ? 42.212  44.605  49.401 1.00 108.87 ? 89   PHE A CD2 1 
ATOM   501  C CE1 . PHE A 1 89  ? 42.586  45.475  46.812 1.00 116.04 ? 89   PHE A CE1 1 
ATOM   502  C CE2 . PHE A 1 89  ? 43.111  43.951  48.578 1.00 114.76 ? 89   PHE A CE2 1 
ATOM   503  C CZ  . PHE A 1 89  ? 43.296  44.386  47.280 1.00 119.12 ? 89   PHE A CZ  1 
ATOM   504  N N   . SER A 1 90  ? 38.673  44.035  50.200 1.00 183.71 ? 90   SER A N   1 
ATOM   505  C CA  . SER A 1 90  ? 38.418  42.610  50.116 1.00 186.21 ? 90   SER A CA  1 
ATOM   506  C C   . SER A 1 90  ? 37.179  42.301  49.287 1.00 184.85 ? 90   SER A C   1 
ATOM   507  O O   . SER A 1 90  ? 37.179  41.354  48.508 1.00 184.35 ? 90   SER A O   1 
ATOM   508  C CB  . SER A 1 90  ? 38.279  42.012  51.513 1.00 181.88 ? 90   SER A CB  1 
ATOM   509  O OG  . SER A 1 90  ? 37.553  40.800  51.466 1.00 183.84 ? 90   SER A OG  1 
ATOM   510  N N   . VAL A 1 91  ? 36.118  43.084  49.444 1.00 145.46 ? 91   VAL A N   1 
ATOM   511  C CA  . VAL A 1 91  ? 34.934  42.834  48.628 1.00 138.39 ? 91   VAL A CA  1 
ATOM   512  C C   . VAL A 1 91  ? 35.236  43.148  47.161 1.00 135.69 ? 91   VAL A C   1 
ATOM   513  O O   . VAL A 1 91  ? 34.994  42.317  46.289 1.00 133.13 ? 91   VAL A O   1 
ATOM   514  C CB  . VAL A 1 91  ? 33.656  43.574  49.122 1.00 134.63 ? 91   VAL A CB  1 
ATOM   515  C CG1 . VAL A 1 91  ? 33.609  43.615  50.640 1.00 139.25 ? 91   VAL A CG1 1 
ATOM   516  C CG2 . VAL A 1 91  ? 33.566  44.970  48.540 1.00 132.67 ? 91   VAL A CG2 1 
ATOM   517  N N   . GLN A 1 92  ? 35.794  44.328  46.895 1.00 154.53 ? 92   GLN A N   1 
ATOM   518  C CA  . GLN A 1 92  ? 36.124  44.721  45.528 1.00 152.66 ? 92   GLN A CA  1 
ATOM   519  C C   . GLN A 1 92  ? 36.979  43.659  44.886 1.00 155.03 ? 92   GLN A C   1 
ATOM   520  O O   . GLN A 1 92  ? 36.908  43.435  43.681 1.00 152.79 ? 92   GLN A O   1 
ATOM   521  C CB  . GLN A 1 92  ? 36.894  46.035  45.500 1.00 155.72 ? 92   GLN A CB  1 
ATOM   522  C CG  . GLN A 1 92  ? 36.514  46.978  46.600 1.00 157.12 ? 92   GLN A CG  1 
ATOM   523  C CD  . GLN A 1 92  ? 36.646  48.418  46.192 1.00 156.94 ? 92   GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 92  ? 37.530  48.778  45.415 1.00 158.78 ? 92   GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 92  ? 35.761  49.260  46.712 1.00 155.03 ? 92   GLN A NE2 1 
ATOM   526  N N   . THR A 1 93  ? 37.802  43.012  45.699 1.00 113.84 ? 93   THR A N   1 
ATOM   527  C CA  . THR A 1 93  ? 38.686  41.979  45.196 1.00 112.24 ? 93   THR A CA  1 
ATOM   528  C C   . THR A 1 93  ? 37.922  40.667  44.978 1.00 114.21 ? 93   THR A C   1 
ATOM   529  O O   . THR A 1 93  ? 38.017  40.063  43.911 1.00 113.28 ? 93   THR A O   1 
ATOM   530  C CB  . THR A 1 93  ? 39.887  41.767  46.135 1.00 120.26 ? 93   THR A CB  1 
ATOM   531  O OG1 . THR A 1 93  ? 41.034  41.380  45.372 1.00 124.50 ? 93   THR A OG1 1 
ATOM   532  C CG2 . THR A 1 93  ? 39.585  40.704  47.158 1.00 121.89 ? 93   THR A CG2 1 
ATOM   533  N N   . MET A 1 94  ? 37.145  40.240  45.970 1.00 143.00 ? 94   MET A N   1 
ATOM   534  C CA  . MET A 1 94  ? 36.458  38.952  45.886 1.00 140.92 ? 94   MET A CA  1 
ATOM   535  C C   . MET A 1 94  ? 35.283  38.945  44.909 1.00 134.65 ? 94   MET A C   1 
ATOM   536  O O   . MET A 1 94  ? 34.977  37.917  44.312 1.00 133.80 ? 94   MET A O   1 
ATOM   537  C CB  . MET A 1 94  ? 35.989  38.475  47.261 1.00 142.26 ? 94   MET A CB  1 
ATOM   538  C CG  . MET A 1 94  ? 35.228  37.158  47.204 1.00 139.95 ? 94   MET A CG  1 
ATOM   539  S SD  . MET A 1 94  ? 34.377  36.771  48.737 1.00 140.54 ? 94   MET A SD  1 
ATOM   540  C CE  . MET A 1 94  ? 33.615  38.354  49.060 1.00 137.45 ? 94   MET A CE  1 
ATOM   541  N N   . ALA A 1 95  ? 34.613  40.081  44.763 1.00 102.29 ? 95   ALA A N   1 
ATOM   542  C CA  . ALA A 1 95  ? 33.532  40.201  43.796 1.00 115.19 ? 95   ALA A CA  1 
ATOM   543  C C   . ALA A 1 95  ? 34.162  40.538  42.463 1.00 115.81 ? 95   ALA A C   1 
ATOM   544  O O   . ALA A 1 95  ? 33.493  40.641  41.437 1.00 113.30 ? 95   ALA A O   1 
ATOM   545  C CB  . ALA A 1 95  ? 32.574  41.286  44.217 1.00 111.84 ? 95   ALA A CB  1 
ATOM   546  N N   . THR A 1 96  ? 35.474  40.728  42.511 1.00 136.30 ? 96   THR A N   1 
ATOM   547  C CA  . THR A 1 96  ? 36.267  41.060  41.342 1.00 137.99 ? 96   THR A CA  1 
ATOM   548  C C   . THR A 1 96  ? 35.801  42.335  40.634 1.00 135.14 ? 96   THR A C   1 
ATOM   549  O O   . THR A 1 96  ? 35.922  42.424  39.431 1.00 135.31 ? 96   THR A O   1 
ATOM   550  C CB  . THR A 1 96  ? 36.289  39.892  40.339 1.00 138.97 ? 96   THR A CB  1 
ATOM   551  O OG1 . THR A 1 96  ? 35.018  39.809  39.697 1.00 134.73 ? 96   THR A OG1 1 
ATOM   552  C CG2 . THR A 1 96  ? 36.555  38.572  41.052 1.00 141.31 ? 96   THR A CG2 1 
ATOM   553  N N   . ILE A 1 97  ? 35.281  43.318  41.366 1.00 156.23 ? 97   ILE A N   1 
ATOM   554  C CA  . ILE A 1 97  ? 34.999  44.614  40.754 1.00 154.55 ? 97   ILE A CA  1 
ATOM   555  C C   . ILE A 1 97  ? 36.332  45.271  40.448 1.00 158.52 ? 97   ILE A C   1 
ATOM   556  O O   . ILE A 1 97  ? 36.506  45.900  39.407 1.00 158.55 ? 97   ILE A O   1 
ATOM   557  C CB  . ILE A 1 97  ? 34.199  45.541  41.676 1.00 152.28 ? 97   ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 97  ? 33.018  44.793  42.291 1.00 149.30 ? 97   ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 97  ? 33.727  46.773  40.913 1.00 150.39 ? 97   ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 97  ? 32.409  45.503  43.467 1.00 148.51 ? 97   ILE A CD1 1 
ATOM   561  N N   . GLY A 1 98  ? 37.271  45.113  41.373 1.00 196.49 ? 98   GLY A N   1 
ATOM   562  C CA  . GLY A 1 98  ? 38.615  45.628  41.209 1.00 201.42 ? 98   GLY A CA  1 
ATOM   563  C C   . GLY A 1 98  ? 38.643  47.051  40.703 1.00 200.89 ? 98   GLY A C   1 
ATOM   564  O O   . GLY A 1 98  ? 39.216  47.308  39.659 1.00 202.32 ? 98   GLY A O   1 
ATOM   565  N N   . TYR A 1 99  ? 38.032  47.970  41.448 1.00 161.57 ? 99   TYR A N   1 
ATOM   566  C CA  . TYR A 1 99  ? 37.982  49.377  41.057 1.00 161.12 ? 99   TYR A CA  1 
ATOM   567  C C   . TYR A 1 99  ? 39.339  49.932  40.652 1.00 166.23 ? 99   TYR A C   1 
ATOM   568  O O   . TYR A 1 99  ? 39.480  50.471  39.561 1.00 165.92 ? 99   TYR A O   1 
ATOM   569  C CB  . TYR A 1 99  ? 37.417  50.236  42.183 1.00 160.66 ? 99   TYR A CB  1 
ATOM   570  C CG  . TYR A 1 99  ? 35.910  50.248  42.267 1.00 155.31 ? 99   TYR A CG  1 
ATOM   571  C CD1 . TYR A 1 99  ? 35.265  50.070  43.483 1.00 154.75 ? 99   TYR A CD1 1 
ATOM   572  C CD2 . TYR A 1 99  ? 35.132  50.436  41.134 1.00 151.66 ? 99   TYR A CD2 1 
ATOM   573  C CE1 . TYR A 1 99  ? 33.886  50.081  43.572 1.00 150.38 ? 99   TYR A CE1 1 
ATOM   574  C CE2 . TYR A 1 99  ? 33.747  50.447  41.212 1.00 147.60 ? 99   TYR A CE2 1 
ATOM   575  C CZ  . TYR A 1 99  ? 33.131  50.269  42.435 1.00 146.81 ? 99   TYR A CZ  1 
ATOM   576  O OH  . TYR A 1 99  ? 31.757  50.278  42.527 1.00 143.22 ? 99   TYR A OH  1 
ATOM   577  N N   . GLY A 1 100 ? 40.325  49.846  41.541 1.00 138.44 ? 100  GLY A N   1 
ATOM   578  C CA  . GLY A 1 100 ? 41.669  50.277  41.192 1.00 144.36 ? 100  GLY A CA  1 
ATOM   579  C C   . GLY A 1 100 ? 42.340  51.302  42.093 1.00 149.64 ? 100  GLY A C   1 
ATOM   580  O O   . GLY A 1 100 ? 43.513  51.623  41.898 1.00 155.33 ? 100  GLY A O   1 
ATOM   581  N N   . LYS A 1 101 ? 41.608  51.833  43.066 1.00 160.38 ? 101  LYS A N   1 
ATOM   582  C CA  . LYS A 1 101 ? 42.219  52.701  44.068 1.00 165.78 ? 101  LYS A CA  1 
ATOM   583  C C   . LYS A 1 101 ? 43.069  51.841  44.973 1.00 173.47 ? 101  LYS A C   1 
ATOM   584  O O   . LYS A 1 101 ? 44.293  51.958  45.007 1.00 170.96 ? 101  LYS A O   1 
ATOM   585  C CB  . LYS A 1 101 ? 41.154  53.403  44.909 1.00 174.36 ? 101  LYS A CB  1 
ATOM   586  C CG  . LYS A 1 101 ? 40.764  54.773  44.404 1.00 167.49 ? 101  LYS A CG  1 
ATOM   587  C CD  . LYS A 1 101 ? 41.872  55.789  44.629 1.00 165.89 ? 101  LYS A CD  1 
ATOM   588  C CE  . LYS A 1 101 ? 41.506  57.123  43.993 1.00 156.42 ? 101  LYS A CE  1 
ATOM   589  N NZ  . LYS A 1 101 ? 42.621  58.110  44.031 1.00 153.66 ? 101  LYS A NZ  1 
ATOM   590  N N   . LEU A 1 102 ? 42.391  50.972  45.710 1.00 106.75 ? 102  LEU A N   1 
ATOM   591  C CA  . LEU A 1 102 ? 43.047  50.010  46.567 1.00 115.01 ? 102  LEU A CA  1 
ATOM   592  C C   . LEU A 1 102 ? 43.613  48.907  45.685 1.00 108.06 ? 102  LEU A C   1 
ATOM   593  O O   . LEU A 1 102 ? 42.910  48.354  44.839 1.00 103.46 ? 102  LEU A O   1 
ATOM   594  C CB  . LEU A 1 102 ? 42.039  49.457  47.570 1.00 127.74 ? 102  LEU A CB  1 
ATOM   595  C CG  . LEU A 1 102 ? 41.016  50.511  48.009 1.00 131.69 ? 102  LEU A CG  1 
ATOM   596  C CD1 . LEU A 1 102 ? 39.894  49.887  48.819 1.00 142.97 ? 102  LEU A CD1 1 
ATOM   597  C CD2 . LEU A 1 102 ? 41.685  51.635  48.784 1.00 135.10 ? 102  LEU A CD2 1 
ATOM   598  N N   . ILE A 1 103 ? 44.894  48.613  45.872 1.00 113.88 ? 103  ILE A N   1 
ATOM   599  C CA  . ILE A 1 103 ? 45.605  47.650  45.044 1.00 103.65 ? 103  ILE A CA  1 
ATOM   600  C C   . ILE A 1 103 ? 46.527  46.842  45.938 1.00 105.17 ? 103  ILE A C   1 
ATOM   601  O O   . ILE A 1 103 ? 46.989  47.342  46.958 1.00 110.72 ? 103  ILE A O   1 
ATOM   602  C CB  . ILE A 1 103 ? 46.470  48.370  43.990 1.00 91.30  ? 103  ILE A CB  1 
ATOM   603  C CG1 . ILE A 1 103 ? 45.629  49.365  43.195 1.00 90.26  ? 103  ILE A CG1 1 
ATOM   604  C CG2 . ILE A 1 103 ? 47.147  47.377  43.054 1.00 81.89  ? 103  ILE A CG2 1 
ATOM   605  C CD1 . ILE A 1 103 ? 46.447  50.234  42.277 1.00 80.71  ? 103  ILE A CD1 1 
ATOM   606  N N   . PRO A 1 104 ? 46.797  45.584  45.570 1.00 123.16 ? 104  PRO A N   1 
ATOM   607  C CA  . PRO A 1 104 ? 47.769  44.806  46.340 1.00 123.51 ? 104  PRO A CA  1 
ATOM   608  C C   . PRO A 1 104 ? 49.184  45.384  46.248 1.00 115.58 ? 104  PRO A C   1 
ATOM   609  O O   . PRO A 1 104 ? 49.521  46.072  45.283 1.00 106.48 ? 104  PRO A O   1 
ATOM   610  C CB  . PRO A 1 104 ? 47.717  43.431  45.665 1.00 118.17 ? 104  PRO A CB  1 
ATOM   611  C CG  . PRO A 1 104 ? 47.174  43.720  44.297 1.00 111.02 ? 104  PRO A CG  1 
ATOM   612  C CD  . PRO A 1 104 ? 46.138  44.753  44.553 1.00 118.71 ? 104  PRO A CD  1 
ATOM   613  N N   . ILE A 1 105 ? 49.997  45.104  47.262 1.00 130.36 ? 105  ILE A N   1 
ATOM   614  C CA  . ILE A 1 105 ? 51.399  45.495  47.262 1.00 123.49 ? 105  ILE A CA  1 
ATOM   615  C C   . ILE A 1 105 ? 52.248  44.355  47.801 1.00 123.35 ? 105  ILE A C   1 
ATOM   616  O O   . ILE A 1 105 ? 52.075  43.933  48.944 1.00 133.69 ? 105  ILE A O   1 
ATOM   617  C CB  . ILE A 1 105 ? 51.637  46.728  48.139 1.00 130.12 ? 105  ILE A CB  1 
ATOM   618  C CG1 . ILE A 1 105 ? 50.976  47.958  47.516 1.00 128.62 ? 105  ILE A CG1 1 
ATOM   619  C CG2 . ILE A 1 105 ? 53.127  46.958  48.336 1.00 124.86 ? 105  ILE A CG2 1 
ATOM   620  C CD1 . ILE A 1 105 ? 50.910  49.148  48.446 1.00 137.39 ? 105  ILE A CD1 1 
ATOM   621  N N   . GLY A 1 106 ? 53.159  43.856  46.975 1.00 111.63 ? 106  GLY A N   1 
ATOM   622  C CA  . GLY A 1 106 ? 54.058  42.795  47.391 1.00 110.27 ? 106  GLY A CA  1 
ATOM   623  C C   . GLY A 1 106 ? 53.444  41.417  47.270 1.00 111.74 ? 106  GLY A C   1 
ATOM   624  O O   . GLY A 1 106 ? 52.231  41.283  47.133 1.00 116.57 ? 106  GLY A O   1 
ATOM   625  N N   . PRO A 1 107 ? 54.287  40.379  47.334 1.00 126.01 ? 107  PRO A N   1 
ATOM   626  C CA  . PRO A 1 107 ? 53.872  38.985  47.127 1.00 125.81 ? 107  PRO A CA  1 
ATOM   627  C C   . PRO A 1 107 ? 52.745  38.539  48.058 1.00 139.10 ? 107  PRO A C   1 
ATOM   628  O O   . PRO A 1 107 ? 51.763  37.956  47.596 1.00 140.09 ? 107  PRO A O   1 
ATOM   629  C CB  . PRO A 1 107 ? 55.150  38.194  47.426 1.00 121.78 ? 107  PRO A CB  1 
ATOM   630  C CG  . PRO A 1 107 ? 56.264  39.169  47.185 1.00 114.57 ? 107  PRO A CG  1 
ATOM   631  C CD  . PRO A 1 107 ? 55.727  40.494  47.621 1.00 121.63 ? 107  PRO A CD  1 
ATOM   632  N N   . LEU A 1 108 ? 52.888  38.808  49.350 1.00 150.16 ? 108  LEU A N   1 
ATOM   633  C CA  . LEU A 1 108 ? 51.888  38.393  50.327 1.00 163.35 ? 108  LEU A CA  1 
ATOM   634  C C   . LEU A 1 108 ? 50.515  38.960  49.993 1.00 167.32 ? 108  LEU A C   1 
ATOM   635  O O   . LEU A 1 108 ? 49.529  38.228  49.938 1.00 171.64 ? 108  LEU A O   1 
ATOM   636  C CB  . LEU A 1 108 ? 52.306  38.809  51.738 1.00 173.84 ? 108  LEU A CB  1 
ATOM   637  C CG  . LEU A 1 108 ? 53.679  38.293  52.167 1.00 171.17 ? 108  LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 108 ? 53.900  38.519  53.655 1.00 183.89 ? 108  LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 108 ? 53.817  36.818  51.808 1.00 166.72 ? 108  LEU A CD2 1 
ATOM   640  N N   . ALA A 1 109 ? 50.458  40.267  49.767 1.00 148.32 ? 109  ALA A N   1 
ATOM   641  C CA  . ALA A 1 109 ? 49.206  40.916  49.405 1.00 151.71 ? 109  ALA A CA  1 
ATOM   642  C C   . ALA A 1 109 ? 48.530  40.186  48.252 1.00 145.59 ? 109  ALA A C   1 
ATOM   643  O O   . ALA A 1 109 ? 47.380  39.768  48.363 1.00 152.47 ? 109  ALA A O   1 
ATOM   644  C CB  . ALA A 1 109 ? 49.450  42.370  49.038 1.00 147.83 ? 109  ALA A CB  1 
ATOM   645  N N   . ASN A 1 110 ? 49.260  40.024  47.153 1.00 141.38 ? 110  ASN A N   1 
ATOM   646  C CA  . ASN A 1 110 ? 48.706  39.456  45.928 1.00 134.91 ? 110  ASN A CA  1 
ATOM   647  C C   . ASN A 1 110 ? 48.310  37.990  46.030 1.00 137.79 ? 110  ASN A C   1 
ATOM   648  O O   . ASN A 1 110 ? 47.288  37.584  45.482 1.00 139.38 ? 110  ASN A O   1 
ATOM   649  C CB  . ASN A 1 110 ? 49.681  39.644  44.770 1.00 120.74 ? 110  ASN A CB  1 
ATOM   650  C CG  . ASN A 1 110 ? 49.909  41.093  44.443 1.00 117.31 ? 110  ASN A CG  1 
ATOM   651  O OD1 . ASN A 1 110 ? 49.058  41.743  43.843 1.00 117.80 ? 110  ASN A OD1 1 
ATOM   652  N ND2 . ASN A 1 110 ? 51.064  41.613  44.832 1.00 114.20 ? 110  ASN A ND2 1 
ATOM   653  N N   . THR A 1 111 ? 49.119  37.188  46.711 1.00 138.62 ? 111  THR A N   1 
ATOM   654  C CA  . THR A 1 111 ? 48.767  35.784  46.885 1.00 141.82 ? 111  THR A CA  1 
ATOM   655  C C   . THR A 1 111 ? 47.381  35.697  47.513 1.00 154.40 ? 111  THR A C   1 
ATOM   656  O O   . THR A 1 111 ? 46.498  35.012  46.998 1.00 155.53 ? 111  THR A O   1 
ATOM   657  C CB  . THR A 1 111 ? 49.788  35.035  47.753 1.00 143.13 ? 111  THR A CB  1 
ATOM   658  O OG1 . THR A 1 111 ? 51.111  35.321  47.283 1.00 132.28 ? 111  THR A OG1 1 
ATOM   659  C CG2 . THR A 1 111 ? 49.541  33.533  47.691 1.00 143.90 ? 111  THR A CG2 1 
ATOM   660  N N   . LEU A 1 112 ? 47.196  36.409  48.621 1.00 91.49  ? 112  LEU A N   1 
ATOM   661  C CA  . LEU A 1 112 ? 45.886  36.537  49.247 1.00 103.64 ? 112  LEU A CA  1 
ATOM   662  C C   . LEU A 1 112 ? 44.828  36.937  48.227 1.00 101.64 ? 112  LEU A C   1 
ATOM   663  O O   . LEU A 1 112 ? 43.688  36.477  48.285 1.00 108.80 ? 112  LEU A O   1 
ATOM   664  C CB  . LEU A 1 112 ? 45.928  37.574  50.370 1.00 112.45 ? 112  LEU A CB  1 
ATOM   665  C CG  . LEU A 1 112 ? 46.387  37.091  51.743 1.00 121.18 ? 112  LEU A CG  1 
ATOM   666  C CD1 . LEU A 1 112 ? 46.257  38.219  52.753 1.00 130.31 ? 112  LEU A CD1 1 
ATOM   667  C CD2 . LEU A 1 112 ? 45.572  35.881  52.171 1.00 128.97 ? 112  LEU A CD2 1 
ATOM   668  N N   . VAL A 1 113 ? 45.209  37.804  47.296 1.00 123.12 ? 113  VAL A N   1 
ATOM   669  C CA  . VAL A 1 113 ? 44.295  38.247  46.251 1.00 120.72 ? 113  VAL A CA  1 
ATOM   670  C C   . VAL A 1 113 ? 43.853  37.072  45.390 1.00 117.37 ? 113  VAL A C   1 
ATOM   671  O O   . VAL A 1 113 ? 42.667  36.768  45.303 1.00 123.98 ? 113  VAL A O   1 
ATOM   672  C CB  . VAL A 1 113 ? 44.937  39.322  45.345 1.00 110.27 ? 113  VAL A CB  1 
ATOM   673  C CG1 . VAL A 1 113 ? 44.024  39.645  44.175 1.00 107.37 ? 113  VAL A CG1 1 
ATOM   674  C CG2 . VAL A 1 113 ? 45.254  40.577  46.145 1.00 114.31 ? 113  VAL A CG2 1 
ATOM   675  N N   . THR A 1 114 ? 44.818  36.404  44.768 1.00 131.83 ? 114  THR A N   1 
ATOM   676  C CA  . THR A 1 114 ? 44.522  35.322  43.837 1.00 127.25 ? 114  THR A CA  1 
ATOM   677  C C   . THR A 1 114 ? 43.819  34.169  44.552 1.00 136.90 ? 114  THR A C   1 
ATOM   678  O O   . THR A 1 114 ? 43.208  33.305  43.918 1.00 136.56 ? 114  THR A O   1 
ATOM   679  C CB  . THR A 1 114 ? 45.800  34.796  43.155 1.00 114.62 ? 114  THR A CB  1 
ATOM   680  O OG1 . THR A 1 114 ? 46.282  33.654  43.867 1.00 116.78 ? 114  THR A OG1 1 
ATOM   681  C CG2 . THR A 1 114 ? 46.881  35.866  43.133 1.00 107.81 ? 114  THR A CG2 1 
ATOM   682  N N   . LEU A 1 115 ? 43.915  34.162  45.878 1.00 90.53  ? 115  LEU A N   1 
ATOM   683  C CA  . LEU A 1 115 ? 43.254  33.150  46.691 1.00 100.65 ? 115  LEU A CA  1 
ATOM   684  C C   . LEU A 1 115 ? 41.801  33.534  46.894 1.00 110.74 ? 115  LEU A C   1 
ATOM   685  O O   . LEU A 1 115 ? 40.895  32.716  46.746 1.00 111.65 ? 115  LEU A O   1 
ATOM   686  C CB  . LEU A 1 115 ? 43.927  33.038  48.053 1.00 106.61 ? 115  LEU A CB  1 
ATOM   687  C CG  . LEU A 1 115 ? 43.721  31.689  48.732 1.00 113.15 ? 115  LEU A CG  1 
ATOM   688  C CD1 . LEU A 1 115 ? 44.804  30.735  48.258 1.00 103.24 ? 115  LEU A CD1 1 
ATOM   689  C CD2 . LEU A 1 115 ? 43.744  31.842  50.241 1.00 121.82 ? 115  LEU A CD2 1 
ATOM   690  N N   . GLU A 1 116 ? 41.593  34.795  47.245 1.00 148.95 ? 116  GLU A N   1 
ATOM   691  C CA  . GLU A 1 116 ? 40.257  35.320  47.429 1.00 151.69 ? 116  GLU A CA  1 
ATOM   692  C C   . GLU A 1 116 ? 39.446  35.114  46.166 1.00 147.78 ? 116  GLU A C   1 
ATOM   693  O O   . GLU A 1 116 ? 38.383  34.504  46.194 1.00 149.42 ? 116  GLU A O   1 
ATOM   694  C CB  . GLU A 1 116 ? 40.326  36.801  47.767 1.00 153.42 ? 116  GLU A CB  1 
ATOM   695  C CG  . GLU A 1 116 ? 39.048  37.336  48.355 1.00 157.86 ? 116  GLU A CG  1 
ATOM   696  C CD  . GLU A 1 116 ? 39.309  38.494  49.282 1.00 161.82 ? 116  GLU A CD  1 
ATOM   697  O OE1 . GLU A 1 116 ? 40.379  39.124  49.145 1.00 160.21 ? 116  GLU A OE1 1 
ATOM   698  O OE2 . GLU A 1 116 ? 38.455  38.769  50.149 1.00 166.72 ? 116  GLU A OE2 1 
ATOM   699  N N   . ALA A 1 117 ? 39.961  35.630  45.057 1.00 106.67 ? 117  ALA A N   1 
ATOM   700  C CA  . ALA A 1 117 ? 39.314  35.480  43.765 1.00 103.01 ? 117  ALA A CA  1 
ATOM   701  C C   . ALA A 1 117 ? 38.701  34.098  43.654 1.00 103.80 ? 117  ALA A C   1 
ATOM   702  O O   . ALA A 1 117 ? 37.479  33.947  43.644 1.00 106.23 ? 117  ALA A O   1 
ATOM   703  C CB  . ALA A 1 117 ? 40.316  35.702  42.656 1.00 91.26  ? 117  ALA A CB  1 
ATOM   704  N N   . LEU A 1 118 ? 39.562  33.090  43.589 1.00 125.34 ? 118  LEU A N   1 
ATOM   705  C CA  . LEU A 1 118 ? 39.132  31.700  43.547 1.00 125.72 ? 118  LEU A CA  1 
ATOM   706  C C   . LEU A 1 118 ? 38.014  31.432  44.550 1.00 131.55 ? 118  LEU A C   1 
ATOM   707  O O   . LEU A 1 118 ? 36.975  30.885  44.201 1.00 132.79 ? 118  LEU A O   1 
ATOM   708  C CB  . LEU A 1 118 ? 40.316  30.787  43.848 1.00 124.15 ? 118  LEU A CB  1 
ATOM   709  C CG  . LEU A 1 118 ? 39.969  29.314  44.044 1.00 127.03 ? 118  LEU A CG  1 
ATOM   710  C CD1 . LEU A 1 118 ? 39.903  28.601  42.709 1.00 120.80 ? 118  LEU A CD1 1 
ATOM   711  C CD2 . LEU A 1 118 ? 40.978  28.643  44.949 1.00 128.03 ? 118  LEU A CD2 1 
ATOM   712  N N   . CYS A 1 119 ? 38.240  31.819  45.799 1.00 117.55 ? 119  CYS A N   1 
ATOM   713  C CA  . CYS A 1 119 ? 37.229  31.697  46.840 1.00 123.28 ? 119  CYS A CA  1 
ATOM   714  C C   . CYS A 1 119 ? 35.910  32.324  46.420 1.00 124.08 ? 119  CYS A C   1 
ATOM   715  O O   . CYS A 1 119 ? 34.851  31.713  46.539 1.00 124.27 ? 119  CYS A O   1 
ATOM   716  C CB  . CYS A 1 119 ? 37.713  32.370  48.121 1.00 127.31 ? 119  CYS A CB  1 
ATOM   717  S SG  . CYS A 1 119 ? 38.544  31.271  49.266 1.00 130.51 ? 119  CYS A SG  1 
ATOM   718  N N   . GLY A 1 120 ? 35.978  33.559  45.945 1.00 152.85 ? 120  GLY A N   1 
ATOM   719  C CA  . GLY A 1 120 ? 34.788  34.257  45.506 1.00 154.42 ? 120  GLY A CA  1 
ATOM   720  C C   . GLY A 1 120 ? 33.957  33.439  44.540 1.00 152.83 ? 120  GLY A C   1 
ATOM   721  O O   . GLY A 1 120 ? 32.782  33.173  44.784 1.00 152.31 ? 120  GLY A O   1 
ATOM   722  N N   . MET A 1 121 ? 34.578  33.030  43.440 1.00 125.37 ? 121  MET A N   1 
ATOM   723  C CA  . MET A 1 121 ? 33.888  32.265  42.405 1.00 124.91 ? 121  MET A CA  1 
ATOM   724  C C   . MET A 1 121 ? 33.339  30.924  42.897 1.00 123.57 ? 121  MET A C   1 
ATOM   725  O O   . MET A 1 121 ? 32.215  30.559  42.585 1.00 122.46 ? 121  MET A O   1 
ATOM   726  C CB  . MET A 1 121 ? 34.791  32.072  41.183 1.00 127.02 ? 121  MET A CB  1 
ATOM   727  N N   . LEU A 1 122 ? 34.135  30.192  43.664 1.00 126.02 ? 122  LEU A N   1 
ATOM   728  C CA  . LEU A 1 122 ? 33.665  28.956  44.279 1.00 125.23 ? 122  LEU A CA  1 
ATOM   729  C C   . LEU A 1 122 ? 32.391  29.211  45.060 1.00 122.90 ? 122  LEU A C   1 
ATOM   730  O O   . LEU A 1 122 ? 31.430  28.458  44.977 1.00 122.43 ? 122  LEU A O   1 
ATOM   731  C CB  . LEU A 1 122 ? 34.713  28.404  45.239 1.00 118.29 ? 122  LEU A CB  1 
ATOM   732  C CG  . LEU A 1 122 ? 36.014  27.898  44.627 1.00 119.51 ? 122  LEU A CG  1 
ATOM   733  C CD1 . LEU A 1 122 ? 36.748  27.028  45.631 1.00 111.11 ? 122  LEU A CD1 1 
ATOM   734  C CD2 . LEU A 1 122 ? 35.733  27.121  43.357 1.00 126.43 ? 122  LEU A CD2 1 
ATOM   735  N N   . GLY A 1 123 ? 32.400  30.280  45.843 1.00 138.66 ? 123  GLY A N   1 
ATOM   736  C CA  . GLY A 1 123 ? 31.224  30.671  46.590 1.00 136.82 ? 123  GLY A CA  1 
ATOM   737  C C   . GLY A 1 123 ? 30.046  30.828  45.657 1.00 138.30 ? 123  GLY A C   1 
ATOM   738  O O   . GLY A 1 123 ? 28.965  30.305  45.905 1.00 137.09 ? 123  GLY A O   1 
ATOM   739  N N   . LEU A 1 124 ? 30.261  31.554  44.569 1.00 86.78  ? 124  LEU A N   1 
ATOM   740  C CA  . LEU A 1 124 ? 29.227  31.728  43.562 1.00 86.48  ? 124  LEU A CA  1 
ATOM   741  C C   . LEU A 1 124 ? 28.709  30.383  43.070 1.00 86.80  ? 124  LEU A C   1 
ATOM   742  O O   . LEU A 1 124 ? 27.505  30.170  42.957 1.00 86.00  ? 124  LEU A O   1 
ATOM   743  C CB  . LEU A 1 124 ? 29.765  32.508  42.368 1.00 88.21  ? 124  LEU A CB  1 
ATOM   744  C CG  . LEU A 1 124 ? 28.644  32.856  41.389 1.00 88.04  ? 124  LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 124 ? 27.844  34.021  41.934 1.00 86.94  ? 124  LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 124 ? 29.161  33.169  39.999 1.00 90.11  ? 124  LEU A CD2 1 
ATOM   747  N N   . ALA A 1 125 ? 29.636  29.485  42.762 1.00 97.83  ? 125  ALA A N   1 
ATOM   748  C CA  . ALA A 1 125 ? 29.294  28.155  42.285 1.00 98.93  ? 125  ALA A CA  1 
ATOM   749  C C   . ALA A 1 125 ? 28.407  27.436  43.285 1.00 97.96  ? 125  ALA A C   1 
ATOM   750  O O   . ALA A 1 125 ? 27.449  26.775  42.909 1.00 98.49  ? 125  ALA A O   1 
ATOM   751  C CB  . ALA A 1 125 ? 30.547  27.355  42.041 1.00 100.89 ? 125  ALA A CB  1 
ATOM   752  N N   . VAL A 1 126 ? 28.733  27.569  44.565 1.00 116.93 ? 126  VAL A N   1 
ATOM   753  C CA  . VAL A 1 126 ? 27.956  26.930  45.621 1.00 116.03 ? 126  VAL A CA  1 
ATOM   754  C C   . VAL A 1 126 ? 26.609  27.616  45.821 1.00 114.15 ? 126  VAL A C   1 
ATOM   755  O O   . VAL A 1 126 ? 25.582  26.956  45.984 1.00 114.22 ? 126  VAL A O   1 
ATOM   756  C CB  . VAL A 1 126 ? 28.725  26.923  46.955 1.00 114.38 ? 126  VAL A CB  1 
ATOM   757  C CG1 . VAL A 1 126 ? 27.821  26.466  48.089 1.00 110.28 ? 126  VAL A CG1 1 
ATOM   758  C CG2 . VAL A 1 126 ? 29.942  26.030  46.851 1.00 112.65 ? 126  VAL A CG2 1 
ATOM   759  N N   . ALA A 1 127 ? 26.622  28.945  45.808 1.00 116.09 ? 127  ALA A N   1 
ATOM   760  C CA  . ALA A 1 127 ? 25.401  29.722  45.957 1.00 114.48 ? 127  ALA A CA  1 
ATOM   761  C C   . ALA A 1 127 ? 24.429  29.402  44.829 1.00 115.22 ? 127  ALA A C   1 
ATOM   762  O O   . ALA A 1 127 ? 23.259  29.105  45.071 1.00 114.65 ? 127  ALA A O   1 
ATOM   763  C CB  . ALA A 1 127 ? 25.721  31.201  45.976 1.00 113.87 ? 127  ALA A CB  1 
ATOM   764  N N   . ALA A 1 128 ? 24.929  29.463  43.597 1.00 110.70 ? 128  ALA A N   1 
ATOM   765  C CA  . ALA A 1 128 ? 24.134  29.145  42.417 1.00 111.87 ? 128  ALA A CA  1 
ATOM   766  C C   . ALA A 1 128 ? 23.391  27.827  42.583 1.00 112.83 ? 128  ALA A C   1 
ATOM   767  O O   . ALA A 1 128 ? 22.166  27.787  42.485 1.00 112.60 ? 128  ALA A O   1 
ATOM   768  C CB  . ALA A 1 128 ? 25.016  29.094  41.189 1.00 113.78 ? 128  ALA A CB  1 
ATOM   769  N N   . SER A 1 129 ? 24.137  26.752  42.828 1.00 109.65 ? 129  SER A N   1 
ATOM   770  C CA  . SER A 1 129 ? 23.556  25.421  42.972 1.00 111.44 ? 129  SER A CA  1 
ATOM   771  C C   . SER A 1 129 ? 22.417  25.433  43.978 1.00 110.10 ? 129  SER A C   1 
ATOM   772  O O   . SER A 1 129 ? 21.317  24.966  43.688 1.00 111.21 ? 129  SER A O   1 
ATOM   773  C CB  . SER A 1 129 ? 24.619  24.423  43.423 1.00 113.08 ? 129  SER A CB  1 
ATOM   774  O OG  . SER A 1 129 ? 25.885  24.755  42.886 1.00 113.38 ? 129  SER A OG  1 
ATOM   775  N N   . LEU A 1 130 ? 22.690  25.962  45.165 1.00 77.66  ? 130  LEU A N   1 
ATOM   776  C CA  . LEU A 1 130 ? 21.657  26.102  46.178 1.00 76.17  ? 130  LEU A CA  1 
ATOM   777  C C   . LEU A 1 130 ? 20.459  26.837  45.591 1.00 75.36  ? 130  LEU A C   1 
ATOM   778  O O   . LEU A 1 130 ? 19.369  26.279  45.510 1.00 76.31  ? 130  LEU A O   1 
ATOM   779  C CB  . LEU A 1 130 ? 22.204  26.818  47.412 1.00 73.94  ? 130  LEU A CB  1 
ATOM   780  C CG  . LEU A 1 130 ? 23.184  25.931  48.181 1.00 74.96  ? 130  LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 130 ? 23.963  26.726  49.207 1.00 73.23  ? 130  LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 130 ? 22.453  24.768  48.832 1.00 76.32  ? 130  LEU A CD2 1 
ATOM   783  N N   . ILE A 1 131 ? 20.670  28.077  45.159 1.00 106.84 ? 131  ILE A N   1 
ATOM   784  C CA  . ILE A 1 131 ? 19.611  28.837  44.503 1.00 106.40 ? 131  ILE A CA  1 
ATOM   785  C C   . ILE A 1 131 ? 18.838  27.951  43.532 1.00 108.65 ? 131  ILE A C   1 
ATOM   786  O O   . ILE A 1 131 ? 17.641  27.747  43.696 1.00 108.78 ? 131  ILE A O   1 
ATOM   787  C CB  . ILE A 1 131 ? 20.154  30.047  43.719 1.00 106.02 ? 131  ILE A CB  1 
ATOM   788  C CG1 . ILE A 1 131 ? 21.073  30.897  44.593 1.00 104.67 ? 131  ILE A CG1 1 
ATOM   789  C CG2 . ILE A 1 131 ? 19.002  30.893  43.194 1.00 105.55 ? 131  ILE A CG2 1 
ATOM   790  C CD1 . ILE A 1 131 ? 20.339  31.761  45.582 1.00 102.73 ? 131  ILE A CD1 1 
ATOM   791  N N   . TYR A 1 132 ? 19.523  27.421  42.523 1.00 79.06  ? 132  TYR A N   1 
ATOM   792  C CA  . TYR A 1 132 ? 18.859  26.587  41.529 1.00 81.62  ? 132  TYR A CA  1 
ATOM   793  C C   . TYR A 1 132 ? 18.125  25.414  42.171 1.00 83.22  ? 132  TYR A C   1 
ATOM   794  O O   . TYR A 1 132 ? 16.993  25.104  41.807 1.00 84.66  ? 132  TYR A O   1 
ATOM   795  C CB  . TYR A 1 132 ? 19.841  26.062  40.480 1.00 83.79  ? 132  TYR A CB  1 
ATOM   796  C CG  . TYR A 1 132 ? 19.217  25.014  39.584 1.00 87.07  ? 132  TYR A CG  1 
ATOM   797  C CD1 . TYR A 1 132 ? 18.847  25.310  38.278 1.00 88.30  ? 132  TYR A CD1 1 
ATOM   798  C CD2 . TYR A 1 132 ? 18.974  23.732  40.056 1.00 89.35  ? 132  TYR A CD2 1 
ATOM   799  C CE1 . TYR A 1 132 ? 18.266  24.351  37.466 1.00 91.66  ? 132  TYR A CE1 1 
ATOM   800  C CE2 . TYR A 1 132 ? 18.389  22.770  39.254 1.00 93.00  ? 132  TYR A CE2 1 
ATOM   801  C CZ  . TYR A 1 132 ? 18.038  23.082  37.959 1.00 94.13  ? 132  TYR A CZ  1 
ATOM   802  O OH  . TYR A 1 132 ? 17.458  22.121  37.160 1.00 98.14  ? 132  TYR A OH  1 
ATOM   803  N N   . ALA A 1 133 ? 18.781  24.751  43.114 1.00 94.59  ? 133  ALA A N   1 
ATOM   804  C CA  . ALA A 1 133 ? 18.185  23.602  43.784 1.00 96.57  ? 133  ALA A CA  1 
ATOM   805  C C   . ALA A 1 133 ? 16.865  23.979  44.447 1.00 95.25  ? 133  ALA A C   1 
ATOM   806  O O   . ALA A 1 133 ? 15.857  23.298  44.267 1.00 97.56  ? 133  ALA A O   1 
ATOM   807  C CB  . ALA A 1 133 ? 19.150  23.020  44.804 1.00 96.60  ? 133  ALA A CB  1 
ATOM   808  N N   . ARG A 1 134 ? 16.867  25.066  45.211 1.00 104.00 ? 134  ARG A N   1 
ATOM   809  C CA  . ARG A 1 134 ? 15.636  25.509  45.855 1.00 102.66 ? 134  ARG A CA  1 
ATOM   810  C C   . ARG A 1 134 ? 14.681  26.212  44.899 1.00 102.62 ? 134  ARG A C   1 
ATOM   811  O O   . ARG A 1 134 ? 13.468  26.162  45.084 1.00 103.05 ? 134  ARG A O   1 
ATOM   812  C CB  . ARG A 1 134 ? 15.909  26.375  47.089 1.00 99.39  ? 134  ARG A CB  1 
ATOM   813  C CG  . ARG A 1 134 ? 17.266  27.030  47.150 1.00 98.01  ? 134  ARG A CG  1 
ATOM   814  C CD  . ARG A 1 134 ? 17.438  27.631  48.525 1.00 95.65  ? 134  ARG A CD  1 
ATOM   815  N NE  . ARG A 1 134 ? 16.224  28.347  48.901 1.00 94.21  ? 134  ARG A NE  1 
ATOM   816  C CZ  . ARG A 1 134 ? 15.782  28.481  50.146 1.00 92.87  ? 134  ARG A CZ  1 
ATOM   817  N NH1 . ARG A 1 134 ? 16.451  27.940  51.153 1.00 92.78  ? 134  ARG A NH1 1 
ATOM   818  N NH2 . ARG A 1 134 ? 14.662  29.149  50.382 1.00 91.78  ? 134  ARG A NH2 1 
ATOM   819  N N   . PHE A 1 135 ? 15.221  26.847  43.867 1.00 114.77 ? 135  PHE A N   1 
ATOM   820  C CA  . PHE A 1 135 ? 14.391  27.616  42.950 1.00 114.70 ? 135  PHE A CA  1 
ATOM   821  C C   . PHE A 1 135 ? 13.574  26.729  42.008 1.00 117.94 ? 135  PHE A C   1 
ATOM   822  O O   . PHE A 1 135 ? 12.410  27.010  41.731 1.00 118.35 ? 135  PHE A O   1 
ATOM   823  C CB  . PHE A 1 135 ? 15.242  28.613  42.155 1.00 113.74 ? 135  PHE A CB  1 
ATOM   824  C CG  . PHE A 1 135 ? 14.443  29.719  41.522 1.00 113.09 ? 135  PHE A CG  1 
ATOM   825  C CD1 . PHE A 1 135 ? 13.821  30.676  42.306 1.00 110.99 ? 135  PHE A CD1 1 
ATOM   826  C CD2 . PHE A 1 135 ? 14.312  29.800  40.144 1.00 114.82 ? 135  PHE A CD2 1 
ATOM   827  C CE1 . PHE A 1 135 ? 13.077  31.696  41.730 1.00 110.72 ? 135  PHE A CE1 1 
ATOM   828  C CE2 . PHE A 1 135 ? 13.570  30.819  39.559 1.00 114.50 ? 135  PHE A CE2 1 
ATOM   829  C CZ  . PHE A 1 135 ? 12.952  31.769  40.357 1.00 112.50 ? 135  PHE A CZ  1 
ATOM   830  N N   . THR A 1 136 ? 14.179  25.649  41.528 1.00 134.80 ? 136  THR A N   1 
ATOM   831  C CA  . THR A 1 136 ? 13.527  24.807  40.527 1.00 138.42 ? 136  THR A CA  1 
ATOM   832  C C   . THR A 1 136 ? 12.587  23.752  41.112 1.00 140.98 ? 136  THR A C   1 
ATOM   833  O O   . THR A 1 136 ? 12.802  22.550  40.940 1.00 144.47 ? 136  THR A O   1 
ATOM   834  C CB  . THR A 1 136 ? 14.547  24.119  39.590 1.00 140.81 ? 136  THR A CB  1 
ATOM   835  O OG1 . THR A 1 136 ? 15.585  23.509  40.369 1.00 140.74 ? 136  THR A OG1 1 
ATOM   836  C CG2 . THR A 1 136 ? 15.156  25.133  38.621 1.00 139.34 ? 136  THR A CG2 1 
ATOM   837  N N   . ARG A 1 137 ? 11.539  24.209  41.791 1.00 170.25 ? 137  ARG A N   1 
ATOM   838  C CA  . ARG A 1 137 ? 10.507  23.315  42.305 1.00 172.97 ? 137  ARG A CA  1 
ATOM   839  C C   . ARG A 1 137 ? 9.129   23.789  41.877 1.00 173.65 ? 137  ARG A C   1 
ATOM   840  O O   . ARG A 1 137 ? 8.731   24.918  42.138 1.00 170.55 ? 137  ARG A O   1 
ATOM   841  C CB  . ARG A 1 137 ? 10.532  23.277  43.816 1.00 171.07 ? 137  ARG A CB  1 
ATOM   842  C CG  . ARG A 1 137 ? 11.848  22.955  44.389 1.00 170.15 ? 137  ARG A CG  1 
ATOM   843  C CD  . ARG A 1 137 ? 11.741  23.171  45.851 1.00 167.88 ? 137  ARG A CD  1 
ATOM   844  N NE  . ARG A 1 137 ? 12.936  22.748  46.548 1.00 167.47 ? 137  ARG A NE  1 
ATOM   845  C CZ  . ARG A 1 137 ? 12.983  22.563  47.858 1.00 166.52 ? 137  ARG A CZ  1 
ATOM   846  N NH1 . ARG A 1 137 ? 11.894  22.761  48.593 1.00 165.91 ? 137  ARG A NH1 1 
ATOM   847  N NH2 . ARG A 1 137 ? 14.113  22.177  48.429 1.00 166.35 ? 137  ARG A NH2 1 
ATOM   848  N N   . PRO A 1 138 ? 8.502   22.502  40.473 1.00 106.73 ? 138  PRO A N   1 
ATOM   849  C CA  . PRO A 1 138 ? 7.256   22.789  39.770 1.00 102.81 ? 138  PRO A CA  1 
ATOM   850  C C   . PRO A 1 138 ? 6.113   22.527  40.728 1.00 104.47 ? 138  PRO A C   1 
ATOM   851  O O   . PRO A 1 138 ? 6.357   22.040  41.827 1.00 99.73  ? 138  PRO A O   1 
ATOM   852  C CB  . PRO A 1 138 ? 7.257   21.753  38.648 1.00 90.06  ? 138  PRO A CB  1 
ATOM   853  C CG  . PRO A 1 138 ? 8.694   21.384  38.474 1.00 92.11  ? 138  PRO A CG  1 
ATOM   854  C CD  . PRO A 1 138 ? 9.264   21.418  39.843 1.00 96.97  ? 138  PRO A CD  1 
ATOM   855  N N   . THR A 1 139 ? 4.892   22.850  40.331 1.00 106.80 ? 139  THR A N   1 
ATOM   856  C CA  . THR A 1 139 ? 3.726   22.471  41.109 1.00 107.14 ? 139  THR A CA  1 
ATOM   857  C C   . THR A 1 139 ? 2.665   22.001  40.140 1.00 97.39  ? 139  THR A C   1 
ATOM   858  O O   . THR A 1 139 ? 2.264   22.751  39.257 1.00 98.11  ? 139  THR A O   1 
ATOM   859  C CB  . THR A 1 139 ? 3.167   23.651  41.919 1.00 121.76 ? 139  THR A CB  1 
ATOM   860  O OG1 . THR A 1 139 ? 3.206   24.839  41.118 1.00 124.54 ? 139  THR A OG1 1 
ATOM   861  C CG2 . THR A 1 139 ? 3.986   23.872  43.174 1.00 133.05 ? 139  THR A CG2 1 
ATOM   862  N N   . ALA A 1 140 ? 2.224   20.757  40.281 1.00 108.92 ? 140  ALA A N   1 
ATOM   863  C CA  . ALA A 1 140 ? 1.137   20.262  39.452 1.00 101.49 ? 140  ALA A CA  1 
ATOM   864  C C   . ALA A 1 140 ? 0.002   21.279  39.482 1.00 107.49 ? 140  ALA A C   1 
ATOM   865  O O   . ALA A 1 140 ? -0.435  21.703  40.555 1.00 115.71 ? 140  ALA A O   1 
ATOM   866  C CB  . ALA A 1 140 ? 0.663   18.918  39.956 1.00 96.16  ? 140  ALA A CB  1 
ATOM   867  N N   . GLY A 1 141 ? -0.463  21.688  38.307 1.00 112.91 ? 141  GLY A N   1 
ATOM   868  C CA  . GLY A 1 141 ? -1.545  22.650  38.238 1.00 119.05 ? 141  GLY A CA  1 
ATOM   869  C C   . GLY A 1 141 ? -2.865  22.008  38.613 1.00 116.48 ? 141  GLY A C   1 
ATOM   870  O O   . GLY A 1 141 ? -3.908  22.381  38.092 1.00 117.18 ? 141  GLY A O   1 
ATOM   871  N N   . VAL A 1 142 ? -2.821  21.051  39.534 1.00 102.97 ? 142  VAL A N   1 
ATOM   872  C CA  . VAL A 1 142 ? -3.968  20.187  39.791 1.00 99.09  ? 142  VAL A CA  1 
ATOM   873  C C   . VAL A 1 142 ? -4.906  20.673  40.890 1.00 107.79 ? 142  VAL A C   1 
ATOM   874  O O   . VAL A 1 142 ? -4.472  21.037  41.979 1.00 116.09 ? 142  VAL A O   1 
ATOM   875  C CB  . VAL A 1 142 ? -3.521  18.758  40.119 1.00 92.63  ? 142  VAL A CB  1 
ATOM   876  C CG1 . VAL A 1 142 ? -4.730  17.841  40.219 1.00 89.04  ? 142  VAL A CG1 1 
ATOM   877  C CG2 . VAL A 1 142 ? -2.574  18.257  39.052 1.00 86.23  ? 142  VAL A CG2 1 
ATOM   878  N N   . LEU A 1 143 ? -6.200  20.654  40.583 1.00 98.17  ? 143  LEU A N   1 
ATOM   879  C CA  . LEU A 1 143 ? -7.244  21.031  41.528 1.00 98.59  ? 143  LEU A CA  1 
ATOM   880  C C   . LEU A 1 143 ? -8.079  19.819  41.944 1.00 101.80 ? 143  LEU A C   1 
ATOM   881  O O   . LEU A 1 143 ? -8.491  19.023  41.097 1.00 93.08  ? 143  LEU A O   1 
ATOM   882  C CB  . LEU A 1 143 ? -8.160  22.082  40.902 1.00 103.59 ? 143  LEU A CB  1 
ATOM   883  C CG  . LEU A 1 143 ? -9.412  22.412  41.712 1.00 112.64 ? 143  LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 143 ? -9.041  23.231  42.936 1.00 127.67 ? 143  LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 143 ? -10.427 23.149  40.855 1.00 114.79 ? 143  LEU A CD2 1 
ATOM   886  N N   . PHE A 1 144 ? -8.336  19.685  43.243 1.00 109.48 ? 144  PHE A N   1 
ATOM   887  C CA  . PHE A 1 144 ? -9.126  18.566  43.752 1.00 106.05 ? 144  PHE A CA  1 
ATOM   888  C C   . PHE A 1 144 ? -10.558 18.972  44.046 1.00 112.41 ? 144  PHE A C   1 
ATOM   889  O O   . PHE A 1 144 ? -10.802 20.001  44.675 1.00 124.51 ? 144  PHE A O   1 
ATOM   890  C CB  . PHE A 1 144 ? -8.515  18.010  45.036 1.00 110.07 ? 144  PHE A CB  1 
ATOM   891  C CG  . PHE A 1 144 ? -7.146  17.430  44.858 1.00 103.99 ? 144  PHE A CG  1 
ATOM   892  C CD1 . PHE A 1 144 ? -6.037  18.255  44.748 1.00 107.53 ? 144  PHE A CD1 1 
ATOM   893  C CD2 . PHE A 1 144 ? -6.962  16.059  44.816 1.00 96.05  ? 144  PHE A CD2 1 
ATOM   894  C CE1 . PHE A 1 144 ? -4.771  17.722  44.588 1.00 102.42 ? 144  PHE A CE1 1 
ATOM   895  C CE2 . PHE A 1 144 ? -5.698  15.521  44.660 1.00 91.65  ? 144  PHE A CE2 1 
ATOM   896  C CZ  . PHE A 1 144 ? -4.601  16.355  44.545 1.00 94.47  ? 144  PHE A CZ  1 
ATOM   897  N N   . SER A 1 145 ? -11.505 18.157  43.600 1.00 107.32 ? 145  SER A N   1 
ATOM   898  C CA  . SER A 1 145 ? -12.890 18.361  43.978 1.00 113.29 ? 145  SER A CA  1 
ATOM   899  C C   . SER A 1 145 ? -12.947 18.481  45.493 1.00 124.44 ? 145  SER A C   1 
ATOM   900  O O   . SER A 1 145 ? -12.385 17.661  46.210 1.00 123.09 ? 145  SER A O   1 
ATOM   901  C CB  . SER A 1 145 ? -13.772 17.209  43.488 1.00 105.41 ? 145  SER A CB  1 
ATOM   902  O OG  . SER A 1 145 ? -13.285 15.950  43.922 1.00 100.40 ? 145  SER A OG  1 
ATOM   903  N N   . SER A 1 146 ? -13.611 19.521  45.976 1.00 112.73 ? 146  SER A N   1 
ATOM   904  C CA  . SER A 1 146 ? -13.678 19.788  47.404 1.00 115.73 ? 146  SER A CA  1 
ATOM   905  C C   . SER A 1 146 ? -14.346 18.647  48.161 1.00 114.33 ? 146  SER A C   1 
ATOM   906  O O   . SER A 1 146 ? -14.133 18.480  49.361 1.00 123.81 ? 146  SER A O   1 
ATOM   907  C CB  . SER A 1 146 ? -14.435 21.091  47.652 1.00 131.21 ? 146  SER A CB  1 
ATOM   908  O OG  . SER A 1 146 ? -15.697 21.069  47.005 1.00 127.77 ? 146  SER A OG  1 
ATOM   909  N N   . ARG A 1 147 ? -15.154 17.863  47.456 1.00 143.27 ? 147  ARG A N   1 
ATOM   910  C CA  . ARG A 1 147 ? -15.891 16.775  48.084 1.00 142.58 ? 147  ARG A CA  1 
ATOM   911  C C   . ARG A 1 147 ? -15.659 15.455  47.380 1.00 128.41 ? 147  ARG A C   1 
ATOM   912  O O   . ARG A 1 147 ? -15.197 15.414  46.239 1.00 119.37 ? 147  ARG A O   1 
ATOM   913  C CB  . ARG A 1 147 ? -17.395 17.057  48.057 1.00 148.01 ? 147  ARG A CB  1 
ATOM   914  C CG  . ARG A 1 147 ? -17.851 18.216  48.909 1.00 165.35 ? 147  ARG A CG  1 
ATOM   915  C CD  . ARG A 1 147 ? -17.656 17.931  50.385 1.00 176.54 ? 147  ARG A CD  1 
ATOM   916  N NE  . ARG A 1 147 ? -17.846 19.144  51.170 1.00 196.00 ? 147  ARG A NE  1 
ATOM   917  C CZ  . ARG A 1 147 ? -17.035 20.196  51.109 1.00 203.39 ? 147  ARG A CZ  1 
ATOM   918  N NH1 . ARG A 1 147 ? -15.987 20.177  50.297 1.00 191.57 ? 147  ARG A NH1 1 
ATOM   919  N NH2 . ARG A 1 147 ? -17.271 21.268  51.851 1.00 223.99 ? 147  ARG A NH2 1 
ATOM   920  N N   . MET A 1 148 ? -15.991 14.375  48.077 1.00 151.80 ? 148  MET A N   1 
ATOM   921  C CA  . MET A 1 148 ? -16.152 13.080  47.445 1.00 141.88 ? 148  MET A CA  1 
ATOM   922  C C   . MET A 1 148 ? -17.637 12.799  47.415 1.00 144.22 ? 148  MET A C   1 
ATOM   923  O O   . MET A 1 148 ? -18.425 13.500  48.052 1.00 153.48 ? 148  MET A O   1 
ATOM   924  C CB  . MET A 1 148 ? -15.457 11.987  48.246 1.00 141.37 ? 148  MET A CB  1 
ATOM   925  C CG  . MET A 1 148 ? -14.111 12.380  48.791 1.00 143.80 ? 148  MET A CG  1 
ATOM   926  S SD  . MET A 1 148 ? -13.184 10.935  49.327 1.00 140.43 ? 148  MET A SD  1 
ATOM   927  C CE  . MET A 1 148 ? -12.890 10.125  47.758 1.00 127.97 ? 148  MET A CE  1 
ATOM   928  N N   . VAL A 1 149 ? -18.023 11.778  46.668 1.00 149.48 ? 149  VAL A N   1 
ATOM   929  C CA  . VAL A 1 149 ? -19.401 11.335  46.679 1.00 152.06 ? 149  VAL A CA  1 
ATOM   930  C C   . VAL A 1 149 ? -19.419 9.822   46.619 1.00 148.56 ? 149  VAL A C   1 
ATOM   931  O O   . VAL A 1 149 ? -18.524 9.203   46.044 1.00 142.75 ? 149  VAL A O   1 
ATOM   932  C CB  . VAL A 1 149 ? -20.201 11.898  45.490 1.00 149.87 ? 149  VAL A CB  1 
ATOM   933  C CG1 . VAL A 1 149 ? -19.751 13.304  45.168 1.00 151.16 ? 149  VAL A CG1 1 
ATOM   934  C CG2 . VAL A 1 149 ? -20.040 11.011  44.274 1.00 142.37 ? 149  VAL A CG2 1 
ATOM   935  N N   . ILE A 1 150 ? -20.428 9.230   47.240 1.00 119.25 ? 150  ILE A N   1 
ATOM   936  C CA  . ILE A 1 150 ? -20.661 7.810   47.098 1.00 117.92 ? 150  ILE A CA  1 
ATOM   937  C C   . ILE A 1 150 ? -21.980 7.659   46.372 1.00 119.03 ? 150  ILE A C   1 
ATOM   938  O O   . ILE A 1 150 ? -23.014 8.120   46.839 1.00 124.26 ? 150  ILE A O   1 
ATOM   939  C CB  . ILE A 1 150 ? -20.686 7.096   48.451 1.00 116.18 ? 150  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 150 ? -19.326 7.242   49.132 1.00 115.74 ? 150  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 150 ? -21.020 5.628   48.264 1.00 116.38 ? 150  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 150 ? -19.174 6.440   50.393 1.00 121.65 ? 150  ILE A CD1 1 
ATOM   943  N N   . SER A 1 151 ? -21.932 7.047   45.200 1.00 159.19 ? 151  SER A N   1 
ATOM   944  C CA  . SER A 1 151 ? -23.123 6.903   44.388 1.00 161.19 ? 151  SER A CA  1 
ATOM   945  C C   . SER A 1 151 ? -22.983 5.708   43.465 1.00 161.01 ? 151  SER A C   1 
ATOM   946  O O   . SER A 1 151 ? -21.882 5.233   43.211 1.00 158.34 ? 151  SER A O   1 
ATOM   947  C CB  . SER A 1 151 ? -23.374 8.170   43.572 1.00 159.21 ? 151  SER A CB  1 
ATOM   948  O OG  . SER A 1 151 ? -22.750 8.083   42.308 1.00 154.85 ? 151  SER A OG  1 
ATOM   949  N N   . ASP A 1 152 ? -24.115 5.232   42.965 1.00 168.82 ? 152  ASP A N   1 
ATOM   950  C CA  . ASP A 1 152 ? -24.141 4.093   42.066 1.00 172.52 ? 152  ASP A CA  1 
ATOM   951  C C   . ASP A 1 152 ? -23.617 4.462   40.701 1.00 170.01 ? 152  ASP A C   1 
ATOM   952  O O   . ASP A 1 152 ? -24.151 5.342   40.038 1.00 169.13 ? 152  ASP A O   1 
ATOM   953  C CB  . ASP A 1 152 ? -25.569 3.574   41.911 1.00 179.78 ? 152  ASP A CB  1 
ATOM   954  C CG  . ASP A 1 152 ? -26.005 2.724   43.076 1.00 184.72 ? 152  ASP A CG  1 
ATOM   955  O OD1 . ASP A 1 152 ? -25.565 2.999   44.210 1.00 182.36 ? 152  ASP A OD1 1 
ATOM   956  O OD2 . ASP A 1 152 ? -26.784 1.775   42.858 1.00 192.21 ? 152  ASP A OD2 1 
ATOM   957  N N   . PHE A 1 153 ? -22.565 3.779   40.285 1.00 169.26 ? 153  PHE A N   1 
ATOM   958  C CA  . PHE A 1 153 ? -22.111 3.867   38.918 1.00 169.72 ? 153  PHE A CA  1 
ATOM   959  C C   . PHE A 1 153 ? -21.958 2.446   38.418 1.00 178.61 ? 153  PHE A C   1 
ATOM   960  O O   . PHE A 1 153 ? -21.430 1.587   39.119 1.00 180.47 ? 153  PHE A O   1 
ATOM   961  C CB  . PHE A 1 153 ? -20.801 4.640   38.833 1.00 161.97 ? 153  PHE A CB  1 
ATOM   962  C CG  . PHE A 1 153 ? -20.079 4.463   37.539 1.00 163.81 ? 153  PHE A CG  1 
ATOM   963  C CD1 . PHE A 1 153 ? -20.225 5.381   36.516 1.00 162.47 ? 153  PHE A CD1 1 
ATOM   964  C CD2 . PHE A 1 153 ? -19.247 3.380   37.348 1.00 168.21 ? 153  PHE A CD2 1 
ATOM   965  C CE1 . PHE A 1 153 ? -19.554 5.216   35.332 1.00 165.47 ? 153  PHE A CE1 1 
ATOM   966  C CE2 . PHE A 1 153 ? -18.576 3.216   36.167 1.00 171.77 ? 153  PHE A CE2 1 
ATOM   967  C CZ  . PHE A 1 153 ? -18.730 4.133   35.157 1.00 170.41 ? 153  PHE A CZ  1 
ATOM   968  N N   . GLU A 1 154 ? -22.450 2.197   37.214 1.00 150.92 ? 154  GLU A N   1 
ATOM   969  C CA  . GLU A 1 154 ? -22.359 0.878   36.620 1.00 162.91 ? 154  GLU A CA  1 
ATOM   970  C C   . GLU A 1 154 ? -22.682 -0.220  37.629 1.00 168.17 ? 154  GLU A C   1 
ATOM   971  O O   . GLU A 1 154 ? -21.947 -1.195  37.760 1.00 173.56 ? 154  GLU A O   1 
ATOM   972  C CB  . GLU A 1 154 ? -20.964 0.680   36.041 1.00 162.87 ? 154  GLU A CB  1 
ATOM   973  C CG  . GLU A 1 154 ? -20.958 0.138   34.629 1.00 175.45 ? 154  GLU A CG  1 
ATOM   974  C CD  . GLU A 1 154 ? -19.986 0.880   33.737 1.00 171.42 ? 154  GLU A CD  1 
ATOM   975  O OE1 . GLU A 1 154 ? -19.014 1.450   34.268 1.00 160.32 ? 154  GLU A OE1 1 
ATOM   976  O OE2 . GLU A 1 154 ? -20.193 0.901   32.507 1.00 180.34 ? 154  GLU A OE2 1 
ATOM   977  N N   . GLY A 1 155 ? -23.772 -0.034  38.364 1.00 195.63 ? 155  GLY A N   1 
ATOM   978  C CA  . GLY A 1 155 ? -24.349 -1.096  39.167 1.00 203.13 ? 155  GLY A CA  1 
ATOM   979  C C   . GLY A 1 155 ? -23.651 -1.490  40.453 1.00 199.47 ? 155  GLY A C   1 
ATOM   980  O O   . GLY A 1 155 ? -23.945 -2.536  41.017 1.00 207.46 ? 155  GLY A O   1 
ATOM   981  N N   . LYS A 1 156 ? -22.726 -0.667  40.922 1.00 176.51 ? 156  LYS A N   1 
ATOM   982  C CA  . LYS A 1 156 ? -22.151 -0.857  42.243 1.00 173.30 ? 156  LYS A CA  1 
ATOM   983  C C   . LYS A 1 156 ? -21.892 0.517   42.822 1.00 162.77 ? 156  LYS A C   1 
ATOM   984  O O   . LYS A 1 156 ? -21.462 1.413   42.108 1.00 157.09 ? 156  LYS A O   1 
ATOM   985  C CB  . LYS A 1 156 ? -20.851 -1.657  42.159 1.00 175.44 ? 156  LYS A CB  1 
ATOM   986  N N   . PRO A 1 157 ? -22.164 0.700   44.116 1.00 152.98 ? 157  PRO A N   1 
ATOM   987  C CA  . PRO A 1 157 ? -21.883 2.012   44.697 1.00 145.87 ? 157  PRO A CA  1 
ATOM   988  C C   . PRO A 1 157 ? -20.416 2.331   44.494 1.00 139.88 ? 157  PRO A C   1 
ATOM   989  O O   . PRO A 1 157 ? -19.574 1.463   44.687 1.00 141.38 ? 157  PRO A O   1 
ATOM   990  C CB  . PRO A 1 157 ? -22.178 1.804   46.182 1.00 149.27 ? 157  PRO A CB  1 
ATOM   991  C CG  . PRO A 1 157 ? -23.072 0.638   46.231 1.00 156.97 ? 157  PRO A CG  1 
ATOM   992  C CD  . PRO A 1 157 ? -22.671 -0.251  45.113 1.00 159.66 ? 157  PRO A CD  1 
ATOM   993  N N   . THR A 1 158 ? -20.111 3.551   44.083 1.00 136.94 ? 158  THR A N   1 
ATOM   994  C CA  . THR A 1 158 ? -18.726 3.922   43.882 1.00 131.72 ? 158  THR A CA  1 
ATOM   995  C C   . THR A 1 158 ? -18.378 5.217   44.587 1.00 128.14 ? 158  THR A C   1 
ATOM   996  O O   . THR A 1 158 ? -19.076 6.223   44.468 1.00 127.90 ? 158  THR A O   1 
ATOM   997  C CB  . THR A 1 158 ? -18.367 4.032   42.391 1.00 129.70 ? 158  THR A CB  1 
ATOM   998  O OG1 . THR A 1 158 ? -18.800 2.850   41.706 1.00 136.17 ? 158  THR A OG1 1 
ATOM   999  C CG2 . THR A 1 158 ? -16.868 4.179   42.232 1.00 125.44 ? 158  THR A CG2 1 
ATOM   1000 N N   . LEU A 1 159 ? -17.293 5.163   45.345 1.00 129.97 ? 159  LEU A N   1 
ATOM   1001 C CA  . LEU A 1 159 ? -16.701 6.352   45.914 1.00 128.22 ? 159  LEU A CA  1 
ATOM   1002 C C   . LEU A 1 159 ? -15.928 7.027   44.798 1.00 122.66 ? 159  LEU A C   1 
ATOM   1003 O O   . LEU A 1 159 ? -15.150 6.379   44.099 1.00 120.23 ? 159  LEU A O   1 
ATOM   1004 C CB  . LEU A 1 159 ? -15.747 5.972   47.044 1.00 130.05 ? 159  LEU A CB  1 
ATOM   1005 C CG  . LEU A 1 159 ? -15.037 7.128   47.745 1.00 130.97 ? 159  LEU A CG  1 
ATOM   1006 C CD1 . LEU A 1 159 ? -16.040 7.975   48.515 1.00 137.41 ? 159  LEU A CD1 1 
ATOM   1007 C CD2 . LEU A 1 159 ? -13.948 6.602   48.666 1.00 132.89 ? 159  LEU A CD2 1 
ATOM   1008 N N   . MET A 1 160 ? -16.154 8.320   44.611 1.00 125.83 ? 160  MET A N   1 
ATOM   1009 C CA  . MET A 1 160 ? -15.369 9.068   43.642 1.00 121.38 ? 160  MET A CA  1 
ATOM   1010 C C   . MET A 1 160 ? -15.067 10.496  44.061 1.00 122.82 ? 160  MET A C   1 
ATOM   1011 O O   . MET A 1 160 ? -15.729 11.066  44.927 1.00 128.41 ? 160  MET A O   1 
ATOM   1012 C CB  . MET A 1 160 ? -16.017 9.044   42.253 1.00 119.75 ? 160  MET A CB  1 
ATOM   1013 C CG  . MET A 1 160 ? -17.525 8.929   42.246 1.00 123.40 ? 160  MET A CG  1 
ATOM   1014 S SD  . MET A 1 160 ? -18.099 8.289   40.658 1.00 123.87 ? 160  MET A SD  1 
ATOM   1015 C CE  . MET A 1 160 ? -19.690 7.603   41.117 1.00 129.65 ? 160  MET A CE  1 
ATOM   1016 N N   . MET A 1 161 ? -14.027 11.042  43.443 1.00 108.47 ? 161  MET A N   1 
ATOM   1017 C CA  . MET A 1 161 ? -13.719 12.461  43.483 1.00 110.43 ? 161  MET A CA  1 
ATOM   1018 C C   . MET A 1 161 ? -13.081 12.761  42.138 1.00 105.27 ? 161  MET A C   1 
ATOM   1019 O O   . MET A 1 161 ? -12.933 11.856  41.314 1.00 101.50 ? 161  MET A O   1 
ATOM   1020 C CB  . MET A 1 161 ? -12.790 12.810  44.650 1.00 114.50 ? 161  MET A CB  1 
ATOM   1021 C CG  . MET A 1 161 ? -11.655 11.828  44.912 1.00 111.29 ? 161  MET A CG  1 
ATOM   1022 S SD  . MET A 1 161 ? -10.147 12.160  43.969 1.00 106.07 ? 161  MET A SD  1 
ATOM   1023 C CE  . MET A 1 161 ? -10.234 13.941  43.792 1.00 109.99 ? 161  MET A CE  1 
ATOM   1024 N N   . ARG A 1 162 ? -12.717 14.012  41.887 1.00 108.82 ? 162  ARG A N   1 
ATOM   1025 C CA  . ARG A 1 162 ? -12.132 14.323  40.588 1.00 104.65 ? 162  ARG A CA  1 
ATOM   1026 C C   . ARG A 1 162 ? -11.069 15.415  40.576 1.00 105.86 ? 162  ARG A C   1 
ATOM   1027 O O   . ARG A 1 162 ? -11.100 16.354  41.369 1.00 112.01 ? 162  ARG A O   1 
ATOM   1028 C CB  . ARG A 1 162 ? -13.223 14.621  39.563 1.00 104.75 ? 162  ARG A CB  1 
ATOM   1029 C CG  . ARG A 1 162 ? -14.230 15.652  40.004 1.00 110.52 ? 162  ARG A CG  1 
ATOM   1030 C CD  . ARG A 1 162 ? -15.255 15.840  38.910 1.00 110.48 ? 162  ARG A CD  1 
ATOM   1031 N NE  . ARG A 1 162 ? -16.162 16.952  39.165 1.00 116.74 ? 162  ARG A NE  1 
ATOM   1032 C CZ  . ARG A 1 162 ? -17.059 17.386  38.286 1.00 118.20 ? 162  ARG A CZ  1 
ATOM   1033 N NH1 . ARG A 1 162 ? -17.159 16.799  37.100 1.00 114.29 ? 162  ARG A NH1 1 
ATOM   1034 N NH2 . ARG A 1 162 ? -17.851 18.404  38.588 1.00 125.10 ? 162  ARG A NH2 1 
ATOM   1035 N N   . LEU A 1 163 ? -10.127 15.262  39.653 1.00 104.03 ? 163  LEU A N   1 
ATOM   1036 C CA  . LEU A 1 163 ? -9.034  16.201  39.482 1.00 104.90 ? 163  LEU A CA  1 
ATOM   1037 C C   . LEU A 1 163 ? -9.228  16.994  38.206 1.00 104.55 ? 163  LEU A C   1 
ATOM   1038 O O   . LEU A 1 163 ? -9.639  16.445  37.182 1.00 101.63 ? 163  LEU A O   1 
ATOM   1039 C CB  . LEU A 1 163 ? -7.717  15.448  39.343 1.00 100.90 ? 163  LEU A CB  1 
ATOM   1040 C CG  . LEU A 1 163 ? -7.386  14.339  40.330 1.00 100.32 ? 163  LEU A CG  1 
ATOM   1041 C CD1 . LEU A 1 163 ? -6.578  13.265  39.625 1.00 96.21  ? 163  LEU A CD1 1 
ATOM   1042 C CD2 . LEU A 1 163 ? -6.632  14.905  41.514 1.00 104.72 ? 163  LEU A CD2 1 
ATOM   1043 N N   . ALA A 1 164 ? -8.909  18.281  38.260 1.00 85.32  ? 164  ALA A N   1 
ATOM   1044 C CA  . ALA A 1 164 ? -8.847  19.090  37.052 1.00 85.56  ? 164  ALA A CA  1 
ATOM   1045 C C   . ALA A 1 164 ? -7.457  19.695  36.896 1.00 86.38  ? 164  ALA A C   1 
ATOM   1046 O O   . ALA A 1 164 ? -6.913  20.276  37.834 1.00 91.36  ? 164  ALA A O   1 
ATOM   1047 C CB  . ALA A 1 164 ? -9.908  20.182  37.071 1.00 91.92  ? 164  ALA A CB  1 
ATOM   1048 N N   . ASN A 1 165 ? -6.886  19.530  35.709 1.00 94.57  ? 165  ASN A N   1 
ATOM   1049 C CA  . ASN A 1 165 ? -5.628  20.164  35.351 1.00 95.62  ? 165  ASN A CA  1 
ATOM   1050 C C   . ASN A 1 165 ? -5.876  21.645  35.124 1.00 102.42 ? 165  ASN A C   1 
ATOM   1051 O O   . ASN A 1 165 ? -6.767  22.012  34.366 1.00 103.64 ? 165  ASN A O   1 
ATOM   1052 C CB  . ASN A 1 165 ? -5.081  19.518  34.077 1.00 91.37  ? 165  ASN A CB  1 
ATOM   1053 C CG  . ASN A 1 165 ? -3.840  20.208  33.546 1.00 92.88  ? 165  ASN A CG  1 
ATOM   1054 O OD1 . ASN A 1 165 ? -3.409  21.232  34.070 1.00 97.37  ? 165  ASN A OD1 1 
ATOM   1055 N ND2 . ASN A 1 165 ? -3.257  19.642  32.492 1.00 90.69  ? 165  ASN A ND2 1 
ATOM   1056 N N   . LEU A 1 166 ? -5.094  22.498  35.777 1.00 92.91  ? 166  LEU A N   1 
ATOM   1057 C CA  . LEU A 1 166 ? -5.337  23.940  35.724 1.00 88.79  ? 166  LEU A CA  1 
ATOM   1058 C C   . LEU A 1 166 ? -4.546  24.660  34.643 1.00 90.08  ? 166  LEU A C   1 
ATOM   1059 O O   . LEU A 1 166 ? -4.711  25.860  34.448 1.00 98.48  ? 166  LEU A O   1 
ATOM   1060 C CB  . LEU A 1 166 ? -5.056  24.587  37.081 1.00 98.54  ? 166  LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 166 ? -6.152  24.324  38.107 1.00 101.85 ? 166  LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 166 ? -5.949  25.157  39.353 1.00 115.48 ? 166  LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 166 ? -7.493  24.624  37.478 1.00 102.51 ? 166  LEU A CD2 1 
ATOM   1064 N N   . ARG A 1 167 ? -3.687  23.931  33.944 1.00 121.66 ? 167  ARG A N   1 
ATOM   1065 C CA  . ARG A 1 167 ? -2.860  24.535  32.908 1.00 123.22 ? 167  ARG A CA  1 
ATOM   1066 C C   . ARG A 1 167 ? -3.082  23.882  31.552 1.00 117.76 ? 167  ARG A C   1 
ATOM   1067 O O   . ARG A 1 167 ? -3.609  22.775  31.460 1.00 112.35 ? 167  ARG A O   1 
ATOM   1068 C CB  . ARG A 1 167 ? -1.386  24.434  33.279 1.00 123.02 ? 167  ARG A CB  1 
ATOM   1069 C CG  . ARG A 1 167 ? -1.041  25.047  34.605 1.00 130.21 ? 167  ARG A CG  1 
ATOM   1070 C CD  . ARG A 1 167 ? 0.320   24.584  35.042 1.00 128.54 ? 167  ARG A CD  1 
ATOM   1071 N NE  . ARG A 1 167 ? 0.870   25.425  36.094 1.00 136.52 ? 167  ARG A NE  1 
ATOM   1072 C CZ  . ARG A 1 167 ? 1.574   24.950  37.112 1.00 138.42 ? 167  ARG A CZ  1 
ATOM   1073 N NH1 . ARG A 1 167 ? 1.783   23.644  37.201 1.00 130.22 ? 167  ARG A NH1 1 
ATOM   1074 N NH2 . ARG A 1 167 ? 2.053   25.769  38.041 1.00 147.27 ? 167  ARG A NH2 1 
ATOM   1075 N N   . ILE A 1 168 ? -2.658  24.578  30.505 1.00 99.16  ? 168  ILE A N   1 
ATOM   1076 C CA  . ILE A 1 168 ? -2.804  24.107  29.137 1.00 96.72  ? 168  ILE A CA  1 
ATOM   1077 C C   . ILE A 1 168 ? -1.896  22.912  28.880 1.00 92.21  ? 168  ILE A C   1 
ATOM   1078 O O   . ILE A 1 168 ? -2.218  22.036  28.078 1.00 90.72  ? 168  ILE A O   1 
ATOM   1079 C CB  . ILE A 1 168 ? -2.454  25.216  28.131 1.00 97.04  ? 168  ILE A CB  1 
ATOM   1080 C CG1 . ILE A 1 168 ? -2.742  26.598  28.727 1.00 100.02 ? 168  ILE A CG1 1 
ATOM   1081 C CG2 . ILE A 1 168 ? -3.217  25.017  26.837 1.00 97.41  ? 168  ILE A CG2 1 
ATOM   1082 C CD1 . ILE A 1 168 ? -1.751  27.044  29.811 1.00 100.67 ? 168  ILE A CD1 1 
ATOM   1083 N N   . GLU A 1 169 ? -0.757  22.883  29.565 1.00 114.64 ? 169  GLU A N   1 
ATOM   1084 C CA  . GLU A 1 169 ? 0.214   21.805  29.409 1.00 111.10 ? 169  GLU A CA  1 
ATOM   1085 C C   . GLU A 1 169 ? -0.346  20.490  29.946 1.00 106.50 ? 169  GLU A C   1 
ATOM   1086 O O   . GLU A 1 169 ? -1.233  20.490  30.798 1.00 105.36 ? 169  GLU A O   1 
ATOM   1087 C CB  . GLU A 1 169 ? 1.528   22.164  30.106 1.00 112.03 ? 169  GLU A CB  1 
ATOM   1088 C CG  . GLU A 1 169 ? 2.242   23.375  29.506 1.00 117.65 ? 169  GLU A CG  1 
ATOM   1089 C CD  . GLU A 1 169 ? 1.534   24.696  29.786 1.00 120.21 ? 169  GLU A CD  1 
ATOM   1090 O OE1 . GLU A 1 169 ? 0.618   24.727  30.635 1.00 121.19 ? 169  GLU A OE1 1 
ATOM   1091 O OE2 . GLU A 1 169 ? 1.900   25.712  29.159 1.00 120.82 ? 169  GLU A OE2 1 
ATOM   1092 N N   . GLN A 1 170 ? 0.166   19.372  29.443 1.00 114.09 ? 170  GLN A N   1 
ATOM   1093 C CA  . GLN A 1 170 ? -0.390  18.071  29.788 1.00 111.66 ? 170  GLN A CA  1 
ATOM   1094 C C   . GLN A 1 170 ? 0.495   17.328  30.775 1.00 109.02 ? 170  GLN A C   1 
ATOM   1095 O O   . GLN A 1 170 ? 1.695   17.573  30.854 1.00 109.57 ? 170  GLN A O   1 
ATOM   1096 C CB  . GLN A 1 170 ? -0.564  17.235  28.527 1.00 115.26 ? 170  GLN A CB  1 
ATOM   1097 C CG  . GLN A 1 170 ? -0.796  18.069  27.290 1.00 119.16 ? 170  GLN A CG  1 
ATOM   1098 C CD  . GLN A 1 170 ? -1.640  17.348  26.272 1.00 121.16 ? 170  GLN A CD  1 
ATOM   1099 O OE1 . GLN A 1 170 ? -1.280  16.269  25.799 1.00 121.29 ? 170  GLN A OE1 1 
ATOM   1100 N NE2 . GLN A 1 170 ? -2.780  17.936  25.930 1.00 122.63 ? 170  GLN A NE2 1 
ATOM   1101 N N   . ILE A 1 171 ? -0.101  16.413  31.526 1.00 79.96  ? 171  ILE A N   1 
ATOM   1102 C CA  . ILE A 1 171 ? 0.665   15.599  32.454 1.00 78.20  ? 171  ILE A CA  1 
ATOM   1103 C C   . ILE A 1 171 ? 0.699   14.154  31.967 1.00 75.24  ? 171  ILE A C   1 
ATOM   1104 O O   . ILE A 1 171 ? -0.340  13.551  31.692 1.00 76.49  ? 171  ILE A O   1 
ATOM   1105 C CB  . ILE A 1 171 ? 0.089   15.690  33.871 1.00 76.03  ? 171  ILE A CB  1 
ATOM   1106 C CG1 . ILE A 1 171 ? -0.108  17.159  34.251 1.00 77.64  ? 171  ILE A CG1 1 
ATOM   1107 C CG2 . ILE A 1 171 ? 0.999   14.987  34.862 1.00 79.81  ? 171  ILE A CG2 1 
ATOM   1108 C CD1 . ILE A 1 171 ? -0.510  17.379  35.691 1.00 78.64  ? 171  ILE A CD1 1 
ATOM   1109 N N   . ILE A 1 172 ? 1.901   13.604  31.844 1.00 81.88  ? 172  ILE A N   1 
ATOM   1110 C CA  . ILE A 1 172 ? 2.054   12.287  31.237 1.00 76.05  ? 172  ILE A CA  1 
ATOM   1111 C C   . ILE A 1 172 ? 2.254   11.175  32.258 1.00 78.17  ? 172  ILE A C   1 
ATOM   1112 O O   . ILE A 1 172 ? 2.869   11.369  33.305 1.00 82.83  ? 172  ILE A O   1 
ATOM   1113 C CB  . ILE A 1 172 ? 3.191   12.265  30.204 1.00 77.49  ? 172  ILE A CB  1 
ATOM   1114 C CG1 . ILE A 1 172 ? 4.520   12.599  30.877 1.00 78.12  ? 172  ILE A CG1 1 
ATOM   1115 C CG2 . ILE A 1 172 ? 2.889   13.243  29.080 1.00 77.20  ? 172  ILE A CG2 1 
ATOM   1116 C CD1 . ILE A 1 172 ? 5.705   11.859  30.289 1.00 81.03  ? 172  ILE A CD1 1 
ATOM   1117 N N   . GLU A 1 173 ? 1.729   10.003  31.927 1.00 136.30 ? 173  GLU A N   1 
ATOM   1118 C CA  . GLU A 1 173 ? 1.704   8.880   32.847 1.00 137.07 ? 173  GLU A CA  1 
ATOM   1119 C C   . GLU A 1 173 ? 1.354   9.377   34.240 1.00 130.10 ? 173  GLU A C   1 
ATOM   1120 O O   . GLU A 1 173 ? 2.050   9.092   35.212 1.00 128.74 ? 173  GLU A O   1 
ATOM   1121 C CB  . GLU A 1 173 ? 3.040   8.136   32.849 1.00 141.27 ? 173  GLU A CB  1 
ATOM   1122 C CG  . GLU A 1 173 ? 4.202   8.936   33.399 1.00 136.62 ? 173  GLU A CG  1 
ATOM   1123 C CD  . GLU A 1 173 ? 5.474   8.124   33.473 1.00 141.23 ? 173  GLU A CD  1 
ATOM   1124 O OE1 . GLU A 1 173 ? 5.479   6.979   32.971 1.00 149.12 ? 173  GLU A OE1 1 
ATOM   1125 O OE2 . GLU A 1 173 ? 6.468   8.632   34.034 1.00 138.34 ? 173  GLU A OE2 1 
ATOM   1126 N N   . ALA A 1 174 ? 0.276   10.147  34.316 1.00 95.93  ? 174  ALA A N   1 
ATOM   1127 C CA  . ALA A 1 174 ? -0.243  10.604  35.589 1.00 91.85  ? 174  ALA A CA  1 
ATOM   1128 C C   . ALA A 1 174 ? -0.925  9.426   36.261 1.00 93.25  ? 174  ALA A C   1 
ATOM   1129 O O   . ALA A 1 174 ? -1.475  8.557   35.588 1.00 97.14  ? 174  ALA A O   1 
ATOM   1130 C CB  . ALA A 1 174 ? -1.227  11.743  35.376 1.00 90.10  ? 174  ALA A CB  1 
ATOM   1131 N N   . ASP A 1 175 ? -0.876  9.382   37.586 1.00 144.58 ? 175  ASP A N   1 
ATOM   1132 C CA  . ASP A 1 175 ? -1.562  8.328   38.319 1.00 146.21 ? 175  ASP A CA  1 
ATOM   1133 C C   . ASP A 1 175 ? -1.898  8.768   39.736 1.00 144.76 ? 175  ASP A C   1 
ATOM   1134 O O   . ASP A 1 175 ? -1.289  9.693   40.271 1.00 143.87 ? 175  ASP A O   1 
ATOM   1135 C CB  . ASP A 1 175 ? -0.743  7.035   38.321 1.00 150.20 ? 175  ASP A CB  1 
ATOM   1136 C CG  . ASP A 1 175 ? 0.514   7.140   39.153 1.00 149.39 ? 175  ASP A CG  1 
ATOM   1137 O OD1 . ASP A 1 175 ? 0.492   7.840   40.187 1.00 147.10 ? 175  ASP A OD1 1 
ATOM   1138 O OD2 . ASP A 1 175 ? 1.526   6.512   38.778 1.00 152.38 ? 175  ASP A OD2 1 
ATOM   1139 N N   . VAL A 1 176 ? -2.864  8.093   40.345 1.00 79.18  ? 176  VAL A N   1 
ATOM   1140 C CA  . VAL A 1 176 ? -3.424  8.565   41.597 1.00 79.47  ? 176  VAL A CA  1 
ATOM   1141 C C   . VAL A 1 176 ? -3.695  7.420   42.576 1.00 80.74  ? 176  VAL A C   1 
ATOM   1142 O O   . VAL A 1 176 ? -4.020  6.308   42.168 1.00 82.63  ? 176  VAL A O   1 
ATOM   1143 C CB  . VAL A 1 176 ? -4.706  9.390   41.325 1.00 80.58  ? 176  VAL A CB  1 
ATOM   1144 C CG1 . VAL A 1 176 ? -5.844  8.486   40.920 1.00 79.93  ? 176  VAL A CG1 1 
ATOM   1145 C CG2 . VAL A 1 176 ? -5.085  10.212  42.532 1.00 81.02  ? 176  VAL A CG2 1 
ATOM   1146 N N   . HIS A 1 177 ? -3.532  7.704   43.868 1.00 151.08 ? 177  HIS A N   1 
ATOM   1147 C CA  . HIS A 1 177 ? -3.790  6.735   44.931 1.00 154.69 ? 177  HIS A CA  1 
ATOM   1148 C C   . HIS A 1 177 ? -4.889  7.226   45.840 1.00 157.37 ? 177  HIS A C   1 
ATOM   1149 O O   . HIS A 1 177 ? -4.846  8.358   46.318 1.00 159.12 ? 177  HIS A O   1 
ATOM   1150 C CB  . HIS A 1 177 ? -2.550  6.530   45.789 1.00 156.21 ? 177  HIS A CB  1 
ATOM   1151 C CG  . HIS A 1 177 ? -1.453  5.798   45.093 1.00 155.45 ? 177  HIS A CG  1 
ATOM   1152 N ND1 . HIS A 1 177 ? -1.303  4.429   45.185 1.00 156.78 ? 177  HIS A ND1 1 
ATOM   1153 C CD2 . HIS A 1 177 ? -0.456  6.237   44.297 1.00 153.96 ? 177  HIS A CD2 1 
ATOM   1154 C CE1 . HIS A 1 177 ? -0.256  4.062   44.469 1.00 157.46 ? 177  HIS A CE1 1 
ATOM   1155 N NE2 . HIS A 1 177 ? 0.278   5.136   43.920 1.00 155.94 ? 177  HIS A NE2 1 
ATOM   1156 N N   . LEU A 1 178 ? -5.863  6.367   46.100 1.00 92.33  ? 178  LEU A N   1 
ATOM   1157 C CA  . LEU A 1 178 ? -6.925  6.716   47.023 1.00 95.99  ? 178  LEU A CA  1 
ATOM   1158 C C   . LEU A 1 178 ? -6.775  5.892   48.282 1.00 98.45  ? 178  LEU A C   1 
ATOM   1159 O O   . LEU A 1 178 ? -7.085  4.707   48.296 1.00 99.05  ? 178  LEU A O   1 
ATOM   1160 C CB  . LEU A 1 178 ? -8.293  6.478   46.396 1.00 95.08  ? 178  LEU A CB  1 
ATOM   1161 C CG  . LEU A 1 178 ? -9.417  7.201   47.133 1.00 98.73  ? 178  LEU A CG  1 
ATOM   1162 C CD1 . LEU A 1 178 ? -8.898  8.492   47.746 1.00 101.63 ? 178  LEU A CD1 1 
ATOM   1163 C CD2 . LEU A 1 178 ? -10.575 7.474   46.194 1.00 96.61  ? 178  LEU A CD2 1 
ATOM   1164 N N   . VAL A 1 179 ? -6.294  6.516   49.345 1.00 92.58  ? 179  VAL A N   1 
ATOM   1165 C CA  . VAL A 1 179 ? -6.024  5.763   50.554 1.00 94.72  ? 179  VAL A CA  1 
ATOM   1166 C C   . VAL A 1 179 ? -6.946  6.116   51.717 1.00 94.59  ? 179  VAL A C   1 
ATOM   1167 O O   . VAL A 1 179 ? -7.031  7.265   52.150 1.00 98.37  ? 179  VAL A O   1 
ATOM   1168 C CB  . VAL A 1 179 ? -4.548  5.861   50.961 1.00 93.87  ? 179  VAL A CB  1 
ATOM   1169 C CG1 . VAL A 1 179 ? -4.315  5.148   52.276 1.00 97.14  ? 179  VAL A CG1 1 
ATOM   1170 C CG2 . VAL A 1 179 ? -3.687  5.250   49.878 1.00 89.63  ? 179  VAL A CG2 1 
ATOM   1171 N N   . LEU A 1 180 ? -7.647  5.097   52.196 1.00 103.29 ? 180  LEU A N   1 
ATOM   1172 C CA  . LEU A 1 180 ? -8.471  5.195   53.384 1.00 109.75 ? 180  LEU A CA  1 
ATOM   1173 C C   . LEU A 1 180 ? -7.608  5.026   54.621 1.00 108.69 ? 180  LEU A C   1 
ATOM   1174 O O   . LEU A 1 180 ? -6.841  4.067   54.721 1.00 106.00 ? 180  LEU A O   1 
ATOM   1175 C CB  . LEU A 1 180 ? -9.534  4.100   53.351 1.00 111.62 ? 180  LEU A CB  1 
ATOM   1176 C CG  . LEU A 1 180 ? -10.032 3.612   54.709 1.00 116.73 ? 180  LEU A CG  1 
ATOM   1177 C CD1 . LEU A 1 180 ? -10.879 4.678   55.382 1.00 122.83 ? 180  LEU A CD1 1 
ATOM   1178 C CD2 . LEU A 1 180 ? -10.813 2.319   54.557 1.00 119.71 ? 180  LEU A CD2 1 
ATOM   1179 N N   . VAL A 1 181 ? -7.711  5.966   55.554 1.00 122.47 ? 181  VAL A N   1 
ATOM   1180 C CA  . VAL A 1 181 ? -7.039  5.816   56.837 1.00 122.58 ? 181  VAL A CA  1 
ATOM   1181 C C   . VAL A 1 181 ? -8.064  5.785   57.963 1.00 127.71 ? 181  VAL A C   1 
ATOM   1182 O O   . VAL A 1 181 ? -8.924  6.694   58.034 1.00 132.54 ? 181  VAL A O   1 
ATOM   1183 C CB  . VAL A 1 181 ? -6.000  6.930   57.094 1.00 122.44 ? 181  VAL A CB  1 
ATOM   1184 C CG1 . VAL A 1 181 ? -5.245  6.649   58.388 1.00 123.19 ? 181  VAL A CG1 1 
ATOM   1185 C CG2 . VAL A 1 181 ? -5.034  7.014   55.928 1.00 118.79 ? 181  VAL A CG2 1 
ATOM   1186 N N   . ARG A 1 182 ? -7.988  4.722   58.779 1.00 112.70 ? 182  ARG A N   1 
ATOM   1187 C CA  . ARG A 1 182 ? -8.958  4.586   59.859 1.00 118.21 ? 182  ARG A CA  1 
ATOM   1188 C C   . ARG A 1 182 ? -8.418  3.747   61.008 1.00 117.78 ? 182  ARG A C   1 
ATOM   1189 O O   . ARG A 1 182 ? -7.458  2.983   60.843 1.00 113.80 ? 182  ARG A O   1 
ATOM   1190 C CB  . ARG A 1 182 ? -10.244 3.956   59.338 1.00 114.33 ? 182  ARG A CB  1 
ATOM   1191 C CG  . ARG A 1 182 ? -10.058 2.497   59.011 1.00 111.80 ? 182  ARG A CG  1 
ATOM   1192 C CD  . ARG A 1 182 ? -11.378 1.811   58.803 1.00 117.64 ? 182  ARG A CD  1 
ATOM   1193 N NE  . ARG A 1 182 ? -11.160 0.415   58.457 1.00 115.85 ? 182  ARG A NE  1 
ATOM   1194 C CZ  . ARG A 1 182 ? -11.965 -0.293  57.676 1.00 119.11 ? 182  ARG A CZ  1 
ATOM   1195 N NH1 . ARG A 1 182 ? -13.046 0.272   57.159 1.00 124.44 ? 182  ARG A NH1 1 
ATOM   1196 N NH2 . ARG A 1 182 ? -11.686 -1.562  57.405 1.00 118.19 ? 182  ARG A NH2 1 
ATOM   1197 N N   . SER A 1 183 ? -9.073  3.856   62.161 1.00 114.75 ? 183  SER A N   1 
ATOM   1198 C CA  . SER A 1 183 ? -8.652  3.142   63.360 1.00 118.81 ? 183  SER A CA  1 
ATOM   1199 C C   . SER A 1 183 ? -9.226  1.733   63.393 1.00 128.72 ? 183  SER A C   1 
ATOM   1200 O O   . SER A 1 183 ? -10.346 1.502   62.934 1.00 133.06 ? 183  SER A O   1 
ATOM   1201 C CB  . SER A 1 183 ? -9.091  3.899   64.611 1.00 117.96 ? 183  SER A CB  1 
ATOM   1202 O OG  . SER A 1 183 ? -8.826  5.285   64.480 1.00 110.28 ? 183  SER A OG  1 
ATOM   1203 N N   . GLU A 1 184 ? -8.450  0.798   63.932 1.00 134.26 ? 184  GLU A N   1 
ATOM   1204 C CA  . GLU A 1 184 ? -8.873  -0.591  64.024 1.00 145.11 ? 184  GLU A CA  1 
ATOM   1205 C C   . GLU A 1 184 ? -8.495  -1.190  65.362 1.00 150.69 ? 184  GLU A C   1 
ATOM   1206 O O   . GLU A 1 184 ? -7.555  -0.740  66.006 1.00 145.10 ? 184  GLU A O   1 
ATOM   1207 C CB  . GLU A 1 184 ? -8.234  -1.405  62.919 1.00 147.08 ? 184  GLU A CB  1 
ATOM   1208 C CG  . GLU A 1 184 ? -8.451  -0.808  61.574 1.00 141.34 ? 184  GLU A CG  1 
ATOM   1209 C CD  . GLU A 1 184 ? -8.231  -1.818  60.502 1.00 146.33 ? 184  GLU A CD  1 
ATOM   1210 O OE1 . GLU A 1 184 ? -7.183  -2.493  60.547 1.00 148.11 ? 184  GLU A OE1 1 
ATOM   1211 O OE2 . GLU A 1 184 ? -9.111  -1.946  59.630 1.00 148.75 ? 184  GLU A OE2 1 
ATOM   1212 N N   . ILE A 1 185 ? -9.260  -2.176  65.810 1.00 127.99 ? 185  ILE A N   1 
ATOM   1213 C CA  . ILE A 1 185 ? -8.941  -2.849  67.057 1.00 131.82 ? 185  ILE A CA  1 
ATOM   1214 C C   . ILE A 1 185 ? -8.314  -4.195  66.767 1.00 137.06 ? 185  ILE A C   1 
ATOM   1215 O O   . ILE A 1 185 ? -8.845  -4.982  65.982 1.00 140.06 ? 185  ILE A O   1 
ATOM   1216 C CB  . ILE A 1 185 ? -10.180 -3.053  67.928 1.00 133.69 ? 185  ILE A CB  1 
ATOM   1217 C CG1 . ILE A 1 185 ? -10.712 -1.700  68.375 1.00 128.56 ? 185  ILE A CG1 1 
ATOM   1218 C CG2 . ILE A 1 185 ? -9.833  -3.892  69.142 1.00 137.65 ? 185  ILE A CG2 1 
ATOM   1219 C CD1 . ILE A 1 185 ? -9.655  -0.852  69.018 1.00 124.34 ? 185  ILE A CD1 1 
ATOM   1220 N N   . SER A 1 186 ? -7.173  -4.449  67.393 1.00 175.80 ? 186  SER A N   1 
ATOM   1221 C CA  . SER A 1 186 ? -6.516  -5.738  67.276 1.00 178.68 ? 186  SER A CA  1 
ATOM   1222 C C   . SER A 1 186 ? -7.251  -6.745  68.152 1.00 179.38 ? 186  SER A C   1 
ATOM   1223 O O   . SER A 1 186 ? -8.012  -6.356  69.039 1.00 178.58 ? 186  SER A O   1 
ATOM   1224 C CB  . SER A 1 186 ? -5.059  -5.614  67.714 1.00 178.91 ? 186  SER A CB  1 
ATOM   1225 O OG  . SER A 1 186 ? -4.436  -6.879  67.761 1.00 180.41 ? 186  SER A OG  1 
ATOM   1226 N N   . GLN A 1 187 ? -7.047  -8.036  67.898 1.00 218.78 ? 187  GLN A N   1 
ATOM   1227 C CA  . GLN A 1 187 ? -7.595  -9.059  68.782 1.00 220.93 ? 187  GLN A CA  1 
ATOM   1228 C C   . GLN A 1 187 ? -7.097  -8.769  70.193 1.00 220.87 ? 187  GLN A C   1 
ATOM   1229 O O   . GLN A 1 187 ? -7.852  -8.848  71.162 1.00 221.50 ? 187  GLN A O   1 
ATOM   1230 C CB  . GLN A 1 187 ? -7.158  -10.462 68.349 1.00 224.12 ? 187  GLN A CB  1 
ATOM   1231 C CG  . GLN A 1 187 ? -7.648  -10.897 66.969 1.00 224.46 ? 187  GLN A CG  1 
ATOM   1232 C CD  . GLN A 1 187 ? -7.134  -12.275 66.576 1.00 227.92 ? 187  GLN A CD  1 
ATOM   1233 O OE1 . GLN A 1 187 ? -6.599  -13.011 67.406 1.00 230.81 ? 187  GLN A OE1 1 
ATOM   1234 N NE2 . GLN A 1 187 ? -7.294  -12.628 65.305 1.00 228.02 ? 187  GLN A NE2 1 
ATOM   1235 N N   . GLU A 1 188 ? -5.817  -8.418  70.289 1.00 211.88 ? 188  GLU A N   1 
ATOM   1236 C CA  . GLU A 1 188 ? -5.193  -8.040  71.554 1.00 211.52 ? 188  GLU A CA  1 
ATOM   1237 C C   . GLU A 1 188 ? -5.754  -6.725  72.084 1.00 208.74 ? 188  GLU A C   1 
ATOM   1238 O O   . GLU A 1 188 ? -5.421  -6.301  73.188 1.00 208.15 ? 188  GLU A O   1 
ATOM   1239 C CB  . GLU A 1 188 ? -3.676  -7.909  71.388 1.00 211.50 ? 188  GLU A CB  1 
ATOM   1240 C CG  . GLU A 1 188 ? -2.965  -9.184  70.965 1.00 214.46 ? 188  GLU A CG  1 
ATOM   1241 C CD  . GLU A 1 188 ? -3.116  -9.481  69.487 1.00 214.49 ? 188  GLU A CD  1 
ATOM   1242 O OE1 . GLU A 1 188 ? -3.308  -8.530  68.705 1.00 212.22 ? 188  GLU A OE1 1 
ATOM   1243 O OE2 . GLU A 1 188 ? -3.033  -10.665 69.105 1.00 217.22 ? 188  GLU A OE2 1 
ATOM   1244 N N   . GLY A 1 189 ? -6.592  -6.072  71.286 1.00 158.89 ? 189  GLY A N   1 
ATOM   1245 C CA  . GLY A 1 189 ? -7.230  -4.837  71.702 1.00 156.82 ? 189  GLY A CA  1 
ATOM   1246 C C   . GLY A 1 189 ? -6.347  -3.601  71.652 1.00 154.23 ? 189  GLY A C   1 
ATOM   1247 O O   . GLY A 1 189 ? -6.533  -2.674  72.440 1.00 150.34 ? 189  GLY A O   1 
ATOM   1248 N N   . MET A 1 190 ? -5.379  -3.585  70.739 1.00 173.18 ? 190  MET A N   1 
ATOM   1249 C CA  . MET A 1 190 ? -4.631  -2.363  70.463 1.00 164.58 ? 190  MET A CA  1 
ATOM   1250 C C   . MET A 1 190 ? -5.454  -1.535  69.485 1.00 158.40 ? 190  MET A C   1 
ATOM   1251 O O   . MET A 1 190 ? -5.866  -2.040  68.441 1.00 161.10 ? 190  MET A O   1 
ATOM   1252 C CB  . MET A 1 190 ? -3.256  -2.681  69.870 1.00 161.09 ? 190  MET A CB  1 
ATOM   1253 N N   . VAL A 1 191 ? -5.718  -0.276  69.825 1.00 129.07 ? 191  VAL A N   1 
ATOM   1254 C CA  . VAL A 1 191 ? -6.504  0.590   68.943 1.00 123.53 ? 191  VAL A CA  1 
ATOM   1255 C C   . VAL A 1 191 ? -5.628  1.564   68.152 1.00 112.75 ? 191  VAL A C   1 
ATOM   1256 O O   . VAL A 1 191 ? -5.265  2.635   68.637 1.00 112.85 ? 191  VAL A O   1 
ATOM   1257 C CB  . VAL A 1 191 ? -7.628  1.344   69.700 1.00 124.08 ? 191  VAL A CB  1 
ATOM   1258 C CG1 . VAL A 1 191 ? -7.063  2.195   70.826 1.00 119.47 ? 191  VAL A CG1 1 
ATOM   1259 C CG2 . VAL A 1 191 ? -8.449  2.184   68.731 1.00 119.30 ? 191  VAL A CG2 1 
ATOM   1260 N N   . PHE A 1 192 ? -5.308  1.178   66.921 1.00 146.96 ? 192  PHE A N   1 
ATOM   1261 C CA  . PHE A 1 192 ? -4.328  1.892   66.109 1.00 138.12 ? 192  PHE A CA  1 
ATOM   1262 C C   . PHE A 1 192 ? -4.909  2.449   64.807 1.00 134.06 ? 192  PHE A C   1 
ATOM   1263 O O   . PHE A 1 192 ? -6.048  2.154   64.446 1.00 138.28 ? 192  PHE A O   1 
ATOM   1264 C CB  . PHE A 1 192 ? -3.185  0.945   65.762 1.00 139.81 ? 192  PHE A CB  1 
ATOM   1265 C CG  . PHE A 1 192 ? -3.632  -0.293  65.032 1.00 147.57 ? 192  PHE A CG  1 
ATOM   1266 C CD1 . PHE A 1 192 ? -3.620  -0.340  63.647 1.00 145.31 ? 192  PHE A CD1 1 
ATOM   1267 C CD2 . PHE A 1 192 ? -4.075  -1.407  65.729 1.00 157.95 ? 192  PHE A CD2 1 
ATOM   1268 C CE1 . PHE A 1 192 ? -4.033  -1.478  62.968 1.00 153.07 ? 192  PHE A CE1 1 
ATOM   1269 C CE2 . PHE A 1 192 ? -4.490  -2.549  65.056 1.00 166.33 ? 192  PHE A CE2 1 
ATOM   1270 C CZ  . PHE A 1 192 ? -4.469  -2.583  63.675 1.00 163.78 ? 192  PHE A CZ  1 
ATOM   1271 N N   . ARG A 1 193 ? -4.106  3.254   64.111 1.00 165.77 ? 193  ARG A N   1 
ATOM   1272 C CA  . ARG A 1 193 ? -4.437  3.744   62.772 1.00 162.20 ? 193  ARG A CA  1 
ATOM   1273 C C   . ARG A 1 193 ? -3.776  2.867   61.704 1.00 163.57 ? 193  ARG A C   1 
ATOM   1274 O O   . ARG A 1 193 ? -2.566  2.641   61.752 1.00 161.33 ? 193  ARG A O   1 
ATOM   1275 C CB  . ARG A 1 193 ? -3.989  5.204   62.591 1.00 154.36 ? 193  ARG A CB  1 
ATOM   1276 C CG  . ARG A 1 193 ? -4.751  6.222   63.424 1.00 152.91 ? 193  ARG A CG  1 
ATOM   1277 C CD  . ARG A 1 193 ? -6.112  6.545   62.823 1.00 154.46 ? 193  ARG A CD  1 
ATOM   1278 N NE  . ARG A 1 193 ? -6.030  7.435   61.666 1.00 149.84 ? 193  ARG A NE  1 
ATOM   1279 C CZ  . ARG A 1 193 ? -7.074  7.760   60.908 1.00 150.55 ? 193  ARG A CZ  1 
ATOM   1280 N NH1 . ARG A 1 193 ? -8.269  7.263   61.189 1.00 155.42 ? 193  ARG A NH1 1 
ATOM   1281 N NH2 . ARG A 1 193 ? -6.926  8.576   59.871 1.00 150.38 ? 193  ARG A NH2 1 
ATOM   1282 N N   . ARG A 1 194 ? -4.561  2.378   60.744 1.00 146.01 ? 194  ARG A N   1 
ATOM   1283 C CA  . ARG A 1 194 ? -4.044  1.503   59.682 1.00 143.71 ? 194  ARG A CA  1 
ATOM   1284 C C   . ARG A 1 194 ? -4.443  2.072   58.290 1.00 141.27 ? 194  ARG A C   1 
ATOM   1285 O O   . ARG A 1 194 ? -5.508  2.661   58.166 1.00 142.02 ? 194  ARG A O   1 
ATOM   1286 C CB  . ARG A 1 194 ? -4.639  0.104   59.837 1.00 144.98 ? 194  ARG A CB  1 
ATOM   1287 C CG  . ARG A 1 194 ? -3.836  -1.018  59.179 1.00 144.60 ? 194  ARG A CG  1 
ATOM   1288 C CD  . ARG A 1 194 ? -4.522  -2.381  59.363 1.00 147.06 ? 194  ARG A CD  1 
ATOM   1289 N NE  . ARG A 1 194 ? -3.593  -3.513  59.395 1.00 149.14 ? 194  ARG A NE  1 
ATOM   1290 C CZ  . ARG A 1 194 ? -3.853  -4.687  59.974 1.00 152.74 ? 194  ARG A CZ  1 
ATOM   1291 N NH1 . ARG A 1 194 ? -5.009  -4.902  60.596 1.00 154.50 ? 194  ARG A NH1 1 
ATOM   1292 N NH2 . ARG A 1 194 ? -2.945  -5.652  59.943 1.00 155.81 ? 194  ARG A NH2 1 
ATOM   1293 N N   . PHE A 1 195 ? -3.625  1.961   57.236 1.00 145.60 ? 195  PHE A N   1 
ATOM   1294 C CA  . PHE A 1 195 ? -3.873  2.514   55.879 1.00 143.39 ? 195  PHE A CA  1 
ATOM   1295 C C   . PHE A 1 195 ? -4.381  1.450   54.906 1.00 142.50 ? 195  PHE A C   1 
ATOM   1296 O O   . PHE A 1 195 ? -3.806  0.376   54.815 1.00 142.92 ? 195  PHE A O   1 
ATOM   1297 C CB  . PHE A 1 195 ? -2.577  3.096   55.291 1.00 142.64 ? 195  PHE A CB  1 
ATOM   1298 C CG  . PHE A 1 195 ? -2.042  4.308   56.016 1.00 144.49 ? 195  PHE A CG  1 
ATOM   1299 C CD1 . PHE A 1 195 ? -1.561  5.373   55.282 1.00 144.49 ? 195  PHE A CD1 1 
ATOM   1300 C CD2 . PHE A 1 195 ? -1.992  4.383   57.410 1.00 146.99 ? 195  PHE A CD2 1 
ATOM   1301 C CE1 . PHE A 1 195 ? -1.048  6.501   55.897 1.00 147.40 ? 195  PHE A CE1 1 
ATOM   1302 C CE2 . PHE A 1 195 ? -1.473  5.530   58.045 1.00 149.65 ? 195  PHE A CE2 1 
ATOM   1303 C CZ  . PHE A 1 195 ? -1.002  6.584   57.279 1.00 150.09 ? 195  PHE A CZ  1 
ATOM   1304 N N   . HIS A 1 196 ? -5.439  1.770   54.160 1.00 137.27 ? 196  HIS A N   1 
ATOM   1305 C CA  . HIS A 1 196 ? -5.921  0.921   53.065 1.00 137.08 ? 196  HIS A CA  1 
ATOM   1306 C C   . HIS A 1 196 ? -5.889  1.610   51.699 1.00 133.84 ? 196  HIS A C   1 
ATOM   1307 O O   . HIS A 1 196 ? -6.624  2.576   51.468 1.00 133.69 ? 196  HIS A O   1 
ATOM   1308 C CB  . HIS A 1 196 ? -7.360  0.485   53.323 1.00 140.70 ? 196  HIS A CB  1 
ATOM   1309 C CG  . HIS A 1 196 ? -7.513  -0.494  54.436 1.00 143.36 ? 196  HIS A CG  1 
ATOM   1310 N ND1 . HIS A 1 196 ? -7.692  -0.116  55.748 1.00 145.14 ? 196  HIS A ND1 1 
ATOM   1311 C CD2 . HIS A 1 196 ? -7.540  -1.852  54.431 1.00 145.25 ? 196  HIS A CD2 1 
ATOM   1312 C CE1 . HIS A 1 196 ? -7.815  -1.193  56.505 1.00 147.63 ? 196  HIS A CE1 1 
ATOM   1313 N NE2 . HIS A 1 196 ? -7.725  -2.256  55.724 1.00 147.92 ? 196  HIS A NE2 1 
ATOM   1314 N N   . ASP A 1 197 ? -5.056  1.115   50.788 1.00 152.28 ? 197  ASP A N   1 
ATOM   1315 C CA  . ASP A 1 197 ? -5.130  1.588   49.413 1.00 149.22 ? 197  ASP A CA  1 
ATOM   1316 C C   . ASP A 1 197 ? -6.389  0.993   48.774 1.00 151.56 ? 197  ASP A C   1 
ATOM   1317 O O   . ASP A 1 197 ? -6.636  -0.206  48.875 1.00 155.22 ? 197  ASP A O   1 
ATOM   1318 C CB  . ASP A 1 197 ? -3.866  1.232   48.624 1.00 147.62 ? 197  ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 197 ? -3.500  2.302   47.588 1.00 144.12 ? 197  ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 197 ? -4.412  2.816   46.903 1.00 143.32 ? 197  ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 197 ? -2.300  2.637   47.456 1.00 142.94 ? 197  ASP A OD2 1 
ATOM   1322 N N   . LEU A 1 198 ? -7.192  1.842   48.137 1.00 97.43  ? 198  LEU A N   1 
ATOM   1323 C CA  . LEU A 1 198 ? -8.487  1.431   47.593 1.00 100.96 ? 198  LEU A CA  1 
ATOM   1324 C C   . LEU A 1 198 ? -8.437  1.228   46.082 1.00 100.61 ? 198  LEU A C   1 
ATOM   1325 O O   . LEU A 1 198 ? -8.148  2.161   45.337 1.00 97.27  ? 198  LEU A O   1 
ATOM   1326 C CB  . LEU A 1 198 ? -9.555  2.478   47.920 1.00 102.45 ? 198  LEU A CB  1 
ATOM   1327 C CG  . LEU A 1 198 ? -9.712  2.893   49.381 1.00 104.59 ? 198  LEU A CG  1 
ATOM   1328 C CD1 . LEU A 1 198 ? -10.846 3.897   49.530 1.00 108.18 ? 198  LEU A CD1 1 
ATOM   1329 C CD2 . LEU A 1 198 ? -9.951  1.672   50.247 1.00 108.40 ? 198  LEU A CD2 1 
ATOM   1330 N N   . THR A 1 199 ? -8.732  0.014   45.629 1.00 115.83 ? 199  THR A N   1 
ATOM   1331 C CA  . THR A 1 199 ? -8.677  -0.292  44.204 1.00 117.03 ? 199  THR A CA  1 
ATOM   1332 C C   . THR A 1 199 ? -9.503  0.704   43.415 1.00 116.66 ? 199  THR A C   1 
ATOM   1333 O O   . THR A 1 199 ? -10.696 0.872   43.668 1.00 117.46 ? 199  THR A O   1 
ATOM   1334 C CB  . THR A 1 199 ? -9.216  -1.698  43.889 1.00 121.38 ? 199  THR A CB  1 
ATOM   1335 O OG1 . THR A 1 199 ? -8.773  -2.626  44.884 1.00 122.14 ? 199  THR A OG1 1 
ATOM   1336 C CG2 . THR A 1 199 ? -8.726  -2.158  42.531 1.00 120.53 ? 199  THR A CG2 1 
ATOM   1337 N N   . LEU A 1 200 ? -8.859  1.360   42.456 1.00 94.03  ? 200  LEU A N   1 
ATOM   1338 C CA  . LEU A 1 200 ? -9.539  2.290   41.562 1.00 90.59  ? 200  LEU A CA  1 
ATOM   1339 C C   . LEU A 1 200 ? -9.835  1.622   40.230 1.00 96.94  ? 200  LEU A C   1 
ATOM   1340 O O   . LEU A 1 200 ? -9.015  0.857   39.721 1.00 97.17  ? 200  LEU A O   1 
ATOM   1341 C CB  . LEU A 1 200 ? -8.676  3.525   41.315 1.00 83.74  ? 200  LEU A CB  1 
ATOM   1342 C CG  . LEU A 1 200 ? -8.222  4.291   42.553 1.00 81.37  ? 200  LEU A CG  1 
ATOM   1343 C CD1 . LEU A 1 200 ? -7.437  5.504   42.126 1.00 79.68  ? 200  LEU A CD1 1 
ATOM   1344 C CD2 . LEU A 1 200 ? -9.423  4.688   43.402 1.00 81.85  ? 200  LEU A CD2 1 
ATOM   1345 N N   . THR A 1 201 ? -11.000 1.910   39.658 1.00 112.34 ? 201  THR A N   1 
ATOM   1346 C CA  . THR A 1 201 ? -11.321 1.373   38.343 1.00 117.97 ? 201  THR A CA  1 
ATOM   1347 C C   . THR A 1 201 ? -10.259 1.848   37.360 1.00 114.70 ? 201  THR A C   1 
ATOM   1348 O O   . THR A 1 201 ? -9.953  1.165   36.389 1.00 115.70 ? 201  THR A O   1 
ATOM   1349 C CB  . THR A 1 201 ? -12.719 1.799   37.846 1.00 121.45 ? 201  THR A CB  1 
ATOM   1350 O OG1 . THR A 1 201 ? -12.646 3.098   37.251 1.00 114.98 ? 201  THR A OG1 1 
ATOM   1351 C CG2 . THR A 1 201 ? -13.718 1.824   38.983 1.00 119.19 ? 201  THR A CG2 1 
ATOM   1352 N N   . ARG A 1 202 ? -9.687  3.019   37.624 1.00 127.21 ? 202  ARG A N   1 
ATOM   1353 C CA  . ARG A 1 202 ? -8.630  3.550   36.770 1.00 124.71 ? 202  ARG A CA  1 
ATOM   1354 C C   . ARG A 1 202 ? -7.596  4.350   37.555 1.00 117.97 ? 202  ARG A C   1 
ATOM   1355 O O   . ARG A 1 202 ? -7.873  5.443   38.045 1.00 111.56 ? 202  ARG A O   1 
ATOM   1356 C CB  . ARG A 1 202 ? -9.222  4.394   35.646 1.00 125.36 ? 202  ARG A CB  1 
ATOM   1357 C CG  . ARG A 1 202 ? -8.218  4.780   34.589 1.00 124.22 ? 202  ARG A CG  1 
ATOM   1358 C CD  . ARG A 1 202 ? -8.882  5.572   33.485 1.00 125.41 ? 202  ARG A CD  1 
ATOM   1359 N NE  . ARG A 1 202 ? -7.899  6.255   32.653 1.00 123.72 ? 202  ARG A NE  1 
ATOM   1360 C CZ  . ARG A 1 202 ? -7.281  5.692   31.621 1.00 123.66 ? 202  ARG A CZ  1 
ATOM   1361 N NH1 . ARG A 1 202 ? -7.545  4.433   31.294 1.00 124.97 ? 202  ARG A NH1 1 
ATOM   1362 N NH2 . ARG A 1 202 ? -6.398  6.387   30.915 1.00 121.93 ? 202  ARG A NH2 1 
ATOM   1363 N N   . SER A 1 203 ? -6.394  3.792   37.649 1.00 103.78 ? 203  SER A N   1 
ATOM   1364 C CA  . SER A 1 203 ? -5.349  4.322   38.513 1.00 98.28  ? 203  SER A CA  1 
ATOM   1365 C C   . SER A 1 203 ? -4.237  5.017   37.723 1.00 96.21  ? 203  SER A C   1 
ATOM   1366 O O   . SER A 1 203 ? -3.526  5.875   38.245 1.00 90.96  ? 203  SER A O   1 
ATOM   1367 C CB  . SER A 1 203 ? -4.779  3.183   39.357 1.00 100.29 ? 203  SER A CB  1 
ATOM   1368 O OG  . SER A 1 203 ? -3.608  3.585   40.036 1.00 96.92  ? 203  SER A OG  1 
ATOM   1369 N N   . ARG A 1 204 ? -4.094  4.630   36.462 1.00 115.53 ? 204  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 204 ? -3.170  5.283   35.544 1.00 114.96 ? 204  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 204 ? -3.926  6.080   34.500 1.00 115.73 ? 204  ARG A C   1 
ATOM   1372 O O   . ARG A 1 204 ? -4.983  5.668   34.031 1.00 117.03 ? 204  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 204 ? -2.314  4.247   34.821 1.00 116.41 ? 204  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 204 ? -0.853  4.260   35.193 1.00 117.91 ? 204  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 204 ? -0.184  5.557   34.770 1.00 116.33 ? 204  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 204 ? 1.271   5.447   34.833 1.00 118.03 ? 204  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 204 ? 1.942   5.057   35.914 1.00 117.56 ? 204  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 204 ? 1.290   4.721   37.022 1.00 115.23 ? 204  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 204 ? 3.267   4.986   35.886 1.00 119.12 ? 204  ARG A NH2 1 
ATOM   1380 N N   . SER A 1 205 ? -3.377  7.227   34.137 1.00 113.72 ? 205  SER A N   1 
ATOM   1381 C CA  . SER A 1 205 ? -3.843  7.964   32.974 1.00 115.15 ? 205  SER A CA  1 
ATOM   1382 C C   . SER A 1 205 ? -2.607  8.449   32.244 1.00 115.86 ? 205  SER A C   1 
ATOM   1383 O O   . SER A 1 205 ? -2.013  9.455   32.633 1.00 109.85 ? 205  SER A O   1 
ATOM   1384 C CB  . SER A 1 205 ? -4.706  9.155   33.383 1.00 108.79 ? 205  SER A CB  1 
ATOM   1385 O OG  . SER A 1 205 ? -4.795  10.095  32.326 1.00 109.20 ? 205  SER A OG  1 
ATOM   1386 N N   . PRO A 1 206 ? -2.190  7.722   31.196 1.00 138.22 ? 206  PRO A N   1 
ATOM   1387 C CA  . PRO A 1 206 ? -0.928  8.112   30.562 1.00 137.86 ? 206  PRO A CA  1 
ATOM   1388 C C   . PRO A 1 206 ? -0.931  9.561   30.065 1.00 136.70 ? 206  PRO A C   1 
ATOM   1389 O O   . PRO A 1 206 ? 0.131   10.177  30.018 1.00 136.09 ? 206  PRO A O   1 
ATOM   1390 C CB  . PRO A 1 206 ? -0.794  7.115   29.407 1.00 137.61 ? 206  PRO A CB  1 
ATOM   1391 C CG  . PRO A 1 206 ? -1.550  5.907   29.881 1.00 138.61 ? 206  PRO A CG  1 
ATOM   1392 C CD  . PRO A 1 206 ? -2.727  6.469   30.636 1.00 138.13 ? 206  PRO A CD  1 
ATOM   1393 N N   . ILE A 1 207 ? -2.097  10.104  29.722 1.00 93.14  ? 207  ILE A N   1 
ATOM   1394 C CA  . ILE A 1 207 ? -2.179  11.499  29.271 1.00 91.02  ? 207  ILE A CA  1 
ATOM   1395 C C   . ILE A 1 207 ? -3.328  12.276  29.923 1.00 86.09  ? 207  ILE A C   1 
ATOM   1396 O O   . ILE A 1 207 ? -4.446  12.319  29.405 1.00 88.79  ? 207  ILE A O   1 
ATOM   1397 C CB  . ILE A 1 207 ? -2.266  11.603  27.727 1.00 91.80  ? 207  ILE A CB  1 
ATOM   1398 C CG1 . ILE A 1 207 ? -0.890  11.367  27.103 1.00 90.29  ? 207  ILE A CG1 1 
ATOM   1399 C CG2 . ILE A 1 207 ? -2.794  12.969  27.300 1.00 92.38  ? 207  ILE A CG2 1 
ATOM   1400 C CD1 . ILE A 1 207 ? -0.941  10.911  25.661 1.00 91.02  ? 207  ILE A CD1 1 
ATOM   1401 N N   . PHE A 1 208 ? -3.032  12.882  31.068 1.00 112.81 ? 208  PHE A N   1 
ATOM   1402 C CA  . PHE A 1 208 ? -3.994  13.690  31.811 1.00 109.23 ? 208  PHE A CA  1 
ATOM   1403 C C   . PHE A 1 208 ? -3.922  15.126  31.324 1.00 109.18 ? 208  PHE A C   1 
ATOM   1404 O O   . PHE A 1 208 ? -2.863  15.748  31.380 1.00 108.49 ? 208  PHE A O   1 
ATOM   1405 C CB  . PHE A 1 208 ? -3.684  13.624  33.310 1.00 105.50 ? 208  PHE A CB  1 
ATOM   1406 C CG  . PHE A 1 208 ? -4.539  14.527  34.158 1.00 104.13 ? 208  PHE A CG  1 
ATOM   1407 C CD1 . PHE A 1 208 ? -5.915  14.529  34.025 1.00 105.08 ? 208  PHE A CD1 1 
ATOM   1408 C CD2 . PHE A 1 208 ? -3.966  15.353  35.107 1.00 103.63 ? 208  PHE A CD2 1 
ATOM   1409 C CE1 . PHE A 1 208 ? -6.701  15.352  34.810 1.00 105.37 ? 208  PHE A CE1 1 
ATOM   1410 C CE2 . PHE A 1 208 ? -4.747  16.175  35.895 1.00 105.21 ? 208  PHE A CE2 1 
ATOM   1411 C CZ  . PHE A 1 208 ? -6.116  16.175  35.746 1.00 105.97 ? 208  PHE A CZ  1 
ATOM   1412 N N   . SER A 1 209 ? -5.043  15.654  30.842 1.00 124.22 ? 209  SER A N   1 
ATOM   1413 C CA  . SER A 1 209 ? -5.026  16.976  30.222 1.00 125.79 ? 209  SER A CA  1 
ATOM   1414 C C   . SER A 1 209 ? -6.148  17.926  30.628 1.00 126.16 ? 209  SER A C   1 
ATOM   1415 O O   . SER A 1 209 ? -5.977  19.136  30.539 1.00 127.90 ? 209  SER A O   1 
ATOM   1416 C CB  . SER A 1 209 ? -4.944  16.864  28.693 1.00 130.58 ? 209  SER A CB  1 
ATOM   1417 O OG  . SER A 1 209 ? -5.660  15.739  28.213 1.00 133.93 ? 209  SER A OG  1 
ATOM   1418 N N   . LEU A 1 210 ? -7.288  17.403  31.069 1.00 98.38  ? 210  LEU A N   1 
ATOM   1419 C CA  . LEU A 1 210 ? -8.405  18.280  31.435 1.00 99.95  ? 210  LEU A CA  1 
ATOM   1420 C C   . LEU A 1 210 ? -9.026  17.951  32.794 1.00 98.61  ? 210  LEU A C   1 
ATOM   1421 O O   . LEU A 1 210 ? -8.753  18.620  33.790 1.00 99.47  ? 210  LEU A O   1 
ATOM   1422 C CB  . LEU A 1 210 ? -9.478  18.268  30.345 1.00 103.26 ? 210  LEU A CB  1 
ATOM   1423 C CG  . LEU A 1 210 ? -8.956  18.298  28.908 1.00 106.33 ? 210  LEU A CG  1 
ATOM   1424 C CD1 . LEU A 1 210 ? -10.098 18.098  27.934 1.00 110.99 ? 210  LEU A CD1 1 
ATOM   1425 C CD2 . LEU A 1 210 ? -8.217  19.590  28.606 1.00 107.75 ? 210  LEU A CD2 1 
ATOM   1426 N N   . SER A 1 211 ? -9.876  16.932  32.828 1.00 117.42 ? 211  SER A N   1 
ATOM   1427 C CA  . SER A 1 211 ? -10.454 16.481  34.085 1.00 116.62 ? 211  SER A CA  1 
ATOM   1428 C C   . SER A 1 211 ? -10.430 14.963  34.177 1.00 115.16 ? 211  SER A C   1 
ATOM   1429 O O   . SER A 1 211 ? -10.527 14.263  33.170 1.00 116.77 ? 211  SER A O   1 
ATOM   1430 C CB  . SER A 1 211 ? -11.883 16.990  34.245 1.00 119.59 ? 211  SER A CB  1 
ATOM   1431 O OG  . SER A 1 211 ? -12.442 16.532  35.464 1.00 119.78 ? 211  SER A OG  1 
ATOM   1432 N N   . TRP A 1 212 ? -10.303 14.459  35.396 1.00 93.47  ? 212  TRP A N   1 
ATOM   1433 C CA  . TRP A 1 212 ? -10.259 13.027  35.627 1.00 93.16  ? 212  TRP A CA  1 
ATOM   1434 C C   . TRP A 1 212 ? -11.102 12.702  36.846 1.00 93.80  ? 212  TRP A C   1 
ATOM   1435 O O   . TRP A 1 212 ? -10.852 13.218  37.931 1.00 93.78  ? 212  TRP A O   1 
ATOM   1436 C CB  . TRP A 1 212 ? -8.806  12.584  35.822 1.00 91.36  ? 212  TRP A CB  1 
ATOM   1437 C CG  . TRP A 1 212 ? -8.617  11.121  36.082 1.00 92.35  ? 212  TRP A CG  1 
ATOM   1438 C CD1 . TRP A 1 212 ? -9.576  10.151  36.052 1.00 95.24  ? 212  TRP A CD1 1 
ATOM   1439 C CD2 . TRP A 1 212 ? -7.380  10.454  36.375 1.00 91.83  ? 212  TRP A CD2 1 
ATOM   1440 N NE1 . TRP A 1 212 ? -9.018  8.928   36.330 1.00 97.10  ? 212  TRP A NE1 1 
ATOM   1441 C CE2 . TRP A 1 212 ? -7.671  9.087   36.529 1.00 94.90  ? 212  TRP A CE2 1 
ATOM   1442 C CE3 . TRP A 1 212 ? -6.058  10.885  36.532 1.00 89.90  ? 212  TRP A CE3 1 
ATOM   1443 C CZ2 . TRP A 1 212 ? -6.690  8.144   36.833 1.00 96.28  ? 212  TRP A CZ2 1 
ATOM   1444 C CZ3 . TRP A 1 212 ? -5.084  9.946   36.834 1.00 90.61  ? 212  TRP A CZ3 1 
ATOM   1445 C CH2 . TRP A 1 212 ? -5.406  8.593   36.980 1.00 93.83  ? 212  TRP A CH2 1 
ATOM   1446 N N   . THR A 1 213 ? -12.121 11.869  36.661 1.00 91.91  ? 213  THR A N   1 
ATOM   1447 C CA  . THR A 1 213 ? -12.945 11.452  37.785 1.00 93.20  ? 213  THR A CA  1 
ATOM   1448 C C   . THR A 1 213 ? -12.522 10.073  38.249 1.00 93.67  ? 213  THR A C   1 
ATOM   1449 O O   . THR A 1 213 ? -12.732 9.081   37.555 1.00 92.38  ? 213  THR A O   1 
ATOM   1450 C CB  . THR A 1 213 ? -14.434 11.442  37.439 1.00 96.13  ? 213  THR A CB  1 
ATOM   1451 O OG1 . THR A 1 213 ? -14.827 12.751  37.012 1.00 96.59  ? 213  THR A OG1 1 
ATOM   1452 C CG2 . THR A 1 213 ? -15.249 11.054  38.663 1.00 98.08  ? 213  THR A CG2 1 
ATOM   1453 N N   . VAL A 1 214 ? -11.914 10.022  39.427 1.00 119.04 ? 214  VAL A N   1 
ATOM   1454 C CA  . VAL A 1 214 ? -11.381 8.778   39.959 1.00 119.94 ? 214  VAL A CA  1 
ATOM   1455 C C   . VAL A 1 214 ? -12.462 8.008   40.703 1.00 123.24 ? 214  VAL A C   1 
ATOM   1456 O O   . VAL A 1 214 ? -13.290 8.603   41.388 1.00 124.34 ? 214  VAL A O   1 
ATOM   1457 C CB  . VAL A 1 214 ? -10.211 9.044   40.908 1.00 118.49 ? 214  VAL A CB  1 
ATOM   1458 C CG1 . VAL A 1 214 ? -9.306  7.841   40.952 1.00 119.10 ? 214  VAL A CG1 1 
ATOM   1459 C CG2 . VAL A 1 214 ? -9.436  10.258  40.446 1.00 116.14 ? 214  VAL A CG2 1 
ATOM   1460 N N   . MET A 1 215 ? -12.455 6.686   40.569 1.00 110.62 ? 215  MET A N   1 
ATOM   1461 C CA  . MET A 1 215 ? -13.501 5.878   41.177 1.00 114.74 ? 215  MET A CA  1 
ATOM   1462 C C   . MET A 1 215 ? -12.979 4.655   41.904 1.00 117.82 ? 215  MET A C   1 
ATOM   1463 O O   . MET A 1 215 ? -12.093 3.953   41.419 1.00 119.23 ? 215  MET A O   1 
ATOM   1464 C CB  . MET A 1 215 ? -14.506 5.434   40.122 1.00 118.63 ? 215  MET A CB  1 
ATOM   1465 C CG  . MET A 1 215 ? -15.093 6.566   39.326 1.00 116.61 ? 215  MET A CG  1 
ATOM   1466 S SD  . MET A 1 215 ? -16.000 5.934   37.906 1.00 123.01 ? 215  MET A SD  1 
ATOM   1467 C CE  . MET A 1 215 ? -15.910 7.347   36.805 1.00 119.68 ? 215  MET A CE  1 
ATOM   1468 N N   . HIS A 1 216 ? -13.551 4.408   43.073 1.00 119.72 ? 216  HIS A N   1 
ATOM   1469 C CA  . HIS A 1 216 ? -13.307 3.183   43.797 1.00 124.05 ? 216  HIS A CA  1 
ATOM   1470 C C   . HIS A 1 216 ? -14.632 2.461   43.951 1.00 129.49 ? 216  HIS A C   1 
ATOM   1471 O O   . HIS A 1 216 ? -15.419 2.795   44.835 1.00 130.42 ? 216  HIS A O   1 
ATOM   1472 C CB  . HIS A 1 216 ? -12.725 3.491   45.171 1.00 123.35 ? 216  HIS A CB  1 
ATOM   1473 C CG  . HIS A 1 216 ? -12.796 2.342   46.120 1.00 128.84 ? 216  HIS A CG  1 
ATOM   1474 N ND1 . HIS A 1 216 ? -11.957 1.256   46.041 1.00 131.62 ? 216  HIS A ND1 1 
ATOM   1475 C CD2 . HIS A 1 216 ? -13.616 2.104   47.179 1.00 133.18 ? 216  HIS A CD2 1 
ATOM   1476 C CE1 . HIS A 1 216 ? -12.248 0.397   47.004 1.00 137.20 ? 216  HIS A CE1 1 
ATOM   1477 N NE2 . HIS A 1 216 ? -13.253 0.897   47.705 1.00 138.07 ? 216  HIS A NE2 1 
ATOM   1478 N N   . PRO A 1 217 ? -14.901 1.485   43.071 1.00 124.83 ? 217  PRO A N   1 
ATOM   1479 C CA  . PRO A 1 217 ? -16.091 0.648   43.228 1.00 131.97 ? 217  PRO A CA  1 
ATOM   1480 C C   . PRO A 1 217 ? -16.101 0.053   44.626 1.00 134.70 ? 217  PRO A C   1 
ATOM   1481 O O   . PRO A 1 217 ? -15.042 -0.300  45.150 1.00 134.37 ? 217  PRO A O   1 
ATOM   1482 C CB  . PRO A 1 217 ? -15.875 -0.458  42.183 1.00 139.88 ? 217  PRO A CB  1 
ATOM   1483 C CG  . PRO A 1 217 ? -14.408 -0.359  41.806 1.00 136.69 ? 217  PRO A CG  1 
ATOM   1484 C CD  . PRO A 1 217 ? -14.125 1.093   41.888 1.00 126.61 ? 217  PRO A CD  1 
ATOM   1485 N N   . ILE A 1 218 ? -17.277 -0.036  45.234 1.00 109.65 ? 218  ILE A N   1 
ATOM   1486 C CA  . ILE A 1 218 ? -17.388 -0.631  46.555 1.00 113.86 ? 218  ILE A CA  1 
ATOM   1487 C C   . ILE A 1 218 ? -18.073 -1.981  46.433 1.00 123.32 ? 218  ILE A C   1 
ATOM   1488 O O   . ILE A 1 218 ? -19.244 -2.066  46.071 1.00 126.85 ? 218  ILE A O   1 
ATOM   1489 C CB  . ILE A 1 218 ? -18.169 0.269   47.531 1.00 112.70 ? 218  ILE A CB  1 
ATOM   1490 C CG1 . ILE A 1 218 ? -17.612 1.694   47.505 1.00 105.70 ? 218  ILE A CG1 1 
ATOM   1491 C CG2 . ILE A 1 218 ? -18.105 -0.302  48.933 1.00 117.88 ? 218  ILE A CG2 1 
ATOM   1492 C CD1 . ILE A 1 218 ? -18.213 2.605   48.546 1.00 107.39 ? 218  ILE A CD1 1 
ATOM   1493 N N   . ASP A 1 219 ? -17.323 -3.038  46.718 1.00 165.98 ? 219  ASP A N   1 
ATOM   1494 C CA  . ASP A 1 219 ? -17.841 -4.395  46.647 1.00 177.19 ? 219  ASP A CA  1 
ATOM   1495 C C   . ASP A 1 219 ? -17.293 -5.174  47.832 1.00 181.73 ? 219  ASP A C   1 
ATOM   1496 O O   . ASP A 1 219 ? -16.694 -4.584  48.729 1.00 176.17 ? 219  ASP A O   1 
ATOM   1497 C CB  . ASP A 1 219 ? -17.414 -5.055  45.341 1.00 182.88 ? 219  ASP A CB  1 
ATOM   1498 C CG  . ASP A 1 219 ? -15.914 -5.261  45.257 1.00 178.23 ? 219  ASP A CG  1 
ATOM   1499 O OD1 . ASP A 1 219 ? -15.215 -5.012  46.260 1.00 174.29 ? 219  ASP A OD1 1 
ATOM   1500 O OD2 . ASP A 1 219 ? -15.431 -5.675  44.185 1.00 178.67 ? 219  ASP A OD2 1 
ATOM   1501 N N   . HIS A 1 220 ? -17.471 -6.493  47.837 1.00 198.53 ? 220  HIS A N   1 
ATOM   1502 C CA  . HIS A 1 220 ? -17.030 -7.274  48.992 1.00 201.88 ? 220  HIS A CA  1 
ATOM   1503 C C   . HIS A 1 220 ? -15.532 -7.160  49.293 1.00 191.53 ? 220  HIS A C   1 
ATOM   1504 O O   . HIS A 1 220 ? -15.076 -7.625  50.336 1.00 190.04 ? 220  HIS A O   1 
ATOM   1505 C CB  . HIS A 1 220 ? -17.482 -8.746  48.928 1.00 212.93 ? 220  HIS A CB  1 
ATOM   1506 C CG  . HIS A 1 220 ? -17.606 -9.296  47.545 1.00 216.70 ? 220  HIS A CG  1 
ATOM   1507 N ND1 . HIS A 1 220 ? -18.826 -9.498  46.932 1.00 224.44 ? 220  HIS A ND1 1 
ATOM   1508 C CD2 . HIS A 1 220 ? -16.669 -9.706  46.653 1.00 210.47 ? 220  HIS A CD2 1 
ATOM   1509 C CE1 . HIS A 1 220 ? -18.632 -9.998  45.723 1.00 227.55 ? 220  HIS A CE1 1 
ATOM   1510 N NE2 . HIS A 1 220 ? -17.335 -10.132 45.532 1.00 218.30 ? 220  HIS A NE2 1 
ATOM   1511 N N   . HIS A 1 221 ? -14.771 -6.526  48.406 1.00 153.58 ? 221  HIS A N   1 
ATOM   1512 C CA  . HIS A 1 221 ? -13.340 -6.345  48.655 1.00 143.47 ? 221  HIS A CA  1 
ATOM   1513 C C   . HIS A 1 221 ? -12.961 -4.950  49.159 1.00 137.24 ? 221  HIS A C   1 
ATOM   1514 O O   . HIS A 1 221 ? -11.875 -4.757  49.706 1.00 130.83 ? 221  HIS A O   1 
ATOM   1515 C CB  . HIS A 1 221 ? -12.510 -6.718  47.425 1.00 139.39 ? 221  HIS A CB  1 
ATOM   1516 C CG  . HIS A 1 221 ? -12.560 -8.178  47.090 1.00 145.23 ? 221  HIS A CG  1 
ATOM   1517 N ND1 . HIS A 1 221 ? -12.270 -8.664  45.833 1.00 145.68 ? 221  HIS A ND1 1 
ATOM   1518 C CD2 . HIS A 1 221 ? -12.885 -9.251  47.845 1.00 151.84 ? 221  HIS A CD2 1 
ATOM   1519 C CE1 . HIS A 1 221 ? -12.402 -9.978  45.833 1.00 152.53 ? 221  HIS A CE1 1 
ATOM   1520 N NE2 . HIS A 1 221 ? -12.777 -10.362 47.040 1.00 156.42 ? 221  HIS A NE2 1 
ATOM   1521 N N   . SER A 1 222 ? -13.853 -3.983  48.983 1.00 140.27 ? 222  SER A N   1 
ATOM   1522 C CA  . SER A 1 222 ? -13.582 -2.629  49.448 1.00 133.02 ? 222  SER A CA  1 
ATOM   1523 C C   . SER A 1 222 ? -13.600 -2.559  50.967 1.00 133.90 ? 222  SER A C   1 
ATOM   1524 O O   . SER A 1 222 ? -14.556 -2.997  51.601 1.00 140.92 ? 222  SER A O   1 
ATOM   1525 C CB  . SER A 1 222 ? -14.600 -1.647  48.880 1.00 129.42 ? 222  SER A CB  1 
ATOM   1526 O OG  . SER A 1 222 ? -14.367 -0.352  49.396 1.00 123.89 ? 222  SER A OG  1 
ATOM   1527 N N   . PRO A 1 223 ? -12.539 -1.999  51.560 1.00 114.61 ? 223  PRO A N   1 
ATOM   1528 C CA  . PRO A 1 223 ? -12.498 -1.877  53.016 1.00 116.49 ? 223  PRO A CA  1 
ATOM   1529 C C   . PRO A 1 223 ? -13.637 -1.009  53.539 1.00 120.75 ? 223  PRO A C   1 
ATOM   1530 O O   . PRO A 1 223 ? -13.836 -0.929  54.748 1.00 124.57 ? 223  PRO A O   1 
ATOM   1531 C CB  . PRO A 1 223 ? -11.146 -1.205  53.275 1.00 109.83 ? 223  PRO A CB  1 
ATOM   1532 C CG  . PRO A 1 223 ? -10.332 -1.511  52.071 1.00 105.30 ? 223  PRO A CG  1 
ATOM   1533 C CD  . PRO A 1 223 ? -11.301 -1.514  50.932 1.00 107.18 ? 223  PRO A CD  1 
ATOM   1534 N N   . ILE A 1 224 ? -14.378 -0.367  52.641 1.00 138.57 ? 224  ILE A N   1 
ATOM   1535 C CA  . ILE A 1 224 ? -15.526 0.435   53.053 1.00 142.44 ? 224  ILE A CA  1 
ATOM   1536 C C   . ILE A 1 224 ? -16.838 -0.212  52.624 1.00 144.92 ? 224  ILE A C   1 
ATOM   1537 O O   . ILE A 1 224 ? -17.863 0.456   52.492 1.00 145.06 ? 224  ILE A O   1 
ATOM   1538 C CB  . ILE A 1 224 ? -15.445 1.881   52.525 1.00 136.73 ? 224  ILE A CB  1 
ATOM   1539 C CG1 . ILE A 1 224 ? -15.281 1.894   51.006 1.00 128.84 ? 224  ILE A CG1 1 
ATOM   1540 C CG2 . ILE A 1 224 ? -14.297 2.621   53.190 1.00 136.60 ? 224  ILE A CG2 1 
ATOM   1541 C CD1 . ILE A 1 224 ? -15.061 3.276   50.435 1.00 123.53 ? 224  ILE A CD1 1 
ATOM   1542 N N   . TYR A 1 225 ? -16.795 -1.524  52.421 1.00 174.92 ? 225  TYR A N   1 
ATOM   1543 C CA  . TYR A 1 225 ? -17.966 -2.280  52.004 1.00 179.31 ? 225  TYR A CA  1 
ATOM   1544 C C   . TYR A 1 225 ? -19.041 -2.313  53.080 1.00 186.36 ? 225  TYR A C   1 
ATOM   1545 O O   . TYR A 1 225 ? -18.748 -2.526  54.254 1.00 191.71 ? 225  TYR A O   1 
ATOM   1546 C CB  . TYR A 1 225 ? -17.571 -3.708  51.648 1.00 184.44 ? 225  TYR A CB  1 
ATOM   1547 C CG  . TYR A 1 225 ? -18.737 -4.540  51.191 1.00 191.10 ? 225  TYR A CG  1 
ATOM   1548 C CD1 . TYR A 1 225 ? -19.408 -4.230  50.019 1.00 188.63 ? 225  TYR A CD1 1 
ATOM   1549 C CD2 . TYR A 1 225 ? -19.173 -5.629  51.931 1.00 200.99 ? 225  TYR A CD2 1 
ATOM   1550 C CE1 . TYR A 1 225 ? -20.478 -4.982  49.590 1.00 196.18 ? 225  TYR A CE1 1 
ATOM   1551 C CE2 . TYR A 1 225 ? -20.244 -6.390  51.511 1.00 208.43 ? 225  TYR A CE2 1 
ATOM   1552 C CZ  . TYR A 1 225 ? -20.893 -6.061  50.338 1.00 206.14 ? 225  TYR A CZ  1 
ATOM   1553 O OH  . TYR A 1 225 ? -21.961 -6.811  49.907 1.00 214.84 ? 225  TYR A OH  1 
ATOM   1554 N N   . GLY A 1 226 ? -20.290 -2.119  52.670 1.00 189.01 ? 226  GLY A N   1 
ATOM   1555 C CA  . GLY A 1 226 ? -21.403 -2.148  53.600 1.00 196.45 ? 226  GLY A CA  1 
ATOM   1556 C C   . GLY A 1 226 ? -21.119 -1.286  54.813 1.00 199.00 ? 226  GLY A C   1 
ATOM   1557 O O   . GLY A 1 226 ? -21.289 -1.710  55.954 1.00 207.35 ? 226  GLY A O   1 
ATOM   1558 N N   . GLU A 1 227 ? -20.672 -0.066  54.551 1.00 165.19 ? 227  GLU A N   1 
ATOM   1559 C CA  . GLU A 1 227 ? -20.351 0.888   55.595 1.00 169.59 ? 227  GLU A CA  1 
ATOM   1560 C C   . GLU A 1 227 ? -21.281 2.077   55.435 1.00 170.44 ? 227  GLU A C   1 
ATOM   1561 O O   . GLU A 1 227 ? -21.431 2.605   54.334 1.00 163.02 ? 227  GLU A O   1 
ATOM   1562 C CB  . GLU A 1 227 ? -18.904 1.352   55.433 1.00 163.94 ? 227  GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 227 ? -18.264 1.918   56.684 1.00 171.29 ? 227  GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 227 ? -17.527 0.862   57.479 1.00 171.17 ? 227  GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 227 ? -16.978 -0.069  56.853 1.00 165.46 ? 227  GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 227 ? -17.489 0.962   58.723 1.00 176.40 ? 227  GLU A OE2 1 
ATOM   1567 N N   . THR A 1 228 ? -21.922 2.496   56.519 1.00 206.31 ? 228  THR A N   1 
ATOM   1568 C CA  . THR A 1 228 ? -22.717 3.714   56.467 1.00 209.30 ? 228  THR A CA  1 
ATOM   1569 C C   . THR A 1 228 ? -21.869 4.906   56.842 1.00 211.85 ? 228  THR A C   1 
ATOM   1570 O O   . THR A 1 228 ? -20.652 4.805   57.004 1.00 209.47 ? 228  THR A O   1 
ATOM   1571 C CB  . THR A 1 228 ? -23.916 3.694   57.429 1.00 221.74 ? 228  THR A CB  1 
ATOM   1572 O OG1 . THR A 1 228 ? -23.466 3.392   58.759 1.00 232.26 ? 228  THR A OG1 1 
ATOM   1573 C CG2 . THR A 1 228 ? -24.954 2.679   56.978 1.00 220.27 ? 228  THR A CG2 1 
ATOM   1574 N N   . ASP A 1 229 ? -22.534 6.041   56.984 1.00 178.30 ? 229  ASP A N   1 
ATOM   1575 C CA  . ASP A 1 229 ? -21.881 7.237   57.455 1.00 185.07 ? 229  ASP A CA  1 
ATOM   1576 C C   . ASP A 1 229 ? -21.482 7.052   58.915 1.00 198.82 ? 229  ASP A C   1 
ATOM   1577 O O   . ASP A 1 229 ? -20.334 7.291   59.289 1.00 199.85 ? 229  ASP A O   1 
ATOM   1578 C CB  . ASP A 1 229 ? -22.816 8.429   57.304 1.00 191.76 ? 229  ASP A CB  1 
ATOM   1579 C CG  . ASP A 1 229 ? -22.138 9.731   57.632 1.00 199.87 ? 229  ASP A CG  1 
ATOM   1580 O OD1 . ASP A 1 229 ? -21.168 9.701   58.416 1.00 205.90 ? 229  ASP A OD1 1 
ATOM   1581 O OD2 . ASP A 1 229 ? -22.567 10.779  57.107 1.00 201.27 ? 229  ASP A OD2 1 
ATOM   1582 N N   . GLU A 1 230 ? -22.437 6.621   59.734 1.00 191.60 ? 230  GLU A N   1 
ATOM   1583 C CA  . GLU A 1 230 ? -22.191 6.417   61.157 1.00 206.07 ? 230  GLU A CA  1 
ATOM   1584 C C   . GLU A 1 230 ? -20.913 5.620   61.392 1.00 193.73 ? 230  GLU A C   1 
ATOM   1585 O O   . GLU A 1 230 ? -20.079 5.995   62.214 1.00 189.17 ? 230  GLU A O   1 
ATOM   1586 C CB  . GLU A 1 230 ? -23.378 5.711   61.816 1.00 215.65 ? 230  GLU A CB  1 
ATOM   1587 N N   . THR A 1 231 ? -20.763 4.523   60.656 1.00 184.09 ? 231  THR A N   1 
ATOM   1588 C CA  . THR A 1 231 ? -19.606 3.645   60.800 1.00 173.54 ? 231  THR A CA  1 
ATOM   1589 C C   . THR A 1 231 ? -18.286 4.320   60.416 1.00 162.06 ? 231  THR A C   1 
ATOM   1590 O O   . THR A 1 231 ? -17.235 4.002   60.973 1.00 152.36 ? 231  THR A O   1 
ATOM   1591 C CB  . THR A 1 231 ? -19.775 2.372   59.958 1.00 167.56 ? 231  THR A CB  1 
ATOM   1592 O OG1 . THR A 1 231 ? -20.200 2.731   58.640 1.00 161.94 ? 231  THR A OG1 1 
ATOM   1593 C CG2 . THR A 1 231 ? -20.817 1.458   60.579 1.00 177.75 ? 231  THR A CG2 1 
ATOM   1594 N N   . LEU A 1 232 ? -18.339 5.243   59.461 1.00 223.91 ? 232  LEU A N   1 
ATOM   1595 C CA  . LEU A 1 232 ? -17.136 5.955   59.037 1.00 214.25 ? 232  LEU A CA  1 
ATOM   1596 C C   . LEU A 1 232 ? -16.640 6.923   60.109 1.00 214.21 ? 232  LEU A C   1 
ATOM   1597 O O   . LEU A 1 232 ? -15.460 6.914   60.460 1.00 204.57 ? 232  LEU A O   1 
ATOM   1598 C CB  . LEU A 1 232 ? -17.357 6.684   57.708 1.00 211.78 ? 232  LEU A CB  1 
ATOM   1599 C CG  . LEU A 1 232 ? -17.217 5.827   56.447 1.00 201.66 ? 232  LEU A CG  1 
ATOM   1600 C CD1 . LEU A 1 232 ? -17.403 6.670   55.199 1.00 194.07 ? 232  LEU A CD1 1 
ATOM   1601 C CD2 . LEU A 1 232 ? -15.869 5.126   56.419 1.00 191.47 ? 232  LEU A CD2 1 
ATOM   1602 N N   . ARG A 1 233 ? -17.537 7.758   60.625 1.00 145.12 ? 233  ARG A N   1 
ATOM   1603 C CA  . ARG A 1 233 ? -17.184 8.644   61.728 1.00 147.04 ? 233  ARG A CA  1 
ATOM   1604 C C   . ARG A 1 233 ? -16.575 7.839   62.870 1.00 141.45 ? 233  ARG A C   1 
ATOM   1605 O O   . ARG A 1 233 ? -15.615 8.269   63.506 1.00 135.83 ? 233  ARG A O   1 
ATOM   1606 C CB  . ARG A 1 233 ? -18.409 9.415   62.230 1.00 163.41 ? 233  ARG A CB  1 
ATOM   1607 C CG  . ARG A 1 233 ? -19.016 10.346  61.196 1.00 171.16 ? 233  ARG A CG  1 
ATOM   1608 C CD  . ARG A 1 233 ? -19.874 11.430  61.831 1.00 187.11 ? 233  ARG A CD  1 
ATOM   1609 N NE  . ARG A 1 233 ? -19.893 12.629  60.998 1.00 190.93 ? 233  ARG A NE  1 
ATOM   1610 C CZ  . ARG A 1 233 ? -20.611 12.754  59.886 1.00 197.09 ? 233  ARG A CZ  1 
ATOM   1611 N NH1 . ARG A 1 233 ? -21.376 11.756  59.477 1.00 197.08 ? 233  ARG A NH1 1 
ATOM   1612 N NH2 . ARG A 1 233 ? -20.567 13.877  59.183 1.00 200.67 ? 233  ARG A NH2 1 
ATOM   1613 N N   . ASN A 1 234 ? -17.139 6.658   63.105 1.00 175.59 ? 234  ASN A N   1 
ATOM   1614 C CA  . ASN A 1 234 ? -16.778 5.814   64.241 1.00 172.86 ? 234  ASN A CA  1 
ATOM   1615 C C   . ASN A 1 234 ? -15.352 5.290   64.239 1.00 159.29 ? 234  ASN A C   1 
ATOM   1616 O O   . ASN A 1 234 ? -14.763 5.067   65.297 1.00 156.86 ? 234  ASN A O   1 
ATOM   1617 C CB  . ASN A 1 234 ? -17.739 4.632   64.341 1.00 179.58 ? 234  ASN A CB  1 
ATOM   1618 C CG  . ASN A 1 234 ? -19.005 4.980   65.076 1.00 195.05 ? 234  ASN A CG  1 
ATOM   1619 O OD1 . ASN A 1 234 ? -19.195 6.122   65.496 1.00 201.02 ? 234  ASN A OD1 1 
ATOM   1620 N ND2 . ASN A 1 234 ? -19.880 3.998   65.245 1.00 203.00 ? 234  ASN A ND2 1 
ATOM   1621 N N   . SER A 1 235 ? -14.812 5.065   63.050 1.00 158.01 ? 235  SER A N   1 
ATOM   1622 C CA  . SER A 1 235 ? -13.438 4.616   62.919 1.00 146.81 ? 235  SER A CA  1 
ATOM   1623 C C   . SER A 1 235 ? -12.547 5.831   62.724 1.00 142.72 ? 235  SER A C   1 
ATOM   1624 O O   . SER A 1 235 ? -11.354 5.708   62.444 1.00 134.70 ? 235  SER A O   1 
ATOM   1625 C CB  . SER A 1 235 ? -13.313 3.651   61.743 1.00 142.01 ? 235  SER A CB  1 
ATOM   1626 O OG  . SER A 1 235 ? -14.273 3.956   60.746 1.00 147.16 ? 235  SER A OG  1 
ATOM   1627 N N   . HIS A 1 236 ? -13.145 7.008   62.893 1.00 230.97 ? 236  HIS A N   1 
ATOM   1628 C CA  . HIS A 1 236 ? -12.456 8.270   62.673 1.00 229.36 ? 236  HIS A CA  1 
ATOM   1629 C C   . HIS A 1 236 ? -11.670 8.172   61.374 1.00 221.05 ? 236  HIS A C   1 
ATOM   1630 O O   . HIS A 1 236 ? -10.471 8.436   61.341 1.00 215.07 ? 236  HIS A O   1 
ATOM   1631 C CB  . HIS A 1 236 ? -11.522 8.582   63.846 1.00 227.60 ? 236  HIS A CB  1 
ATOM   1632 C CG  . HIS A 1 236 ? -11.080 10.013  63.905 1.00 230.00 ? 236  HIS A CG  1 
ATOM   1633 N ND1 . HIS A 1 236 ? -10.368 10.614  62.891 1.00 225.67 ? 236  HIS A ND1 1 
ATOM   1634 C CD2 . HIS A 1 236 ? -11.240 10.956  64.865 1.00 237.17 ? 236  HIS A CD2 1 
ATOM   1635 C CE1 . HIS A 1 236 ? -10.113 11.870  63.218 1.00 230.24 ? 236  HIS A CE1 1 
ATOM   1636 N NE2 . HIS A 1 236 ? -10.631 12.101  64.411 1.00 237.29 ? 236  HIS A NE2 1 
ATOM   1637 N N   . SER A 1 237 ? -12.357 7.785   60.303 1.00 160.51 ? 237  SER A N   1 
ATOM   1638 C CA  . SER A 1 237 ? -11.693 7.463   59.042 1.00 152.86 ? 237  SER A CA  1 
ATOM   1639 C C   . SER A 1 237 ? -11.660 8.622   58.049 1.00 153.59 ? 237  SER A C   1 
ATOM   1640 O O   . SER A 1 237 ? -12.658 9.316   57.847 1.00 161.53 ? 237  SER A O   1 
ATOM   1641 C CB  . SER A 1 237 ? -12.340 6.235   58.395 1.00 152.73 ? 237  SER A CB  1 
ATOM   1642 O OG  . SER A 1 237 ? -13.741 6.394   58.283 1.00 162.27 ? 237  SER A OG  1 
ATOM   1643 N N   . GLU A 1 238 ? -10.499 8.813   57.427 1.00 161.02 ? 238  GLU A N   1 
ATOM   1644 C CA  . GLU A 1 238 ? -10.319 9.846   56.415 1.00 161.11 ? 238  GLU A CA  1 
ATOM   1645 C C   . GLU A 1 238 ? -9.868  9.233   55.096 1.00 154.57 ? 238  GLU A C   1 
ATOM   1646 O O   . GLU A 1 238 ? -9.551  8.045   55.027 1.00 149.95 ? 238  GLU A O   1 
ATOM   1647 C CB  . GLU A 1 238 ? -9.281  10.869  56.872 1.00 160.50 ? 238  GLU A CB  1 
ATOM   1648 C CG  . GLU A 1 238 ? -9.468  11.375  58.291 1.00 166.10 ? 238  GLU A CG  1 
ATOM   1649 C CD  . GLU A 1 238 ? -8.342  12.295  58.722 1.00 165.93 ? 238  GLU A CD  1 
ATOM   1650 O OE1 . GLU A 1 238 ? -7.230  12.169  58.166 1.00 160.23 ? 238  GLU A OE1 1 
ATOM   1651 O OE2 . GLU A 1 238 ? -8.564  13.141  59.615 1.00 172.60 ? 238  GLU A OE2 1 
ATOM   1652 N N   . PHE A 1 239 ? -9.829  10.055  54.054 1.00 135.77 ? 239  PHE A N   1 
ATOM   1653 C CA  . PHE A 1 239 ? -9.404  9.598   52.737 1.00 129.87 ? 239  PHE A CA  1 
ATOM   1654 C C   . PHE A 1 239 ? -8.332  10.502  52.146 1.00 127.32 ? 239  PHE A C   1 
ATOM   1655 O O   . PHE A 1 239 ? -8.522  11.709  51.990 1.00 131.77 ? 239  PHE A O   1 
ATOM   1656 C CB  . PHE A 1 239 ? -10.601 9.479   51.800 1.00 129.54 ? 239  PHE A CB  1 
ATOM   1657 C CG  . PHE A 1 239 ? -11.647 8.532   52.294 1.00 132.76 ? 239  PHE A CG  1 
ATOM   1658 C CD1 . PHE A 1 239 ? -12.573 8.941   53.237 1.00 142.21 ? 239  PHE A CD1 1 
ATOM   1659 C CD2 . PHE A 1 239 ? -11.694 7.227   51.836 1.00 127.84 ? 239  PHE A CD2 1 
ATOM   1660 C CE1 . PHE A 1 239 ? -13.532 8.072   53.704 1.00 146.09 ? 239  PHE A CE1 1 
ATOM   1661 C CE2 . PHE A 1 239 ? -12.654 6.351   52.300 1.00 132.06 ? 239  PHE A CE2 1 
ATOM   1662 C CZ  . PHE A 1 239 ? -13.574 6.775   53.235 1.00 140.87 ? 239  PHE A CZ  1 
ATOM   1663 N N   . LEU A 1 240 ? -7.202  9.890   51.819 1.00 108.26 ? 240  LEU A N   1 
ATOM   1664 C CA  . LEU A 1 240 ? -6.027  10.602  51.357 1.00 106.45 ? 240  LEU A CA  1 
ATOM   1665 C C   . LEU A 1 240 ? -5.794  10.356  49.875 1.00 99.18  ? 240  LEU A C   1 
ATOM   1666 O O   . LEU A 1 240 ? -5.746  9.213   49.435 1.00 94.25  ? 240  LEU A O   1 
ATOM   1667 C CB  . LEU A 1 240 ? -4.815  10.122  52.143 1.00 104.89 ? 240  LEU A CB  1 
ATOM   1668 C CG  . LEU A 1 240 ? -3.556  10.941  51.916 1.00 105.52 ? 240  LEU A CG  1 
ATOM   1669 C CD1 . LEU A 1 240 ? -3.904  12.418  51.883 1.00 110.45 ? 240  LEU A CD1 1 
ATOM   1670 C CD2 . LEU A 1 240 ? -2.568  10.645  53.015 1.00 106.30 ? 240  LEU A CD2 1 
ATOM   1671 N N   . VAL A 1 241 ? -5.642  11.427  49.105 1.00 92.43  ? 241  VAL A N   1 
ATOM   1672 C CA  . VAL A 1 241 ? -5.393  11.294  47.676 1.00 86.28  ? 241  VAL A CA  1 
ATOM   1673 C C   . VAL A 1 241 ? -4.004  11.787  47.312 1.00 84.86  ? 241  VAL A C   1 
ATOM   1674 O O   . VAL A 1 241 ? -3.643  12.927  47.601 1.00 90.08  ? 241  VAL A O   1 
ATOM   1675 C CB  . VAL A 1 241 ? -6.403  12.095  46.840 1.00 84.34  ? 241  VAL A CB  1 
ATOM   1676 C CG1 . VAL A 1 241 ? -6.102  11.935  45.368 1.00 83.10  ? 241  VAL A CG1 1 
ATOM   1677 C CG2 . VAL A 1 241 ? -7.819  11.653  47.145 1.00 85.87  ? 241  VAL A CG2 1 
ATOM   1678 N N   . LEU A 1 242 ? -3.226  10.930  46.669 1.00 87.06  ? 242  LEU A N   1 
ATOM   1679 C CA  . LEU A 1 242 ? -1.947  11.358  46.139 1.00 85.20  ? 242  LEU A CA  1 
ATOM   1680 C C   . LEU A 1 242 ? -1.939  11.275  44.617 1.00 79.62  ? 242  LEU A C   1 
ATOM   1681 O O   . LEU A 1 242 ? -2.138  10.208  44.041 1.00 78.70  ? 242  LEU A O   1 
ATOM   1682 C CB  . LEU A 1 242 ? -0.818  10.528  46.739 1.00 86.51  ? 242  LEU A CB  1 
ATOM   1683 C CG  . LEU A 1 242 ? -0.659  10.745  48.240 1.00 84.60  ? 242  LEU A CG  1 
ATOM   1684 C CD1 . LEU A 1 242 ? 0.438   9.866   48.800 1.00 84.66  ? 242  LEU A CD1 1 
ATOM   1685 C CD2 . LEU A 1 242 ? -0.371  12.202  48.518 1.00 90.79  ? 242  LEU A CD2 1 
ATOM   1686 N N   . PHE A 1 243 ? -1.722  12.416  43.972 1.00 80.55  ? 243  PHE A N   1 
ATOM   1687 C CA  . PHE A 1 243 ? -1.593  12.465  42.525 1.00 78.71  ? 243  PHE A CA  1 
ATOM   1688 C C   . PHE A 1 243 ? -0.161  12.766  42.144 1.00 78.25  ? 243  PHE A C   1 
ATOM   1689 O O   . PHE A 1 243 ? 0.488   13.586  42.781 1.00 87.12  ? 243  PHE A O   1 
ATOM   1690 C CB  . PHE A 1 243 ? -2.473  13.559  41.935 1.00 79.10  ? 243  PHE A CB  1 
ATOM   1691 C CG  . PHE A 1 243 ? -2.125  13.900  40.517 1.00 83.62  ? 243  PHE A CG  1 
ATOM   1692 C CD1 . PHE A 1 243 ? -2.824  13.335  39.464 1.00 80.59  ? 243  PHE A CD1 1 
ATOM   1693 C CD2 . PHE A 1 243 ? -1.080  14.763  40.234 1.00 84.81  ? 243  PHE A CD2 1 
ATOM   1694 C CE1 . PHE A 1 243 ? -2.497  13.636  38.154 1.00 79.14  ? 243  PHE A CE1 1 
ATOM   1695 C CE2 . PHE A 1 243 ? -0.748  15.065  38.930 1.00 82.51  ? 243  PHE A CE2 1 
ATOM   1696 C CZ  . PHE A 1 243 ? -1.458  14.500  37.887 1.00 79.83  ? 243  PHE A CZ  1 
ATOM   1697 N N   . THR A 1 244 ? 0.325   12.118  41.092 1.00 104.24 ? 244  THR A N   1 
ATOM   1698 C CA  . THR A 1 244 ? 1.659   12.402  40.573 1.00 104.06 ? 244  THR A CA  1 
ATOM   1699 C C   . THR A 1 244 ? 1.716   12.145  39.070 1.00 101.71 ? 244  THR A C   1 
ATOM   1700 O O   . THR A 1 244 ? 0.940   11.353  38.532 1.00 101.04 ? 244  THR A O   1 
ATOM   1701 C CB  . THR A 1 244 ? 2.756   11.565  41.277 1.00 105.57 ? 244  THR A CB  1 
ATOM   1702 O OG1 . THR A 1 244 ? 2.777   10.241  40.738 1.00 104.49 ? 244  THR A OG1 1 
ATOM   1703 C CG2 . THR A 1 244 ? 2.506   11.477  42.771 1.00 109.12 ? 244  THR A CG2 1 
ATOM   1704 N N   . GLY A 1 245 ? 2.643   12.816  38.398 1.00 79.16  ? 245  GLY A N   1 
ATOM   1705 C CA  . GLY A 1 245 ? 2.788   12.679  36.961 1.00 78.73  ? 245  GLY A CA  1 
ATOM   1706 C C   . GLY A 1 245 ? 3.920   13.534  36.434 1.00 79.75  ? 245  GLY A C   1 
ATOM   1707 O O   . GLY A 1 245 ? 4.494   14.328  37.170 1.00 80.97  ? 245  GLY A O   1 
ATOM   1708 N N   . HIS A 1 246 ? 4.245   13.372  35.157 1.00 79.32  ? 246  HIS A N   1 
ATOM   1709 C CA  . HIS A 1 246 ? 5.310   14.149  34.540 1.00 80.87  ? 246  HIS A CA  1 
ATOM   1710 C C   . HIS A 1 246 ? 4.741   15.327  33.757 1.00 81.28  ? 246  HIS A C   1 
ATOM   1711 O O   . HIS A 1 246 ? 4.086   15.143  32.730 1.00 82.10  ? 246  HIS A O   1 
ATOM   1712 C CB  . HIS A 1 246 ? 6.152   13.266  33.624 1.00 83.75  ? 246  HIS A CB  1 
ATOM   1713 C CG  . HIS A 1 246 ? 7.242   14.003  32.916 1.00 85.98  ? 246  HIS A CG  1 
ATOM   1714 N ND1 . HIS A 1 246 ? 8.560   13.959  33.326 1.00 87.22  ? 246  HIS A ND1 1 
ATOM   1715 C CD2 . HIS A 1 246 ? 7.215   14.813  31.831 1.00 87.81  ? 246  HIS A CD2 1 
ATOM   1716 C CE1 . HIS A 1 246 ? 9.292   14.705  32.521 1.00 89.60  ? 246  HIS A CE1 1 
ATOM   1717 N NE2 . HIS A 1 246 ? 8.501   15.234  31.605 1.00 90.08  ? 246  HIS A NE2 1 
ATOM   1718 N N   . HIS A 1 247 ? 5.002   16.536  34.245 1.00 81.37  ? 247  HIS A N   1 
ATOM   1719 C CA  . HIS A 1 247 ? 4.419   17.743  33.668 1.00 80.60  ? 247  HIS A CA  1 
ATOM   1720 C C   . HIS A 1 247 ? 5.205   18.233  32.462 1.00 81.91  ? 247  HIS A C   1 
ATOM   1721 O O   . HIS A 1 247 ? 6.390   18.534  32.567 1.00 83.87  ? 247  HIS A O   1 
ATOM   1722 C CB  . HIS A 1 247 ? 4.346   18.856  34.713 1.00 82.55  ? 247  HIS A CB  1 
ATOM   1723 C CG  . HIS A 1 247 ? 3.212   19.812  34.498 1.00 84.62  ? 247  HIS A CG  1 
ATOM   1724 N ND1 . HIS A 1 247 ? 3.069   20.545  33.339 1.00 86.35  ? 247  HIS A ND1 1 
ATOM   1725 C CD2 . HIS A 1 247 ? 2.170   20.151  35.289 1.00 86.24  ? 247  HIS A CD2 1 
ATOM   1726 C CE1 . HIS A 1 247 ? 1.986   21.291  33.426 1.00 88.69  ? 247  HIS A CE1 1 
ATOM   1727 N NE2 . HIS A 1 247 ? 1.417   21.077  34.600 1.00 88.83  ? 247  HIS A NE2 1 
ATOM   1728 N N   . GLU A 1 248 ? 4.536   18.320  31.318 1.00 92.79  ? 248  GLU A N   1 
ATOM   1729 C CA  . GLU A 1 248 ? 5.175   18.812  30.107 1.00 96.31  ? 248  GLU A CA  1 
ATOM   1730 C C   . GLU A 1 248 ? 5.677   20.241  30.267 1.00 99.28  ? 248  GLU A C   1 
ATOM   1731 O O   . GLU A 1 248 ? 6.737   20.589  29.755 1.00 102.14 ? 248  GLU A O   1 
ATOM   1732 C CB  . GLU A 1 248 ? 4.229   18.703  28.913 1.00 98.16  ? 248  GLU A CB  1 
ATOM   1733 C CG  . GLU A 1 248 ? 4.234   17.326  28.294 1.00 99.72  ? 248  GLU A CG  1 
ATOM   1734 C CD  . GLU A 1 248 ? 3.218   17.173  27.184 1.00 103.26 ? 248  GLU A CD  1 
ATOM   1735 O OE1 . GLU A 1 248 ? 2.821   18.196  26.588 1.00 103.55 ? 248  GLU A OE1 1 
ATOM   1736 O OE2 . GLU A 1 248 ? 2.817   16.023  26.907 1.00 103.50 ? 248  GLU A OE2 1 
ATOM   1737 N N   . ALA A 1 249 ? 4.916   21.064  30.980 1.00 92.30  ? 249  ALA A N   1 
ATOM   1738 C CA  . ALA A 1 249 ? 5.324   22.442  31.238 1.00 83.90  ? 249  ALA A CA  1 
ATOM   1739 C C   . ALA A 1 249 ? 6.759   22.497  31.743 1.00 85.84  ? 249  ALA A C   1 
ATOM   1740 O O   . ALA A 1 249 ? 7.595   23.218  31.202 1.00 90.08  ? 249  ALA A O   1 
ATOM   1741 C CB  . ALA A 1 249 ? 4.392   23.091  32.243 1.00 86.41  ? 249  ALA A CB  1 
ATOM   1742 N N   . PHE A 1 250 ? 7.045   21.717  32.777 1.00 100.36 ? 250  PHE A N   1 
ATOM   1743 C CA  . PHE A 1 250 ? 8.343   21.781  33.430 1.00 103.15 ? 250  PHE A CA  1 
ATOM   1744 C C   . PHE A 1 250 ? 9.311   20.702  32.952 1.00 100.00 ? 250  PHE A C   1 
ATOM   1745 O O   . PHE A 1 250 ? 10.498  20.742  33.278 1.00 102.52 ? 250  PHE A O   1 
ATOM   1746 C CB  . PHE A 1 250 ? 8.162   21.710  34.946 1.00 104.87 ? 250  PHE A CB  1 
ATOM   1747 C CG  . PHE A 1 250 ? 7.086   22.619  35.459 1.00 109.47 ? 250  PHE A CG  1 
ATOM   1748 C CD1 . PHE A 1 250 ? 5.889   22.107  35.933 1.00 106.31 ? 250  PHE A CD1 1 
ATOM   1749 C CD2 . PHE A 1 250 ? 7.261   23.991  35.436 1.00 118.25 ? 250  PHE A CD2 1 
ATOM   1750 C CE1 . PHE A 1 250 ? 4.898   22.947  36.397 1.00 111.71 ? 250  PHE A CE1 1 
ATOM   1751 C CE2 . PHE A 1 250 ? 6.273   24.838  35.894 1.00 124.54 ? 250  PHE A CE2 1 
ATOM   1752 C CZ  . PHE A 1 250 ? 5.090   24.317  36.376 1.00 121.19 ? 250  PHE A CZ  1 
ATOM   1753 N N   . ALA A 1 251 ? 8.812   19.750  32.167 1.00 91.98  ? 251  ALA A N   1 
ATOM   1754 C CA  . ALA A 1 251 ? 9.631   18.627  31.722 1.00 91.18  ? 251  ALA A CA  1 
ATOM   1755 C C   . ALA A 1 251 ? 10.249  17.972  32.947 1.00 90.07  ? 251  ALA A C   1 
ATOM   1756 O O   . ALA A 1 251 ? 11.431  17.630  32.963 1.00 91.85  ? 251  ALA A O   1 
ATOM   1757 C CB  . ALA A 1 251 ? 10.710  19.098  30.767 1.00 95.33  ? 251  ALA A CB  1 
ATOM   1758 N N   . GLN A 1 252 ? 9.422   17.801  33.972 1.00 114.66 ? 252  GLN A N   1 
ATOM   1759 C CA  . GLN A 1 252 ? 9.866   17.373  35.288 1.00 114.88 ? 252  GLN A CA  1 
ATOM   1760 C C   . GLN A 1 252 ? 8.661   16.781  36.006 1.00 111.95 ? 252  GLN A C   1 
ATOM   1761 O O   . GLN A 1 252 ? 7.520   17.082  35.660 1.00 110.56 ? 252  GLN A O   1 
ATOM   1762 C CB  . GLN A 1 252 ? 10.389  18.589  36.053 1.00 120.11 ? 252  GLN A CB  1 
ATOM   1763 C CG  . GLN A 1 252 ? 11.101  18.298  37.358 1.00 122.89 ? 252  GLN A CG  1 
ATOM   1764 C CD  . GLN A 1 252 ? 11.550  19.573  38.058 1.00 131.06 ? 252  GLN A CD  1 
ATOM   1765 O OE1 . GLN A 1 252 ? 11.303  20.681  37.577 1.00 134.65 ? 252  GLN A OE1 1 
ATOM   1766 N NE2 . GLN A 1 252 ? 12.214  19.421  39.198 1.00 135.65 ? 252  GLN A NE2 1 
ATOM   1767 N N   . ASN A 1 253 ? 8.901   15.938  37.000 1.00 91.97  ? 253  ASN A N   1 
ATOM   1768 C CA  . ASN A 1 253 ? 7.796   15.324  37.722 1.00 89.88  ? 253  ASN A CA  1 
ATOM   1769 C C   . ASN A 1 253 ? 7.126   16.274  38.709 1.00 92.88  ? 253  ASN A C   1 
ATOM   1770 O O   . ASN A 1 253 ? 7.768   17.174  39.255 1.00 98.16  ? 253  ASN A O   1 
ATOM   1771 C CB  . ASN A 1 253 ? 8.247   14.040  38.420 1.00 89.53  ? 253  ASN A CB  1 
ATOM   1772 C CG  . ASN A 1 253 ? 7.994   12.801  37.578 1.00 87.63  ? 253  ASN A CG  1 
ATOM   1773 O OD1 . ASN A 1 253 ? 7.155   11.967  37.923 1.00 86.53  ? 253  ASN A OD1 1 
ATOM   1774 N ND2 . ASN A 1 253 ? 8.703   12.682  36.460 1.00 88.86  ? 253  ASN A ND2 1 
ATOM   1775 N N   . VAL A 1 254 ? 5.830   16.068  38.919 1.00 93.89  ? 254  VAL A N   1 
ATOM   1776 C CA  . VAL A 1 254 ? 5.033   16.898  39.811 1.00 98.13  ? 254  VAL A CA  1 
ATOM   1777 C C   . VAL A 1 254 ? 4.145   15.986  40.649 1.00 96.82  ? 254  VAL A C   1 
ATOM   1778 O O   . VAL A 1 254 ? 3.857   14.856  40.264 1.00 92.07  ? 254  VAL A O   1 
ATOM   1779 C CB  . VAL A 1 254 ? 4.127   17.864  39.019 1.00 98.44  ? 254  VAL A CB  1 
ATOM   1780 C CG1 . VAL A 1 254 ? 4.957   18.949  38.364 1.00 101.89 ? 254  VAL A CG1 1 
ATOM   1781 C CG2 . VAL A 1 254 ? 3.332   17.107  37.979 1.00 92.34  ? 254  VAL A CG2 1 
ATOM   1782 N N   . HIS A 1 255 ? 3.672   16.494  41.772 1.00 132.77 ? 255  HIS A N   1 
ATOM   1783 C CA  . HIS A 1 255 ? 2.616   15.794  42.424 1.00 132.66 ? 255  HIS A CA  1 
ATOM   1784 C C   . HIS A 1 255 ? 1.776   16.784  43.304 1.00 140.35 ? 255  HIS A C   1 
ATOM   1785 O O   . HIS A 1 255 ? 2.040   17.992  43.375 1.00 147.69 ? 255  HIS A O   1 
ATOM   1786 C CB  . HIS A 1 255 ? 3.327   14.736  43.194 1.00 133.97 ? 255  HIS A CB  1 
ATOM   1787 C CG  . HIS A 1 255 ? 4.388   15.265  44.118 1.00 136.88 ? 255  HIS A CG  1 
ATOM   1788 N ND1 . HIS A 1 255 ? 5.378   14.496  44.694 1.00 137.61 ? 255  HIS A ND1 1 
ATOM   1789 C CD2 . HIS A 1 255 ? 4.405   16.447  44.820 1.00 141.24 ? 255  HIS A CD2 1 
ATOM   1790 C CE1 . HIS A 1 255 ? 6.014   15.190  45.596 1.00 141.81 ? 255  HIS A CE1 1 
ATOM   1791 N NE2 . HIS A 1 255 ? 5.555   16.423  45.594 1.00 144.38 ? 255  HIS A NE2 1 
ATOM   1792 N N   . ALA A 1 256 ? 0.704   16.251  43.879 1.00 110.15 ? 256  ALA A N   1 
ATOM   1793 C CA  . ALA A 1 256 ? -0.296  17.011  44.592 1.00 117.86 ? 256  ALA A CA  1 
ATOM   1794 C C   . ALA A 1 256 ? -0.960  16.011  45.490 1.00 118.17 ? 256  ALA A C   1 
ATOM   1795 O O   . ALA A 1 256 ? -1.191  14.871  45.104 1.00 110.43 ? 256  ALA A O   1 
ATOM   1796 C CB  . ALA A 1 256 ? -1.308  17.586  43.631 1.00 115.04 ? 256  ALA A CB  1 
ATOM   1797 N N   . ARG A 1 257 ? -1.265  16.447  46.706 1.00 111.15 ? 257  ARG A N   1 
ATOM   1798 C CA  . ARG A 1 257 ? -1.916  15.603  47.691 1.00 111.82 ? 257  ARG A CA  1 
ATOM   1799 C C   . ARG A 1 257 ? -3.095  16.340  48.296 1.00 119.34 ? 257  ARG A C   1 
ATOM   1800 O O   . ARG A 1 257 ? -3.076  17.559  48.432 1.00 127.45 ? 257  ARG A O   1 
ATOM   1801 C CB  . ARG A 1 257 ? -0.931  15.208  48.784 1.00 113.78 ? 257  ARG A CB  1 
ATOM   1802 C CG  . ARG A 1 257 ? 0.374   15.972  48.720 1.00 118.06 ? 257  ARG A CG  1 
ATOM   1803 C CD  . ARG A 1 257 ? 0.780   16.484  50.087 1.00 126.71 ? 257  ARG A CD  1 
ATOM   1804 N NE  . ARG A 1 257 ? 1.060   15.391  51.010 1.00 128.34 ? 257  ARG A NE  1 
ATOM   1805 C CZ  . ARG A 1 257 ? 1.750   15.526  52.136 1.00 134.10 ? 257  ARG A CZ  1 
ATOM   1806 N NH1 . ARG A 1 257 ? 1.957   14.475  52.916 1.00 133.85 ? 257  ARG A NH1 1 
ATOM   1807 N NH2 . ARG A 1 257 ? 2.231   16.710  52.485 1.00 140.58 ? 257  ARG A NH2 1 
ATOM   1808 N N   . HIS A 1 258 ? -4.124  15.585  48.654 1.00 118.65 ? 258  HIS A N   1 
ATOM   1809 C CA  . HIS A 1 258 ? -5.328  16.138  49.225 1.00 126.50 ? 258  HIS A CA  1 
ATOM   1810 C C   . HIS A 1 258 ? -5.870  15.124  50.211 1.00 124.66 ? 258  HIS A C   1 
ATOM   1811 O O   . HIS A 1 258 ? -5.550  13.942  50.125 1.00 118.29 ? 258  HIS A O   1 
ATOM   1812 C CB  . HIS A 1 258 ? -6.350  16.409  48.125 1.00 124.38 ? 258  HIS A CB  1 
ATOM   1813 C CG  . HIS A 1 258 ? -7.511  17.247  48.570 1.00 134.85 ? 258  HIS A CG  1 
ATOM   1814 N ND1 . HIS A 1 258 ? -7.388  18.596  48.842 1.00 144.90 ? 258  HIS A ND1 1 
ATOM   1815 C CD2 . HIS A 1 258 ? -8.803  16.934  48.782 1.00 135.72 ? 258  HIS A CD2 1 
ATOM   1816 C CE1 . HIS A 1 258 ? -8.561  19.071  49.207 1.00 153.17 ? 258  HIS A CE1 1 
ATOM   1817 N NE2 . HIS A 1 258 ? -9.444  18.089  49.181 1.00 148.73 ? 258  HIS A NE2 1 
ATOM   1818 N N   . ALA A 1 259 ? -6.676  15.584  51.157 1.00 134.37 ? 259  ALA A N   1 
ATOM   1819 C CA  . ALA A 1 259 ? -7.280  14.684  52.122 1.00 133.85 ? 259  ALA A CA  1 
ATOM   1820 C C   . ALA A 1 259 ? -8.740  15.051  52.330 1.00 141.50 ? 259  ALA A C   1 
ATOM   1821 O O   . ALA A 1 259 ? -9.110  16.221  52.252 1.00 148.82 ? 259  ALA A O   1 
ATOM   1822 C CB  . ALA A 1 259 ? -6.525  14.732  53.435 1.00 134.40 ? 259  ALA A CB  1 
ATOM   1823 N N   . TYR A 1 260 ? -9.564  14.042  52.590 1.00 141.70 ? 260  TYR A N   1 
ATOM   1824 C CA  . TYR A 1 260 ? -10.980 14.249  52.872 1.00 150.74 ? 260  TYR A CA  1 
ATOM   1825 C C   . TYR A 1 260 ? -11.348 13.609  54.202 1.00 152.66 ? 260  TYR A C   1 
ATOM   1826 O O   . TYR A 1 260 ? -10.812 12.562  54.561 1.00 145.81 ? 260  TYR A O   1 
ATOM   1827 C CB  . TYR A 1 260 ? -11.849 13.624  51.781 1.00 148.41 ? 260  TYR A CB  1 
ATOM   1828 C CG  . TYR A 1 260 ? -11.661 14.204  50.403 1.00 140.34 ? 260  TYR A CG  1 
ATOM   1829 C CD1 . TYR A 1 260 ? -11.045 13.468  49.405 1.00 127.11 ? 260  TYR A CD1 1 
ATOM   1830 C CD2 . TYR A 1 260 ? -12.113 15.480  50.095 1.00 146.42 ? 260  TYR A CD2 1 
ATOM   1831 C CE1 . TYR A 1 260 ? -10.880 13.983  48.144 1.00 120.00 ? 260  TYR A CE1 1 
ATOM   1832 C CE2 . TYR A 1 260 ? -11.949 16.006  48.833 1.00 138.69 ? 260  TYR A CE2 1 
ATOM   1833 C CZ  . TYR A 1 260 ? -11.330 15.250  47.861 1.00 125.37 ? 260  TYR A CZ  1 
ATOM   1834 O OH  . TYR A 1 260 ? -11.153 15.752  46.595 1.00 118.83 ? 260  TYR A OH  1 
ATOM   1835 N N   . SER A 1 261 ? -12.271 14.230  54.927 1.00 158.33 ? 261  SER A N   1 
ATOM   1836 C CA  . SER A 1 261 ? -12.777 13.639  56.158 1.00 161.58 ? 261  SER A CA  1 
ATOM   1837 C C   . SER A 1 261 ? -14.097 12.926  55.889 1.00 167.49 ? 261  SER A C   1 
ATOM   1838 O O   . SER A 1 261 ? -14.727 13.146  54.857 1.00 171.46 ? 261  SER A O   1 
ATOM   1839 C CB  . SER A 1 261 ? -12.953 14.706  57.237 1.00 170.52 ? 261  SER A CB  1 
ATOM   1840 O OG  . SER A 1 261 ? -13.577 15.865  56.713 1.00 180.14 ? 261  SER A OG  1 
ATOM   1841 N N   . CYS A 1 262 ? -14.505 12.065  56.814 1.00 220.13 ? 262  CYS A N   1 
ATOM   1842 C CA  . CYS A 1 262 ? -15.747 11.317  56.665 1.00 227.28 ? 262  CYS A CA  1 
ATOM   1843 C C   . CYS A 1 262 ? -16.896 12.208  56.188 1.00 239.79 ? 262  CYS A C   1 
ATOM   1844 O O   . CYS A 1 262 ? -17.705 11.800  55.354 1.00 232.90 ? 262  CYS A O   1 
ATOM   1845 C CB  . CYS A 1 262 ? -16.113 10.627  57.983 1.00 230.78 ? 262  CYS A CB  1 
ATOM   1846 S SG  . CYS A 1 262 ? -15.546 11.500  59.469 1.00 232.44 ? 262  CYS A SG  1 
ATOM   1847 N N   . ASP A 1 263 ? -16.940 13.433  56.703 1.00 172.47 ? 263  ASP A N   1 
ATOM   1848 C CA  . ASP A 1 263 ? -18.051 14.349  56.451 1.00 187.85 ? 263  ASP A CA  1 
ATOM   1849 C C   . ASP A 1 263 ? -17.976 15.106  55.125 1.00 179.60 ? 263  ASP A C   1 
ATOM   1850 O O   . ASP A 1 263 ? -18.851 15.917  54.827 1.00 185.34 ? 263  ASP A O   1 
ATOM   1851 C CB  . ASP A 1 263 ? -18.152 15.368  57.583 1.00 197.15 ? 263  ASP A CB  1 
ATOM   1852 C CG  . ASP A 1 263 ? -16.940 16.270  57.654 1.00 190.01 ? 263  ASP A CG  1 
ATOM   1853 O OD1 . ASP A 1 263 ? -15.874 15.793  58.096 1.00 178.02 ? 263  ASP A OD1 1 
ATOM   1854 O OD2 . ASP A 1 263 ? -17.051 17.453  57.268 1.00 197.43 ? 263  ASP A OD2 1 
ATOM   1855 N N   . GLU A 1 264 ? -16.933 14.869  54.339 1.00 193.23 ? 264  GLU A N   1 
ATOM   1856 C CA  . GLU A 1 264 ? -16.831 15.513  53.033 1.00 183.63 ? 264  GLU A CA  1 
ATOM   1857 C C   . GLU A 1 264 ? -17.255 14.529  51.958 1.00 166.51 ? 264  GLU A C   1 
ATOM   1858 O O   . GLU A 1 264 ? -17.080 14.770  50.763 1.00 156.44 ? 264  GLU A O   1 
ATOM   1859 C CB  . GLU A 1 264 ? -15.413 16.017  52.780 1.00 181.66 ? 264  GLU A CB  1 
ATOM   1860 C CG  . GLU A 1 264 ? -14.672 16.376  54.050 1.00 188.87 ? 264  GLU A CG  1 
ATOM   1861 C CD  . GLU A 1 264 ? -13.883 17.661  53.923 1.00 189.81 ? 264  GLU A CD  1 
ATOM   1862 O OE1 . GLU A 1 264 ? -14.403 18.620  53.313 1.00 198.87 ? 264  GLU A OE1 1 
ATOM   1863 O OE2 . GLU A 1 264 ? -12.750 17.718  54.447 1.00 182.71 ? 264  GLU A OE2 1 
ATOM   1864 N N   . ILE A 1 265 ? -17.806 13.409  52.409 1.00 166.82 ? 265  ILE A N   1 
ATOM   1865 C CA  . ILE A 1 265 ? -18.400 12.425  51.524 1.00 154.72 ? 265  ILE A CA  1 
ATOM   1866 C C   . ILE A 1 265 ? -19.885 12.717  51.381 1.00 159.18 ? 265  ILE A C   1 
ATOM   1867 O O   . ILE A 1 265 ? -20.645 12.620  52.345 1.00 169.55 ? 265  ILE A O   1 
ATOM   1868 C CB  . ILE A 1 265 ? -18.238 11.007  52.079 1.00 152.35 ? 265  ILE A CB  1 
ATOM   1869 C CG1 . ILE A 1 265 ? -16.758 10.676  52.278 1.00 148.84 ? 265  ILE A CG1 1 
ATOM   1870 C CG2 . ILE A 1 265 ? -18.903 10.001  51.157 1.00 142.83 ? 265  ILE A CG2 1 
ATOM   1871 C CD1 . ILE A 1 265 ? -16.522 9.313   52.879 1.00 148.00 ? 265  ILE A CD1 1 
ATOM   1872 N N   . ILE A 1 266 ? -20.292 13.082  50.172 1.00 161.72 ? 266  ILE A N   1 
ATOM   1873 C CA  . ILE A 1 266 ? -21.686 13.384  49.885 1.00 165.46 ? 266  ILE A CA  1 
ATOM   1874 C C   . ILE A 1 266 ? -22.393 12.134  49.367 1.00 157.91 ? 266  ILE A C   1 
ATOM   1875 O O   . ILE A 1 266 ? -22.298 11.801  48.186 1.00 148.23 ? 266  ILE A O   1 
ATOM   1876 C CB  . ILE A 1 266 ? -21.795 14.527  48.855 1.00 163.72 ? 266  ILE A CB  1 
ATOM   1877 C CG1 . ILE A 1 266 ? -21.644 15.880  49.551 1.00 177.29 ? 266  ILE A CG1 1 
ATOM   1878 C CG2 . ILE A 1 266 ? -23.116 14.468  48.107 1.00 161.80 ? 266  ILE A CG2 1 
ATOM   1879 C CD1 . ILE A 1 266 ? -21.432 17.035  48.598 1.00 176.21 ? 266  ILE A CD1 1 
ATOM   1880 N N   . TRP A 1 267 ? -23.094 11.436  50.255 1.00 176.33 ? 267  TRP A N   1 
ATOM   1881 C CA  . TRP A 1 267 ? -23.752 10.188  49.883 1.00 171.37 ? 267  TRP A CA  1 
ATOM   1882 C C   . TRP A 1 267 ? -24.897 10.418  48.900 1.00 169.66 ? 267  TRP A C   1 
ATOM   1883 O O   . TRP A 1 267 ? -25.734 11.298  49.094 1.00 176.86 ? 267  TRP A O   1 
ATOM   1884 C CB  . TRP A 1 267 ? -24.261 9.450   51.121 1.00 179.55 ? 267  TRP A CB  1 
ATOM   1885 C CG  . TRP A 1 267 ? -23.181 9.096   52.092 1.00 181.98 ? 267  TRP A CG  1 
ATOM   1886 C CD1 . TRP A 1 267 ? -22.554 9.940   52.959 1.00 190.06 ? 267  TRP A CD1 1 
ATOM   1887 C CD2 . TRP A 1 267 ? -22.607 7.801   52.305 1.00 178.12 ? 267  TRP A CD2 1 
ATOM   1888 N NE1 . TRP A 1 267 ? -21.621 9.254   53.697 1.00 190.83 ? 267  TRP A NE1 1 
ATOM   1889 C CE2 . TRP A 1 267 ? -21.633 7.937   53.316 1.00 183.22 ? 267  TRP A CE2 1 
ATOM   1890 C CE3 . TRP A 1 267 ? -22.818 6.538   51.741 1.00 172.51 ? 267  TRP A CE3 1 
ATOM   1891 C CZ2 . TRP A 1 267 ? -20.873 6.861   53.773 1.00 181.80 ? 267  TRP A CZ2 1 
ATOM   1892 C CZ3 . TRP A 1 267 ? -22.062 5.470   52.197 1.00 171.91 ? 267  TRP A CZ3 1 
ATOM   1893 C CH2 . TRP A 1 267 ? -21.103 5.639   53.202 1.00 176.00 ? 267  TRP A CH2 1 
ATOM   1894 N N   . GLY A 1 268 ? -24.924 9.618   47.840 1.00 170.86 ? 268  GLY A N   1 
ATOM   1895 C CA  . GLY A 1 268 ? -25.961 9.715   46.830 1.00 169.83 ? 268  GLY A CA  1 
ATOM   1896 C C   . GLY A 1 268 ? -25.689 10.807  45.816 1.00 166.10 ? 268  GLY A C   1 
ATOM   1897 O O   . GLY A 1 268 ? -26.356 10.889  44.784 1.00 164.44 ? 268  GLY A O   1 
ATOM   1898 N N   . GLY A 1 269 ? -24.703 11.649  46.111 1.00 175.23 ? 269  GLY A N   1 
ATOM   1899 C CA  . GLY A 1 269 ? -24.366 12.758  45.236 1.00 172.82 ? 269  GLY A CA  1 
ATOM   1900 C C   . GLY A 1 269 ? -23.814 12.308  43.895 1.00 163.63 ? 269  GLY A C   1 
ATOM   1901 O O   . GLY A 1 269 ? -23.344 11.181  43.748 1.00 159.26 ? 269  GLY A O   1 
ATOM   1902 N N   . HIS A 1 270 ? -23.885 13.198  42.913 1.00 192.18 ? 270  HIS A N   1 
ATOM   1903 C CA  . HIS A 1 270 ? -23.293 12.960  41.610 1.00 185.33 ? 270  HIS A CA  1 
ATOM   1904 C C   . HIS A 1 270 ? -22.592 14.230  41.189 1.00 184.54 ? 270  HIS A C   1 
ATOM   1905 O O   . HIS A 1 270 ? -23.152 15.305  41.228 1.00 189.80 ? 270  HIS A O   1 
ATOM   1906 C CB  . HIS A 1 270 ? -24.367 12.625  40.576 1.00 186.12 ? 270  HIS A CB  1 
ATOM   1907 C CG  . HIS A 1 270 ? -25.092 11.345  40.846 1.00 188.11 ? 270  HIS A CG  1 
ATOM   1908 N ND1 . HIS A 1 270 ? -26.381 11.302  41.330 1.00 193.97 ? 270  HIS A ND1 1 
ATOM   1909 C CD2 . HIS A 1 270 ? -24.702 10.053  40.698 1.00 186.30 ? 270  HIS A CD2 1 
ATOM   1910 C CE1 . HIS A 1 270 ? -26.756 10.043  41.470 1.00 195.31 ? 270  HIS A CE1 1 
ATOM   1911 N NE2 . HIS A 1 270 ? -25.759 9.267   41.095 1.00 191.17 ? 270  HIS A NE2 1 
ATOM   1912 N N   . PHE A 1 271 ? -21.345 14.126  40.783 1.00 150.52 ? 271  PHE A N   1 
ATOM   1913 C CA  . PHE A 1 271 ? -20.655 15.290  40.267 1.00 150.09 ? 271  PHE A CA  1 
ATOM   1914 C C   . PHE A 1 271 ? -21.376 15.789  39.037 1.00 150.65 ? 271  PHE A C   1 
ATOM   1915 O O   . PHE A 1 271 ? -21.719 15.011  38.149 1.00 148.21 ? 271  PHE A O   1 
ATOM   1916 C CB  . PHE A 1 271 ? -19.196 14.970  39.950 1.00 144.00 ? 271  PHE A CB  1 
ATOM   1917 C CG  . PHE A 1 271 ? -18.319 14.948  41.156 1.00 145.00 ? 271  PHE A CG  1 
ATOM   1918 C CD1 . PHE A 1 271 ? -17.841 13.753  41.661 1.00 142.08 ? 271  PHE A CD1 1 
ATOM   1919 C CD2 . PHE A 1 271 ? -17.994 16.123  41.803 1.00 150.70 ? 271  PHE A CD2 1 
ATOM   1920 C CE1 . PHE A 1 271 ? -17.030 13.734  42.782 1.00 143.86 ? 271  PHE A CE1 1 
ATOM   1921 C CE2 . PHE A 1 271 ? -17.189 16.112  42.920 1.00 153.51 ? 271  PHE A CE2 1 
ATOM   1922 C CZ  . PHE A 1 271 ? -16.704 14.916  43.412 1.00 149.65 ? 271  PHE A CZ  1 
ATOM   1923 N N   . VAL A 1 272 ? -21.645 17.087  39.012 1.00 132.24 ? 272  VAL A N   1 
ATOM   1924 C CA  . VAL A 1 272 ? -22.219 17.711  37.836 1.00 133.47 ? 272  VAL A CA  1 
ATOM   1925 C C   . VAL A 1 272 ? -21.212 17.583  36.709 1.00 127.61 ? 272  VAL A C   1 
ATOM   1926 O O   . VAL A 1 272 ? -20.066 17.194  36.932 1.00 123.18 ? 272  VAL A O   1 
ATOM   1927 C CB  . VAL A 1 272 ? -22.554 19.191  38.097 1.00 141.44 ? 272  VAL A CB  1 
ATOM   1928 C CG1 . VAL A 1 272 ? -22.569 19.992  36.799 1.00 141.69 ? 272  VAL A CG1 1 
ATOM   1929 C CG2 . VAL A 1 272 ? -23.880 19.311  38.817 1.00 149.02 ? 272  VAL A CG2 1 
ATOM   1930 N N   . ASP A 1 273 ? -21.652 17.884  35.495 1.00 173.42 ? 273  ASP A N   1 
ATOM   1931 C CA  . ASP A 1 273 ? -20.754 17.850  34.365 1.00 169.81 ? 273  ASP A CA  1 
ATOM   1932 C C   . ASP A 1 273 ? -20.261 19.239  34.044 1.00 172.06 ? 273  ASP A C   1 
ATOM   1933 O O   . ASP A 1 273 ? -20.877 20.237  34.235 1.00 177.82 ? 273  ASP A O   1 
ATOM   1934 C CB  . ASP A 1 273 ? -21.433 17.278  33.133 1.00 171.16 ? 273  ASP A CB  1 
ATOM   1935 C CG  . ASP A 1 273 ? -20.436 16.897  32.051 1.00 168.89 ? 273  ASP A CG  1 
ATOM   1936 O OD1 . ASP A 1 273 ? -19.218 17.041  32.282 1.00 165.09 ? 273  ASP A OD1 1 
ATOM   1937 O OD2 . ASP A 1 273 ? -20.869 16.453  30.973 1.00 172.16 ? 273  ASP A OD2 1 
ATOM   1938 N N   . VAL A 1 274 ? -19.095 19.316  33.503 1.00 139.71 ? 274  VAL A N   1 
ATOM   1939 C CA  . VAL A 1 274 ? -18.418 20.545  33.182 1.00 141.89 ? 274  VAL A CA  1 
ATOM   1940 C C   . VAL A 1 274 ? -18.183 20.573  31.682 1.00 141.41 ? 274  VAL A C   1 
ATOM   1941 O O   . VAL A 1 274 ? -17.461 21.425  31.164 1.00 142.65 ? 274  VAL A O   1 
ATOM   1942 C CB  . VAL A 1 274 ? -17.071 20.568  33.933 1.00 138.88 ? 274  VAL A CB  1 
ATOM   1943 C CG1 . VAL A 1 274 ? -17.348 20.778  35.417 1.00 142.64 ? 274  VAL A CG1 1 
ATOM   1944 C CG2 . VAL A 1 274 ? -16.348 19.260  33.729 1.00 132.24 ? 274  VAL A CG2 1 
ATOM   1945 N N   . PHE A 1 275 ? -18.799 19.618  30.995 1.00 124.79 ? 275  PHE A N   1 
ATOM   1946 C CA  . PHE A 1 275 ? -18.652 19.517  29.555 1.00 140.43 ? 275  PHE A CA  1 
ATOM   1947 C C   . PHE A 1 275 ? -19.894 20.012  28.828 1.00 150.88 ? 275  PHE A C   1 
ATOM   1948 O O   . PHE A 1 275 ? -21.016 19.572  29.080 1.00 152.13 ? 275  PHE A O   1 
ATOM   1949 C CB  . PHE A 1 275 ? -18.276 18.098  29.147 1.00 147.63 ? 275  PHE A CB  1 
ATOM   1950 C CG  . PHE A 1 275 ? -16.910 17.695  29.601 1.00 139.03 ? 275  PHE A CG  1 
ATOM   1951 C CD1 . PHE A 1 275 ? -16.741 16.718  30.566 1.00 129.93 ? 275  PHE A CD1 1 
ATOM   1952 C CD2 . PHE A 1 275 ? -15.793 18.319  29.088 1.00 139.76 ? 275  PHE A CD2 1 
ATOM   1953 C CE1 . PHE A 1 275 ? -15.480 16.357  30.989 1.00 121.34 ? 275  PHE A CE1 1 
ATOM   1954 C CE2 . PHE A 1 275 ? -14.535 17.962  29.507 1.00 131.12 ? 275  PHE A CE2 1 
ATOM   1955 C CZ  . PHE A 1 275 ? -14.377 16.982  30.459 1.00 121.70 ? 275  PHE A CZ  1 
ATOM   1956 N N   . THR A 1 276 ? -19.659 20.948  27.924 1.00 172.43 ? 276  THR A N   1 
ATOM   1957 C CA  . THR A 1 276 ? -20.708 21.738  27.324 1.00 179.48 ? 276  THR A CA  1 
ATOM   1958 C C   . THR A 1 276 ? -20.562 21.699  25.819 1.00 197.00 ? 276  THR A C   1 
ATOM   1959 O O   . THR A 1 276 ? -19.509 21.344  25.296 1.00 202.23 ? 276  THR A O   1 
ATOM   1960 C CB  . THR A 1 276 ? -20.576 23.197  27.789 1.00 170.46 ? 276  THR A CB  1 
ATOM   1961 O OG1 . THR A 1 276 ? -20.766 23.259  29.208 1.00 155.17 ? 276  THR A OG1 1 
ATOM   1962 C CG2 . THR A 1 276 ? -21.590 24.092  27.095 1.00 178.26 ? 276  THR A CG2 1 
ATOM   1963 N N   . THR A 1 277 ? -21.632 22.047  25.122 1.00 204.92 ? 277  THR A N   1 
ATOM   1964 C CA  . THR A 1 277 ? -21.535 22.338  23.707 1.00 221.39 ? 277  THR A CA  1 
ATOM   1965 C C   . THR A 1 277 ? -21.839 23.819  23.525 1.00 219.52 ? 277  THR A C   1 
ATOM   1966 O O   . THR A 1 277 ? -22.898 24.301  23.922 1.00 214.39 ? 277  THR A O   1 
ATOM   1967 C CB  . THR A 1 277 ? -22.507 21.488  22.882 1.00 236.26 ? 277  THR A CB  1 
ATOM   1968 O OG1 . THR A 1 277 ? -22.546 20.156  23.410 1.00 234.08 ? 277  THR A OG1 1 
ATOM   1969 C CG2 . THR A 1 277 ? -22.065 21.443  21.429 1.00 255.03 ? 277  THR A CG2 1 
ATOM   1970 N N   . LEU A 1 278 ? -20.893 24.545  22.946 1.00 250.70 ? 278  LEU A N   1 
ATOM   1971 C CA  . LEU A 1 278 ? -21.057 25.974  22.738 1.00 248.68 ? 278  LEU A CA  1 
ATOM   1972 C C   . LEU A 1 278 ? -22.157 26.229  21.721 1.00 261.92 ? 278  LEU A C   1 
ATOM   1973 O O   . LEU A 1 278 ? -22.619 25.303  21.055 1.00 273.59 ? 278  LEU A O   1 
ATOM   1974 C CB  . LEU A 1 278 ? -19.740 26.592  22.263 1.00 251.21 ? 278  LEU A CB  1 
ATOM   1975 C CG  . LEU A 1 278 ? -18.618 26.527  23.299 1.00 236.98 ? 278  LEU A CG  1 
ATOM   1976 C CD1 . LEU A 1 278 ? -17.310 27.056  22.746 1.00 240.76 ? 278  LEU A CD1 1 
ATOM   1977 C CD2 . LEU A 1 278 ? -19.015 27.296  24.541 1.00 220.57 ? 278  LEU A CD2 1 
ATOM   1978 N N   . PRO A 1 279 ? -22.602 27.487  21.615 1.00 208.17 ? 279  PRO A N   1 
ATOM   1979 C CA  . PRO A 1 279 ? -23.484 27.848  20.507 1.00 221.30 ? 279  PRO A CA  1 
ATOM   1980 C C   . PRO A 1 279 ? -22.775 27.523  19.200 1.00 238.99 ? 279  PRO A C   1 
ATOM   1981 O O   . PRO A 1 279 ? -23.390 27.033  18.256 1.00 251.34 ? 279  PRO A O   1 
ATOM   1982 C CB  . PRO A 1 279 ? -23.635 29.367  20.671 1.00 214.48 ? 279  PRO A CB  1 
ATOM   1983 C CG  . PRO A 1 279 ? -22.493 29.769  21.568 1.00 201.10 ? 279  PRO A CG  1 
ATOM   1984 C CD  . PRO A 1 279 ? -22.383 28.629  22.513 1.00 193.40 ? 279  PRO A CD  1 
ATOM   1985 N N   . ASP A 1 280 ? -21.470 27.772  19.170 1.00 238.94 ? 280  ASP A N   1 
ATOM   1986 C CA  . ASP A 1 280 ? -20.658 27.520  17.989 1.00 243.97 ? 280  ASP A CA  1 
ATOM   1987 C C   . ASP A 1 280 ? -20.655 26.042  17.601 1.00 252.07 ? 280  ASP A C   1 
ATOM   1988 O O   . ASP A 1 280 ? -20.350 25.694  16.464 1.00 259.15 ? 280  ASP A O   1 
ATOM   1989 C CB  . ASP A 1 280 ? -19.223 28.014  18.215 1.00 236.27 ? 280  ASP A CB  1 
ATOM   1990 C CG  . ASP A 1 280 ? -18.331 27.803  17.001 1.00 241.01 ? 280  ASP A CG  1 
ATOM   1991 O OD1 . ASP A 1 280 ? -18.862 27.501  15.914 1.00 250.57 ? 280  ASP A OD1 1 
ATOM   1992 O OD2 . ASP A 1 280 ? -17.097 27.948  17.127 1.00 235.55 ? 280  ASP A OD2 1 
ATOM   1993 N N   . GLY A 1 281 ? -21.001 25.172  18.542 1.00 249.78 ? 281  GLY A N   1 
ATOM   1994 C CA  . GLY A 1 281 ? -20.945 23.742  18.293 1.00 256.90 ? 281  GLY A CA  1 
ATOM   1995 C C   . GLY A 1 281 ? -19.576 23.192  18.641 1.00 252.53 ? 281  GLY A C   1 
ATOM   1996 O O   . GLY A 1 281 ? -19.222 22.071  18.280 1.00 258.25 ? 281  GLY A O   1 
ATOM   1997 N N   . ARG A 1 282 ? -18.801 24.003  19.349 1.00 230.57 ? 282  ARG A N   1 
ATOM   1998 C CA  . ARG A 1 282 ? -17.485 23.599  19.816 1.00 224.46 ? 282  ARG A CA  1 
ATOM   1999 C C   . ARG A 1 282 ? -17.554 23.183  21.281 1.00 207.15 ? 282  ARG A C   1 
ATOM   2000 O O   . ARG A 1 282 ? -18.145 23.878  22.104 1.00 194.80 ? 282  ARG A O   1 
ATOM   2001 C CB  . ARG A 1 282 ? -16.489 24.743  19.626 1.00 217.15 ? 282  ARG A CB  1 
ATOM   2002 C CG  . ARG A 1 282 ? -17.113 26.119  19.759 1.00 213.91 ? 282  ARG A CG  1 
ATOM   2003 C CD  . ARG A 1 282 ? -16.087 27.211  19.534 1.00 207.35 ? 282  ARG A CD  1 
ATOM   2004 N NE  . ARG A 1 282 ? -16.465 28.460  20.186 1.00 201.08 ? 282  ARG A NE  1 
ATOM   2005 C CZ  . ARG A 1 282 ? -15.588 29.347  20.636 1.00 192.50 ? 282  ARG A CZ  1 
ATOM   2006 N NH1 . ARG A 1 282 ? -14.292 29.112  20.499 1.00 188.61 ? 282  ARG A NH1 1 
ATOM   2007 N NH2 . ARG A 1 282 ? -16.001 30.460  21.225 1.00 184.62 ? 282  ARG A NH2 1 
ATOM   2008 N N   . ARG A 1 283 ? -16.962 22.038  21.598 1.00 209.79 ? 283  ARG A N   1 
ATOM   2009 C CA  . ARG A 1 283 ? -16.969 21.528  22.963 1.00 192.68 ? 283  ARG A CA  1 
ATOM   2010 C C   . ARG A 1 283 ? -16.204 22.470  23.889 1.00 175.77 ? 283  ARG A C   1 
ATOM   2011 O O   . ARG A 1 283 ? -15.351 23.233  23.436 1.00 177.84 ? 283  ARG A O   1 
ATOM   2012 C CB  . ARG A 1 283 ? -16.375 20.119  23.002 1.00 195.50 ? 283  ARG A CB  1 
ATOM   2013 C CG  . ARG A 1 283 ? -17.215 19.067  22.292 1.00 210.96 ? 283  ARG A CG  1 
ATOM   2014 C CD  . ARG A 1 283 ? -18.023 18.238  23.278 1.00 201.81 ? 283  ARG A CD  1 
ATOM   2015 N N   . ALA A 1 284 ? -16.515 22.421  25.183 1.00 128.43 ? 284  ALA A N   1 
ATOM   2016 C CA  . ALA A 1 284 ? -15.935 23.356  26.147 1.00 113.70 ? 284  ALA A CA  1 
ATOM   2017 C C   . ALA A 1 284 ? -15.844 22.778  27.558 1.00 111.88 ? 284  ALA A C   1 
ATOM   2018 O O   . ALA A 1 284 ? -16.491 21.787  27.867 1.00 113.78 ? 284  ALA A O   1 
ATOM   2019 C CB  . ALA A 1 284 ? -16.728 24.637  26.165 1.00 113.00 ? 284  ALA A CB  1 
ATOM   2020 N N   . LEU A 1 285 ? -15.029 23.406  28.403 1.00 141.83 ? 285  LEU A N   1 
ATOM   2021 C CA  . LEU A 1 285 ? -14.939 23.036  29.818 1.00 125.82 ? 285  LEU A CA  1 
ATOM   2022 C C   . LEU A 1 285 ? -15.219 24.217  30.731 1.00 114.25 ? 285  LEU A C   1 
ATOM   2023 O O   . LEU A 1 285 ? -14.557 25.248  30.684 1.00 110.05 ? 285  LEU A O   1 
ATOM   2024 C CB  . LEU A 1 285 ? -13.558 22.453  30.128 1.00 169.48 ? 285  LEU A CB  1 
ATOM   2025 C CG  . LEU A 1 285 ? -13.291 22.085  31.590 1.00 165.96 ? 285  LEU A CG  1 
ATOM   2026 C CD1 . LEU A 1 285 ? -14.237 20.986  32.047 1.00 170.15 ? 285  LEU A CD1 1 
ATOM   2027 C CD2 . LEU A 1 285 ? -11.842 21.666  31.783 1.00 160.44 ? 285  LEU A CD2 1 
ATOM   2028 N N   . ASP A 1 286 ? -16.223 24.043  31.571 1.00 147.87 ? 286  ASP A N   1 
ATOM   2029 C CA  . ASP A 1 286 ? -16.622 25.058  32.525 1.00 156.16 ? 286  ASP A CA  1 
ATOM   2030 C C   . ASP A 1 286 ? -16.231 24.590  33.921 1.00 155.18 ? 286  ASP A C   1 
ATOM   2031 O O   . ASP A 1 286 ? -16.957 23.820  34.538 1.00 152.98 ? 286  ASP A O   1 
ATOM   2032 C CB  . ASP A 1 286 ? -18.135 25.251  32.449 1.00 161.32 ? 286  ASP A CB  1 
ATOM   2033 C CG  . ASP A 1 286 ? -18.616 26.440  33.248 1.00 172.84 ? 286  ASP A CG  1 
ATOM   2034 O OD1 . ASP A 1 286 ? -17.784 27.076  33.930 1.00 177.59 ? 286  ASP A OD1 1 
ATOM   2035 O OD2 . ASP A 1 286 ? -19.830 26.737  33.195 1.00 178.58 ? 286  ASP A OD2 1 
ATOM   2036 N N   . LEU A 1 287 ? -15.071 25.012  34.415 1.00 114.35 ? 287  LEU A N   1 
ATOM   2037 C CA  . LEU A 1 287 ? -14.568 24.584  35.721 1.00 114.50 ? 287  LEU A CA  1 
ATOM   2038 C C   . LEU A 1 287 ? -15.299 25.259  36.867 1.00 125.94 ? 287  LEU A C   1 
ATOM   2039 O O   . LEU A 1 287 ? -14.924 25.146  38.025 1.00 130.05 ? 287  LEU A O   1 
ATOM   2040 C CB  . LEU A 1 287 ? -13.067 24.855  35.828 1.00 113.95 ? 287  LEU A CB  1 
ATOM   2041 C CG  . LEU A 1 287 ? -12.108 24.027  34.969 1.00 103.45 ? 287  LEU A CG  1 
ATOM   2042 C CD1 . LEU A 1 287 ? -10.683 24.455  35.241 1.00 104.77 ? 287  LEU A CD1 1 
ATOM   2043 C CD2 . LEU A 1 287 ? -12.280 22.542  35.233 1.00 94.95  ? 287  LEU A CD2 1 
ATOM   2044 N N   . GLY A 1 288 ? -16.327 26.013  36.539 1.00 108.39 ? 288  GLY A N   1 
ATOM   2045 C CA  . GLY A 1 288 ? -17.169 26.552  37.579 1.00 120.54 ? 288  GLY A CA  1 
ATOM   2046 C C   . GLY A 1 288 ? -17.989 25.423  38.179 1.00 115.58 ? 288  GLY A C   1 
ATOM   2047 O O   . GLY A 1 288 ? -18.275 25.391  39.378 1.00 122.79 ? 288  GLY A O   1 
ATOM   2048 N N   . LYS A 1 289 ? -18.364 24.478  37.328 1.00 199.96 ? 289  LYS A N   1 
ATOM   2049 C CA  . LYS A 1 289 ? -19.164 23.340  37.751 1.00 195.32 ? 289  LYS A CA  1 
ATOM   2050 C C   . LYS A 1 289 ? -18.342 22.325  38.532 1.00 189.17 ? 289  LYS A C   1 
ATOM   2051 O O   . LYS A 1 289 ? -18.901 21.463  39.205 1.00 187.93 ? 289  LYS A O   1 
ATOM   2052 C CB  . LYS A 1 289 ? -19.789 22.680  36.527 1.00 187.99 ? 289  LYS A CB  1 
ATOM   2053 C CG  . LYS A 1 289 ? -20.401 23.698  35.599 1.00 193.64 ? 289  LYS A CG  1 
ATOM   2054 C CD  . LYS A 1 289 ? -21.048 23.065  34.397 1.00 188.52 ? 289  LYS A CD  1 
ATOM   2055 C CE  . LYS A 1 289 ? -21.600 24.141  33.496 1.00 194.95 ? 289  LYS A CE  1 
ATOM   2056 N NZ  . LYS A 1 289 ? -22.499 25.019  34.294 1.00 205.80 ? 289  LYS A NZ  1 
ATOM   2057 N N   . PHE A 1 290 ? -17.020 22.445  38.457 1.00 132.11 ? 290  PHE A N   1 
ATOM   2058 C CA  . PHE A 1 290 ? -16.120 21.421  38.992 1.00 125.44 ? 290  PHE A CA  1 
ATOM   2059 C C   . PHE A 1 290 ? -16.428 20.951  40.411 1.00 129.76 ? 290  PHE A C   1 
ATOM   2060 O O   . PHE A 1 290 ? -16.296 19.766  40.714 1.00 123.38 ? 290  PHE A O   1 
ATOM   2061 C CB  . PHE A 1 290 ? -14.659 21.867  38.914 1.00 124.80 ? 290  PHE A CB  1 
ATOM   2062 C CG  . PHE A 1 290 ? -13.683 20.781  39.275 1.00 117.25 ? 290  PHE A CG  1 
ATOM   2063 C CD1 . PHE A 1 290 ? -13.505 19.689  38.442 1.00 107.53 ? 290  PHE A CD1 1 
ATOM   2064 C CD2 . PHE A 1 290 ? -12.949 20.849  40.445 1.00 121.65 ? 290  PHE A CD2 1 
ATOM   2065 C CE1 . PHE A 1 290 ? -12.615 18.690  38.767 1.00 102.01 ? 290  PHE A CE1 1 
ATOM   2066 C CE2 . PHE A 1 290 ? -12.055 19.852  40.774 1.00 115.26 ? 290  PHE A CE2 1 
ATOM   2067 C CZ  . PHE A 1 290 ? -11.888 18.771  39.932 1.00 105.24 ? 290  PHE A CZ  1 
ATOM   2068 N N   . HIS A 1 291 ? -16.818 21.873  41.282 1.00 106.19 ? 291  HIS A N   1 
ATOM   2069 C CA  . HIS A 1 291 ? -17.080 21.522  42.673 1.00 109.89 ? 291  HIS A CA  1 
ATOM   2070 C C   . HIS A 1 291 ? -18.544 21.236  42.929 1.00 113.22 ? 291  HIS A C   1 
ATOM   2071 O O   . HIS A 1 291 ? -18.941 20.940  44.055 1.00 119.90 ? 291  HIS A O   1 
ATOM   2072 C CB  . HIS A 1 291 ? -16.610 22.631  43.610 1.00 124.76 ? 291  HIS A CB  1 
ATOM   2073 C CG  . HIS A 1 291 ? -15.121 22.746  43.705 1.00 122.96 ? 291  HIS A CG  1 
ATOM   2074 N ND1 . HIS A 1 291 ? -14.343 21.768  44.301 1.00 117.16 ? 291  HIS A ND1 1 
ATOM   2075 C CD2 . HIS A 1 291 ? -14.271 23.703  43.287 1.00 126.76 ? 291  HIS A CD2 1 
ATOM   2076 C CE1 . HIS A 1 291 ? -13.075 22.135  44.238 1.00 117.26 ? 291  HIS A CE1 1 
ATOM   2077 N NE2 . HIS A 1 291 ? -12.997 23.298  43.634 1.00 123.01 ? 291  HIS A NE2 1 
ATOM   2078 N N   . GLU A 1 292 ? -19.351 21.309  41.883 1.00 225.99 ? 292  GLU A N   1 
ATOM   2079 C CA  . GLU A 1 292 ? -20.780 21.133  42.057 1.00 230.06 ? 292  GLU A CA  1 
ATOM   2080 C C   . GLU A 1 292 ? -21.227 19.679  42.046 1.00 221.19 ? 292  GLU A C   1 
ATOM   2081 O O   . GLU A 1 292 ? -20.927 18.945  41.089 1.00 210.97 ? 292  GLU A O   1 
ATOM   2082 C CB  . GLU A 1 292 ? -21.550 21.955  41.031 1.00 232.70 ? 292  GLU A CB  1 
ATOM   2083 C CG  . GLU A 1 292 ? -21.774 23.371  41.492 1.00 247.91 ? 292  GLU A CG  1 
ATOM   2084 C CD  . GLU A 1 292 ? -22.432 24.226  40.436 1.00 251.02 ? 292  GLU A CD  1 
ATOM   2085 O OE1 . GLU A 1 292 ? -23.080 23.663  39.526 1.00 243.15 ? 292  GLU A OE1 1 
ATOM   2086 O OE2 . GLU A 1 292 ? -22.309 25.464  40.521 1.00 262.81 ? 292  GLU A OE2 1 
ATOM   2087 N N   . ILE A 1 293 ? -21.949 19.301  43.107 1.00 186.76 ? 293  ILE A N   1 
ATOM   2088 C CA  . ILE A 1 293 ? -22.438 17.938  43.233 1.00 180.41 ? 293  ILE A CA  1 
ATOM   2089 C C   . ILE A 1 293 ? -23.956 17.919  43.267 1.00 185.41 ? 293  ILE A C   1 
ATOM   2090 O O   . ILE A 1 293 ? -24.575 18.441  44.201 1.00 196.23 ? 293  ILE A O   1 
ATOM   2091 C CB  . ILE A 1 293 ? -21.906 17.270  44.502 1.00 182.28 ? 293  ILE A CB  1 
ATOM   2092 C CG1 . ILE A 1 293 ? -20.391 17.424  44.578 1.00 179.21 ? 293  ILE A CG1 1 
ATOM   2093 C CG2 . ILE A 1 293 ? -22.302 15.795  44.543 1.00 175.88 ? 293  ILE A CG2 1 
ATOM   2094 C CD1 . ILE A 1 293 ? -19.754 16.633  45.667 1.00 179.81 ? 293  ILE A CD1 1 
ATOM   2095 N N   . ALA A 1 294 ? -24.548 17.310  42.246 1.00 213.30 ? 294  ALA A N   1 
ATOM   2096 C CA  . ALA A 1 294 ? -25.990 17.140  42.175 1.00 217.41 ? 294  ALA A CA  1 
ATOM   2097 C C   . ALA A 1 294 ? -26.450 16.230  43.306 1.00 220.39 ? 294  ALA A C   1 
ATOM   2098 O O   . ALA A 1 294 ? -25.695 15.381  43.781 1.00 216.09 ? 294  ALA A O   1 
ATOM   2099 C CB  . ALA A 1 294 ? -26.382 16.556  40.828 1.00 210.87 ? 294  ALA A CB  1 
ATOM   2100 N N   . GLN A 1 295 ? -27.692 16.408  43.735 1.00 176.81 ? 295  GLN A N   1 
ATOM   2101 C CA  . GLN A 1 295 ? -28.224 15.621  44.833 1.00 181.29 ? 295  GLN A CA  1 
ATOM   2102 C C   . GLN A 1 295 ? -29.745 15.496  44.759 1.00 186.85 ? 295  GLN A C   1 
ATOM   2103 O O   . GLN A 1 295 ? -30.441 16.453  44.415 1.00 192.50 ? 295  GLN A O   1 
ATOM   2104 C CB  . GLN A 1 295 ? -27.798 16.232  46.166 1.00 190.95 ? 295  GLN A CB  1 
ATOM   2105 C CG  . GLN A 1 295 ? -28.145 15.378  47.359 1.00 195.85 ? 295  GLN A CG  1 
ATOM   2106 C CD  . GLN A 1 295 ? -27.078 15.428  48.426 1.00 199.77 ? 295  GLN A CD  1 
ATOM   2107 O OE1 . GLN A 1 295 ? -26.475 16.472  48.671 1.00 205.99 ? 295  GLN A OE1 1 
ATOM   2108 N NE2 . GLN A 1 295 ? -26.832 14.291  49.065 1.00 197.34 ? 295  GLN A NE2 1 
ATOM   2109 N N   . PRO B 1 12  ? 33.447  -12.604 60.046 1.00 157.20 ? 12   PRO B N   1 
ATOM   2110 C CA  . PRO B 1 12  ? 33.882  -12.709 58.649 1.00 157.19 ? 12   PRO B CA  1 
ATOM   2111 C C   . PRO B 1 12  ? 32.725  -12.458 57.689 1.00 154.08 ? 12   PRO B C   1 
ATOM   2112 O O   . PRO B 1 12  ? 32.498  -13.263 56.787 1.00 153.87 ? 12   PRO B O   1 
ATOM   2113 C CB  . PRO B 1 12  ? 34.330  -14.165 58.540 1.00 159.40 ? 12   PRO B CB  1 
ATOM   2114 C CG  . PRO B 1 12  ? 33.479  -14.893 59.536 1.00 159.22 ? 12   PRO B CG  1 
ATOM   2115 C CD  . PRO B 1 12  ? 33.122  -13.917 60.632 1.00 158.40 ? 12   PRO B CD  1 
ATOM   2116 N N   . ARG B 1 13  ? 32.014  -11.350 57.878 1.00 169.61 ? 13   ARG B N   1 
ATOM   2117 C CA  . ARG B 1 13  ? 30.778  -11.091 57.141 1.00 166.80 ? 13   ARG B CA  1 
ATOM   2118 C C   . ARG B 1 13  ? 30.980  -10.624 55.700 1.00 165.93 ? 13   ARG B C   1 
ATOM   2119 O O   . ARG B 1 13  ? 31.842  -9.790  55.414 1.00 166.64 ? 13   ARG B O   1 
ATOM   2120 C CB  . ARG B 1 13  ? 29.899  -10.096 57.905 1.00 164.82 ? 13   ARG B CB  1 
ATOM   2121 C CG  . ARG B 1 13  ? 30.635  -8.865  58.412 1.00 165.19 ? 13   ARG B CG  1 
ATOM   2122 C CD  . ARG B 1 13  ? 29.845  -8.173  59.515 1.00 163.84 ? 13   ARG B CD  1 
ATOM   2123 N NE  . ARG B 1 13  ? 28.516  -7.762  59.068 1.00 161.11 ? 13   ARG B NE  1 
ATOM   2124 C CZ  . ARG B 1 13  ? 27.616  -7.169  59.846 1.00 159.69 ? 13   ARG B CZ  1 
ATOM   2125 N NH1 . ARG B 1 13  ? 27.902  -6.916  61.116 1.00 160.63 ? 13   ARG B NH1 1 
ATOM   2126 N NH2 . ARG B 1 13  ? 26.431  -6.829  59.356 1.00 157.50 ? 13   ARG B NH2 1 
ATOM   2127 N N   . ILE B 1 14  ? 30.166  -11.174 54.802 1.00 141.68 ? 14   ILE B N   1 
ATOM   2128 C CA  . ILE B 1 14  ? 30.188  -10.800 53.395 1.00 140.68 ? 14   ILE B CA  1 
ATOM   2129 C C   . ILE B 1 14  ? 29.738  -9.359  53.241 1.00 138.66 ? 14   ILE B C   1 
ATOM   2130 O O   . ILE B 1 14  ? 30.304  -8.602  52.456 1.00 138.73 ? 14   ILE B O   1 
ATOM   2131 C CB  . ILE B 1 14  ? 29.235  -11.669 52.555 1.00 139.71 ? 14   ILE B CB  1 
ATOM   2132 C CG1 . ILE B 1 14  ? 29.284  -13.128 53.014 1.00 141.48 ? 14   ILE B CG1 1 
ATOM   2133 C CG2 . ILE B 1 14  ? 29.544  -11.517 51.067 1.00 139.38 ? 14   ILE B CG2 1 
ATOM   2134 C CD1 . ILE B 1 14  ? 30.674  -13.624 53.344 1.00 144.05 ? 14   ILE B CD1 1 
ATOM   2135 N N   . LEU B 1 15  ? 28.704  -8.991  53.989 1.00 138.96 ? 15   LEU B N   1 
ATOM   2136 C CA  . LEU B 1 15  ? 28.147  -7.647  53.915 1.00 136.93 ? 15   LEU B CA  1 
ATOM   2137 C C   . LEU B 1 15  ? 28.334  -6.896  55.225 1.00 137.09 ? 15   LEU B C   1 
ATOM   2138 O O   . LEU B 1 15  ? 28.141  -7.451  56.306 1.00 137.77 ? 15   LEU B O   1 
ATOM   2139 C CB  . LEU B 1 15  ? 26.663  -7.698  53.547 1.00 134.87 ? 15   LEU B CB  1 
ATOM   2140 C CG  . LEU B 1 15  ? 26.316  -8.195  52.142 1.00 134.44 ? 15   LEU B CG  1 
ATOM   2141 C CD1 . LEU B 1 15  ? 24.839  -8.547  52.040 1.00 133.29 ? 15   LEU B CD1 1 
ATOM   2142 C CD2 . LEU B 1 15  ? 26.698  -7.162  51.097 1.00 133.70 ? 15   LEU B CD2 1 
ATOM   2143 N N   . ASN B 1 16  ? 28.717  -5.629  55.116 1.00 134.26 ? 16   ASN B N   1 
ATOM   2144 C CA  . ASN B 1 16  ? 28.869  -4.773  56.281 1.00 134.35 ? 16   ASN B CA  1 
ATOM   2145 C C   . ASN B 1 16  ? 27.529  -4.195  56.703 1.00 131.88 ? 16   ASN B C   1 
ATOM   2146 O O   . ASN B 1 16  ? 26.548  -4.268  55.961 1.00 130.21 ? 16   ASN B O   1 
ATOM   2147 C CB  . ASN B 1 16  ? 29.843  -3.633  55.987 1.00 135.30 ? 16   ASN B CB  1 
ATOM   2148 C CG  . ASN B 1 16  ? 31.174  -4.122  55.458 1.00 138.10 ? 16   ASN B CG  1 
ATOM   2149 O OD1 . ASN B 1 16  ? 31.680  -5.162  55.880 1.00 139.87 ? 16   ASN B OD1 1 
ATOM   2150 N ND2 . ASN B 1 16  ? 31.753  -3.367  54.532 1.00 138.78 ? 16   ASN B ND2 1 
ATOM   2151 N N   . SER B 1 17  ? 27.497  -3.614  57.897 1.00 105.09 ? 17   SER B N   1 
ATOM   2152 C CA  . SER B 1 17  ? 26.288  -3.002  58.423 1.00 103.00 ? 17   SER B CA  1 
ATOM   2153 C C   . SER B 1 17  ? 25.784  -1.907  57.493 1.00 101.06 ? 17   SER B C   1 
ATOM   2154 O O   . SER B 1 17  ? 24.581  -1.786  57.269 1.00 99.29  ? 17   SER B O   1 
ATOM   2155 C CB  . SER B 1 17  ? 26.554  -2.432  59.812 1.00 103.53 ? 17   SER B CB  1 
ATOM   2156 O OG  . SER B 1 17  ? 27.270  -3.366  60.597 1.00 105.80 ? 17   SER B OG  1 
ATOM   2157 N N   . ASP B 1 18  ? 26.707  -1.117  56.947 1.00 149.84 ? 18   ASP B N   1 
ATOM   2158 C CA  . ASP B 1 18  ? 26.346  -0.023  56.047 1.00 148.36 ? 18   ASP B CA  1 
ATOM   2159 C C   . ASP B 1 18  ? 25.781  -0.539  54.724 1.00 147.48 ? 18   ASP B C   1 
ATOM   2160 O O   . ASP B 1 18  ? 25.362  0.244   53.872 1.00 146.28 ? 18   ASP B O   1 
ATOM   2161 C CB  . ASP B 1 18  ? 27.547  0.892   55.787 1.00 149.98 ? 18   ASP B CB  1 
ATOM   2162 C CG  . ASP B 1 18  ? 28.549  0.284   54.822 1.00 151.97 ? 18   ASP B CG  1 
ATOM   2163 O OD1 . ASP B 1 18  ? 29.180  -0.735  55.175 1.00 153.71 ? 18   ASP B OD1 1 
ATOM   2164 O OD2 . ASP B 1 18  ? 28.712  0.833   53.712 1.00 151.94 ? 18   ASP B OD2 1 
ATOM   2165 N N   . GLY B 1 19  ? 25.779  -1.858  54.556 1.00 83.69  ? 19   GLY B N   1 
ATOM   2166 C CA  . GLY B 1 19  ? 25.196  -2.482  53.380 1.00 83.02  ? 19   GLY B CA  1 
ATOM   2167 C C   . GLY B 1 19  ? 26.164  -2.691  52.229 1.00 84.26  ? 19   GLY B C   1 
ATOM   2168 O O   . GLY B 1 19  ? 25.819  -3.306  51.221 1.00 84.01  ? 19   GLY B O   1 
ATOM   2169 N N   . SER B 1 20  ? 27.376  -2.173  52.379 1.00 121.54 ? 20   SER B N   1 
ATOM   2170 C CA  . SER B 1 20  ? 28.408  -2.326  51.363 1.00 123.27 ? 20   SER B CA  1 
ATOM   2171 C C   . SER B 1 20  ? 28.999  -3.724  51.433 1.00 125.02 ? 20   SER B C   1 
ATOM   2172 O O   . SER B 1 20  ? 29.353  -4.196  52.511 1.00 126.13 ? 20   SER B O   1 
ATOM   2173 C CB  . SER B 1 20  ? 29.517  -1.303  51.589 1.00 125.08 ? 20   SER B CB  1 
ATOM   2174 O OG  . SER B 1 20  ? 30.120  -1.494  52.859 1.00 126.56 ? 20   SER B OG  1 
ATOM   2175 N N   . SER B 1 21  ? 29.113  -4.389  50.288 1.00 145.75 ? 21   SER B N   1 
ATOM   2176 C CA  . SER B 1 21  ? 29.694  -5.726  50.277 1.00 147.52 ? 21   SER B CA  1 
ATOM   2177 C C   . SER B 1 21  ? 31.152  -5.656  50.729 1.00 150.41 ? 21   SER B C   1 
ATOM   2178 O O   . SER B 1 21  ? 31.827  -4.644  50.540 1.00 151.43 ? 21   SER B O   1 
ATOM   2179 C CB  . SER B 1 21  ? 29.561  -6.392  48.905 1.00 147.41 ? 21   SER B CB  1 
ATOM   2180 O OG  . SER B 1 21  ? 30.546  -5.917  48.007 1.00 148.95 ? 21   SER B OG  1 
ATOM   2181 N N   . ASN B 1 22  ? 31.620  -6.742  51.332 1.00 129.05 ? 22   ASN B N   1 
ATOM   2182 C CA  . ASN B 1 22  ? 32.888  -6.761  52.046 1.00 131.97 ? 22   ASN B CA  1 
ATOM   2183 C C   . ASN B 1 22  ? 33.894  -7.693  51.382 1.00 134.52 ? 22   ASN B C   1 
ATOM   2184 O O   . ASN B 1 22  ? 34.324  -8.681  51.975 1.00 136.13 ? 22   ASN B O   1 
ATOM   2185 C CB  . ASN B 1 22  ? 32.635  -7.217  53.485 1.00 132.03 ? 22   ASN B CB  1 
ATOM   2186 C CG  . ASN B 1 22  ? 33.812  -6.965  54.400 1.00 134.90 ? 22   ASN B CG  1 
ATOM   2187 O OD1 . ASN B 1 22  ? 34.709  -6.187  54.080 1.00 136.71 ? 22   ASN B OD1 1 
ATOM   2188 N ND2 . ASN B 1 22  ? 33.808  -7.618  55.557 1.00 135.64 ? 22   ASN B ND2 1 
ATOM   2189 N N   . ILE B 1 23  ? 34.267  -7.377  50.148 1.00 129.67 ? 23   ILE B N   1 
ATOM   2190 C CA  . ILE B 1 23  ? 35.143  -8.247  49.379 1.00 132.01 ? 23   ILE B CA  1 
ATOM   2191 C C   . ILE B 1 23  ? 36.378  -7.493  48.902 1.00 135.06 ? 23   ILE B C   1 
ATOM   2192 O O   . ILE B 1 23  ? 36.352  -6.272  48.757 1.00 134.81 ? 23   ILE B O   1 
ATOM   2193 C CB  . ILE B 1 23  ? 34.400  -8.840  48.164 1.00 130.18 ? 23   ILE B CB  1 
ATOM   2194 C CG1 . ILE B 1 23  ? 33.076  -9.473  48.601 1.00 127.56 ? 23   ILE B CG1 1 
ATOM   2195 C CG2 . ILE B 1 23  ? 35.270  -9.854  47.443 1.00 132.57 ? 23   ILE B CG2 1 
ATOM   2196 C CD1 . ILE B 1 23  ? 33.233  -10.662 49.524 1.00 128.76 ? 23   ILE B CD1 1 
ATOM   2197 N N   . THR B 1 24  ? 37.461  -8.227  48.670 1.00 153.36 ? 24   THR B N   1 
ATOM   2198 C CA  . THR B 1 24  ? 38.677  -7.656  48.106 1.00 156.94 ? 24   THR B CA  1 
ATOM   2199 C C   . THR B 1 24  ? 38.601  -7.694  46.582 1.00 156.54 ? 24   THR B C   1 
ATOM   2200 O O   . THR B 1 24  ? 38.446  -8.762  45.994 1.00 156.04 ? 24   THR B O   1 
ATOM   2201 C CB  . THR B 1 24  ? 39.920  -8.447  48.553 1.00 161.01 ? 24   THR B CB  1 
ATOM   2202 O OG1 . THR B 1 24  ? 39.844  -8.719  49.959 1.00 161.05 ? 24   THR B OG1 1 
ATOM   2203 C CG2 . THR B 1 24  ? 41.189  -7.666  48.248 1.00 165.37 ? 24   THR B CG2 1 
ATOM   2204 N N   . ARG B 1 25  ? 38.707  -6.536  45.938 1.00 188.49 ? 25   ARG B N   1 
ATOM   2205 C CA  . ARG B 1 25  ? 38.629  -6.482  44.480 1.00 188.29 ? 25   ARG B CA  1 
ATOM   2206 C C   . ARG B 1 25  ? 40.013  -6.615  43.829 1.00 192.91 ? 25   ARG B C   1 
ATOM   2207 O O   . ARG B 1 25  ? 40.970  -5.964  44.248 1.00 196.45 ? 25   ARG B O   1 
ATOM   2208 C CB  . ARG B 1 25  ? 37.965  -5.179  44.031 1.00 75.57  ? 25   ARG B CB  1 
ATOM   2209 N N   . LEU B 1 26  ? 40.110  -7.463  42.807 1.00 204.67 ? 26   LEU B N   1 
ATOM   2210 C CA  . LEU B 1 26  ? 41.390  -7.747  42.153 1.00 209.16 ? 26   LEU B CA  1 
ATOM   2211 C C   . LEU B 1 26  ? 41.406  -7.338  40.681 1.00 209.63 ? 26   LEU B C   1 
ATOM   2212 O O   . LEU B 1 26  ? 40.884  -8.053  39.823 1.00 207.71 ? 26   LEU B O   1 
ATOM   2213 C CB  . LEU B 1 26  ? 41.728  -9.236  42.267 1.00 209.85 ? 26   LEU B CB  1 
ATOM   2214 C CG  . LEU B 1 26  ? 41.602  -9.879  43.649 1.00 209.29 ? 26   LEU B CG  1 
ATOM   2215 C CD1 . LEU B 1 26  ? 41.997  -11.348 43.596 1.00 210.55 ? 26   LEU B CD1 1 
ATOM   2216 C CD2 . LEU B 1 26  ? 42.446  -9.129  44.659 1.00 212.45 ? 26   LEU B CD2 1 
ATOM   2217 N N   . GLY B 1 27  ? 42.023  -6.196  40.389 1.00 165.71 ? 27   GLY B N   1 
ATOM   2218 C CA  . GLY B 1 27  ? 42.078  -5.692  39.029 1.00 165.21 ? 27   GLY B CA  1 
ATOM   2219 C C   . GLY B 1 27  ? 43.465  -5.242  38.613 1.00 167.44 ? 27   GLY B C   1 
ATOM   2220 O O   . GLY B 1 27  ? 43.616  -4.241  37.912 1.00 167.06 ? 27   GLY B O   1 
ATOM   2221 N N   . TRP B 1 33  ? 44.402  5.957   35.406 1.00 164.32 ? 33   TRP B N   1 
ATOM   2222 C CA  . TRP B 1 33  ? 44.887  7.220   35.947 1.00 160.34 ? 33   TRP B CA  1 
ATOM   2223 C C   . TRP B 1 33  ? 43.928  8.317   35.545 1.00 159.29 ? 33   TRP B C   1 
ATOM   2224 O O   . TRP B 1 33  ? 43.423  9.062   36.384 1.00 155.11 ? 33   TRP B O   1 
ATOM   2225 C CB  . TRP B 1 33  ? 46.277  7.546   35.402 1.00 161.89 ? 33   TRP B CB  1 
ATOM   2226 N N   . LEU B 1 34  ? 43.681  8.407   34.247 1.00 200.40 ? 34   LEU B N   1 
ATOM   2227 C CA  . LEU B 1 34  ? 42.762  9.400   33.721 1.00 200.52 ? 34   LEU B CA  1 
ATOM   2228 C C   . LEU B 1 34  ? 41.526  8.709   33.167 1.00 203.21 ? 34   LEU B C   1 
ATOM   2229 O O   . LEU B 1 34  ? 40.603  9.357   32.674 1.00 203.93 ? 34   LEU B O   1 
ATOM   2230 C CB  . LEU B 1 34  ? 43.446  10.233  32.639 1.00 203.78 ? 34   LEU B CB  1 
ATOM   2231 C CG  . LEU B 1 34  ? 44.633  11.059  33.136 1.00 201.14 ? 34   LEU B CG  1 
ATOM   2232 C CD1 . LEU B 1 34  ? 45.331  11.758  31.981 1.00 205.56 ? 34   LEU B CD1 1 
ATOM   2233 C CD2 . LEU B 1 34  ? 44.181  12.064  34.185 1.00 195.61 ? 34   LEU B CD2 1 
ATOM   2234 N N   . ASP B 1 35  ? 41.516  7.384   33.275 1.00 186.97 ? 35   ASP B N   1 
ATOM   2235 C CA  . ASP B 1 35  ? 40.462  6.552   32.706 1.00 188.14 ? 35   ASP B CA  1 
ATOM   2236 C C   . ASP B 1 35  ? 39.051  6.982   33.116 1.00 184.81 ? 35   ASP B C   1 
ATOM   2237 O O   . ASP B 1 35  ? 38.186  7.188   32.266 1.00 184.97 ? 35   ASP B O   1 
ATOM   2238 C CB  . ASP B 1 35  ? 40.697  5.089   33.089 1.00 187.09 ? 35   ASP B CB  1 
ATOM   2239 C CG  . ASP B 1 35  ? 40.158  4.120   32.053 1.00 187.25 ? 35   ASP B CG  1 
ATOM   2240 O OD1 . ASP B 1 35  ? 39.744  4.575   30.966 1.00 188.66 ? 35   ASP B OD1 1 
ATOM   2241 O OD2 . ASP B 1 35  ? 40.154  2.899   32.321 1.00 186.25 ? 35   ASP B OD2 1 
ATOM   2242 N N   . ASP B 1 36  ? 38.825  7.114   34.419 1.00 122.06 ? 36   ASP B N   1 
ATOM   2243 C CA  . ASP B 1 36  ? 37.491  7.386   34.944 1.00 118.78 ? 36   ASP B CA  1 
ATOM   2244 C C   . ASP B 1 36  ? 37.380  8.808   35.488 1.00 116.72 ? 36   ASP B C   1 
ATOM   2245 O O   . ASP B 1 36  ? 36.989  9.013   36.633 1.00 112.63 ? 36   ASP B O   1 
ATOM   2246 C CB  . ASP B 1 36  ? 37.168  6.379   36.048 1.00 116.06 ? 36   ASP B CB  1 
ATOM   2247 C CG  . ASP B 1 36  ? 35.684  6.182   36.240 1.00 113.28 ? 36   ASP B CG  1 
ATOM   2248 O OD1 . ASP B 1 36  ? 34.910  7.038   35.761 1.00 113.00 ? 36   ASP B OD1 1 
ATOM   2249 O OD2 . ASP B 1 36  ? 35.294  5.170   36.863 1.00 111.71 ? 36   ASP B OD2 1 
ATOM   2250 N N   . HIS B 1 37  ? 37.713  9.789   34.658 1.00 126.39 ? 37   HIS B N   1 
ATOM   2251 C CA  . HIS B 1 37  ? 37.849  11.166  35.128 1.00 122.54 ? 37   HIS B CA  1 
ATOM   2252 C C   . HIS B 1 37  ? 36.614  11.707  35.858 1.00 118.94 ? 37   HIS B C   1 
ATOM   2253 O O   . HIS B 1 37  ? 36.723  12.244  36.964 1.00 114.09 ? 37   HIS B O   1 
ATOM   2254 C CB  . HIS B 1 37  ? 38.285  12.099  33.983 1.00 125.68 ? 37   HIS B CB  1 
ATOM   2255 C CG  . HIS B 1 37  ? 37.165  12.546  33.090 1.00 128.75 ? 37   HIS B CG  1 
ATOM   2256 N ND1 . HIS B 1 37  ? 36.370  11.665  32.390 1.00 132.58 ? 37   HIS B ND1 1 
ATOM   2257 C CD2 . HIS B 1 37  ? 36.726  13.785  32.770 1.00 128.90 ? 37   HIS B CD2 1 
ATOM   2258 C CE1 . HIS B 1 37  ? 35.480  12.339  31.688 1.00 134.45 ? 37   HIS B CE1 1 
ATOM   2259 N NE2 . HIS B 1 37  ? 35.671  13.631  31.899 1.00 132.88 ? 37   HIS B NE2 1 
ATOM   2260 N N   . TYR B 1 38  ? 35.443  11.552  35.251 1.00 102.97 ? 38   TYR B N   1 
ATOM   2261 C CA  . TYR B 1 38  ? 34.235  12.157  35.793 1.00 100.09 ? 38   TYR B CA  1 
ATOM   2262 C C   . TYR B 1 38  ? 33.823  11.532  37.121 1.00 96.50  ? 38   TYR B C   1 
ATOM   2263 O O   . TYR B 1 38  ? 33.529  12.238  38.087 1.00 91.99  ? 38   TYR B O   1 
ATOM   2264 C CB  . TYR B 1 38  ? 33.091  12.070  34.789 1.00 103.09 ? 38   TYR B CB  1 
ATOM   2265 C CG  . TYR B 1 38  ? 31.810  12.675  35.305 1.00 98.80  ? 38   TYR B CG  1 
ATOM   2266 C CD1 . TYR B 1 38  ? 31.751  14.012  35.663 1.00 96.33  ? 38   TYR B CD1 1 
ATOM   2267 C CD2 . TYR B 1 38  ? 30.659  11.909  35.437 1.00 94.95  ? 38   TYR B CD2 1 
ATOM   2268 C CE1 . TYR B 1 38  ? 30.581  14.573  36.139 1.00 92.39  ? 38   TYR B CE1 1 
ATOM   2269 C CE2 . TYR B 1 38  ? 29.486  12.458  35.911 1.00 91.49  ? 38   TYR B CE2 1 
ATOM   2270 C CZ  . TYR B 1 38  ? 29.451  13.789  36.261 1.00 91.06  ? 38   TYR B CZ  1 
ATOM   2271 O OH  . TYR B 1 38  ? 28.278  14.333  36.732 1.00 87.19  ? 38   TYR B OH  1 
ATOM   2272 N N   . HIS B 1 39  ? 33.791  10.206  37.159 1.00 100.47 ? 39   HIS B N   1 
ATOM   2273 C CA  . HIS B 1 39  ? 33.513  9.483   38.393 1.00 98.21  ? 39   HIS B CA  1 
ATOM   2274 C C   . HIS B 1 39  ? 34.464  9.941   39.487 1.00 93.89  ? 39   HIS B C   1 
ATOM   2275 O O   . HIS B 1 39  ? 34.041  10.363  40.561 1.00 89.90  ? 39   HIS B O   1 
ATOM   2276 C CB  . HIS B 1 39  ? 33.676  7.983   38.158 1.00 99.22  ? 39   HIS B CB  1 
ATOM   2277 C CG  . HIS B 1 39  ? 33.842  7.183   39.411 1.00 97.74  ? 39   HIS B CG  1 
ATOM   2278 N ND1 . HIS B 1 39  ? 35.023  7.137   40.118 1.00 98.63  ? 39   HIS B ND1 1 
ATOM   2279 C CD2 . HIS B 1 39  ? 32.976  6.373   40.072 1.00 95.92  ? 39   HIS B CD2 1 
ATOM   2280 C CE1 . HIS B 1 39  ? 34.877  6.347   41.166 1.00 97.43  ? 39   HIS B CE1 1 
ATOM   2281 N NE2 . HIS B 1 39  ? 33.645  5.872   41.161 1.00 95.85  ? 39   HIS B NE2 1 
ATOM   2282 N N   . ASP B 1 40  ? 35.756  9.862   39.193 1.00 97.54  ? 40   ASP B N   1 
ATOM   2283 C CA  . ASP B 1 40  ? 36.796  10.207  40.155 1.00 93.97  ? 40   ASP B CA  1 
ATOM   2284 C C   . ASP B 1 40  ? 36.608  11.599  40.743 1.00 89.15  ? 40   ASP B C   1 
ATOM   2285 O O   . ASP B 1 40  ? 36.790  11.802  41.941 1.00 85.34  ? 40   ASP B O   1 
ATOM   2286 C CB  . ASP B 1 40  ? 38.179  10.085  39.510 1.00 96.06  ? 40   ASP B CB  1 
ATOM   2287 C CG  . ASP B 1 40  ? 38.509  8.659   39.102 1.00 100.44 ? 40   ASP B CG  1 
ATOM   2288 O OD1 . ASP B 1 40  ? 37.757  7.735   39.487 1.00 101.65 ? 40   ASP B OD1 1 
ATOM   2289 O OD2 . ASP B 1 40  ? 39.522  8.461   38.396 1.00 102.84 ? 40   ASP B OD2 1 
ATOM   2290 N N   . LEU B 1 41  ? 36.236  12.556  39.902 1.00 79.05  ? 41   LEU B N   1 
ATOM   2291 C CA  . LEU B 1 41  ? 36.037  13.922  40.369 1.00 81.78  ? 41   LEU B CA  1 
ATOM   2292 C C   . LEU B 1 41  ? 34.870  14.035  41.350 1.00 78.45  ? 41   LEU B C   1 
ATOM   2293 O O   . LEU B 1 41  ? 34.922  14.818  42.294 1.00 77.39  ? 41   LEU B O   1 
ATOM   2294 C CB  . LEU B 1 41  ? 35.854  14.879  39.190 1.00 83.99  ? 41   LEU B CB  1 
ATOM   2295 C CG  . LEU B 1 41  ? 37.162  15.230  38.481 1.00 86.10  ? 41   LEU B CG  1 
ATOM   2296 C CD1 . LEU B 1 41  ? 36.896  15.908  37.151 1.00 90.37  ? 41   LEU B CD1 1 
ATOM   2297 C CD2 . LEU B 1 41  ? 38.031  16.099  39.379 1.00 81.45  ? 41   LEU B CD2 1 
ATOM   2298 N N   . LEU B 1 42  ? 33.822  13.251  41.128 1.00 90.56  ? 42   LEU B N   1 
ATOM   2299 C CA  . LEU B 1 42  ? 32.676  13.253  42.030 1.00 88.08  ? 42   LEU B CA  1 
ATOM   2300 C C   . LEU B 1 42  ? 32.928  12.380  43.254 1.00 86.95  ? 42   LEU B C   1 
ATOM   2301 O O   . LEU B 1 42  ? 32.239  12.507  44.264 1.00 84.23  ? 42   LEU B O   1 
ATOM   2302 C CB  . LEU B 1 42  ? 31.420  12.756  41.311 1.00 91.50  ? 42   LEU B CB  1 
ATOM   2303 C CG  . LEU B 1 42  ? 30.889  13.574  40.136 1.00 93.44  ? 42   LEU B CG  1 
ATOM   2304 C CD1 . LEU B 1 42  ? 29.522  13.060  39.708 1.00 94.61  ? 42   LEU B CD1 1 
ATOM   2305 C CD2 . LEU B 1 42  ? 30.816  15.043  40.510 1.00 89.26  ? 42   LEU B CD2 1 
ATOM   2306 N N   . THR B 1 43  ? 33.916  11.495  43.158 1.00 79.11  ? 43   THR B N   1 
ATOM   2307 C CA  . THR B 1 43  ? 34.155  10.482  44.182 1.00 77.68  ? 43   THR B CA  1 
ATOM   2308 C C   . THR B 1 43  ? 35.176  10.944  45.215 1.00 82.60  ? 43   THR B C   1 
ATOM   2309 O O   . THR B 1 43  ? 35.170  10.499  46.359 1.00 75.00  ? 43   THR B O   1 
ATOM   2310 C CB  . THR B 1 43  ? 34.643  9.176   43.537 1.00 78.48  ? 43   THR B CB  1 
ATOM   2311 O OG1 . THR B 1 43  ? 33.607  8.646   42.703 1.00 81.92  ? 43   THR B OG1 1 
ATOM   2312 C CG2 . THR B 1 43  ? 35.014  8.146   44.595 1.00 79.60  ? 43   THR B CG2 1 
ATOM   2313 N N   . VAL B 1 44  ? 36.050  11.846  44.794 1.00 85.90  ? 44   VAL B N   1 
ATOM   2314 C CA  . VAL B 1 44  ? 37.126  12.354  45.632 1.00 84.44  ? 44   VAL B CA  1 
ATOM   2315 C C   . VAL B 1 44  ? 36.609  13.109  46.860 1.00 86.37  ? 44   VAL B C   1 
ATOM   2316 O O   . VAL B 1 44  ? 35.498  13.633  46.845 1.00 88.59  ? 44   VAL B O   1 
ATOM   2317 C CB  . VAL B 1 44  ? 38.032  13.273  44.796 1.00 81.89  ? 44   VAL B CB  1 
ATOM   2318 C CG1 . VAL B 1 44  ? 38.816  14.200  45.677 1.00 81.07  ? 44   VAL B CG1 1 
ATOM   2319 C CG2 . VAL B 1 44  ? 38.947  12.444  43.916 1.00 79.37  ? 44   VAL B CG2 1 
ATOM   2320 N N   . SER B 1 45  ? 37.414  13.156  47.922 1.00 101.06 ? 45   SER B N   1 
ATOM   2321 C CA  . SER B 1 45  ? 37.057  13.911  49.126 1.00 102.76 ? 45   SER B CA  1 
ATOM   2322 C C   . SER B 1 45  ? 37.136  15.415  48.863 1.00 101.89 ? 45   SER B C   1 
ATOM   2323 O O   . SER B 1 45  ? 37.980  15.867  48.087 1.00 99.42  ? 45   SER B O   1 
ATOM   2324 C CB  . SER B 1 45  ? 37.980  13.543  50.292 1.00 102.36 ? 45   SER B CB  1 
ATOM   2325 O OG  . SER B 1 45  ? 39.234  14.201  50.187 1.00 97.31  ? 45   SER B OG  1 
ATOM   2326 N N   . TRP B 1 46  ? 36.260  16.193  49.493 1.00 122.39 ? 46   TRP B N   1 
ATOM   2327 C CA  . TRP B 1 46  ? 36.249  17.638  49.262 1.00 122.15 ? 46   TRP B CA  1 
ATOM   2328 C C   . TRP B 1 46  ? 37.643  18.262  49.339 1.00 119.17 ? 46   TRP B C   1 
ATOM   2329 O O   . TRP B 1 46  ? 38.049  18.974  48.420 1.00 117.84 ? 46   TRP B O   1 
ATOM   2330 C CB  . TRP B 1 46  ? 35.260  18.356  50.187 1.00 125.43 ? 46   TRP B CB  1 
ATOM   2331 C CG  . TRP B 1 46  ? 33.839  18.280  49.702 1.00 128.64 ? 46   TRP B CG  1 
ATOM   2332 C CD1 . TRP B 1 46  ? 32.820  17.564  50.260 1.00 131.23 ? 46   TRP B CD1 1 
ATOM   2333 C CD2 . TRP B 1 46  ? 33.282  18.934  48.549 1.00 126.56 ? 46   TRP B CD2 1 
ATOM   2334 N NE1 . TRP B 1 46  ? 31.666  17.735  49.532 1.00 130.50 ? 46   TRP B NE1 1 
ATOM   2335 C CE2 . TRP B 1 46  ? 31.924  18.570  48.479 1.00 127.66 ? 46   TRP B CE2 1 
ATOM   2336 C CE3 . TRP B 1 46  ? 33.806  19.792  47.574 1.00 124.41 ? 46   TRP B CE3 1 
ATOM   2337 C CZ2 . TRP B 1 46  ? 31.078  19.035  47.470 1.00 126.44 ? 46   TRP B CZ2 1 
ATOM   2338 C CZ3 . TRP B 1 46  ? 32.961  20.252  46.573 1.00 123.65 ? 46   TRP B CZ3 1 
ATOM   2339 C CH2 . TRP B 1 46  ? 31.615  19.873  46.530 1.00 124.52 ? 46   TRP B CH2 1 
ATOM   2340 N N   . PRO B 1 47  ? 38.383  17.992  50.429 1.00 104.06 ? 47   PRO B N   1 
ATOM   2341 C CA  . PRO B 1 47  ? 39.771  18.459  50.487 1.00 101.39 ? 47   PRO B CA  1 
ATOM   2342 C C   . PRO B 1 47  ? 40.477  18.252  49.148 1.00 99.27  ? 47   PRO B C   1 
ATOM   2343 O O   . PRO B 1 47  ? 40.903  19.219  48.509 1.00 98.37  ? 47   PRO B O   1 
ATOM   2344 C CB  . PRO B 1 47  ? 40.393  17.543  51.538 1.00 100.52 ? 47   PRO B CB  1 
ATOM   2345 C CG  . PRO B 1 47  ? 39.272  17.215  52.453 1.00 104.19 ? 47   PRO B CG  1 
ATOM   2346 C CD  . PRO B 1 47  ? 38.007  17.230  51.634 1.00 106.00 ? 47   PRO B CD  1 
ATOM   2347 N N   . VAL B 1 48  ? 40.586  16.994  48.731 1.00 89.00  ? 48   VAL B N   1 
ATOM   2348 C CA  . VAL B 1 48  ? 41.264  16.651  47.486 1.00 85.17  ? 48   VAL B CA  1 
ATOM   2349 C C   . VAL B 1 48  ? 40.676  17.382  46.275 1.00 88.40  ? 48   VAL B C   1 
ATOM   2350 O O   . VAL B 1 48  ? 41.414  17.974  45.483 1.00 86.23  ? 48   VAL B O   1 
ATOM   2351 C CB  . VAL B 1 48  ? 41.234  15.135  47.232 1.00 83.30  ? 48   VAL B CB  1 
ATOM   2352 C CG1 . VAL B 1 48  ? 41.849  14.810  45.875 1.00 80.20  ? 48   VAL B CG1 1 
ATOM   2353 C CG2 . VAL B 1 48  ? 41.947  14.391  48.342 1.00 79.38  ? 48   VAL B CG2 1 
ATOM   2354 N N   . PHE B 1 49  ? 39.353  17.335  46.133 1.00 84.01  ? 49   PHE B N   1 
ATOM   2355 C CA  . PHE B 1 49  ? 38.676  18.009  45.028 1.00 84.92  ? 49   PHE B CA  1 
ATOM   2356 C C   . PHE B 1 49  ? 39.100  19.473  44.934 1.00 84.87  ? 49   PHE B C   1 
ATOM   2357 O O   . PHE B 1 49  ? 39.470  19.951  43.861 1.00 84.42  ? 49   PHE B O   1 
ATOM   2358 C CB  . PHE B 1 49  ? 37.157  17.894  45.183 1.00 87.77  ? 49   PHE B CB  1 
ATOM   2359 C CG  . PHE B 1 49  ? 36.372  18.724  44.199 1.00 89.39  ? 49   PHE B CG  1 
ATOM   2360 C CD1 . PHE B 1 49  ? 36.256  18.333  42.876 1.00 88.98  ? 49   PHE B CD1 1 
ATOM   2361 C CD2 . PHE B 1 49  ? 35.733  19.883  44.606 1.00 91.68  ? 49   PHE B CD2 1 
ATOM   2362 C CE1 . PHE B 1 49  ? 35.529  19.086  41.976 1.00 90.84  ? 49   PHE B CE1 1 
ATOM   2363 C CE2 . PHE B 1 49  ? 35.004  20.639  43.710 1.00 91.99  ? 49   PHE B CE2 1 
ATOM   2364 C CZ  . PHE B 1 49  ? 34.901  20.239  42.392 1.00 92.20  ? 49   PHE B CZ  1 
ATOM   2365 N N   . ILE B 1 50  ? 39.055  20.172  46.064 1.00 107.29 ? 50   ILE B N   1 
ATOM   2366 C CA  . ILE B 1 50  ? 39.451  21.574  46.116 1.00 107.52 ? 50   ILE B CA  1 
ATOM   2367 C C   . ILE B 1 50  ? 40.914  21.743  45.715 1.00 105.24 ? 50   ILE B C   1 
ATOM   2368 O O   . ILE B 1 50  ? 41.257  22.651  44.955 1.00 105.54 ? 50   ILE B O   1 
ATOM   2369 C CB  . ILE B 1 50  ? 39.238  22.166  47.515 1.00 108.57 ? 50   ILE B CB  1 
ATOM   2370 C CG1 . ILE B 1 50  ? 37.819  21.878  48.002 1.00 111.34 ? 50   ILE B CG1 1 
ATOM   2371 C CG2 . ILE B 1 50  ? 39.487  23.656  47.500 1.00 109.29 ? 50   ILE B CG2 1 
ATOM   2372 C CD1 . ILE B 1 50  ? 37.572  22.302  49.432 1.00 112.70 ? 50   ILE B CD1 1 
ATOM   2373 N N   . THR B 1 51  ? 41.769  20.864  46.233 1.00 77.71  ? 51   THR B N   1 
ATOM   2374 C CA  . THR B 1 51  ? 43.184  20.843  45.872 1.00 73.37  ? 51   THR B CA  1 
ATOM   2375 C C   . THR B 1 51  ? 43.369  20.754  44.365 1.00 72.51  ? 51   THR B C   1 
ATOM   2376 O O   . THR B 1 51  ? 44.043  21.587  43.768 1.00 71.59  ? 51   THR B O   1 
ATOM   2377 C CB  . THR B 1 51  ? 43.892  19.636  46.490 1.00 72.57  ? 51   THR B CB  1 
ATOM   2378 O OG1 . THR B 1 51  ? 43.790  19.706  47.915 1.00 71.71  ? 51   THR B OG1 1 
ATOM   2379 C CG2 . THR B 1 51  ? 45.359  19.607  46.082 1.00 72.10  ? 51   THR B CG2 1 
ATOM   2380 N N   . LEU B 1 52  ? 42.776  19.722  43.769 1.00 101.48 ? 52   LEU B N   1 
ATOM   2381 C CA  . LEU B 1 52  ? 42.826  19.500  42.329 1.00 101.08 ? 52   LEU B CA  1 
ATOM   2382 C C   . LEU B 1 52  ? 42.482  20.756  41.562 1.00 104.97 ? 52   LEU B C   1 
ATOM   2383 O O   . LEU B 1 52  ? 43.212  21.183  40.667 1.00 103.23 ? 52   LEU B O   1 
ATOM   2384 C CB  . LEU B 1 52  ? 41.824  18.423  41.940 1.00 103.32 ? 52   LEU B CB  1 
ATOM   2385 C CG  . LEU B 1 52  ? 42.271  16.994  42.197 1.00 99.12  ? 52   LEU B CG  1 
ATOM   2386 C CD1 . LEU B 1 52  ? 41.228  16.041  41.652 1.00 102.01 ? 52   LEU B CD1 1 
ATOM   2387 C CD2 . LEU B 1 52  ? 43.619  16.770  41.538 1.00 93.63  ? 52   LEU B CD2 1 
ATOM   2388 N N   . ILE B 1 53  ? 41.336  21.326  41.905 1.00 97.67  ? 53   ILE B N   1 
ATOM   2389 C CA  . ILE B 1 53  ? 40.893  22.568  41.303 1.00 99.80  ? 53   ILE B CA  1 
ATOM   2390 C C   . ILE B 1 53  ? 41.965  23.638  41.470 1.00 99.69  ? 53   ILE B C   1 
ATOM   2391 O O   . ILE B 1 53  ? 42.435  24.210  40.489 1.00 100.52 ? 53   ILE B O   1 
ATOM   2392 C CB  . ILE B 1 53  ? 39.570  23.025  41.925 1.00 102.00 ? 53   ILE B CB  1 
ATOM   2393 C CG1 . ILE B 1 53  ? 38.428  22.162  41.383 1.00 103.00 ? 53   ILE B CG1 1 
ATOM   2394 C CG2 . ILE B 1 53  ? 39.330  24.499  41.657 1.00 104.42 ? 53   ILE B CG2 1 
ATOM   2395 C CD1 . ILE B 1 53  ? 37.062  22.620  41.807 1.00 105.93 ? 53   ILE B CD1 1 
ATOM   2396 N N   . THR B 1 54  ? 42.360  23.889  42.713 1.00 77.34  ? 54   THR B N   1 
ATOM   2397 C CA  . THR B 1 54  ? 43.443  24.824  42.998 1.00 77.13  ? 54   THR B CA  1 
ATOM   2398 C C   . THR B 1 54  ? 44.656  24.559  42.107 1.00 73.06  ? 54   THR B C   1 
ATOM   2399 O O   . THR B 1 54  ? 45.086  25.432  41.361 1.00 73.81  ? 54   THR B O   1 
ATOM   2400 C CB  . THR B 1 54  ? 43.893  24.729  44.460 1.00 75.79  ? 54   THR B CB  1 
ATOM   2401 O OG1 . THR B 1 54  ? 42.746  24.722  45.318 1.00 76.73  ? 54   THR B OG1 1 
ATOM   2402 C CG2 . THR B 1 54  ? 44.790  25.903  44.814 1.00 75.15  ? 54   THR B CG2 1 
ATOM   2403 N N   . GLY B 1 55  ? 45.210  23.354  42.198 1.00 108.35 ? 55   GLY B N   1 
ATOM   2404 C CA  . GLY B 1 55  ? 46.332  22.971  41.362 1.00 104.03 ? 55   GLY B CA  1 
ATOM   2405 C C   . GLY B 1 55  ? 46.103  23.403  39.931 1.00 106.38 ? 55   GLY B C   1 
ATOM   2406 O O   . GLY B 1 55  ? 46.872  24.185  39.379 1.00 105.90 ? 55   GLY B O   1 
ATOM   2407 N N   . LEU B 1 56  ? 45.029  22.898  39.335 1.00 81.53  ? 56   LEU B N   1 
ATOM   2408 C CA  . LEU B 1 56  ? 44.662  23.257  37.974 1.00 83.91  ? 56   LEU B CA  1 
ATOM   2409 C C   . LEU B 1 56  ? 44.703  24.774  37.777 1.00 87.40  ? 56   LEU B C   1 
ATOM   2410 O O   . LEU B 1 56  ? 45.285  25.279  36.815 1.00 87.09  ? 56   LEU B O   1 
ATOM   2411 C CB  . LEU B 1 56  ? 43.269  22.714  37.660 1.00 87.70  ? 56   LEU B CB  1 
ATOM   2412 C CG  . LEU B 1 56  ? 42.718  23.016  36.267 1.00 90.90  ? 56   LEU B CG  1 
ATOM   2413 C CD1 . LEU B 1 56  ? 43.828  22.971  35.227 1.00 87.23  ? 56   LEU B CD1 1 
ATOM   2414 C CD2 . LEU B 1 56  ? 41.597  22.048  35.908 1.00 92.51  ? 56   LEU B CD2 1 
ATOM   2415 N N   . TYR B 1 57  ? 44.082  25.484  38.710 1.00 104.32 ? 57   TYR B N   1 
ATOM   2416 C CA  . TYR B 1 57  ? 44.015  26.939  38.713 1.00 108.32 ? 57   TYR B CA  1 
ATOM   2417 C C   . TYR B 1 57  ? 45.401  27.573  38.631 1.00 105.13 ? 57   TYR B C   1 
ATOM   2418 O O   . TYR B 1 57  ? 45.717  28.274  37.669 1.00 106.53 ? 57   TYR B O   1 
ATOM   2419 C CB  . TYR B 1 57  ? 43.293  27.373  39.988 1.00 109.36 ? 57   TYR B CB  1 
ATOM   2420 C CG  . TYR B 1 57  ? 43.168  28.855  40.209 1.00 112.10 ? 57   TYR B CG  1 
ATOM   2421 C CD1 . TYR B 1 57  ? 42.687  29.691  39.213 1.00 115.55 ? 57   TYR B CD1 1 
ATOM   2422 C CD2 . TYR B 1 57  ? 43.491  29.412  41.440 1.00 111.52 ? 57   TYR B CD2 1 
ATOM   2423 C CE1 . TYR B 1 57  ? 42.559  31.047  39.428 1.00 118.50 ? 57   TYR B CE1 1 
ATOM   2424 C CE2 . TYR B 1 57  ? 43.368  30.764  41.667 1.00 114.17 ? 57   TYR B CE2 1 
ATOM   2425 C CZ  . TYR B 1 57  ? 42.901  31.580  40.659 1.00 117.71 ? 57   TYR B CZ  1 
ATOM   2426 O OH  . TYR B 1 57  ? 42.780  32.934  40.891 1.00 120.71 ? 57   TYR B OH  1 
ATOM   2427 N N   . LEU B 1 58  ? 46.223  27.321  39.645 1.00 93.20  ? 58   LEU B N   1 
ATOM   2428 C CA  . LEU B 1 58  ? 47.589  27.831  39.681 1.00 90.06  ? 58   LEU B CA  1 
ATOM   2429 C C   . LEU B 1 58  ? 48.322  27.438  38.412 1.00 87.65  ? 58   LEU B C   1 
ATOM   2430 O O   . LEU B 1 58  ? 48.799  28.296  37.672 1.00 89.21  ? 58   LEU B O   1 
ATOM   2431 C CB  . LEU B 1 58  ? 48.328  27.293  40.904 1.00 85.75  ? 58   LEU B CB  1 
ATOM   2432 C CG  . LEU B 1 58  ? 47.590  27.545  42.216 1.00 88.06  ? 58   LEU B CG  1 
ATOM   2433 C CD1 . LEU B 1 58  ? 48.502  27.306  43.399 1.00 84.22  ? 58   LEU B CD1 1 
ATOM   2434 C CD2 . LEU B 1 58  ? 47.046  28.961  42.239 1.00 93.59  ? 58   LEU B CD2 1 
ATOM   2435 N N   . VAL B 1 59  ? 48.399  26.135  38.167 1.00 91.63  ? 59   VAL B N   1 
ATOM   2436 C CA  . VAL B 1 59  ? 49.022  25.614  36.958 1.00 89.57  ? 59   VAL B CA  1 
ATOM   2437 C C   . VAL B 1 59  ? 48.713  26.471  35.731 1.00 93.42  ? 59   VAL B C   1 
ATOM   2438 O O   . VAL B 1 59  ? 49.608  27.105  35.174 1.00 93.41  ? 59   VAL B O   1 
ATOM   2439 C CB  . VAL B 1 59  ? 48.597  24.161  36.682 1.00 87.50  ? 59   VAL B CB  1 
ATOM   2440 C CG1 . VAL B 1 59  ? 49.084  23.715  35.309 1.00 86.07  ? 59   VAL B CG1 1 
ATOM   2441 C CG2 . VAL B 1 59  ? 49.129  23.242  37.770 1.00 83.59  ? 59   VAL B CG2 1 
ATOM   2442 N N   . THR B 1 60  ? 47.451  26.503  35.315 1.00 116.69 ? 60   THR B N   1 
ATOM   2443 C CA  . THR B 1 60  ? 47.091  27.210  34.084 1.00 120.39 ? 60   THR B CA  1 
ATOM   2444 C C   . THR B 1 60  ? 47.561  28.675  34.055 1.00 123.16 ? 60   THR B C   1 
ATOM   2445 O O   . THR B 1 60  ? 48.013  29.162  33.017 1.00 124.07 ? 60   THR B O   1 
ATOM   2446 C CB  . THR B 1 60  ? 45.573  27.145  33.781 1.00 124.94 ? 60   THR B CB  1 
ATOM   2447 O OG1 . THR B 1 60  ? 44.873  28.086  34.605 1.00 129.51 ? 60   THR B OG1 1 
ATOM   2448 C CG2 . THR B 1 60  ? 45.035  25.747  34.024 1.00 122.84 ? 60   THR B CG2 1 
ATOM   2449 N N   . ASN B 1 61  ? 47.452  29.372  35.184 1.00 115.21 ? 61   ASN B N   1 
ATOM   2450 C CA  . ASN B 1 61  ? 47.944  30.745  35.268 1.00 117.92 ? 61   ASN B CA  1 
ATOM   2451 C C   . ASN B 1 61  ? 49.437  30.832  35.010 1.00 114.43 ? 61   ASN B C   1 
ATOM   2452 O O   . ASN B 1 61  ? 49.902  31.726  34.305 1.00 116.66 ? 61   ASN B O   1 
ATOM   2453 C CB  . ASN B 1 61  ? 47.634  31.356  36.629 1.00 119.89 ? 61   ASN B CB  1 
ATOM   2454 C CG  . ASN B 1 61  ? 46.249  31.950  36.692 1.00 126.12 ? 61   ASN B CG  1 
ATOM   2455 O OD1 . ASN B 1 61  ? 45.919  32.878  35.953 1.00 130.73 ? 61   ASN B OD1 1 
ATOM   2456 N ND2 . ASN B 1 61  ? 45.427  31.420  37.587 1.00 126.76 ? 61   ASN B ND2 1 
ATOM   2457 N N   . ALA B 1 62  ? 50.187  29.911  35.605 1.00 89.87  ? 62   ALA B N   1 
ATOM   2458 C CA  . ALA B 1 62  ? 51.612  29.814  35.343 1.00 86.68  ? 62   ALA B CA  1 
ATOM   2459 C C   . ALA B 1 62  ? 51.836  29.659  33.841 1.00 87.22  ? 62   ALA B C   1 
ATOM   2460 O O   . ALA B 1 62  ? 52.605  30.407  33.236 1.00 88.56  ? 62   ALA B O   1 
ATOM   2461 C CB  . ALA B 1 62  ? 52.207  28.645  36.096 1.00 81.64  ? 62   ALA B CB  1 
ATOM   2462 N N   . LEU B 1 63  ? 51.154  28.691  33.240 1.00 104.17 ? 63   LEU B N   1 
ATOM   2463 C CA  . LEU B 1 63  ? 51.235  28.492  31.799 1.00 104.65 ? 63   LEU B CA  1 
ATOM   2464 C C   . LEU B 1 63  ? 51.005  29.804  31.069 1.00 109.56 ? 63   LEU B C   1 
ATOM   2465 O O   . LEU B 1 63  ? 51.810  30.211  30.235 1.00 110.19 ? 63   LEU B O   1 
ATOM   2466 C CB  . LEU B 1 63  ? 50.211  27.457  31.338 1.00 104.20 ? 63   LEU B CB  1 
ATOM   2467 C CG  . LEU B 1 63  ? 50.519  25.996  31.666 1.00 99.54  ? 63   LEU B CG  1 
ATOM   2468 C CD1 . LEU B 1 63  ? 49.331  25.116  31.310 1.00 100.11 ? 63   LEU B CD1 1 
ATOM   2469 C CD2 . LEU B 1 63  ? 51.775  25.543  30.937 1.00 96.84  ? 63   LEU B CD2 1 
ATOM   2470 N N   . PHE B 1 64  ? 49.900  30.466  31.388 1.00 109.17 ? 64   PHE B N   1 
ATOM   2471 C CA  . PHE B 1 64  ? 49.585  31.743  30.759 1.00 114.51 ? 64   PHE B CA  1 
ATOM   2472 C C   . PHE B 1 64  ? 50.680  32.781  30.982 1.00 115.22 ? 64   PHE B C   1 
ATOM   2473 O O   . PHE B 1 64  ? 51.105  33.443  30.038 1.00 117.35 ? 64   PHE B O   1 
ATOM   2474 C CB  . PHE B 1 64  ? 48.224  32.270  31.219 1.00 119.15 ? 64   PHE B CB  1 
ATOM   2475 C CG  . PHE B 1 64  ? 47.110  31.986  30.251 1.00 122.06 ? 64   PHE B CG  1 
ATOM   2476 C CD1 . PHE B 1 64  ? 46.332  30.847  30.375 1.00 120.46 ? 64   PHE B CD1 1 
ATOM   2477 C CD2 . PHE B 1 64  ? 46.848  32.858  29.208 1.00 126.60 ? 64   PHE B CD2 1 
ATOM   2478 C CE1 . PHE B 1 64  ? 45.306  30.588  29.478 1.00 123.39 ? 64   PHE B CE1 1 
ATOM   2479 C CE2 . PHE B 1 64  ? 45.825  32.604  28.310 1.00 129.45 ? 64   PHE B CE2 1 
ATOM   2480 C CZ  . PHE B 1 64  ? 45.053  31.468  28.444 1.00 127.83 ? 64   PHE B CZ  1 
ATOM   2481 N N   . ALA B 1 65  ? 51.140  32.917  32.222 1.00 122.16 ? 65   ALA B N   1 
ATOM   2482 C CA  . ALA B 1 65  ? 52.257  33.809  32.520 1.00 122.52 ? 65   ALA B CA  1 
ATOM   2483 C C   . ALA B 1 65  ? 53.393  33.595  31.523 1.00 120.97 ? 65   ALA B C   1 
ATOM   2484 O O   . ALA B 1 65  ? 53.856  34.541  30.886 1.00 124.28 ? 65   ALA B O   1 
ATOM   2485 C CB  . ALA B 1 65  ? 52.752  33.597  33.942 1.00 119.39 ? 65   ALA B CB  1 
ATOM   2486 N N   . LEU B 1 66  ? 53.834  32.348  31.391 1.00 118.38 ? 66   LEU B N   1 
ATOM   2487 C CA  . LEU B 1 66  ? 54.878  32.004  30.430 1.00 117.12 ? 66   LEU B CA  1 
ATOM   2488 C C   . LEU B 1 66  ? 54.545  32.517  29.040 1.00 120.81 ? 66   LEU B C   1 
ATOM   2489 O O   . LEU B 1 66  ? 55.394  33.101  28.368 1.00 122.66 ? 66   LEU B O   1 
ATOM   2490 C CB  . LEU B 1 66  ? 55.097  30.493  30.383 1.00 112.42 ? 66   LEU B CB  1 
ATOM   2491 C CG  . LEU B 1 66  ? 56.130  29.939  31.362 1.00 108.64 ? 66   LEU B CG  1 
ATOM   2492 C CD1 . LEU B 1 66  ? 55.895  30.505  32.747 1.00 108.87 ? 66   LEU B CD1 1 
ATOM   2493 C CD2 . LEU B 1 66  ? 56.092  28.420  31.379 1.00 104.48 ? 66   LEU B CD2 1 
ATOM   2494 N N   . ALA B 1 67  ? 53.310  32.288  28.609 1.00 154.92 ? 67   ALA B N   1 
ATOM   2495 C CA  . ALA B 1 67  ? 52.847  32.802  27.329 1.00 158.89 ? 67   ALA B CA  1 
ATOM   2496 C C   . ALA B 1 67  ? 53.146  34.292  27.228 1.00 163.63 ? 67   ALA B C   1 
ATOM   2497 O O   . ALA B 1 67  ? 53.649  34.767  26.210 1.00 165.98 ? 67   ALA B O   1 
ATOM   2498 C CB  . ALA B 1 67  ? 51.363  32.544  27.163 1.00 160.65 ? 67   ALA B CB  1 
ATOM   2499 N N   . TYR B 1 68  ? 52.844  35.024  28.295 1.00 124.16 ? 68   TYR B N   1 
ATOM   2500 C CA  . TYR B 1 68  ? 53.108  36.458  28.326 1.00 128.91 ? 68   TYR B CA  1 
ATOM   2501 C C   . TYR B 1 68  ? 54.593  36.766  28.211 1.00 128.02 ? 68   TYR B C   1 
ATOM   2502 O O   . TYR B 1 68  ? 55.026  37.427  27.270 1.00 131.02 ? 68   TYR B O   1 
ATOM   2503 C CB  . TYR B 1 68  ? 52.502  37.098  29.575 1.00 130.82 ? 68   TYR B CB  1 
ATOM   2504 C CG  . TYR B 1 68  ? 51.009  37.262  29.458 1.00 134.41 ? 68   TYR B CG  1 
ATOM   2505 C CD1 . TYR B 1 68  ? 50.146  36.606  30.321 1.00 132.80 ? 68   TYR B CD1 1 
ATOM   2506 C CD2 . TYR B 1 68  ? 50.463  38.048  28.453 1.00 139.75 ? 68   TYR B CD2 1 
ATOM   2507 C CE1 . TYR B 1 68  ? 48.786  36.747  30.201 1.00 136.76 ? 68   TYR B CE1 1 
ATOM   2508 C CE2 . TYR B 1 68  ? 49.103  38.194  28.325 1.00 143.56 ? 68   TYR B CE2 1 
ATOM   2509 C CZ  . TYR B 1 68  ? 48.270  37.543  29.201 1.00 142.18 ? 68   TYR B CZ  1 
ATOM   2510 O OH  . TYR B 1 68  ? 46.912  37.688  29.073 1.00 146.67 ? 68   TYR B OH  1 
ATOM   2511 N N   . LEU B 1 69  ? 55.373  36.265  29.157 1.00 112.05 ? 69   LEU B N   1 
ATOM   2512 C CA  . LEU B 1 69  ? 56.815  36.414  29.097 1.00 111.77 ? 69   LEU B CA  1 
ATOM   2513 C C   . LEU B 1 69  ? 57.323  36.054  27.718 1.00 112.34 ? 69   LEU B C   1 
ATOM   2514 O O   . LEU B 1 69  ? 58.146  36.764  27.145 1.00 115.44 ? 69   LEU B O   1 
ATOM   2515 C CB  . LEU B 1 69  ? 57.472  35.503  30.121 1.00 106.57 ? 69   LEU B CB  1 
ATOM   2516 C CG  . LEU B 1 69  ? 57.166  35.917  31.552 1.00 106.26 ? 69   LEU B CG  1 
ATOM   2517 C CD1 . LEU B 1 69  ? 58.065  35.181  32.520 1.00 101.82 ? 69   LEU B CD1 1 
ATOM   2518 C CD2 . LEU B 1 69  ? 57.365  37.409  31.674 1.00 110.98 ? 69   LEU B CD2 1 
ATOM   2519 N N   . ALA B 1 70  ? 56.832  34.937  27.194 1.00 130.34 ? 70   ALA B N   1 
ATOM   2520 C CA  . ALA B 1 70  ? 57.263  34.450  25.894 1.00 129.96 ? 70   ALA B CA  1 
ATOM   2521 C C   . ALA B 1 70  ? 57.257  35.576  24.869 1.00 135.36 ? 70   ALA B C   1 
ATOM   2522 O O   . ALA B 1 70  ? 58.179  35.699  24.071 1.00 136.73 ? 70   ALA B O   1 
ATOM   2523 C CB  . ALA B 1 70  ? 56.378  33.318  25.438 1.00 127.16 ? 70   ALA B CB  1 
ATOM   2524 N N   . CYS B 1 71  ? 56.211  36.393  24.893 1.00 161.44 ? 71   CYS B N   1 
ATOM   2525 C CA  . CYS B 1 71  ? 56.145  37.568  24.038 1.00 167.09 ? 71   CYS B CA  1 
ATOM   2526 C C   . CYS B 1 71  ? 57.205  38.574  24.458 1.00 169.61 ? 71   CYS B C   1 
ATOM   2527 O O   . CYS B 1 71  ? 57.830  39.225  23.621 1.00 173.41 ? 71   CYS B O   1 
ATOM   2528 C CB  . CYS B 1 71  ? 54.749  38.191  24.093 1.00 170.62 ? 71   CYS B CB  1 
ATOM   2529 S SG  . CYS B 1 71  ? 53.436  37.127  23.476 1.00 168.76 ? 71   CYS B SG  1 
ATOM   2530 N N   . GLY B 1 72  ? 57.379  38.700  25.768 1.00 153.56 ? 72   GLY B N   1 
ATOM   2531 C CA  . GLY B 1 72  ? 58.437  39.527  26.306 1.00 155.19 ? 72   GLY B CA  1 
ATOM   2532 C C   . GLY B 1 72  ? 58.008  40.944  26.623 1.00 149.99 ? 72   GLY B C   1 
ATOM   2533 O O   . GLY B 1 72  ? 57.729  41.732  25.724 1.00 156.54 ? 72   GLY B O   1 
ATOM   2534 N N   . ASP B 1 73  ? 57.944  41.264  27.911 1.00 201.21 ? 73   ASP B N   1 
ATOM   2535 C CA  . ASP B 1 73  ? 57.710  42.635  28.352 1.00 197.03 ? 73   ASP B CA  1 
ATOM   2536 C C   . ASP B 1 73  ? 56.472  43.260  27.726 1.00 192.38 ? 73   ASP B C   1 
ATOM   2537 O O   . ASP B 1 73  ? 56.526  44.381  27.227 1.00 192.59 ? 73   ASP B O   1 
ATOM   2538 C CB  . ASP B 1 73  ? 58.920  43.508  28.017 1.00 202.40 ? 73   ASP B CB  1 
ATOM   2539 C CG  . ASP B 1 73  ? 60.175  43.070  28.737 1.00 207.74 ? 73   ASP B CG  1 
ATOM   2540 O OD1 . ASP B 1 73  ? 60.092  42.156  29.582 1.00 206.64 ? 73   ASP B OD1 1 
ATOM   2541 O OD2 . ASP B 1 73  ? 61.246  43.644  28.456 1.00 213.53 ? 73   ASP B OD2 1 
ATOM   2542 N N   . VAL B 1 74  ? 55.356  42.544  27.756 1.00 158.66 ? 74   VAL B N   1 
ATOM   2543 C CA  . VAL B 1 74  ? 54.135  43.050  27.148 1.00 155.25 ? 74   VAL B CA  1 
ATOM   2544 C C   . VAL B 1 74  ? 53.102  43.485  28.172 1.00 149.13 ? 74   VAL B C   1 
ATOM   2545 O O   . VAL B 1 74  ? 51.939  43.682  27.838 1.00 152.96 ? 74   VAL B O   1 
ATOM   2546 C CB  . VAL B 1 74  ? 53.502  42.022  26.198 1.00 156.47 ? 74   VAL B CB  1 
ATOM   2547 C CG1 . VAL B 1 74  ? 53.893  42.317  24.767 1.00 161.30 ? 74   VAL B CG1 1 
ATOM   2548 C CG2 . VAL B 1 74  ? 53.908  40.619  26.588 1.00 158.33 ? 74   VAL B CG2 1 
ATOM   2549 N N   . ILE B 1 75  ? 53.525  43.635  29.420 1.00 161.60 ? 75   ILE B N   1 
ATOM   2550 C CA  . ILE B 1 75  ? 52.608  44.082  30.456 1.00 156.19 ? 75   ILE B CA  1 
ATOM   2551 C C   . ILE B 1 75  ? 53.085  45.343  31.155 1.00 155.06 ? 75   ILE B C   1 
ATOM   2552 O O   . ILE B 1 75  ? 54.176  45.395  31.720 1.00 156.91 ? 75   ILE B O   1 
ATOM   2553 C CB  . ILE B 1 75  ? 52.329  42.983  31.486 1.00 153.73 ? 75   ILE B CB  1 
ATOM   2554 C CG1 . ILE B 1 75  ? 51.558  41.845  30.825 1.00 154.04 ? 75   ILE B CG1 1 
ATOM   2555 C CG2 . ILE B 1 75  ? 51.533  43.538  32.654 1.00 149.04 ? 75   ILE B CG2 1 
ATOM   2556 C CD1 . ILE B 1 75  ? 51.646  40.557  31.582 1.00 152.76 ? 75   ILE B CD1 1 
ATOM   2557 N N   . GLU B 1 76  ? 52.243  46.364  31.099 1.00 143.26 ? 76   GLU B N   1 
ATOM   2558 C CA  . GLU B 1 76  ? 52.497  47.612  31.787 1.00 141.71 ? 76   GLU B CA  1 
ATOM   2559 C C   . GLU B 1 76  ? 52.921  47.354  33.226 1.00 139.77 ? 76   GLU B C   1 
ATOM   2560 O O   . GLU B 1 76  ? 52.397  46.459  33.888 1.00 137.75 ? 76   GLU B O   1 
ATOM   2561 C CB  . GLU B 1 76  ? 51.232  48.469  31.776 1.00 146.55 ? 76   GLU B CB  1 
ATOM   2562 C CG  . GLU B 1 76  ? 51.488  49.937  32.011 1.00 142.63 ? 76   GLU B CG  1 
ATOM   2563 C CD  . GLU B 1 76  ? 52.423  50.515  30.977 1.00 144.35 ? 76   GLU B CD  1 
ATOM   2564 O OE1 . GLU B 1 76  ? 52.158  50.330  29.771 1.00 146.62 ? 76   GLU B OE1 1 
ATOM   2565 O OE2 . GLU B 1 76  ? 53.426  51.146  31.370 1.00 143.33 ? 76   GLU B OE2 1 
ATOM   2566 N N   . ASN B 1 77  ? 53.879  48.140  33.701 1.00 135.90 ? 77   ASN B N   1 
ATOM   2567 C CA  . ASN B 1 77  ? 54.266  48.123  35.107 1.00 132.66 ? 77   ASN B CA  1 
ATOM   2568 C C   . ASN B 1 77  ? 54.673  46.757  35.642 1.00 132.58 ? 77   ASN B C   1 
ATOM   2569 O O   . ASN B 1 77  ? 54.523  46.475  36.831 1.00 130.28 ? 77   ASN B O   1 
ATOM   2570 C CB  . ASN B 1 77  ? 53.144  48.706  35.963 1.00 132.70 ? 77   ASN B CB  1 
ATOM   2571 C CG  . ASN B 1 77  ? 53.024  50.202  35.810 1.00 133.95 ? 77   ASN B CG  1 
ATOM   2572 O OD1 . ASN B 1 77  ? 53.877  50.954  36.280 1.00 131.20 ? 77   ASN B OD1 1 
ATOM   2573 N ND2 . ASN B 1 77  ? 51.963  50.647  35.147 1.00 135.87 ? 77   ASN B ND2 1 
ATOM   2574 N N   . ALA B 1 78  ? 55.191  45.911  34.763 1.00 143.91 ? 78   ALA B N   1 
ATOM   2575 C CA  . ALA B 1 78  ? 55.687  44.610  35.177 1.00 146.16 ? 78   ALA B CA  1 
ATOM   2576 C C   . ALA B 1 78  ? 57.205  44.644  35.203 1.00 152.06 ? 78   ALA B C   1 
ATOM   2577 O O   . ALA B 1 78  ? 57.837  45.077  34.241 1.00 156.16 ? 78   ALA B O   1 
ATOM   2578 C CB  . ALA B 1 78  ? 55.195  43.525  34.231 1.00 147.29 ? 78   ALA B CB  1 
ATOM   2579 N N   . ARG B 1 79  ? 57.789  44.208  36.312 1.00 148.89 ? 79   ARG B N   1 
ATOM   2580 C CA  . ARG B 1 79  ? 59.231  44.055  36.372 1.00 150.29 ? 79   ARG B CA  1 
ATOM   2581 C C   . ARG B 1 79  ? 59.639  43.193  35.188 1.00 157.79 ? 79   ARG B C   1 
ATOM   2582 O O   . ARG B 1 79  ? 59.068  42.126  34.972 1.00 159.53 ? 79   ARG B O   1 
ATOM   2583 C CB  . ARG B 1 79  ? 59.657  43.417  37.695 1.00 145.57 ? 79   ARG B CB  1 
ATOM   2584 C CG  . ARG B 1 79  ? 59.292  44.253  38.911 1.00 138.33 ? 79   ARG B CG  1 
ATOM   2585 C CD  . ARG B 1 79  ? 59.989  43.763  40.171 1.00 132.21 ? 79   ARG B CD  1 
ATOM   2586 N NE  . ARG B 1 79  ? 59.311  42.620  40.775 1.00 131.10 ? 79   ARG B NE  1 
ATOM   2587 C CZ  . ARG B 1 79  ? 59.656  41.351  40.576 1.00 135.63 ? 79   ARG B CZ  1 
ATOM   2588 N NH1 . ARG B 1 79  ? 60.681  41.054  39.787 1.00 139.78 ? 79   ARG B NH1 1 
ATOM   2589 N NH2 . ARG B 1 79  ? 58.977  40.374  41.168 1.00 133.46 ? 79   ARG B NH2 1 
ATOM   2590 N N   . PRO B 1 80  ? 60.605  43.676  34.396 1.00 148.16 ? 80   PRO B N   1 
ATOM   2591 C CA  . PRO B 1 80  ? 61.061  42.985  33.186 1.00 156.21 ? 80   PRO B CA  1 
ATOM   2592 C C   . PRO B 1 80  ? 61.399  41.517  33.440 1.00 158.15 ? 80   PRO B C   1 
ATOM   2593 O O   . PRO B 1 80  ? 62.108  41.196  34.394 1.00 155.67 ? 80   PRO B O   1 
ATOM   2594 C CB  . PRO B 1 80  ? 62.315  43.769  32.797 1.00 159.80 ? 80   PRO B CB  1 
ATOM   2595 C CG  . PRO B 1 80  ? 62.046  45.144  33.294 1.00 154.48 ? 80   PRO B CG  1 
ATOM   2596 C CD  . PRO B 1 80  ? 61.292  44.965  34.584 1.00 146.62 ? 80   PRO B CD  1 
ATOM   2597 N N   . GLY B 1 81  ? 60.876  40.642  32.586 1.00 177.51 ? 81   GLY B N   1 
ATOM   2598 C CA  . GLY B 1 81  ? 61.133  39.216  32.676 1.00 180.14 ? 81   GLY B CA  1 
ATOM   2599 C C   . GLY B 1 81  ? 60.977  38.623  34.065 1.00 173.78 ? 81   GLY B C   1 
ATOM   2600 O O   . GLY B 1 81  ? 61.790  37.798  34.478 1.00 172.59 ? 81   GLY B O   1 
ATOM   2601 N N   . SER B 1 82  ? 59.942  39.036  34.791 1.00 164.11 ? 82   SER B N   1 
ATOM   2602 C CA  . SER B 1 82  ? 59.677  38.455  36.105 1.00 164.23 ? 82   SER B CA  1 
ATOM   2603 C C   . SER B 1 82  ? 58.389  37.644  36.087 1.00 161.77 ? 82   SER B C   1 
ATOM   2604 O O   . SER B 1 82  ? 57.309  38.162  35.791 1.00 157.82 ? 82   SER B O   1 
ATOM   2605 C CB  . SER B 1 82  ? 59.614  39.523  37.197 1.00 164.22 ? 82   SER B CB  1 
ATOM   2606 O OG  . SER B 1 82  ? 58.284  39.725  37.640 1.00 161.44 ? 82   SER B OG  1 
ATOM   2607 N N   . PHE B 1 83  ? 58.523  36.364  36.408 1.00 150.96 ? 83   PHE B N   1 
ATOM   2608 C CA  . PHE B 1 83  ? 57.408  35.431  36.361 1.00 149.15 ? 83   PHE B CA  1 
ATOM   2609 C C   . PHE B 1 83  ? 56.296  35.804  37.330 1.00 146.81 ? 83   PHE B C   1 
ATOM   2610 O O   . PHE B 1 83  ? 55.121  35.746  36.980 1.00 140.97 ? 83   PHE B O   1 
ATOM   2611 C CB  . PHE B 1 83  ? 57.896  34.019  36.674 1.00 151.19 ? 83   PHE B CB  1 
ATOM   2612 C CG  . PHE B 1 83  ? 56.796  33.007  36.752 1.00 149.36 ? 83   PHE B CG  1 
ATOM   2613 C CD1 . PHE B 1 83  ? 56.167  32.560  35.604 1.00 144.21 ? 83   PHE B CD1 1 
ATOM   2614 C CD2 . PHE B 1 83  ? 56.388  32.505  37.974 1.00 150.02 ? 83   PHE B CD2 1 
ATOM   2615 C CE1 . PHE B 1 83  ? 55.151  31.629  35.673 1.00 140.84 ? 83   PHE B CE1 1 
ATOM   2616 C CE2 . PHE B 1 83  ? 55.375  31.575  38.051 1.00 147.90 ? 83   PHE B CE2 1 
ATOM   2617 C CZ  . PHE B 1 83  ? 54.755  31.133  36.898 1.00 142.65 ? 83   PHE B CZ  1 
ATOM   2618 N N   . THR B 1 84  ? 56.671  36.176  38.549 1.00 200.02 ? 84   THR B N   1 
ATOM   2619 C CA  . THR B 1 84  ? 55.698  36.566  39.560 1.00 198.75 ? 84   THR B CA  1 
ATOM   2620 C C   . THR B 1 84  ? 54.736  37.576  38.966 1.00 195.12 ? 84   THR B C   1 
ATOM   2621 O O   . THR B 1 84  ? 53.537  37.326  38.861 1.00 189.92 ? 84   THR B O   1 
ATOM   2622 C CB  . THR B 1 84  ? 56.382  37.219  40.765 1.00 200.94 ? 84   THR B CB  1 
ATOM   2623 O OG1 . THR B 1 84  ? 57.510  36.433  41.161 1.00 204.18 ? 84   THR B OG1 1 
ATOM   2624 C CG2 . THR B 1 84  ? 55.413  37.335  41.930 1.00 200.34 ? 84   THR B CG2 1 
ATOM   2625 N N   . ASP B 1 85  ? 55.276  38.726  38.581 1.00 160.45 ? 85   ASP B N   1 
ATOM   2626 C CA  . ASP B 1 85  ? 54.475  39.785  37.985 1.00 154.86 ? 85   ASP B CA  1 
ATOM   2627 C C   . ASP B 1 85  ? 53.538  39.236  36.908 1.00 148.31 ? 85   ASP B C   1 
ATOM   2628 O O   . ASP B 1 85  ? 52.332  39.483  36.936 1.00 143.40 ? 85   ASP B O   1 
ATOM   2629 C CB  . ASP B 1 85  ? 55.379  40.877  37.407 1.00 156.56 ? 85   ASP B CB  1 
ATOM   2630 C CG  . ASP B 1 85  ? 56.152  41.622  38.483 1.00 160.89 ? 85   ASP B CG  1 
ATOM   2631 O OD1 . ASP B 1 85  ? 56.443  41.015  39.537 1.00 162.61 ? 85   ASP B OD1 1 
ATOM   2632 O OD2 . ASP B 1 85  ? 56.468  42.813  38.274 1.00 160.93 ? 85   ASP B OD2 1 
ATOM   2633 N N   . ALA B 1 86  ? 54.098  38.483  35.966 1.00 141.75 ? 86   ALA B N   1 
ATOM   2634 C CA  . ALA B 1 86  ? 53.306  37.884  34.897 1.00 136.30 ? 86   ALA B CA  1 
ATOM   2635 C C   . ALA B 1 86  ? 52.212  36.971  35.451 1.00 133.81 ? 86   ALA B C   1 
ATOM   2636 O O   . ALA B 1 86  ? 51.054  37.059  35.045 1.00 128.31 ? 86   ALA B O   1 
ATOM   2637 C CB  . ALA B 1 86  ? 54.205  37.120  33.938 1.00 138.34 ? 86   ALA B CB  1 
ATOM   2638 N N   . PHE B 1 87  ? 52.589  36.096  36.378 1.00 128.58 ? 87   PHE B N   1 
ATOM   2639 C CA  . PHE B 1 87  ? 51.647  35.189  37.019 1.00 127.11 ? 87   PHE B CA  1 
ATOM   2640 C C   . PHE B 1 87  ? 50.479  35.943  37.645 1.00 123.71 ? 87   PHE B C   1 
ATOM   2641 O O   . PHE B 1 87  ? 49.321  35.699  37.308 1.00 119.44 ? 87   PHE B O   1 
ATOM   2642 C CB  . PHE B 1 87  ? 52.349  34.350  38.086 1.00 125.70 ? 87   PHE B CB  1 
ATOM   2643 C CG  . PHE B 1 87  ? 51.417  33.476  38.875 1.00 124.89 ? 87   PHE B CG  1 
ATOM   2644 C CD1 . PHE B 1 87  ? 51.045  32.224  38.396 1.00 130.70 ? 87   PHE B CD1 1 
ATOM   2645 C CD2 . PHE B 1 87  ? 50.901  33.904  40.089 1.00 125.39 ? 87   PHE B CD2 1 
ATOM   2646 C CE1 . PHE B 1 87  ? 50.182  31.413  39.115 1.00 126.86 ? 87   PHE B CE1 1 
ATOM   2647 C CE2 . PHE B 1 87  ? 50.037  33.100  40.815 1.00 128.29 ? 87   PHE B CE2 1 
ATOM   2648 C CZ  . PHE B 1 87  ? 49.677  31.851  40.326 1.00 125.23 ? 87   PHE B CZ  1 
ATOM   2649 N N   . PHE B 1 88  ? 50.786  36.853  38.562 1.00 143.09 ? 88   PHE B N   1 
ATOM   2650 C CA  . PHE B 1 88  ? 49.750  37.638  39.221 1.00 140.49 ? 88   PHE B CA  1 
ATOM   2651 C C   . PHE B 1 88  ? 48.908  38.421  38.231 1.00 134.06 ? 88   PHE B C   1 
ATOM   2652 O O   . PHE B 1 88  ? 47.698  38.516  38.392 1.00 130.06 ? 88   PHE B O   1 
ATOM   2653 C CB  . PHE B 1 88  ? 50.343  38.569  40.276 1.00 145.36 ? 88   PHE B CB  1 
ATOM   2654 C CG  . PHE B 1 88  ? 50.709  37.871  41.548 1.00 151.22 ? 88   PHE B CG  1 
ATOM   2655 C CD1 . PHE B 1 88  ? 52.032  37.752  41.932 1.00 157.77 ? 88   PHE B CD1 1 
ATOM   2656 C CD2 . PHE B 1 88  ? 49.728  37.310  42.351 1.00 147.99 ? 88   PHE B CD2 1 
ATOM   2657 C CE1 . PHE B 1 88  ? 52.372  37.100  43.101 1.00 161.05 ? 88   PHE B CE1 1 
ATOM   2658 C CE2 . PHE B 1 88  ? 50.059  36.652  43.523 1.00 150.26 ? 88   PHE B CE2 1 
ATOM   2659 C CZ  . PHE B 1 88  ? 51.383  36.548  43.900 1.00 157.66 ? 88   PHE B CZ  1 
ATOM   2660 N N   . PHE B 1 89  ? 49.540  38.981  37.206 1.00 124.85 ? 89   PHE B N   1 
ATOM   2661 C CA  . PHE B 1 89  ? 48.781  39.628  36.146 1.00 118.93 ? 89   PHE B CA  1 
ATOM   2662 C C   . PHE B 1 89  ? 47.791  38.639  35.544 1.00 114.49 ? 89   PHE B C   1 
ATOM   2663 O O   . PHE B 1 89  ? 46.611  38.942  35.355 1.00 117.25 ? 89   PHE B O   1 
ATOM   2664 C CB  . PHE B 1 89  ? 49.694  40.144  35.040 1.00 119.38 ? 89   PHE B CB  1 
ATOM   2665 C CG  . PHE B 1 89  ? 48.945  40.608  33.830 1.00 113.75 ? 89   PHE B CG  1 
ATOM   2666 C CD1 . PHE B 1 89  ? 48.120  41.717  33.904 1.00 117.69 ? 89   PHE B CD1 1 
ATOM   2667 C CD2 . PHE B 1 89  ? 49.033  39.922  32.631 1.00 119.61 ? 89   PHE B CD2 1 
ATOM   2668 C CE1 . PHE B 1 89  ? 47.414  42.149  32.798 1.00 112.60 ? 89   PHE B CE1 1 
ATOM   2669 C CE2 . PHE B 1 89  ? 48.334  40.351  31.515 1.00 114.73 ? 89   PHE B CE2 1 
ATOM   2670 C CZ  . PHE B 1 89  ? 47.521  41.466  31.600 1.00 111.21 ? 89   PHE B CZ  1 
ATOM   2671 N N   . SER B 1 90  ? 48.294  37.450  35.241 1.00 147.00 ? 90   SER B N   1 
ATOM   2672 C CA  . SER B 1 90  ? 47.482  36.404  34.655 1.00 143.52 ? 90   SER B CA  1 
ATOM   2673 C C   . SER B 1 90  ? 46.264  36.086  35.513 1.00 141.53 ? 90   SER B C   1 
ATOM   2674 O O   . SER B 1 90  ? 45.179  35.869  34.986 1.00 136.85 ? 90   SER B O   1 
ATOM   2675 C CB  . SER B 1 90  ? 48.316  35.147  34.436 1.00 146.90 ? 90   SER B CB  1 
ATOM   2676 O OG  . SER B 1 90  ? 47.486  34.005  34.373 1.00 144.84 ? 90   SER B OG  1 
ATOM   2677 N N   . VAL B 1 91  ? 46.422  36.051  36.832 1.00 129.17 ? 91   VAL B N   1 
ATOM   2678 C CA  . VAL B 1 91  ? 45.255  35.791  37.671 1.00 127.43 ? 91   VAL B CA  1 
ATOM   2679 C C   . VAL B 1 91  ? 44.282  36.969  37.595 1.00 122.99 ? 91   VAL B C   1 
ATOM   2680 O O   . VAL B 1 91  ? 43.096  36.779  37.332 1.00 118.45 ? 91   VAL B O   1 
ATOM   2681 C CB  . VAL B 1 91  ? 45.606  35.431  39.146 1.00 129.58 ? 91   VAL B CB  1 
ATOM   2682 C CG1 . VAL B 1 91  ? 46.866  34.581  39.213 1.00 135.00 ? 91   VAL B CG1 1 
ATOM   2683 C CG2 . VAL B 1 91  ? 45.746  36.675  39.998 1.00 131.51 ? 91   VAL B CG2 1 
ATOM   2684 N N   . GLN B 1 92  ? 44.788  38.185  37.790 1.00 141.96 ? 92   GLN B N   1 
ATOM   2685 C CA  . GLN B 1 92  ? 43.945  39.377  37.732 1.00 138.19 ? 92   GLN B CA  1 
ATOM   2686 C C   . GLN B 1 92  ? 43.187  39.404  36.428 1.00 131.71 ? 92   GLN B C   1 
ATOM   2687 O O   . GLN B 1 92  ? 42.062  39.893  36.361 1.00 125.37 ? 92   GLN B O   1 
ATOM   2688 C CB  . GLN B 1 92  ? 44.780  40.646  37.826 1.00 140.39 ? 92   GLN B CB  1 
ATOM   2689 C CG  . GLN B 1 92  ? 46.003  40.495  38.670 1.00 146.97 ? 92   GLN B CG  1 
ATOM   2690 C CD  . GLN B 1 92  ? 46.373  41.770  39.370 1.00 149.57 ? 92   GLN B CD  1 
ATOM   2691 O OE1 . GLN B 1 92  ? 46.181  42.865  38.839 1.00 146.74 ? 92   GLN B OE1 1 
ATOM   2692 N NE2 . GLN B 1 92  ? 46.906  41.641  40.579 1.00 155.21 ? 92   GLN B NE2 1 
ATOM   2693 N N   . THR B 1 93  ? 43.818  38.885  35.384 1.00 161.82 ? 93   THR B N   1 
ATOM   2694 C CA  . THR B 1 93  ? 43.202  38.866  34.073 1.00 155.21 ? 93   THR B CA  1 
ATOM   2695 C C   . THR B 1 93  ? 42.168  37.732  33.976 1.00 151.06 ? 93   THR B C   1 
ATOM   2696 O O   . THR B 1 93  ? 41.032  37.959  33.564 1.00 144.21 ? 93   THR B O   1 
ATOM   2697 C CB  . THR B 1 93  ? 44.266  38.749  32.961 1.00 157.77 ? 93   THR B CB  1 
ATOM   2698 O OG1 . THR B 1 93  ? 43.824  39.443  31.790 1.00 151.84 ? 93   THR B OG1 1 
ATOM   2699 C CG2 . THR B 1 93  ? 44.525  37.306  32.620 1.00 159.31 ? 93   THR B CG2 1 
ATOM   2700 N N   . MET B 1 94  ? 42.546  36.523  34.383 1.00 141.15 ? 94   MET B N   1 
ATOM   2701 C CA  . MET B 1 94  ? 41.663  35.371  34.223 1.00 138.02 ? 94   MET B CA  1 
ATOM   2702 C C   . MET B 1 94  ? 40.481  35.372  35.188 1.00 134.67 ? 94   MET B C   1 
ATOM   2703 O O   . MET B 1 94  ? 39.417  34.851  34.868 1.00 128.51 ? 94   MET B O   1 
ATOM   2704 C CB  . MET B 1 94  ? 42.428  34.054  34.350 1.00 143.88 ? 94   MET B CB  1 
ATOM   2705 C CG  . MET B 1 94  ? 41.526  32.835  34.237 1.00 141.23 ? 94   MET B CG  1 
ATOM   2706 S SD  . MET B 1 94  ? 42.360  31.322  34.714 1.00 145.31 ? 94   MET B SD  1 
ATOM   2707 C CE  . MET B 1 94  ? 43.104  31.870  36.245 1.00 149.06 ? 94   MET B CE  1 
ATOM   2708 N N   . ALA B 1 95  ? 40.673  35.936  36.375 1.00 114.78 ? 95   ALA B N   1 
ATOM   2709 C CA  . ALA B 1 95  ? 39.588  36.059  37.343 1.00 113.65 ? 95   ALA B CA  1 
ATOM   2710 C C   . ALA B 1 95  ? 38.840  37.333  37.011 1.00 108.78 ? 95   ALA B C   1 
ATOM   2711 O O   . ALA B 1 95  ? 37.825  37.671  37.621 1.00 107.98 ? 95   ALA B O   1 
ATOM   2712 C CB  . ALA B 1 95  ? 40.143  36.124  38.746 1.00 112.52 ? 95   ALA B CB  1 
ATOM   2713 N N   . THR B 1 96  ? 39.385  38.040  36.030 1.00 122.15 ? 96   THR B N   1 
ATOM   2714 C CA  . THR B 1 96  ? 38.827  39.289  35.555 1.00 116.80 ? 96   THR B CA  1 
ATOM   2715 C C   . THR B 1 96  ? 38.692  40.347  36.653 1.00 118.09 ? 96   THR B C   1 
ATOM   2716 O O   . THR B 1 96  ? 37.772  41.138  36.609 1.00 112.75 ? 96   THR B O   1 
ATOM   2717 C CB  . THR B 1 96  ? 37.458  39.070  34.879 1.00 108.69 ? 96   THR B CB  1 
ATOM   2718 O OG1 . THR B 1 96  ? 36.476  38.807  35.882 1.00 106.75 ? 96   THR B OG1 1 
ATOM   2719 C CG2 . THR B 1 96  ? 37.511  37.889  33.928 1.00 108.28 ? 96   THR B CG2 1 
ATOM   2720 N N   . ILE B 1 97  ? 39.595  40.370  37.631 1.00 134.17 ? 97   ILE B N   1 
ATOM   2721 C CA  . ILE B 1 97  ? 39.596  41.474  38.589 1.00 135.36 ? 97   ILE B CA  1 
ATOM   2722 C C   . ILE B 1 97  ? 40.061  42.713  37.846 1.00 135.62 ? 97   ILE B C   1 
ATOM   2723 O O   . ILE B 1 97  ? 39.544  43.813  38.043 1.00 132.26 ? 97   ILE B O   1 
ATOM   2724 C CB  . ILE B 1 97  ? 40.538  41.226  39.776 1.00 142.02 ? 97   ILE B CB  1 
ATOM   2725 C CG1 . ILE B 1 97  ? 40.328  39.820  40.333 1.00 140.14 ? 97   ILE B CG1 1 
ATOM   2726 C CG2 . ILE B 1 97  ? 40.327  42.287  40.858 1.00 142.11 ? 97   ILE B CG2 1 
ATOM   2727 C CD1 . ILE B 1 97  ? 41.434  39.362  41.240 1.00 147.57 ? 97   ILE B CD1 1 
ATOM   2728 N N   . GLY B 1 98  ? 41.049  42.514  36.981 1.00 131.48 ? 98   GLY B N   1 
ATOM   2729 C CA  . GLY B 1 98  ? 41.582  43.581  36.159 1.00 131.17 ? 98   GLY B CA  1 
ATOM   2730 C C   . GLY B 1 98  ? 41.833  44.855  36.934 1.00 134.51 ? 98   GLY B C   1 
ATOM   2731 O O   . GLY B 1 98  ? 41.266  45.885  36.606 1.00 130.37 ? 98   GLY B O   1 
ATOM   2732 N N   . TYR B 1 99  ? 42.686  44.784  37.953 1.00 160.52 ? 99   TYR B N   1 
ATOM   2733 C CA  . TYR B 1 99  ? 43.006  45.946  38.782 1.00 164.09 ? 99   TYR B CA  1 
ATOM   2734 C C   . TYR B 1 99  ? 43.362  47.181  37.968 1.00 162.31 ? 99   TYR B C   1 
ATOM   2735 O O   . TYR B 1 99  ? 42.759  48.232  38.149 1.00 159.97 ? 99   TYR B O   1 
ATOM   2736 C CB  . TYR B 1 99  ? 44.160  45.640  39.733 1.00 170.94 ? 99   TYR B CB  1 
ATOM   2737 C CG  . TYR B 1 99  ? 43.757  44.908  40.990 1.00 173.84 ? 99   TYR B CG  1 
ATOM   2738 C CD1 . TYR B 1 99  ? 44.477  43.806  41.430 1.00 178.31 ? 99   TYR B CD1 1 
ATOM   2739 C CD2 . TYR B 1 99  ? 42.661  45.316  41.738 1.00 172.11 ? 99   TYR B CD2 1 
ATOM   2740 C CE1 . TYR B 1 99  ? 44.119  43.129  42.579 1.00 179.35 ? 99   TYR B CE1 1 
ATOM   2741 C CE2 . TYR B 1 99  ? 42.293  44.642  42.893 1.00 170.70 ? 99   TYR B CE2 1 
ATOM   2742 C CZ  . TYR B 1 99  ? 43.028  43.550  43.308 1.00 174.85 ? 99   TYR B CZ  1 
ATOM   2743 O OH  . TYR B 1 99  ? 42.675  42.874  44.454 1.00 172.53 ? 99   TYR B OH  1 
ATOM   2744 N N   . GLY B 1 100 ? 44.368  47.074  37.106 1.00 126.92 ? 100  GLY B N   1 
ATOM   2745 C CA  . GLY B 1 100 ? 44.706  48.188  36.237 1.00 125.44 ? 100  GLY B CA  1 
ATOM   2746 C C   . GLY B 1 100 ? 46.141  48.690  36.255 1.00 130.42 ? 100  GLY B C   1 
ATOM   2747 O O   . GLY B 1 100 ? 46.501  49.560  35.463 1.00 129.41 ? 100  GLY B O   1 
ATOM   2748 N N   . LYS B 1 101 ? 46.963  48.166  37.159 1.00 154.19 ? 101  LYS B N   1 
ATOM   2749 C CA  . LYS B 1 101 ? 48.389  48.476  37.140 1.00 155.10 ? 101  LYS B CA  1 
ATOM   2750 C C   . LYS B 1 101 ? 49.011  47.769  35.958 1.00 155.41 ? 101  LYS B C   1 
ATOM   2751 O O   . LYS B 1 101 ? 49.481  48.394  35.011 1.00 154.85 ? 101  LYS B O   1 
ATOM   2752 C CB  . LYS B 1 101 ? 49.073  47.998  38.420 1.00 156.68 ? 101  LYS B CB  1 
ATOM   2753 C CG  . LYS B 1 101 ? 49.168  49.044  39.509 1.00 156.74 ? 101  LYS B CG  1 
ATOM   2754 C CD  . LYS B 1 101 ? 50.176  50.126  39.159 1.00 156.83 ? 101  LYS B CD  1 
ATOM   2755 C CE  . LYS B 1 101 ? 50.155  51.228  40.208 1.00 156.84 ? 101  LYS B CE  1 
ATOM   2756 N NZ  . LYS B 1 101 ? 51.005  52.396  39.836 1.00 156.96 ? 101  LYS B NZ  1 
ATOM   2757 N N   . LEU B 1 102 ? 49.006  46.446  36.036 1.00 125.65 ? 102  LEU B N   1 
ATOM   2758 C CA  . LEU B 1 102 ? 49.472  45.606  34.954 1.00 125.97 ? 102  LEU B CA  1 
ATOM   2759 C C   . LEU B 1 102 ? 48.410  45.605  33.863 1.00 124.64 ? 102  LEU B C   1 
ATOM   2760 O O   . LEU B 1 102 ? 47.230  45.371  34.131 1.00 124.21 ? 102  LEU B O   1 
ATOM   2761 C CB  . LEU B 1 102 ? 49.718  44.196  35.482 1.00 127.53 ? 102  LEU B CB  1 
ATOM   2762 C CG  . LEU B 1 102 ? 50.243  44.199  36.920 1.00 128.69 ? 102  LEU B CG  1 
ATOM   2763 C CD1 . LEU B 1 102 ? 50.262  42.798  37.506 1.00 130.18 ? 102  LEU B CD1 1 
ATOM   2764 C CD2 . LEU B 1 102 ? 51.620  44.840  36.991 1.00 129.19 ? 102  LEU B CD2 1 
ATOM   2765 N N   . ILE B 1 103 ? 48.833  45.891  32.639 1.00 124.76 ? 103  ILE B N   1 
ATOM   2766 C CA  . ILE B 1 103 ? 47.922  46.020  31.513 1.00 123.44 ? 103  ILE B CA  1 
ATOM   2767 C C   . ILE B 1 103 ? 48.576  45.384  30.302 1.00 123.65 ? 103  ILE B C   1 
ATOM   2768 O O   . ILE B 1 103 ? 49.800  45.363  30.206 1.00 124.34 ? 103  ILE B O   1 
ATOM   2769 C CB  . ILE B 1 103 ? 47.658  47.503  31.193 1.00 122.00 ? 103  ILE B CB  1 
ATOM   2770 C CG1 . ILE B 1 103 ? 47.199  48.250  32.443 1.00 121.84 ? 103  ILE B CG1 1 
ATOM   2771 C CG2 . ILE B 1 103 ? 46.631  47.656  30.078 1.00 120.57 ? 103  ILE B CG2 1 
ATOM   2772 C CD1 . ILE B 1 103 ? 47.095  49.742  32.242 1.00 120.69 ? 103  ILE B CD1 1 
ATOM   2773 N N   . PRO B 1 104 ? 47.770  44.854  29.372 1.00 132.07 ? 104  PRO B N   1 
ATOM   2774 C CA  . PRO B 1 104 ? 48.350  44.337  28.129 1.00 132.07 ? 104  PRO B CA  1 
ATOM   2775 C C   . PRO B 1 104 ? 48.992  45.437  27.280 1.00 131.04 ? 104  PRO B C   1 
ATOM   2776 O O   . PRO B 1 104 ? 48.621  46.609  27.377 1.00 130.00 ? 104  PRO B O   1 
ATOM   2777 C CB  . PRO B 1 104 ? 47.134  43.756  27.403 1.00 131.53 ? 104  PRO B CB  1 
ATOM   2778 C CG  . PRO B 1 104 ? 45.967  44.475  28.015 1.00 130.67 ? 104  PRO B CG  1 
ATOM   2779 C CD  . PRO B 1 104 ? 46.332  44.556  29.451 1.00 131.54 ? 104  PRO B CD  1 
ATOM   2780 N N   . ILE B 1 105 ? 49.959  45.049  26.456 1.00 121.50 ? 105  ILE B N   1 
ATOM   2781 C CA  . ILE B 1 105 ? 50.587  45.962  25.513 1.00 120.60 ? 105  ILE B CA  1 
ATOM   2782 C C   . ILE B 1 105 ? 50.774  45.270  24.173 1.00 120.34 ? 105  ILE B C   1 
ATOM   2783 O O   . ILE B 1 105 ? 51.476  44.263  24.080 1.00 121.37 ? 105  ILE B O   1 
ATOM   2784 C CB  . ILE B 1 105 ? 51.958  46.424  26.009 1.00 121.41 ? 105  ILE B CB  1 
ATOM   2785 C CG1 . ILE B 1 105 ? 51.804  47.314  27.241 1.00 121.58 ? 105  ILE B CG1 1 
ATOM   2786 C CG2 . ILE B 1 105 ? 52.698  47.161  24.905 1.00 120.69 ? 105  ILE B CG2 1 
ATOM   2787 C CD1 . ILE B 1 105 ? 53.104  47.577  27.962 1.00 122.76 ? 105  ILE B CD1 1 
ATOM   2788 N N   . GLY B 1 106 ? 50.139  45.808  23.138 1.00 140.21 ? 106  GLY B N   1 
ATOM   2789 C CA  . GLY B 1 106 ? 50.280  45.266  21.800 1.00 139.81 ? 106  GLY B CA  1 
ATOM   2790 C C   . GLY B 1 106 ? 49.342  44.107  21.534 1.00 140.12 ? 106  GLY B C   1 
ATOM   2791 O O   . GLY B 1 106 ? 48.787  43.530  22.467 1.00 140.94 ? 106  GLY B O   1 
ATOM   2792 N N   . PRO B 1 107 ? 49.174  43.747  20.254 1.00 159.99 ? 107  PRO B N   1 
ATOM   2793 C CA  . PRO B 1 107 ? 48.225  42.718  19.814 1.00 160.25 ? 107  PRO B CA  1 
ATOM   2794 C C   . PRO B 1 107 ? 48.435  41.372  20.508 1.00 162.03 ? 107  PRO B C   1 
ATOM   2795 O O   . PRO B 1 107 ? 47.473  40.785  21.006 1.00 162.63 ? 107  PRO B O   1 
ATOM   2796 C CB  . PRO B 1 107 ? 48.516  42.596  18.315 1.00 159.50 ? 107  PRO B CB  1 
ATOM   2797 C CG  . PRO B 1 107 ? 49.111  43.910  17.938 1.00 158.31 ? 107  PRO B CG  1 
ATOM   2798 C CD  . PRO B 1 107 ? 49.919  44.327  19.124 1.00 159.10 ? 107  PRO B CD  1 
ATOM   2799 N N   . LEU B 1 108 ? 49.675  40.893  20.541 1.00 130.23 ? 108  LEU B N   1 
ATOM   2800 C CA  . LEU B 1 108 ? 49.973  39.598  21.145 1.00 132.00 ? 108  LEU B CA  1 
ATOM   2801 C C   . LEU B 1 108 ? 49.525  39.542  22.599 1.00 132.84 ? 108  LEU B C   1 
ATOM   2802 O O   . LEU B 1 108 ? 48.826  38.617  23.007 1.00 133.87 ? 108  LEU B O   1 
ATOM   2803 C CB  . LEU B 1 108 ? 51.464  39.281  21.037 1.00 132.66 ? 108  LEU B CB  1 
ATOM   2804 C CG  . LEU B 1 108 ? 52.009  39.319  19.610 1.00 131.80 ? 108  LEU B CG  1 
ATOM   2805 C CD1 . LEU B 1 108 ? 53.410  38.729  19.558 1.00 130.43 ? 108  LEU B CD1 1 
ATOM   2806 C CD2 . LEU B 1 108 ? 51.068  38.584  18.665 1.00 131.64 ? 108  LEU B CD2 1 
ATOM   2807 N N   . ALA B 1 109 ? 49.928  40.538  23.377 1.00 141.53 ? 109  ALA B N   1 
ATOM   2808 C CA  . ALA B 1 109 ? 49.529  40.612  24.775 1.00 142.22 ? 109  ALA B CA  1 
ATOM   2809 C C   . ALA B 1 109 ? 48.022  40.445  24.922 1.00 141.93 ? 109  ALA B C   1 
ATOM   2810 O O   . ALA B 1 109 ? 47.555  39.565  25.640 1.00 143.14 ? 109  ALA B O   1 
ATOM   2811 C CB  . ALA B 1 109 ? 49.976  41.931  25.385 1.00 141.55 ? 109  ALA B CB  1 
ATOM   2812 N N   . ASN B 1 110 ? 47.271  41.291  24.224 1.00 126.38 ? 110  ASN B N   1 
ATOM   2813 C CA  . ASN B 1 110 ? 45.819  41.338  24.364 1.00 125.91 ? 110  ASN B CA  1 
ATOM   2814 C C   . ASN B 1 110 ? 45.099  40.090  23.873 1.00 126.77 ? 110  ASN B C   1 
ATOM   2815 O O   . ASN B 1 110 ? 44.135  39.647  24.493 1.00 127.35 ? 110  ASN B O   1 
ATOM   2816 C CB  . ASN B 1 110 ? 45.258  42.570  23.661 1.00 124.02 ? 110  ASN B CB  1 
ATOM   2817 C CG  . ASN B 1 110 ? 45.735  43.855  24.284 1.00 123.32 ? 110  ASN B CG  1 
ATOM   2818 O OD1 . ASN B 1 110 ? 45.265  44.250  25.345 1.00 123.34 ? 110  ASN B OD1 1 
ATOM   2819 N ND2 . ASN B 1 110 ? 46.672  44.521  23.625 1.00 122.77 ? 110  ASN B ND2 1 
ATOM   2820 N N   . THR B 1 111 ? 45.548  39.529  22.757 1.00 101.22 ? 111  THR B N   1 
ATOM   2821 C CA  . THR B 1 111 ? 44.924  38.309  22.259 1.00 101.19 ? 111  THR B CA  1 
ATOM   2822 C C   . THR B 1 111 ? 44.963  37.259  23.361 1.00 103.13 ? 111  THR B C   1 
ATOM   2823 O O   . THR B 1 111 ? 43.939  36.673  23.708 1.00 103.92 ? 111  THR B O   1 
ATOM   2824 C CB  . THR B 1 111 ? 45.618  37.775  21.001 1.00 101.27 ? 111  THR B CB  1 
ATOM   2825 O OG1 . THR B 1 111 ? 45.781  38.842  20.060 1.00 99.45  ? 111  THR B OG1 1 
ATOM   2826 C CG2 . THR B 1 111 ? 44.787  36.671  20.364 1.00 99.55  ? 111  THR B CG2 1 
ATOM   2827 N N   . LEU B 1 112 ? 46.151  37.040  23.916 1.00 106.06 ? 112  LEU B N   1 
ATOM   2828 C CA  . LEU B 1 112 ? 46.312  36.167  25.073 1.00 107.93 ? 112  LEU B CA  1 
ATOM   2829 C C   . LEU B 1 112 ? 45.321  36.527  26.173 1.00 107.88 ? 112  LEU B C   1 
ATOM   2830 O O   . LEU B 1 112 ? 44.799  35.650  26.862 1.00 109.33 ? 112  LEU B O   1 
ATOM   2831 C CB  . LEU B 1 112 ? 47.736  36.265  25.622 1.00 108.45 ? 112  LEU B CB  1 
ATOM   2832 C CG  . LEU B 1 112 ? 48.792  35.371  24.978 1.00 109.37 ? 112  LEU B CG  1 
ATOM   2833 C CD1 . LEU B 1 112 ? 50.108  35.514  25.724 1.00 109.92 ? 112  LEU B CD1 1 
ATOM   2834 C CD2 . LEU B 1 112 ? 48.322  33.928  24.975 1.00 111.17 ? 112  LEU B CD2 1 
ATOM   2835 N N   . VAL B 1 113 ? 45.072  37.822  26.339 1.00 114.75 ? 113  VAL B N   1 
ATOM   2836 C CA  . VAL B 1 113 ? 44.123  38.293  27.340 1.00 114.43 ? 113  VAL B CA  1 
ATOM   2837 C C   . VAL B 1 113 ? 42.725  37.770  27.045 1.00 114.59 ? 113  VAL B C   1 
ATOM   2838 O O   . VAL B 1 113 ? 42.131  37.064  27.858 1.00 115.83 ? 113  VAL B O   1 
ATOM   2839 C CB  . VAL B 1 113 ? 44.078  39.834  27.407 1.00 112.54 ? 113  VAL B CB  1 
ATOM   2840 C CG1 . VAL B 1 113 ? 42.975  40.291  28.347 1.00 112.10 ? 113  VAL B CG1 1 
ATOM   2841 C CG2 . VAL B 1 113 ? 45.425  40.386  27.845 1.00 112.61 ? 113  VAL B CG2 1 
ATOM   2842 N N   . THR B 1 114 ? 42.209  38.108  25.869 1.00 107.90 ? 114  THR B N   1 
ATOM   2843 C CA  . THR B 1 114 ? 40.844  37.752  25.506 1.00 107.85 ? 114  THR B CA  1 
ATOM   2844 C C   . THR B 1 114 ? 40.675  36.234  25.447 1.00 109.99 ? 114  THR B C   1 
ATOM   2845 O O   . THR B 1 114 ? 39.556  35.720  25.465 1.00 110.60 ? 114  THR B O   1 
ATOM   2846 C CB  . THR B 1 114 ? 40.436  38.369  24.152 1.00 106.20 ? 114  THR B CB  1 
ATOM   2847 O OG1 . THR B 1 114 ? 40.645  37.413  23.111 1.00 107.07 ? 114  THR B OG1 1 
ATOM   2848 C CG2 . THR B 1 114 ? 41.255  39.608  23.859 1.00 104.60 ? 114  THR B CG2 1 
ATOM   2849 N N   . LEU B 1 115 ? 41.797  35.524  25.372 1.00 112.91 ? 115  LEU B N   1 
ATOM   2850 C CA  . LEU B 1 115 ? 41.788  34.067  25.354 1.00 115.12 ? 115  LEU B CA  1 
ATOM   2851 C C   . LEU B 1 115 ? 41.673  33.544  26.774 1.00 116.64 ? 115  LEU B C   1 
ATOM   2852 O O   . LEU B 1 115 ? 40.880  32.650  27.069 1.00 117.56 ? 115  LEU B O   1 
ATOM   2853 C CB  . LEU B 1 115 ? 43.078  33.540  24.737 1.00 115.01 ? 115  LEU B CB  1 
ATOM   2854 C CG  . LEU B 1 115 ? 42.949  32.140  24.157 1.00 113.24 ? 115  LEU B CG  1 
ATOM   2855 C CD1 . LEU B 1 115 ? 42.459  32.257  22.724 1.00 111.13 ? 115  LEU B CD1 1 
ATOM   2856 C CD2 . LEU B 1 115 ? 44.276  31.405  24.233 1.00 113.00 ? 115  LEU B CD2 1 
ATOM   2857 N N   . GLU B 1 116 ? 42.486  34.113  27.652 1.00 123.71 ? 116  GLU B N   1 
ATOM   2858 C CA  . GLU B 1 116 ? 42.460  33.756  29.051 1.00 124.96 ? 116  GLU B CA  1 
ATOM   2859 C C   . GLU B 1 116 ? 41.065  33.958  29.602 1.00 124.71 ? 116  GLU B C   1 
ATOM   2860 O O   . GLU B 1 116 ? 40.469  33.036  30.141 1.00 126.39 ? 116  GLU B O   1 
ATOM   2861 C CB  . GLU B 1 116 ? 43.449  34.612  29.821 1.00 124.23 ? 116  GLU B CB  1 
ATOM   2862 C CG  . GLU B 1 116 ? 43.773  34.061  31.181 1.00 125.80 ? 116  GLU B CG  1 
ATOM   2863 C CD  . GLU B 1 116 ? 45.158  34.450  31.617 1.00 125.73 ? 116  GLU B CD  1 
ATOM   2864 O OE1 . GLU B 1 116 ? 45.681  35.448  31.077 1.00 124.11 ? 116  GLU B OE1 1 
ATOM   2865 O OE2 . GLU B 1 116 ? 45.726  33.759  32.487 1.00 127.34 ? 116  GLU B OE2 1 
ATOM   2866 N N   . ALA B 1 117 ? 40.554  35.175  29.462 1.00 111.55 ? 117  ALA B N   1 
ATOM   2867 C CA  . ALA B 1 117 ? 39.207  35.497  29.906 1.00 111.03 ? 117  ALA B CA  1 
ATOM   2868 C C   . ALA B 1 117 ? 38.271  34.323  29.644 1.00 112.68 ? 117  ALA B C   1 
ATOM   2869 O O   . ALA B 1 117 ? 37.803  33.658  30.571 1.00 114.15 ? 117  ALA B O   1 
ATOM   2870 C CB  . ALA B 1 117 ? 38.712  36.741  29.195 1.00 108.72 ? 117  ALA B CB  1 
ATOM   2871 N N   . LEU B 1 118 ? 38.023  34.064  28.368 1.00 112.72 ? 118  LEU B N   1 
ATOM   2872 C CA  . LEU B 1 118 ? 37.202  32.942  27.949 1.00 114.25 ? 118  LEU B CA  1 
ATOM   2873 C C   . LEU B 1 118 ? 37.554  31.683  28.733 1.00 115.55 ? 118  LEU B C   1 
ATOM   2874 O O   . LEU B 1 118 ? 36.687  31.029  29.299 1.00 115.94 ? 118  LEU B O   1 
ATOM   2875 C CB  . LEU B 1 118 ? 37.408  32.695  26.460 1.00 112.59 ? 118  LEU B CB  1 
ATOM   2876 C CG  . LEU B 1 118 ? 36.768  31.425  25.913 1.00 111.28 ? 118  LEU B CG  1 
ATOM   2877 C CD1 . LEU B 1 118 ? 35.312  31.664  25.559 1.00 115.97 ? 118  LEU B CD1 1 
ATOM   2878 C CD2 . LEU B 1 118 ? 37.532  30.927  24.705 1.00 114.79 ? 118  LEU B CD2 1 
ATOM   2879 N N   . CYS B 1 119 ? 38.837  31.348  28.761 1.00 139.27 ? 119  CYS B N   1 
ATOM   2880 C CA  . CYS B 1 119 ? 39.315  30.210  29.535 1.00 139.89 ? 119  CYS B CA  1 
ATOM   2881 C C   . CYS B 1 119 ? 38.837  30.268  30.977 1.00 142.00 ? 119  CYS B C   1 
ATOM   2882 O O   . CYS B 1 119 ? 38.311  29.294  31.510 1.00 142.47 ? 119  CYS B O   1 
ATOM   2883 C CB  . CYS B 1 119 ? 40.841  30.165  29.515 1.00 140.11 ? 119  CYS B CB  1 
ATOM   2884 S SG  . CYS B 1 119 ? 41.538  29.136  28.228 1.00 137.86 ? 119  CYS B SG  1 
ATOM   2885 N N   . GLY B 1 120 ? 39.045  31.413  31.611 1.00 124.04 ? 120  GLY B N   1 
ATOM   2886 C CA  . GLY B 1 120 ? 38.635  31.601  32.986 1.00 124.44 ? 120  GLY B CA  1 
ATOM   2887 C C   . GLY B 1 120 ? 37.196  31.205  33.216 1.00 125.07 ? 120  GLY B C   1 
ATOM   2888 O O   . GLY B 1 120 ? 36.903  30.345  34.042 1.00 126.98 ? 120  GLY B O   1 
ATOM   2889 N N   . MET B 1 121 ? 36.297  31.821  32.459 1.00 153.01 ? 121  MET B N   1 
ATOM   2890 C CA  . MET B 1 121 ? 34.867  31.564  32.606 1.00 153.28 ? 121  MET B CA  1 
ATOM   2891 C C   . MET B 1 121 ? 34.479  30.112  32.318 1.00 153.22 ? 121  MET B C   1 
ATOM   2892 O O   . MET B 1 121 ? 33.698  29.516  33.050 1.00 155.93 ? 121  MET B O   1 
ATOM   2893 C CB  . MET B 1 121 ? 34.052  32.532  31.741 1.00 149.87 ? 121  MET B CB  1 
ATOM   2894 N N   . LEU B 1 122 ? 35.025  29.547  31.251 1.00 88.08  ? 122  LEU B N   1 
ATOM   2895 C CA  . LEU B 1 122 ? 34.806  28.137  30.952 1.00 88.09  ? 122  LEU B CA  1 
ATOM   2896 C C   . LEU B 1 122 ? 35.166  27.285  32.153 1.00 92.63  ? 122  LEU B C   1 
ATOM   2897 O O   . LEU B 1 122 ? 34.440  26.376  32.531 1.00 94.35  ? 122  LEU B O   1 
ATOM   2898 C CB  . LEU B 1 122 ? 35.672  27.704  29.773 1.00 85.00  ? 122  LEU B CB  1 
ATOM   2899 C CG  . LEU B 1 122 ? 35.342  28.295  28.405 1.00 81.83  ? 122  LEU B CG  1 
ATOM   2900 C CD1 . LEU B 1 122 ? 36.003  27.468  27.312 1.00 80.95  ? 122  LEU B CD1 1 
ATOM   2901 C CD2 . LEU B 1 122 ? 33.840  28.346  28.197 1.00 80.95  ? 122  LEU B CD2 1 
ATOM   2902 N N   . GLY B 1 123 ? 36.315  27.576  32.743 1.00 116.02 ? 123  GLY B N   1 
ATOM   2903 C CA  . GLY B 1 123 ? 36.738  26.882  33.939 1.00 120.57 ? 123  GLY B CA  1 
ATOM   2904 C C   . GLY B 1 123 ? 35.659  26.972  34.993 1.00 124.01 ? 123  GLY B C   1 
ATOM   2905 O O   . GLY B 1 123 ? 35.278  25.977  35.598 1.00 127.00 ? 123  GLY B O   1 
ATOM   2906 N N   . LEU B 1 124 ? 35.159  28.180  35.208 1.00 86.50  ? 124  LEU B N   1 
ATOM   2907 C CA  . LEU B 1 124 ? 34.087  28.392  36.167 1.00 89.75  ? 124  LEU B CA  1 
ATOM   2908 C C   . LEU B 1 124 ? 32.899  27.506  35.843 1.00 89.13  ? 124  LEU B C   1 
ATOM   2909 O O   . LEU B 1 124 ? 32.328  26.864  36.722 1.00 92.90  ? 124  LEU B O   1 
ATOM   2910 C CB  . LEU B 1 124 ? 33.628  29.846  36.155 1.00 88.45  ? 124  LEU B CB  1 
ATOM   2911 C CG  . LEU B 1 124 ? 32.625  30.109  37.278 1.00 92.25  ? 124  LEU B CG  1 
ATOM   2912 C CD1 . LEU B 1 124 ? 33.359  30.231  38.603 1.00 97.29  ? 124  LEU B CD1 1 
ATOM   2913 C CD2 . LEU B 1 124 ? 31.774  31.338  37.017 1.00 90.02  ? 124  LEU B CD2 1 
ATOM   2914 N N   . ALA B 1 125 ? 32.521  27.490  34.570 1.00 113.34 ? 125  ALA B N   1 
ATOM   2915 C CA  . ALA B 1 125 ? 31.393  26.693  34.111 1.00 112.28 ? 125  ALA B CA  1 
ATOM   2916 C C   . ALA B 1 125 ? 31.600  25.228  34.452 1.00 114.77 ? 125  ALA B C   1 
ATOM   2917 O O   . ALA B 1 125 ? 30.674  24.548  34.874 1.00 116.88 ? 125  ALA B O   1 
ATOM   2918 C CB  . ALA B 1 125 ? 31.212  26.858  32.623 1.00 107.00 ? 125  ALA B CB  1 
ATOM   2919 N N   . VAL B 1 126 ? 32.823  24.748  34.265 1.00 94.63  ? 126  VAL B N   1 
ATOM   2920 C CA  . VAL B 1 126 ? 33.152  23.357  34.554 1.00 96.96  ? 126  VAL B CA  1 
ATOM   2921 C C   . VAL B 1 126 ? 33.208  23.097  36.055 1.00 102.79 ? 126  VAL B C   1 
ATOM   2922 O O   . VAL B 1 126 ? 32.701  22.083  36.539 1.00 105.56 ? 126  VAL B O   1 
ATOM   2923 C CB  . VAL B 1 126 ? 34.495  22.957  33.916 1.00 95.04  ? 126  VAL B CB  1 
ATOM   2924 C CG1 . VAL B 1 126 ? 34.939  21.593  34.416 1.00 97.98  ? 126  VAL B CG1 1 
ATOM   2925 C CG2 . VAL B 1 126 ? 34.373  22.960  32.406 1.00 89.81  ? 126  VAL B CG2 1 
ATOM   2926 N N   . ALA B 1 127 ? 33.826  24.018  36.786 1.00 77.10  ? 127  ALA B N   1 
ATOM   2927 C CA  . ALA B 1 127 ? 33.921  23.905  38.236 1.00 77.10  ? 127  ALA B CA  1 
ATOM   2928 C C   . ALA B 1 127 ? 32.530  23.879  38.856 1.00 78.78  ? 127  ALA B C   1 
ATOM   2929 O O   . ALA B 1 127 ? 32.217  23.001  39.658 1.00 82.99  ? 127  ALA B O   1 
ATOM   2930 C CB  . ALA B 1 127 ? 34.734  25.051  38.802 1.00 77.39  ? 127  ALA B CB  1 
ATOM   2931 N N   . ALA B 1 128 ? 31.702  24.844  38.470 1.00 78.03  ? 128  ALA B N   1 
ATOM   2932 C CA  . ALA B 1 128 ? 30.329  24.922  38.948 1.00 79.86  ? 128  ALA B CA  1 
ATOM   2933 C C   . ALA B 1 128 ? 29.619  23.578  38.822 1.00 80.78  ? 128  ALA B C   1 
ATOM   2934 O O   . ALA B 1 128 ? 29.128  23.040  39.814 1.00 85.61  ? 128  ALA B O   1 
ATOM   2935 C CB  . ALA B 1 128 ? 29.569  25.989  38.189 1.00 77.31  ? 128  ALA B CB  1 
ATOM   2936 N N   . SER B 1 129 ? 29.565  23.044  37.604 1.00 89.64  ? 129  SER B N   1 
ATOM   2937 C CA  . SER B 1 129 ? 28.870  21.788  37.344 1.00 90.05  ? 129  SER B CA  1 
ATOM   2938 C C   . SER B 1 129 ? 29.348  20.702  38.294 1.00 95.00  ? 129  SER B C   1 
ATOM   2939 O O   . SER B 1 129 ? 28.544  20.032  38.941 1.00 98.59  ? 129  SER B O   1 
ATOM   2940 C CB  . SER B 1 129 ? 29.108  21.340  35.906 1.00 84.80  ? 129  SER B CB  1 
ATOM   2941 O OG  . SER B 1 129 ? 29.231  22.453  35.043 1.00 80.38  ? 129  SER B OG  1 
ATOM   2942 N N   . LEU B 1 130 ? 30.662  20.526  38.369 1.00 79.28  ? 130  LEU B N   1 
ATOM   2943 C CA  . LEU B 1 130 ? 31.230  19.572  39.306 1.00 81.00  ? 130  LEU B CA  1 
ATOM   2944 C C   . LEU B 1 130 ? 30.709  19.855  40.709 1.00 78.42  ? 130  LEU B C   1 
ATOM   2945 O O   . LEU B 1 130 ? 30.037  19.015  41.299 1.00 82.17  ? 130  LEU B O   1 
ATOM   2946 C CB  . LEU B 1 130 ? 32.755  19.615  39.255 1.00 80.44  ? 130  LEU B CB  1 
ATOM   2947 C CG  . LEU B 1 130 ? 33.280  19.023  37.946 1.00 78.58  ? 130  LEU B CG  1 
ATOM   2948 C CD1 . LEU B 1 130 ? 34.742  19.350  37.746 1.00 77.15  ? 130  LEU B CD1 1 
ATOM   2949 C CD2 . LEU B 1 130 ? 33.052  17.520  37.909 1.00 79.88  ? 130  LEU B CD2 1 
ATOM   2950 N N   . ILE B 1 131 ? 30.995  21.046  41.229 1.00 85.14  ? 131  ILE B N   1 
ATOM   2951 C CA  . ILE B 1 131 ? 30.471  21.448  42.530 1.00 90.57  ? 131  ILE B CA  1 
ATOM   2952 C C   . ILE B 1 131 ? 29.013  21.034  42.669 1.00 91.99  ? 131  ILE B C   1 
ATOM   2953 O O   . ILE B 1 131 ? 28.674  20.246  43.544 1.00 97.10  ? 131  ILE B O   1 
ATOM   2954 C CB  . ILE B 1 131 ? 30.557  22.968  42.757 1.00 89.91  ? 131  ILE B CB  1 
ATOM   2955 C CG1 . ILE B 1 131 ? 31.965  23.483  42.471 1.00 87.81  ? 131  ILE B CG1 1 
ATOM   2956 C CG2 . ILE B 1 131 ? 30.161  23.309  44.184 1.00 96.20  ? 131  ILE B CG2 1 
ATOM   2957 C CD1 . ILE B 1 131 ? 32.949  23.181  43.567 1.00 93.02  ? 131  ILE B CD1 1 
ATOM   2958 N N   . TYR B 1 132 ? 28.150  21.560  41.805 1.00 92.82  ? 132  TYR B N   1 
ATOM   2959 C CA  . TYR B 1 132 ? 26.728  21.240  41.885 1.00 94.01  ? 132  TYR B CA  1 
ATOM   2960 C C   . TYR B 1 132 ? 26.468  19.735  41.842 1.00 95.73  ? 132  TYR B C   1 
ATOM   2961 O O   . TYR B 1 132 ? 25.650  19.216  42.599 1.00 100.09 ? 132  TYR B O   1 
ATOM   2962 C CB  . TYR B 1 132 ? 25.926  21.927  40.779 1.00 88.43  ? 132  TYR B CB  1 
ATOM   2963 C CG  . TYR B 1 132 ? 24.501  21.418  40.711 1.00 89.14  ? 132  TYR B CG  1 
ATOM   2964 C CD1 . TYR B 1 132 ? 23.441  22.181  41.185 1.00 90.49  ? 132  TYR B CD1 1 
ATOM   2965 C CD2 . TYR B 1 132 ? 24.220  20.157  40.195 1.00 88.67  ? 132  TYR B CD2 1 
ATOM   2966 C CE1 . TYR B 1 132 ? 22.141  21.710  41.132 1.00 91.24  ? 132  TYR B CE1 1 
ATOM   2967 C CE2 . TYR B 1 132 ? 22.924  19.675  40.142 1.00 89.48  ? 132  TYR B CE2 1 
ATOM   2968 C CZ  . TYR B 1 132 ? 21.888  20.455  40.611 1.00 90.78  ? 132  TYR B CZ  1 
ATOM   2969 O OH  . TYR B 1 132 ? 20.596  19.973  40.558 1.00 91.65  ? 132  TYR B OH  1 
ATOM   2970 N N   . ALA B 1 133 ? 27.152  19.043  40.937 1.00 102.44 ? 133  ALA B N   1 
ATOM   2971 C CA  . ALA B 1 133 ? 26.980  17.604  40.787 1.00 103.62 ? 133  ALA B CA  1 
ATOM   2972 C C   . ALA B 1 133 ? 27.291  16.872  42.087 1.00 110.33 ? 133  ALA B C   1 
ATOM   2973 O O   . ALA B 1 133 ? 26.517  16.024  42.529 1.00 113.87 ? 133  ALA B O   1 
ATOM   2974 C CB  . ALA B 1 133 ? 27.850  17.079  39.660 1.00 98.97  ? 133  ALA B CB  1 
ATOM   2975 N N   . ARG B 1 134 ? 28.424  17.198  42.701 1.00 86.28  ? 134  ARG B N   1 
ATOM   2976 C CA  . ARG B 1 134 ? 28.780  16.572  43.970 1.00 92.88  ? 134  ARG B CA  1 
ATOM   2977 C C   . ARG B 1 134 ? 28.022  17.154  45.155 1.00 98.15  ? 134  ARG B C   1 
ATOM   2978 O O   . ARG B 1 134 ? 27.772  16.459  46.133 1.00 103.96 ? 134  ARG B O   1 
ATOM   2979 C CB  . ARG B 1 134 ? 30.289  16.590  44.224 1.00 93.53  ? 134  ARG B CB  1 
ATOM   2980 C CG  . ARG B 1 134 ? 31.072  17.630  43.471 1.00 88.30  ? 134  ARG B CG  1 
ATOM   2981 C CD  . ARG B 1 134 ? 32.540  17.350  43.672 1.00 89.01  ? 134  ARG B CD  1 
ATOM   2982 N NE  . ARG B 1 134 ? 32.803  17.075  45.080 1.00 95.90  ? 134  ARG B NE  1 
ATOM   2983 C CZ  . ARG B 1 134 ? 33.750  16.257  45.528 1.00 98.59  ? 134  ARG B CZ  1 
ATOM   2984 N NH1 . ARG B 1 134 ? 34.536  15.616  44.678 1.00 94.87  ? 134  ARG B NH1 1 
ATOM   2985 N NH2 . ARG B 1 134 ? 33.905  16.072  46.832 1.00 105.13 ? 134  ARG B NH2 1 
ATOM   2986 N N   . PHE B 1 135 ? 27.633  18.418  45.059 1.00 102.08 ? 135  PHE B N   1 
ATOM   2987 C CA  . PHE B 1 135 ? 26.963  19.079  46.173 1.00 107.03 ? 135  PHE B CA  1 
ATOM   2988 C C   . PHE B 1 135 ? 25.514  18.626  46.351 1.00 109.14 ? 135  PHE B C   1 
ATOM   2989 O O   . PHE B 1 135 ? 25.049  18.442  47.472 1.00 115.31 ? 135  PHE B O   1 
ATOM   2990 C CB  . PHE B 1 135 ? 27.036  20.602  46.020 1.00 104.30 ? 135  PHE B CB  1 
ATOM   2991 C CG  . PHE B 1 135 ? 26.771  21.350  47.296 1.00 109.85 ? 135  PHE B CG  1 
ATOM   2992 C CD1 . PHE B 1 135 ? 27.671  21.284  48.348 1.00 115.02 ? 135  PHE B CD1 1 
ATOM   2993 C CD2 . PHE B 1 135 ? 25.627  22.119  47.445 1.00 110.01 ? 135  PHE B CD2 1 
ATOM   2994 C CE1 . PHE B 1 135 ? 27.434  21.967  49.530 1.00 120.45 ? 135  PHE B CE1 1 
ATOM   2995 C CE2 . PHE B 1 135 ? 25.384  22.806  48.624 1.00 115.26 ? 135  PHE B CE2 1 
ATOM   2996 C CZ  . PHE B 1 135 ? 26.290  22.729  49.669 1.00 120.59 ? 135  PHE B CZ  1 
ATOM   2997 N N   . THR B 1 136 ? 24.805  18.440  45.243 1.00 146.18 ? 136  THR B N   1 
ATOM   2998 C CA  . THR B 1 136 ? 23.378  18.133  45.305 1.00 147.67 ? 136  THR B CA  1 
ATOM   2999 C C   . THR B 1 136 ? 23.063  16.654  45.514 1.00 150.98 ? 136  THR B C   1 
ATOM   3000 O O   . THR B 1 136 ? 22.440  16.006  44.667 1.00 148.06 ? 136  THR B O   1 
ATOM   3001 C CB  . THR B 1 136 ? 22.612  18.658  44.072 1.00 141.23 ? 136  THR B CB  1 
ATOM   3002 O OG1 . THR B 1 136 ? 23.308  18.287  42.876 1.00 135.69 ? 136  THR B OG1 1 
ATOM   3003 C CG2 . THR B 1 136 ? 22.481  20.178  44.133 1.00 139.48 ? 136  THR B CG2 1 
ATOM   3004 N N   . ARG B 1 137 ? 23.490  16.138  46.661 1.00 148.94 ? 137  ARG B N   1 
ATOM   3005 C CA  . ARG B 1 137 ? 23.130  14.797  47.094 1.00 153.17 ? 137  ARG B CA  1 
ATOM   3006 C C   . ARG B 1 137 ? 22.570  14.869  48.506 1.00 160.62 ? 137  ARG B C   1 
ATOM   3007 O O   . ARG B 1 137 ? 23.291  15.082  49.475 1.00 165.37 ? 137  ARG B O   1 
ATOM   3008 C CB  . ARG B 1 137 ? 24.345  13.890  47.085 1.00 153.75 ? 137  ARG B CB  1 
ATOM   3009 C CG  . ARG B 1 137 ? 25.082  13.912  45.801 1.00 146.69 ? 137  ARG B CG  1 
ATOM   3010 C CD  . ARG B 1 137 ? 26.355  13.176  45.995 1.00 147.87 ? 137  ARG B CD  1 
ATOM   3011 N NE  . ARG B 1 137 ? 27.080  13.024  44.750 1.00 141.45 ? 137  ARG B NE  1 
ATOM   3012 C CZ  . ARG B 1 137 ? 28.082  12.172  44.594 1.00 141.29 ? 137  ARG B CZ  1 
ATOM   3013 N NH1 . ARG B 1 137 ? 28.459  11.400  45.609 1.00 147.16 ? 137  ARG B NH1 1 
ATOM   3014 N NH2 . ARG B 1 137 ? 28.702  12.087  43.425 1.00 135.42 ? 137  ARG B NH2 1 
ATOM   3015 N N   . PRO B 1 138 ? 20.699  14.104  48.360 1.00 122.12 ? 138  PRO B N   1 
ATOM   3016 C CA  . PRO B 1 138 ? 20.057  14.149  49.671 1.00 119.29 ? 138  PRO B CA  1 
ATOM   3017 C C   . PRO B 1 138 ? 20.448  12.887  50.403 1.00 115.86 ? 138  PRO B C   1 
ATOM   3018 O O   . PRO B 1 138 ? 21.097  12.037  49.801 1.00 114.62 ? 138  PRO B O   1 
ATOM   3019 C CB  . PRO B 1 138 ? 18.573  14.125  49.317 1.00 113.82 ? 138  PRO B CB  1 
ATOM   3020 C CG  . PRO B 1 138 ? 18.508  14.662  47.932 1.00 115.74 ? 138  PRO B CG  1 
ATOM   3021 C CD  . PRO B 1 138 ? 19.728  14.146  47.262 1.00 118.43 ? 138  PRO B CD  1 
ATOM   3022 N N   . THR B 1 139 ? 20.082  12.767  51.670 1.00 114.07 ? 139  THR B N   1 
ATOM   3023 C CA  . THR B 1 139 ? 20.258  11.513  52.379 1.00 110.69 ? 139  THR B CA  1 
ATOM   3024 C C   . THR B 1 139 ? 19.006  11.268  53.189 1.00 103.79 ? 139  THR B C   1 
ATOM   3025 O O   . THR B 1 139 ? 18.647  12.089  54.021 1.00 107.08 ? 139  THR B O   1 
ATOM   3026 C CB  . THR B 1 139 ? 21.467  11.553  53.331 1.00 116.85 ? 139  THR B CB  1 
ATOM   3027 O OG1 . THR B 1 139 ? 21.512  12.823  53.992 1.00 123.20 ? 139  THR B OG1 1 
ATOM   3028 C CG2 . THR B 1 139 ? 22.761  11.344  52.565 1.00 120.79 ? 139  THR B CG2 1 
ATOM   3029 N N   . ALA B 1 140 ? 18.326  10.156  52.935 1.00 96.76  ? 140  ALA B N   1 
ATOM   3030 C CA  . ALA B 1 140 ? 17.172  9.794   53.741 1.00 93.42  ? 140  ALA B CA  1 
ATOM   3031 C C   . ALA B 1 140 ? 17.550  9.909   55.212 1.00 96.58  ? 140  ALA B C   1 
ATOM   3032 O O   . ALA B 1 140 ? 18.564  9.360   55.648 1.00 99.42  ? 140  ALA B O   1 
ATOM   3033 C CB  . ALA B 1 140 ? 16.728  8.386   53.416 1.00 92.82  ? 140  ALA B CB  1 
ATOM   3034 N N   . GLY B 1 141 ? 16.747  10.637  55.977 1.00 108.59 ? 141  GLY B N   1 
ATOM   3035 C CA  . GLY B 1 141 ? 17.032  10.800  57.388 1.00 111.91 ? 141  GLY B CA  1 
ATOM   3036 C C   . GLY B 1 141 ? 16.706  9.533   58.151 1.00 104.24 ? 141  GLY B C   1 
ATOM   3037 O O   . GLY B 1 141 ? 16.303  9.587   59.307 1.00 103.85 ? 141  GLY B O   1 
ATOM   3038 N N   . VAL B 1 142 ? 16.899  8.385   57.510 1.00 114.47 ? 142  VAL B N   1 
ATOM   3039 C CA  . VAL B 1 142 ? 16.389  7.125   58.037 1.00 107.51 ? 142  VAL B CA  1 
ATOM   3040 C C   . VAL B 1 142 ? 17.359  6.359   58.932 1.00 108.96 ? 142  VAL B C   1 
ATOM   3041 O O   . VAL B 1 142 ? 18.523  6.164   58.585 1.00 112.85 ? 142  VAL B O   1 
ATOM   3042 C CB  . VAL B 1 142 ? 15.930  6.203   56.905 1.00 101.89 ? 142  VAL B CB  1 
ATOM   3043 C CG1 . VAL B 1 142 ? 15.259  4.969   57.473 1.00 96.81  ? 142  VAL B CG1 1 
ATOM   3044 C CG2 . VAL B 1 142 ? 14.977  6.943   56.001 1.00 101.29 ? 142  VAL B CG2 1 
ATOM   3045 N N   . LEU B 1 143 ? 16.851  5.915   60.078 1.00 98.99  ? 143  LEU B N   1 
ATOM   3046 C CA  . LEU B 1 143 ? 17.620  5.117   61.027 1.00 98.10  ? 143  LEU B CA  1 
ATOM   3047 C C   . LEU B 1 143 ? 17.104  3.677   61.079 1.00 93.89  ? 143  LEU B C   1 
ATOM   3048 O O   . LEU B 1 143 ? 15.897  3.452   61.151 1.00 91.32  ? 143  LEU B O   1 
ATOM   3049 C CB  . LEU B 1 143 ? 17.534  5.740   62.420 1.00 101.84 ? 143  LEU B CB  1 
ATOM   3050 C CG  . LEU B 1 143 ? 18.134  4.906   63.551 1.00 102.88 ? 143  LEU B CG  1 
ATOM   3051 C CD1 . LEU B 1 143 ? 19.653  4.919   63.464 1.00 109.91 ? 143  LEU B CD1 1 
ATOM   3052 C CD2 . LEU B 1 143 ? 17.665  5.416   64.901 1.00 105.03 ? 143  LEU B CD2 1 
ATOM   3053 N N   . PHE B 1 144 ? 18.016  2.708   61.056 1.00 106.95 ? 144  PHE B N   1 
ATOM   3054 C CA  . PHE B 1 144 ? 17.634  1.299   61.115 1.00 102.58 ? 144  PHE B CA  1 
ATOM   3055 C C   . PHE B 1 144 ? 17.823  0.716   62.505 1.00 103.73 ? 144  PHE B C   1 
ATOM   3056 O O   . PHE B 1 144 ? 18.869  0.904   63.128 1.00 108.10 ? 144  PHE B O   1 
ATOM   3057 C CB  . PHE B 1 144 ? 18.467  0.471   60.143 1.00 102.15 ? 144  PHE B CB  1 
ATOM   3058 C CG  . PHE B 1 144 ? 18.268  0.838   58.707 1.00 100.88 ? 144  PHE B CG  1 
ATOM   3059 C CD1 . PHE B 1 144 ? 18.864  1.970   58.177 1.00 104.95 ? 144  PHE B CD1 1 
ATOM   3060 C CD2 . PHE B 1 144 ? 17.497  0.043   57.879 1.00 96.98  ? 144  PHE B CD2 1 
ATOM   3061 C CE1 . PHE B 1 144 ? 18.685  2.308   56.846 1.00 104.20 ? 144  PHE B CE1 1 
ATOM   3062 C CE2 . PHE B 1 144 ? 17.318  0.376   56.546 1.00 96.20  ? 144  PHE B CE2 1 
ATOM   3063 C CZ  . PHE B 1 144 ? 17.912  1.510   56.031 1.00 99.36  ? 144  PHE B CZ  1 
ATOM   3064 N N   . SER B 1 145 ? 16.816  -0.006  62.983 1.00 117.84 ? 145  SER B N   1 
ATOM   3065 C CA  . SER B 1 145 ? 16.964  -0.746  64.224 1.00 119.15 ? 145  SER B CA  1 
ATOM   3066 C C   . SER B 1 145 ? 18.234  -1.578  64.123 1.00 120.52 ? 145  SER B C   1 
ATOM   3067 O O   . SER B 1 145 ? 18.456  -2.272  63.138 1.00 118.88 ? 145  SER B O   1 
ATOM   3068 C CB  . SER B 1 145 ? 15.745  -1.635  64.488 1.00 117.90 ? 145  SER B CB  1 
ATOM   3069 O OG  . SER B 1 145 ? 15.471  -2.493  63.394 1.00 116.28 ? 145  SER B OG  1 
ATOM   3070 N N   . SER B 1 146 ? 19.080  -1.486  65.139 1.00 128.71 ? 146  SER B N   1 
ATOM   3071 C CA  . SER B 1 146 ? 20.359  -2.179  65.132 1.00 131.71 ? 146  SER B CA  1 
ATOM   3072 C C   . SER B 1 146 ? 20.183  -3.690  65.040 1.00 129.30 ? 146  SER B C   1 
ATOM   3073 O O   . SER B 1 146 ? 21.091  -4.403  64.616 1.00 130.82 ? 146  SER B O   1 
ATOM   3074 C CB  . SER B 1 146 ? 21.148  -1.825  66.392 1.00 137.58 ? 146  SER B CB  1 
ATOM   3075 O OG  . SER B 1 146 ? 20.371  -2.058  67.556 1.00 136.51 ? 146  SER B OG  1 
ATOM   3076 N N   . ARG B 1 147 ? 19.014  -4.176  65.439 1.00 143.63 ? 147  ARG B N   1 
ATOM   3077 C CA  . ARG B 1 147 ? 18.754  -5.608  65.451 1.00 143.44 ? 147  ARG B CA  1 
ATOM   3078 C C   . ARG B 1 147 ? 17.487  -5.955  64.701 1.00 141.49 ? 147  ARG B C   1 
ATOM   3079 O O   . ARG B 1 147 ? 16.644  -5.096  64.443 1.00 140.13 ? 147  ARG B O   1 
ATOM   3080 C CB  . ARG B 1 147 ? 18.596  -6.114  66.885 1.00 146.13 ? 147  ARG B CB  1 
ATOM   3081 C CG  . ARG B 1 147 ? 19.845  -6.064  67.733 1.00 149.57 ? 147  ARG B CG  1 
ATOM   3082 C CD  . ARG B 1 147 ? 20.903  -7.024  67.223 1.00 151.11 ? 147  ARG B CD  1 
ATOM   3083 N NE  . ARG B 1 147 ? 22.184  -6.770  67.872 1.00 155.96 ? 147  ARG B NE  1 
ATOM   3084 C CZ  . ARG B 1 147 ? 22.893  -5.659  67.696 1.00 158.74 ? 147  ARG B CZ  1 
ATOM   3085 N NH1 . ARG B 1 147 ? 22.440  -4.702  66.896 1.00 156.16 ? 147  ARG B NH1 1 
ATOM   3086 N NH2 . ARG B 1 147 ? 24.050  -5.497  68.323 1.00 165.49 ? 147  ARG B NH2 1 
ATOM   3087 N N   . MET B 1 148 ? 17.364  -7.232  64.358 1.00 119.51 ? 148  MET B N   1 
ATOM   3088 C CA  . MET B 1 148 ? 16.092  -7.791  63.945 1.00 120.99 ? 148  MET B CA  1 
ATOM   3089 C C   . MET B 1 148 ? 15.620  -8.662  65.084 1.00 125.63 ? 148  MET B C   1 
ATOM   3090 O O   . MET B 1 148 ? 16.376  -8.950  66.011 1.00 126.59 ? 148  MET B O   1 
ATOM   3091 C CB  . MET B 1 148 ? 16.245  -8.657  62.702 1.00 121.14 ? 148  MET B CB  1 
ATOM   3092 C CG  . MET B 1 148 ? 17.161  -8.086  61.655 1.00 117.54 ? 148  MET B CG  1 
ATOM   3093 S SD  . MET B 1 148 ? 16.936  -8.933  60.082 1.00 117.88 ? 148  MET B SD  1 
ATOM   3094 C CE  . MET B 1 148 ? 15.287  -8.394  59.647 1.00 118.84 ? 148  MET B CE  1 
ATOM   3095 N N   . VAL B 1 149 ? 14.365  -9.079  65.022 1.00 116.29 ? 149  VAL B N   1 
ATOM   3096 C CA  . VAL B 1 149 ? 13.854  -10.032 65.986 1.00 122.85 ? 149  VAL B CA  1 
ATOM   3097 C C   . VAL B 1 149 ? 12.941  -11.005 65.266 1.00 129.47 ? 149  VAL B C   1 
ATOM   3098 O O   . VAL B 1 149 ? 12.303  -10.657 64.273 1.00 129.38 ? 149  VAL B O   1 
ATOM   3099 C CB  . VAL B 1 149 ? 13.066  -9.347  67.115 1.00 125.08 ? 149  VAL B CB  1 
ATOM   3100 C CG1 . VAL B 1 149 ? 13.694  -8.018  67.464 1.00 119.02 ? 149  VAL B CG1 1 
ATOM   3101 C CG2 . VAL B 1 149 ? 11.622  -9.144  66.708 1.00 129.85 ? 149  VAL B CG2 1 
ATOM   3102 N N   . ILE B 1 150 ? 12.905  -12.234 65.756 1.00 111.48 ? 150  ILE B N   1 
ATOM   3103 C CA  . ILE B 1 150 ? 11.941  -13.198 65.271 1.00 121.19 ? 150  ILE B CA  1 
ATOM   3104 C C   . ILE B 1 150 ? 11.014  -13.502 66.431 1.00 130.73 ? 150  ILE B C   1 
ATOM   3105 O O   . ILE B 1 150 ? 11.441  -13.950 67.482 1.00 132.04 ? 150  ILE B O   1 
ATOM   3106 C CB  . ILE B 1 150 ? 12.612  -14.469 64.754 1.00 123.90 ? 150  ILE B CB  1 
ATOM   3107 C CG1 . ILE B 1 150 ? 13.501  -14.131 63.559 1.00 115.28 ? 150  ILE B CG1 1 
ATOM   3108 C CG2 . ILE B 1 150 ? 11.567  -15.486 64.350 1.00 136.56 ? 150  ILE B CG2 1 
ATOM   3109 C CD1 . ILE B 1 150 ? 14.081  -15.318 62.855 1.00 118.17 ? 150  ILE B CD1 1 
ATOM   3110 N N   . SER B 1 151 ? 9.740   -13.197 66.260 1.00 131.58 ? 151  SER B N   1 
ATOM   3111 C CA  . SER B 1 151 ? 8.771   -13.376 67.323 1.00 142.23 ? 151  SER B CA  1 
ATOM   3112 C C   . SER B 1 151 ? 7.384   -13.553 66.739 1.00 154.36 ? 151  SER B C   1 
ATOM   3113 O O   . SER B 1 151 ? 7.132   -13.199 65.594 1.00 152.19 ? 151  SER B O   1 
ATOM   3114 C CB  . SER B 1 151 ? 8.786   -12.180 68.272 1.00 136.09 ? 151  SER B CB  1 
ATOM   3115 O OG  . SER B 1 151 ? 7.854   -11.202 67.865 1.00 137.09 ? 151  SER B OG  1 
ATOM   3116 N N   . ASP B 1 152 ? 6.490   -14.111 67.544 1.00 174.54 ? 152  ASP B N   1 
ATOM   3117 C CA  . ASP B 1 152 ? 5.120   -14.348 67.129 1.00 187.75 ? 152  ASP B CA  1 
ATOM   3118 C C   . ASP B 1 152 ? 4.340   -13.060 67.053 1.00 184.97 ? 152  ASP B C   1 
ATOM   3119 O O   . ASP B 1 152 ? 4.205   -12.346 68.038 1.00 186.82 ? 152  ASP B O   1 
ATOM   3120 C CB  . ASP B 1 152 ? 4.423   -15.277 68.119 1.00 202.49 ? 152  ASP B CB  1 
ATOM   3121 C CG  . ASP B 1 152 ? 4.787   -16.722 67.911 1.00 208.47 ? 152  ASP B CG  1 
ATOM   3122 O OD1 . ASP B 1 152 ? 5.936   -16.994 67.513 1.00 201.47 ? 152  ASP B OD1 1 
ATOM   3123 O OD2 . ASP B 1 152 ? 3.920   -17.589 68.138 1.00 220.60 ? 152  ASP B OD2 1 
ATOM   3124 N N   . PHE B 1 153 ? 3.825   -12.770 65.872 1.00 193.09 ? 153  PHE B N   1 
ATOM   3125 C CA  . PHE B 1 153 ? 2.871   -11.699 65.717 1.00 192.99 ? 153  PHE B CA  1 
ATOM   3126 C C   . PHE B 1 153 ? 1.699   -12.278 64.955 1.00 197.54 ? 153  PHE B C   1 
ATOM   3127 O O   . PHE B 1 153 ? 1.879   -13.014 63.987 1.00 192.64 ? 153  PHE B O   1 
ATOM   3128 C CB  . PHE B 1 153 ? 3.500   -10.522 64.981 1.00 180.79 ? 153  PHE B CB  1 
ATOM   3129 C CG  . PHE B 1 153 ? 2.507   -9.542  64.453 1.00 180.27 ? 153  PHE B CG  1 
ATOM   3130 C CD1 . PHE B 1 153 ? 2.181   -8.409  65.170 1.00 180.48 ? 153  PHE B CD1 1 
ATOM   3131 C CD2 . PHE B 1 153 ? 1.904   -9.751  63.230 1.00 180.44 ? 153  PHE B CD2 1 
ATOM   3132 C CE1 . PHE B 1 153 ? 1.273   -7.509  64.676 1.00 180.61 ? 153  PHE B CE1 1 
ATOM   3133 C CE2 . PHE B 1 153 ? 0.999   -8.853  62.735 1.00 180.69 ? 153  PHE B CE2 1 
ATOM   3134 C CZ  . PHE B 1 153 ? 0.680   -7.731  63.458 1.00 180.72 ? 153  PHE B CZ  1 
ATOM   3135 N N   . GLU B 1 154 ? 0.495   -11.975 65.416 1.00 232.73 ? 154  GLU B N   1 
ATOM   3136 C CA  . GLU B 1 154 ? -0.701  -12.460 64.755 1.00 231.36 ? 154  GLU B CA  1 
ATOM   3137 C C   . GLU B 1 154 ? -0.585  -13.929 64.373 1.00 231.72 ? 154  GLU B C   1 
ATOM   3138 O O   . GLU B 1 154 ? -0.894  -14.313 63.249 1.00 226.65 ? 154  GLU B O   1 
ATOM   3139 C CB  . GLU B 1 154 ? -0.941  -11.632 63.506 1.00 222.58 ? 154  GLU B CB  1 
ATOM   3140 C CG  . GLU B 1 154 ? -2.378  -11.281 63.270 1.00 223.56 ? 154  GLU B CG  1 
ATOM   3141 C CD  . GLU B 1 154 ? -2.522  -9.818  62.956 1.00 219.99 ? 154  GLU B CD  1 
ATOM   3142 O OE1 . GLU B 1 154 ? -1.566  -9.252  62.393 1.00 214.70 ? 154  GLU B OE1 1 
ATOM   3143 O OE2 . GLU B 1 154 ? -3.569  -9.228  63.285 1.00 223.06 ? 154  GLU B OE2 1 
ATOM   3144 N N   . GLY B 1 155 ? -0.103  -14.740 65.304 1.00 219.02 ? 155  GLY B N   1 
ATOM   3145 C CA  . GLY B 1 155 ? -0.174  -16.182 65.168 1.00 222.35 ? 155  GLY B CA  1 
ATOM   3146 C C   . GLY B 1 155 ? 0.763   -16.859 64.188 1.00 216.46 ? 155  GLY B C   1 
ATOM   3147 O O   . GLY B 1 155 ? 0.563   -18.019 63.846 1.00 218.73 ? 155  GLY B O   1 
ATOM   3148 N N   . LYS B 1 156 ? 1.782   -16.149 63.729 1.00 160.65 ? 156  LYS B N   1 
ATOM   3149 C CA  . LYS B 1 156 ? 2.844   -16.773 62.956 1.00 156.75 ? 156  LYS B CA  1 
ATOM   3150 C C   . LYS B 1 156 ? 4.138   -16.085 63.329 1.00 154.57 ? 156  LYS B C   1 
ATOM   3151 O O   . LYS B 1 156 ? 4.159   -14.874 63.500 1.00 152.23 ? 156  LYS B O   1 
ATOM   3152 C CB  . LYS B 1 156 ? 2.576   -16.634 61.458 1.00 149.70 ? 156  LYS B CB  1 
ATOM   3153 N N   . PRO B 1 157 ? 5.224   -16.847 63.472 1.00 163.69 ? 157  PRO B N   1 
ATOM   3154 C CA  . PRO B 1 157 ? 6.489   -16.191 63.794 1.00 158.22 ? 157  PRO B CA  1 
ATOM   3155 C C   . PRO B 1 157 ? 6.797   -15.171 62.719 1.00 146.93 ? 157  PRO B C   1 
ATOM   3156 O O   . PRO B 1 157 ? 6.625   -15.438 61.544 1.00 145.87 ? 157  PRO B O   1 
ATOM   3157 C CB  . PRO B 1 157 ? 7.497   -17.337 63.744 1.00 159.34 ? 157  PRO B CB  1 
ATOM   3158 C CG  . PRO B 1 157 ? 6.699   -18.556 63.931 1.00 170.06 ? 157  PRO B CG  1 
ATOM   3159 C CD  . PRO B 1 157 ? 5.379   -18.297 63.305 1.00 167.54 ? 157  PRO B CD  1 
ATOM   3160 N N   . THR B 1 158 ? 7.214   -13.987 63.119 1.00 146.01 ? 158  THR B N   1 
ATOM   3161 C CA  . THR B 1 158 ? 7.536   -12.973 62.139 1.00 136.37 ? 158  THR B CA  1 
ATOM   3162 C C   . THR B 1 158 ? 8.904   -12.365 62.377 1.00 121.99 ? 158  THR B C   1 
ATOM   3163 O O   . THR B 1 158 ? 9.237   -11.954 63.486 1.00 118.15 ? 158  THR B O   1 
ATOM   3164 C CB  . THR B 1 158 ? 6.483   -11.857 62.096 1.00 136.13 ? 158  THR B CB  1 
ATOM   3165 O OG1 . THR B 1 158 ? 5.176   -12.435 61.980 1.00 145.19 ? 158  THR B OG1 1 
ATOM   3166 C CG2 . THR B 1 158 ? 6.739   -10.955 60.905 1.00 127.93 ? 158  THR B CG2 1 
ATOM   3167 N N   . LEU B 1 159 ? 9.697   -12.331 61.315 1.00 127.03 ? 159  LEU B N   1 
ATOM   3168 C CA  . LEU B 1 159 ? 10.941  -11.596 61.315 1.00 114.32 ? 159  LEU B CA  1 
ATOM   3169 C C   . LEU B 1 159 ? 10.583  -10.134 61.139 1.00 108.69 ? 159  LEU B C   1 
ATOM   3170 O O   . LEU B 1 159 ? 9.808   -9.786  60.250 1.00 110.92 ? 159  LEU B O   1 
ATOM   3171 C CB  . LEU B 1 159 ? 11.817  -12.049 60.150 1.00 110.40 ? 159  LEU B CB  1 
ATOM   3172 C CG  . LEU B 1 159 ? 13.173  -11.354 60.010 1.00 99.85  ? 159  LEU B CG  1 
ATOM   3173 C CD1 . LEU B 1 159 ? 14.067  -11.713 61.188 1.00 98.97  ? 159  LEU B CD1 1 
ATOM   3174 C CD2 . LEU B 1 159 ? 13.835  -11.719 58.686 1.00 97.67  ? 159  LEU B CD2 1 
ATOM   3175 N N   . MET B 1 160 ? 11.126  -9.277  61.994 1.00 125.95 ? 160  MET B N   1 
ATOM   3176 C CA  . MET B 1 160 ? 10.927  -7.845  61.824 1.00 120.74 ? 160  MET B CA  1 
ATOM   3177 C C   . MET B 1 160 ? 12.133  -7.004  62.207 1.00 112.85 ? 160  MET B C   1 
ATOM   3178 O O   . MET B 1 160 ? 13.024  -7.446  62.932 1.00 111.91 ? 160  MET B O   1 
ATOM   3179 C CB  . MET B 1 160 ? 9.677   -7.358  62.565 1.00 126.00 ? 160  MET B CB  1 
ATOM   3180 C CG  . MET B 1 160 ? 9.312   -8.146  63.802 1.00 133.16 ? 160  MET B CG  1 
ATOM   3181 S SD  . MET B 1 160 ? 7.563   -7.921  64.191 1.00 144.61 ? 160  MET B SD  1 
ATOM   3182 C CE  . MET B 1 160 ? 7.236   -9.384  65.167 1.00 156.38 ? 160  MET B CE  1 
ATOM   3183 N N   . MET B 1 161 ? 12.151  -5.792  61.669 1.00 138.07 ? 161  MET B N   1 
ATOM   3184 C CA  . MET B 1 161 ? 13.052  -4.736  62.094 1.00 133.40 ? 161  MET B CA  1 
ATOM   3185 C C   . MET B 1 161 ? 12.274  -3.449  61.879 1.00 132.77 ? 161  MET B C   1 
ATOM   3186 O O   . MET B 1 161 ? 11.134  -3.495  61.414 1.00 135.78 ? 161  MET B O   1 
ATOM   3187 C CB  . MET B 1 161 ? 14.364  -4.754  61.301 1.00 129.74 ? 161  MET B CB  1 
ATOM   3188 C CG  . MET B 1 161 ? 14.235  -5.023  59.805 1.00 128.95 ? 161  MET B CG  1 
ATOM   3189 S SD  . MET B 1 161 ? 13.965  -3.549  58.791 1.00 126.27 ? 161  MET B SD  1 
ATOM   3190 C CE  . MET B 1 161 ? 14.816  -2.301  59.765 1.00 125.32 ? 161  MET B CE  1 
ATOM   3191 N N   . ARG B 1 162 ? 12.852  -2.306  62.223 1.00 102.21 ? 162  ARG B N   1 
ATOM   3192 C CA  . ARG B 1 162 ? 12.104  -1.067  62.053 1.00 102.33 ? 162  ARG B CA  1 
ATOM   3193 C C   . ARG B 1 162 ? 12.923  0.162   61.684 1.00 100.17 ? 162  ARG B C   1 
ATOM   3194 O O   . ARG B 1 162 ? 14.085  0.303   62.069 1.00 99.97  ? 162  ARG B O   1 
ATOM   3195 C CB  . ARG B 1 162 ? 11.245  -0.786  63.281 1.00 105.62 ? 162  ARG B CB  1 
ATOM   3196 C CG  . ARG B 1 162 ? 11.989  -0.835  64.592 1.00 105.91 ? 162  ARG B CG  1 
ATOM   3197 C CD  . ARG B 1 162 ? 11.021  -0.559  65.718 1.00 109.61 ? 162  ARG B CD  1 
ATOM   3198 N NE  . ARG B 1 162 ? 11.678  -0.402  67.007 1.00 110.27 ? 162  ARG B NE  1 
ATOM   3199 C CZ  . ARG B 1 162 ? 11.047  -0.023  68.111 1.00 113.52 ? 162  ARG B CZ  1 
ATOM   3200 N NH1 . ARG B 1 162 ? 9.748   0.238   68.074 1.00 116.77 ? 162  ARG B NH1 1 
ATOM   3201 N NH2 . ARG B 1 162 ? 11.713  0.097   69.248 1.00 114.44 ? 162  ARG B NH2 1 
ATOM   3202 N N   . LEU B 1 163 ? 12.283  1.048   60.928 1.00 95.33  ? 163  LEU B N   1 
ATOM   3203 C CA  . LEU B 1 163 ? 12.894  2.284   60.472 1.00 94.97  ? 163  LEU B CA  1 
ATOM   3204 C C   . LEU B 1 163 ? 12.292  3.462   61.204 1.00 97.17  ? 163  LEU B C   1 
ATOM   3205 O O   . LEU B 1 163 ? 11.085  3.507   61.432 1.00 98.48  ? 163  LEU B O   1 
ATOM   3206 C CB  . LEU B 1 163 ? 12.609  2.489   58.989 1.00 93.88  ? 163  LEU B CB  1 
ATOM   3207 C CG  . LEU B 1 163 ? 12.830  1.340   58.017 1.00 92.25  ? 163  LEU B CG  1 
ATOM   3208 C CD1 . LEU B 1 163 ? 11.818  1.435   56.891 1.00 92.69  ? 163  LEU B CD1 1 
ATOM   3209 C CD2 . LEU B 1 163 ? 14.249  1.378   57.486 1.00 91.49  ? 163  LEU B CD2 1 
ATOM   3210 N N   . ALA B 1 164 ? 13.128  4.430   61.548 1.00 92.67  ? 164  ALA B N   1 
ATOM   3211 C CA  . ALA B 1 164 ? 12.630  5.693   62.064 1.00 95.56  ? 164  ALA B CA  1 
ATOM   3212 C C   . ALA B 1 164 ? 13.121  6.836   61.187 1.00 92.14  ? 164  ALA B C   1 
ATOM   3213 O O   . ALA B 1 164 ? 14.308  6.920   60.869 1.00 93.98  ? 164  ALA B O   1 
ATOM   3214 C CB  . ALA B 1 164 ? 13.063  5.898   63.511 1.00 98.34  ? 164  ALA B CB  1 
ATOM   3215 N N   . ASN B 1 165 ? 12.193  7.696   60.786 1.00 91.14  ? 165  ASN B N   1 
ATOM   3216 C CA  . ASN B 1 165 ? 12.513  8.923   60.073 1.00 91.15  ? 165  ASN B CA  1 
ATOM   3217 C C   . ASN B 1 165 ? 13.128  9.922   61.043 1.00 94.74  ? 165  ASN B C   1 
ATOM   3218 O O   . ASN B 1 165 ? 12.559  10.198  62.091 1.00 95.98  ? 165  ASN B O   1 
ATOM   3219 C CB  . ASN B 1 165 ? 11.236  9.499   59.460 1.00 90.98  ? 165  ASN B CB  1 
ATOM   3220 C CG  . ASN B 1 165 ? 11.450  10.851  58.805 1.00 93.05  ? 165  ASN B CG  1 
ATOM   3221 O OD1 . ASN B 1 165 ? 12.536  11.424  58.869 1.00 91.87  ? 165  ASN B OD1 1 
ATOM   3222 N ND2 . ASN B 1 165 ? 10.406  11.367  58.165 1.00 91.11  ? 165  ASN B ND2 1 
ATOM   3223 N N   . LEU B 1 166 ? 14.289  10.466  60.700 1.00 98.86  ? 166  LEU B N   1 
ATOM   3224 C CA  . LEU B 1 166 ? 15.016  11.329  61.627 1.00 96.91  ? 166  LEU B CA  1 
ATOM   3225 C C   . LEU B 1 166 ? 14.717  12.808  61.450 1.00 100.33 ? 166  LEU B C   1 
ATOM   3226 O O   . LEU B 1 166 ? 15.219  13.639  62.203 1.00 108.62 ? 166  LEU B O   1 
ATOM   3227 C CB  . LEU B 1 166 ? 16.524  11.097  61.518 1.00 99.09  ? 166  LEU B CB  1 
ATOM   3228 C CG  . LEU B 1 166 ? 16.980  9.805   62.188 1.00 96.36  ? 166  LEU B CG  1 
ATOM   3229 C CD1 . LEU B 1 166 ? 18.492  9.722   62.249 1.00 102.99 ? 166  LEU B CD1 1 
ATOM   3230 C CD2 . LEU B 1 166 ? 16.384  9.734   63.577 1.00 99.98  ? 166  LEU B CD2 1 
ATOM   3231 N N   . ARG B 1 167 ? 13.905  13.139  60.455 1.00 99.52  ? 167  ARG B N   1 
ATOM   3232 C CA  . ARG B 1 167 ? 13.584  14.534  60.181 1.00 106.20 ? 167  ARG B CA  1 
ATOM   3233 C C   . ARG B 1 167 ? 12.087  14.792  60.247 1.00 102.46 ? 167  ARG B C   1 
ATOM   3234 O O   . ARG B 1 167 ? 11.280  13.868  60.175 1.00 95.27  ? 167  ARG B O   1 
ATOM   3235 C CB  . ARG B 1 167 ? 14.109  14.943  58.808 1.00 109.50 ? 167  ARG B CB  1 
ATOM   3236 C CG  . ARG B 1 167 ? 15.587  14.742  58.627 1.00 115.24 ? 167  ARG B CG  1 
ATOM   3237 C CD  . ARG B 1 167 ? 15.941  14.822  57.167 1.00 116.53 ? 167  ARG B CD  1 
ATOM   3238 N NE  . ARG B 1 167 ? 17.368  15.017  56.966 1.00 126.73 ? 167  ARG B NE  1 
ATOM   3239 C CZ  . ARG B 1 167 ? 18.058  14.447  55.989 1.00 126.00 ? 167  ARG B CZ  1 
ATOM   3240 N NH1 . ARG B 1 167 ? 17.436  13.635  55.151 1.00 115.89 ? 167  ARG B NH1 1 
ATOM   3241 N NH2 . ARG B 1 167 ? 19.360  14.671  55.860 1.00 131.47 ? 167  ARG B NH2 1 
ATOM   3242 N N   . ILE B 1 168 ? 11.731  16.064  60.372 1.00 116.23 ? 168  ILE B N   1 
ATOM   3243 C CA  . ILE B 1 168 ? 10.341  16.483  60.455 1.00 114.87 ? 168  ILE B CA  1 
ATOM   3244 C C   . ILE B 1 168 ? 9.629   16.275  59.122 1.00 110.81 ? 168  ILE B C   1 
ATOM   3245 O O   . ILE B 1 168 ? 8.430   16.004  59.085 1.00 107.71 ? 168  ILE B O   1 
ATOM   3246 C CB  . ILE B 1 168 ? 10.236  17.970  60.844 1.00 124.13 ? 168  ILE B CB  1 
ATOM   3247 C CG1 . ILE B 1 168 ? 11.444  18.399  61.687 1.00 132.13 ? 168  ILE B CG1 1 
ATOM   3248 C CG2 . ILE B 1 168 ? 8.936   18.234  61.583 1.00 123.53 ? 168  ILE B CG2 1 
ATOM   3249 C CD1 . ILE B 1 168 ? 12.756  18.532  60.903 1.00 137.40 ? 168  ILE B CD1 1 
ATOM   3250 N N   . GLU B 1 169 ? 10.379  16.407  58.031 1.00 141.89 ? 169  GLU B N   1 
ATOM   3251 C CA  . GLU B 1 169 ? 9.834   16.246  56.686 1.00 138.74 ? 169  GLU B CA  1 
ATOM   3252 C C   . GLU B 1 169 ? 9.409   14.799  56.446 1.00 130.43 ? 169  GLU B C   1 
ATOM   3253 O O   . GLU B 1 169 ? 9.917   13.882  57.092 1.00 127.11 ? 169  GLU B O   1 
ATOM   3254 C CB  . GLU B 1 169 ? 10.856  16.693  55.637 1.00 143.14 ? 169  GLU B CB  1 
ATOM   3255 C CG  . GLU B 1 169 ? 11.206  18.175  55.701 1.00 153.80 ? 169  GLU B CG  1 
ATOM   3256 C CD  . GLU B 1 169 ? 12.034  18.544  56.922 1.00 160.25 ? 169  GLU B CD  1 
ATOM   3257 O OE1 . GLU B 1 169 ? 12.555  17.633  57.600 1.00 156.50 ? 169  GLU B OE1 1 
ATOM   3258 O OE2 . GLU B 1 169 ? 12.175  19.754  57.200 1.00 170.10 ? 169  GLU B OE2 1 
ATOM   3259 N N   . GLN B 1 170 ? 8.476   14.596  55.522 1.00 138.07 ? 170  GLN B N   1 
ATOM   3260 C CA  . GLN B 1 170 ? 7.904   13.271  55.308 1.00 132.63 ? 170  GLN B CA  1 
ATOM   3261 C C   . GLN B 1 170 ? 8.440   12.613  54.048 1.00 129.67 ? 170  GLN B C   1 
ATOM   3262 O O   . GLN B 1 170 ? 8.877   13.291  53.120 1.00 132.04 ? 170  GLN B O   1 
ATOM   3263 C CB  . GLN B 1 170 ? 6.388   13.373  55.219 1.00 134.39 ? 170  GLN B CB  1 
ATOM   3264 C CG  . GLN B 1 170 ? 5.827   14.539  55.998 1.00 139.49 ? 170  GLN B CG  1 
ATOM   3265 C CD  . GLN B 1 170 ? 4.436   14.260  56.509 1.00 141.53 ? 170  GLN B CD  1 
ATOM   3266 O OE1 . GLN B 1 170 ? 3.516   14.005  55.732 1.00 143.13 ? 170  GLN B OE1 1 
ATOM   3267 N NE2 . GLN B 1 170 ? 4.274   14.299  57.826 1.00 142.78 ? 170  GLN B NE2 1 
ATOM   3268 N N   . ILE B 1 171 ? 8.401   11.289  54.012 1.00 104.51 ? 171  ILE B N   1 
ATOM   3269 C CA  . ILE B 1 171 ? 8.837   10.568  52.828 1.00 101.93 ? 171  ILE B CA  1 
ATOM   3270 C C   . ILE B 1 171 ? 7.640   9.916   52.149 1.00 101.71 ? 171  ILE B C   1 
ATOM   3271 O O   . ILE B 1 171 ? 6.884   9.180   52.775 1.00 101.91 ? 171  ILE B O   1 
ATOM   3272 C CB  . ILE B 1 171 ? 9.910   9.531   53.173 1.00 98.55  ? 171  ILE B CB  1 
ATOM   3273 C CG1 . ILE B 1 171 ? 11.015  10.195  53.996 1.00 101.00 ? 171  ILE B CG1 1 
ATOM   3274 C CG2 . ILE B 1 171 ? 10.477  8.911   51.909 1.00 96.71  ? 171  ILE B CG2 1 
ATOM   3275 C CD1 . ILE B 1 171 ? 12.214  9.311   54.249 1.00 99.25  ? 171  ILE B CD1 1 
ATOM   3276 N N   . ILE B 1 172 ? 7.460   10.200  50.865 1.00 112.09 ? 172  ILE B N   1 
ATOM   3277 C CA  . ILE B 1 172 ? 6.258   9.762   50.171 1.00 114.17 ? 172  ILE B CA  1 
ATOM   3278 C C   . ILE B 1 172 ? 6.483   8.528   49.308 1.00 112.14 ? 172  ILE B C   1 
ATOM   3279 O O   . ILE B 1 172 ? 7.554   8.342   48.726 1.00 109.35 ? 172  ILE B O   1 
ATOM   3280 C CB  . ILE B 1 172 ? 5.649   10.887  49.324 1.00 118.27 ? 172  ILE B CB  1 
ATOM   3281 C CG1 . ILE B 1 172 ? 6.644   11.336  48.251 1.00 117.42 ? 172  ILE B CG1 1 
ATOM   3282 C CG2 . ILE B 1 172 ? 5.240   12.046  50.220 1.00 121.58 ? 172  ILE B CG2 1 
ATOM   3283 C CD1 . ILE B 1 172 ? 5.996   11.759  46.950 1.00 120.75 ? 172  ILE B CD1 1 
ATOM   3284 N N   . GLU B 1 173 ? 5.446   7.700   49.228 1.00 139.76 ? 173  GLU B N   1 
ATOM   3285 C CA  . GLU B 1 173 ? 5.529   6.402   48.576 1.00 139.42 ? 173  GLU B CA  1 
ATOM   3286 C C   . GLU B 1 173 ? 6.857   5.750   48.919 1.00 133.77 ? 173  GLU B C   1 
ATOM   3287 O O   . GLU B 1 173 ? 7.608   5.325   48.041 1.00 131.51 ? 173  GLU B O   1 
ATOM   3288 C CB  . GLU B 1 173 ? 5.353   6.527   47.066 1.00 141.19 ? 173  GLU B CB  1 
ATOM   3289 C CG  . GLU B 1 173 ? 6.462   7.290   46.374 1.00 137.58 ? 173  GLU B CG  1 
ATOM   3290 C CD  . GLU B 1 173 ? 6.306   7.305   44.871 1.00 139.62 ? 173  GLU B CD  1 
ATOM   3291 O OE1 . GLU B 1 173 ? 5.257   6.839   44.374 1.00 144.31 ? 173  GLU B OE1 1 
ATOM   3292 O OE2 . GLU B 1 173 ? 7.234   7.784   44.186 1.00 137.79 ? 173  GLU B OE2 1 
ATOM   3293 N N   . ALA B 1 174 ? 7.144   5.703   50.214 1.00 91.27  ? 174  ALA B N   1 
ATOM   3294 C CA  . ALA B 1 174 ? 8.322   5.020   50.708 1.00 87.65  ? 174  ALA B CA  1 
ATOM   3295 C C   . ALA B 1 174 ? 8.060   3.527   50.620 1.00 87.88  ? 174  ALA B C   1 
ATOM   3296 O O   . ALA B 1 174 ? 6.924   3.087   50.762 1.00 87.10  ? 174  ALA B O   1 
ATOM   3297 C CB  . ALA B 1 174 ? 8.607   5.434   52.144 1.00 88.88  ? 174  ALA B CB  1 
ATOM   3298 N N   . ASP B 1 175 ? 9.102   2.747   50.365 1.00 145.90 ? 175  ASP B N   1 
ATOM   3299 C CA  . ASP B 1 175 ? 8.957   1.299   50.349 1.00 147.26 ? 175  ASP B CA  1 
ATOM   3300 C C   . ASP B 1 175 ? 10.274  0.604   50.650 1.00 143.48 ? 175  ASP B C   1 
ATOM   3301 O O   . ASP B 1 175 ? 11.349  1.187   50.498 1.00 140.62 ? 175  ASP B O   1 
ATOM   3302 C CB  . ASP B 1 175 ? 8.366   0.814   49.025 1.00 150.77 ? 175  ASP B CB  1 
ATOM   3303 C CG  . ASP B 1 175 ? 9.320   0.974   47.867 1.00 147.63 ? 175  ASP B CG  1 
ATOM   3304 O OD1 . ASP B 1 175 ? 10.543  0.814   48.062 1.00 143.82 ? 175  ASP B OD1 1 
ATOM   3305 O OD2 . ASP B 1 175 ? 8.842   1.252   46.750 1.00 149.90 ? 175  ASP B OD2 1 
ATOM   3306 N N   . VAL B 1 176 ? 10.184  -0.649  51.072 1.00 90.13  ? 176  VAL B N   1 
ATOM   3307 C CA  . VAL B 1 176 ? 11.344  -1.339  51.605 1.00 87.33  ? 176  VAL B CA  1 
ATOM   3308 C C   . VAL B 1 176 ? 11.432  -2.796  51.134 1.00 89.40  ? 176  VAL B C   1 
ATOM   3309 O O   . VAL B 1 176 ? 10.417  -3.451  50.930 1.00 86.01  ? 176  VAL B O   1 
ATOM   3310 C CB  . VAL B 1 176 ? 11.346  -1.246  53.149 1.00 87.05  ? 176  VAL B CB  1 
ATOM   3311 C CG1 . VAL B 1 176 ? 10.284  -2.146  53.729 1.00 91.84  ? 176  VAL B CG1 1 
ATOM   3312 C CG2 . VAL B 1 176 ? 12.713  -1.587  53.713 1.00 84.29  ? 176  VAL B CG2 1 
ATOM   3313 N N   . HIS B 1 177 ? 12.655  -3.282  50.946 1.00 137.56 ? 177  HIS B N   1 
ATOM   3314 C CA  . HIS B 1 177 ? 12.891  -4.663  50.545 1.00 139.62 ? 177  HIS B CA  1 
ATOM   3315 C C   . HIS B 1 177 ? 13.692  -5.388  51.602 1.00 138.78 ? 177  HIS B C   1 
ATOM   3316 O O   . HIS B 1 177 ? 14.726  -4.894  52.051 1.00 135.72 ? 177  HIS B O   1 
ATOM   3317 C CB  . HIS B 1 177 ? 13.680  -4.721  49.244 1.00 138.22 ? 177  HIS B CB  1 
ATOM   3318 C CG  . HIS B 1 177 ? 12.908  -4.281  48.044 1.00 139.91 ? 177  HIS B CG  1 
ATOM   3319 N ND1 . HIS B 1 177 ? 12.224  -5.169  47.236 1.00 144.59 ? 177  HIS B ND1 1 
ATOM   3320 C CD2 . HIS B 1 177 ? 12.724  -3.058  47.503 1.00 138.58 ? 177  HIS B CD2 1 
ATOM   3321 C CE1 . HIS B 1 177 ? 11.648  -4.501  46.255 1.00 145.75 ? 177  HIS B CE1 1 
ATOM   3322 N NE2 . HIS B 1 177 ? 11.933  -3.222  46.388 1.00 141.88 ? 177  HIS B NE2 1 
ATOM   3323 N N   . LEU B 1 178 ? 13.226  -6.568  51.988 1.00 127.04 ? 178  LEU B N   1 
ATOM   3324 C CA  . LEU B 1 178 ? 13.956  -7.380  52.943 1.00 126.95 ? 178  LEU B CA  1 
ATOM   3325 C C   . LEU B 1 178 ? 14.523  -8.589  52.232 1.00 128.90 ? 178  LEU B C   1 
ATOM   3326 O O   . LEU B 1 178 ? 13.799  -9.525  51.913 1.00 134.56 ? 178  LEU B O   1 
ATOM   3327 C CB  . LEU B 1 178 ? 13.049  -7.817  54.086 1.00 131.31 ? 178  LEU B CB  1 
ATOM   3328 C CG  . LEU B 1 178 ? 13.824  -8.301  55.307 1.00 130.43 ? 178  LEU B CG  1 
ATOM   3329 C CD1 . LEU B 1 178 ? 15.154  -7.567  55.408 1.00 124.80 ? 178  LEU B CD1 1 
ATOM   3330 C CD2 . LEU B 1 178 ? 12.998  -8.113  56.566 1.00 133.12 ? 178  LEU B CD2 1 
ATOM   3331 N N   . VAL B 1 179 ? 15.822  -8.573  51.978 1.00 85.68  ? 179  VAL B N   1 
ATOM   3332 C CA  . VAL B 1 179 ? 16.416  -9.649  51.209 1.00 87.74  ? 179  VAL B CA  1 
ATOM   3333 C C   . VAL B 1 179 ? 17.364  -10.533 52.014 1.00 88.68  ? 179  VAL B C   1 
ATOM   3334 O O   . VAL B 1 179 ? 18.346  -10.071 52.595 1.00 86.32  ? 179  VAL B O   1 
ATOM   3335 C CB  . VAL B 1 179 ? 17.086  -9.124  49.935 1.00 85.63  ? 179  VAL B CB  1 
ATOM   3336 C CG1 . VAL B 1 179 ? 17.783  -10.249 49.201 1.00 88.13  ? 179  VAL B CG1 1 
ATOM   3337 C CG2 . VAL B 1 179 ? 16.038  -8.490  49.047 1.00 86.14  ? 179  VAL B CG2 1 
ATOM   3338 N N   . LEU B 1 180 ? 17.028  -11.815 52.047 1.00 84.91  ? 180  LEU B N   1 
ATOM   3339 C CA  . LEU B 1 180 ? 17.870  -12.834 52.642 1.00 87.00  ? 180  LEU B CA  1 
ATOM   3340 C C   . LEU B 1 180 ? 18.936  -13.257 51.642 1.00 86.89  ? 180  LEU B C   1 
ATOM   3341 O O   . LEU B 1 180 ? 18.620  -13.594 50.503 1.00 88.94  ? 180  LEU B O   1 
ATOM   3342 C CB  . LEU B 1 180 ? 17.015  -14.047 53.007 1.00 94.20  ? 180  LEU B CB  1 
ATOM   3343 C CG  . LEU B 1 180 ? 17.726  -15.401 53.016 1.00 98.65  ? 180  LEU B CG  1 
ATOM   3344 C CD1 . LEU B 1 180 ? 18.703  -15.495 54.179 1.00 96.67  ? 180  LEU B CD1 1 
ATOM   3345 C CD2 . LEU B 1 180 ? 16.715  -16.531 53.073 1.00 108.01 ? 180  LEU B CD2 1 
ATOM   3346 N N   . VAL B 1 181 ? 20.196  -13.233 52.058 1.00 89.91  ? 181  VAL B N   1 
ATOM   3347 C CA  . VAL B 1 181 ? 21.262  -13.767 51.226 1.00 91.63  ? 181  VAL B CA  1 
ATOM   3348 C C   . VAL B 1 181 ? 21.935  -14.927 51.948 1.00 95.36  ? 181  VAL B C   1 
ATOM   3349 O O   . VAL B 1 181 ? 22.345  -14.795 53.101 1.00 95.07  ? 181  VAL B O   1 
ATOM   3350 C CB  . VAL B 1 181 ? 22.302  -12.693 50.848 1.00 89.51  ? 181  VAL B CB  1 
ATOM   3351 C CG1 . VAL B 1 181 ? 23.329  -13.274 49.890 1.00 92.66  ? 181  VAL B CG1 1 
ATOM   3352 C CG2 . VAL B 1 181 ? 21.620  -11.491 50.223 1.00 86.23  ? 181  VAL B CG2 1 
ATOM   3353 N N   . ARG B 1 182 ? 22.038  -16.065 51.268 1.00 101.56 ? 182  ARG B N   1 
ATOM   3354 C CA  . ARG B 1 182 ? 22.619  -17.259 51.872 1.00 106.13 ? 182  ARG B CA  1 
ATOM   3355 C C   . ARG B 1 182 ? 23.151  -18.227 50.822 1.00 110.45 ? 182  ARG B C   1 
ATOM   3356 O O   . ARG B 1 182 ? 22.778  -18.148 49.646 1.00 110.47 ? 182  ARG B O   1 
ATOM   3357 C CB  . ARG B 1 182 ? 21.580  -17.980 52.717 1.00 109.63 ? 182  ARG B CB  1 
ATOM   3358 C CG  . ARG B 1 182 ? 20.526  -18.656 51.885 1.00 114.59 ? 182  ARG B CG  1 
ATOM   3359 C CD  . ARG B 1 182 ? 19.705  -19.611 52.705 1.00 119.41 ? 182  ARG B CD  1 
ATOM   3360 N NE  . ARG B 1 182 ? 18.675  -20.218 51.879 1.00 121.65 ? 182  ARG B NE  1 
ATOM   3361 C CZ  . ARG B 1 182 ? 17.492  -20.604 52.335 1.00 125.26 ? 182  ARG B CZ  1 
ATOM   3362 N NH1 . ARG B 1 182 ? 17.190  -20.439 53.615 1.00 126.48 ? 182  ARG B NH1 1 
ATOM   3363 N NH2 . ARG B 1 182 ? 16.608  -21.147 51.511 1.00 128.91 ? 182  ARG B NH2 1 
ATOM   3364 N N   . SER B 1 183 ? 24.009  -19.145 51.267 1.00 111.02 ? 183  SER B N   1 
ATOM   3365 C CA  . SER B 1 183 ? 24.650  -20.115 50.387 1.00 116.09 ? 183  SER B CA  1 
ATOM   3366 C C   . SER B 1 183 ? 23.750  -21.326 50.181 1.00 122.44 ? 183  SER B C   1 
ATOM   3367 O O   . SER B 1 183 ? 23.038  -21.746 51.098 1.00 124.70 ? 183  SER B O   1 
ATOM   3368 C CB  . SER B 1 183 ? 25.989  -20.559 50.975 1.00 119.70 ? 183  SER B CB  1 
ATOM   3369 O OG  . SER B 1 183 ? 26.727  -19.449 51.456 1.00 113.98 ? 183  SER B OG  1 
ATOM   3370 N N   . GLU B 1 184 ? 23.775  -21.872 48.969 1.00 133.61 ? 184  GLU B N   1 
ATOM   3371 C CA  . GLU B 1 184 ? 22.954  -23.028 48.637 1.00 140.08 ? 184  GLU B CA  1 
ATOM   3372 C C   . GLU B 1 184 ? 23.711  -24.024 47.769 1.00 147.31 ? 184  GLU B C   1 
ATOM   3373 O O   . GLU B 1 184 ? 24.762  -23.711 47.216 1.00 146.79 ? 184  GLU B O   1 
ATOM   3374 C CB  . GLU B 1 184 ? 21.677  -22.592 47.915 1.00 137.18 ? 184  GLU B CB  1 
ATOM   3375 C CG  . GLU B 1 184 ? 20.884  -21.526 48.650 1.00 131.06 ? 184  GLU B CG  1 
ATOM   3376 C CD  . GLU B 1 184 ? 19.434  -21.457 48.204 1.00 131.36 ? 184  GLU B CD  1 
ATOM   3377 O OE1 . GLU B 1 184 ? 19.176  -21.404 46.982 1.00 131.50 ? 184  GLU B OE1 1 
ATOM   3378 O OE2 . GLU B 1 184 ? 18.549  -21.447 49.084 1.00 131.93 ? 184  GLU B OE2 1 
ATOM   3379 N N   . ILE B 1 185 ? 23.168  -25.229 47.654 1.00 134.50 ? 185  ILE B N   1 
ATOM   3380 C CA  . ILE B 1 185 ? 23.745  -26.237 46.779 1.00 142.66 ? 185  ILE B CA  1 
ATOM   3381 C C   . ILE B 1 185 ? 22.747  -26.610 45.703 1.00 144.28 ? 185  ILE B C   1 
ATOM   3382 O O   . ILE B 1 185 ? 21.595  -26.925 45.998 1.00 144.82 ? 185  ILE B O   1 
ATOM   3383 C CB  . ILE B 1 185 ? 24.140  -27.504 47.545 1.00 152.40 ? 185  ILE B CB  1 
ATOM   3384 C CG1 . ILE B 1 185 ? 25.271  -27.184 48.511 1.00 151.88 ? 185  ILE B CG1 1 
ATOM   3385 C CG2 . ILE B 1 185 ? 24.591  -28.589 46.580 1.00 162.39 ? 185  ILE B CG2 1 
ATOM   3386 C CD1 . ILE B 1 185 ? 26.422  -26.496 47.838 1.00 148.96 ? 185  ILE B CD1 1 
ATOM   3387 N N   . SER B 1 186 ? 23.193  -26.557 44.455 1.00 134.22 ? 186  SER B N   1 
ATOM   3388 C CA  . SER B 1 186 ? 22.377  -26.990 43.334 1.00 137.19 ? 186  SER B CA  1 
ATOM   3389 C C   . SER B 1 186 ? 22.349  -28.515 43.294 1.00 148.39 ? 186  SER B C   1 
ATOM   3390 O O   . SER B 1 186 ? 23.188  -29.167 43.918 1.00 153.25 ? 186  SER B O   1 
ATOM   3391 C CB  . SER B 1 186 ? 22.960  -26.442 42.036 1.00 135.60 ? 186  SER B CB  1 
ATOM   3392 O OG  . SER B 1 186 ? 22.291  -26.977 40.914 1.00 139.70 ? 186  SER B OG  1 
ATOM   3393 N N   . GLN B 1 187 ? 21.382  -29.087 42.581 1.00 166.24 ? 187  GLN B N   1 
ATOM   3394 C CA  . GLN B 1 187 ? 21.372  -30.530 42.370 1.00 172.72 ? 187  GLN B CA  1 
ATOM   3395 C C   . GLN B 1 187 ? 22.706  -30.927 41.752 1.00 173.35 ? 187  GLN B C   1 
ATOM   3396 O O   . GLN B 1 187 ? 23.312  -31.928 42.135 1.00 178.63 ? 187  GLN B O   1 
ATOM   3397 C CB  . GLN B 1 187 ? 20.225  -30.950 41.447 1.00 174.35 ? 187  GLN B CB  1 
ATOM   3398 C CG  . GLN B 1 187 ? 18.828  -30.664 41.986 1.00 175.17 ? 187  GLN B CG  1 
ATOM   3399 C CD  . GLN B 1 187 ? 17.734  -31.066 41.008 1.00 177.18 ? 187  GLN B CD  1 
ATOM   3400 O OE1 . GLN B 1 187 ? 17.991  -31.757 40.021 1.00 178.64 ? 187  GLN B OE1 1 
ATOM   3401 N NE2 . GLN B 1 187 ? 16.507  -30.634 41.280 1.00 173.62 ? 187  GLN B NE2 1 
ATOM   3402 N N   . GLU B 1 188 ? 23.159  -30.119 40.797 1.00 176.93 ? 188  GLU B N   1 
ATOM   3403 C CA  . GLU B 1 188 ? 24.446  -30.321 40.138 1.00 172.71 ? 188  GLU B CA  1 
ATOM   3404 C C   . GLU B 1 188 ? 25.602  -30.072 41.097 1.00 170.42 ? 188  GLU B C   1 
ATOM   3405 O O   . GLU B 1 188 ? 26.763  -30.285 40.750 1.00 165.62 ? 188  GLU B O   1 
ATOM   3406 C CB  . GLU B 1 188 ? 24.587  -29.390 38.929 1.00 167.15 ? 188  GLU B CB  1 
ATOM   3407 C CG  . GLU B 1 188 ? 23.552  -29.595 37.833 1.00 169.30 ? 188  GLU B CG  1 
ATOM   3408 C CD  . GLU B 1 188 ? 22.208  -28.983 38.172 1.00 170.02 ? 188  GLU B CD  1 
ATOM   3409 O OE1 . GLU B 1 188 ? 22.175  -28.022 38.965 1.00 166.87 ? 188  GLU B OE1 1 
ATOM   3410 O OE2 . GLU B 1 188 ? 21.185  -29.458 37.638 1.00 172.39 ? 188  GLU B OE2 1 
ATOM   3411 N N   . GLY B 1 189 ? 25.284  -29.600 42.297 1.00 157.09 ? 189  GLY B N   1 
ATOM   3412 C CA  . GLY B 1 189 ? 26.294  -29.372 43.312 1.00 156.28 ? 189  GLY B CA  1 
ATOM   3413 C C   . GLY B 1 189 ? 27.124  -28.114 43.124 1.00 149.71 ? 189  GLY B C   1 
ATOM   3414 O O   . GLY B 1 189 ? 28.290  -28.074 43.517 1.00 146.86 ? 189  GLY B O   1 
ATOM   3415 N N   . MET B 1 190 ? 26.542  -27.087 42.516 1.00 139.80 ? 190  MET B N   1 
ATOM   3416 C CA  . MET B 1 190 ? 27.180  -25.779 42.513 1.00 134.13 ? 190  MET B CA  1 
ATOM   3417 C C   . MET B 1 190 ? 26.840  -25.113 43.840 1.00 129.30 ? 190  MET B C   1 
ATOM   3418 O O   . MET B 1 190 ? 25.670  -25.051 44.217 1.00 126.09 ? 190  MET B O   1 
ATOM   3419 C CB  . MET B 1 190 ? 26.681  -24.932 41.341 1.00 129.37 ? 190  MET B CB  1 
ATOM   3420 N N   . VAL B 1 191 ? 27.852  -24.639 44.563 1.00 170.13 ? 191  VAL B N   1 
ATOM   3421 C CA  . VAL B 1 191 ? 27.612  -23.965 45.841 1.00 163.71 ? 191  VAL B CA  1 
ATOM   3422 C C   . VAL B 1 191 ? 27.708  -22.442 45.717 1.00 153.22 ? 191  VAL B C   1 
ATOM   3423 O O   . VAL B 1 191 ? 28.793  -21.865 45.785 1.00 151.48 ? 191  VAL B O   1 
ATOM   3424 C CB  . VAL B 1 191 ? 28.539  -24.485 46.969 1.00 169.28 ? 191  VAL B CB  1 
ATOM   3425 C CG1 . VAL B 1 191 ? 30.004  -24.313 46.604 1.00 172.18 ? 191  VAL B CG1 1 
ATOM   3426 C CG2 . VAL B 1 191 ? 28.214  -23.793 48.286 1.00 162.86 ? 191  VAL B CG2 1 
ATOM   3427 N N   . PHE B 1 192 ? 26.555  -21.801 45.546 1.00 135.17 ? 192  PHE B N   1 
ATOM   3428 C CA  . PHE B 1 192 ? 26.490  -20.377 45.227 1.00 126.46 ? 192  PHE B CA  1 
ATOM   3429 C C   . PHE B 1 192 ? 25.776  -19.551 46.297 1.00 120.27 ? 192  PHE B C   1 
ATOM   3430 O O   . PHE B 1 192 ? 25.179  -20.098 47.226 1.00 122.38 ? 192  PHE B O   1 
ATOM   3431 C CB  . PHE B 1 192 ? 25.765  -20.190 43.894 1.00 125.53 ? 192  PHE B CB  1 
ATOM   3432 C CG  . PHE B 1 192 ? 24.374  -20.771 43.877 1.00 127.68 ? 192  PHE B CG  1 
ATOM   3433 C CD1 . PHE B 1 192 ? 23.271  -19.977 44.154 1.00 122.57 ? 192  PHE B CD1 1 
ATOM   3434 C CD2 . PHE B 1 192 ? 24.170  -22.112 43.591 1.00 135.62 ? 192  PHE B CD2 1 
ATOM   3435 C CE1 . PHE B 1 192 ? 21.987  -20.509 44.141 1.00 125.16 ? 192  PHE B CE1 1 
ATOM   3436 C CE2 . PHE B 1 192 ? 22.889  -22.650 43.579 1.00 137.81 ? 192  PHE B CE2 1 
ATOM   3437 C CZ  . PHE B 1 192 ? 21.797  -21.846 43.855 1.00 132.48 ? 192  PHE B CZ  1 
ATOM   3438 N N   . ARG B 1 193 ? 25.841  -18.230 46.152 1.00 128.42 ? 193  ARG B N   1 
ATOM   3439 C CA  . ARG B 1 193 ? 25.073  -17.314 46.990 1.00 123.08 ? 193  ARG B CA  1 
ATOM   3440 C C   . ARG B 1 193 ? 23.790  -16.933 46.265 1.00 121.85 ? 193  ARG B C   1 
ATOM   3441 O O   . ARG B 1 193 ? 23.832  -16.483 45.125 1.00 120.38 ? 193  ARG B O   1 
ATOM   3442 C CB  . ARG B 1 193 ? 25.875  -16.041 47.275 1.00 117.05 ? 193  ARG B CB  1 
ATOM   3443 C CG  . ARG B 1 193 ? 27.043  -16.219 48.227 1.00 117.81 ? 193  ARG B CG  1 
ATOM   3444 C CD  . ARG B 1 193 ? 26.568  -16.362 49.664 1.00 117.97 ? 193  ARG B CD  1 
ATOM   3445 N NE  . ARG B 1 193 ? 26.240  -15.078 50.278 1.00 111.95 ? 193  ARG B NE  1 
ATOM   3446 C CZ  . ARG B 1 193 ? 25.765  -14.946 51.513 1.00 111.41 ? 193  ARG B CZ  1 
ATOM   3447 N NH1 . ARG B 1 193 ? 25.557  -16.024 52.256 1.00 116.23 ? 193  ARG B NH1 1 
ATOM   3448 N NH2 . ARG B 1 193 ? 25.494  -13.742 52.007 1.00 106.68 ? 193  ARG B NH2 1 
ATOM   3449 N N   . ARG B 1 194 ? 22.647  -17.098 46.919 1.00 138.19 ? 194  ARG B N   1 
ATOM   3450 C CA  . ARG B 1 194 ? 21.377  -16.704 46.319 1.00 137.50 ? 194  ARG B CA  1 
ATOM   3451 C C   . ARG B 1 194 ? 20.658  -15.635 47.130 1.00 132.95 ? 194  ARG B C   1 
ATOM   3452 O O   . ARG B 1 194 ? 20.797  -15.567 48.347 1.00 131.67 ? 194  ARG B O   1 
ATOM   3453 C CB  . ARG B 1 194 ? 20.459  -17.910 46.134 1.00 144.58 ? 194  ARG B CB  1 
ATOM   3454 C CG  . ARG B 1 194 ? 19.256  -17.619 45.254 1.00 146.50 ? 194  ARG B CG  1 
ATOM   3455 C CD  . ARG B 1 194 ? 18.317  -18.802 45.209 1.00 153.96 ? 194  ARG B CD  1 
ATOM   3456 N NE  . ARG B 1 194 ? 17.706  -18.961 43.895 1.00 158.32 ? 194  ARG B NE  1 
ATOM   3457 C CZ  . ARG B 1 194 ? 17.294  -20.127 43.414 1.00 163.54 ? 194  ARG B CZ  1 
ATOM   3458 N NH1 . ARG B 1 194 ? 17.436  -21.226 44.143 1.00 164.54 ? 194  ARG B NH1 1 
ATOM   3459 N NH2 . ARG B 1 194 ? 16.747  -20.200 42.208 1.00 168.59 ? 194  ARG B NH2 1 
ATOM   3460 N N   . PHE B 1 195 ? 19.885  -14.805 46.438 1.00 124.76 ? 195  PHE B N   1 
ATOM   3461 C CA  . PHE B 1 195 ? 19.093  -13.762 47.074 1.00 121.14 ? 195  PHE B CA  1 
ATOM   3462 C C   . PHE B 1 195 ? 17.619  -14.176 47.104 1.00 125.79 ? 195  PHE B C   1 
ATOM   3463 O O   . PHE B 1 195 ? 17.064  -14.586 46.088 1.00 130.14 ? 195  PHE B O   1 
ATOM   3464 C CB  . PHE B 1 195 ? 19.229  -12.442 46.302 1.00 116.88 ? 195  PHE B CB  1 
ATOM   3465 C CG  . PHE B 1 195 ? 20.621  -11.843 46.320 1.00 114.58 ? 195  PHE B CG  1 
ATOM   3466 C CD1 . PHE B 1 195 ? 20.797  -10.478 46.515 1.00 111.36 ? 195  PHE B CD1 1 
ATOM   3467 C CD2 . PHE B 1 195 ? 21.749  -12.633 46.126 1.00 117.31 ? 195  PHE B CD2 1 
ATOM   3468 C CE1 . PHE B 1 195 ? 22.071  -9.909  46.523 1.00 112.09 ? 195  PHE B CE1 1 
ATOM   3469 C CE2 . PHE B 1 195 ? 23.030  -12.070 46.135 1.00 117.68 ? 195  PHE B CE2 1 
ATOM   3470 C CZ  . PHE B 1 195 ? 23.188  -10.708 46.334 1.00 115.66 ? 195  PHE B CZ  1 
ATOM   3471 N N   . HIS B 1 196 ? 16.988  -14.072 48.268 1.00 115.00 ? 196  HIS B N   1 
ATOM   3472 C CA  . HIS B 1 196 ? 15.549  -14.285 48.372 1.00 121.10 ? 196  HIS B CA  1 
ATOM   3473 C C   . HIS B 1 196 ? 14.868  -13.022 48.871 1.00 117.22 ? 196  HIS B C   1 
ATOM   3474 O O   . HIS B 1 196 ? 15.102  -12.599 50.003 1.00 113.74 ? 196  HIS B O   1 
ATOM   3475 C CB  . HIS B 1 196 ? 15.236  -15.411 49.356 1.00 127.98 ? 196  HIS B CB  1 
ATOM   3476 C CG  . HIS B 1 196 ? 15.555  -16.778 48.845 1.00 133.80 ? 196  HIS B CG  1 
ATOM   3477 N ND1 . HIS B 1 196 ? 16.791  -17.366 49.012 1.00 131.70 ? 196  HIS B ND1 1 
ATOM   3478 C CD2 . HIS B 1 196 ? 14.792  -17.690 48.194 1.00 139.11 ? 196  HIS B CD2 1 
ATOM   3479 C CE1 . HIS B 1 196 ? 16.777  -18.575 48.476 1.00 134.95 ? 196  HIS B CE1 1 
ATOM   3480 N NE2 . HIS B 1 196 ? 15.579  -18.792 47.974 1.00 139.55 ? 196  HIS B NE2 1 
ATOM   3481 N N   . ASP B 1 197 ? 14.028  -12.412 48.043 1.00 228.79 ? 197  ASP B N   1 
ATOM   3482 C CA  . ASP B 1 197 ? 13.211  -11.313 48.534 1.00 226.88 ? 197  ASP B CA  1 
ATOM   3483 C C   . ASP B 1 197 ? 12.128  -11.932 49.413 1.00 235.06 ? 197  ASP B C   1 
ATOM   3484 O O   . ASP B 1 197 ? 11.488  -12.906 49.024 1.00 244.65 ? 197  ASP B O   1 
ATOM   3485 C CB  . ASP B 1 197 ? 12.609  -10.503 47.383 1.00 226.73 ? 197  ASP B CB  1 
ATOM   3486 C CG  . ASP B 1 197 ? 12.441  -9.027  47.731 1.00 220.93 ? 197  ASP B CG  1 
ATOM   3487 O OD1 . ASP B 1 197 ? 11.995  -8.727  48.860 1.00 221.19 ? 197  ASP B OD1 1 
ATOM   3488 O OD2 . ASP B 1 197 ? 12.757  -8.165  46.879 1.00 216.85 ? 197  ASP B OD2 1 
ATOM   3489 N N   . LEU B 1 198 ? 11.949  -11.382 50.610 1.00 103.12 ? 198  LEU B N   1 
ATOM   3490 C CA  . LEU B 1 198 ? 11.040  -11.956 51.599 1.00 111.42 ? 198  LEU B CA  1 
ATOM   3491 C C   . LEU B 1 198 ? 9.731   -11.178 51.657 1.00 115.95 ? 198  LEU B C   1 
ATOM   3492 O O   . LEU B 1 198 ? 9.733   -9.983  51.945 1.00 109.33 ? 198  LEU B O   1 
ATOM   3493 C CB  . LEU B 1 198 ? 11.696  -11.955 52.984 1.00 107.11 ? 198  LEU B CB  1 
ATOM   3494 C CG  . LEU B 1 198 ? 13.073  -12.609 53.120 1.00 103.01 ? 198  LEU B CG  1 
ATOM   3495 C CD1 . LEU B 1 198 ? 13.559  -12.566 54.562 1.00 100.54 ? 198  LEU B CD1 1 
ATOM   3496 C CD2 . LEU B 1 198 ? 13.037  -14.038 52.609 1.00 111.28 ? 198  LEU B CD2 1 
ATOM   3497 N N   . THR B 1 199 ? 8.615   -11.853 51.395 1.00 129.19 ? 199  THR B N   1 
ATOM   3498 C CA  . THR B 1 199 ? 7.313   -11.192 51.398 1.00 134.38 ? 199  THR B CA  1 
ATOM   3499 C C   . THR B 1 199 ? 7.065   -10.467 52.708 1.00 131.06 ? 199  THR B C   1 
ATOM   3500 O O   . THR B 1 199 ? 7.094   -11.074 53.778 1.00 132.37 ? 199  THR B O   1 
ATOM   3501 C CB  . THR B 1 199 ? 6.159   -12.184 51.208 1.00 144.36 ? 199  THR B CB  1 
ATOM   3502 O OG1 . THR B 1 199 ? 6.512   -13.155 50.220 1.00 148.85 ? 199  THR B OG1 1 
ATOM   3503 C CG2 . THR B 1 199 ? 4.908   -11.453 50.765 1.00 148.74 ? 199  THR B CG2 1 
ATOM   3504 N N   . LEU B 1 200 ? 6.813   -9.167  52.619 1.00 128.88 ? 200  LEU B N   1 
ATOM   3505 C CA  . LEU B 1 200 ? 6.503   -8.372  53.797 1.00 126.72 ? 200  LEU B CA  1 
ATOM   3506 C C   . LEU B 1 200 ? 4.998   -8.187  53.898 1.00 133.83 ? 200  LEU B C   1 
ATOM   3507 O O   . LEU B 1 200 ? 4.315   -8.053  52.882 1.00 137.64 ? 200  LEU B O   1 
ATOM   3508 C CB  . LEU B 1 200 ? 7.185   -7.006  53.718 1.00 114.25 ? 200  LEU B CB  1 
ATOM   3509 C CG  . LEU B 1 200 ? 8.698   -7.008  53.518 1.00 103.79 ? 200  LEU B CG  1 
ATOM   3510 C CD1 . LEU B 1 200 ? 9.211   -5.585  53.501 1.00 95.16  ? 200  LEU B CD1 1 
ATOM   3511 C CD2 . LEU B 1 200 ? 9.380   -7.821  54.608 1.00 103.28 ? 200  LEU B CD2 1 
ATOM   3512 N N   . THR B 1 201 ? 4.478   -8.184  55.121 1.00 124.25 ? 201  THR B N   1 
ATOM   3513 C CA  . THR B 1 201 ? 3.064   -7.905  55.317 1.00 130.99 ? 201  THR B CA  1 
ATOM   3514 C C   . THR B 1 201 ? 2.754   -6.515  54.776 1.00 128.50 ? 201  THR B C   1 
ATOM   3515 O O   . THR B 1 201 ? 1.643   -6.249  54.330 1.00 134.29 ? 201  THR B O   1 
ATOM   3516 C CB  . THR B 1 201 ? 2.647   -7.983  56.798 1.00 134.14 ? 201  THR B CB  1 
ATOM   3517 O OG1 . THR B 1 201 ? 2.900   -6.729  57.442 1.00 129.23 ? 201  THR B OG1 1 
ATOM   3518 C CG2 . THR B 1 201 ? 3.408   -9.078  57.515 1.00 134.27 ? 201  THR B CG2 1 
ATOM   3519 N N   . ARG B 1 202 ? 3.743   -5.630  54.809 1.00 194.07 ? 202  ARG B N   1 
ATOM   3520 C CA  . ARG B 1 202 ? 3.555   -4.290  54.275 1.00 191.99 ? 202  ARG B CA  1 
ATOM   3521 C C   . ARG B 1 202 ? 4.835   -3.739  53.663 1.00 178.45 ? 202  ARG B C   1 
ATOM   3522 O O   . ARG B 1 202 ? 5.793   -3.434  54.369 1.00 169.85 ? 202  ARG B O   1 
ATOM   3523 C CB  . ARG B 1 202 ? 3.031   -3.355  55.357 1.00 192.77 ? 202  ARG B CB  1 
ATOM   3524 C CG  . ARG B 1 202 ? 2.626   -2.000  54.837 1.00 190.29 ? 202  ARG B CG  1 
ATOM   3525 C CD  . ARG B 1 202 ? 2.087   -1.146  55.959 1.00 191.66 ? 202  ARG B CD  1 
ATOM   3526 N NE  . ARG B 1 202 ? 1.997   0.257   55.576 1.00 186.97 ? 202  ARG B NE  1 
ATOM   3527 C CZ  . ARG B 1 202 ? 0.962   0.788   54.934 1.00 194.26 ? 202  ARG B CZ  1 
ATOM   3528 N NH1 . ARG B 1 202 ? -0.072  0.027   54.598 1.00 205.62 ? 202  ARG B NH1 1 
ATOM   3529 N NH2 . ARG B 1 202 ? 0.962   2.079   54.627 1.00 189.85 ? 202  ARG B NH2 1 
ATOM   3530 N N   . SER B 1 203 ? 4.827   -3.605  52.342 1.00 157.29 ? 203  SER B N   1 
ATOM   3531 C CA  . SER B 1 203 ? 6.020   -3.262  51.580 1.00 147.21 ? 203  SER B CA  1 
ATOM   3532 C C   . SER B 1 203 ? 5.997   -1.815  51.089 1.00 142.58 ? 203  SER B C   1 
ATOM   3533 O O   . SER B 1 203 ? 7.040   -1.215  50.827 1.00 134.52 ? 203  SER B O   1 
ATOM   3534 C CB  . SER B 1 203 ? 6.157   -4.226  50.401 1.00 150.59 ? 203  SER B CB  1 
ATOM   3535 O OG  . SER B 1 203 ? 7.133   -3.783  49.478 1.00 142.67 ? 203  SER B OG  1 
ATOM   3536 N N   . ARG B 1 204 ? 4.796   -1.266  50.959 1.00 144.69 ? 204  ARG B N   1 
ATOM   3537 C CA  . ARG B 1 204 ? 4.620   0.136   50.611 1.00 141.78 ? 204  ARG B CA  1 
ATOM   3538 C C   . ARG B 1 204 ? 4.089   0.917   51.795 1.00 142.96 ? 204  ARG B C   1 
ATOM   3539 O O   . ARG B 1 204 ? 3.266   0.423   52.557 1.00 150.25 ? 204  ARG B O   1 
ATOM   3540 C CB  . ARG B 1 204 ? 3.629   0.284   49.461 1.00 149.18 ? 204  ARG B CB  1 
ATOM   3541 C CG  . ARG B 1 204 ? 4.234   0.762   48.162 1.00 144.16 ? 204  ARG B CG  1 
ATOM   3542 C CD  . ARG B 1 204 ? 4.786   2.176   48.286 1.00 137.28 ? 204  ARG B CD  1 
ATOM   3543 N NE  . ARG B 1 204 ? 5.040   2.760   46.972 1.00 135.68 ? 204  ARG B NE  1 
ATOM   3544 C CZ  . ARG B 1 204 ? 5.804   2.191   46.045 1.00 133.07 ? 204  ARG B CZ  1 
ATOM   3545 N NH1 . ARG B 1 204 ? 6.375   1.019   46.290 1.00 131.74 ? 204  ARG B NH1 1 
ATOM   3546 N NH2 . ARG B 1 204 ? 5.990   2.782   44.871 1.00 132.40 ? 204  ARG B NH2 1 
ATOM   3547 N N   . SER B 1 205 ? 4.571   2.141   51.943 1.00 129.42 ? 205  SER B N   1 
ATOM   3548 C CA  . SER B 1 205 ? 3.983   3.095   52.868 1.00 131.45 ? 205  SER B CA  1 
ATOM   3549 C C   . SER B 1 205 ? 3.925   4.419   52.135 1.00 129.96 ? 205  SER B C   1 
ATOM   3550 O O   . SER B 1 205 ? 4.935   5.118   52.036 1.00 123.63 ? 205  SER B O   1 
ATOM   3551 C CB  . SER B 1 205 ? 4.836   3.234   54.126 1.00 126.07 ? 205  SER B CB  1 
ATOM   3552 O OG  . SER B 1 205 ? 4.524   4.435   54.811 1.00 126.23 ? 205  SER B OG  1 
ATOM   3553 N N   . PRO B 1 206 ? 2.752   4.760   51.584 1.00 164.87 ? 206  PRO B N   1 
ATOM   3554 C CA  . PRO B 1 206 ? 2.706   5.985   50.781 1.00 163.77 ? 206  PRO B CA  1 
ATOM   3555 C C   . PRO B 1 206 ? 3.137   7.228   51.565 1.00 160.05 ? 206  PRO B C   1 
ATOM   3556 O O   . PRO B 1 206 ? 3.666   8.164   50.962 1.00 157.17 ? 206  PRO B O   1 
ATOM   3557 C CB  . PRO B 1 206 ? 1.238   6.064   50.352 1.00 173.97 ? 206  PRO B CB  1 
ATOM   3558 C CG  . PRO B 1 206 ? 0.786   4.631   50.339 1.00 180.20 ? 206  PRO B CG  1 
ATOM   3559 C CD  . PRO B 1 206 ? 1.492   4.001   51.511 1.00 175.60 ? 206  PRO B CD  1 
ATOM   3560 N N   . ILE B 1 207 ? 2.937   7.230   52.882 1.00 91.25  ? 207  ILE B N   1 
ATOM   3561 C CA  . ILE B 1 207 ? 3.357   8.363   53.713 1.00 91.07  ? 207  ILE B CA  1 
ATOM   3562 C C   . ILE B 1 207 ? 4.117   7.958   54.981 1.00 95.22  ? 207  ILE B C   1 
ATOM   3563 O O   . ILE B 1 207 ? 3.522   7.771   56.042 1.00 92.84  ? 207  ILE B O   1 
ATOM   3564 C CB  . ILE B 1 207 ? 2.167   9.280   54.059 1.00 95.38  ? 207  ILE B CB  1 
ATOM   3565 C CG1 . ILE B 1 207 ? 1.847   10.165  52.859 1.00 97.51  ? 207  ILE B CG1 1 
ATOM   3566 C CG2 . ILE B 1 207 ? 2.484   10.160  55.253 1.00 94.26  ? 207  ILE B CG2 1 
ATOM   3567 C CD1 . ILE B 1 207 ? 0.456   10.704  52.864 1.00 95.13  ? 207  ILE B CD1 1 
ATOM   3568 N N   . PHE B 1 208 ? 5.437   7.832   54.854 1.00 121.74 ? 208  PHE B N   1 
ATOM   3569 C CA  . PHE B 1 208 ? 6.317   7.488   55.970 1.00 118.69 ? 208  PHE B CA  1 
ATOM   3570 C C   . PHE B 1 208 ? 6.762   8.758   56.679 1.00 119.13 ? 208  PHE B C   1 
ATOM   3571 O O   . PHE B 1 208 ? 7.371   9.637   56.065 1.00 118.96 ? 208  PHE B O   1 
ATOM   3572 C CB  . PHE B 1 208 ? 7.537   6.712   55.461 1.00 114.07 ? 208  PHE B CB  1 
ATOM   3573 C CG  . PHE B 1 208 ? 8.562   6.409   56.523 1.00 111.68 ? 208  PHE B CG  1 
ATOM   3574 C CD1 . PHE B 1 208 ? 8.188   5.843   57.729 1.00 112.74 ? 208  PHE B CD1 1 
ATOM   3575 C CD2 . PHE B 1 208 ? 9.907   6.667   56.300 1.00 109.71 ? 208  PHE B CD2 1 
ATOM   3576 C CE1 . PHE B 1 208 ? 9.132   5.557   58.701 1.00 111.03 ? 208  PHE B CE1 1 
ATOM   3577 C CE2 . PHE B 1 208 ? 10.855  6.381   57.267 1.00 108.97 ? 208  PHE B CE2 1 
ATOM   3578 C CZ  . PHE B 1 208 ? 10.466  5.825   58.471 1.00 109.19 ? 208  PHE B CZ  1 
ATOM   3579 N N   . SER B 1 209 ? 6.458   8.859   57.971 1.00 118.70 ? 209  SER B N   1 
ATOM   3580 C CA  . SER B 1 209 ? 6.718   10.100  58.697 1.00 120.71 ? 209  SER B CA  1 
ATOM   3581 C C   . SER B 1 209 ? 7.362   9.959   60.076 1.00 120.35 ? 209  SER B C   1 
ATOM   3582 O O   . SER B 1 209 ? 8.014   10.888  60.538 1.00 122.17 ? 209  SER B O   1 
ATOM   3583 C CB  . SER B 1 209 ? 5.449   10.959  58.784 1.00 125.68 ? 209  SER B CB  1 
ATOM   3584 O OG  . SER B 1 209 ? 4.292   10.155  58.919 1.00 128.41 ? 209  SER B OG  1 
ATOM   3585 N N   . LEU B 1 210 ? 7.193   8.818   60.737 1.00 129.64 ? 210  LEU B N   1 
ATOM   3586 C CA  . LEU B 1 210 ? 7.763   8.656   62.077 1.00 129.67 ? 210  LEU B CA  1 
ATOM   3587 C C   . LEU B 1 210 ? 8.536   7.350   62.257 1.00 126.30 ? 210  LEU B C   1 
ATOM   3588 O O   . LEU B 1 210 ? 9.766   7.334   62.199 1.00 124.50 ? 210  LEU B O   1 
ATOM   3589 C CB  . LEU B 1 210 ? 6.674   8.777   63.142 1.00 133.67 ? 210  LEU B CB  1 
ATOM   3590 C CG  . LEU B 1 210 ? 5.644   9.884   62.905 1.00 138.00 ? 210  LEU B CG  1 
ATOM   3591 C CD1 . LEU B 1 210 ? 4.524   9.785   63.921 1.00 143.05 ? 210  LEU B CD1 1 
ATOM   3592 C CD2 . LEU B 1 210 ? 6.281   11.262  62.945 1.00 139.31 ? 210  LEU B CD2 1 
ATOM   3593 N N   . SER B 1 211 ? 7.816   6.259   62.491 1.00 105.75 ? 211  SER B N   1 
ATOM   3594 C CA  . SER B 1 211 ? 8.452   4.953   62.590 1.00 103.26 ? 211  SER B CA  1 
ATOM   3595 C C   . SER B 1 211 ? 7.671   3.907   61.811 1.00 104.49 ? 211  SER B C   1 
ATOM   3596 O O   . SER B 1 211 ? 6.450   3.988   61.690 1.00 109.08 ? 211  SER B O   1 
ATOM   3597 C CB  . SER B 1 211 ? 8.594   4.521   64.047 1.00 104.64 ? 211  SER B CB  1 
ATOM   3598 O OG  . SER B 1 211 ? 9.208   3.247   64.131 1.00 102.92 ? 211  SER B OG  1 
ATOM   3599 N N   . TRP B 1 212 ? 8.388   2.923   61.283 1.00 107.83 ? 212  TRP B N   1 
ATOM   3600 C CA  . TRP B 1 212 ? 7.775   1.862   60.502 1.00 110.07 ? 212  TRP B CA  1 
ATOM   3601 C C   . TRP B 1 212 ? 8.402   0.538   60.903 1.00 109.38 ? 212  TRP B C   1 
ATOM   3602 O O   . TRP B 1 212 ? 9.614   0.367   60.801 1.00 104.97 ? 212  TRP B O   1 
ATOM   3603 C CB  . TRP B 1 212 ? 7.970   2.139   59.005 1.00 107.73 ? 212  TRP B CB  1 
ATOM   3604 C CG  . TRP B 1 212 ? 7.381   1.113   58.084 1.00 110.72 ? 212  TRP B CG  1 
ATOM   3605 C CD1 . TRP B 1 212 ? 6.617   0.039   58.434 1.00 116.72 ? 212  TRP B CD1 1 
ATOM   3606 C CD2 . TRP B 1 212 ? 7.477   1.088   56.654 1.00 109.53 ? 212  TRP B CD2 1 
ATOM   3607 N NE1 . TRP B 1 212 ? 6.251   -0.666  57.313 1.00 119.84 ? 212  TRP B NE1 1 
ATOM   3608 C CE2 . TRP B 1 212 ? 6.764   -0.039  56.207 1.00 114.96 ? 212  TRP B CE2 1 
ATOM   3609 C CE3 . TRP B 1 212 ? 8.106   1.905   55.708 1.00 105.52 ? 212  TRP B CE3 1 
ATOM   3610 C CZ2 . TRP B 1 212 ? 6.659   -0.372  54.858 1.00 115.91 ? 212  TRP B CZ2 1 
ATOM   3611 C CZ3 . TRP B 1 212 ? 8.001   1.571   54.365 1.00 105.94 ? 212  TRP B CZ3 1 
ATOM   3612 C CH2 . TRP B 1 212 ? 7.284   0.444   53.954 1.00 110.78 ? 212  TRP B CH2 1 
ATOM   3613 N N   . THR B 1 213 ? 7.582   -0.386  61.388 1.00 94.46  ? 213  THR B N   1 
ATOM   3614 C CA  . THR B 1 213 ? 8.077   -1.710  61.736 1.00 92.13  ? 213  THR B CA  1 
ATOM   3615 C C   . THR B 1 213 ? 7.747   -2.693  60.629 1.00 94.01  ? 213  THR B C   1 
ATOM   3616 O O   . THR B 1 213 ? 6.587   -3.046  60.423 1.00 101.88 ? 213  THR B O   1 
ATOM   3617 C CB  . THR B 1 213 ? 7.495   -2.218  63.054 1.00 96.74  ? 213  THR B CB  1 
ATOM   3618 O OG1 . THR B 1 213 ? 7.821   -1.298  64.101 1.00 95.48  ? 213  THR B OG1 1 
ATOM   3619 C CG2 . THR B 1 213 ? 8.084   -3.573  63.389 1.00 97.76  ? 213  THR B CG2 1 
ATOM   3620 N N   . VAL B 1 214 ? 8.778   -3.124  59.912 1.00 112.85 ? 214  VAL B N   1 
ATOM   3621 C CA  . VAL B 1 214 ? 8.599   -3.999  58.765 1.00 115.47 ? 214  VAL B CA  1 
ATOM   3622 C C   . VAL B 1 214 ? 8.546   -5.451  59.215 1.00 121.02 ? 214  VAL B C   1 
ATOM   3623 O O   . VAL B 1 214 ? 9.271   -5.847  60.126 1.00 119.01 ? 214  VAL B O   1 
ATOM   3624 C CB  . VAL B 1 214 ? 9.738   -3.825  57.757 1.00 108.61 ? 214  VAL B CB  1 
ATOM   3625 C CG1 . VAL B 1 214 ? 9.262   -4.214  56.385 1.00 111.30 ? 214  VAL B CG1 1 
ATOM   3626 C CG2 . VAL B 1 214 ? 10.213  -2.391  57.751 1.00 103.33 ? 214  VAL B CG2 1 
ATOM   3627 N N   . MET B 1 215 ? 7.688   -6.243  58.578 1.00 111.47 ? 215  MET B N   1 
ATOM   3628 C CA  . MET B 1 215 ? 7.505   -7.629  58.991 1.00 119.47 ? 215  MET B CA  1 
ATOM   3629 C C   . MET B 1 215 ? 7.493   -8.617  57.839 1.00 124.04 ? 215  MET B C   1 
ATOM   3630 O O   . MET B 1 215 ? 6.884   -8.380  56.796 1.00 127.11 ? 215  MET B O   1 
ATOM   3631 C CB  . MET B 1 215 ? 6.215   -7.779  59.786 1.00 130.84 ? 215  MET B CB  1 
ATOM   3632 C CG  . MET B 1 215 ? 6.115   -6.840  60.955 1.00 127.63 ? 215  MET B CG  1 
ATOM   3633 S SD  . MET B 1 215 ? 4.451   -6.853  61.629 1.00 142.60 ? 215  MET B SD  1 
ATOM   3634 C CE  . MET B 1 215 ? 4.392   -5.233  62.392 1.00 135.46 ? 215  MET B CE  1 
ATOM   3635 N N   . HIS B 1 216 ? 8.172   -9.734  58.052 1.00 110.14 ? 216  HIS B N   1 
ATOM   3636 C CA  . HIS B 1 216 ? 8.109   -10.848 57.137 1.00 116.75 ? 216  HIS B CA  1 
ATOM   3637 C C   . HIS B 1 216 ? 7.568   -12.038 57.898 1.00 124.91 ? 216  HIS B C   1 
ATOM   3638 O O   . HIS B 1 216 ? 8.312   -12.701 58.615 1.00 125.43 ? 216  HIS B O   1 
ATOM   3639 C CB  . HIS B 1 216 ? 9.497   -11.172 56.600 1.00 108.09 ? 216  HIS B CB  1 
ATOM   3640 C CG  . HIS B 1 216 ? 9.592   -12.523 55.965 1.00 115.37 ? 216  HIS B CG  1 
ATOM   3641 N ND1 . HIS B 1 216 ? 9.077   -12.795 54.717 1.00 119.94 ? 216  HIS B ND1 1 
ATOM   3642 C CD2 . HIS B 1 216 ? 10.141  -13.679 56.408 1.00 118.85 ? 216  HIS B CD2 1 
ATOM   3643 C CE1 . HIS B 1 216 ? 9.305   -14.062 54.416 1.00 124.68 ? 216  HIS B CE1 1 
ATOM   3644 N NE2 . HIS B 1 216 ? 9.950   -14.618 55.424 1.00 124.67 ? 216  HIS B NE2 1 
ATOM   3645 N N   . PRO B 1 217 ? 6.260   -12.295 57.771 1.00 130.32 ? 217  PRO B N   1 
ATOM   3646 C CA  . PRO B 1 217 ? 5.672   -13.499 58.359 1.00 139.99 ? 217  PRO B CA  1 
ATOM   3647 C C   . PRO B 1 217 ? 6.449   -14.712 57.877 1.00 141.50 ? 217  PRO B C   1 
ATOM   3648 O O   . PRO B 1 217 ? 6.873   -14.746 56.720 1.00 138.33 ? 217  PRO B O   1 
ATOM   3649 C CB  . PRO B 1 217 ? 4.252   -13.514 57.775 1.00 141.86 ? 217  PRO B CB  1 
ATOM   3650 C CG  . PRO B 1 217 ? 4.301   -12.545 56.611 1.00 138.21 ? 217  PRO B CG  1 
ATOM   3651 C CD  . PRO B 1 217 ? 5.248   -11.496 57.070 1.00 131.35 ? 217  PRO B CD  1 
ATOM   3652 N N   . ILE B 1 218 ? 6.655   -15.683 58.757 1.00 146.83 ? 218  ILE B N   1 
ATOM   3653 C CA  . ILE B 1 218 ? 7.353   -16.897 58.376 1.00 148.71 ? 218  ILE B CA  1 
ATOM   3654 C C   . ILE B 1 218 ? 6.355   -18.037 58.317 1.00 153.81 ? 218  ILE B C   1 
ATOM   3655 O O   . ILE B 1 218 ? 5.786   -18.432 59.332 1.00 158.40 ? 218  ILE B O   1 
ATOM   3656 C CB  . ILE B 1 218 ? 8.485   -17.243 59.356 1.00 148.76 ? 218  ILE B CB  1 
ATOM   3657 C CG1 . ILE B 1 218 ? 9.379   -16.024 59.590 1.00 137.97 ? 218  ILE B CG1 1 
ATOM   3658 C CG2 . ILE B 1 218 ? 9.301   -18.404 58.821 1.00 147.03 ? 218  ILE B CG2 1 
ATOM   3659 C CD1 . ILE B 1 218 ? 10.616  -16.317 60.404 1.00 135.36 ? 218  ILE B CD1 1 
ATOM   3660 N N   . ASP B 1 219 ? 6.130   -18.546 57.113 1.00 136.08 ? 219  ASP B N   1 
ATOM   3661 C CA  . ASP B 1 219 ? 5.202   -19.646 56.900 1.00 141.02 ? 219  ASP B CA  1 
ATOM   3662 C C   . ASP B 1 219 ? 5.808   -20.598 55.882 1.00 138.44 ? 219  ASP B C   1 
ATOM   3663 O O   . ASP B 1 219 ? 6.980   -20.459 55.533 1.00 133.48 ? 219  ASP B O   1 
ATOM   3664 C CB  . ASP B 1 219 ? 3.866   -19.117 56.391 1.00 141.44 ? 219  ASP B CB  1 
ATOM   3665 C CG  . ASP B 1 219 ? 3.972   -18.500 55.011 1.00 138.94 ? 219  ASP B CG  1 
ATOM   3666 O OD1 . ASP B 1 219 ? 5.052   -18.591 54.393 1.00 138.03 ? 219  ASP B OD1 1 
ATOM   3667 O OD2 . ASP B 1 219 ? 2.973   -17.922 54.539 1.00 138.81 ? 219  ASP B OD2 1 
ATOM   3668 N N   . HIS B 1 220 ? 5.020   -21.548 55.384 1.00 228.74 ? 220  HIS B N   1 
ATOM   3669 C CA  . HIS B 1 220 ? 5.573   -22.533 54.454 1.00 227.61 ? 220  HIS B CA  1 
ATOM   3670 C C   . HIS B 1 220 ? 6.189   -21.929 53.185 1.00 224.64 ? 220  HIS B C   1 
ATOM   3671 O O   . HIS B 1 220 ? 6.851   -22.633 52.426 1.00 223.81 ? 220  HIS B O   1 
ATOM   3672 C CB  . HIS B 1 220 ? 4.583   -23.670 54.116 1.00 233.76 ? 220  HIS B CB  1 
ATOM   3673 C CG  . HIS B 1 220 ? 3.138   -23.281 54.166 1.00 239.80 ? 220  HIS B CG  1 
ATOM   3674 N ND1 . HIS B 1 220 ? 2.309   -23.632 55.209 1.00 244.56 ? 220  HIS B ND1 1 
ATOM   3675 C CD2 . HIS B 1 220 ? 2.359   -22.599 53.287 1.00 242.96 ? 220  HIS B CD2 1 
ATOM   3676 C CE1 . HIS B 1 220 ? 1.090   -23.172 54.983 1.00 250.05 ? 220  HIS B CE1 1 
ATOM   3677 N NE2 . HIS B 1 220 ? 1.099   -22.541 53.820 1.00 249.13 ? 220  HIS B NE2 1 
ATOM   3678 N N   . HIS B 1 221 ? 5.997   -20.631 52.966 1.00 159.21 ? 221  HIS B N   1 
ATOM   3679 C CA  . HIS B 1 221 ? 6.583   -19.982 51.793 1.00 157.32 ? 221  HIS B CA  1 
ATOM   3680 C C   . HIS B 1 221 ? 7.849   -19.173 52.087 1.00 151.20 ? 221  HIS B C   1 
ATOM   3681 O O   . HIS B 1 221 ? 8.606   -18.848 51.175 1.00 148.62 ? 221  HIS B O   1 
ATOM   3682 C CB  . HIS B 1 221 ? 5.551   -19.117 51.066 1.00 161.56 ? 221  HIS B CB  1 
ATOM   3683 C CG  . HIS B 1 221 ? 4.447   -19.909 50.436 1.00 168.83 ? 221  HIS B CG  1 
ATOM   3684 N ND1 . HIS B 1 221 ? 3.221   -19.355 50.120 1.00 174.61 ? 221  HIS B ND1 1 
ATOM   3685 C CD2 . HIS B 1 221 ? 4.376   -21.210 50.083 1.00 172.06 ? 221  HIS B CD2 1 
ATOM   3686 C CE1 . HIS B 1 221 ? 2.452   -20.286 49.587 1.00 181.40 ? 221  HIS B CE1 1 
ATOM   3687 N NE2 . HIS B 1 221 ? 3.121   -21.420 49.553 1.00 179.96 ? 221  HIS B NE2 1 
ATOM   3688 N N   . SER B 1 222 ? 8.081   -18.850 53.352 1.00 147.29 ? 222  SER B N   1 
ATOM   3689 C CA  . SER B 1 222 ? 9.277   -18.104 53.719 1.00 140.13 ? 222  SER B CA  1 
ATOM   3690 C C   . SER B 1 222 ? 10.528  -18.958 53.561 1.00 135.08 ? 222  SER B C   1 
ATOM   3691 O O   . SER B 1 222 ? 10.596  -20.068 54.083 1.00 139.06 ? 222  SER B O   1 
ATOM   3692 C CB  . SER B 1 222 ? 9.181   -17.603 55.155 1.00 140.27 ? 222  SER B CB  1 
ATOM   3693 O OG  . SER B 1 222 ? 10.376  -16.944 55.523 1.00 131.16 ? 222  SER B OG  1 
ATOM   3694 N N   . PRO B 1 223 ? 11.530  -18.438 52.843 1.00 143.38 ? 223  PRO B N   1 
ATOM   3695 C CA  . PRO B 1 223 ? 12.772  -19.192 52.665 1.00 139.39 ? 223  PRO B CA  1 
ATOM   3696 C C   . PRO B 1 223 ? 13.458  -19.467 53.997 1.00 137.97 ? 223  PRO B C   1 
ATOM   3697 O O   . PRO B 1 223 ? 14.431  -20.215 54.034 1.00 136.25 ? 223  PRO B O   1 
ATOM   3698 C CB  . PRO B 1 223 ? 13.629  -18.258 51.804 1.00 132.32 ? 223  PRO B CB  1 
ATOM   3699 C CG  . PRO B 1 223 ? 12.655  -17.364 51.124 1.00 134.00 ? 223  PRO B CG  1 
ATOM   3700 C CD  . PRO B 1 223 ? 11.548  -17.163 52.110 1.00 138.97 ? 223  PRO B CD  1 
ATOM   3701 N N   . ILE B 1 224 ? 12.962  -18.869 55.076 1.00 173.29 ? 224  ILE B N   1 
ATOM   3702 C CA  . ILE B 1 224 ? 13.520  -19.124 56.400 1.00 173.52 ? 224  ILE B CA  1 
ATOM   3703 C C   . ILE B 1 224 ? 12.548  -19.913 57.266 1.00 182.13 ? 224  ILE B C   1 
ATOM   3704 O O   . ILE B 1 224 ? 12.622  -19.877 58.493 1.00 184.27 ? 224  ILE B O   1 
ATOM   3705 C CB  . ILE B 1 224 ? 13.935  -17.823 57.119 1.00 169.41 ? 224  ILE B CB  1 
ATOM   3706 C CG1 . ILE B 1 224 ? 12.760  -16.848 57.196 1.00 171.65 ? 224  ILE B CG1 1 
ATOM   3707 C CG2 . ILE B 1 224 ? 15.112  -17.182 56.407 1.00 161.06 ? 224  ILE B CG2 1 
ATOM   3708 C CD1 . ILE B 1 224 ? 13.132  -15.494 57.761 1.00 161.74 ? 224  ILE B CD1 1 
ATOM   3709 N N   . TYR B 1 225 ? 11.644  -20.636 56.612 1.00 139.41 ? 225  TYR B N   1 
ATOM   3710 C CA  . TYR B 1 225 ? 10.652  -21.445 57.309 1.00 146.86 ? 225  TYR B CA  1 
ATOM   3711 C C   . TYR B 1 225 ? 11.284  -22.605 58.064 1.00 148.48 ? 225  TYR B C   1 
ATOM   3712 O O   . TYR B 1 225 ? 12.160  -23.292 57.543 1.00 146.17 ? 225  TYR B O   1 
ATOM   3713 C CB  . TYR B 1 225 ? 9.618   -21.986 56.325 1.00 148.60 ? 225  TYR B CB  1 
ATOM   3714 C CG  . TYR B 1 225 ? 8.543   -22.815 56.985 1.00 154.04 ? 225  TYR B CG  1 
ATOM   3715 C CD1 . TYR B 1 225 ? 7.652   -22.240 57.882 1.00 157.96 ? 225  TYR B CD1 1 
ATOM   3716 C CD2 . TYR B 1 225 ? 8.418   -24.170 56.714 1.00 156.11 ? 225  TYR B CD2 1 
ATOM   3717 C CE1 . TYR B 1 225 ? 6.662   -22.991 58.491 1.00 164.01 ? 225  TYR B CE1 1 
ATOM   3718 C CE2 . TYR B 1 225 ? 7.431   -24.931 57.318 1.00 161.79 ? 225  TYR B CE2 1 
ATOM   3719 C CZ  . TYR B 1 225 ? 6.555   -24.337 58.206 1.00 165.83 ? 225  TYR B CZ  1 
ATOM   3720 O OH  . TYR B 1 225 ? 5.570   -25.090 58.810 1.00 172.55 ? 225  TYR B OH  1 
ATOM   3721 N N   . GLY B 1 226 ? 10.825  -22.827 59.290 1.00 178.18 ? 226  GLY B N   1 
ATOM   3722 C CA  . GLY B 1 226 ? 11.337  -23.913 60.103 1.00 181.15 ? 226  GLY B CA  1 
ATOM   3723 C C   . GLY B 1 226 ? 12.851  -23.919 60.114 1.00 177.90 ? 226  GLY B C   1 
ATOM   3724 O O   . GLY B 1 226 ? 13.489  -24.946 59.892 1.00 177.31 ? 226  GLY B O   1 
ATOM   3725 N N   . GLU B 1 227 ? 13.421  -22.749 60.369 1.00 184.67 ? 227  GLU B N   1 
ATOM   3726 C CA  . GLU B 1 227 ? 14.860  -22.579 60.417 1.00 177.90 ? 227  GLU B CA  1 
ATOM   3727 C C   . GLU B 1 227 ? 15.225  -22.143 61.824 1.00 179.69 ? 227  GLU B C   1 
ATOM   3728 O O   . GLU B 1 227 ? 14.615  -21.226 62.367 1.00 180.87 ? 227  GLU B O   1 
ATOM   3729 C CB  . GLU B 1 227 ? 15.275  -21.493 59.425 1.00 169.83 ? 227  GLU B CB  1 
ATOM   3730 C CG  . GLU B 1 227 ? 16.721  -21.549 58.978 1.00 164.30 ? 227  GLU B CG  1 
ATOM   3731 C CD  . GLU B 1 227 ? 16.899  -22.362 57.714 1.00 163.19 ? 227  GLU B CD  1 
ATOM   3732 O OE1 . GLU B 1 227 ? 15.976  -22.351 56.873 1.00 164.25 ? 227  GLU B OE1 1 
ATOM   3733 O OE2 . GLU B 1 227 ? 17.960  -23.004 57.556 1.00 162.14 ? 227  GLU B OE2 1 
ATOM   3734 N N   . THR B 1 228 ? 16.204  -22.804 62.428 1.00 140.20 ? 228  THR B N   1 
ATOM   3735 C CA  . THR B 1 228 ? 16.698  -22.347 63.718 1.00 142.48 ? 228  THR B CA  1 
ATOM   3736 C C   . THR B 1 228 ? 17.841  -21.382 63.526 1.00 130.79 ? 228  THR B C   1 
ATOM   3737 O O   . THR B 1 228 ? 18.153  -20.970 62.408 1.00 125.18 ? 228  THR B O   1 
ATOM   3738 C CB  . THR B 1 228 ? 17.221  -23.489 64.602 1.00 148.73 ? 228  THR B CB  1 
ATOM   3739 O OG1 . THR B 1 228 ? 18.199  -24.251 63.879 1.00 145.74 ? 228  THR B OG1 1 
ATOM   3740 C CG2 . THR B 1 228 ? 16.079  -24.383 65.062 1.00 157.47 ? 228  THR B CG2 1 
ATOM   3741 N N   . ASP B 1 229 ? 18.470  -21.032 64.636 1.00 179.71 ? 229  ASP B N   1 
ATOM   3742 C CA  . ASP B 1 229 ? 19.655  -20.209 64.599 1.00 170.36 ? 229  ASP B CA  1 
ATOM   3743 C C   . ASP B 1 229 ? 20.795  -20.995 63.961 1.00 171.31 ? 229  ASP B C   1 
ATOM   3744 O O   . ASP B 1 229 ? 21.455  -20.515 63.040 1.00 165.88 ? 229  ASP B O   1 
ATOM   3745 C CB  . ASP B 1 229 ? 20.029  -19.778 66.011 1.00 169.12 ? 229  ASP B CB  1 
ATOM   3746 C CG  . ASP B 1 229 ? 21.161  -18.788 66.023 1.00 161.62 ? 229  ASP B CG  1 
ATOM   3747 O OD1 . ASP B 1 229 ? 21.957  -18.807 65.061 1.00 159.35 ? 229  ASP B OD1 1 
ATOM   3748 O OD2 . ASP B 1 229 ? 21.256  -17.992 66.980 1.00 159.26 ? 229  ASP B OD2 1 
ATOM   3749 N N   . GLU B 1 230 ? 21.017  -22.209 64.458 1.00 228.38 ? 230  GLU B N   1 
ATOM   3750 C CA  . GLU B 1 230 ? 22.081  -23.067 63.948 1.00 230.86 ? 230  GLU B CA  1 
ATOM   3751 C C   . GLU B 1 230 ? 22.069  -23.113 62.425 1.00 229.23 ? 230  GLU B C   1 
ATOM   3752 O O   . GLU B 1 230 ? 23.103  -22.944 61.780 1.00 225.48 ? 230  GLU B O   1 
ATOM   3753 C CB  . GLU B 1 230 ? 21.948  -24.483 64.516 1.00 241.64 ? 230  GLU B CB  1 
ATOM   3754 N N   . THR B 1 231 ? 20.888  -23.335 61.858 1.00 148.88 ? 231  THR B N   1 
ATOM   3755 C CA  . THR B 1 231 ? 20.731  -23.453 60.412 1.00 144.17 ? 231  THR B CA  1 
ATOM   3756 C C   . THR B 1 231 ? 21.068  -22.160 59.664 1.00 138.33 ? 231  THR B C   1 
ATOM   3757 O O   . THR B 1 231 ? 21.540  -22.198 58.527 1.00 135.05 ? 231  THR B O   1 
ATOM   3758 C CB  . THR B 1 231 ? 19.302  -23.882 60.051 1.00 145.90 ? 231  THR B CB  1 
ATOM   3759 O OG1 . THR B 1 231 ? 18.369  -23.080 60.783 1.00 147.48 ? 231  THR B OG1 1 
ATOM   3760 C CG2 . THR B 1 231 ? 19.077  -25.339 60.407 1.00 152.14 ? 231  THR B CG2 1 
ATOM   3761 N N   . LEU B 1 232 ? 20.817  -21.019 60.298 1.00 132.66 ? 232  LEU B N   1 
ATOM   3762 C CA  . LEU B 1 232 ? 21.115  -19.735 59.672 1.00 123.97 ? 232  LEU B CA  1 
ATOM   3763 C C   . LEU B 1 232 ? 22.619  -19.490 59.571 1.00 120.79 ? 232  LEU B C   1 
ATOM   3764 O O   . LEU B 1 232 ? 23.125  -19.141 58.503 1.00 118.08 ? 232  LEU B O   1 
ATOM   3765 C CB  . LEU B 1 232 ? 20.425  -18.582 60.407 1.00 119.66 ? 232  LEU B CB  1 
ATOM   3766 C CG  . LEU B 1 232 ? 18.959  -18.343 60.040 1.00 121.39 ? 232  LEU B CG  1 
ATOM   3767 C CD1 . LEU B 1 232 ? 18.408  -17.140 60.782 1.00 117.00 ? 232  LEU B CD1 1 
ATOM   3768 C CD2 . LEU B 1 232 ? 18.806  -18.157 58.542 1.00 119.50 ? 232  LEU B CD2 1 
ATOM   3769 N N   . ARG B 1 233 ? 23.331  -19.670 60.679 1.00 161.85 ? 233  ARG B N   1 
ATOM   3770 C CA  . ARG B 1 233 ? 24.785  -19.563 60.660 1.00 161.91 ? 233  ARG B CA  1 
ATOM   3771 C C   . ARG B 1 233 ? 25.363  -20.470 59.583 1.00 165.32 ? 233  ARG B C   1 
ATOM   3772 O O   . ARG B 1 233 ? 26.305  -20.103 58.883 1.00 164.39 ? 233  ARG B O   1 
ATOM   3773 C CB  . ARG B 1 233 ? 25.373  -19.940 62.018 1.00 165.74 ? 233  ARG B CB  1 
ATOM   3774 C CG  . ARG B 1 233 ? 24.934  -19.028 63.138 1.00 163.01 ? 233  ARG B CG  1 
ATOM   3775 C CD  . ARG B 1 233 ? 25.896  -19.079 64.307 1.00 166.37 ? 233  ARG B CD  1 
ATOM   3776 N NE  . ARG B 1 233 ? 25.908  -17.801 65.008 1.00 163.16 ? 233  ARG B NE  1 
ATOM   3777 C CZ  . ARG B 1 233 ? 24.946  -17.396 65.828 1.00 161.27 ? 233  ARG B CZ  1 
ATOM   3778 N NH1 . ARG B 1 233 ? 23.902  -18.175 66.058 1.00 163.15 ? 233  ARG B NH1 1 
ATOM   3779 N NH2 . ARG B 1 233 ? 25.028  -16.216 66.423 1.00 158.94 ? 233  ARG B NH2 1 
ATOM   3780 N N   . ASN B 1 234 ? 24.769  -21.652 59.453 1.00 138.68 ? 234  ASN B N   1 
ATOM   3781 C CA  . ASN B 1 234 ? 25.269  -22.703 58.571 1.00 143.56 ? 234  ASN B CA  1 
ATOM   3782 C C   . ASN B 1 234 ? 25.248  -22.374 57.089 1.00 140.87 ? 234  ASN B C   1 
ATOM   3783 O O   . ASN B 1 234 ? 26.082  -22.860 56.327 1.00 143.59 ? 234  ASN B O   1 
ATOM   3784 C CB  . ASN B 1 234 ? 24.487  -23.993 58.800 1.00 149.66 ? 234  ASN B CB  1 
ATOM   3785 C CG  . ASN B 1 234 ? 25.022  -24.790 59.959 1.00 155.76 ? 234  ASN B CG  1 
ATOM   3786 O OD1 . ASN B 1 234 ? 25.966  -24.371 60.631 1.00 154.90 ? 234  ASN B OD1 1 
ATOM   3787 N ND2 . ASN B 1 234 ? 24.429  -25.953 60.200 1.00 158.66 ? 234  ASN B ND2 1 
ATOM   3788 N N   . SER B 1 235 ? 24.273  -21.576 56.680 1.00 161.27 ? 235  SER B N   1 
ATOM   3789 C CA  . SER B 1 235 ? 24.180  -21.148 55.297 1.00 158.64 ? 235  SER B CA  1 
ATOM   3790 C C   . SER B 1 235 ? 24.890  -19.813 55.158 1.00 152.38 ? 235  SER B C   1 
ATOM   3791 O O   . SER B 1 235 ? 24.835  -19.168 54.110 1.00 149.25 ? 235  SER B O   1 
ATOM   3792 C CB  . SER B 1 235 ? 22.715  -21.038 54.881 1.00 158.11 ? 235  SER B CB  1 
ATOM   3793 O OG  . SER B 1 235 ? 21.904  -20.706 55.995 1.00 158.46 ? 235  SER B OG  1 
ATOM   3794 N N   . HIS B 1 236 ? 25.571  -19.416 56.230 1.00 157.66 ? 236  HIS B N   1 
ATOM   3795 C CA  . HIS B 1 236 ? 26.252  -18.133 56.279 1.00 154.26 ? 236  HIS B CA  1 
ATOM   3796 C C   . HIS B 1 236 ? 25.313  -17.060 55.745 1.00 148.56 ? 236  HIS B C   1 
ATOM   3797 O O   . HIS B 1 236 ? 25.673  -16.295 54.852 1.00 146.78 ? 236  HIS B O   1 
ATOM   3798 C CB  . HIS B 1 236 ? 27.533  -18.180 55.445 1.00 157.49 ? 236  HIS B CB  1 
ATOM   3799 C CG  . HIS B 1 236 ? 28.479  -17.062 55.739 1.00 158.25 ? 236  HIS B CG  1 
ATOM   3800 N ND1 . HIS B 1 236 ? 28.141  -15.738 55.575 1.00 154.19 ? 236  HIS B ND1 1 
ATOM   3801 C CD2 . HIS B 1 236 ? 29.759  -17.068 56.193 1.00 164.40 ? 236  HIS B CD2 1 
ATOM   3802 C CE1 . HIS B 1 236 ? 29.165  -14.975 55.915 1.00 158.26 ? 236  HIS B CE1 1 
ATOM   3803 N NE2 . HIS B 1 236 ? 30.158  -15.761 56.291 1.00 164.81 ? 236  HIS B NE2 1 
ATOM   3804 N N   . SER B 1 237 ? 24.104  -17.014 56.296 1.00 114.38 ? 237  SER B N   1 
ATOM   3805 C CA  . SER B 1 237 ? 23.045  -16.173 55.743 1.00 110.26 ? 237  SER B CA  1 
ATOM   3806 C C   . SER B 1 237 ? 22.916  -14.809 56.417 1.00 106.05 ? 237  SER B C   1 
ATOM   3807 O O   . SER B 1 237 ? 22.959  -14.701 57.643 1.00 106.52 ? 237  SER B O   1 
ATOM   3808 C CB  . SER B 1 237 ? 21.706  -16.910 55.783 1.00 113.07 ? 237  SER B CB  1 
ATOM   3809 O OG  . SER B 1 237 ? 21.436  -17.397 57.082 1.00 115.98 ? 237  SER B OG  1 
ATOM   3810 N N   . GLU B 1 238 ? 22.751  -13.774 55.600 1.00 123.67 ? 238  GLU B N   1 
ATOM   3811 C CA  . GLU B 1 238 ? 22.567  -12.416 56.094 1.00 120.44 ? 238  GLU B CA  1 
ATOM   3812 C C   . GLU B 1 238 ? 21.251  -11.837 55.594 1.00 117.36 ? 238  GLU B C   1 
ATOM   3813 O O   . GLU B 1 238 ? 20.581  -12.431 54.751 1.00 118.22 ? 238  GLU B O   1 
ATOM   3814 C CB  . GLU B 1 238 ? 23.709  -11.520 55.629 1.00 121.00 ? 238  GLU B CB  1 
ATOM   3815 C CG  . GLU B 1 238 ? 25.086  -12.118 55.807 1.00 126.01 ? 238  GLU B CG  1 
ATOM   3816 C CD  . GLU B 1 238 ? 26.167  -11.227 55.228 1.00 129.19 ? 238  GLU B CD  1 
ATOM   3817 O OE1 . GLU B 1 238 ? 25.864  -10.460 54.289 1.00 127.17 ? 238  GLU B OE1 1 
ATOM   3818 O OE2 . GLU B 1 238 ? 27.317  -11.294 55.711 1.00 134.97 ? 238  GLU B OE2 1 
ATOM   3819 N N   . PHE B 1 239 ? 20.894  -10.667 56.111 1.00 124.10 ? 239  PHE B N   1 
ATOM   3820 C CA  . PHE B 1 239 ? 19.669  -9.994  55.701 1.00 121.83 ? 239  PHE B CA  1 
ATOM   3821 C C   . PHE B 1 239 ? 19.922  -8.545  55.306 1.00 119.35 ? 239  PHE B C   1 
ATOM   3822 O O   . PHE B 1 239 ? 20.439  -7.747  56.088 1.00 119.42 ? 239  PHE B O   1 
ATOM   3823 C CB  . PHE B 1 239 ? 18.619  -10.090 56.800 1.00 122.65 ? 239  PHE B CB  1 
ATOM   3824 C CG  . PHE B 1 239 ? 18.272  -11.498 57.163 1.00 126.98 ? 239  PHE B CG  1 
ATOM   3825 C CD1 . PHE B 1 239 ? 19.080  -12.219 58.023 1.00 128.97 ? 239  PHE B CD1 1 
ATOM   3826 C CD2 . PHE B 1 239 ? 17.152  -12.111 56.629 1.00 130.62 ? 239  PHE B CD2 1 
ATOM   3827 C CE1 . PHE B 1 239 ? 18.771  -13.519 58.354 1.00 133.99 ? 239  PHE B CE1 1 
ATOM   3828 C CE2 . PHE B 1 239 ? 16.836  -13.413 56.958 1.00 136.80 ? 239  PHE B CE2 1 
ATOM   3829 C CZ  . PHE B 1 239 ? 17.648  -14.118 57.822 1.00 138.22 ? 239  PHE B CZ  1 
ATOM   3830 N N   . LEU B 1 240 ? 19.544  -8.224  54.074 1.00 87.45  ? 240  LEU B N   1 
ATOM   3831 C CA  . LEU B 1 240 ? 19.811  -6.930  53.477 1.00 86.23  ? 240  LEU B CA  1 
ATOM   3832 C C   . LEU B 1 240 ? 18.532  -6.114  53.365 1.00 84.20  ? 240  LEU B C   1 
ATOM   3833 O O   . LEU B 1 240 ? 17.544  -6.585  52.816 1.00 84.41  ? 240  LEU B O   1 
ATOM   3834 C CB  . LEU B 1 240 ? 20.400  -7.139  52.088 1.00 87.20  ? 240  LEU B CB  1 
ATOM   3835 C CG  . LEU B 1 240 ? 20.929  -5.871  51.435 1.00 87.82  ? 240  LEU B CG  1 
ATOM   3836 C CD1 . LEU B 1 240 ? 21.670  -5.038  52.468 1.00 90.11  ? 240  LEU B CD1 1 
ATOM   3837 C CD2 . LEU B 1 240 ? 21.829  -6.227  50.274 1.00 90.31  ? 240  LEU B CD2 1 
ATOM   3838 N N   . VAL B 1 241 ? 18.550  -4.889  53.878 1.00 94.81  ? 241  VAL B N   1 
ATOM   3839 C CA  . VAL B 1 241 ? 17.380  -4.021  53.792 1.00 93.45  ? 241  VAL B CA  1 
ATOM   3840 C C   . VAL B 1 241 ? 17.637  -2.828  52.892 1.00 93.45  ? 241  VAL B C   1 
ATOM   3841 O O   . VAL B 1 241 ? 18.585  -2.070  53.107 1.00 95.34  ? 241  VAL B O   1 
ATOM   3842 C CB  . VAL B 1 241 ? 16.966  -3.475  55.165 1.00 93.44  ? 241  VAL B CB  1 
ATOM   3843 C CG1 . VAL B 1 241 ? 15.756  -2.578  55.024 1.00 92.93  ? 241  VAL B CG1 1 
ATOM   3844 C CG2 . VAL B 1 241 ? 16.681  -4.611  56.126 1.00 94.38  ? 241  VAL B CG2 1 
ATOM   3845 N N   . LEU B 1 242 ? 16.788  -2.657  51.888 1.00 82.88  ? 242  LEU B N   1 
ATOM   3846 C CA  . LEU B 1 242 ? 16.850  -1.462  51.066 1.00 83.29  ? 242  LEU B CA  1 
ATOM   3847 C C   . LEU B 1 242 ? 15.590  -0.623  51.235 1.00 82.79  ? 242  LEU B C   1 
ATOM   3848 O O   . LEU B 1 242 ? 14.487  -1.084  50.960 1.00 82.84  ? 242  LEU B O   1 
ATOM   3849 C CB  . LEU B 1 242 ? 17.038  -1.823  49.599 1.00 83.67  ? 242  LEU B CB  1 
ATOM   3850 C CG  . LEU B 1 242 ? 16.735  -0.643  48.679 1.00 84.40  ? 242  LEU B CG  1 
ATOM   3851 C CD1 . LEU B 1 242 ? 17.550  0.587   49.080 1.00 86.96  ? 242  LEU B CD1 1 
ATOM   3852 C CD2 . LEU B 1 242 ? 16.981  -1.015  47.226 1.00 85.20  ? 242  LEU B CD2 1 
ATOM   3853 N N   . PHE B 1 243 ? 15.765  0.612   51.693 1.00 87.35  ? 243  PHE B N   1 
ATOM   3854 C CA  . PHE B 1 243 ? 14.662  1.553   51.813 1.00 87.54  ? 243  PHE B CA  1 
ATOM   3855 C C   . PHE B 1 243 ? 14.809  2.647   50.784 1.00 89.14  ? 243  PHE B C   1 
ATOM   3856 O O   . PHE B 1 243 ? 15.914  3.125   50.543 1.00 91.54  ? 243  PHE B O   1 
ATOM   3857 C CB  . PHE B 1 243 ? 14.648  2.213   53.189 1.00 88.34  ? 243  PHE B CB  1 
ATOM   3858 C CG  . PHE B 1 243 ? 13.773  3.434   53.253 1.00 89.56  ? 243  PHE B CG  1 
ATOM   3859 C CD1 . PHE B 1 243 ? 12.470  3.346   53.716 1.00 89.51  ? 243  PHE B CD1 1 
ATOM   3860 C CD2 . PHE B 1 243 ? 14.242  4.662   52.823 1.00 92.18  ? 243  PHE B CD2 1 
ATOM   3861 C CE1 . PHE B 1 243 ? 11.655  4.466   53.764 1.00 91.30  ? 243  PHE B CE1 1 
ATOM   3862 C CE2 . PHE B 1 243 ? 13.431  5.780   52.864 1.00 93.84  ? 243  PHE B CE2 1 
ATOM   3863 C CZ  . PHE B 1 243 ? 12.135  5.681   53.337 1.00 93.01  ? 243  PHE B CZ  1 
ATOM   3864 N N   . THR B 1 244 ? 13.693  3.059   50.193 1.00 95.74  ? 244  THR B N   1 
ATOM   3865 C CA  . THR B 1 244 ? 13.699  4.183   49.260 1.00 97.78  ? 244  THR B CA  1 
ATOM   3866 C C   . THR B 1 244 ? 12.364  4.920   49.283 1.00 98.71  ? 244  THR B C   1 
ATOM   3867 O O   . THR B 1 244 ? 11.334  4.345   49.624 1.00 98.36  ? 244  THR B O   1 
ATOM   3868 C CB  . THR B 1 244 ? 13.999  3.742   47.808 1.00 97.91  ? 244  THR B CB  1 
ATOM   3869 O OG1 . THR B 1 244 ? 12.817  3.194   47.217 1.00 97.36  ? 244  THR B OG1 1 
ATOM   3870 C CG2 . THR B 1 244 ? 15.100  2.698   47.767 1.00 97.16  ? 244  THR B CG2 1 
ATOM   3871 N N   . GLY B 1 245 ? 12.390  6.195   48.911 1.00 111.08 ? 245  GLY B N   1 
ATOM   3872 C CA  . GLY B 1 245 ? 11.192  7.012   48.910 1.00 112.80 ? 245  GLY B CA  1 
ATOM   3873 C C   . GLY B 1 245 ? 11.480  8.422   48.439 1.00 116.50 ? 245  GLY B C   1 
ATOM   3874 O O   . GLY B 1 245 ? 12.635  8.788   48.233 1.00 118.71 ? 245  GLY B O   1 
ATOM   3875 N N   . HIS B 1 246 ? 10.431  9.217   48.265 1.00 113.48 ? 246  HIS B N   1 
ATOM   3876 C CA  . HIS B 1 246 ? 10.592  10.593  47.819 1.00 117.98 ? 246  HIS B CA  1 
ATOM   3877 C C   . HIS B 1 246 ? 10.525  11.560  48.998 1.00 120.83 ? 246  HIS B C   1 
ATOM   3878 O O   . HIS B 1 246 ? 9.474   11.735  49.607 1.00 120.78 ? 246  HIS B O   1 
ATOM   3879 C CB  . HIS B 1 246 ? 9.527   10.945  46.786 1.00 119.64 ? 246  HIS B CB  1 
ATOM   3880 C CG  . HIS B 1 246 ? 9.601   12.362  46.310 1.00 124.90 ? 246  HIS B CG  1 
ATOM   3881 N ND1 . HIS B 1 246 ? 10.179  12.711  45.105 1.00 127.59 ? 246  HIS B ND1 1 
ATOM   3882 C CD2 . HIS B 1 246 ? 9.186   13.514  46.879 1.00 128.90 ? 246  HIS B CD2 1 
ATOM   3883 C CE1 . HIS B 1 246 ? 10.108  14.021  44.958 1.00 133.36 ? 246  HIS B CE1 1 
ATOM   3884 N NE2 . HIS B 1 246 ? 9.513   14.536  46.013 1.00 134.22 ? 246  HIS B NE2 1 
ATOM   3885 N N   . HIS B 1 247 ? 11.651  12.193  49.309 1.00 102.74 ? 247  HIS B N   1 
ATOM   3886 C CA  . HIS B 1 247 ? 11.750  13.046  50.487 1.00 106.49 ? 247  HIS B CA  1 
ATOM   3887 C C   . HIS B 1 247 ? 11.225  14.447  50.217 1.00 112.39 ? 247  HIS B C   1 
ATOM   3888 O O   . HIS B 1 247 ? 11.719  15.146  49.335 1.00 117.69 ? 247  HIS B O   1 
ATOM   3889 C CB  . HIS B 1 247 ? 13.200  13.128  50.959 1.00 110.75 ? 247  HIS B CB  1 
ATOM   3890 C CG  . HIS B 1 247 ? 13.342  13.349  52.435 1.00 112.39 ? 247  HIS B CG  1 
ATOM   3891 N ND1 . HIS B 1 247 ? 12.814  14.452  53.072 1.00 116.90 ? 247  HIS B ND1 1 
ATOM   3892 C CD2 . HIS B 1 247 ? 13.946  12.610  53.389 1.00 110.65 ? 247  HIS B CD2 1 
ATOM   3893 C CE1 . HIS B 1 247 ? 13.090  14.377  54.361 1.00 117.74 ? 247  HIS B CE1 1 
ATOM   3894 N NE2 . HIS B 1 247 ? 13.773  13.277  54.586 1.00 114.01 ? 247  HIS B NE2 1 
ATOM   3895 N N   . GLU B 1 248 ? 10.225  14.861  50.984 1.00 121.14 ? 248  GLU B N   1 
ATOM   3896 C CA  . GLU B 1 248 ? 9.672   16.199  50.830 1.00 127.29 ? 248  GLU B CA  1 
ATOM   3897 C C   . GLU B 1 248 ? 10.709  17.283  51.092 1.00 135.82 ? 248  GLU B C   1 
ATOM   3898 O O   . GLU B 1 248 ? 10.712  18.313  50.424 1.00 142.45 ? 248  GLU B O   1 
ATOM   3899 C CB  . GLU B 1 248 ? 8.446   16.393  51.718 1.00 126.64 ? 248  GLU B CB  1 
ATOM   3900 C CG  . GLU B 1 248 ? 7.179   15.813  51.116 1.00 123.50 ? 248  GLU B CG  1 
ATOM   3901 C CD  . GLU B 1 248 ? 5.996   15.867  52.064 1.00 124.32 ? 248  GLU B CD  1 
ATOM   3902 O OE1 . GLU B 1 248 ? 6.004   16.709  52.992 1.00 127.97 ? 248  GLU B OE1 1 
ATOM   3903 O OE2 . GLU B 1 248 ? 5.056   15.064  51.881 1.00 122.58 ? 248  GLU B OE2 1 
ATOM   3904 N N   . ALA B 1 249 ? 11.589  17.049  52.058 1.00 129.22 ? 249  ALA B N   1 
ATOM   3905 C CA  . ALA B 1 249 ? 12.660  17.993  52.352 1.00 139.75 ? 249  ALA B CA  1 
ATOM   3906 C C   . ALA B 1 249 ? 13.379  18.417  51.076 1.00 142.89 ? 249  ALA B C   1 
ATOM   3907 O O   . ALA B 1 249 ? 13.514  19.606  50.787 1.00 147.81 ? 249  ALA B O   1 
ATOM   3908 C CB  . ALA B 1 249 ? 13.641  17.380  53.320 1.00 140.23 ? 249  ALA B CB  1 
ATOM   3909 N N   . PHE B 1 250 ? 13.825  17.434  50.306 1.00 110.53 ? 250  PHE B N   1 
ATOM   3910 C CA  . PHE B 1 250 ? 14.640  17.706  49.134 1.00 112.88 ? 250  PHE B CA  1 
ATOM   3911 C C   . PHE B 1 250 ? 13.834  17.739  47.840 1.00 112.03 ? 250  PHE B C   1 
ATOM   3912 O O   . PHE B 1 250 ? 14.352  18.143  46.798 1.00 115.05 ? 250  PHE B O   1 
ATOM   3913 C CB  . PHE B 1 250 ? 15.768  16.679  49.040 1.00 111.33 ? 250  PHE B CB  1 
ATOM   3914 C CG  . PHE B 1 250 ? 16.490  16.472  50.333 1.00 112.60 ? 250  PHE B CG  1 
ATOM   3915 C CD1 . PHE B 1 250 ? 16.346  15.295  51.044 1.00 108.07 ? 250  PHE B CD1 1 
ATOM   3916 C CD2 . PHE B 1 250 ? 17.287  17.471  50.855 1.00 119.39 ? 250  PHE B CD2 1 
ATOM   3917 C CE1 . PHE B 1 250 ? 17.007  15.108  52.240 1.00 110.05 ? 250  PHE B CE1 1 
ATOM   3918 C CE2 . PHE B 1 250 ? 17.947  17.290  52.049 1.00 121.85 ? 250  PHE B CE2 1 
ATOM   3919 C CZ  . PHE B 1 250 ? 17.806  16.111  52.746 1.00 117.06 ? 250  PHE B CZ  1 
ATOM   3920 N N   . ALA B 1 251 ? 12.569  17.331  47.908 1.00 126.83 ? 251  ALA B N   1 
ATOM   3921 C CA  . ALA B 1 251 ? 11.733  17.236  46.714 1.00 123.80 ? 251  ALA B CA  1 
ATOM   3922 C C   . ALA B 1 251 ? 12.451  16.371  45.685 1.00 121.52 ? 251  ALA B C   1 
ATOM   3923 O O   . ALA B 1 251 ? 12.500  16.688  44.499 1.00 124.71 ? 251  ALA B O   1 
ATOM   3924 C CB  . ALA B 1 251 ? 11.447  18.617  46.152 1.00 132.43 ? 251  ALA B CB  1 
ATOM   3925 N N   . GLN B 1 252 ? 13.008  15.268  46.166 1.00 149.05 ? 252  GLN B N   1 
ATOM   3926 C CA  . GLN B 1 252 ? 13.896  14.436  45.378 1.00 147.98 ? 252  GLN B CA  1 
ATOM   3927 C C   . GLN B 1 252 ? 13.909  13.059  46.025 1.00 139.66 ? 252  GLN B C   1 
ATOM   3928 O O   . GLN B 1 252 ? 13.583  12.919  47.204 1.00 136.97 ? 252  GLN B O   1 
ATOM   3929 C CB  . GLN B 1 252 ? 15.296  15.052  45.391 1.00 158.22 ? 252  GLN B CB  1 
ATOM   3930 C CG  . GLN B 1 252 ? 16.303  14.439  44.436 1.00 160.23 ? 252  GLN B CG  1 
ATOM   3931 C CD  . GLN B 1 252 ? 17.681  15.070  44.578 1.00 165.44 ? 252  GLN B CD  1 
ATOM   3932 O OE1 . GLN B 1 252 ? 17.889  15.958  45.407 1.00 168.60 ? 252  GLN B OE1 1 
ATOM   3933 N NE2 . GLN B 1 252 ? 18.628  14.613  43.767 1.00 167.46 ? 252  GLN B NE2 1 
ATOM   3934 N N   . ASN B 1 253 ? 14.271  12.037  45.262 1.00 116.37 ? 253  ASN B N   1 
ATOM   3935 C CA  . ASN B 1 253 ? 14.286  10.691  45.814 1.00 109.41 ? 253  ASN B CA  1 
ATOM   3936 C C   . ASN B 1 253 ? 15.476  10.427  46.725 1.00 111.58 ? 253  ASN B C   1 
ATOM   3937 O O   . ASN B 1 253 ? 16.560  10.975  46.529 1.00 119.18 ? 253  ASN B O   1 
ATOM   3938 C CB  . ASN B 1 253 ? 14.205  9.642   44.710 1.00 105.54 ? 253  ASN B CB  1 
ATOM   3939 C CG  . ASN B 1 253 ? 12.785  9.202   44.441 1.00 101.18 ? 253  ASN B CG  1 
ATOM   3940 O OD1 . ASN B 1 253 ? 12.419  8.059   44.710 1.00 96.85  ? 253  ASN B OD1 1 
ATOM   3941 N ND2 . ASN B 1 253 ? 11.969  10.115  43.931 1.00 103.80 ? 253  ASN B ND2 1 
ATOM   3942 N N   . VAL B 1 254 ? 15.257  9.589   47.730 1.00 98.25  ? 254  VAL B N   1 
ATOM   3943 C CA  . VAL B 1 254 ? 16.293  9.243   48.686 1.00 100.09 ? 254  VAL B CA  1 
ATOM   3944 C C   . VAL B 1 254 ? 16.278  7.744   48.902 1.00 93.46  ? 254  VAL B C   1 
ATOM   3945 O O   . VAL B 1 254 ? 15.301  7.078   48.578 1.00 87.64  ? 254  VAL B O   1 
ATOM   3946 C CB  . VAL B 1 254 ? 16.038  9.900   50.045 1.00 89.47  ? 254  VAL B CB  1 
ATOM   3947 C CG1 . VAL B 1 254 ? 16.297  11.386  49.976 1.00 98.30  ? 254  VAL B CG1 1 
ATOM   3948 C CG2 . VAL B 1 254 ? 14.618  9.626   50.499 1.00 95.45  ? 254  VAL B CG2 1 
ATOM   3949 N N   . HIS B 1 255 ? 17.364  7.205   49.438 1.00 113.10 ? 255  HIS B N   1 
ATOM   3950 C CA  . HIS B 1 255 ? 17.347  5.823   49.884 1.00 107.54 ? 255  HIS B CA  1 
ATOM   3951 C C   . HIS B 1 255 ? 18.397  5.562   50.932 1.00 110.43 ? 255  HIS B C   1 
ATOM   3952 O O   . HIS B 1 255 ? 19.247  6.403   51.235 1.00 117.82 ? 255  HIS B O   1 
ATOM   3953 C CB  . HIS B 1 255 ? 17.555  4.842   48.724 1.00 105.53 ? 255  HIS B CB  1 
ATOM   3954 C CG  . HIS B 1 255 ? 18.823  5.078   47.950 1.00 111.94 ? 255  HIS B CG  1 
ATOM   3955 N ND1 . HIS B 1 255 ? 18.808  5.469   46.623 1.00 115.91 ? 255  HIS B ND1 1 
ATOM   3956 C CD2 . HIS B 1 255 ? 20.126  5.003   48.304 1.00 116.66 ? 255  HIS B CD2 1 
ATOM   3957 C CE1 . HIS B 1 255 ? 20.045  5.630   46.210 1.00 123.13 ? 255  HIS B CE1 1 
ATOM   3958 N NE2 . HIS B 1 255 ? 20.873  5.351   47.186 1.00 123.90 ? 255  HIS B NE2 1 
ATOM   3959 N N   . ALA B 1 256 ? 18.306  4.363   51.480 1.00 98.94  ? 256  ALA B N   1 
ATOM   3960 C CA  . ALA B 1 256 ? 19.126  3.962   52.587 1.00 101.04 ? 256  ALA B CA  1 
ATOM   3961 C C   . ALA B 1 256 ? 19.169  2.453   52.569 1.00 96.52  ? 256  ALA B C   1 
ATOM   3962 O O   . ALA B 1 256 ? 18.175  1.800   52.273 1.00 91.38  ? 256  ALA B O   1 
ATOM   3963 C CB  . ALA B 1 256 ? 18.508  4.444   53.862 1.00 100.22 ? 256  ALA B CB  1 
ATOM   3964 N N   . ARG B 1 257 ? 20.325  1.891   52.874 1.00 96.92  ? 257  ARG B N   1 
ATOM   3965 C CA  . ARG B 1 257 ? 20.413  0.451   52.995 1.00 93.41  ? 257  ARG B CA  1 
ATOM   3966 C C   . ARG B 1 257 ? 21.088  0.061   54.280 1.00 95.58  ? 257  ARG B C   1 
ATOM   3967 O O   . ARG B 1 257 ? 21.820  0.842   54.892 1.00 101.52 ? 257  ARG B O   1 
ATOM   3968 C CB  . ARG B 1 257 ? 21.181  -0.123  51.834 1.00 95.32  ? 257  ARG B CB  1 
ATOM   3969 C CG  . ARG B 1 257 ? 22.159  0.855   51.344 1.00 103.24 ? 257  ARG B CG  1 
ATOM   3970 C CD  . ARG B 1 257 ? 23.024  0.219   50.384 1.00 106.28 ? 257  ARG B CD  1 
ATOM   3971 N NE  . ARG B 1 257 ? 23.993  1.150   49.865 1.00 115.89 ? 257  ARG B NE  1 
ATOM   3972 C CZ  . ARG B 1 257 ? 25.316  1.056   49.981 1.00 125.09 ? 257  ARG B CZ  1 
ATOM   3973 N NH1 . ARG B 1 257 ? 25.934  0.028   50.577 1.00 125.12 ? 257  ARG B NH1 1 
ATOM   3974 N NH2 . ARG B 1 257 ? 26.039  2.013   49.437 1.00 134.63 ? 257  ARG B NH2 1 
ATOM   3975 N N   . HIS B 1 258 ? 20.828  -1.172  54.675 1.00 109.15 ? 258  HIS B N   1 
ATOM   3976 C CA  . HIS B 1 258 ? 21.366  -1.707  55.901 1.00 110.93 ? 258  HIS B CA  1 
ATOM   3977 C C   . HIS B 1 258 ? 21.472  -3.210  55.736 1.00 108.87 ? 258  HIS B C   1 
ATOM   3978 O O   . HIS B 1 258 ? 20.790  -3.794  54.897 1.00 105.52 ? 258  HIS B O   1 
ATOM   3979 C CB  . HIS B 1 258 ? 20.446  -1.358  57.066 1.00 108.71 ? 258  HIS B CB  1 
ATOM   3980 C CG  . HIS B 1 258 ? 21.055  -1.606  58.410 1.00 111.66 ? 258  HIS B CG  1 
ATOM   3981 N ND1 . HIS B 1 258 ? 22.058  -0.816  58.928 1.00 118.34 ? 258  HIS B ND1 1 
ATOM   3982 C CD2 . HIS B 1 258 ? 20.796  -2.549  59.344 1.00 109.99 ? 258  HIS B CD2 1 
ATOM   3983 C CE1 . HIS B 1 258 ? 22.395  -1.265  60.124 1.00 120.15 ? 258  HIS B CE1 1 
ATOM   3984 N NE2 . HIS B 1 258 ? 21.644  -2.316  60.402 1.00 114.75 ? 258  HIS B NE2 1 
ATOM   3985 N N   . ALA B 1 259 ? 22.333  -3.835  56.526 1.00 103.22 ? 259  ALA B N   1 
ATOM   3986 C CA  . ALA B 1 259 ? 22.480  -5.278  56.471 1.00 102.23 ? 259  ALA B CA  1 
ATOM   3987 C C   . ALA B 1 259 ? 22.572  -5.847  57.879 1.00 103.12 ? 259  ALA B C   1 
ATOM   3988 O O   . ALA B 1 259 ? 23.110  -5.207  58.782 1.00 106.53 ? 259  ALA B O   1 
ATOM   3989 C CB  . ALA B 1 259 ? 23.705  -5.656  55.661 1.00 106.55 ? 259  ALA B CB  1 
ATOM   3990 N N   . TYR B 1 260 ? 22.040  -7.052  58.057 1.00 93.56  ? 260  TYR B N   1 
ATOM   3991 C CA  . TYR B 1 260 ? 22.108  -7.752  59.334 1.00 95.01  ? 260  TYR B CA  1 
ATOM   3992 C C   . TYR B 1 260 ? 22.726  -9.128  59.150 1.00 97.24  ? 260  TYR B C   1 
ATOM   3993 O O   . TYR B 1 260 ? 22.505  -9.782  58.132 1.00 96.38  ? 260  TYR B O   1 
ATOM   3994 C CB  . TYR B 1 260 ? 20.714  -7.938  59.919 1.00 92.53  ? 260  TYR B CB  1 
ATOM   3995 C CG  . TYR B 1 260 ? 19.981  -6.663  60.231 1.00 90.72  ? 260  TYR B CG  1 
ATOM   3996 C CD1 . TYR B 1 260 ? 18.888  -6.272  59.475 1.00 88.27  ? 260  TYR B CD1 1 
ATOM   3997 C CD2 . TYR B 1 260 ? 20.369  -5.858  61.292 1.00 92.42  ? 260  TYR B CD2 1 
ATOM   3998 C CE1 . TYR B 1 260 ? 18.204  -5.118  59.759 1.00 87.17  ? 260  TYR B CE1 1 
ATOM   3999 C CE2 . TYR B 1 260 ? 19.690  -4.695  61.584 1.00 91.38  ? 260  TYR B CE2 1 
ATOM   4000 C CZ  . TYR B 1 260 ? 18.607  -4.332  60.811 1.00 88.55  ? 260  TYR B CZ  1 
ATOM   4001 O OH  . TYR B 1 260 ? 17.915  -3.176  61.077 1.00 88.00  ? 260  TYR B OH  1 
ATOM   4002 N N   . SER B 1 261 ? 23.486  -9.577  60.142 1.00 116.52 ? 261  SER B N   1 
ATOM   4003 C CA  . SER B 1 261 ? 24.035  -10.927 60.112 1.00 119.30 ? 261  SER B CA  1 
ATOM   4004 C C   . SER B 1 261 ? 23.156  -11.865 60.928 1.00 119.13 ? 261  SER B C   1 
ATOM   4005 O O   . SER B 1 261 ? 22.330  -11.417 61.721 1.00 117.69 ? 261  SER B O   1 
ATOM   4006 C CB  . SER B 1 261 ? 25.471  -10.939 60.634 1.00 125.08 ? 261  SER B CB  1 
ATOM   4007 O OG  . SER B 1 261 ? 25.591  -10.164 61.814 1.00 126.75 ? 261  SER B OG  1 
ATOM   4008 N N   . CYS B 1 262 ? 23.325  -13.167 60.726 1.00 151.81 ? 262  CYS B N   1 
ATOM   4009 C CA  . CYS B 1 262 ? 22.535  -14.161 61.445 1.00 153.92 ? 262  CYS B CA  1 
ATOM   4010 C C   . CYS B 1 262 ? 22.433  -13.835 62.937 1.00 154.76 ? 262  CYS B C   1 
ATOM   4011 O O   . CYS B 1 262 ? 21.376  -13.998 63.547 1.00 155.19 ? 262  CYS B O   1 
ATOM   4012 C CB  . CYS B 1 262 ? 23.123  -15.561 61.237 1.00 158.48 ? 262  CYS B CB  1 
ATOM   4013 S SG  . CYS B 1 262 ? 24.920  -15.592 60.972 1.00 161.18 ? 262  CYS B SG  1 
ATOM   4014 N N   . ASP B 1 263 ? 23.532  -13.346 63.505 1.00 153.72 ? 263  ASP B N   1 
ATOM   4015 C CA  . ASP B 1 263 ? 23.638  -13.123 64.945 1.00 155.70 ? 263  ASP B CA  1 
ATOM   4016 C C   . ASP B 1 263 ? 23.025  -11.812 65.440 1.00 152.80 ? 263  ASP B C   1 
ATOM   4017 O O   . ASP B 1 263 ? 23.078  -11.516 66.632 1.00 154.59 ? 263  ASP B O   1 
ATOM   4018 C CB  . ASP B 1 263 ? 25.104  -13.161 65.367 1.00 160.45 ? 263  ASP B CB  1 
ATOM   4019 C CG  . ASP B 1 263 ? 25.909  -12.046 64.741 1.00 161.00 ? 263  ASP B CG  1 
ATOM   4020 O OD1 . ASP B 1 263 ? 26.185  -12.131 63.527 1.00 160.26 ? 263  ASP B OD1 1 
ATOM   4021 O OD2 . ASP B 1 263 ? 26.261  -11.084 65.456 1.00 163.21 ? 263  ASP B OD2 1 
ATOM   4022 N N   . GLU B 1 264 ? 22.465  -11.015 64.537 1.00 148.86 ? 264  GLU B N   1 
ATOM   4023 C CA  . GLU B 1 264 ? 21.808  -9.777  64.950 1.00 146.56 ? 264  GLU B CA  1 
ATOM   4024 C C   . GLU B 1 264 ? 20.305  -9.996  64.976 1.00 144.73 ? 264  GLU B C   1 
ATOM   4025 O O   . GLU B 1 264 ? 19.521  -9.055  65.109 1.00 142.73 ? 264  GLU B O   1 
ATOM   4026 C CB  . GLU B 1 264 ? 22.172  -8.625  64.018 1.00 144.85 ? 264  GLU B CB  1 
ATOM   4027 C CG  . GLU B 1 264 ? 23.537  -8.779  63.384 1.00 148.12 ? 264  GLU B CG  1 
ATOM   4028 C CD  . GLU B 1 264 ? 24.320  -7.486  63.357 1.00 151.44 ? 264  GLU B CD  1 
ATOM   4029 O OE1 . GLU B 1 264 ? 24.277  -6.745  64.362 1.00 153.34 ? 264  GLU B OE1 1 
ATOM   4030 O OE2 . GLU B 1 264 ? 24.991  -7.217  62.338 1.00 153.35 ? 264  GLU B OE2 1 
ATOM   4031 N N   . ILE B 1 265 ? 19.921  -11.259 64.833 1.00 114.22 ? 265  ILE B N   1 
ATOM   4032 C CA  . ILE B 1 265 ? 18.538  -11.670 64.981 1.00 115.99 ? 265  ILE B CA  1 
ATOM   4033 C C   . ILE B 1 265 ? 18.298  -12.095 66.423 1.00 119.97 ? 265  ILE B C   1 
ATOM   4034 O O   . ILE B 1 265 ? 18.864  -13.083 66.892 1.00 123.49 ? 265  ILE B O   1 
ATOM   4035 C CB  . ILE B 1 265 ? 18.211  -12.853 64.068 1.00 118.91 ? 265  ILE B CB  1 
ATOM   4036 C CG1 . ILE B 1 265 ? 18.473  -12.488 62.607 1.00 115.32 ? 265  ILE B CG1 1 
ATOM   4037 C CG2 . ILE B 1 265 ? 16.773  -13.292 64.271 1.00 123.89 ? 265  ILE B CG2 1 
ATOM   4038 C CD1 . ILE B 1 265 ? 18.230  -13.627 61.650 1.00 118.78 ? 265  ILE B CD1 1 
ATOM   4039 N N   . ILE B 1 266 ? 17.461  -11.340 67.123 1.00 103.51 ? 266  ILE B N   1 
ATOM   4040 C CA  . ILE B 1 266 ? 17.128  -11.632 68.510 1.00 107.68 ? 266  ILE B CA  1 
ATOM   4041 C C   . ILE B 1 266 ? 15.865  -12.484 68.573 1.00 113.94 ? 266  ILE B C   1 
ATOM   4042 O O   . ILE B 1 266 ? 14.752  -11.965 68.484 1.00 115.05 ? 266  ILE B O   1 
ATOM   4043 C CB  . ILE B 1 266 ? 16.933  -10.330 69.311 1.00 105.59 ? 266  ILE B CB  1 
ATOM   4044 C CG1 . ILE B 1 266 ? 18.289  -9.775  69.750 1.00 103.90 ? 266  ILE B CG1 1 
ATOM   4045 C CG2 . ILE B 1 266 ? 16.041  -10.558 70.520 1.00 110.70 ? 266  ILE B CG2 1 
ATOM   4046 C CD1 . ILE B 1 266 ? 18.229  -8.348  70.255 1.00 107.92 ? 266  ILE B CD1 1 
ATOM   4047 N N   . TRP B 1 267 ? 16.040  -13.796 68.713 1.00 118.36 ? 267  TRP B N   1 
ATOM   4048 C CA  . TRP B 1 267 ? 14.905  -14.717 68.719 1.00 127.25 ? 267  TRP B CA  1 
ATOM   4049 C C   . TRP B 1 267 ? 14.026  -14.533 69.954 1.00 132.88 ? 267  TRP B C   1 
ATOM   4050 O O   . TRP B 1 267 ? 14.516  -14.463 71.081 1.00 132.81 ? 267  TRP B O   1 
ATOM   4051 C CB  . TRP B 1 267 ? 15.376  -16.169 68.616 1.00 133.24 ? 267  TRP B CB  1 
ATOM   4052 C CG  . TRP B 1 267 ? 16.163  -16.459 67.377 1.00 129.22 ? 267  TRP B CG  1 
ATOM   4053 C CD1 . TRP B 1 267 ? 17.458  -16.110 67.131 1.00 122.33 ? 267  TRP B CD1 1 
ATOM   4054 C CD2 . TRP B 1 267 ? 15.710  -17.169 66.218 1.00 133.38 ? 267  TRP B CD2 1 
ATOM   4055 N NE1 . TRP B 1 267 ? 17.841  -16.553 65.888 1.00 121.38 ? 267  TRP B NE1 1 
ATOM   4056 C CE2 . TRP B 1 267 ? 16.786  -17.208 65.306 1.00 127.64 ? 267  TRP B CE2 1 
ATOM   4057 C CE3 . TRP B 1 267 ? 14.503  -17.774 65.857 1.00 142.87 ? 267  TRP B CE3 1 
ATOM   4058 C CZ2 . TRP B 1 267 ? 16.689  -17.827 64.063 1.00 129.93 ? 267  TRP B CZ2 1 
ATOM   4059 C CZ3 . TRP B 1 267 ? 14.408  -18.389 64.621 1.00 145.87 ? 267  TRP B CZ3 1 
ATOM   4060 C CH2 . TRP B 1 267 ? 15.494  -18.411 63.740 1.00 138.82 ? 267  TRP B CH2 1 
ATOM   4061 N N   . GLY B 1 268 ? 12.720  -14.453 69.728 1.00 154.69 ? 268  GLY B N   1 
ATOM   4062 C CA  . GLY B 1 268 ? 11.765  -14.288 70.805 1.00 161.73 ? 268  GLY B CA  1 
ATOM   4063 C C   . GLY B 1 268 ? 11.630  -12.846 71.245 1.00 154.91 ? 268  GLY B C   1 
ATOM   4064 O O   . GLY B 1 268 ? 10.718  -12.501 71.998 1.00 160.29 ? 268  GLY B O   1 
ATOM   4065 N N   . GLY B 1 269 ? 12.539  -11.999 70.773 1.00 158.79 ? 269  GLY B N   1 
ATOM   4066 C CA  . GLY B 1 269 ? 12.535  -10.596 71.144 1.00 153.01 ? 269  GLY B CA  1 
ATOM   4067 C C   . GLY B 1 269 ? 11.315  -9.850  70.637 1.00 154.58 ? 269  GLY B C   1 
ATOM   4068 O O   . GLY B 1 269 ? 10.647  -10.286 69.701 1.00 158.47 ? 269  GLY B O   1 
ATOM   4069 N N   . HIS B 1 270 ? 11.022  -8.723  71.274 1.00 125.74 ? 270  HIS B N   1 
ATOM   4070 C CA  . HIS B 1 270 ? 9.960   -7.834  70.831 1.00 126.69 ? 270  HIS B CA  1 
ATOM   4071 C C   . HIS B 1 270 ? 10.482  -6.419  70.909 1.00 118.91 ? 270  HIS B C   1 
ATOM   4072 O O   . HIS B 1 270 ? 11.027  -6.018  71.931 1.00 117.57 ? 270  HIS B O   1 
ATOM   4073 C CB  . HIS B 1 270 ? 8.733   -7.957  71.734 1.00 136.52 ? 270  HIS B CB  1 
ATOM   4074 C CG  . HIS B 1 270 ? 8.079   -9.300  71.688 1.00 147.53 ? 270  HIS B CG  1 
ATOM   4075 N ND1 . HIS B 1 270 ? 8.192   -10.221 72.706 1.00 154.18 ? 270  HIS B ND1 1 
ATOM   4076 C CD2 . HIS B 1 270 ? 7.302   -9.883  70.740 1.00 154.57 ? 270  HIS B CD2 1 
ATOM   4077 C CE1 . HIS B 1 270 ? 7.515   -11.312 72.392 1.00 165.30 ? 270  HIS B CE1 1 
ATOM   4078 N NE2 . HIS B 1 270 ? 6.967   -11.130 71.202 1.00 166.04 ? 270  HIS B NE2 1 
ATOM   4079 N N   . PHE B 1 271 ? 10.330  -5.657  69.836 1.00 114.87 ? 271  PHE B N   1 
ATOM   4080 C CA  . PHE B 1 271 ? 10.719  -4.261  69.892 1.00 109.42 ? 271  PHE B CA  1 
ATOM   4081 C C   . PHE B 1 271 ? 9.878   -3.560  70.933 1.00 113.44 ? 271  PHE B C   1 
ATOM   4082 O O   . PHE B 1 271 ? 8.659   -3.719  70.967 1.00 119.64 ? 271  PHE B O   1 
ATOM   4083 C CB  . PHE B 1 271 ? 10.574  -3.585  68.530 1.00 112.12 ? 271  PHE B CB  1 
ATOM   4084 C CG  . PHE B 1 271 ? 11.698  -3.891  67.596 1.00 107.11 ? 271  PHE B CG  1 
ATOM   4085 C CD1 . PHE B 1 271 ? 11.517  -4.750  66.528 1.00 107.64 ? 271  PHE B CD1 1 
ATOM   4086 C CD2 . PHE B 1 271 ? 12.950  -3.346  67.808 1.00 103.41 ? 271  PHE B CD2 1 
ATOM   4087 C CE1 . PHE B 1 271 ? 12.559  -5.045  65.674 1.00 103.57 ? 271  PHE B CE1 1 
ATOM   4088 C CE2 . PHE B 1 271 ? 13.996  -3.637  66.958 1.00 100.37 ? 271  PHE B CE2 1 
ATOM   4089 C CZ  . PHE B 1 271 ? 13.800  -4.488  65.890 1.00 99.97  ? 271  PHE B CZ  1 
ATOM   4090 N N   . VAL B 1 272 ? 10.544  -2.812  71.803 1.00 129.29 ? 272  VAL B N   1 
ATOM   4091 C CA  . VAL B 1 272 ? 9.847   -1.980  72.765 1.00 132.77 ? 272  VAL B CA  1 
ATOM   4092 C C   . VAL B 1 272 ? 9.076   -0.922  71.995 1.00 132.04 ? 272  VAL B C   1 
ATOM   4093 O O   . VAL B 1 272 ? 9.250   -0.777  70.785 1.00 128.25 ? 272  VAL B O   1 
ATOM   4094 C CB  . VAL B 1 272 ? 10.829  -1.316  73.750 1.00 131.23 ? 272  VAL B CB  1 
ATOM   4095 C CG1 . VAL B 1 272 ? 10.243  -0.034  74.337 1.00 133.29 ? 272  VAL B CG1 1 
ATOM   4096 C CG2 . VAL B 1 272 ? 11.212  -2.290  74.845 1.00 134.45 ? 272  VAL B CG2 1 
ATOM   4097 N N   . ASP B 1 273 ? 8.224   -0.186  72.698 1.00 140.55 ? 273  ASP B N   1 
ATOM   4098 C CA  . ASP B 1 273 ? 7.476   0.873   72.041 1.00 140.82 ? 273  ASP B CA  1 
ATOM   4099 C C   . ASP B 1 273 ? 8.142   2.246   72.291 1.00 137.60 ? 273  ASP B C   1 
ATOM   4100 O O   . ASP B 1 273 ? 8.681   2.482   73.356 1.00 138.18 ? 273  ASP B O   1 
ATOM   4101 C CB  . ASP B 1 273 ? 6.039   0.898   72.542 1.00 149.19 ? 273  ASP B CB  1 
ATOM   4102 C CG  . ASP B 1 273 ? 5.132   1.719   71.642 1.00 150.30 ? 273  ASP B CG  1 
ATOM   4103 O OD1 . ASP B 1 273 ? 5.630   2.250   70.624 1.00 144.25 ? 273  ASP B OD1 1 
ATOM   4104 O OD2 . ASP B 1 273 ? 3.926   1.841   71.941 1.00 158.07 ? 273  ASP B OD2 1 
ATOM   4105 N N   . VAL B 1 274 ? 8.140   3.166   71.324 1.00 142.66 ? 274  VAL B N   1 
ATOM   4106 C CA  . VAL B 1 274 ? 8.828   4.480   71.345 1.00 141.24 ? 274  VAL B CA  1 
ATOM   4107 C C   . VAL B 1 274 ? 7.894   5.687   71.428 1.00 144.63 ? 274  VAL B C   1 
ATOM   4108 O O   . VAL B 1 274 ? 8.321   6.838   71.255 1.00 144.56 ? 274  VAL B O   1 
ATOM   4109 C CB  . VAL B 1 274 ? 9.656   4.711   70.044 1.00 136.87 ? 274  VAL B CB  1 
ATOM   4110 C CG1 . VAL B 1 274 ? 10.880  3.816   70.020 1.00 134.34 ? 274  VAL B CG1 1 
ATOM   4111 C CG2 . VAL B 1 274 ? 8.791   4.531   68.800 1.00 135.93 ? 274  VAL B CG2 1 
ATOM   4112 N N   . PHE B 1 275 ? 6.614   5.426   71.645 1.00 137.42 ? 275  PHE B N   1 
ATOM   4113 C CA  . PHE B 1 275 ? 5.633   6.497   71.698 1.00 138.75 ? 275  PHE B CA  1 
ATOM   4114 C C   . PHE B 1 275 ? 5.241   6.759   73.135 1.00 139.47 ? 275  PHE B C   1 
ATOM   4115 O O   . PHE B 1 275 ? 4.921   5.837   73.884 1.00 133.14 ? 275  PHE B O   1 
ATOM   4116 C CB  . PHE B 1 275 ? 4.412   6.169   70.843 1.00 130.16 ? 275  PHE B CB  1 
ATOM   4117 C CG  . PHE B 1 275 ? 4.682   6.232   69.373 1.00 130.46 ? 275  PHE B CG  1 
ATOM   4118 C CD1 . PHE B 1 275 ? 4.727   5.082   68.610 1.00 123.74 ? 275  PHE B CD1 1 
ATOM   4119 C CD2 . PHE B 1 275 ? 4.916   7.444   68.760 1.00 137.38 ? 275  PHE B CD2 1 
ATOM   4120 C CE1 . PHE B 1 275 ? 4.983   5.147   67.267 1.00 124.00 ? 275  PHE B CE1 1 
ATOM   4121 C CE2 . PHE B 1 275 ? 5.170   7.510   67.423 1.00 137.28 ? 275  PHE B CE2 1 
ATOM   4122 C CZ  . PHE B 1 275 ? 5.205   6.364   66.675 1.00 130.59 ? 275  PHE B CZ  1 
ATOM   4123 N N   . THR B 1 276 ? 5.278   8.030   73.511 1.00 142.69 ? 276  THR B N   1 
ATOM   4124 C CA  . THR B 1 276 ? 5.208   8.432   74.902 1.00 146.51 ? 276  THR B CA  1 
ATOM   4125 C C   . THR B 1 276 ? 4.129   9.469   75.096 1.00 147.59 ? 276  THR B C   1 
ATOM   4126 O O   . THR B 1 276 ? 3.637   10.064  74.142 1.00 147.77 ? 276  THR B O   1 
ATOM   4127 C CB  . THR B 1 276 ? 6.545   9.057   75.342 1.00 157.74 ? 276  THR B CB  1 
ATOM   4128 O OG1 . THR B 1 276 ? 7.579   8.071   75.262 1.00 156.89 ? 276  THR B OG1 1 
ATOM   4129 C CG2 . THR B 1 276 ? 6.466   9.586   76.765 1.00 163.02 ? 276  THR B CG2 1 
ATOM   4130 N N   . THR B 1 277 ? 3.760   9.667   76.350 1.00 133.56 ? 277  THR B N   1 
ATOM   4131 C CA  . THR B 1 277 ? 2.921   10.773  76.744 1.00 136.35 ? 277  THR B CA  1 
ATOM   4132 C C   . THR B 1 277 ? 3.762   11.668  77.632 1.00 147.72 ? 277  THR B C   1 
ATOM   4133 O O   . THR B 1 277 ? 4.240   11.239  78.677 1.00 149.06 ? 277  THR B O   1 
ATOM   4134 C CB  . THR B 1 277 ? 1.739   10.286  77.574 1.00 126.95 ? 277  THR B CB  1 
ATOM   4135 O OG1 . THR B 1 277 ? 1.015   9.291   76.844 1.00 115.49 ? 277  THR B OG1 1 
ATOM   4136 C CG2 . THR B 1 277 ? 0.816   11.432  77.903 1.00 127.87 ? 277  THR B CG2 1 
ATOM   4137 N N   . LEU B 1 278 ? 3.948   12.911  77.222 1.00 135.61 ? 278  LEU B N   1 
ATOM   4138 C CA  . LEU B 1 278 ? 4.718   13.840  78.025 1.00 147.28 ? 278  LEU B CA  1 
ATOM   4139 C C   . LEU B 1 278 ? 3.979   14.147  79.312 1.00 146.98 ? 278  LEU B C   1 
ATOM   4140 O O   . LEU B 1 278 ? 2.801   13.819  79.452 1.00 137.47 ? 278  LEU B O   1 
ATOM   4141 C CB  . LEU B 1 278 ? 4.971   15.126  77.248 1.00 155.65 ? 278  LEU B CB  1 
ATOM   4142 C CG  . LEU B 1 278 ? 5.853   14.918  76.022 1.00 156.79 ? 278  LEU B CG  1 
ATOM   4143 C CD1 . LEU B 1 278 ? 6.013   16.215  75.277 1.00 163.96 ? 278  LEU B CD1 1 
ATOM   4144 C CD2 . LEU B 1 278 ? 7.201   14.378  76.437 1.00 161.47 ? 278  LEU B CD2 1 
ATOM   4145 N N   . PRO B 1 279 ? 4.681   14.755  80.276 1.00 154.13 ? 279  PRO B N   1 
ATOM   4146 C CA  . PRO B 1 279 ? 3.988   15.304  81.436 1.00 155.28 ? 279  PRO B CA  1 
ATOM   4147 C C   . PRO B 1 279 ? 2.964   16.286  80.908 1.00 153.95 ? 279  PRO B C   1 
ATOM   4148 O O   . PRO B 1 279 ? 1.826   16.309  81.357 1.00 147.19 ? 279  PRO B O   1 
ATOM   4149 C CB  . PRO B 1 279 ? 5.102   16.056  82.174 1.00 168.96 ? 279  PRO B CB  1 
ATOM   4150 C CG  . PRO B 1 279 ? 6.173   16.249  81.141 1.00 174.50 ? 279  PRO B CG  1 
ATOM   4151 C CD  . PRO B 1 279 ? 6.128   14.983  80.368 1.00 164.36 ? 279  PRO B CD  1 
ATOM   4152 N N   . ASP B 1 280 ? 3.365   17.073  79.917 1.00 176.60 ? 280  ASP B N   1 
ATOM   4153 C CA  . ASP B 1 280 ? 2.470   18.064  79.345 1.00 176.41 ? 280  ASP B CA  1 
ATOM   4154 C C   . ASP B 1 280 ? 1.219   17.432  78.755 1.00 162.97 ? 280  ASP B C   1 
ATOM   4155 O O   . ASP B 1 280 ? 0.270   18.128  78.448 1.00 160.18 ? 280  ASP B O   1 
ATOM   4156 C CB  . ASP B 1 280 ? 3.174   18.898  78.275 1.00 184.00 ? 280  ASP B CB  1 
ATOM   4157 C CG  . ASP B 1 280 ? 2.255   19.942  77.658 1.00 183.87 ? 280  ASP B CG  1 
ATOM   4158 O OD1 . ASP B 1 280 ? 1.181   20.209  78.238 1.00 179.44 ? 280  ASP B OD1 1 
ATOM   4159 O OD2 . ASP B 1 280 ? 2.600   20.504  76.601 1.00 187.77 ? 280  ASP B OD2 1 
ATOM   4160 N N   . GLY B 1 281 ? 1.214   16.119  78.576 1.00 221.25 ? 281  GLY B N   1 
ATOM   4161 C CA  . GLY B 1 281 ? 0.067   15.473  77.969 1.00 208.69 ? 281  GLY B CA  1 
ATOM   4162 C C   . GLY B 1 281 ? 0.135   15.567  76.462 1.00 207.79 ? 281  GLY B C   1 
ATOM   4163 O O   . GLY B 1 281 ? -0.850  15.353  75.765 1.00 198.79 ? 281  GLY B O   1 
ATOM   4164 N N   . ARG B 1 282 ? 1.316   15.903  75.965 1.00 134.40 ? 282  ARG B N   1 
ATOM   4165 C CA  . ARG B 1 282 ? 1.561   15.937  74.539 1.00 134.39 ? 282  ARG B CA  1 
ATOM   4166 C C   . ARG B 1 282 ? 2.341   14.694  74.143 1.00 130.99 ? 282  ARG B C   1 
ATOM   4167 O O   . ARG B 1 282 ? 3.318   14.327  74.789 1.00 135.14 ? 282  ARG B O   1 
ATOM   4168 C CB  . ARG B 1 282 ? 2.334   17.199  74.174 1.00 146.15 ? 282  ARG B CB  1 
ATOM   4169 C CG  . ARG B 1 282 ? 3.245   17.669  75.282 1.00 156.06 ? 282  ARG B CG  1 
ATOM   4170 C CD  . ARG B 1 282 ? 3.977   18.932  74.892 1.00 167.48 ? 282  ARG B CD  1 
ATOM   4171 N NE  . ARG B 1 282 ? 5.231   19.079  75.622 1.00 177.04 ? 282  ARG B NE  1 
ATOM   4172 C CZ  . ARG B 1 282 ? 6.290   19.715  75.136 1.00 182.59 ? 282  ARG B CZ  1 
ATOM   4173 N NH1 . ARG B 1 282 ? 6.228   20.252  73.927 1.00 172.44 ? 282  ARG B NH1 1 
ATOM   4174 N NH2 . ARG B 1 282 ? 7.405   19.808  75.848 1.00 190.01 ? 282  ARG B NH2 1 
ATOM   4175 N N   . ARG B 1 283 ? 1.887   14.041  73.084 1.00 124.45 ? 283  ARG B N   1 
ATOM   4176 C CA  . ARG B 1 283 ? 2.519   12.837  72.574 1.00 120.18 ? 283  ARG B CA  1 
ATOM   4177 C C   . ARG B 1 283 ? 3.900   13.090  71.982 1.00 128.53 ? 283  ARG B C   1 
ATOM   4178 O O   . ARG B 1 283 ? 4.183   14.170  71.463 1.00 135.93 ? 283  ARG B O   1 
ATOM   4179 C CB  . ARG B 1 283 ? 1.619   12.208  71.519 1.00 110.76 ? 283  ARG B CB  1 
ATOM   4180 C CG  . ARG B 1 283 ? 0.368   11.571  72.068 1.00 100.84 ? 283  ARG B CG  1 
ATOM   4181 C CD  . ARG B 1 283 ? 0.667   10.119  72.330 1.00 101.93 ? 283  ARG B CD  1 
ATOM   4182 N N   . ALA B 1 284 ? 4.729   12.052  72.017 1.00 162.50 ? 284  ALA B N   1 
ATOM   4183 C CA  . ALA B 1 284 ? 6.153   12.181  71.745 1.00 169.89 ? 284  ALA B CA  1 
ATOM   4184 C C   . ALA B 1 284 ? 6.760   11.003  70.991 1.00 164.32 ? 284  ALA B C   1 
ATOM   4185 O O   . ALA B 1 284 ? 6.197   9.915   70.950 1.00 155.65 ? 284  ALA B O   1 
ATOM   4186 C CB  . ALA B 1 284 ? 6.879   12.355  73.043 1.00 177.50 ? 284  ALA B CB  1 
ATOM   4187 N N   . LEU B 1 285 ? 7.927   11.223  70.402 1.00 131.76 ? 285  LEU B N   1 
ATOM   4188 C CA  . LEU B 1 285 ? 8.712   10.110  69.886 1.00 127.20 ? 285  LEU B CA  1 
ATOM   4189 C C   . LEU B 1 285 ? 10.085  10.074  70.540 1.00 133.06 ? 285  LEU B C   1 
ATOM   4190 O O   . LEU B 1 285 ? 10.931  10.932  70.295 1.00 140.55 ? 285  LEU B O   1 
ATOM   4191 C CB  . LEU B 1 285 ? 8.852   10.207  68.365 1.00 181.60 ? 285  LEU B CB  1 
ATOM   4192 C CG  . LEU B 1 285 ? 9.716   9.137   67.694 1.00 181.91 ? 285  LEU B CG  1 
ATOM   4193 C CD1 . LEU B 1 285 ? 9.110   7.756   67.895 1.00 187.65 ? 285  LEU B CD1 1 
ATOM   4194 C CD2 . LEU B 1 285 ? 9.896   9.439   66.215 1.00 177.72 ? 285  LEU B CD2 1 
ATOM   4195 N N   . ASP B 1 286 ? 10.284  9.083   71.400 1.00 140.92 ? 286  ASP B N   1 
ATOM   4196 C CA  . ASP B 1 286 ? 11.596  8.849   71.980 1.00 142.51 ? 286  ASP B CA  1 
ATOM   4197 C C   . ASP B 1 286 ? 12.351  7.840   71.142 1.00 138.13 ? 286  ASP B C   1 
ATOM   4198 O O   . ASP B 1 286 ? 12.229  6.649   71.271 1.00 134.96 ? 286  ASP B O   1 
ATOM   4199 C CB  . ASP B 1 286 ? 11.480  8.332   73.402 1.00 144.59 ? 286  ASP B CB  1 
ATOM   4200 C CG  . ASP B 1 286 ? 12.816  8.184   74.065 1.00 147.65 ? 286  ASP B CG  1 
ATOM   4201 O OD1 . ASP B 1 286 ? 13.818  8.501   73.409 1.00 149.01 ? 286  ASP B OD1 1 
ATOM   4202 O OD2 . ASP B 1 286 ? 12.857  7.756   75.242 1.00 149.77 ? 286  ASP B OD2 1 
ATOM   4203 N N   . LEU B 1 287 ? 13.148  8.351   70.241 1.00 150.17 ? 287  LEU B N   1 
ATOM   4204 C CA  . LEU B 1 287 ? 14.032  7.491   69.469 1.00 147.30 ? 287  LEU B CA  1 
ATOM   4205 C C   . LEU B 1 287 ? 15.140  6.946   70.355 1.00 150.27 ? 287  LEU B C   1 
ATOM   4206 O O   . LEU B 1 287 ? 16.176  6.477   69.879 1.00 150.60 ? 287  LEU B O   1 
ATOM   4207 C CB  . LEU B 1 287 ? 14.611  8.273   68.296 1.00 149.00 ? 287  LEU B CB  1 
ATOM   4208 C CG  . LEU B 1 287 ? 13.484  8.808   67.410 1.00 146.37 ? 287  LEU B CG  1 
ATOM   4209 C CD1 . LEU B 1 287 ? 13.981  9.722   66.281 1.00 149.15 ? 287  LEU B CD1 1 
ATOM   4210 C CD2 . LEU B 1 287 ? 12.676  7.654   66.846 1.00 139.98 ? 287  LEU B CD2 1 
ATOM   4211 N N   . GLY B 1 288 ? 14.898  7.047   71.658 1.00 114.62 ? 288  GLY B N   1 
ATOM   4212 C CA  . GLY B 1 288 ? 15.721  6.404   72.658 1.00 117.56 ? 288  GLY B CA  1 
ATOM   4213 C C   . GLY B 1 288 ? 15.361  4.937   72.782 1.00 112.84 ? 288  GLY B C   1 
ATOM   4214 O O   . GLY B 1 288 ? 16.245  4.090   72.831 1.00 112.79 ? 288  GLY B O   1 
ATOM   4215 N N   . LYS B 1 289 ? 14.068  4.629   72.831 1.00 177.97 ? 289  LYS B N   1 
ATOM   4216 C CA  . LYS B 1 289 ? 13.609  3.246   72.924 1.00 175.02 ? 289  LYS B CA  1 
ATOM   4217 C C   . LYS B 1 289 ? 13.810  2.492   71.621 1.00 170.64 ? 289  LYS B C   1 
ATOM   4218 O O   . LYS B 1 289 ? 13.730  1.271   71.587 1.00 169.17 ? 289  LYS B O   1 
ATOM   4219 C CB  . LYS B 1 289 ? 12.130  3.226   73.304 1.00 175.79 ? 289  LYS B CB  1 
ATOM   4220 C CG  . LYS B 1 289 ? 11.836  4.132   74.473 1.00 180.31 ? 289  LYS B CG  1 
ATOM   4221 C CD  . LYS B 1 289 ? 10.381  4.104   74.875 1.00 182.59 ? 289  LYS B CD  1 
ATOM   4222 C CE  . LYS B 1 289 ? 10.156  5.078   76.007 1.00 187.35 ? 289  LYS B CE  1 
ATOM   4223 N NZ  . LYS B 1 289 ? 11.122  4.771   77.098 1.00 189.52 ? 289  LYS B NZ  1 
ATOM   4224 N N   . PHE B 1 290 ? 14.065  3.228   70.547 1.00 120.25 ? 290  PHE B N   1 
ATOM   4225 C CA  . PHE B 1 290 ? 14.081  2.665   69.197 1.00 116.29 ? 290  PHE B CA  1 
ATOM   4226 C C   . PHE B 1 290 ? 14.888  1.378   69.029 1.00 114.84 ? 290  PHE B C   1 
ATOM   4227 O O   . PHE B 1 290 ? 14.483  0.478   68.293 1.00 112.19 ? 290  PHE B O   1 
ATOM   4228 C CB  . PHE B 1 290 ? 14.554  3.698   68.176 1.00 116.41 ? 290  PHE B CB  1 
ATOM   4229 C CG  . PHE B 1 290 ? 14.419  3.236   66.754 1.00 112.53 ? 290  PHE B CG  1 
ATOM   4230 C CD1 . PHE B 1 290 ? 13.169  3.088   66.181 1.00 110.45 ? 290  PHE B CD1 1 
ATOM   4231 C CD2 . PHE B 1 290 ? 15.538  2.944   65.994 1.00 112.16 ? 290  PHE B CD2 1 
ATOM   4232 C CE1 . PHE B 1 290 ? 13.035  2.662   64.877 1.00 107.70 ? 290  PHE B CE1 1 
ATOM   4233 C CE2 . PHE B 1 290 ? 15.412  2.519   64.687 1.00 108.88 ? 290  PHE B CE2 1 
ATOM   4234 C CZ  . PHE B 1 290 ? 14.158  2.378   64.128 1.00 106.46 ? 290  PHE B CZ  1 
ATOM   4235 N N   . HIS B 1 291 ? 16.032  1.291   69.696 1.00 133.67 ? 291  HIS B N   1 
ATOM   4236 C CA  . HIS B 1 291 ? 16.890  0.123   69.549 1.00 133.16 ? 291  HIS B CA  1 
ATOM   4237 C C   . HIS B 1 291 ? 16.640  -0.909  70.629 1.00 134.16 ? 291  HIS B C   1 
ATOM   4238 O O   . HIS B 1 291 ? 17.301  -1.948  70.666 1.00 134.44 ? 291  HIS B O   1 
ATOM   4239 C CB  . HIS B 1 291 ? 18.360  0.528   69.566 1.00 137.44 ? 291  HIS B CB  1 
ATOM   4240 C CG  . HIS B 1 291 ? 18.797  1.251   68.330 1.00 137.67 ? 291  HIS B CG  1 
ATOM   4241 N ND1 . HIS B 1 291 ? 18.869  0.625   67.099 1.00 133.96 ? 291  HIS B ND1 1 
ATOM   4242 C CD2 . HIS B 1 291 ? 19.174  2.526   68.132 1.00 142.12 ? 291  HIS B CD2 1 
ATOM   4243 C CE1 . HIS B 1 291 ? 19.276  1.500   66.201 1.00 135.77 ? 291  HIS B CE1 1 
ATOM   4244 N NE2 . HIS B 1 291 ? 19.473  2.660   66.789 1.00 141.05 ? 291  HIS B NE2 1 
ATOM   4245 N N   . GLU B 1 292 ? 15.691  -0.630  71.511 1.00 200.10 ? 292  GLU B N   1 
ATOM   4246 C CA  . GLU B 1 292 ? 15.453  -1.522  72.630 1.00 202.44 ? 292  GLU B CA  1 
ATOM   4247 C C   . GLU B 1 292 ? 14.526  -2.677  72.300 1.00 201.89 ? 292  GLU B C   1 
ATOM   4248 O O   . GLU B 1 292 ? 13.403  -2.458  71.824 1.00 201.65 ? 292  GLU B O   1 
ATOM   4249 C CB  . GLU B 1 292 ? 14.957  -0.748  73.845 1.00 205.80 ? 292  GLU B CB  1 
ATOM   4250 C CG  . GLU B 1 292 ? 16.097  -0.172  74.640 1.00 209.38 ? 292  GLU B CG  1 
ATOM   4251 C CD  . GLU B 1 292 ? 15.625  0.691   75.785 1.00 213.15 ? 292  GLU B CD  1 
ATOM   4252 O OE1 . GLU B 1 292 ? 14.456  0.539   76.203 1.00 213.32 ? 292  GLU B OE1 1 
ATOM   4253 O OE2 . GLU B 1 292 ? 16.426  1.515   76.273 1.00 217.24 ? 292  GLU B OE2 1 
ATOM   4254 N N   . ILE B 1 293 ? 15.011  -3.888  72.586 1.00 125.73 ? 293  ILE B N   1 
ATOM   4255 C CA  . ILE B 1 293 ? 14.249  -5.098  72.325 1.00 127.50 ? 293  ILE B CA  1 
ATOM   4256 C C   . ILE B 1 293 ? 13.971  -5.847  73.617 1.00 132.88 ? 293  ILE B C   1 
ATOM   4257 O O   . ILE B 1 293 ? 14.893  -6.340  74.274 1.00 133.99 ? 293  ILE B O   1 
ATOM   4258 C CB  . ILE B 1 293 ? 14.993  -6.029  71.364 1.00 125.57 ? 293  ILE B CB  1 
ATOM   4259 C CG1 . ILE B 1 293 ? 15.439  -5.255  70.128 1.00 120.97 ? 293  ILE B CG1 1 
ATOM   4260 C CG2 . ILE B 1 293 ? 14.114  -7.214  70.974 1.00 128.96 ? 293  ILE B CG2 1 
ATOM   4261 C CD1 . ILE B 1 293 ? 15.990  -6.111  69.040 1.00 119.41 ? 293  ILE B CD1 1 
ATOM   4262 N N   . ALA B 1 294 ? 12.693  -5.930  73.970 1.00 137.37 ? 294  ALA B N   1 
ATOM   4263 C CA  . ALA B 1 294 ? 12.254  -6.682  75.136 1.00 144.22 ? 294  ALA B CA  1 
ATOM   4264 C C   . ALA B 1 294 ? 12.551  -8.161  74.925 1.00 147.09 ? 294  ALA B C   1 
ATOM   4265 O O   . ALA B 1 294 ? 12.588  -8.642  73.792 1.00 145.66 ? 294  ALA B O   1 
ATOM   4266 C CB  . ALA B 1 294 ? 10.768  -6.466  75.368 1.00 150.39 ? 294  ALA B CB  1 
ATOM   4267 N N   . GLN B 1 295 ? 12.764  -8.880  76.019 1.00 149.65 ? 295  GLN B N   1 
ATOM   4268 C CA  . GLN B 1 295 ? 13.087  -10.295 75.937 1.00 153.36 ? 295  GLN B CA  1 
ATOM   4269 C C   . GLN B 1 295 ? 12.654  -11.053 77.189 1.00 162.21 ? 295  GLN B C   1 
ATOM   4270 O O   . GLN B 1 295 ? 12.784  -10.554 78.308 1.00 163.12 ? 295  GLN B O   1 
ATOM   4271 C CB  . GLN B 1 295 ? 14.583  -10.473 75.696 1.00 147.80 ? 295  GLN B CB  1 
ATOM   4272 C CG  . GLN B 1 295 ? 14.975  -11.898 75.405 1.00 151.06 ? 295  GLN B CG  1 
ATOM   4273 C CD  . GLN B 1 295 ? 16.064  -11.988 74.363 1.00 145.26 ? 295  GLN B CD  1 
ATOM   4274 O OE1 . GLN B 1 295 ? 16.976  -11.161 74.329 1.00 140.37 ? 295  GLN B OE1 1 
ATOM   4275 N NE2 . GLN B 1 295 ? 15.973  -12.993 73.497 1.00 147.13 ? 295  GLN B NE2 1 
ATOM   4276 N N   . PRO C 1 12  ? 27.963  -11.111 9.751  1.00 133.74 ? 12   PRO C N   1 
ATOM   4277 C CA  . PRO C 1 12  ? 26.943  -10.232 9.168  1.00 134.45 ? 12   PRO C CA  1 
ATOM   4278 C C   . PRO C 1 12  ? 25.842  -9.913  10.174 1.00 132.50 ? 12   PRO C C   1 
ATOM   4279 O O   . PRO C 1 12  ? 24.666  -10.088 9.857  1.00 131.23 ? 12   PRO C O   1 
ATOM   4280 C CB  . PRO C 1 12  ? 26.366  -11.084 8.038  1.00 133.41 ? 12   PRO C CB  1 
ATOM   4281 C CG  . PRO C 1 12  ? 26.537  -12.502 8.509  1.00 130.90 ? 12   PRO C CG  1 
ATOM   4282 C CD  . PRO C 1 12  ? 27.729  -12.533 9.436  1.00 131.91 ? 12   PRO C CD  1 
ATOM   4283 N N   . ARG C 1 13  ? 26.216  -9.444  11.360 1.00 119.06 ? 13   ARG C N   1 
ATOM   4284 C CA  . ARG C 1 13  ? 25.259  -9.288  12.455 1.00 116.89 ? 13   ARG C CA  1 
ATOM   4285 C C   . ARG C 1 13  ? 24.363  -8.061  12.336 1.00 117.91 ? 13   ARG C C   1 
ATOM   4286 O O   . ARG C 1 13  ? 24.810  -6.982  11.952 1.00 120.93 ? 13   ARG C O   1 
ATOM   4287 C CB  . ARG C 1 13  ? 25.978  -9.295  13.808 1.00 116.13 ? 13   ARG C CB  1 
ATOM   4288 C CG  . ARG C 1 13  ? 27.213  -8.415  13.869 1.00 118.38 ? 13   ARG C CG  1 
ATOM   4289 C CD  . ARG C 1 13  ? 28.120  -8.835  15.016 1.00 117.60 ? 13   ARG C CD  1 
ATOM   4290 N NE  . ARG C 1 13  ? 27.439  -8.778  16.306 1.00 115.40 ? 13   ARG C NE  1 
ATOM   4291 C CZ  . ARG C 1 13  ? 28.006  -9.097  17.465 1.00 114.78 ? 13   ARG C CZ  1 
ATOM   4292 N NH1 . ARG C 1 13  ? 29.270  -9.502  17.502 1.00 116.28 ? 13   ARG C NH1 1 
ATOM   4293 N NH2 . ARG C 1 13  ? 27.310  -9.011  18.590 1.00 112.93 ? 13   ARG C NH2 1 
ATOM   4294 N N   . ILE C 1 14  ? 23.091  -8.249  12.677 1.00 99.30  ? 14   ILE C N   1 
ATOM   4295 C CA  . ILE C 1 14  ? 22.110  -7.171  12.701 1.00 100.15 ? 14   ILE C CA  1 
ATOM   4296 C C   . ILE C 1 14  ? 22.442  -6.176  13.797 1.00 100.39 ? 14   ILE C C   1 
ATOM   4297 O O   . ILE C 1 14  ? 22.330  -4.968  13.608 1.00 103.16 ? 14   ILE C O   1 
ATOM   4298 C CB  . ILE C 1 14  ? 20.697  -7.698  13.005 1.00 97.54  ? 14   ILE C CB  1 
ATOM   4299 C CG1 . ILE C 1 14  ? 20.433  -9.007  12.262 1.00 96.12  ? 14   ILE C CG1 1 
ATOM   4300 C CG2 . ILE C 1 14  ? 19.658  -6.646  12.688 1.00 99.22  ? 14   ILE C CG2 1 
ATOM   4301 C CD1 . ILE C 1 14  ? 21.018  -9.051  10.866 1.00 98.09  ? 14   ILE C CD1 1 
ATOM   4302 N N   . LEU C 1 15  ? 22.830  -6.695  14.955 1.00 63.05  ? 15   LEU C N   1 
ATOM   4303 C CA  . LEU C 1 15  ? 23.176  -5.862  16.096 1.00 62.54  ? 15   LEU C CA  1 
ATOM   4304 C C   . LEU C 1 15  ? 24.648  -5.983  16.452 1.00 63.07  ? 15   LEU C C   1 
ATOM   4305 O O   . LEU C 1 15  ? 25.213  -7.078  16.457 1.00 62.48  ? 15   LEU C O   1 
ATOM   4306 C CB  . LEU C 1 15  ? 22.334  -6.248  17.307 1.00 59.40  ? 15   LEU C CB  1 
ATOM   4307 C CG  . LEU C 1 15  ? 20.843  -5.960  17.185 1.00 58.71  ? 15   LEU C CG  1 
ATOM   4308 C CD1 . LEU C 1 15  ? 20.073  -6.694  18.265 1.00 55.87  ? 15   LEU C CD1 1 
ATOM   4309 C CD2 . LEU C 1 15  ? 20.597  -4.461  17.258 1.00 60.41  ? 15   LEU C CD2 1 
ATOM   4310 N N   . ASN C 1 16  ? 25.262  -4.848  16.760 1.00 77.14  ? 16   ASN C N   1 
ATOM   4311 C CA  . ASN C 1 16  ? 26.652  -4.827  17.178 1.00 77.67  ? 16   ASN C CA  1 
ATOM   4312 C C   . ASN C 1 16  ? 26.767  -5.134  18.659 1.00 74.67  ? 16   ASN C C   1 
ATOM   4313 O O   . ASN C 1 16  ? 25.766  -5.142  19.372 1.00 72.47  ? 16   ASN C O   1 
ATOM   4314 C CB  . ASN C 1 16  ? 27.264  -3.463  16.882 1.00 80.95  ? 16   ASN C CB  1 
ATOM   4315 C CG  . ASN C 1 16  ? 27.076  -3.048  15.439 1.00 85.10  ? 16   ASN C CG  1 
ATOM   4316 O OD1 . ASN C 1 16  ? 27.093  -3.884  14.536 1.00 85.57  ? 16   ASN C OD1 1 
ATOM   4317 N ND2 . ASN C 1 16  ? 26.893  -1.753  15.213 1.00 88.60  ? 16   ASN C ND2 1 
ATOM   4318 N N   . SER C 1 17  ? 27.986  -5.382  19.120 1.00 92.56  ? 17   SER C N   1 
ATOM   4319 C CA  . SER C 1 17  ? 28.221  -5.669  20.524 1.00 90.30  ? 17   SER C CA  1 
ATOM   4320 C C   . SER C 1 17  ? 27.792  -4.500  21.398 1.00 88.64  ? 17   SER C C   1 
ATOM   4321 O O   . SER C 1 17  ? 27.230  -4.698  22.469 1.00 86.13  ? 17   SER C O   1 
ATOM   4322 C CB  . SER C 1 17  ? 29.693  -5.976  20.753 1.00 91.51  ? 17   SER C CB  1 
ATOM   4323 O OG  . SER C 1 17  ? 30.165  -6.853  19.750 1.00 93.51  ? 17   SER C OG  1 
ATOM   4324 N N   . ASP C 1 18  ? 28.046  -3.279  20.942 1.00 104.60 ? 18   ASP C N   1 
ATOM   4325 C CA  . ASP C 1 18  ? 27.653  -2.102  21.713 1.00 103.56 ? 18   ASP C CA  1 
ATOM   4326 C C   . ASP C 1 18  ? 26.127  -1.965  21.842 1.00 102.33 ? 18   ASP C C   1 
ATOM   4327 O O   . ASP C 1 18  ? 25.631  -1.116  22.584 1.00 101.35 ? 18   ASP C O   1 
ATOM   4328 C CB  . ASP C 1 18  ? 28.262  -0.830  21.116 1.00 107.12 ? 18   ASP C CB  1 
ATOM   4329 C CG  . ASP C 1 18  ? 27.551  -0.377  19.855 1.00 110.83 ? 18   ASP C CG  1 
ATOM   4330 O OD1 . ASP C 1 18  ? 27.608  -1.108  18.842 1.00 112.45 ? 18   ASP C OD1 1 
ATOM   4331 O OD2 . ASP C 1 18  ? 26.943  0.717   19.878 1.00 112.41 ? 18   ASP C OD2 1 
ATOM   4332 N N   . GLY C 1 19  ? 25.390  -2.807  21.125 1.00 53.09  ? 19   GLY C N   1 
ATOM   4333 C CA  . GLY C 1 19  ? 23.937  -2.794  21.176 1.00 51.73  ? 19   GLY C CA  1 
ATOM   4334 C C   . GLY C 1 19  ? 23.276  -1.960  20.086 1.00 54.69  ? 19   GLY C C   1 
ATOM   4335 O O   . GLY C 1 19  ? 22.051  -1.942  19.950 1.00 54.13  ? 19   GLY C O   1 
ATOM   4336 N N   . SER C 1 20  ? 24.086  -1.252  19.310 1.00 84.58  ? 20   SER C N   1 
ATOM   4337 C CA  . SER C 1 20  ? 23.563  -0.410  18.247 1.00 88.94  ? 20   SER C CA  1 
ATOM   4338 C C   . SER C 1 20  ? 23.216  -1.281  17.057 1.00 90.14  ? 20   SER C C   1 
ATOM   4339 O O   . SER C 1 20  ? 24.004  -2.137  16.660 1.00 90.05  ? 20   SER C O   1 
ATOM   4340 C CB  . SER C 1 20  ? 24.605  0.629   17.840 1.00 93.50  ? 20   SER C CB  1 
ATOM   4341 O OG  . SER C 1 20  ? 25.795  -0.005  17.402 1.00 94.19  ? 20   SER C OG  1 
ATOM   4342 N N   . SER C 1 21  ? 22.037  -1.077  16.484 1.00 121.10 ? 21   SER C N   1 
ATOM   4343 C CA  . SER C 1 21  ? 21.662  -1.859  15.316 1.00 122.17 ? 21   SER C CA  1 
ATOM   4344 C C   . SER C 1 21  ? 22.610  -1.531  14.166 1.00 127.11 ? 21   SER C C   1 
ATOM   4345 O O   . SER C 1 21  ? 23.166  -0.432  14.097 1.00 131.27 ? 21   SER C O   1 
ATOM   4346 C CB  . SER C 1 21  ? 20.211  -1.609  14.923 1.00 122.79 ? 21   SER C CB  1 
ATOM   4347 O OG  . SER C 1 21  ? 20.092  -0.383  14.232 1.00 128.66 ? 21   SER C OG  1 
ATOM   4348 N N   . ASN C 1 22  ? 22.793  -2.494  13.270 1.00 87.93  ? 22   ASN C N   1 
ATOM   4349 C CA  . ASN C 1 22  ? 23.873  -2.444  12.298 1.00 91.77  ? 22   ASN C CA  1 
ATOM   4350 C C   . ASN C 1 22  ? 23.338  -2.362  10.887 1.00 95.53  ? 22   ASN C C   1 
ATOM   4351 O O   . ASN C 1 22  ? 23.495  -3.303  10.106 1.00 94.63  ? 22   ASN C O   1 
ATOM   4352 C CB  . ASN C 1 22  ? 24.731  -3.693  12.430 1.00 88.39  ? 22   ASN C CB  1 
ATOM   4353 C CG  . ASN C 1 22  ? 25.991  -3.610  11.619 1.00 91.87  ? 22   ASN C CG  1 
ATOM   4354 O OD1 . ASN C 1 22  ? 26.396  -2.528  11.195 1.00 96.86  ? 22   ASN C OD1 1 
ATOM   4355 N ND2 . ASN C 1 22  ? 26.629  -4.750  11.399 1.00 89.74  ? 22   ASN C ND2 1 
ATOM   4356 N N   . ILE C 1 23  ? 22.715  -1.229  10.572 1.00 119.13 ? 23   ILE C N   1 
ATOM   4357 C CA  . ILE C 1 23  ? 21.875  -1.087  9.391  1.00 123.15 ? 23   ILE C CA  1 
ATOM   4358 C C   . ILE C 1 23  ? 22.261  0.142   8.605  1.00 131.83 ? 23   ILE C C   1 
ATOM   4359 O O   . ILE C 1 23  ? 22.678  1.139   9.183  1.00 134.73 ? 23   ILE C O   1 
ATOM   4360 C CB  . ILE C 1 23  ? 20.390  -0.995  9.805  1.00 121.29 ? 23   ILE C CB  1 
ATOM   4361 C CG1 . ILE C 1 23  ? 20.030  -2.245  10.588 1.00 113.52 ? 23   ILE C CG1 1 
ATOM   4362 C CG2 . ILE C 1 23  ? 19.477  -0.870  8.603  1.00 125.13 ? 23   ILE C CG2 1 
ATOM   4363 C CD1 . ILE C 1 23  ? 20.763  -3.491  10.067 1.00 111.04 ? 23   ILE C CD1 1 
ATOM   4364 N N   . THR C 1 24  ? 22.136  0.061   7.284  1.00 61.10  ? 24   THR C N   1 
ATOM   4365 C CA  . THR C 1 24  ? 22.388  1.217   6.435  1.00 70.80  ? 24   THR C CA  1 
ATOM   4366 C C   . THR C 1 24  ? 21.116  2.038   6.246  1.00 75.05  ? 24   THR C C   1 
ATOM   4367 O O   . THR C 1 24  ? 20.114  1.529   5.752  1.00 73.22  ? 24   THR C O   1 
ATOM   4368 C CB  . THR C 1 24  ? 22.897  0.809   5.052  1.00 74.63  ? 24   THR C CB  1 
ATOM   4369 O OG1 . THR C 1 24  ? 23.966  -0.136  5.185  1.00 69.60  ? 24   THR C OG1 1 
ATOM   4370 C CG2 . THR C 1 24  ? 23.392  2.027   4.316  1.00 85.59  ? 24   THR C CG2 1 
ATOM   4371 N N   . ARG C 1 25  ? 21.154  3.309   6.630  1.00 60.54  ? 25   ARG C N   1 
ATOM   4372 C CA  . ARG C 1 25  ? 19.951  4.135   6.567  1.00 65.27  ? 25   ARG C CA  1 
ATOM   4373 C C   . ARG C 1 25  ? 19.870  4.874   5.230  1.00 73.49  ? 25   ARG C C   1 
ATOM   4374 O O   . ARG C 1 25  ? 20.864  5.433   4.769  1.00 78.85  ? 25   ARG C O   1 
ATOM   4375 C CB  . ARG C 1 25  ? 19.923  5.134   7.726  1.00 52.66  ? 25   ARG C CB  1 
ATOM   4376 N N   . LEU C 1 26  ? 18.689  4.858   4.607  1.00 82.35  ? 26   LEU C N   1 
ATOM   4377 C CA  . LEU C 1 26  ? 18.487  5.455   3.279  1.00 88.31  ? 26   LEU C CA  1 
ATOM   4378 C C   . LEU C 1 26  ? 17.486  6.616   3.290  1.00 93.98  ? 26   LEU C C   1 
ATOM   4379 O O   . LEU C 1 26  ? 16.271  6.398   3.292  1.00 90.52  ? 26   LEU C O   1 
ATOM   4380 C CB  . LEU C 1 26  ? 18.006  4.394   2.285  1.00 83.63  ? 26   LEU C CB  1 
ATOM   4381 C CG  . LEU C 1 26  ? 18.765  3.071   2.287  1.00 77.46  ? 26   LEU C CG  1 
ATOM   4382 C CD1 . LEU C 1 26  ? 18.247  2.132   1.218  1.00 73.55  ? 26   LEU C CD1 1 
ATOM   4383 C CD2 . LEU C 1 26  ? 20.218  3.344   2.081  1.00 81.83  ? 26   LEU C CD2 1 
ATOM   4384 N N   . GLY C 1 27  ? 17.995  7.846   3.277  1.00 130.51 ? 27   GLY C N   1 
ATOM   4385 C CA  . GLY C 1 27  ? 17.140  9.019   3.350  1.00 133.86 ? 27   GLY C CA  1 
ATOM   4386 C C   . GLY C 1 27  ? 17.526  10.112  2.375  1.00 140.33 ? 27   GLY C C   1 
ATOM   4387 O O   . GLY C 1 27  ? 17.478  11.298  2.708  1.00 145.52 ? 27   GLY C O   1 
ATOM   4388 N N   . TRP C 1 33  ? 20.172  22.240  9.102  1.00 117.06 ? 33   TRP C N   1 
ATOM   4389 C CA  . TRP C 1 33  ? 21.323  23.071  9.445  1.00 118.48 ? 33   TRP C CA  1 
ATOM   4390 C C   . TRP C 1 33  ? 21.197  23.682  10.844 1.00 116.50 ? 33   TRP C C   1 
ATOM   4391 O O   . TRP C 1 33  ? 22.068  23.485  11.688 1.00 114.04 ? 33   TRP C O   1 
ATOM   4392 C CB  . TRP C 1 33  ? 21.536  24.167  8.395  1.00 123.97 ? 33   TRP C CB  1 
ATOM   4393 N N   . LEU C 1 34  ? 20.120  24.424  11.085 1.00 171.33 ? 34   LEU C N   1 
ATOM   4394 C CA  . LEU C 1 34  ? 19.859  24.986  12.408 1.00 168.36 ? 34   LEU C CA  1 
ATOM   4395 C C   . LEU C 1 34  ? 18.679  24.271  13.053 1.00 165.91 ? 34   LEU C C   1 
ATOM   4396 O O   . LEU C 1 34  ? 18.281  24.584  14.177 1.00 163.74 ? 34   LEU C O   1 
ATOM   4397 C CB  . LEU C 1 34  ? 19.575  26.486  12.313 1.00 171.01 ? 34   LEU C CB  1 
ATOM   4398 C CG  . LEU C 1 34  ? 20.741  27.349  11.828 1.00 173.70 ? 34   LEU C CG  1 
ATOM   4399 C CD1 . LEU C 1 34  ? 20.314  28.802  11.651 1.00 176.59 ? 34   LEU C CD1 1 
ATOM   4400 C CD2 . LEU C 1 34  ? 21.914  27.244  12.788 1.00 170.88 ? 34   LEU C CD2 1 
ATOM   4401 N N   . ASP C 1 35  ? 18.137  23.299  12.327 1.00 250.06 ? 35   ASP C N   1 
ATOM   4402 C CA  . ASP C 1 35  ? 16.937  22.576  12.732 1.00 248.89 ? 35   ASP C CA  1 
ATOM   4403 C C   . ASP C 1 35  ? 17.020  21.987  14.143 1.00 244.58 ? 35   ASP C C   1 
ATOM   4404 O O   . ASP C 1 35  ? 16.136  22.209  14.970 1.00 244.20 ? 35   ASP C O   1 
ATOM   4405 C CB  . ASP C 1 35  ? 16.648  21.465  11.719 1.00 248.70 ? 35   ASP C CB  1 
ATOM   4406 C CG  . ASP C 1 35  ? 15.171  21.137  11.613 1.00 249.33 ? 35   ASP C CG  1 
ATOM   4407 O OD1 . ASP C 1 35  ? 14.350  21.868  12.206 1.00 251.59 ? 35   ASP C OD1 1 
ATOM   4408 O OD2 . ASP C 1 35  ? 14.828  20.151  10.927 1.00 247.90 ? 35   ASP C OD2 1 
ATOM   4409 N N   . ASP C 1 36  ? 18.083  21.234  14.410 1.00 117.06 ? 36   ASP C N   1 
ATOM   4410 C CA  . ASP C 1 36  ? 18.215  20.507  15.669 1.00 110.68 ? 36   ASP C CA  1 
ATOM   4411 C C   . ASP C 1 36  ? 19.287  21.124  16.566 1.00 108.86 ? 36   ASP C C   1 
ATOM   4412 O O   . ASP C 1 36  ? 20.202  20.439  17.012 1.00 103.63 ? 36   ASP C O   1 
ATOM   4413 C CB  . ASP C 1 36  ? 18.558  19.046  15.377 1.00 105.50 ? 36   ASP C CB  1 
ATOM   4414 C CG  . ASP C 1 36  ? 18.137  18.114  16.491 1.00 97.16  ? 36   ASP C CG  1 
ATOM   4415 O OD1 . ASP C 1 36  ? 17.879  18.606  17.610 1.00 94.68  ? 36   ASP C OD1 1 
ATOM   4416 O OD2 . ASP C 1 36  ? 18.060  16.890  16.248 1.00 93.46  ? 36   ASP C OD2 1 
ATOM   4417 N N   . HIS C 1 37  ? 19.162  22.418  16.840 1.00 149.77 ? 37   HIS C N   1 
ATOM   4418 C CA  . HIS C 1 37  ? 20.229  23.160  17.508 1.00 148.52 ? 37   HIS C CA  1 
ATOM   4419 C C   . HIS C 1 37  ? 20.684  22.544  18.836 1.00 141.45 ? 37   HIS C C   1 
ATOM   4420 O O   . HIS C 1 37  ? 21.879  22.341  19.052 1.00 139.32 ? 37   HIS C O   1 
ATOM   4421 C CB  . HIS C 1 37  ? 19.856  24.645  17.670 1.00 150.39 ? 37   HIS C CB  1 
ATOM   4422 C CG  . HIS C 1 37  ? 18.964  24.934  18.842 1.00 148.98 ? 37   HIS C CG  1 
ATOM   4423 N ND1 . HIS C 1 37  ? 17.719  24.362  18.992 1.00 149.46 ? 37   HIS C ND1 1 
ATOM   4424 C CD2 . HIS C 1 37  ? 19.133  25.755  19.905 1.00 147.67 ? 37   HIS C CD2 1 
ATOM   4425 C CE1 . HIS C 1 37  ? 17.165  24.806  20.106 1.00 147.74 ? 37   HIS C CE1 1 
ATOM   4426 N NE2 . HIS C 1 37  ? 18.000  25.653  20.680 1.00 147.56 ? 37   HIS C NE2 1 
ATOM   4427 N N   . TYR C 1 38  ? 19.735  22.228  19.710 1.00 117.53 ? 38   TYR C N   1 
ATOM   4428 C CA  . TYR C 1 38  ? 20.074  21.780  21.054 1.00 109.84 ? 38   TYR C CA  1 
ATOM   4429 C C   . TYR C 1 38  ? 20.746  20.416  21.051 1.00 102.97 ? 38   TYR C C   1 
ATOM   4430 O O   . TYR C 1 38  ? 21.771  20.217  21.703 1.00 96.61  ? 38   TYR C O   1 
ATOM   4431 C CB  . TYR C 1 38  ? 18.835  21.759  21.945 1.00 105.88 ? 38   TYR C CB  1 
ATOM   4432 C CG  . TYR C 1 38  ? 19.127  21.294  23.350 1.00 91.32  ? 38   TYR C CG  1 
ATOM   4433 C CD1 . TYR C 1 38  ? 20.026  21.981  24.152 1.00 89.70  ? 38   TYR C CD1 1 
ATOM   4434 C CD2 . TYR C 1 38  ? 18.510  20.167  23.873 1.00 79.71  ? 38   TYR C CD2 1 
ATOM   4435 C CE1 . TYR C 1 38  ? 20.301  21.559  25.436 1.00 76.75  ? 38   TYR C CE1 1 
ATOM   4436 C CE2 . TYR C 1 38  ? 18.778  19.736  25.154 1.00 67.43  ? 38   TYR C CE2 1 
ATOM   4437 C CZ  . TYR C 1 38  ? 19.673  20.435  25.931 1.00 65.91  ? 38   TYR C CZ  1 
ATOM   4438 O OH  . TYR C 1 38  ? 19.937  20.003  27.210 1.00 62.41  ? 38   TYR C OH  1 
ATOM   4439 N N   . HIS C 1 39  ? 20.155  19.476  20.325 1.00 103.95 ? 39   HIS C N   1 
ATOM   4440 C CA  . HIS C 1 39  ? 20.744  18.155  20.159 1.00 96.00  ? 39   HIS C CA  1 
ATOM   4441 C C   . HIS C 1 39  ? 22.167  18.296  19.637 1.00 101.17 ? 39   HIS C C   1 
ATOM   4442 O O   . HIS C 1 39  ? 23.118  17.790  20.231 1.00 93.73  ? 39   HIS C O   1 
ATOM   4443 C CB  . HIS C 1 39  ? 19.901  17.332  19.183 1.00 97.33  ? 39   HIS C CB  1 
ATOM   4444 C CG  . HIS C 1 39  ? 20.614  16.154  18.601 1.00 93.47  ? 39   HIS C CG  1 
ATOM   4445 N ND1 . HIS C 1 39  ? 21.560  16.273  17.600 1.00 101.48 ? 39   HIS C ND1 1 
ATOM   4446 C CD2 . HIS C 1 39  ? 20.507  14.831  18.861 1.00 83.02  ? 39   HIS C CD2 1 
ATOM   4447 C CE1 . HIS C 1 39  ? 22.009  15.076  17.283 1.00 95.56  ? 39   HIS C CE1 1 
ATOM   4448 N NE2 . HIS C 1 39  ? 21.392  14.181  18.029 1.00 84.55  ? 39   HIS C NE2 1 
ATOM   4449 N N   . ASP C 1 40  ? 22.303  19.005  18.524 1.00 97.08  ? 40   ASP C N   1 
ATOM   4450 C CA  . ASP C 1 40  ? 23.591  19.172  17.868 1.00 100.65 ? 40   ASP C CA  1 
ATOM   4451 C C   . ASP C 1 40  ? 24.663  19.704  18.815 1.00 98.79  ? 40   ASP C C   1 
ATOM   4452 O O   . ASP C 1 40  ? 25.809  19.258  18.775 1.00 97.82  ? 40   ASP C O   1 
ATOM   4453 C CB  . ASP C 1 40  ? 23.451  20.092  16.656 1.00 109.71 ? 40   ASP C CB  1 
ATOM   4454 C CG  . ASP C 1 40  ? 22.555  19.505  15.581 1.00 112.07 ? 40   ASP C CG  1 
ATOM   4455 O OD1 . ASP C 1 40  ? 22.200  18.311  15.690 1.00 106.58 ? 40   ASP C OD1 1 
ATOM   4456 O OD2 . ASP C 1 40  ? 22.206  20.238  14.629 1.00 119.51 ? 40   ASP C OD2 1 
ATOM   4457 N N   . LEU C 1 41  ? 24.292  20.656  19.664 1.00 90.09  ? 41   LEU C N   1 
ATOM   4458 C CA  . LEU C 1 41  ? 25.248  21.244  20.596 1.00 88.34  ? 41   LEU C CA  1 
ATOM   4459 C C   . LEU C 1 41  ? 25.735  20.233  21.631 1.00 77.63  ? 41   LEU C C   1 
ATOM   4460 O O   . LEU C 1 41  ? 26.893  20.259  22.037 1.00 75.12  ? 41   LEU C O   1 
ATOM   4461 C CB  . LEU C 1 41  ? 24.654  22.477  21.279 1.00 89.70  ? 41   LEU C CB  1 
ATOM   4462 C CG  . LEU C 1 41  ? 24.657  23.731  20.406 1.00 98.73  ? 41   LEU C CG  1 
ATOM   4463 C CD1 . LEU C 1 41  ? 23.780  24.819  21.008 1.00 100.28 ? 41   LEU C CD1 1 
ATOM   4464 C CD2 . LEU C 1 41  ? 26.084  24.222  20.194 1.00 102.14 ? 41   LEU C CD2 1 
ATOM   4465 N N   . LEU C 1 42  ? 24.850  19.338  22.051 1.00 100.57 ? 42   LEU C N   1 
ATOM   4466 C CA  . LEU C 1 42  ? 25.228  18.305  23.002 1.00 87.01  ? 42   LEU C CA  1 
ATOM   4467 C C   . LEU C 1 42  ? 25.915  17.134  22.308 1.00 85.16  ? 42   LEU C C   1 
ATOM   4468 O O   . LEU C 1 42  ? 26.586  16.334  22.954 1.00 76.39  ? 42   LEU C O   1 
ATOM   4469 C CB  . LEU C 1 42  ? 23.998  17.792  23.756 1.00 78.07  ? 42   LEU C CB  1 
ATOM   4470 C CG  . LEU C 1 42  ? 23.231  18.765  24.648 1.00 77.24  ? 42   LEU C CG  1 
ATOM   4471 C CD1 . LEU C 1 42  ? 22.199  18.017  25.471 1.00 66.79  ? 42   LEU C CD1 1 
ATOM   4472 C CD2 . LEU C 1 42  ? 24.194  19.511  25.548 1.00 75.51  ? 42   LEU C CD2 1 
ATOM   4473 N N   . THR C 1 43  ? 25.741  17.034  20.994 1.00 79.52  ? 43   THR C N   1 
ATOM   4474 C CA  . THR C 1 43  ? 26.199  15.870  20.236 1.00 77.81  ? 43   THR C CA  1 
ATOM   4475 C C   . THR C 1 43  ? 27.596  16.077  19.659 1.00 83.85  ? 43   THR C C   1 
ATOM   4476 O O   . THR C 1 43  ? 28.336  15.125  19.424 1.00 80.12  ? 43   THR C O   1 
ATOM   4477 C CB  . THR C 1 43  ? 25.212  15.558  19.095 1.00 83.19  ? 43   THR C CB  1 
ATOM   4478 O OG1 . THR C 1 43  ? 23.951  15.169  19.654 1.00 76.43  ? 43   THR C OG1 1 
ATOM   4479 C CG2 . THR C 1 43  ? 25.735  14.438  18.203 1.00 82.42  ? 43   THR C CG2 1 
ATOM   4480 N N   . VAL C 1 44  ? 27.945  17.336  19.440 1.00 115.43 ? 44   VAL C N   1 
ATOM   4481 C CA  . VAL C 1 44  ? 29.215  17.705  18.838 1.00 113.13 ? 44   VAL C CA  1 
ATOM   4482 C C   . VAL C 1 44  ? 30.411  17.288  19.700 1.00 112.66 ? 44   VAL C C   1 
ATOM   4483 O O   . VAL C 1 44  ? 30.280  17.141  20.913 1.00 114.31 ? 44   VAL C O   1 
ATOM   4484 C CB  . VAL C 1 44  ? 29.237  19.221  18.605 1.00 113.78 ? 44   VAL C CB  1 
ATOM   4485 C CG1 . VAL C 1 44  ? 30.646  19.723  18.485 1.00 112.29 ? 44   VAL C CG1 1 
ATOM   4486 C CG2 . VAL C 1 44  ? 28.414  19.573  17.378 1.00 114.31 ? 44   VAL C CG2 1 
ATOM   4487 N N   . SER C 1 45  ? 31.569  17.087  19.071 1.00 78.12  ? 45   SER C N   1 
ATOM   4488 C CA  . SER C 1 45  ? 32.802  16.779  19.801 1.00 77.81  ? 45   SER C CA  1 
ATOM   4489 C C   . SER C 1 45  ? 33.305  17.995  20.581 1.00 78.59  ? 45   SER C C   1 
ATOM   4490 O O   . SER C 1 45  ? 33.153  19.132  20.131 1.00 72.57  ? 45   SER C O   1 
ATOM   4491 C CB  . SER C 1 45  ? 33.897  16.304  18.843 1.00 78.00  ? 45   SER C CB  1 
ATOM   4492 O OG  . SER C 1 45  ? 34.531  17.397  18.193 1.00 75.79  ? 45   SER C OG  1 
ATOM   4493 N N   . TRP C 1 46  ? 33.912  17.760  21.742 1.00 79.15  ? 46   TRP C N   1 
ATOM   4494 C CA  . TRP C 1 46  ? 34.378  18.872  22.568 1.00 81.42  ? 46   TRP C CA  1 
ATOM   4495 C C   . TRP C 1 46  ? 35.174  19.905  21.768 1.00 81.03  ? 46   TRP C C   1 
ATOM   4496 O O   . TRP C 1 46  ? 34.862  21.095  21.823 1.00 83.56  ? 46   TRP C O   1 
ATOM   4497 C CB  . TRP C 1 46  ? 35.158  18.387  23.798 1.00 83.32  ? 46   TRP C CB  1 
ATOM   4498 C CG  . TRP C 1 46  ? 34.264  17.951  24.926 1.00 85.96  ? 46   TRP C CG  1 
ATOM   4499 C CD1 . TRP C 1 46  ? 34.067  16.678  25.365 1.00 86.37  ? 46   TRP C CD1 1 
ATOM   4500 C CD2 . TRP C 1 46  ? 33.433  18.792  25.744 1.00 89.59  ? 46   TRP C CD2 1 
ATOM   4501 N NE1 . TRP C 1 46  ? 33.169  16.669  26.407 1.00 89.60  ? 46   TRP C NE1 1 
ATOM   4502 C CE2 . TRP C 1 46  ? 32.765  17.952  26.659 1.00 91.56  ? 46   TRP C CE2 1 
ATOM   4503 C CE3 . TRP C 1 46  ? 33.189  20.167  25.791 1.00 92.39  ? 46   TRP C CE3 1 
ATOM   4504 C CZ2 . TRP C 1 46  ? 31.872  18.445  27.611 1.00 95.81  ? 46   TRP C CZ2 1 
ATOM   4505 C CZ3 . TRP C 1 46  ? 32.299  20.655  26.740 1.00 97.15  ? 46   TRP C CZ3 1 
ATOM   4506 C CH2 . TRP C 1 46  ? 31.654  19.796  27.635 1.00 98.58  ? 46   TRP C CH2 1 
ATOM   4507 N N   . PRO C 1 47  ? 36.197  19.456  21.016 1.00 75.06  ? 47   PRO C N   1 
ATOM   4508 C CA  . PRO C 1 47  ? 36.909  20.386  20.135 1.00 74.93  ? 47   PRO C CA  1 
ATOM   4509 C C   . PRO C 1 47  ? 35.935  21.321  19.423 1.00 75.75  ? 47   PRO C C   1 
ATOM   4510 O O   . PRO C 1 47  ? 35.995  22.540  19.610 1.00 79.07  ? 47   PRO C O   1 
ATOM   4511 C CB  . PRO C 1 47  ? 37.555  19.456  19.112 1.00 72.24  ? 47   PRO C CB  1 
ATOM   4512 C CG  . PRO C 1 47  ? 37.794  18.194  19.858 1.00 72.46  ? 47   PRO C CG  1 
ATOM   4513 C CD  . PRO C 1 47  ? 36.717  18.080  20.903 1.00 73.50  ? 47   PRO C CD  1 
ATOM   4514 N N   . VAL C 1 48  ? 35.041  20.744  18.625 1.00 85.32  ? 48   VAL C N   1 
ATOM   4515 C CA  . VAL C 1 48  ? 34.066  21.522  17.866 1.00 86.39  ? 48   VAL C CA  1 
ATOM   4516 C C   . VAL C 1 48  ? 33.210  22.433  18.753 1.00 90.27  ? 48   VAL C C   1 
ATOM   4517 O O   . VAL C 1 48  ? 33.070  23.628  18.473 1.00 93.56  ? 48   VAL C O   1 
ATOM   4518 C CB  . VAL C 1 48  ? 33.143  20.612  17.040 1.00 84.61  ? 48   VAL C CB  1 
ATOM   4519 C CG1 . VAL C 1 48  ? 32.069  21.442  16.342 1.00 86.44  ? 48   VAL C CG1 1 
ATOM   4520 C CG2 . VAL C 1 48  ? 33.944  19.799  16.041 1.00 82.58  ? 48   VAL C CG2 1 
ATOM   4521 N N   . PHE C 1 49  ? 32.638  21.864  19.812 1.00 81.15  ? 49   PHE C N   1 
ATOM   4522 C CA  . PHE C 1 49  ? 31.828  22.633  20.751 1.00 85.61  ? 49   PHE C CA  1 
ATOM   4523 C C   . PHE C 1 49  ? 32.569  23.884  21.221 1.00 90.07  ? 49   PHE C C   1 
ATOM   4524 O O   . PHE C 1 49  ? 32.025  24.989  21.173 1.00 94.84  ? 49   PHE C O   1 
ATOM   4525 C CB  . PHE C 1 49  ? 31.424  21.767  21.945 1.00 86.01  ? 49   PHE C CB  1 
ATOM   4526 C CG  . PHE C 1 49  ? 30.738  22.525  23.051 1.00 91.50  ? 49   PHE C CG  1 
ATOM   4527 C CD1 . PHE C 1 49  ? 29.426  22.948  22.916 1.00 94.05  ? 49   PHE C CD1 1 
ATOM   4528 C CD2 . PHE C 1 49  ? 31.401  22.793  24.236 1.00 94.86  ? 49   PHE C CD2 1 
ATOM   4529 C CE1 . PHE C 1 49  ? 28.795  23.634  23.935 1.00 99.97  ? 49   PHE C CE1 1 
ATOM   4530 C CE2 . PHE C 1 49  ? 30.773  23.476  25.258 1.00 100.99 ? 49   PHE C CE2 1 
ATOM   4531 C CZ  . PHE C 1 49  ? 29.468  23.896  25.107 1.00 103.64 ? 49   PHE C CZ  1 
ATOM   4532 N N   . ILE C 1 50  ? 33.812  23.707  21.663 1.00 86.60  ? 50   ILE C N   1 
ATOM   4533 C CA  . ILE C 1 50  ? 34.632  24.822  22.125 1.00 91.66  ? 50   ILE C CA  1 
ATOM   4534 C C   . ILE C 1 50  ? 34.850  25.840  21.011 1.00 93.44  ? 50   ILE C C   1 
ATOM   4535 O O   . ILE C 1 50  ? 34.759  27.049  21.235 1.00 100.08 ? 50   ILE C O   1 
ATOM   4536 C CB  . ILE C 1 50  ? 35.995  24.340  22.641 1.00 90.55  ? 50   ILE C CB  1 
ATOM   4537 C CG1 . ILE C 1 50  ? 35.814  23.210  23.653 1.00 89.09  ? 50   ILE C CG1 1 
ATOM   4538 C CG2 . ILE C 1 50  ? 36.752  25.486  23.273 1.00 97.19  ? 50   ILE C CG2 1 
ATOM   4539 C CD1 . ILE C 1 50  ? 37.114  22.580  24.103 1.00 87.90  ? 50   ILE C CD1 1 
ATOM   4540 N N   . THR C 1 51  ? 35.136  25.339  19.812 1.00 78.20  ? 51   THR C N   1 
ATOM   4541 C CA  . THR C 1 51  ? 35.287  26.182  18.632 1.00 79.72  ? 51   THR C CA  1 
ATOM   4542 C C   . THR C 1 51  ? 34.064  27.060  18.427 1.00 84.23  ? 51   THR C C   1 
ATOM   4543 O O   . THR C 1 51  ? 34.174  28.282  18.351 1.00 90.52  ? 51   THR C O   1 
ATOM   4544 C CB  . THR C 1 51  ? 35.465  25.335  17.374 1.00 74.17  ? 51   THR C CB  1 
ATOM   4545 O OG1 . THR C 1 51  ? 36.645  24.538  17.504 1.00 70.97  ? 51   THR C OG1 1 
ATOM   4546 C CG2 . THR C 1 51  ? 35.589  26.221  16.146 1.00 76.28  ? 51   THR C CG2 1 
ATOM   4547 N N   . LEU C 1 52  ? 32.905  26.416  18.322 1.00 76.78  ? 52   LEU C N   1 
ATOM   4548 C CA  . LEU C 1 52  ? 31.631  27.103  18.151 1.00 80.99  ? 52   LEU C CA  1 
ATOM   4549 C C   . LEU C 1 52  ? 31.470  28.234  19.138 1.00 89.07  ? 52   LEU C C   1 
ATOM   4550 O O   . LEU C 1 52  ? 31.159  29.365  18.770 1.00 95.53  ? 52   LEU C O   1 
ATOM   4551 C CB  . LEU C 1 52  ? 30.485  26.126  18.371 1.00 77.88  ? 52   LEU C CB  1 
ATOM   4552 C CG  . LEU C 1 52  ? 30.170  25.215  17.197 1.00 72.68  ? 52   LEU C CG  1 
ATOM   4553 C CD1 . LEU C 1 52  ? 28.943  24.387  17.518 1.00 71.69  ? 52   LEU C CD1 1 
ATOM   4554 C CD2 . LEU C 1 52  ? 29.952  26.066  15.958 1.00 75.07  ? 52   LEU C CD2 1 
ATOM   4555 N N   . ILE C 1 53  ? 31.649  27.900  20.407 1.00 80.08  ? 53   ILE C N   1 
ATOM   4556 C CA  . ILE C 1 53  ? 31.583  28.883  21.470 1.00 88.76  ? 53   ILE C CA  1 
ATOM   4557 C C   . ILE C 1 53  ? 32.563  30.014  21.193 1.00 94.42  ? 53   ILE C C   1 
ATOM   4558 O O   . ILE C 1 53  ? 32.176  31.179  21.136 1.00 98.04  ? 53   ILE C O   1 
ATOM   4559 C CB  . ILE C 1 53  ? 31.882  28.233  22.822 1.00 88.18  ? 53   ILE C CB  1 
ATOM   4560 C CG1 . ILE C 1 53  ? 30.668  27.417  23.272 1.00 86.14  ? 53   ILE C CG1 1 
ATOM   4561 C CG2 . ILE C 1 53  ? 32.260  29.284  23.853 1.00 93.21  ? 53   ILE C CG2 1 
ATOM   4562 C CD1 . ILE C 1 53  ? 30.793  26.853  24.659 1.00 87.12  ? 53   ILE C CD1 1 
ATOM   4563 N N   . THR C 1 54  ? 33.830  29.662  21.002 1.00 75.23  ? 54   THR C N   1 
ATOM   4564 C CA  . THR C 1 54  ? 34.849  30.641  20.642 1.00 80.36  ? 54   THR C CA  1 
ATOM   4565 C C   . THR C 1 54  ? 34.386  31.532  19.490 1.00 83.86  ? 54   THR C C   1 
ATOM   4566 O O   . THR C 1 54  ? 34.314  32.752  19.627 1.00 88.03  ? 54   THR C O   1 
ATOM   4567 C CB  . THR C 1 54  ? 36.162  29.958  20.231 1.00 73.97  ? 54   THR C CB  1 
ATOM   4568 O OG1 . THR C 1 54  ? 36.498  28.947  21.189 1.00 69.68  ? 54   THR C OG1 1 
ATOM   4569 C CG2 . THR C 1 54  ? 37.289  30.979  20.146 1.00 80.69  ? 54   THR C CG2 1 
ATOM   4570 N N   . GLY C 1 55  ? 34.086  30.919  18.350 1.00 70.01  ? 55   GLY C N   1 
ATOM   4571 C CA  . GLY C 1 55  ? 33.574  31.657  17.210 1.00 73.44  ? 55   GLY C CA  1 
ATOM   4572 C C   . GLY C 1 55  ? 32.512  32.651  17.637 1.00 81.74  ? 55   GLY C C   1 
ATOM   4573 O O   . GLY C 1 55  ? 32.662  33.854  17.441 1.00 86.34  ? 55   GLY C O   1 
ATOM   4574 N N   . LEU C 1 56  ? 31.439  32.141  18.232 1.00 96.67  ? 56   LEU C N   1 
ATOM   4575 C CA  . LEU C 1 56  ? 30.361  32.981  18.736 1.00 98.70  ? 56   LEU C CA  1 
ATOM   4576 C C   . LEU C 1 56  ? 30.913  34.144  19.560 1.00 98.16  ? 56   LEU C C   1 
ATOM   4577 O O   . LEU C 1 56  ? 30.541  35.300  19.362 1.00 99.55  ? 56   LEU C O   1 
ATOM   4578 C CB  . LEU C 1 56  ? 29.400  32.138  19.573 1.00 96.49  ? 56   LEU C CB  1 
ATOM   4579 C CG  . LEU C 1 56  ? 28.213  32.871  20.191 1.00 96.42  ? 56   LEU C CG  1 
ATOM   4580 C CD1 . LEU C 1 56  ? 27.691  33.938  19.242 1.00 99.60  ? 56   LEU C CD1 1 
ATOM   4581 C CD2 . LEU C 1 56  ? 27.111  31.891  20.560 1.00 96.28  ? 56   LEU C CD2 1 
ATOM   4582 N N   . TYR C 1 57  ? 31.813  33.814  20.477 1.00 143.93 ? 57   TYR C N   1 
ATOM   4583 C CA  . TYR C 1 57  ? 32.470  34.778  21.349 1.00 144.64 ? 57   TYR C CA  1 
ATOM   4584 C C   . TYR C 1 57  ? 33.145  35.899  20.561 1.00 147.76 ? 57   TYR C C   1 
ATOM   4585 O O   . TYR C 1 57  ? 32.783  37.069  20.691 1.00 148.67 ? 57   TYR C O   1 
ATOM   4586 C CB  . TYR C 1 57  ? 33.494  34.024  22.193 1.00 144.93 ? 57   TYR C CB  1 
ATOM   4587 C CG  . TYR C 1 57  ? 34.321  34.857  23.135 1.00 147.24 ? 57   TYR C CG  1 
ATOM   4588 C CD1 . TYR C 1 57  ? 33.731  35.769  23.995 1.00 147.11 ? 57   TYR C CD1 1 
ATOM   4589 C CD2 . TYR C 1 57  ? 35.698  34.693  23.195 1.00 144.30 ? 57   TYR C CD2 1 
ATOM   4590 C CE1 . TYR C 1 57  ? 34.492  36.514  24.868 1.00 150.14 ? 57   TYR C CE1 1 
ATOM   4591 C CE2 . TYR C 1 57  ? 36.468  35.432  24.063 1.00 142.48 ? 57   TYR C CE2 1 
ATOM   4592 C CZ  . TYR C 1 57  ? 35.861  36.341  24.897 1.00 145.40 ? 57   TYR C CZ  1 
ATOM   4593 O OH  . TYR C 1 57  ? 36.631  37.080  25.765 1.00 144.59 ? 57   TYR C OH  1 
ATOM   4594 N N   . LEU C 1 58  ? 34.129  35.532  19.747 1.00 107.50 ? 58   LEU C N   1 
ATOM   4595 C CA  . LEU C 1 58  ? 34.829  36.492  18.906 1.00 106.42 ? 58   LEU C CA  1 
ATOM   4596 C C   . LEU C 1 58  ? 33.836  37.284  18.072 1.00 111.64 ? 58   LEU C C   1 
ATOM   4597 O O   . LEU C 1 58  ? 33.771  38.508  18.164 1.00 113.42 ? 58   LEU C O   1 
ATOM   4598 C CB  . LEU C 1 58  ? 35.825  35.774  17.998 1.00 103.01 ? 58   LEU C CB  1 
ATOM   4599 C CG  . LEU C 1 58  ? 36.787  34.865  18.761 1.00 99.15  ? 58   LEU C CG  1 
ATOM   4600 C CD1 . LEU C 1 58  ? 37.954  34.465  17.885 1.00 96.41  ? 58   LEU C CD1 1 
ATOM   4601 C CD2 . LEU C 1 58  ? 37.282  35.565  20.012 1.00 97.29  ? 58   LEU C CD2 1 
ATOM   4602 N N   . VAL C 1 59  ? 33.058  36.571  17.265 1.00 73.00  ? 59   VAL C N   1 
ATOM   4603 C CA  . VAL C 1 59  ? 32.024  37.189  16.448 1.00 74.84  ? 59   VAL C CA  1 
ATOM   4604 C C   . VAL C 1 59  ? 31.307  38.320  17.181 1.00 74.07  ? 59   VAL C C   1 
ATOM   4605 O O   . VAL C 1 59  ? 31.425  39.479  16.791 1.00 77.09  ? 59   VAL C O   1 
ATOM   4606 C CB  . VAL C 1 59  ? 30.986  36.157  15.966 1.00 74.41  ? 59   VAL C CB  1 
ATOM   4607 C CG1 . VAL C 1 59  ? 29.805  36.853  15.300 1.00 77.54  ? 59   VAL C CG1 1 
ATOM   4608 C CG2 . VAL C 1 59  ? 31.635  35.158  15.019 1.00 76.74  ? 59   VAL C CG2 1 
ATOM   4609 N N   . THR C 1 60  ? 30.578  37.994  18.245 1.00 130.03 ? 60   THR C N   1 
ATOM   4610 C CA  . THR C 1 60  ? 29.767  39.001  18.934 1.00 130.34 ? 60   THR C CA  1 
ATOM   4611 C C   . THR C 1 60  ? 30.570  40.233  19.376 1.00 131.96 ? 60   THR C C   1 
ATOM   4612 O O   . THR C 1 60  ? 30.080  41.359  19.276 1.00 134.51 ? 60   THR C O   1 
ATOM   4613 C CB  . THR C 1 60  ? 29.003  38.427  20.147 1.00 127.47 ? 60   THR C CB  1 
ATOM   4614 O OG1 . THR C 1 60  ? 29.895  38.289  21.259 1.00 125.60 ? 60   THR C OG1 1 
ATOM   4615 C CG2 . THR C 1 60  ? 28.383  37.085  19.807 1.00 126.22 ? 60   THR C CG2 1 
ATOM   4616 N N   . ASN C 1 61  ? 31.791  40.025  19.864 1.00 107.07 ? 61   ASN C N   1 
ATOM   4617 C CA  . ASN C 1 61  ? 32.655  41.146  20.233 1.00 109.90 ? 61   ASN C CA  1 
ATOM   4618 C C   . ASN C 1 61  ? 32.964  42.045  19.051 1.00 113.97 ? 61   ASN C C   1 
ATOM   4619 O O   . ASN C 1 61  ? 32.955  43.269  19.172 1.00 116.79 ? 61   ASN C O   1 
ATOM   4620 C CB  . ASN C 1 61  ? 33.962  40.654  20.841 1.00 110.31 ? 61   ASN C CB  1 
ATOM   4621 C CG  . ASN C 1 61  ? 33.847  40.384  22.319 1.00 108.66 ? 61   ASN C CG  1 
ATOM   4622 O OD1 . ASN C 1 61  ? 33.561  41.283  23.111 1.00 110.09 ? 61   ASN C OD1 1 
ATOM   4623 N ND2 . ASN C 1 61  ? 34.079  39.138  22.704 1.00 106.47 ? 61   ASN C ND2 1 
ATOM   4624 N N   . ALA C 1 62  ? 33.261  41.428  17.913 1.00 87.12  ? 62   ALA C N   1 
ATOM   4625 C CA  . ALA C 1 62  ? 33.458  42.167  16.677 1.00 91.81  ? 62   ALA C CA  1 
ATOM   4626 C C   . ALA C 1 62  ? 32.222  43.014  16.391 1.00 93.15  ? 62   ALA C C   1 
ATOM   4627 O O   . ALA C 1 62  ? 32.321  44.220  16.169 1.00 96.89  ? 62   ALA C O   1 
ATOM   4628 C CB  . ALA C 1 62  ? 33.727  41.214  15.531 1.00 89.67  ? 62   ALA C CB  1 
ATOM   4629 N N   . LEU C 1 63  ? 31.058  42.375  16.403 1.00 106.67 ? 63   LEU C N   1 
ATOM   4630 C CA  . LEU C 1 63  ? 29.801  43.087  16.225 1.00 109.03 ? 63   LEU C CA  1 
ATOM   4631 C C   . LEU C 1 63  ? 29.727  44.289  17.154 1.00 109.73 ? 63   LEU C C   1 
ATOM   4632 O O   . LEU C 1 63  ? 29.482  45.409  16.716 1.00 114.11 ? 63   LEU C O   1 
ATOM   4633 C CB  . LEU C 1 63  ? 28.615  42.159  16.484 1.00 106.85 ? 63   LEU C CB  1 
ATOM   4634 C CG  . LEU C 1 63  ? 28.312  41.120  15.407 1.00 108.20 ? 63   LEU C CG  1 
ATOM   4635 C CD1 . LEU C 1 63  ? 27.228  40.169  15.890 1.00 106.16 ? 63   LEU C CD1 1 
ATOM   4636 C CD2 . LEU C 1 63  ? 27.907  41.804  14.109 1.00 114.87 ? 63   LEU C CD2 1 
ATOM   4637 N N   . PHE C 1 64  ? 29.941  44.050  18.443 1.00 119.82 ? 64   PHE C N   1 
ATOM   4638 C CA  . PHE C 1 64  ? 29.913  45.129  19.421 1.00 121.23 ? 64   PHE C CA  1 
ATOM   4639 C C   . PHE C 1 64  ? 30.930  46.219  19.106 1.00 125.13 ? 64   PHE C C   1 
ATOM   4640 O O   . PHE C 1 64  ? 30.594  47.401  19.133 1.00 128.91 ? 64   PHE C O   1 
ATOM   4641 C CB  . PHE C 1 64  ? 30.100  44.599  20.844 1.00 117.92 ? 64   PHE C CB  1 
ATOM   4642 C CG  . PHE C 1 64  ? 28.810  44.433  21.598 1.00 117.14 ? 64   PHE C CG  1 
ATOM   4643 C CD1 . PHE C 1 64  ? 28.136  43.224  21.600 1.00 114.18 ? 64   PHE C CD1 1 
ATOM   4644 C CD2 . PHE C 1 64  ? 28.264  45.496  22.296 1.00 120.36 ? 64   PHE C CD2 1 
ATOM   4645 C CE1 . PHE C 1 64  ? 26.945  43.079  22.294 1.00 114.63 ? 64   PHE C CE1 1 
ATOM   4646 C CE2 . PHE C 1 64  ? 27.074  45.355  22.989 1.00 120.91 ? 64   PHE C CE2 1 
ATOM   4647 C CZ  . PHE C 1 64  ? 26.415  44.146  22.988 1.00 118.14 ? 64   PHE C CZ  1 
ATOM   4648 N N   . ALA C 1 65  ? 32.164  45.825  18.805 1.00 102.73 ? 65   ALA C N   1 
ATOM   4649 C CA  . ALA C 1 65  ? 33.184  46.781  18.385 1.00 107.55 ? 65   ALA C CA  1 
ATOM   4650 C C   . ALA C 1 65  ? 32.634  47.731  17.320 1.00 111.99 ? 65   ALA C C   1 
ATOM   4651 O O   . ALA C 1 65  ? 32.697  48.953  17.468 1.00 115.96 ? 65   ALA C O   1 
ATOM   4652 C CB  . ALA C 1 65  ? 34.415  46.055  17.866 1.00 108.18 ? 65   ALA C CB  1 
ATOM   4653 N N   . LEU C 1 66  ? 32.095  47.162  16.246 1.00 103.61 ? 66   LEU C N   1 
ATOM   4654 C CA  . LEU C 1 66  ? 31.474  47.955  15.191 1.00 108.83 ? 66   LEU C CA  1 
ATOM   4655 C C   . LEU C 1 66  ? 30.455  48.934  15.753 1.00 110.52 ? 66   LEU C C   1 
ATOM   4656 O O   . LEU C 1 66  ? 30.450  50.106  15.390 1.00 115.84 ? 66   LEU C O   1 
ATOM   4657 C CB  . LEU C 1 66  ? 30.805  47.050  14.157 1.00 109.18 ? 66   LEU C CB  1 
ATOM   4658 C CG  . LEU C 1 66  ? 31.691  46.593  12.999 1.00 112.13 ? 66   LEU C CG  1 
ATOM   4659 C CD1 . LEU C 1 66  ? 33.027  46.093  13.516 1.00 109.50 ? 66   LEU C CD1 1 
ATOM   4660 C CD2 . LEU C 1 66  ? 30.986  45.529  12.169 1.00 112.44 ? 66   LEU C CD2 1 
ATOM   4661 N N   . ALA C 1 67  ? 29.586  48.444  16.629 1.00 122.78 ? 67   ALA C N   1 
ATOM   4662 C CA  . ALA C 1 67  ? 28.619  49.301  17.295 1.00 124.99 ? 67   ALA C CA  1 
ATOM   4663 C C   . ALA C 1 67  ? 29.325  50.511  17.890 1.00 127.79 ? 67   ALA C C   1 
ATOM   4664 O O   . ALA C 1 67  ? 28.867  51.643  17.735 1.00 133.00 ? 67   ALA C O   1 
ATOM   4665 C CB  . ALA C 1 67  ? 27.879  48.531  18.371 1.00 120.74 ? 67   ALA C CB  1 
ATOM   4666 N N   . TYR C 1 68  ? 30.449  50.272  18.559 1.00 135.53 ? 68   TYR C N   1 
ATOM   4667 C CA  . TYR C 1 68  ? 31.222  51.357  19.155 1.00 139.17 ? 68   TYR C CA  1 
ATOM   4668 C C   . TYR C 1 68  ? 31.753  52.322  18.104 1.00 145.01 ? 68   TYR C C   1 
ATOM   4669 O O   . TYR C 1 68  ? 31.427  53.509  18.114 1.00 150.04 ? 68   TYR C O   1 
ATOM   4670 C CB  . TYR C 1 68  ? 32.353  50.812  20.026 1.00 136.78 ? 68   TYR C CB  1 
ATOM   4671 C CG  . TYR C 1 68  ? 31.850  50.299  21.348 1.00 133.39 ? 68   TYR C CG  1 
ATOM   4672 C CD1 . TYR C 1 68  ? 31.980  48.964  21.694 1.00 128.20 ? 68   TYR C CD1 1 
ATOM   4673 C CD2 . TYR C 1 68  ? 31.207  51.148  22.235 1.00 136.19 ? 68   TYR C CD2 1 
ATOM   4674 C CE1 . TYR C 1 68  ? 31.507  48.495  22.894 1.00 125.91 ? 68   TYR C CE1 1 
ATOM   4675 C CE2 . TYR C 1 68  ? 30.730  50.689  23.438 1.00 134.21 ? 68   TYR C CE2 1 
ATOM   4676 C CZ  . TYR C 1 68  ? 30.882  49.362  23.763 1.00 129.05 ? 68   TYR C CZ  1 
ATOM   4677 O OH  . TYR C 1 68  ? 30.405  48.900  24.965 1.00 127.81 ? 68   TYR C OH  1 
ATOM   4678 N N   . LEU C 1 69  ? 32.551  51.805  17.182 1.00 151.25 ? 69   LEU C N   1 
ATOM   4679 C CA  . LEU C 1 69  ? 33.033  52.611  16.078 1.00 157.44 ? 69   LEU C CA  1 
ATOM   4680 C C   . LEU C 1 69  ? 31.887  53.379  15.452 1.00 161.40 ? 69   LEU C C   1 
ATOM   4681 O O   . LEU C 1 69  ? 32.000  54.570  15.181 1.00 167.44 ? 69   LEU C O   1 
ATOM   4682 C CB  . LEU C 1 69  ? 33.669  51.716  15.027 1.00 157.22 ? 69   LEU C CB  1 
ATOM   4683 C CG  . LEU C 1 69  ? 34.940  51.051  15.528 1.00 155.29 ? 69   LEU C CG  1 
ATOM   4684 C CD1 . LEU C 1 69  ? 35.687  50.404  14.384 1.00 153.13 ? 69   LEU C CD1 1 
ATOM   4685 C CD2 . LEU C 1 69  ? 35.797  52.100  16.200 1.00 159.75 ? 69   LEU C CD2 1 
ATOM   4686 N N   . ALA C 1 70  ? 30.781  52.682  15.219 1.00 154.52 ? 70   ALA C N   1 
ATOM   4687 C CA  . ALA C 1 70  ? 29.621  53.282  14.578 1.00 159.64 ? 70   ALA C CA  1 
ATOM   4688 C C   . ALA C 1 70  ? 29.288  54.624  15.210 1.00 163.99 ? 70   ALA C C   1 
ATOM   4689 O O   . ALA C 1 70  ? 28.977  55.584  14.510 1.00 170.88 ? 70   ALA C O   1 
ATOM   4690 C CB  . ALA C 1 70  ? 28.436  52.354  14.662 1.00 156.66 ? 70   ALA C CB  1 
ATOM   4691 N N   . CYS C 1 71  ? 29.348  54.684  16.536 1.00 204.39 ? 71   CYS C N   1 
ATOM   4692 C CA  . CYS C 1 71  ? 29.166  55.940  17.249 1.00 209.03 ? 71   CYS C CA  1 
ATOM   4693 C C   . CYS C 1 71  ? 30.326  56.881  16.951 1.00 213.73 ? 71   CYS C C   1 
ATOM   4694 O O   . CYS C 1 71  ? 30.143  58.083  16.794 1.00 220.30 ? 71   CYS C O   1 
ATOM   4695 C CB  . CYS C 1 71  ? 29.047  55.694  18.754 1.00 205.32 ? 71   CYS C CB  1 
ATOM   4696 S SG  . CYS C 1 71  ? 27.617  54.702  19.228 1.00 201.40 ? 71   CYS C SG  1 
ATOM   4697 N N   . GLY C 1 72  ? 31.524  56.318  16.882 1.00 187.52 ? 72   GLY C N   1 
ATOM   4698 C CA  . GLY C 1 72  ? 32.697  57.067  16.477 1.00 194.96 ? 72   GLY C CA  1 
ATOM   4699 C C   . GLY C 1 72  ? 33.472  57.654  17.635 1.00 202.01 ? 72   GLY C C   1 
ATOM   4700 O O   . GLY C 1 72  ? 33.002  58.571  18.303 1.00 204.12 ? 72   GLY C O   1 
ATOM   4701 N N   . ASP C 1 73  ? 34.661  57.116  17.880 1.00 224.82 ? 73   ASP C N   1 
ATOM   4702 C CA  . ASP C 1 73  ? 35.585  57.697  18.848 1.00 232.12 ? 73   ASP C CA  1 
ATOM   4703 C C   . ASP C 1 73  ? 34.956  57.901  20.218 1.00 231.19 ? 73   ASP C C   1 
ATOM   4704 O O   . ASP C 1 73  ? 35.074  58.974  20.803 1.00 236.30 ? 73   ASP C O   1 
ATOM   4705 C CB  . ASP C 1 73  ? 36.094  59.045  18.337 1.00 239.00 ? 73   ASP C CB  1 
ATOM   4706 C CG  . ASP C 1 73  ? 36.891  58.921  17.059 1.00 241.40 ? 73   ASP C CG  1 
ATOM   4707 O OD1 . ASP C 1 73  ? 37.138  57.782  16.617 1.00 237.96 ? 73   ASP C OD1 1 
ATOM   4708 O OD2 . ASP C 1 73  ? 37.273  59.969  16.497 1.00 246.87 ? 73   ASP C OD2 1 
ATOM   4709 N N   . VAL C 1 74  ? 34.290  56.877  20.732 1.00 171.59 ? 74   VAL C N   1 
ATOM   4710 C CA  . VAL C 1 74  ? 33.627  57.001  22.021 1.00 170.40 ? 74   VAL C CA  1 
ATOM   4711 C C   . VAL C 1 74  ? 34.343  56.249  23.126 1.00 172.13 ? 74   VAL C C   1 
ATOM   4712 O O   . VAL C 1 74  ? 33.786  56.040  24.197 1.00 169.76 ? 74   VAL C O   1 
ATOM   4713 C CB  . VAL C 1 74  ? 32.162  56.536  21.959 1.00 167.05 ? 74   VAL C CB  1 
ATOM   4714 C CG1 . VAL C 1 74  ? 31.237  57.723  21.799 1.00 171.67 ? 74   VAL C CG1 1 
ATOM   4715 C CG2 . VAL C 1 74  ? 31.968  55.550  20.832 1.00 165.95 ? 74   VAL C CG2 1 
ATOM   4716 N N   . ILE C 1 75  ? 35.578  55.843  22.868 1.00 163.56 ? 75   ILE C N   1 
ATOM   4717 C CA  . ILE C 1 75  ? 36.344  55.139  23.883 1.00 159.75 ? 75   ILE C CA  1 
ATOM   4718 C C   . ILE C 1 75  ? 37.659  55.826  24.207 1.00 168.87 ? 75   ILE C C   1 
ATOM   4719 O O   . ILE C 1 75  ? 38.501  56.047  23.339 1.00 173.17 ? 75   ILE C O   1 
ATOM   4720 C CB  . ILE C 1 75  ? 36.596  53.679  23.498 1.00 155.76 ? 75   ILE C CB  1 
ATOM   4721 C CG1 . ILE C 1 75  ? 35.275  52.915  23.488 1.00 152.78 ? 75   ILE C CG1 1 
ATOM   4722 C CG2 . ILE C 1 75  ? 37.564  53.033  24.474 1.00 159.71 ? 75   ILE C CG2 1 
ATOM   4723 C CD1 . ILE C 1 75  ? 35.334  51.646  22.695 1.00 148.60 ? 75   ILE C CD1 1 
ATOM   4724 N N   . GLU C 1 76  ? 37.815  56.161  25.479 1.00 217.92 ? 76   GLU C N   1 
ATOM   4725 C CA  . GLU C 1 76  ? 39.040  56.749  25.978 1.00 226.50 ? 76   GLU C CA  1 
ATOM   4726 C C   . GLU C 1 76  ? 40.245  55.959  25.490 1.00 229.77 ? 76   GLU C C   1 
ATOM   4727 O O   . GLU C 1 76  ? 40.210  54.731  25.422 1.00 225.51 ? 76   GLU C O   1 
ATOM   4728 C CB  . GLU C 1 76  ? 39.022  56.755  27.506 1.00 227.56 ? 76   GLU C CB  1 
ATOM   4729 C CG  . GLU C 1 76  ? 39.978  57.749  28.118 1.00 236.26 ? 76   GLU C CG  1 
ATOM   4730 C CD  . GLU C 1 76  ? 39.687  59.161  27.665 1.00 239.29 ? 76   GLU C CD  1 
ATOM   4731 O OE1 . GLU C 1 76  ? 38.516  59.583  27.768 1.00 234.86 ? 76   GLU C OE1 1 
ATOM   4732 O OE2 . GLU C 1 76  ? 40.623  59.846  27.202 1.00 246.29 ? 76   GLU C OE2 1 
ATOM   4733 N N   . ASN C 1 77  ? 41.306  56.677  25.140 1.00 153.79 ? 77   ASN C N   1 
ATOM   4734 C CA  . ASN C 1 77  ? 42.589  56.063  24.818 1.00 150.74 ? 77   ASN C CA  1 
ATOM   4735 C C   . ASN C 1 77  ? 42.536  55.018  23.712 1.00 153.85 ? 77   ASN C C   1 
ATOM   4736 O O   . ASN C 1 77  ? 43.348  54.094  23.679 1.00 147.84 ? 77   ASN C O   1 
ATOM   4737 C CB  . ASN C 1 77  ? 43.209  55.460  26.078 1.00 153.17 ? 77   ASN C CB  1 
ATOM   4738 C CG  . ASN C 1 77  ? 43.734  56.517  27.026 1.00 160.20 ? 77   ASN C CG  1 
ATOM   4739 O OD1 . ASN C 1 77  ? 44.743  57.166  26.749 1.00 167.89 ? 77   ASN C OD1 1 
ATOM   4740 N ND2 . ASN C 1 77  ? 43.053  56.695  28.153 1.00 157.69 ? 77   ASN C ND2 1 
ATOM   4741 N N   . ALA C 1 78  ? 41.578  55.164  22.808 1.00 208.17 ? 78   ALA C N   1 
ATOM   4742 C CA  . ALA C 1 78  ? 41.479  54.266  21.669 1.00 203.74 ? 78   ALA C CA  1 
ATOM   4743 C C   . ALA C 1 78  ? 42.006  54.976  20.438 1.00 207.92 ? 78   ALA C C   1 
ATOM   4744 O O   . ALA C 1 78  ? 41.616  56.108  20.154 1.00 209.41 ? 78   ALA C O   1 
ATOM   4745 C CB  . ALA C 1 78  ? 40.040  53.832  21.455 1.00 194.36 ? 78   ALA C CB  1 
ATOM   4746 N N   . ARG C 1 79  ? 42.909  54.323  19.717 1.00 205.47 ? 79   ARG C N   1 
ATOM   4747 C CA  . ARG C 1 79  ? 43.354  54.855  18.442 1.00 208.70 ? 79   ARG C CA  1 
ATOM   4748 C C   . ARG C 1 79  ? 42.110  55.119  17.612 1.00 201.72 ? 79   ARG C C   1 
ATOM   4749 O O   . ARG C 1 79  ? 41.256  54.243  17.476 1.00 193.85 ? 79   ARG C O   1 
ATOM   4750 C CB  . ARG C 1 79  ? 44.288  53.871  17.737 1.00 210.24 ? 79   ARG C CB  1 
ATOM   4751 C CG  . ARG C 1 79  ? 45.558  53.587  18.516 1.00 213.54 ? 79   ARG C CG  1 
ATOM   4752 C CD  . ARG C 1 79  ? 46.596  52.866  17.674 1.00 202.36 ? 79   ARG C CD  1 
ATOM   4753 N NE  . ARG C 1 79  ? 46.349  51.430  17.594 1.00 193.01 ? 79   ARG C NE  1 
ATOM   4754 C CZ  . ARG C 1 79  ? 45.709  50.835  16.593 1.00 192.60 ? 79   ARG C CZ  1 
ATOM   4755 N NH1 . ARG C 1 79  ? 45.246  51.553  15.577 1.00 200.94 ? 79   ARG C NH1 1 
ATOM   4756 N NH2 . ARG C 1 79  ? 45.531  49.520  16.604 1.00 183.92 ? 79   ARG C NH2 1 
ATOM   4757 N N   . PRO C 1 80  ? 41.987  56.344  17.084 1.00 173.56 ? 80   PRO C N   1 
ATOM   4758 C CA  . PRO C 1 80  ? 40.818  56.764  16.306 1.00 167.87 ? 80   PRO C CA  1 
ATOM   4759 C C   . PRO C 1 80  ? 40.460  55.776  15.197 1.00 161.35 ? 80   PRO C C   1 
ATOM   4760 O O   . PRO C 1 80  ? 41.328  55.348  14.435 1.00 163.90 ? 80   PRO C O   1 
ATOM   4761 C CB  . PRO C 1 80  ? 41.263  58.101  15.716 1.00 174.60 ? 80   PRO C CB  1 
ATOM   4762 C CG  . PRO C 1 80  ? 42.214  58.633  16.728 1.00 182.59 ? 80   PRO C CG  1 
ATOM   4763 C CD  . PRO C 1 80  ? 42.958  57.437  17.250 1.00 183.02 ? 80   PRO C CD  1 
ATOM   4764 N N   . GLY C 1 81  ? 39.181  55.414  15.130 1.00 213.35 ? 81   GLY C N   1 
ATOM   4765 C CA  . GLY C 1 81  ? 38.678  54.509  14.114 1.00 206.49 ? 81   GLY C CA  1 
ATOM   4766 C C   . GLY C 1 81  ? 39.503  53.251  13.916 1.00 206.54 ? 81   GLY C C   1 
ATOM   4767 O O   . GLY C 1 81  ? 39.727  52.830  12.783 1.00 205.13 ? 81   GLY C O   1 
ATOM   4768 N N   . SER C 1 82  ? 39.961  52.648  15.010 1.00 200.98 ? 82   SER C N   1 
ATOM   4769 C CA  . SER C 1 82  ? 40.690  51.387  14.910 1.00 201.02 ? 82   SER C CA  1 
ATOM   4770 C C   . SER C 1 82  ? 39.883  50.243  15.515 1.00 194.78 ? 82   SER C C   1 
ATOM   4771 O O   . SER C 1 82  ? 39.532  50.261  16.698 1.00 191.28 ? 82   SER C O   1 
ATOM   4772 C CB  . SER C 1 82  ? 42.066  51.474  15.570 1.00 204.67 ? 82   SER C CB  1 
ATOM   4773 O OG  . SER C 1 82  ? 42.095  50.752  16.787 1.00 200.76 ? 82   SER C OG  1 
ATOM   4774 N N   . PHE C 1 83  ? 39.595  49.249  14.683 1.00 187.29 ? 83   PHE C N   1 
ATOM   4775 C CA  . PHE C 1 83  ? 38.763  48.123  15.074 1.00 181.98 ? 83   PHE C CA  1 
ATOM   4776 C C   . PHE C 1 83  ? 39.378  47.318  16.209 1.00 179.97 ? 83   PHE C C   1 
ATOM   4777 O O   . PHE C 1 83  ? 38.685  46.933  17.147 1.00 175.45 ? 83   PHE C O   1 
ATOM   4778 C CB  . PHE C 1 83  ? 38.526  47.209  13.876 1.00 182.35 ? 83   PHE C CB  1 
ATOM   4779 C CG  . PHE C 1 83  ? 37.769  45.963  14.212 1.00 177.42 ? 83   PHE C CG  1 
ATOM   4780 C CD1 . PHE C 1 83  ? 36.410  46.012  14.471 1.00 173.75 ? 83   PHE C CD1 1 
ATOM   4781 C CD2 . PHE C 1 83  ? 38.415  44.740  14.272 1.00 176.91 ? 83   PHE C CD2 1 
ATOM   4782 C CE1 . PHE C 1 83  ? 35.710  44.864  14.785 1.00 169.73 ? 83   PHE C CE1 1 
ATOM   4783 C CE2 . PHE C 1 83  ? 37.723  43.589  14.584 1.00 172.61 ? 83   PHE C CE2 1 
ATOM   4784 C CZ  . PHE C 1 83  ? 36.366  43.650  14.840 1.00 169.06 ? 83   PHE C CZ  1 
ATOM   4785 N N   . THR C 1 84  ? 40.679  47.058  16.116 1.00 153.68 ? 84   THR C N   1 
ATOM   4786 C CA  . THR C 1 84  ? 41.381  46.303  17.147 1.00 152.67 ? 84   THR C CA  1 
ATOM   4787 C C   . THR C 1 84  ? 41.051  46.883  18.511 1.00 149.98 ? 84   THR C C   1 
ATOM   4788 O O   . THR C 1 84  ? 40.459  46.218  19.357 1.00 145.38 ? 84   THR C O   1 
ATOM   4789 C CB  . THR C 1 84  ? 42.898  46.382  16.954 1.00 158.70 ? 84   THR C CB  1 
ATOM   4790 O OG1 . THR C 1 84  ? 43.221  46.130  15.583 1.00 162.22 ? 84   THR C OG1 1 
ATOM   4791 C CG2 . THR C 1 84  ? 43.602  45.362  17.832 1.00 158.05 ? 84   THR C CG2 1 
ATOM   4792 N N   . ASP C 1 85  ? 41.445  48.133  18.716 1.00 158.99 ? 85   ASP C N   1 
ATOM   4793 C CA  . ASP C 1 85  ? 41.183  48.819  19.972 1.00 157.04 ? 85   ASP C CA  1 
ATOM   4794 C C   . ASP C 1 85  ? 39.739  48.615  20.425 1.00 151.17 ? 85   ASP C C   1 
ATOM   4795 O O   . ASP C 1 85  ? 39.486  48.210  21.559 1.00 147.83 ? 85   ASP C O   1 
ATOM   4796 C CB  . ASP C 1 85  ? 41.499  50.313  19.838 1.00 161.12 ? 85   ASP C CB  1 
ATOM   4797 C CG  . ASP C 1 85  ? 42.982  50.580  19.619 1.00 167.62 ? 85   ASP C CG  1 
ATOM   4798 O OD1 . ASP C 1 85  ? 43.664  49.704  19.043 1.00 169.77 ? 85   ASP C OD1 1 
ATOM   4799 O OD2 . ASP C 1 85  ? 43.464  51.664  20.020 1.00 170.95 ? 85   ASP C OD2 1 
ATOM   4800 N N   . ALA C 1 86  ? 38.794  48.891  19.532 1.00 143.29 ? 86   ALA C N   1 
ATOM   4801 C CA  . ALA C 1 86  ? 37.379  48.724  19.843 1.00 138.66 ? 86   ALA C CA  1 
ATOM   4802 C C   . ALA C 1 86  ? 37.059  47.280  20.232 1.00 136.99 ? 86   ALA C C   1 
ATOM   4803 O O   . ALA C 1 86  ? 36.386  47.034  21.233 1.00 133.40 ? 86   ALA C O   1 
ATOM   4804 C CB  . ALA C 1 86  ? 36.521  49.167  18.664 1.00 141.69 ? 86   ALA C CB  1 
ATOM   4805 N N   . PHE C 1 87  ? 37.544  46.332  19.434 1.00 137.47 ? 87   PHE C N   1 
ATOM   4806 C CA  . PHE C 1 87  ? 37.339  44.913  19.698 1.00 134.32 ? 87   PHE C CA  1 
ATOM   4807 C C   . PHE C 1 87  ? 37.828  44.528  21.090 1.00 132.68 ? 87   PHE C C   1 
ATOM   4808 O O   . PHE C 1 87  ? 37.064  44.015  21.908 1.00 128.84 ? 87   PHE C O   1 
ATOM   4809 C CB  . PHE C 1 87  ? 38.055  44.064  18.650 1.00 136.64 ? 87   PHE C CB  1 
ATOM   4810 C CG  . PHE C 1 87  ? 38.003  42.590  18.931 1.00 133.86 ? 87   PHE C CG  1 
ATOM   4811 C CD1 . PHE C 1 87  ? 36.915  41.832  18.525 1.00 130.90 ? 87   PHE C CD1 1 
ATOM   4812 C CD2 . PHE C 1 87  ? 39.038  41.962  19.606 1.00 134.58 ? 87   PHE C CD2 1 
ATOM   4813 C CE1 . PHE C 1 87  ? 36.859  40.473  18.783 1.00 128.52 ? 87   PHE C CE1 1 
ATOM   4814 C CE2 . PHE C 1 87  ? 38.988  40.602  19.868 1.00 132.17 ? 87   PHE C CE2 1 
ATOM   4815 C CZ  . PHE C 1 87  ? 37.897  39.858  19.456 1.00 129.04 ? 87   PHE C CZ  1 
ATOM   4816 N N   . PHE C 1 88  ? 39.108  44.773  21.355 1.00 132.00 ? 88   PHE C N   1 
ATOM   4817 C CA  . PHE C 1 88  ? 39.684  44.462  22.658 1.00 131.25 ? 88   PHE C CA  1 
ATOM   4818 C C   . PHE C 1 88  ? 38.951  45.165  23.787 1.00 129.48 ? 88   PHE C C   1 
ATOM   4819 O O   . PHE C 1 88  ? 38.723  44.571  24.834 1.00 126.77 ? 88   PHE C O   1 
ATOM   4820 C CB  . PHE C 1 88  ? 41.177  44.786  22.700 1.00 134.25 ? 88   PHE C CB  1 
ATOM   4821 C CG  . PHE C 1 88  ? 42.026  43.766  22.011 1.00 136.68 ? 88   PHE C CG  1 
ATOM   4822 C CD1 . PHE C 1 88  ? 42.709  44.080  20.852 1.00 137.40 ? 88   PHE C CD1 1 
ATOM   4823 C CD2 . PHE C 1 88  ? 42.122  42.483  22.511 1.00 134.43 ? 88   PHE C CD2 1 
ATOM   4824 C CE1 . PHE C 1 88  ? 43.485  43.139  20.211 1.00 137.78 ? 88   PHE C CE1 1 
ATOM   4825 C CE2 . PHE C 1 88  ? 42.895  41.532  21.872 1.00 132.81 ? 88   PHE C CE2 1 
ATOM   4826 C CZ  . PHE C 1 88  ? 43.580  41.863  20.721 1.00 135.45 ? 88   PHE C CZ  1 
ATOM   4827 N N   . PHE C 1 89  ? 38.576  46.423  23.579 1.00 134.83 ? 89   PHE C N   1 
ATOM   4828 C CA  . PHE C 1 89  ? 37.754  47.112  24.563 1.00 132.33 ? 89   PHE C CA  1 
ATOM   4829 C C   . PHE C 1 89  ? 36.485  46.314  24.816 1.00 127.78 ? 89   PHE C C   1 
ATOM   4830 O O   . PHE C 1 89  ? 36.093  46.081  25.961 1.00 125.15 ? 89   PHE C O   1 
ATOM   4831 C CB  . PHE C 1 89  ? 37.367  48.507  24.093 1.00 134.13 ? 89   PHE C CB  1 
ATOM   4832 C CG  . PHE C 1 89  ? 36.341  49.160  24.968 1.00 131.52 ? 89   PHE C CG  1 
ATOM   4833 C CD1 . PHE C 1 89  ? 36.653  49.501  26.273 1.00 131.04 ? 89   PHE C CD1 1 
ATOM   4834 C CD2 . PHE C 1 89  ? 35.061  49.405  24.501 1.00 134.30 ? 89   PHE C CD2 1 
ATOM   4835 C CE1 . PHE C 1 89  ? 35.713  50.097  27.092 1.00 128.86 ? 89   PHE C CE1 1 
ATOM   4836 C CE2 . PHE C 1 89  ? 34.116  50.007  25.312 1.00 132.41 ? 89   PHE C CE2 1 
ATOM   4837 C CZ  . PHE C 1 89  ? 34.442  50.351  26.611 1.00 131.78 ? 89   PHE C CZ  1 
ATOM   4838 N N   . SER C 1 90  ? 35.846  45.902  23.728 1.00 166.55 ? 90   SER C N   1 
ATOM   4839 C CA  . SER C 1 90  ? 34.614  45.138  23.804 1.00 163.08 ? 90   SER C CA  1 
ATOM   4840 C C   . SER C 1 90  ? 34.779  43.876  24.636 1.00 160.63 ? 90   SER C C   1 
ATOM   4841 O O   . SER C 1 90  ? 33.890  43.524  25.402 1.00 157.81 ? 90   SER C O   1 
ATOM   4842 C CB  . SER C 1 90  ? 34.118  44.784  22.404 1.00 163.77 ? 90   SER C CB  1 
ATOM   4843 O OG  . SER C 1 90  ? 33.256  43.664  22.450 1.00 161.04 ? 90   SER C OG  1 
ATOM   4844 N N   . VAL C 1 91  ? 35.903  43.182  24.494 1.00 130.41 ? 91   VAL C N   1 
ATOM   4845 C CA  . VAL C 1 91  ? 36.102  41.992  25.316 1.00 128.30 ? 91   VAL C CA  1 
ATOM   4846 C C   . VAL C 1 91  ? 36.272  42.390  26.786 1.00 127.45 ? 91   VAL C C   1 
ATOM   4847 O O   . VAL C 1 91  ? 35.583  41.859  27.657 1.00 124.51 ? 91   VAL C O   1 
ATOM   4848 C CB  . VAL C 1 91  ? 37.267  41.080  24.833 1.00 130.31 ? 91   VAL C CB  1 
ATOM   4849 C CG1 . VAL C 1 91  ? 37.333  41.046  23.315 1.00 132.35 ? 91   VAL C CG1 1 
ATOM   4850 C CG2 . VAL C 1 91  ? 38.592  41.521  25.423 1.00 133.41 ? 91   VAL C CG2 1 
ATOM   4851 N N   . GLN C 1 92  ? 37.161  43.344  27.055 1.00 143.34 ? 92   GLN C N   1 
ATOM   4852 C CA  . GLN C 1 92  ? 37.389  43.802  28.421 1.00 143.07 ? 92   GLN C CA  1 
ATOM   4853 C C   . GLN C 1 92  ? 36.078  44.201  29.051 1.00 140.04 ? 92   GLN C C   1 
ATOM   4854 O O   . GLN C 1 92  ? 35.883  44.045  30.253 1.00 138.41 ? 92   GLN C O   1 
ATOM   4855 C CB  . GLN C 1 92  ? 38.321  45.006  28.450 1.00 146.92 ? 92   GLN C CB  1 
ATOM   4856 C CG  . GLN C 1 92  ? 39.349  44.991  27.362 1.00 150.86 ? 92   GLN C CG  1 
ATOM   4857 C CD  . GLN C 1 92  ? 40.637  45.649  27.774 1.00 155.32 ? 92   GLN C CD  1 
ATOM   4858 O OE1 . GLN C 1 92  ? 40.640  46.608  28.546 1.00 155.90 ? 92   GLN C OE1 1 
ATOM   4859 N NE2 . GLN C 1 92  ? 41.748  45.134  27.264 1.00 158.92 ? 92   GLN C NE2 1 
ATOM   4860 N N   . THR C 1 93  ? 35.182  44.731  28.230 1.00 127.56 ? 93   THR C N   1 
ATOM   4861 C CA  . THR C 1 93  ? 33.889  45.170  28.721 1.00 125.41 ? 93   THR C CA  1 
ATOM   4862 C C   . THR C 1 93  ? 32.954  43.971  28.935 1.00 122.49 ? 93   THR C C   1 
ATOM   4863 O O   . THR C 1 93  ? 32.354  43.834  29.999 1.00 120.68 ? 93   THR C O   1 
ATOM   4864 C CB  . THR C 1 93  ? 33.255  46.213  27.774 1.00 126.74 ? 93   THR C CB  1 
ATOM   4865 O OG1 . THR C 1 93  ? 32.473  47.149  28.527 1.00 126.12 ? 93   THR C OG1 1 
ATOM   4866 C CG2 . THR C 1 93  ? 32.386  45.540  26.739 1.00 125.88 ? 93   THR C CG2 1 
ATOM   4867 N N   . MET C 1 94  ? 32.850  43.090  27.944 1.00 140.38 ? 94   MET C N   1 
ATOM   4868 C CA  . MET C 1 94  ? 31.903  41.980  28.022 1.00 138.04 ? 94   MET C CA  1 
ATOM   4869 C C   . MET C 1 94  ? 32.320  40.884  28.999 1.00 136.45 ? 94   MET C C   1 
ATOM   4870 O O   . MET C 1 94  ? 31.471  40.211  29.578 1.00 134.54 ? 94   MET C O   1 
ATOM   4871 C CB  . MET C 1 94  ? 31.647  41.367  26.648 1.00 138.52 ? 94   MET C CB  1 
ATOM   4872 C CG  . MET C 1 94  ? 30.709  40.175  26.704 1.00 136.67 ? 94   MET C CG  1 
ATOM   4873 S SD  . MET C 1 94  ? 30.672  39.266  25.158 1.00 137.46 ? 94   MET C SD  1 
ATOM   4874 C CE  . MET C 1 94  ? 32.429  39.126  24.861 1.00 139.06 ? 94   MET C CE  1 
ATOM   4875 N N   . ALA C 1 95  ? 33.623  40.688  29.164 1.00 120.32 ? 95   ALA C N   1 
ATOM   4876 C CA  . ALA C 1 95  ? 34.126  39.725  30.137 1.00 119.32 ? 95   ALA C CA  1 
ATOM   4877 C C   . ALA C 1 95  ? 34.202  40.443  31.468 1.00 119.19 ? 95   ALA C C   1 
ATOM   4878 O O   . ALA C 1 95  ? 34.533  39.864  32.505 1.00 118.54 ? 95   ALA C O   1 
ATOM   4879 C CB  . ALA C 1 95  ? 35.489  39.231  29.726 1.00 121.41 ? 95   ALA C CB  1 
ATOM   4880 N N   . THR C 1 96  ? 33.902  41.732  31.406 1.00 112.72 ? 96   THR C N   1 
ATOM   4881 C CA  . THR C 1 96  ? 33.899  42.591  32.572 1.00 112.85 ? 96   THR C CA  1 
ATOM   4882 C C   . THR C 1 96  ? 35.247  42.640  33.290 1.00 114.74 ? 96   THR C C   1 
ATOM   4883 O O   . THR C 1 96  ? 35.270  42.796  34.492 1.00 114.38 ? 96   THR C O   1 
ATOM   4884 C CB  . THR C 1 96  ? 32.797  42.183  33.580 1.00 110.38 ? 96   THR C CB  1 
ATOM   4885 O OG1 . THR C 1 96  ? 33.184  40.979  34.239 1.00 109.50 ? 96   THR C OG1 1 
ATOM   4886 C CG2 . THR C 1 96  ? 31.476  41.946  32.877 1.00 109.26 ? 96   THR C CG2 1 
ATOM   4887 N N   . ILE C 1 97  ? 36.360  42.521  32.569 1.00 116.79 ? 97   ILE C N   1 
ATOM   4888 C CA  . ILE C 1 97  ? 37.664  42.743  33.194 1.00 119.65 ? 97   ILE C CA  1 
ATOM   4889 C C   . ILE C 1 97  ? 37.787  44.224  33.490 1.00 121.33 ? 97   ILE C C   1 
ATOM   4890 O O   . ILE C 1 97  ? 38.324  44.626  34.522 1.00 122.41 ? 97   ILE C O   1 
ATOM   4891 C CB  . ILE C 1 97  ? 38.833  42.337  32.287 1.00 122.76 ? 97   ILE C CB  1 
ATOM   4892 C CG1 . ILE C 1 97  ? 38.575  40.964  31.668 1.00 120.96 ? 97   ILE C CG1 1 
ATOM   4893 C CG2 . ILE C 1 97  ? 40.149  42.359  33.066 1.00 126.15 ? 97   ILE C CG2 1 
ATOM   4894 C CD1 . ILE C 1 97  ? 39.469  40.659  30.500 1.00 123.84 ? 97   ILE C CD1 1 
ATOM   4895 N N   . GLY C 1 98  ? 37.284  45.032  32.564 1.00 231.83 ? 98   GLY C N   1 
ATOM   4896 C CA  . GLY C 1 98  ? 37.269  46.472  32.721 1.00 233.42 ? 98   GLY C CA  1 
ATOM   4897 C C   . GLY C 1 98  ? 38.579  47.019  33.243 1.00 237.22 ? 98   GLY C C   1 
ATOM   4898 O O   . GLY C 1 98  ? 38.596  47.648  34.287 1.00 237.51 ? 98   GLY C O   1 
ATOM   4899 N N   . TYR C 1 99  ? 39.666  46.785  32.511 1.00 161.19 ? 99   TYR C N   1 
ATOM   4900 C CA  . TYR C 1 99  ? 40.991  47.265  32.906 1.00 165.85 ? 99   TYR C CA  1 
ATOM   4901 C C   . TYR C 1 99  ? 41.012  48.732  33.299 1.00 167.67 ? 99   TYR C C   1 
ATOM   4902 O O   . TYR C 1 99  ? 41.477  49.070  34.379 1.00 168.93 ? 99   TYR C O   1 
ATOM   4903 C CB  . TYR C 1 99  ? 42.010  47.055  31.790 1.00 169.96 ? 99   TYR C CB  1 
ATOM   4904 C CG  . TYR C 1 99  ? 42.581  45.663  31.716 1.00 170.19 ? 99   TYR C CG  1 
ATOM   4905 C CD1 . TYR C 1 99  ? 42.668  44.997  30.503 1.00 170.58 ? 99   TYR C CD1 1 
ATOM   4906 C CD2 . TYR C 1 99  ? 43.034  45.014  32.854 1.00 170.24 ? 99   TYR C CD2 1 
ATOM   4907 C CE1 . TYR C 1 99  ? 43.189  43.724  30.420 1.00 170.94 ? 99   TYR C CE1 1 
ATOM   4908 C CE2 . TYR C 1 99  ? 43.558  43.734  32.783 1.00 170.69 ? 99   TYR C CE2 1 
ATOM   4909 C CZ  . TYR C 1 99  ? 43.633  43.095  31.561 1.00 171.01 ? 99   TYR C CZ  1 
ATOM   4910 O OH  . TYR C 1 99  ? 44.152  41.824  31.478 1.00 171.61 ? 99   TYR C OH  1 
ATOM   4911 N N   . GLY C 1 100 ? 40.564  49.610  32.407 1.00 200.76 ? 100  GLY C N   1 
ATOM   4912 C CA  . GLY C 1 100 ? 40.467  51.018  32.754 1.00 202.30 ? 100  GLY C CA  1 
ATOM   4913 C C   . GLY C 1 100 ? 41.173  52.016  31.853 1.00 207.13 ? 100  GLY C C   1 
ATOM   4914 O O   . GLY C 1 100 ? 41.032  53.222  32.045 1.00 208.48 ? 100  GLY C O   1 
ATOM   4915 N N   . LYS C 1 101 ? 41.944  51.532  30.885 1.00 123.57 ? 101  LYS C N   1 
ATOM   4916 C CA  . LYS C 1 101 ? 42.535  52.418  29.888 1.00 127.48 ? 101  LYS C CA  1 
ATOM   4917 C C   . LYS C 1 101 ? 41.431  52.889  28.974 1.00 132.24 ? 101  LYS C C   1 
ATOM   4918 O O   . LYS C 1 101 ? 41.092  54.069  28.933 1.00 125.44 ? 101  LYS C O   1 
ATOM   4919 C CB  . LYS C 1 101 ? 43.588  51.687  29.058 1.00 140.20 ? 101  LYS C CB  1 
ATOM   4920 C CG  . LYS C 1 101 ? 45.003  51.830  29.572 1.00 136.81 ? 101  LYS C CG  1 
ATOM   4921 C CD  . LYS C 1 101 ? 45.541  53.235  29.348 1.00 130.59 ? 101  LYS C CD  1 
ATOM   4922 C CE  . LYS C 1 101 ? 46.911  53.391  29.998 1.00 124.97 ? 101  LYS C CE  1 
ATOM   4923 N NZ  . LYS C 1 101 ? 47.412  54.795  29.961 1.00 117.58 ? 101  LYS C NZ  1 
ATOM   4924 N N   . LEU C 1 102 ? 40.879  51.938  28.234 1.00 138.29 ? 102  LEU C N   1 
ATOM   4925 C CA  . LEU C 1 102 ? 39.751  52.189  27.364 1.00 142.49 ? 102  LEU C CA  1 
ATOM   4926 C C   . LEU C 1 102 ? 38.508  52.314  28.234 1.00 133.09 ? 102  LEU C C   1 
ATOM   4927 O O   . LEU C 1 102 ? 38.244  51.462  29.081 1.00 129.44 ? 102  LEU C O   1 
ATOM   4928 C CB  . LEU C 1 102 ? 39.615  51.041  26.367 1.00 147.83 ? 102  LEU C CB  1 
ATOM   4929 C CG  . LEU C 1 102 ? 40.974  50.475  25.941 1.00 144.58 ? 102  LEU C CG  1 
ATOM   4930 C CD1 . LEU C 1 102 ? 40.816  49.197  25.135 1.00 141.55 ? 102  LEU C CD1 1 
ATOM   4931 C CD2 . LEU C 1 102 ? 41.785  51.509  25.172 1.00 147.98 ? 102  LEU C CD2 1 
ATOM   4932 N N   . ILE C 1 103 ? 37.765  53.396  28.036 1.00 133.12 ? 103  ILE C N   1 
ATOM   4933 C CA  . ILE C 1 103 ? 36.601  53.699  28.856 1.00 124.07 ? 103  ILE C CA  1 
ATOM   4934 C C   . ILE C 1 103 ? 35.519  54.255  27.955 1.00 126.36 ? 103  ILE C C   1 
ATOM   4935 O O   . ILE C 1 103 ? 35.822  54.866  26.935 1.00 132.28 ? 103  ILE C O   1 
ATOM   4936 C CB  . ILE C 1 103 ? 36.936  54.771  29.905 1.00 108.11 ? 103  ILE C CB  1 
ATOM   4937 C CG1 . ILE C 1 103 ? 38.164  54.362  30.715 1.00 103.42 ? 103  ILE C CG1 1 
ATOM   4938 C CG2 . ILE C 1 103 ? 35.753  55.031  30.827 1.00 97.35  ? 103  ILE C CG2 1 
ATOM   4939 C CD1 . ILE C 1 103 ? 38.654  55.453  31.635 1.00 90.78  ? 103  ILE C CD1 1 
ATOM   4940 N N   . PRO C 1 104 ? 34.247  54.044  28.318 1.00 166.18 ? 104  PRO C N   1 
ATOM   4941 C CA  . PRO C 1 104 ? 33.170  54.652  27.534 1.00 166.45 ? 104  PRO C CA  1 
ATOM   4942 C C   . PRO C 1 104 ? 33.184  56.178  27.617 1.00 163.11 ? 104  PRO C C   1 
ATOM   4943 O O   . PRO C 1 104 ? 33.694  56.749  28.583 1.00 152.23 ? 104  PRO C O   1 
ATOM   4944 C CB  . PRO C 1 104 ? 31.908  54.099  28.204 1.00 160.58 ? 104  PRO C CB  1 
ATOM   4945 C CG  . PRO C 1 104 ? 32.366  53.707  29.579 1.00 155.29 ? 104  PRO C CG  1 
ATOM   4946 C CD  . PRO C 1 104 ? 33.710  53.128  29.335 1.00 160.52 ? 104  PRO C CD  1 
ATOM   4947 N N   . ILE C 1 105 ? 32.628  56.825  26.598 1.00 138.21 ? 105  ILE C N   1 
ATOM   4948 C CA  . ILE C 1 105 ? 32.473  58.272  26.588 1.00 135.81 ? 105  ILE C CA  1 
ATOM   4949 C C   . ILE C 1 105 ? 31.103  58.641  26.036 1.00 134.09 ? 105  ILE C C   1 
ATOM   4950 O O   . ILE C 1 105 ? 30.784  58.329  24.888 1.00 136.60 ? 105  ILE C O   1 
ATOM   4951 C CB  . ILE C 1 105 ? 33.545  58.948  25.723 1.00 141.51 ? 105  ILE C CB  1 
ATOM   4952 C CG1 . ILE C 1 105 ? 34.920  58.794  26.369 1.00 135.93 ? 105  ILE C CG1 1 
ATOM   4953 C CG2 . ILE C 1 105 ? 33.214  60.418  25.519 1.00 136.35 ? 105  ILE C CG2 1 
ATOM   4954 C CD1 . ILE C 1 105 ? 36.052  59.132  25.451 1.00 144.27 ? 105  ILE C CD1 1 
ATOM   4955 N N   . GLY C 1 106 ? 30.295  59.301  26.858 1.00 133.41 ? 106  GLY C N   1 
ATOM   4956 C CA  . GLY C 1 106 ? 28.984  59.748  26.429 1.00 132.19 ? 106  GLY C CA  1 
ATOM   4957 C C   . GLY C 1 106 ? 27.929  58.670  26.545 1.00 129.49 ? 106  GLY C C   1 
ATOM   4958 O O   . GLY C 1 106 ? 28.251  57.493  26.691 1.00 130.31 ? 106  GLY C O   1 
ATOM   4959 N N   . PRO C 1 107 ? 26.653  59.070  26.466 1.00 136.21 ? 107  PRO C N   1 
ATOM   4960 C CA  . PRO C 1 107 ? 25.511  58.173  26.667 1.00 133.60 ? 107  PRO C CA  1 
ATOM   4961 C C   . PRO C 1 107 ? 25.529  56.962  25.738 1.00 137.23 ? 107  PRO C C   1 
ATOM   4962 O O   . PRO C 1 107 ? 25.359  55.835  26.204 1.00 135.99 ? 107  PRO C O   1 
ATOM   4963 C CB  . PRO C 1 107 ? 24.309  59.065  26.351 1.00 132.05 ? 107  PRO C CB  1 
ATOM   4964 C CG  . PRO C 1 107 ? 24.794  60.452  26.596 1.00 131.48 ? 107  PRO C CG  1 
ATOM   4965 C CD  . PRO C 1 107 ? 26.227  60.447  26.169 1.00 135.74 ? 107  PRO C CD  1 
ATOM   4966 N N   . LEU C 1 108 ? 25.732  57.192  24.445 1.00 156.28 ? 108  LEU C N   1 
ATOM   4967 C CA  . LEU C 1 108 ? 25.729  56.103  23.473 1.00 160.14 ? 108  LEU C CA  1 
ATOM   4968 C C   . LEU C 1 108 ? 26.759  55.035  23.822 1.00 161.43 ? 108  LEU C C   1 
ATOM   4969 O O   . LEU C 1 108 ? 26.440  53.847  23.879 1.00 161.35 ? 108  LEU C O   1 
ATOM   4970 C CB  . LEU C 1 108 ? 25.974  56.639  22.063 1.00 165.21 ? 108  LEU C CB  1 
ATOM   4971 C CG  . LEU C 1 108 ? 24.987  57.718  21.626 1.00 164.75 ? 108  LEU C CG  1 
ATOM   4972 C CD1 . LEU C 1 108 ? 25.128  58.001  20.138 1.00 170.35 ? 108  LEU C CD1 1 
ATOM   4973 C CD2 . LEU C 1 108 ? 23.563  57.300  21.975 1.00 161.76 ? 108  LEU C CD2 1 
ATOM   4974 N N   . ALA C 1 109 ? 27.993  55.463  24.060 1.00 126.21 ? 109  ALA C N   1 
ATOM   4975 C CA  . ALA C 1 109 ? 29.055  54.539  24.437 1.00 127.95 ? 109  ALA C CA  1 
ATOM   4976 C C   . ALA C 1 109 ? 28.616  53.646  25.590 1.00 123.79 ? 109  ALA C C   1 
ATOM   4977 O O   . ALA C 1 109 ? 28.652  52.424  25.486 1.00 124.95 ? 109  ALA C O   1 
ATOM   4978 C CB  . ALA C 1 109 ? 30.312  55.300  24.809 1.00 129.69 ? 109  ALA C CB  1 
ATOM   4979 N N   . ASN C 1 110 ? 28.189  54.269  26.683 1.00 139.69 ? 110  ASN C N   1 
ATOM   4980 C CA  . ASN C 1 110 ? 27.850  53.547  27.903 1.00 135.79 ? 110  ASN C CA  1 
ATOM   4981 C C   . ASN C 1 110 ? 26.636  52.638  27.788 1.00 134.04 ? 110  ASN C C   1 
ATOM   4982 O O   . ASN C 1 110 ? 26.631  51.540  28.336 1.00 133.23 ? 110  ASN C O   1 
ATOM   4983 C CB  . ASN C 1 110 ? 27.653  54.523  29.058 1.00 131.39 ? 110  ASN C CB  1 
ATOM   4984 C CG  . ASN C 1 110 ? 28.912  55.268  29.396 1.00 133.32 ? 110  ASN C CG  1 
ATOM   4985 O OD1 . ASN C 1 110 ? 29.822  54.717  30.008 1.00 132.35 ? 110  ASN C OD1 1 
ATOM   4986 N ND2 . ASN C 1 110 ? 28.976  56.534  29.000 1.00 133.23 ? 110  ASN C ND2 1 
ATOM   4987 N N   . THR C 1 111 ? 25.598  53.093  27.099 1.00 135.21 ? 111  THR C N   1 
ATOM   4988 C CA  . THR C 1 111 ? 24.426  52.249  26.920 1.00 134.41 ? 111  THR C CA  1 
ATOM   4989 C C   . THR C 1 111 ? 24.867  50.930  26.297 1.00 138.22 ? 111  THR C C   1 
ATOM   4990 O O   . THR C 1 111 ? 24.547  49.856  26.807 1.00 137.06 ? 111  THR C O   1 
ATOM   4991 C CB  . THR C 1 111 ? 23.359  52.917  26.042 1.00 135.25 ? 111  THR C CB  1 
ATOM   4992 O OG1 . THR C 1 111 ? 23.125  54.248  26.514 1.00 132.42 ? 111  THR C OG1 1 
ATOM   4993 C CG2 . THR C 1 111 ? 22.055  52.132  26.095 1.00 134.20 ? 111  THR C CG2 1 
ATOM   4994 N N   . LEU C 1 112 ? 25.617  51.020  25.203 1.00 145.15 ? 112  LEU C N   1 
ATOM   4995 C CA  . LEU C 1 112 ? 26.214  49.843  24.583 1.00 149.07 ? 112  LEU C CA  1 
ATOM   4996 C C   . LEU C 1 112 ? 26.967  49.006  25.609 1.00 147.91 ? 112  LEU C C   1 
ATOM   4997 O O   . LEU C 1 112 ? 26.960  47.776  25.550 1.00 149.30 ? 112  LEU C O   1 
ATOM   4998 C CB  . LEU C 1 112 ? 27.169  50.253  23.464 1.00 154.12 ? 112  LEU C CB  1 
ATOM   4999 C CG  . LEU C 1 112 ? 26.562  50.495  22.086 1.00 157.47 ? 112  LEU C CG  1 
ATOM   5000 C CD1 . LEU C 1 112 ? 27.666  50.782  21.086 1.00 162.64 ? 112  LEU C CD1 1 
ATOM   5001 C CD2 . LEU C 1 112 ? 25.743  49.290  21.657 1.00 158.67 ? 112  LEU C CD2 1 
ATOM   5002 N N   . VAL C 1 113 ? 27.626  49.682  26.544 1.00 129.92 ? 113  VAL C N   1 
ATOM   5003 C CA  . VAL C 1 113 ? 28.363  48.998  27.600 1.00 129.23 ? 113  VAL C CA  1 
ATOM   5004 C C   . VAL C 1 113 ? 27.425  48.158  28.456 1.00 125.43 ? 113  VAL C C   1 
ATOM   5005 O O   . VAL C 1 113 ? 27.572  46.942  28.544 1.00 126.71 ? 113  VAL C O   1 
ATOM   5006 C CB  . VAL C 1 113 ? 29.115  49.991  28.509 1.00 127.76 ? 113  VAL C CB  1 
ATOM   5007 C CG1 . VAL C 1 113 ? 29.746  49.261  29.680 1.00 127.02 ? 113  VAL C CG1 1 
ATOM   5008 C CG2 . VAL C 1 113 ? 30.165  50.750  27.716 1.00 132.23 ? 113  VAL C CG2 1 
ATOM   5009 N N   . THR C 1 114 ? 26.450  48.813  29.076 1.00 157.66 ? 114  THR C N   1 
ATOM   5010 C CA  . THR C 1 114 ? 25.542  48.138  29.996 1.00 153.96 ? 114  THR C CA  1 
ATOM   5011 C C   . THR C 1 114 ? 24.734  47.061  29.273 1.00 155.71 ? 114  THR C C   1 
ATOM   5012 O O   . THR C 1 114 ? 24.150  46.179  29.904 1.00 153.91 ? 114  THR C O   1 
ATOM   5013 C CB  . THR C 1 114 ? 24.579  49.132  30.675 1.00 149.28 ? 114  THR C CB  1 
ATOM   5014 O OG1 . THR C 1 114 ? 23.343  49.161  29.957 1.00 149.28 ? 114  THR C OG1 1 
ATOM   5015 C CG2 . THR C 1 114 ? 25.174  50.528  30.696 1.00 149.00 ? 114  THR C CG2 1 
ATOM   5016 N N   . LEU C 1 115 ? 24.705  47.142  27.947 1.00 115.99 ? 115  LEU C N   1 
ATOM   5017 C CA  . LEU C 1 115 ? 24.013  46.156  27.130 1.00 118.59 ? 115  LEU C CA  1 
ATOM   5018 C C   . LEU C 1 115 ? 24.907  44.944  26.939 1.00 121.83 ? 115  LEU C C   1 
ATOM   5019 O O   . LEU C 1 115 ? 24.478  43.797  27.085 1.00 122.19 ? 115  LEU C O   1 
ATOM   5020 C CB  . LEU C 1 115 ? 23.676  46.741  25.765 1.00 121.96 ? 115  LEU C CB  1 
ATOM   5021 C CG  . LEU C 1 115 ? 22.508  46.047  25.080 1.00 123.76 ? 115  LEU C CG  1 
ATOM   5022 C CD1 . LEU C 1 115 ? 21.220  46.706  25.542 1.00 120.43 ? 115  LEU C CD1 1 
ATOM   5023 C CD2 . LEU C 1 115 ? 22.652  46.112  23.569 1.00 128.99 ? 115  LEU C CD2 1 
ATOM   5024 N N   . GLU C 1 116 ? 26.159  45.216  26.602 1.00 126.87 ? 116  GLU C N   1 
ATOM   5025 C CA  . GLU C 1 116 ? 27.143  44.167  26.432 1.00 130.31 ? 116  GLU C CA  1 
ATOM   5026 C C   . GLU C 1 116 ? 27.243  43.342  27.701 1.00 127.68 ? 116  GLU C C   1 
ATOM   5027 O O   . GLU C 1 116 ? 27.058  42.131  27.678 1.00 128.74 ? 116  GLU C O   1 
ATOM   5028 C CB  . GLU C 1 116 ? 28.495  44.776  26.097 1.00 133.38 ? 116  GLU C CB  1 
ATOM   5029 C CG  . GLU C 1 116 ? 29.465  43.783  25.517 1.00 138.31 ? 116  GLU C CG  1 
ATOM   5030 C CD  . GLU C 1 116 ? 30.454  44.448  24.597 1.00 142.68 ? 116  GLU C CD  1 
ATOM   5031 O OE1 . GLU C 1 116 ? 30.645  45.676  24.732 1.00 141.62 ? 116  GLU C OE1 1 
ATOM   5032 O OE2 . GLU C 1 116 ? 31.034  43.754  23.738 1.00 147.33 ? 116  GLU C OE2 1 
ATOM   5033 N N   . ALA C 1 117 ? 27.538  44.012  28.807 1.00 102.30 ? 117  ALA C N   1 
ATOM   5034 C CA  . ALA C 1 117 ? 27.610  43.358  30.103 1.00 103.49 ? 117  ALA C CA  1 
ATOM   5035 C C   . ALA C 1 117 ? 26.546  42.276  30.201 1.00 102.51 ? 117  ALA C C   1 
ATOM   5036 O O   . ALA C 1 117 ? 26.851  41.081  30.206 1.00 104.60 ? 117  ALA C O   1 
ATOM   5037 C CB  . ALA C 1 117 ? 27.431  44.377  31.207 1.00 98.92  ? 117  ALA C CB  1 
ATOM   5038 N N   . LEU C 1 118 ? 25.292  42.708  30.257 1.00 132.93 ? 118  LEU C N   1 
ATOM   5039 C CA  . LEU C 1 118 ? 24.160  41.798  30.297 1.00 132.14 ? 118  LEU C CA  1 
ATOM   5040 C C   . LEU C 1 118 ? 24.341  40.660  29.302 1.00 136.87 ? 118  LEU C C   1 
ATOM   5041 O O   . LEU C 1 118 ? 24.221  39.493  29.654 1.00 137.42 ? 118  LEU C O   1 
ATOM   5042 C CB  . LEU C 1 118 ? 22.878  42.560  29.979 1.00 130.26 ? 118  LEU C CB  1 
ATOM   5043 C CG  . LEU C 1 118 ? 21.632  41.700  29.780 1.00 130.83 ? 118  LEU C CG  1 
ATOM   5044 C CD1 . LEU C 1 118 ? 20.977  41.380  31.110 1.00 126.77 ? 118  LEU C CD1 1 
ATOM   5045 C CD2 . LEU C 1 118 ? 20.647  42.392  28.862 1.00 132.05 ? 118  LEU C CD2 1 
ATOM   5046 N N   . CYS C 1 119 ? 24.631  41.010  28.055 1.00 113.05 ? 119  CYS C N   1 
ATOM   5047 C CA  . CYS C 1 119 ? 24.895  40.019  27.020 1.00 117.58 ? 119  CYS C CA  1 
ATOM   5048 C C   . CYS C 1 119 ? 25.960  39.024  27.457 1.00 119.21 ? 119  CYS C C   1 
ATOM   5049 O O   . CYS C 1 119 ? 25.785  37.812  27.348 1.00 121.19 ? 119  CYS C O   1 
ATOM   5050 C CB  . CYS C 1 119 ? 25.353  40.708  25.738 1.00 121.21 ? 119  CYS C CB  1 
ATOM   5051 S SG  . CYS C 1 119 ? 24.038  41.077  24.583 1.00 122.84 ? 119  CYS C SG  1 
ATOM   5052 N N   . GLY C 1 120 ? 27.077  39.546  27.940 1.00 126.49 ? 120  GLY C N   1 
ATOM   5053 C CA  . GLY C 1 120 ? 28.164  38.703  28.390 1.00 128.79 ? 120  GLY C CA  1 
ATOM   5054 C C   . GLY C 1 120 ? 27.698  37.635  29.350 1.00 126.84 ? 120  GLY C C   1 
ATOM   5055 O O   . GLY C 1 120 ? 27.882  36.443  29.108 1.00 129.59 ? 120  GLY C O   1 
ATOM   5056 N N   . MET C 1 121 ? 27.081  38.071  30.442 1.00 104.37 ? 121  MET C N   1 
ATOM   5057 C CA  . MET C 1 121 ? 26.613  37.153  31.476 1.00 95.84  ? 121  MET C CA  1 
ATOM   5058 C C   . MET C 1 121 ? 25.583  36.141  30.972 1.00 90.22  ? 121  MET C C   1 
ATOM   5059 O O   . MET C 1 121 ? 25.663  34.961  31.290 1.00 89.15  ? 121  MET C O   1 
ATOM   5060 C CB  . MET C 1 121 ? 26.079  37.926  32.687 1.00 87.17  ? 121  MET C CB  1 
ATOM   5061 N N   . LEU C 1 122 ? 24.619  36.604  30.187 1.00 111.29 ? 122  LEU C N   1 
ATOM   5062 C CA  . LEU C 1 122 ? 23.645  35.706  29.573 1.00 106.54 ? 122  LEU C CA  1 
ATOM   5063 C C   . LEU C 1 122 ? 24.357  34.613  28.804 1.00 114.89 ? 122  LEU C C   1 
ATOM   5064 O O   . LEU C 1 122 ? 24.008  33.440  28.887 1.00 111.66 ? 122  LEU C O   1 
ATOM   5065 C CB  . LEU C 1 122 ? 22.746  36.469  28.608 1.00 104.74 ? 122  LEU C CB  1 
ATOM   5066 C CG  . LEU C 1 122 ? 21.788  37.491  29.209 1.00 95.74  ? 122  LEU C CG  1 
ATOM   5067 C CD1 . LEU C 1 122 ? 20.717  37.841  28.193 1.00 93.47  ? 122  LEU C CD1 1 
ATOM   5068 C CD2 . LEU C 1 122 ? 21.159  36.948  30.477 1.00 86.34  ? 122  LEU C CD2 1 
ATOM   5069 N N   . GLY C 1 123 ? 25.355  35.013  28.033 1.00 116.53 ? 123  GLY C N   1 
ATOM   5070 C CA  . GLY C 1 123 ? 26.162  34.064  27.299 1.00 114.07 ? 123  GLY C CA  1 
ATOM   5071 C C   . GLY C 1 123 ? 26.719  33.028  28.246 1.00 118.50 ? 123  GLY C C   1 
ATOM   5072 O O   . GLY C 1 123 ? 26.624  31.828  28.006 1.00 116.66 ? 123  GLY C O   1 
ATOM   5073 N N   . LEU C 1 124 ? 27.300  33.499  29.340 1.00 68.03  ? 124  LEU C N   1 
ATOM   5074 C CA  . LEU C 1 124 ? 27.838  32.606  30.353 1.00 69.54  ? 124  LEU C CA  1 
ATOM   5075 C C   . LEU C 1 124 ? 26.780  31.632  30.843 1.00 65.26  ? 124  LEU C C   1 
ATOM   5076 O O   . LEU C 1 124 ? 27.029  30.437  30.973 1.00 65.99  ? 124  LEU C O   1 
ATOM   5077 C CB  . LEU C 1 124 ? 28.354  33.401  31.545 1.00 70.23  ? 124  LEU C CB  1 
ATOM   5078 C CG  . LEU C 1 124 ? 29.083  32.486  32.529 1.00 70.57  ? 124  LEU C CG  1 
ATOM   5079 C CD1 . LEU C 1 124 ? 30.471  32.178  31.995 1.00 82.21  ? 124  LEU C CD1 1 
ATOM   5080 C CD2 . LEU C 1 124 ? 29.163  33.075  33.926 1.00 72.57  ? 124  LEU C CD2 1 
ATOM   5081 N N   . ALA C 1 125 ? 25.599  32.161  31.132 1.00 101.40 ? 125  ALA C N   1 
ATOM   5082 C CA  . ALA C 1 125 ? 24.486  31.352  31.601 1.00 91.25  ? 125  ALA C CA  1 
ATOM   5083 C C   . ALA C 1 125 ? 24.157  30.256  30.600 1.00 92.97  ? 125  ALA C C   1 
ATOM   5084 O O   . ALA C 1 125 ? 23.894  29.118  30.976 1.00 89.19  ? 125  ALA C O   1 
ATOM   5085 C CB  . ALA C 1 125 ? 23.276  32.222  31.829 1.00 82.33  ? 125  ALA C CB  1 
ATOM   5086 N N   . VAL C 1 126 ? 24.174  30.606  29.320 1.00 87.93  ? 126  VAL C N   1 
ATOM   5087 C CA  . VAL C 1 126 ? 23.877  29.648  28.265 1.00 88.47  ? 126  VAL C CA  1 
ATOM   5088 C C   . VAL C 1 126 ? 25.012  28.649  28.080 1.00 90.91  ? 126  VAL C C   1 
ATOM   5089 O O   . VAL C 1 126 ? 24.781  27.449  27.925 1.00 89.46  ? 126  VAL C O   1 
ATOM   5090 C CB  . VAL C 1 126 ? 23.603  30.356  26.933 1.00 84.30  ? 126  VAL C CB  1 
ATOM   5091 C CG1 . VAL C 1 126 ? 23.524  29.345  25.802 1.00 79.10  ? 126  VAL C CG1 1 
ATOM   5092 C CG2 . VAL C 1 126 ? 22.323  31.157  27.027 1.00 81.62  ? 126  VAL C CG2 1 
ATOM   5093 N N   . ALA C 1 127 ? 26.240  29.152  28.094 1.00 80.33  ? 127  ALA C N   1 
ATOM   5094 C CA  . ALA C 1 127 ? 27.412  28.299  27.963 1.00 81.28  ? 127  ALA C CA  1 
ATOM   5095 C C   . ALA C 1 127 ? 27.457  27.283  29.099 1.00 86.38  ? 127  ALA C C   1 
ATOM   5096 O O   . ALA C 1 127 ? 27.610  26.084  28.866 1.00 85.25  ? 127  ALA C O   1 
ATOM   5097 C CB  . ALA C 1 127 ? 28.674  29.140  27.949 1.00 83.70  ? 127  ALA C CB  1 
ATOM   5098 N N   . ALA C 1 128 ? 27.316  27.775  30.325 1.00 111.85 ? 128  ALA C N   1 
ATOM   5099 C CA  . ALA C 1 128 ? 27.314  26.921  31.504 1.00 107.31 ? 128  ALA C CA  1 
ATOM   5100 C C   . ALA C 1 128 ? 26.366  25.744  31.331 1.00 101.29 ? 128  ALA C C   1 
ATOM   5101 O O   . ALA C 1 128 ? 26.782  24.589  31.429 1.00 103.67 ? 128  ALA C O   1 
ATOM   5102 C CB  . ALA C 1 128 ? 26.933  27.719  32.728 1.00 99.17  ? 128  ALA C CB  1 
ATOM   5103 N N   . SER C 1 129 ? 25.094  26.043  31.079 1.00 87.43  ? 129  SER C N   1 
ATOM   5104 C CA  . SER C 1 129 ? 24.070  25.011  30.930 1.00 80.98  ? 129  SER C CA  1 
ATOM   5105 C C   . SER C 1 129 ? 24.506  23.947  29.932 1.00 88.37  ? 129  SER C C   1 
ATOM   5106 O O   . SER C 1 129 ? 24.466  22.756  30.226 1.00 86.72  ? 129  SER C O   1 
ATOM   5107 C CB  . SER C 1 129 ? 22.753  25.631  30.469 1.00 73.92  ? 129  SER C CB  1 
ATOM   5108 O OG  . SER C 1 129 ? 22.594  26.936  30.997 1.00 71.00  ? 129  SER C OG  1 
ATOM   5109 N N   . LEU C 1 130 ? 24.911  24.387  28.746 1.00 62.30  ? 130  LEU C N   1 
ATOM   5110 C CA  . LEU C 1 130 ? 25.431  23.475  27.744 1.00 62.96  ? 130  LEU C CA  1 
ATOM   5111 C C   . LEU C 1 130 ? 26.552  22.644  28.347 1.00 63.85  ? 130  LEU C C   1 
ATOM   5112 O O   . LEU C 1 130 ? 26.440  21.427  28.431 1.00 64.33  ? 130  LEU C O   1 
ATOM   5113 C CB  . LEU C 1 130 ? 25.904  24.242  26.512 1.00 63.35  ? 130  LEU C CB  1 
ATOM   5114 C CG  . LEU C 1 130 ? 24.724  24.827  25.735 1.00 61.17  ? 130  LEU C CG  1 
ATOM   5115 C CD1 . LEU C 1 130 ? 25.188  25.842  24.718 1.00 63.10  ? 130  LEU C CD1 1 
ATOM   5116 C CD2 . LEU C 1 130 ? 23.922  23.719  25.067 1.00 59.56  ? 130  LEU C CD2 1 
ATOM   5117 N N   . ILE C 1 131 ? 27.620  23.302  28.792 1.00 82.75  ? 131  ILE C N   1 
ATOM   5118 C CA  . ILE C 1 131 ? 28.715  22.600  29.452 1.00 87.65  ? 131  ILE C CA  1 
ATOM   5119 C C   . ILE C 1 131 ? 28.173  21.561  30.421 1.00 92.06  ? 131  ILE C C   1 
ATOM   5120 O O   . ILE C 1 131 ? 28.426  20.374  30.260 1.00 91.82  ? 131  ILE C O   1 
ATOM   5121 C CB  . ILE C 1 131 ? 29.631  23.548  30.241 1.00 93.04  ? 131  ILE C CB  1 
ATOM   5122 C CG1 . ILE C 1 131 ? 30.089  24.714  29.368 1.00 89.39  ? 131  ILE C CG1 1 
ATOM   5123 C CG2 . ILE C 1 131 ? 30.839  22.793  30.768 1.00 97.50  ? 131  ILE C CG2 1 
ATOM   5124 C CD1 . ILE C 1 131 ? 31.179  24.351  28.397 1.00 86.50  ? 131  ILE C CD1 1 
ATOM   5125 N N   . TYR C 1 132 ? 27.420  22.004  31.423 1.00 126.47 ? 132  TYR C N   1 
ATOM   5126 C CA  . TYR C 1 132 ? 26.877  21.077  32.412 1.00 118.20 ? 132  TYR C CA  1 
ATOM   5127 C C   . TYR C 1 132 ? 26.055  19.956  31.778 1.00 115.34 ? 132  TYR C C   1 
ATOM   5128 O O   . TYR C 1 132 ? 26.170  18.797  32.169 1.00 114.29 ? 132  TYR C O   1 
ATOM   5129 C CB  . TYR C 1 132 ? 26.023  21.797  33.454 1.00 107.99 ? 132  TYR C CB  1 
ATOM   5130 C CG  . TYR C 1 132 ? 25.270  20.830  34.344 1.00 99.33  ? 132  TYR C CG  1 
ATOM   5131 C CD1 . TYR C 1 132 ? 25.670  20.601  35.657 1.00 96.49  ? 132  TYR C CD1 1 
ATOM   5132 C CD2 . TYR C 1 132 ? 24.170  20.130  33.864 1.00 94.38  ? 132  TYR C CD2 1 
ATOM   5133 C CE1 . TYR C 1 132 ? 24.988  19.713  36.466 1.00 89.11  ? 132  TYR C CE1 1 
ATOM   5134 C CE2 . TYR C 1 132 ? 23.485  19.237  34.663 1.00 86.98  ? 132  TYR C CE2 1 
ATOM   5135 C CZ  . TYR C 1 132 ? 23.896  19.034  35.965 1.00 84.48  ? 132  TYR C CZ  1 
ATOM   5136 O OH  . TYR C 1 132 ? 23.213  18.146  36.767 1.00 77.56  ? 132  TYR C OH  1 
ATOM   5137 N N   . ALA C 1 133 ? 25.206  20.309  30.821 1.00 65.93  ? 133  ALA C N   1 
ATOM   5138 C CA  . ALA C 1 133 ? 24.366  19.328  30.142 1.00 63.42  ? 133  ALA C CA  1 
ATOM   5139 C C   . ALA C 1 133 ? 25.207  18.241  29.484 1.00 72.29  ? 133  ALA C C   1 
ATOM   5140 O O   . ALA C 1 133 ? 24.937  17.054  29.651 1.00 69.87  ? 133  ALA C O   1 
ATOM   5141 C CB  . ALA C 1 133 ? 23.474  20.005  29.115 1.00 62.00  ? 133  ALA C CB  1 
ATOM   5142 N N   . ARG C 1 134 ? 26.227  18.643  28.735 1.00 80.00  ? 134  ARG C N   1 
ATOM   5143 C CA  . ARG C 1 134 ? 27.098  17.662  28.103 1.00 78.28  ? 134  ARG C CA  1 
ATOM   5144 C C   . ARG C 1 134 ? 28.099  17.038  29.068 1.00 84.68  ? 134  ARG C C   1 
ATOM   5145 O O   . ARG C 1 134 ? 28.500  15.893  28.892 1.00 84.79  ? 134  ARG C O   1 
ATOM   5146 C CB  . ARG C 1 134 ? 27.809  18.232  26.875 1.00 73.36  ? 134  ARG C CB  1 
ATOM   5147 C CG  . ARG C 1 134 ? 27.928  19.736  26.811 1.00 72.76  ? 134  ARG C CG  1 
ATOM   5148 C CD  . ARG C 1 134 ? 28.437  20.118  25.436 1.00 67.58  ? 134  ARG C CD  1 
ATOM   5149 N NE  . ARG C 1 134 ? 29.550  19.248  25.068 1.00 67.91  ? 134  ARG C NE  1 
ATOM   5150 C CZ  . ARG C 1 134 ? 29.840  18.874  23.827 1.00 68.52  ? 134  ARG C CZ  1 
ATOM   5151 N NH1 . ARG C 1 134 ? 29.096  19.287  22.811 1.00 68.47  ? 134  ARG C NH1 1 
ATOM   5152 N NH2 . ARG C 1 134 ? 30.873  18.076  23.603 1.00 69.48  ? 134  ARG C NH2 1 
ATOM   5153 N N   . PHE C 1 135 ? 28.486  17.779  30.098 1.00 88.63  ? 135  PHE C N   1 
ATOM   5154 C CA  . PHE C 1 135 ? 29.498  17.293  31.030 1.00 95.18  ? 135  PHE C CA  1 
ATOM   5155 C C   . PHE C 1 135 ? 28.970  16.211  31.973 1.00 89.82  ? 135  PHE C C   1 
ATOM   5156 O O   . PHE C 1 135 ? 29.660  15.239  32.258 1.00 93.17  ? 135  PHE C O   1 
ATOM   5157 C CB  . PHE C 1 135 ? 30.098  18.456  31.830 1.00 97.66  ? 135  PHE C CB  1 
ATOM   5158 C CG  . PHE C 1 135 ? 31.415  18.131  32.475 1.00 103.48 ? 135  PHE C CG  1 
ATOM   5159 C CD1 . PHE C 1 135 ? 32.541  17.906  31.700 1.00 102.93 ? 135  PHE C CD1 1 
ATOM   5160 C CD2 . PHE C 1 135 ? 31.529  18.053  33.853 1.00 98.66  ? 135  PHE C CD2 1 
ATOM   5161 C CE1 . PHE C 1 135 ? 33.758  17.603  32.286 1.00 108.20 ? 135  PHE C CE1 1 
ATOM   5162 C CE2 . PHE C 1 135 ? 32.743  17.753  34.448 1.00 104.22 ? 135  PHE C CE2 1 
ATOM   5163 C CZ  . PHE C 1 135 ? 33.861  17.527  33.661 1.00 114.30 ? 135  PHE C CZ  1 
ATOM   5164 N N   . THR C 1 136 ? 27.741  16.378  32.447 1.00 100.97 ? 136  THR C N   1 
ATOM   5165 C CA  . THR C 1 136 ? 27.189  15.468  33.451 1.00 92.96  ? 136  THR C CA  1 
ATOM   5166 C C   . THR C 1 136 ? 26.551  14.214  32.871 1.00 91.46  ? 136  THR C C   1 
ATOM   5167 O O   . THR C 1 136 ? 25.354  13.972  33.044 1.00 83.03  ? 136  THR C O   1 
ATOM   5168 C CB  . THR C 1 136 ? 26.170  16.166  34.374 1.00 82.34  ? 136  THR C CB  1 
ATOM   5169 O OG1 . THR C 1 136 ? 25.220  16.894  33.584 1.00 79.51  ? 136  THR C OG1 1 
ATOM   5170 C CG2 . THR C 1 136 ? 26.884  17.120  35.329 1.00 82.79  ? 136  THR C CG2 1 
ATOM   5171 N N   . ARG C 1 137 ? 27.360  13.415  32.186 1.00 124.07 ? 137  ARG C N   1 
ATOM   5172 C CA  . ARG C 1 137 ? 26.927  12.106  31.720 1.00 122.50 ? 137  ARG C CA  1 
ATOM   5173 C C   . ARG C 1 137 ? 27.892  11.052  32.239 1.00 125.01 ? 137  ARG C C   1 
ATOM   5174 O O   . ARG C 1 137 ? 29.063  11.016  31.874 1.00 132.39 ? 137  ARG C O   1 
ATOM   5175 C CB  . ARG C 1 137 ? 26.898  12.055  30.203 1.00 125.93 ? 137  ARG C CB  1 
ATOM   5176 C CG  . ARG C 1 137 ? 26.108  13.152  29.582 1.00 124.51 ? 137  ARG C CG  1 
ATOM   5177 C CD  . ARG C 1 137 ? 26.376  13.144  28.114 1.00 124.15 ? 137  ARG C CD  1 
ATOM   5178 N NE  . ARG C 1 137 ? 25.550  14.102  27.403 1.00 119.07 ? 137  ARG C NE  1 
ATOM   5179 C CZ  . ARG C 1 137 ? 25.384  14.087  26.088 1.00 112.74 ? 137  ARG C CZ  1 
ATOM   5180 N NH1 . ARG C 1 137 ? 25.986  13.158  25.355 1.00 110.85 ? 137  ARG C NH1 1 
ATOM   5181 N NH2 . ARG C 1 137 ? 24.615  14.995  25.508 1.00 108.70 ? 137  ARG C NH2 1 
ATOM   5182 N N   . PRO C 1 138 ? 26.687  9.762   33.326 1.00 105.42 ? 138  PRO C N   1 
ATOM   5183 C CA  . PRO C 1 138 ? 27.510  8.766   34.006 1.00 106.10 ? 138  PRO C CA  1 
ATOM   5184 C C   . PRO C 1 138 ? 27.647  7.587   33.070 1.00 104.93 ? 138  PRO C C   1 
ATOM   5185 O O   . PRO C 1 138 ? 27.014  7.593   32.018 1.00 103.50 ? 138  PRO C O   1 
ATOM   5186 C CB  . PRO C 1 138 ? 26.653  8.393   35.215 1.00 104.35 ? 138  PRO C CB  1 
ATOM   5187 C CG  . PRO C 1 138 ? 25.772  9.572   35.430 1.00 104.38 ? 138  PRO C CG  1 
ATOM   5188 C CD  . PRO C 1 138 ? 25.457  10.068  34.065 1.00 103.48 ? 138  PRO C CD  1 
ATOM   5189 N N   . THR C 1 139 ? 28.460  6.604   33.424 1.00 98.26  ? 139  THR C N   1 
ATOM   5190 C CA  . THR C 1 139 ? 28.501  5.366   32.667 1.00 96.95  ? 139  THR C CA  1 
ATOM   5191 C C   . THR C 1 139 ? 28.553  4.229   33.661 1.00 94.15  ? 139  THR C C   1 
ATOM   5192 O O   . THR C 1 139 ? 29.461  4.176   34.480 1.00 95.46  ? 139  THR C O   1 
ATOM   5193 C CB  . THR C 1 139 ? 29.739  5.292   31.760 1.00 100.11 ? 139  THR C CB  1 
ATOM   5194 O OG1 . THR C 1 139 ? 30.873  5.813   32.462 1.00 103.03 ? 139  THR C OG1 1 
ATOM   5195 C CG2 . THR C 1 139 ? 29.523  6.103   30.494 1.00 104.38 ? 139  THR C CG2 1 
ATOM   5196 N N   . ALA C 1 140 ? 27.574  3.334   33.613 1.00 96.33  ? 140  ALA C N   1 
ATOM   5197 C CA  . ALA C 1 140 ? 27.609  2.159   34.471 1.00 94.34  ? 140  ALA C CA  1 
ATOM   5198 C C   . ALA C 1 140 ? 28.980  1.508   34.348 1.00 93.92  ? 140  ALA C C   1 
ATOM   5199 O O   . ALA C 1 140 ? 29.456  1.248   33.238 1.00 93.18  ? 140  ALA C O   1 
ATOM   5200 C CB  . ALA C 1 140 ? 26.523  1.189   34.073 1.00 91.53  ? 140  ALA C CB  1 
ATOM   5201 N N   . GLY C 1 141 ? 29.628  1.261   35.480 1.00 80.71  ? 141  GLY C N   1 
ATOM   5202 C CA  . GLY C 1 141 ? 30.939  0.638   35.452 1.00 82.44  ? 141  GLY C CA  1 
ATOM   5203 C C   . GLY C 1 141 ? 30.836  -0.837  35.112 1.00 80.43  ? 141  GLY C C   1 
ATOM   5204 O O   . GLY C 1 141 ? 31.631  -1.642  35.579 1.00 83.46  ? 141  GLY C O   1 
ATOM   5205 N N   . VAL C 1 142 ? 29.862  -1.191  34.282 1.00 95.39  ? 142  VAL C N   1 
ATOM   5206 C CA  . VAL C 1 142 ? 29.494  -2.590  34.089 1.00 93.88  ? 142  VAL C CA  1 
ATOM   5207 C C   . VAL C 1 142 ? 30.216  -3.292  32.946 1.00 93.95  ? 142  VAL C C   1 
ATOM   5208 O O   . VAL C 1 142 ? 30.291  -2.776  31.834 1.00 93.31  ? 142  VAL C O   1 
ATOM   5209 C CB  . VAL C 1 142 ? 27.983  -2.737  33.880 1.00 90.85  ? 142  VAL C CB  1 
ATOM   5210 C CG1 . VAL C 1 142 ? 27.602  -4.204  33.822 1.00 89.80  ? 142  VAL C CG1 1 
ATOM   5211 C CG2 . VAL C 1 142 ? 27.243  -2.048  35.001 1.00 90.50  ? 142  VAL C CG2 1 
ATOM   5212 N N   . LEU C 1 143 ? 30.729  -4.483  33.238 1.00 81.02  ? 143  LEU C N   1 
ATOM   5213 C CA  . LEU C 1 143 ? 31.404  -5.319  32.253 1.00 81.09  ? 143  LEU C CA  1 
ATOM   5214 C C   . LEU C 1 143 ? 30.581  -6.566  31.928 1.00 80.24  ? 143  LEU C C   1 
ATOM   5215 O O   . LEU C 1 143 ? 30.083  -7.238  32.834 1.00 81.85  ? 143  LEU C O   1 
ATOM   5216 C CB  . LEU C 1 143 ? 32.774  -5.747  32.779 1.00 84.35  ? 143  LEU C CB  1 
ATOM   5217 C CG  . LEU C 1 143 ? 33.503  -6.788  31.927 1.00 84.54  ? 143  LEU C CG  1 
ATOM   5218 C CD1 . LEU C 1 143 ? 34.009  -6.155  30.637 1.00 83.34  ? 143  LEU C CD1 1 
ATOM   5219 C CD2 . LEU C 1 143 ? 34.643  -7.417  32.703 1.00 89.22  ? 143  LEU C CD2 1 
ATOM   5220 N N   . PHE C 1 144 ? 30.454  -6.881  30.639 1.00 84.70  ? 144  PHE C N   1 
ATOM   5221 C CA  . PHE C 1 144 ? 29.694  -8.053  30.208 1.00 84.35  ? 144  PHE C CA  1 
ATOM   5222 C C   . PHE C 1 144 ? 30.604  -9.217  29.863 1.00 86.46  ? 144  PHE C C   1 
ATOM   5223 O O   . PHE C 1 144 ? 31.593  -9.054  29.148 1.00 87.24  ? 144  PHE C O   1 
ATOM   5224 C CB  . PHE C 1 144 ? 28.845  -7.733  28.979 1.00 82.29  ? 144  PHE C CB  1 
ATOM   5225 C CG  . PHE C 1 144 ? 27.794  -6.695  29.217 1.00 79.00  ? 144  PHE C CG  1 
ATOM   5226 C CD1 . PHE C 1 144 ? 28.128  -5.354  29.277 1.00 79.17  ? 144  PHE C CD1 1 
ATOM   5227 C CD2 . PHE C 1 144 ? 26.468  -7.057  29.368 1.00 77.17  ? 144  PHE C CD2 1 
ATOM   5228 C CE1 . PHE C 1 144 ? 27.157  -4.395  29.493 1.00 77.81  ? 144  PHE C CE1 1 
ATOM   5229 C CE2 . PHE C 1 144 ? 25.493  -6.099  29.580 1.00 76.01  ? 144  PHE C CE2 1 
ATOM   5230 C CZ  . PHE C 1 144 ? 25.839  -4.768  29.645 1.00 76.47  ? 144  PHE C CZ  1 
ATOM   5231 N N   . SER C 1 145 ? 30.260  -10.397 30.364 1.00 85.63  ? 145  SER C N   1 
ATOM   5232 C CA  . SER C 1 145 ? 30.957  -11.602 29.960 1.00 88.57  ? 145  SER C CA  1 
ATOM   5233 C C   . SER C 1 145 ? 30.964  -11.639 28.441 1.00 86.98  ? 145  SER C C   1 
ATOM   5234 O O   . SER C 1 145 ? 29.935  -11.455 27.803 1.00 85.21  ? 145  SER C O   1 
ATOM   5235 C CB  . SER C 1 145 ? 30.281  -12.850 30.537 1.00 92.54  ? 145  SER C CB  1 
ATOM   5236 O OG  . SER C 1 145 ? 28.903  -12.902 30.210 1.00 89.94  ? 145  SER C OG  1 
ATOM   5237 N N   . SER C 1 146 ? 32.137  -11.854 27.864 1.00 80.36  ? 146  SER C N   1 
ATOM   5238 C CA  . SER C 1 146 ? 32.292  -11.850 26.419 1.00 78.70  ? 146  SER C CA  1 
ATOM   5239 C C   . SER C 1 146 ? 31.445  -12.929 25.753 1.00 80.01  ? 146  SER C C   1 
ATOM   5240 O O   . SER C 1 146 ? 31.112  -12.827 24.574 1.00 80.23  ? 146  SER C O   1 
ATOM   5241 C CB  . SER C 1 146 ? 33.763  -12.046 26.058 1.00 82.22  ? 146  SER C CB  1 
ATOM   5242 O OG  . SER C 1 146 ? 34.283  -13.204 26.688 1.00 84.64  ? 146  SER C OG  1 
ATOM   5243 N N   . ARG C 1 147 ? 31.099  -13.963 26.510 1.00 96.80  ? 147  ARG C N   1 
ATOM   5244 C CA  . ARG C 1 147 ? 30.337  -15.075 25.964 1.00 98.87  ? 147  ARG C CA  1 
ATOM   5245 C C   . ARG C 1 147 ? 29.091  -15.357 26.776 1.00 97.67  ? 147  ARG C C   1 
ATOM   5246 O O   . ARG C 1 147 ? 28.963  -14.920 27.918 1.00 96.75  ? 147  ARG C O   1 
ATOM   5247 C CB  . ARG C 1 147 ? 31.180  -16.348 25.956 1.00 104.06 ? 147  ARG C CB  1 
ATOM   5248 C CG  . ARG C 1 147 ? 32.352  -16.339 25.010 1.00 106.89 ? 147  ARG C CG  1 
ATOM   5249 C CD  . ARG C 1 147 ? 31.896  -16.302 23.564 1.00 108.85 ? 147  ARG C CD  1 
ATOM   5250 N NE  . ARG C 1 147 ? 33.020  -16.021 22.676 1.00 113.13 ? 147  ARG C NE  1 
ATOM   5251 C CZ  . ARG C 1 147 ? 33.674  -14.861 22.654 1.00 112.33 ? 147  ARG C CZ  1 
ATOM   5252 N NH1 . ARG C 1 147 ? 33.314  -13.880 23.472 1.00 106.98 ? 147  ARG C NH1 1 
ATOM   5253 N NH2 . ARG C 1 147 ? 34.690  -14.678 21.821 1.00 117.90 ? 147  ARG C NH2 1 
ATOM   5254 N N   . MET C 1 148 ? 28.177  -16.101 26.168 1.00 99.57  ? 148  MET C N   1 
ATOM   5255 C CA  . MET C 1 148 ? 27.105  -16.737 26.905 1.00 98.32  ? 148  MET C CA  1 
ATOM   5256 C C   . MET C 1 148 ? 27.424  -18.216 26.940 1.00 103.15 ? 148  MET C C   1 
ATOM   5257 O O   . MET C 1 148 ? 28.310  -18.686 26.227 1.00 107.59 ? 148  MET C O   1 
ATOM   5258 C CB  . MET C 1 148 ? 25.766  -16.542 26.208 1.00 95.26  ? 148  MET C CB  1 
ATOM   5259 C CG  . MET C 1 148 ? 25.552  -15.167 25.656 1.00 92.81  ? 148  MET C CG  1 
ATOM   5260 S SD  . MET C 1 148 ? 23.818  -14.930 25.255 1.00 89.85  ? 148  MET C SD  1 
ATOM   5261 C CE  . MET C 1 148 ? 23.100  -14.899 26.894 1.00 85.93  ? 148  MET C CE  1 
ATOM   5262 N N   . VAL C 1 149 ? 26.704  -18.952 27.774 1.00 102.06 ? 149  VAL C N   1 
ATOM   5263 C CA  . VAL C 1 149 ? 26.829  -20.393 27.779 1.00 104.41 ? 149  VAL C CA  1 
ATOM   5264 C C   . VAL C 1 149 ? 25.453  -20.996 27.959 1.00 99.59  ? 149  VAL C C   1 
ATOM   5265 O O   . VAL C 1 149 ? 24.577  -20.397 28.590 1.00 95.41  ? 149  VAL C O   1 
ATOM   5266 C CB  . VAL C 1 149 ? 27.745  -20.883 28.909 1.00 107.89 ? 149  VAL C CB  1 
ATOM   5267 C CG1 . VAL C 1 149 ? 28.886  -19.910 29.116 1.00 111.80 ? 149  VAL C CG1 1 
ATOM   5268 C CG2 . VAL C 1 149 ? 26.964  -21.037 30.194 1.00 104.14 ? 149  VAL C CG2 1 
ATOM   5269 N N   . ILE C 1 150 ? 25.251  -22.167 27.374 1.00 85.27  ? 150  ILE C N   1 
ATOM   5270 C CA  . ILE C 1 150 ? 24.043  -22.922 27.633 1.00 82.15  ? 150  ILE C CA  1 
ATOM   5271 C C   . ILE C 1 150 ? 24.461  -24.186 28.358 1.00 84.83  ? 150  ILE C C   1 
ATOM   5272 O O   . ILE C 1 150 ? 25.266  -24.959 27.836 1.00 89.21  ? 150  ILE C O   1 
ATOM   5273 C CB  . ILE C 1 150 ? 23.292  -23.252 26.346 1.00 82.01  ? 150  ILE C CB  1 
ATOM   5274 C CG1 . ILE C 1 150 ? 22.839  -21.953 25.676 1.00 80.13  ? 150  ILE C CG1 1 
ATOM   5275 C CG2 . ILE C 1 150 ? 22.095  -24.131 26.653 1.00 83.07  ? 150  ILE C CG2 1 
ATOM   5276 C CD1 . ILE C 1 150 ? 21.944  -22.145 24.490 1.00 80.51  ? 150  ILE C CD1 1 
ATOM   5277 N N   . SER C 1 151 ? 23.989  -24.342 29.590 1.00 96.84  ? 151  SER C N   1 
ATOM   5278 C CA  . SER C 1 151 ? 24.382  -25.483 30.394 1.00 100.35 ? 151  SER C CA  1 
ATOM   5279 C C   . SER C 1 151 ? 23.303  -25.801 31.410 1.00 99.43  ? 151  SER C C   1 
ATOM   5280 O O   . SER C 1 151 ? 22.458  -24.963 31.716 1.00 96.80  ? 151  SER C O   1 
ATOM   5281 C CB  . SER C 1 151 ? 25.710  -25.214 31.104 1.00 104.42 ? 151  SER C CB  1 
ATOM   5282 O OG  . SER C 1 151 ? 25.484  -24.658 32.382 1.00 104.11 ? 151  SER C OG  1 
ATOM   5283 N N   . ASP C 1 152 ? 23.351  -27.016 31.939 1.00 147.79 ? 152  ASP C N   1 
ATOM   5284 C CA  . ASP C 1 152 ? 22.386  -27.467 32.924 1.00 149.05 ? 152  ASP C CA  1 
ATOM   5285 C C   . ASP C 1 152 ? 22.630  -26.812 34.260 1.00 151.62 ? 152  ASP C C   1 
ATOM   5286 O O   . ASP C 1 152 ? 23.702  -26.941 34.837 1.00 155.31 ? 152  ASP C O   1 
ATOM   5287 C CB  . ASP C 1 152 ? 22.475  -28.980 33.102 1.00 153.00 ? 152  ASP C CB  1 
ATOM   5288 C CG  . ASP C 1 152 ? 21.766  -29.733 32.008 1.00 151.18 ? 152  ASP C CG  1 
ATOM   5289 O OD1 . ASP C 1 152 ? 21.759  -29.248 30.860 1.00 147.97 ? 152  ASP C OD1 1 
ATOM   5290 O OD2 . ASP C 1 152 ? 21.205  -30.809 32.298 1.00 153.74 ? 152  ASP C OD2 1 
ATOM   5291 N N   . PHE C 1 153 ? 21.628  -26.100 34.742 1.00 132.70 ? 153  PHE C N   1 
ATOM   5292 C CA  . PHE C 1 153 ? 21.642  -25.620 36.102 1.00 136.91 ? 153  PHE C CA  1 
ATOM   5293 C C   . PHE C 1 153 ? 20.321  -26.018 36.723 1.00 140.42 ? 153  PHE C C   1 
ATOM   5294 O O   . PHE C 1 153 ? 19.270  -25.889 36.101 1.00 137.88 ? 153  PHE C O   1 
ATOM   5295 C CB  . PHE C 1 153 ? 21.847  -24.111 36.137 1.00 134.18 ? 153  PHE C CB  1 
ATOM   5296 C CG  . PHE C 1 153 ? 21.505  -23.489 37.448 1.00 138.64 ? 153  PHE C CG  1 
ATOM   5297 C CD1 . PHE C 1 153 ? 22.485  -23.243 38.390 1.00 143.02 ? 153  PHE C CD1 1 
ATOM   5298 C CD2 . PHE C 1 153 ? 20.202  -23.141 37.737 1.00 139.78 ? 153  PHE C CD2 1 
ATOM   5299 C CE1 . PHE C 1 153 ? 22.166  -22.665 39.591 1.00 148.25 ? 153  PHE C CE1 1 
ATOM   5300 C CE2 . PHE C 1 153 ? 19.883  -22.563 38.936 1.00 145.45 ? 153  PHE C CE2 1 
ATOM   5301 C CZ  . PHE C 1 153 ? 20.865  -22.325 39.865 1.00 149.60 ? 153  PHE C CZ  1 
ATOM   5302 N N   . GLU C 1 154 ? 20.384  -26.524 37.945 1.00 142.37 ? 154  GLU C N   1 
ATOM   5303 C CA  . GLU C 1 154 ? 19.196  -26.967 38.653 1.00 148.22 ? 154  GLU C CA  1 
ATOM   5304 C C   . GLU C 1 154 ? 18.219  -27.696 37.729 1.00 145.82 ? 154  GLU C C   1 
ATOM   5305 O O   . GLU C 1 154 ? 17.030  -27.397 37.695 1.00 147.12 ? 154  GLU C O   1 
ATOM   5306 C CB  . GLU C 1 154 ? 18.536  -25.783 39.365 1.00 150.68 ? 154  GLU C CB  1 
ATOM   5307 C CG  . GLU C 1 154 ? 18.284  -26.030 40.857 1.00 161.73 ? 154  GLU C CG  1 
ATOM   5308 C CD  . GLU C 1 154 ? 18.659  -24.842 41.743 1.00 164.71 ? 154  GLU C CD  1 
ATOM   5309 O OE1 . GLU C 1 154 ? 18.798  -23.720 41.217 1.00 158.10 ? 154  GLU C OE1 1 
ATOM   5310 O OE2 . GLU C 1 154 ? 18.815  -25.030 42.971 1.00 174.38 ? 154  GLU C OE2 1 
ATOM   5311 N N   . GLY C 1 155 ? 18.749  -28.640 36.960 1.00 133.31 ? 155  GLY C N   1 
ATOM   5312 C CA  . GLY C 1 155 ? 17.932  -29.601 36.244 1.00 132.93 ? 155  GLY C CA  1 
ATOM   5313 C C   . GLY C 1 155 ? 17.206  -29.145 34.994 1.00 127.13 ? 155  GLY C C   1 
ATOM   5314 O O   . GLY C 1 155 ? 16.322  -29.840 34.508 1.00 128.15 ? 155  GLY C O   1 
ATOM   5315 N N   . LYS C 1 156 ? 17.563  -27.984 34.470 1.00 106.11 ? 156  LYS C N   1 
ATOM   5316 C CA  . LYS C 1 156 ? 17.054  -27.558 33.177 1.00 101.15 ? 156  LYS C CA  1 
ATOM   5317 C C   . LYS C 1 156 ? 18.167  -26.799 32.487 1.00 96.34  ? 156  LYS C C   1 
ATOM   5318 O O   . LYS C 1 156 ? 18.881  -26.040 33.128 1.00 96.35  ? 156  LYS C O   1 
ATOM   5319 C CB  . LYS C 1 156 ? 15.820  -26.671 33.347 1.00 102.25 ? 156  LYS C CB  1 
ATOM   5320 N N   . PRO C 1 157 ? 18.334  -27.002 31.178 1.00 106.08 ? 157  PRO C N   1 
ATOM   5321 C CA  . PRO C 1 157 ? 19.381  -26.247 30.492 1.00 103.28 ? 157  PRO C CA  1 
ATOM   5322 C C   . PRO C 1 157 ? 19.125  -24.773 30.685 1.00 101.06 ? 157  PRO C C   1 
ATOM   5323 O O   . PRO C 1 157 ? 17.982  -24.343 30.569 1.00 100.55 ? 157  PRO C O   1 
ATOM   5324 C CB  . PRO C 1 157 ? 19.188  -26.633 29.028 1.00 102.12 ? 157  PRO C CB  1 
ATOM   5325 C CG  . PRO C 1 157 ? 18.461  -27.914 29.068 1.00 104.38 ? 157  PRO C CG  1 
ATOM   5326 C CD  . PRO C 1 157 ? 17.580  -27.863 30.260 1.00 106.30 ? 157  PRO C CD  1 
ATOM   5327 N N   . THR C 1 158 ? 20.160  -24.011 31.006 1.00 90.18  ? 158  THR C N   1 
ATOM   5328 C CA  . THR C 1 158 ? 19.987  -22.581 31.188 1.00 88.19  ? 158  THR C CA  1 
ATOM   5329 C C   . THR C 1 158 ? 20.982  -21.763 30.390 1.00 86.52  ? 158  THR C C   1 
ATOM   5330 O O   . THR C 1 158 ? 22.194  -22.051 30.425 1.00 88.41  ? 158  THR C O   1 
ATOM   5331 C CB  . THR C 1 158 ? 20.064  -22.181 32.669 1.00 90.59  ? 158  THR C CB  1 
ATOM   5332 O OG1 . THR C 1 158 ? 19.195  -23.023 33.436 1.00 94.18  ? 158  THR C OG1 1 
ATOM   5333 C CG2 . THR C 1 158 ? 19.633  -20.733 32.833 1.00 88.95  ? 158  THR C CG2 1 
ATOM   5334 N N   . LEU C 1 159 ? 20.429  -20.817 29.625 1.00 77.08  ? 159  LEU C N   1 
ATOM   5335 C CA  . LEU C 1 159 ? 21.247  -19.819 28.975 1.00 76.32  ? 159  LEU C CA  1 
ATOM   5336 C C   . LEU C 1 159 ? 21.661  -18.825 30.044 1.00 76.05  ? 159  LEU C C   1 
ATOM   5337 O O   . LEU C 1 159 ? 20.820  -18.346 30.808 1.00 75.39  ? 159  LEU C O   1 
ATOM   5338 C CB  . LEU C 1 159 ? 20.452  -19.112 27.891 1.00 74.88  ? 159  LEU C CB  1 
ATOM   5339 C CG  . LEU C 1 159 ? 21.180  -18.028 27.105 1.00 75.23  ? 159  LEU C CG  1 
ATOM   5340 C CD1 . LEU C 1 159 ? 22.277  -18.652 26.258 1.00 75.90  ? 159  LEU C CD1 1 
ATOM   5341 C CD2 . LEU C 1 159 ? 20.206  -17.255 26.238 1.00 74.43  ? 159  LEU C CD2 1 
ATOM   5342 N N   . MET C 1 160 ? 22.953  -18.532 30.122 1.00 95.86  ? 160  MET C N   1 
ATOM   5343 C CA  . MET C 1 160 ? 23.415  -17.498 31.034 1.00 96.07  ? 160  MET C CA  1 
ATOM   5344 C C   . MET C 1 160 ? 24.580  -16.677 30.514 1.00 97.48  ? 160  MET C C   1 
ATOM   5345 O O   . MET C 1 160 ? 25.298  -17.089 29.606 1.00 99.94  ? 160  MET C O   1 
ATOM   5346 C CB  . MET C 1 160 ? 23.749  -18.074 32.411 1.00 98.92  ? 160  MET C CB  1 
ATOM   5347 C CG  . MET C 1 160 ? 24.241  -19.503 32.413 1.00 101.76 ? 160  MET C CG  1 
ATOM   5348 S SD  . MET C 1 160 ? 24.008  -20.249 34.045 1.00 105.40 ? 160  MET C SD  1 
ATOM   5349 C CE  . MET C 1 160 ? 23.946  -21.986 33.619 1.00 107.12 ? 160  MET C CE  1 
ATOM   5350 N N   . MET C 1 161 ? 24.725  -15.493 31.098 1.00 83.30  ? 161  MET C N   1 
ATOM   5351 C CA  . MET C 1 161 ? 25.900  -14.649 30.939 1.00 85.82  ? 161  MET C CA  1 
ATOM   5352 C C   . MET C 1 161 ? 26.033  -13.909 32.256 1.00 86.19  ? 161  MET C C   1 
ATOM   5353 O O   . MET C 1 161 ? 25.200  -14.088 33.144 1.00 85.12  ? 161  MET C O   1 
ATOM   5354 C CB  . MET C 1 161 ? 25.759  -13.681 29.754 1.00 84.16  ? 161  MET C CB  1 
ATOM   5355 C CG  . MET C 1 161 ? 24.385  -13.027 29.577 1.00 80.59  ? 161  MET C CG  1 
ATOM   5356 S SD  . MET C 1 161 ? 24.152  -11.475 30.478 1.00 78.43  ? 161  MET C SD  1 
ATOM   5357 C CE  . MET C 1 161 ? 25.840  -10.858 30.538 1.00 79.95  ? 161  MET C CE  1 
ATOM   5358 N N   . ARG C 1 162 ? 27.069  -13.095 32.411 1.00 77.38  ? 162  ARG C N   1 
ATOM   5359 C CA  . ARG C 1 162 ? 27.228  -12.402 33.682 1.00 78.51  ? 162  ARG C CA  1 
ATOM   5360 C C   . ARG C 1 162 ? 27.815  -11.000 33.611 1.00 78.60  ? 162  ARG C C   1 
ATOM   5361 O O   . ARG C 1 162 ? 28.632  -10.688 32.746 1.00 77.49  ? 162  ARG C O   1 
ATOM   5362 C CB  . ARG C 1 162 ? 28.018  -13.259 34.664 1.00 83.40  ? 162  ARG C CB  1 
ATOM   5363 C CG  . ARG C 1 162 ? 29.325  -13.776 34.129 1.00 88.32  ? 162  ARG C CG  1 
ATOM   5364 C CD  . ARG C 1 162 ? 29.976  -14.631 35.187 1.00 93.79  ? 162  ARG C CD  1 
ATOM   5365 N NE  . ARG C 1 162 ? 31.325  -15.049 34.833 1.00 100.44 ? 162  ARG C NE  1 
ATOM   5366 C CZ  . ARG C 1 162 ? 32.135  -15.698 35.661 1.00 107.01 ? 162  ARG C CZ  1 
ATOM   5367 N NH1 . ARG C 1 162 ? 31.728  -15.997 36.889 1.00 107.75 ? 162  ARG C NH1 1 
ATOM   5368 N NH2 . ARG C 1 162 ? 33.351  -16.045 35.267 1.00 114.23 ? 162  ARG C NH2 1 
ATOM   5369 N N   . LEU C 1 163 ? 27.378  -10.165 34.548 1.00 80.00  ? 163  LEU C N   1 
ATOM   5370 C CA  . LEU C 1 163 ? 27.829  -8.789  34.654 1.00 78.12  ? 163  LEU C CA  1 
ATOM   5371 C C   . LEU C 1 163 ? 28.734  -8.630  35.856 1.00 82.45  ? 163  LEU C C   1 
ATOM   5372 O O   . LEU C 1 163 ? 28.476  -9.201  36.915 1.00 83.90  ? 163  LEU C O   1 
ATOM   5373 C CB  . LEU C 1 163 ? 26.637  -7.871  34.872 1.00 72.80  ? 163  LEU C CB  1 
ATOM   5374 C CG  . LEU C 1 163 ? 25.412  -8.030  33.983 1.00 72.03  ? 163  LEU C CG  1 
ATOM   5375 C CD1 . LEU C 1 163 ? 24.167  -7.687  34.779 1.00 74.18  ? 163  LEU C CD1 1 
ATOM   5376 C CD2 . LEU C 1 163 ? 25.547  -7.148  32.763 1.00 70.50  ? 163  LEU C CD2 1 
ATOM   5377 N N   . ALA C 1 164 ? 29.782  -7.833  35.701 1.00 76.83  ? 164  ALA C N   1 
ATOM   5378 C CA  . ALA C 1 164 ? 30.593  -7.445  36.842 1.00 81.37  ? 164  ALA C CA  1 
ATOM   5379 C C   . ALA C 1 164 ? 30.621  -5.927  36.966 1.00 78.13  ? 164  ALA C C   1 
ATOM   5380 O O   . ALA C 1 164 ? 30.870  -5.222  35.989 1.00 76.76  ? 164  ALA C O   1 
ATOM   5381 C CB  . ALA C 1 164 ? 32.007  -8.007  36.725 1.00 90.48  ? 164  ALA C CB  1 
ATOM   5382 N N   . ASN C 1 165 ? 30.340  -5.436  38.168 1.00 77.12  ? 165  ASN C N   1 
ATOM   5383 C CA  . ASN C 1 165 ? 30.475  -4.023  38.490 1.00 82.08  ? 165  ASN C CA  1 
ATOM   5384 C C   . ASN C 1 165 ? 31.953  -3.673  38.591 1.00 83.67  ? 165  ASN C C   1 
ATOM   5385 O O   . ASN C 1 165 ? 32.699  -4.330  39.309 1.00 83.22  ? 165  ASN C O   1 
ATOM   5386 C CB  . ASN C 1 165 ? 29.765  -3.739  39.814 1.00 80.37  ? 165  ASN C CB  1 
ATOM   5387 C CG  . ASN C 1 165 ? 29.966  -2.316  40.304 1.00 80.96  ? 165  ASN C CG  1 
ATOM   5388 O OD1 . ASN C 1 165 ? 30.700  -1.534  39.704 1.00 83.04  ? 165  ASN C OD1 1 
ATOM   5389 N ND2 . ASN C 1 165 ? 29.304  -1.975  41.406 1.00 80.17  ? 165  ASN C ND2 1 
ATOM   5390 N N   . LEU C 1 166 ? 32.380  -2.641  37.873 1.00 88.28  ? 166  LEU C N   1 
ATOM   5391 C CA  . LEU C 1 166 ? 33.801  -2.299  37.806 1.00 93.97  ? 166  LEU C CA  1 
ATOM   5392 C C   . LEU C 1 166 ? 34.237  -1.260  38.830 1.00 98.74  ? 166  LEU C C   1 
ATOM   5393 O O   . LEU C 1 166 ? 35.418  -0.926  38.914 1.00 103.80 ? 166  LEU C O   1 
ATOM   5394 C CB  . LEU C 1 166 ? 34.178  -1.824  36.403 1.00 88.75  ? 166  LEU C CB  1 
ATOM   5395 C CG  . LEU C 1 166 ? 34.285  -2.960  35.393 1.00 85.19  ? 166  LEU C CG  1 
ATOM   5396 C CD1 . LEU C 1 166 ? 34.872  -2.479  34.083 1.00 81.89  ? 166  LEU C CD1 1 
ATOM   5397 C CD2 . LEU C 1 166 ? 35.135  -4.057  35.986 1.00 90.09  ? 166  LEU C CD2 1 
ATOM   5398 N N   . ARG C 1 167 ? 33.289  -0.746  39.603 1.00 89.62  ? 167  ARG C N   1 
ATOM   5399 C CA  . ARG C 1 167 ? 33.601  0.275   40.592 1.00 92.45  ? 167  ARG C CA  1 
ATOM   5400 C C   . ARG C 1 167 ? 33.202  -0.153  41.996 1.00 91.71  ? 167  ARG C C   1 
ATOM   5401 O O   . ARG C 1 167 ? 32.397  -1.064  42.175 1.00 87.45  ? 167  ARG C O   1 
ATOM   5402 C CB  . ARG C 1 167 ? 32.898  1.581   40.240 1.00 88.20  ? 167  ARG C CB  1 
ATOM   5403 C CG  . ARG C 1 167 ? 33.225  2.112   38.871 1.00 89.05  ? 167  ARG C CG  1 
ATOM   5404 C CD  . ARG C 1 167 ? 32.247  3.189   38.496 1.00 85.32  ? 167  ARG C CD  1 
ATOM   5405 N NE  . ARG C 1 167 ? 32.725  3.997   37.385 1.00 86.71  ? 167  ARG C NE  1 
ATOM   5406 C CZ  . ARG C 1 167 ? 31.936  4.439   36.416 1.00 83.65  ? 167  ARG C CZ  1 
ATOM   5407 N NH1 . ARG C 1 167 ? 30.648  4.124   36.438 1.00 80.25  ? 167  ARG C NH1 1 
ATOM   5408 N NH2 . ARG C 1 167 ? 32.428  5.175   35.428 1.00 85.51  ? 167  ARG C NH2 1 
ATOM   5409 N N   . ILE C 1 168 ? 33.766  0.526   42.986 1.00 96.88  ? 168  ILE C N   1 
ATOM   5410 C CA  . ILE C 1 168 ? 33.498  0.241   44.386 1.00 97.51  ? 168  ILE C CA  1 
ATOM   5411 C C   . ILE C 1 168 ? 32.069  0.621   44.751 1.00 90.23  ? 168  ILE C C   1 
ATOM   5412 O O   . ILE C 1 168 ? 31.454  -0.004  45.613 1.00 88.93  ? 168  ILE C O   1 
ATOM   5413 C CB  . ILE C 1 168 ? 34.463  1.015   45.301 1.00 105.36 ? 168  ILE C CB  1 
ATOM   5414 C CG1 . ILE C 1 168 ? 35.795  1.276   44.591 1.00 114.03 ? 168  ILE C CG1 1 
ATOM   5415 C CG2 . ILE C 1 168 ? 34.683  0.259   46.594 1.00 109.88 ? 168  ILE C CG2 1 
ATOM   5416 C CD1 . ILE C 1 168 ? 35.732  2.341   43.487 1.00 111.31 ? 168  ILE C CD1 1 
ATOM   5417 N N   . GLU C 1 169 ? 31.547  1.651   44.091 1.00 103.54 ? 169  GLU C N   1 
ATOM   5418 C CA  . GLU C 1 169 ? 30.189  2.128   44.339 1.00 99.97  ? 169  GLU C CA  1 
ATOM   5419 C C   . GLU C 1 169 ? 29.158  1.086   43.904 1.00 95.34  ? 169  GLU C C   1 
ATOM   5420 O O   . GLU C 1 169 ? 29.435  0.250   43.044 1.00 93.56  ? 169  GLU C O   1 
ATOM   5421 C CB  . GLU C 1 169 ? 29.950  3.462   43.627 1.00 100.77 ? 169  GLU C CB  1 
ATOM   5422 C CG  . GLU C 1 169 ? 30.829  4.606   44.131 1.00 106.29 ? 169  GLU C CG  1 
ATOM   5423 C CD  . GLU C 1 169 ? 32.293  4.453   43.746 1.00 110.10 ? 169  GLU C CD  1 
ATOM   5424 O OE1 . GLU C 1 169 ? 32.609  3.601   42.890 1.00 108.71 ? 169  GLU C OE1 1 
ATOM   5425 O OE2 . GLU C 1 169 ? 33.134  5.192   44.297 1.00 116.01 ? 169  GLU C OE2 1 
ATOM   5426 N N   . GLN C 1 170 ? 27.971  1.134   44.501 1.00 129.33 ? 170  GLN C N   1 
ATOM   5427 C CA  . GLN C 1 170 ? 26.963  0.110   44.260 1.00 126.72 ? 170  GLN C CA  1 
ATOM   5428 C C   . GLN C 1 170 ? 25.856  0.611   43.348 1.00 126.40 ? 170  GLN C C   1 
ATOM   5429 O O   . GLN C 1 170 ? 25.606  1.811   43.260 1.00 129.47 ? 170  GLN C O   1 
ATOM   5430 C CB  . GLN C 1 170 ? 26.362  -0.344  45.584 1.00 128.78 ? 170  GLN C CB  1 
ATOM   5431 C CG  . GLN C 1 170 ? 27.318  -0.206  46.746 1.00 131.70 ? 170  GLN C CG  1 
ATOM   5432 C CD  . GLN C 1 170 ? 27.067  -1.244  47.810 1.00 133.17 ? 170  GLN C CD  1 
ATOM   5433 O OE1 . GLN C 1 170 ? 25.974  -1.322  48.371 1.00 134.47 ? 170  GLN C OE1 1 
ATOM   5434 N NE2 . GLN C 1 170 ? 28.078  -2.058  48.090 1.00 134.81 ? 170  GLN C NE2 1 
ATOM   5435 N N   . ILE C 1 171 ? 25.188  -0.313  42.672 1.00 79.45  ? 171  ILE C N   1 
ATOM   5436 C CA  . ILE C 1 171 ? 24.070  0.057   41.819 1.00 80.93  ? 171  ILE C CA  1 
ATOM   5437 C C   . ILE C 1 171 ? 22.769  -0.461  42.422 1.00 84.59  ? 171  ILE C C   1 
ATOM   5438 O O   . ILE C 1 171 ? 22.642  -1.645  42.730 1.00 82.95  ? 171  ILE C O   1 
ATOM   5439 C CB  . ILE C 1 171 ? 24.265  -0.463  40.389 1.00 77.21  ? 171  ILE C CB  1 
ATOM   5440 C CG1 . ILE C 1 171 ? 25.655  -0.073  39.885 1.00 75.36  ? 171  ILE C CG1 1 
ATOM   5441 C CG2 . ILE C 1 171 ? 23.185  0.081   39.469 1.00 80.27  ? 171  ILE C CG2 1 
ATOM   5442 C CD1 . ILE C 1 171 ? 25.892  -0.392  38.430 1.00 76.23  ? 171  ILE C CD1 1 
ATOM   5443 N N   . ILE C 1 172 ? 21.806  0.435   42.606 1.00 99.94  ? 172  ILE C N   1 
ATOM   5444 C CA  . ILE C 1 172 ? 20.588  0.079   43.323 1.00 106.49 ? 172  ILE C CA  1 
ATOM   5445 C C   . ILE C 1 172 ? 19.407  -0.189  42.399 1.00 111.39 ? 172  ILE C C   1 
ATOM   5446 O O   . ILE C 1 172 ? 19.263  0.433   41.346 1.00 109.56 ? 172  ILE C O   1 
ATOM   5447 C CB  . ILE C 1 172 ? 20.206  1.141   44.366 1.00 114.62 ? 172  ILE C CB  1 
ATOM   5448 C CG1 . ILE C 1 172 ? 19.941  2.481   43.678 1.00 120.85 ? 172  ILE C CG1 1 
ATOM   5449 C CG2 . ILE C 1 172 ? 21.306  1.264   45.411 1.00 110.55 ? 172  ILE C CG2 1 
ATOM   5450 C CD1 . ILE C 1 172 ? 18.851  3.300   44.335 1.00 131.70 ? 172  ILE C CD1 1 
ATOM   5451 N N   . GLU C 1 173 ? 18.560  -1.119  42.823 1.00 123.48 ? 173  GLU C N   1 
ATOM   5452 C CA  . GLU C 1 173 ? 17.468  -1.606  41.998 1.00 126.63 ? 173  GLU C CA  1 
ATOM   5453 C C   . GLU C 1 173 ? 17.947  -1.759  40.565 1.00 116.91 ? 173  GLU C C   1 
ATOM   5454 O O   . GLU C 1 173 ? 17.342  -1.240  39.627 1.00 113.70 ? 173  GLU C O   1 
ATOM   5455 C CB  . GLU C 1 173 ? 16.255  -0.682  42.079 1.00 132.72 ? 173  GLU C CB  1 
ATOM   5456 C CG  . GLU C 1 173 ? 16.474  0.690   41.487 1.00 128.23 ? 173  GLU C CG  1 
ATOM   5457 C CD  . GLU C 1 173 ? 15.218  1.529   41.496 1.00 134.17 ? 173  GLU C CD  1 
ATOM   5458 O OE1 . GLU C 1 173 ? 14.208  1.085   42.084 1.00 143.03 ? 173  GLU C OE1 1 
ATOM   5459 O OE2 . GLU C 1 173 ? 15.243  2.633   40.915 1.00 131.03 ? 173  GLU C OE2 1 
ATOM   5460 N N   . ALA C 1 174 ? 19.062  -2.461  40.413 1.00 101.73 ? 174  ALA C N   1 
ATOM   5461 C CA  . ALA C 1 174 ? 19.581  -2.785  39.102 1.00 95.00  ? 174  ALA C CA  1 
ATOM   5462 C C   . ALA C 1 174 ? 18.707  -3.883  38.522 1.00 94.61  ? 174  ALA C C   1 
ATOM   5463 O O   . ALA C 1 174 ? 18.182  -4.712  39.257 1.00 99.07  ? 174  ALA C O   1 
ATOM   5464 C CB  . ALA C 1 174 ? 21.024  -3.249  39.212 1.00 88.47  ? 174  ALA C CB  1 
ATOM   5465 N N   . ASP C 1 175 ? 18.533  -3.881  37.207 1.00 118.35 ? 175  ASP C N   1 
ATOM   5466 C CA  . ASP C 1 175 ? 17.787  -4.949  36.557 1.00 117.32 ? 175  ASP C CA  1 
ATOM   5467 C C   . ASP C 1 175 ? 18.211  -5.119  35.101 1.00 111.32 ? 175  ASP C C   1 
ATOM   5468 O O   . ASP C 1 175 ? 18.779  -4.208  34.496 1.00 108.75 ? 175  ASP C O   1 
ATOM   5469 C CB  . ASP C 1 175 ? 16.279  -4.724  36.684 1.00 122.01 ? 175  ASP C CB  1 
ATOM   5470 C CG  . ASP C 1 175 ? 15.795  -3.538  35.885 1.00 120.50 ? 175  ASP C CG  1 
ATOM   5471 O OD1 . ASP C 1 175 ? 16.331  -3.292  34.783 1.00 114.89 ? 175  ASP C OD1 1 
ATOM   5472 O OD2 . ASP C 1 175 ? 14.865  -2.855  36.356 1.00 125.09 ? 175  ASP C OD2 1 
ATOM   5473 N N   . VAL C 1 176 ? 17.927  -6.289  34.544 1.00 76.14  ? 176  VAL C N   1 
ATOM   5474 C CA  . VAL C 1 176 ? 18.472  -6.647  33.247 1.00 71.98  ? 176  VAL C CA  1 
ATOM   5475 C C   . VAL C 1 176 ? 17.448  -7.356  32.357 1.00 73.41  ? 176  VAL C C   1 
ATOM   5476 O O   . VAL C 1 176 ? 16.586  -8.079  32.846 1.00 74.52  ? 176  VAL C O   1 
ATOM   5477 C CB  . VAL C 1 176 ? 19.747  -7.503  33.427 1.00 71.09  ? 176  VAL C CB  1 
ATOM   5478 C CG1 . VAL C 1 176 ? 19.392  -8.888  33.898 1.00 72.58  ? 176  VAL C CG1 1 
ATOM   5479 C CG2 . VAL C 1 176 ? 20.540  -7.566  32.140 1.00 70.17  ? 176  VAL C CG2 1 
ATOM   5480 N N   . HIS C 1 177 ? 17.537  -7.115  31.050 1.00 131.88 ? 177  HIS C N   1 
ATOM   5481 C CA  . HIS C 1 177 ? 16.663  -7.751  30.067 1.00 132.11 ? 177  HIS C CA  1 
ATOM   5482 C C   . HIS C 1 177 ? 17.471  -8.587  29.105 1.00 130.62 ? 177  HIS C C   1 
ATOM   5483 O O   . HIS C 1 177 ? 18.456  -8.112  28.542 1.00 129.56 ? 177  HIS C O   1 
ATOM   5484 C CB  . HIS C 1 177 ? 15.912  -6.709  29.246 1.00 132.88 ? 177  HIS C CB  1 
ATOM   5485 C CG  . HIS C 1 177 ? 14.862  -5.977  30.013 1.00 135.55 ? 177  HIS C CG  1 
ATOM   5486 N ND1 . HIS C 1 177 ? 13.542  -6.381  30.036 1.00 138.63 ? 177  HIS C ND1 1 
ATOM   5487 C CD2 . HIS C 1 177 ? 14.933  -4.867  30.780 1.00 136.58 ? 177  HIS C CD2 1 
ATOM   5488 C CE1 . HIS C 1 177 ? 12.850  -5.549  30.791 1.00 141.75 ? 177  HIS C CE1 1 
ATOM   5489 N NE2 . HIS C 1 177 ? 13.663  -4.621  31.255 1.00 140.53 ? 177  HIS C NE2 1 
ATOM   5490 N N   . LEU C 1 178 ? 17.041  -9.825  28.897 1.00 82.13  ? 178  LEU C N   1 
ATOM   5491 C CA  . LEU C 1 178 ? 17.704  -10.692 27.941 1.00 81.48  ? 178  LEU C CA  1 
ATOM   5492 C C   . LEU C 1 178 ? 16.785  -10.901 26.763 1.00 83.06  ? 178  LEU C C   1 
ATOM   5493 O O   . LEU C 1 178 ? 15.812  -11.637 26.852 1.00 84.33  ? 178  LEU C O   1 
ATOM   5494 C CB  . LEU C 1 178 ? 18.064  -12.030 28.575 1.00 81.31  ? 178  LEU C CB  1 
ATOM   5495 C CG  . LEU C 1 178 ? 19.105  -12.804 27.774 1.00 81.38  ? 178  LEU C CG  1 
ATOM   5496 C CD1 . LEU C 1 178 ? 20.039  -11.845 27.056 1.00 82.00  ? 178  LEU C CD1 1 
ATOM   5497 C CD2 . LEU C 1 178 ? 19.879  -13.741 28.686 1.00 81.57  ? 178  LEU C CD2 1 
ATOM   5498 N N   . VAL C 1 179 ? 17.086  -10.246 25.654 1.00 73.74  ? 179  VAL C N   1 
ATOM   5499 C CA  . VAL C 1 179 ? 16.194  -10.317 24.511 1.00 76.50  ? 179  VAL C CA  1 
ATOM   5500 C C   . VAL C 1 179 ? 16.783  -11.057 23.314 1.00 73.60  ? 179  VAL C C   1 
ATOM   5501 O O   . VAL C 1 179 ? 17.833  -10.701 22.779 1.00 74.98  ? 179  VAL C O   1 
ATOM   5502 C CB  . VAL C 1 179 ? 15.675  -8.927  24.117 1.00 78.28  ? 179  VAL C CB  1 
ATOM   5503 C CG1 . VAL C 1 179 ? 14.829  -9.012  22.864 1.00 77.37  ? 179  VAL C CG1 1 
ATOM   5504 C CG2 . VAL C 1 179 ? 14.862  -8.358  25.256 1.00 77.80  ? 179  VAL C CG2 1 
ATOM   5505 N N   . LEU C 1 180 ? 16.082  -12.110 22.919 1.00 75.78  ? 180  LEU C N   1 
ATOM   5506 C CA  . LEU C 1 180 ? 16.401  -12.858 21.722 1.00 79.08  ? 180  LEU C CA  1 
ATOM   5507 C C   . LEU C 1 180 ? 15.804  -12.152 20.515 1.00 83.85  ? 180  LEU C C   1 
ATOM   5508 O O   . LEU C 1 180 ? 14.617  -11.830 20.511 1.00 85.03  ? 180  LEU C O   1 
ATOM   5509 C CB  . LEU C 1 180 ? 15.804  -14.260 21.829 1.00 79.04  ? 180  LEU C CB  1 
ATOM   5510 C CG  . LEU C 1 180 ? 15.444  -14.949 20.512 1.00 83.77  ? 180  LEU C CG  1 
ATOM   5511 C CD1 . LEU C 1 180 ? 16.698  -15.332 19.745 1.00 78.44  ? 180  LEU C CD1 1 
ATOM   5512 C CD2 . LEU C 1 180 ? 14.575  -16.166 20.768 1.00 83.72  ? 180  LEU C CD2 1 
ATOM   5513 N N   . VAL C 1 181 ? 16.623  -11.902 19.499 1.00 80.60  ? 181  VAL C N   1 
ATOM   5514 C CA  . VAL C 1 181 ? 16.119  -11.368 18.241 1.00 86.51  ? 181  VAL C CA  1 
ATOM   5515 C C   . VAL C 1 181 ? 16.407  -12.349 17.121 1.00 88.84  ? 181  VAL C C   1 
ATOM   5516 O O   . VAL C 1 181 ? 17.546  -12.786 16.943 1.00 85.97  ? 181  VAL C O   1 
ATOM   5517 C CB  . VAL C 1 181 ? 16.723  -9.990  17.904 1.00 86.74  ? 181  VAL C CB  1 
ATOM   5518 C CG1 . VAL C 1 181 ? 16.083  -9.435  16.650 1.00 93.60  ? 181  VAL C CG1 1 
ATOM   5519 C CG2 . VAL C 1 181 ? 16.524  -9.028  19.061 1.00 83.90  ? 181  VAL C CG2 1 
ATOM   5520 N N   . ARG C 1 182 ? 15.360  -12.709 16.386 1.00 82.76  ? 182  ARG C N   1 
ATOM   5521 C CA  . ARG C 1 182 ? 15.512  -13.682 15.313 1.00 83.60  ? 182  ARG C CA  1 
ATOM   5522 C C   . ARG C 1 182 ? 14.424  -13.545 14.249 1.00 91.40  ? 182  ARG C C   1 
ATOM   5523 O O   . ARG C 1 182 ? 13.364  -12.966 14.491 1.00 95.04  ? 182  ARG C O   1 
ATOM   5524 C CB  . ARG C 1 182 ? 15.470  -15.095 15.877 1.00 81.94  ? 182  ARG C CB  1 
ATOM   5525 C CG  . ARG C 1 182 ? 14.092  -15.490 16.322 1.00 82.70  ? 182  ARG C CG  1 
ATOM   5526 C CD  . ARG C 1 182 ? 13.991  -16.973 16.572 1.00 83.68  ? 182  ARG C CD  1 
ATOM   5527 N NE  . ARG C 1 182 ? 12.652  -17.303 17.036 1.00 82.64  ? 182  ARG C NE  1 
ATOM   5528 C CZ  . ARG C 1 182 ? 12.375  -18.304 17.857 1.00 82.36  ? 182  ARG C CZ  1 
ATOM   5529 N NH1 . ARG C 1 182 ? 13.354  -19.077 18.308 1.00 81.46  ? 182  ARG C NH1 1 
ATOM   5530 N NH2 . ARG C 1 182 ? 11.122  -18.525 18.232 1.00 83.30  ? 182  ARG C NH2 1 
ATOM   5531 N N   . SER C 1 183 ? 14.694  -14.107 13.075 1.00 119.65 ? 183  SER C N   1 
ATOM   5532 C CA  . SER C 1 183 ? 13.777  -14.024 11.949 1.00 116.40 ? 183  SER C CA  1 
ATOM   5533 C C   . SER C 1 183 ? 12.719  -15.086 12.043 1.00 115.45 ? 183  SER C C   1 
ATOM   5534 O O   . SER C 1 183 ? 12.963  -16.201 12.471 1.00 116.25 ? 183  SER C O   1 
ATOM   5535 C CB  . SER C 1 183 ? 14.537  -14.185 10.635 1.00 122.68 ? 183  SER C CB  1 
ATOM   5536 O OG  . SER C 1 183 ? 15.722  -13.405 10.649 1.00 121.27 ? 183  SER C OG  1 
ATOM   5537 N N   . GLU C 1 184 ? 11.536  -14.745 11.575 1.00 117.19 ? 184  GLU C N   1 
ATOM   5538 C CA  . GLU C 1 184 ? 10.451  -15.692 11.659 1.00 117.30 ? 184  GLU C CA  1 
ATOM   5539 C C   . GLU C 1 184 ? 9.503   -15.591 10.485 1.00 119.74 ? 184  GLU C C   1 
ATOM   5540 O O   . GLU C 1 184 ? 9.574   -14.663 9.679  1.00 120.55 ? 184  GLU C O   1 
ATOM   5541 C CB  . GLU C 1 184 ? 9.720   -15.516 12.987 1.00 118.57 ? 184  GLU C CB  1 
ATOM   5542 C CG  . GLU C 1 184 ? 10.689  -15.464 14.161 1.00 114.47 ? 184  GLU C CG  1 
ATOM   5543 C CD  . GLU C 1 184 ? 10.035  -15.684 15.509 1.00 121.83 ? 184  GLU C CD  1 
ATOM   5544 O OE1 . GLU C 1 184 ? 9.042   -14.998 15.834 1.00 123.09 ? 184  GLU C OE1 1 
ATOM   5545 O OE2 . GLU C 1 184 ? 10.538  -16.545 16.256 1.00 116.89 ? 184  GLU C OE2 1 
ATOM   5546 N N   . ILE C 1 185 ? 8.629   -16.581 10.393 1.00 139.48 ? 185  ILE C N   1 
ATOM   5547 C CA  . ILE C 1 185 ? 7.571   -16.573 9.410  1.00 141.09 ? 185  ILE C CA  1 
ATOM   5548 C C   . ILE C 1 185 ? 6.265   -16.575 10.160 1.00 143.17 ? 185  ILE C C   1 
ATOM   5549 O O   . ILE C 1 185 ? 6.048   -17.400 11.046 1.00 142.69 ? 185  ILE C O   1 
ATOM   5550 C CB  . ILE C 1 185 ? 7.635   -17.798 8.492  1.00 139.88 ? 185  ILE C CB  1 
ATOM   5551 C CG1 . ILE C 1 185 ? 8.898   -17.726 7.644  1.00 135.38 ? 185  ILE C CG1 1 
ATOM   5552 C CG2 . ILE C 1 185 ? 6.418   -17.852 7.578  1.00 141.97 ? 185  ILE C CG2 1 
ATOM   5553 C CD1 . ILE C 1 185 ? 9.052   -16.401 6.946  1.00 139.42 ? 185  ILE C CD1 1 
ATOM   5554 N N   . SER C 1 186 ? 5.408   -15.625 9.816  1.00 132.41 ? 186  SER C N   1 
ATOM   5555 C CA  . SER C 1 186 ? 4.069   -15.564 10.363 1.00 134.98 ? 186  SER C CA  1 
ATOM   5556 C C   . SER C 1 186 ? 3.226   -16.634 9.683  1.00 135.30 ? 186  SER C C   1 
ATOM   5557 O O   . SER C 1 186 ? 3.610   -17.145 8.630  1.00 134.14 ? 186  SER C O   1 
ATOM   5558 C CB  . SER C 1 186 ? 3.483   -14.185 10.088 1.00 137.96 ? 186  SER C CB  1 
ATOM   5559 O OG  . SER C 1 186 ? 2.120   -14.134 10.440 1.00 140.85 ? 186  SER C OG  1 
ATOM   5560 N N   . GLN C 1 187 ? 2.092   -16.989 10.283 1.00 147.66 ? 187  GLN C N   1 
ATOM   5561 C CA  . GLN C 1 187 ? 1.152   -17.887 9.620  1.00 148.49 ? 187  GLN C CA  1 
ATOM   5562 C C   . GLN C 1 187 ? 0.804   -17.292 8.260  1.00 150.37 ? 187  GLN C C   1 
ATOM   5563 O O   . GLN C 1 187 ? 0.747   -17.997 7.253  1.00 149.92 ? 187  GLN C O   1 
ATOM   5564 C CB  . GLN C 1 187 ? -0.120  -18.067 10.452 1.00 150.79 ? 187  GLN C CB  1 
ATOM   5565 C CG  . GLN C 1 187 ? 0.091   -18.721 11.812 1.00 149.45 ? 187  GLN C CG  1 
ATOM   5566 C CD  . GLN C 1 187 ? -1.199  -18.829 12.611 1.00 152.08 ? 187  GLN C CD  1 
ATOM   5567 O OE1 . GLN C 1 187 ? -2.290  -18.614 12.081 1.00 154.70 ? 187  GLN C OE1 1 
ATOM   5568 N NE2 . GLN C 1 187 ? -1.077  -19.162 13.892 1.00 146.16 ? 187  GLN C NE2 1 
ATOM   5569 N N   . GLU C 1 188 ? 0.586   -15.979 8.248  1.00 152.67 ? 188  GLU C N   1 
ATOM   5570 C CA  . GLU C 1 188 ? 0.306   -15.236 7.024  1.00 154.87 ? 188  GLU C CA  1 
ATOM   5571 C C   . GLU C 1 188 ? 1.521   -15.191 6.106  1.00 152.69 ? 188  GLU C C   1 
ATOM   5572 O O   . GLU C 1 188 ? 1.442   -14.695 4.985  1.00 154.32 ? 188  GLU C O   1 
ATOM   5573 C CB  . GLU C 1 188 ? -0.127  -13.805 7.352  1.00 157.86 ? 188  GLU C CB  1 
ATOM   5574 C CG  . GLU C 1 188 ? -1.394  -13.702 8.182  1.00 160.71 ? 188  GLU C CG  1 
ATOM   5575 C CD  . GLU C 1 188 ? -1.160  -13.992 9.650  1.00 159.14 ? 188  GLU C CD  1 
ATOM   5576 O OE1 . GLU C 1 188 ? -0.025  -13.786 10.124 1.00 156.64 ? 188  GLU C OE1 1 
ATOM   5577 O OE2 . GLU C 1 188 ? -2.115  -14.418 10.332 1.00 160.65 ? 188  GLU C OE2 1 
ATOM   5578 N N   . GLY C 1 189 ? 2.649   -15.696 6.592  1.00 199.45 ? 189  GLY C N   1 
ATOM   5579 C CA  . GLY C 1 189 ? 3.854   -15.772 5.789  1.00 197.26 ? 189  GLY C CA  1 
ATOM   5580 C C   . GLY C 1 189 ? 4.598   -14.458 5.643  1.00 197.60 ? 189  GLY C C   1 
ATOM   5581 O O   . GLY C 1 189 ? 5.248   -14.220 4.624  1.00 197.28 ? 189  GLY C O   1 
ATOM   5582 N N   . MET C 1 190 ? 4.498   -13.594 6.648  1.00 158.92 ? 190  MET C N   1 
ATOM   5583 C CA  . MET C 1 190 ? 5.359   -12.420 6.704  1.00 158.75 ? 190  MET C CA  1 
ATOM   5584 C C   . MET C 1 190 ? 6.686   -12.847 7.319  1.00 155.35 ? 190  MET C C   1 
ATOM   5585 O O   . MET C 1 190 ? 6.700   -13.470 8.381  1.00 154.25 ? 190  MET C O   1 
ATOM   5586 C CB  . MET C 1 190 ? 4.716   -11.306 7.534  1.00 161.24 ? 190  MET C CB  1 
ATOM   5587 N N   . VAL C 1 191 ? 7.795   -12.539 6.654  1.00 129.25 ? 191  VAL C N   1 
ATOM   5588 C CA  . VAL C 1 191 ? 9.104   -12.911 7.181  1.00 126.33 ? 191  VAL C CA  1 
ATOM   5589 C C   . VAL C 1 191 ? 9.792   -11.721 7.883  1.00 126.32 ? 191  VAL C C   1 
ATOM   5590 O O   . VAL C 1 191 ? 10.493  -10.934 7.219  1.00 126.39 ? 191  VAL C O   1 
ATOM   5591 C CB  . VAL C 1 191 ? 9.995   -13.599 6.097  1.00 125.50 ? 191  VAL C CB  1 
ATOM   5592 C CG1 . VAL C 1 191 ? 10.182  -12.707 4.874  1.00 129.04 ? 191  VAL C CG1 1 
ATOM   5593 C CG2 . VAL C 1 191 ? 11.327  -14.030 6.696  1.00 125.19 ? 191  VAL C CG2 1 
ATOM   5594 N N   . PHE C 1 192 ? 9.569   -11.610 9.207  1.00 130.18 ? 192  PHE C N   1 
ATOM   5595 C CA  . PHE C 1 192 ? 9.980   -10.433 9.986  1.00 130.85 ? 192  PHE C CA  1 
ATOM   5596 C C   . PHE C 1 192 ? 11.013  -10.730 11.076 1.00 128.96 ? 192  PHE C C   1 
ATOM   5597 O O   . PHE C 1 192 ? 11.294  -11.889 11.385 1.00 127.38 ? 192  PHE C O   1 
ATOM   5598 C CB  . PHE C 1 192 ? 8.751   -9.784  10.626 1.00 133.74 ? 192  PHE C CB  1 
ATOM   5599 C CG  . PHE C 1 192 ? 8.003   -10.694 11.568 1.00 134.03 ? 192  PHE C CG  1 
ATOM   5600 C CD1 . PHE C 1 192 ? 8.282   -10.683 12.927 1.00 133.90 ? 192  PHE C CD1 1 
ATOM   5601 C CD2 . PHE C 1 192 ? 7.015   -11.549 11.098 1.00 134.66 ? 192  PHE C CD2 1 
ATOM   5602 C CE1 . PHE C 1 192 ? 7.603   -11.511 13.798 1.00 134.08 ? 192  PHE C CE1 1 
ATOM   5603 C CE2 . PHE C 1 192 ? 6.330   -12.387 11.969 1.00 134.99 ? 192  PHE C CE2 1 
ATOM   5604 C CZ  . PHE C 1 192 ? 6.626   -12.365 13.320 1.00 134.87 ? 192  PHE C CZ  1 
ATOM   5605 N N   . ARG C 1 193 ? 11.567  -9.671  11.662 1.00 125.82 ? 193  ARG C N   1 
ATOM   5606 C CA  . ARG C 1 193 ? 12.420  -9.791  12.841 1.00 124.80 ? 193  ARG C CA  1 
ATOM   5607 C C   . ARG C 1 193 ? 11.581  -9.582  14.092 1.00 125.92 ? 193  ARG C C   1 
ATOM   5608 O O   . ARG C 1 193 ? 10.968  -8.533  14.266 1.00 128.24 ? 193  ARG C O   1 
ATOM   5609 C CB  . ARG C 1 193 ? 13.539  -8.748  12.819 1.00 124.33 ? 193  ARG C CB  1 
ATOM   5610 C CG  . ARG C 1 193 ? 14.618  -8.978  11.774 1.00 122.28 ? 193  ARG C CG  1 
ATOM   5611 C CD  . ARG C 1 193 ? 15.555  -10.109 12.169 1.00 120.23 ? 193  ARG C CD  1 
ATOM   5612 N NE  . ARG C 1 193 ? 16.569  -9.690  13.132 1.00 119.93 ? 193  ARG C NE  1 
ATOM   5613 C CZ  . ARG C 1 193 ? 17.458  -10.513 13.683 1.00 119.11 ? 193  ARG C CZ  1 
ATOM   5614 N NH1 . ARG C 1 193 ? 17.452  -11.804 13.366 1.00 120.73 ? 193  ARG C NH1 1 
ATOM   5615 N NH2 . ARG C 1 193 ? 18.351  -10.050 14.552 1.00 115.99 ? 193  ARG C NH2 1 
ATOM   5616 N N   . ARG C 1 194 ? 11.560  -10.578 14.967 1.00 107.73 ? 194  ARG C N   1 
ATOM   5617 C CA  . ARG C 1 194 ? 10.801  -10.466 16.203 1.00 102.35 ? 194  ARG C CA  1 
ATOM   5618 C C   . ARG C 1 194 ? 11.691  -10.505 17.438 1.00 93.73  ? 194  ARG C C   1 
ATOM   5619 O O   . ARG C 1 194 ? 12.698  -11.205 17.494 1.00 91.03  ? 194  ARG C O   1 
ATOM   5620 C CB  . ARG C 1 194 ? 9.748   -11.563 16.294 1.00 104.04 ? 194  ARG C CB  1 
ATOM   5621 C CG  . ARG C 1 194 ? 8.699   -11.297 17.344 1.00 102.74 ? 194  ARG C CG  1 
ATOM   5622 C CD  . ARG C 1 194 ? 7.773   -12.474 17.468 1.00 105.18 ? 194  ARG C CD  1 
ATOM   5623 N NE  . ARG C 1 194 ? 6.414   -12.052 17.774 1.00 110.57 ? 194  ARG C NE  1 
ATOM   5624 C CZ  . ARG C 1 194 ? 5.333   -12.742 17.430 1.00 117.13 ? 194  ARG C CZ  1 
ATOM   5625 N NH1 . ARG C 1 194 ? 5.461   -13.884 16.763 1.00 118.32 ? 194  ARG C NH1 1 
ATOM   5626 N NH2 . ARG C 1 194 ? 4.128   -12.288 17.746 1.00 123.43 ? 194  ARG C NH2 1 
ATOM   5627 N N   . PHE C 1 195 ? 11.306  -9.722  18.431 1.00 104.16 ? 195  PHE C N   1 
ATOM   5628 C CA  . PHE C 1 195 ? 12.007  -9.676  19.704 1.00 97.16  ? 195  PHE C CA  1 
ATOM   5629 C C   . PHE C 1 195 ? 11.280  -10.553 20.718 1.00 95.08  ? 195  PHE C C   1 
ATOM   5630 O O   . PHE C 1 195 ? 10.067  -10.445 20.880 1.00 98.67  ? 195  PHE C O   1 
ATOM   5631 C CB  . PHE C 1 195 ? 12.065  -8.232  20.225 1.00 96.12  ? 195  PHE C CB  1 
ATOM   5632 C CG  . PHE C 1 195 ? 12.891  -7.298  19.372 1.00 98.32  ? 195  PHE C CG  1 
ATOM   5633 C CD1 . PHE C 1 195 ? 13.776  -6.404  19.954 1.00 94.94  ? 195  PHE C CD1 1 
ATOM   5634 C CD2 . PHE C 1 195 ? 12.780  -7.311  17.990 1.00 104.97 ? 195  PHE C CD2 1 
ATOM   5635 C CE1 . PHE C 1 195 ? 14.536  -5.541  19.177 1.00 98.06  ? 195  PHE C CE1 1 
ATOM   5636 C CE2 . PHE C 1 195 ? 13.537  -6.450  17.206 1.00 108.71 ? 195  PHE C CE2 1 
ATOM   5637 C CZ  . PHE C 1 195 ? 14.417  -5.566  17.802 1.00 105.21 ? 195  PHE C CZ  1 
ATOM   5638 N N   . HIS C 1 196 ? 12.018  -11.426 21.395 1.00 103.47 ? 196  HIS C N   1 
ATOM   5639 C CA  . HIS C 1 196 ? 11.457  -12.217 22.484 1.00 102.16 ? 196  HIS C CA  1 
ATOM   5640 C C   . HIS C 1 196 ? 12.186  -11.901 23.771 1.00 97.61  ? 196  HIS C C   1 
ATOM   5641 O O   . HIS C 1 196 ? 13.369  -12.208 23.899 1.00 94.17  ? 196  HIS C O   1 
ATOM   5642 C CB  . HIS C 1 196 ? 11.613  -13.709 22.210 1.00 101.92 ? 196  HIS C CB  1 
ATOM   5643 C CG  . HIS C 1 196 ? 10.682  -14.240 21.169 1.00 107.26 ? 196  HIS C CG  1 
ATOM   5644 N ND1 . HIS C 1 196 ? 11.012  -14.287 19.830 1.00 110.21 ? 196  HIS C ND1 1 
ATOM   5645 C CD2 . HIS C 1 196 ? 9.441   -14.770 21.269 1.00 111.39 ? 196  HIS C CD2 1 
ATOM   5646 C CE1 . HIS C 1 196 ? 10.009  -14.814 19.152 1.00 115.53 ? 196  HIS C CE1 1 
ATOM   5647 N NE2 . HIS C 1 196 ? 9.044   -15.115 19.997 1.00 116.20 ? 196  HIS C NE2 1 
ATOM   5648 N N   . ASP C 1 197 ? 11.497  -11.282 24.721 1.00 143.14 ? 197  ASP C N   1 
ATOM   5649 C CA  . ASP C 1 197 ? 12.083  -11.107 26.036 1.00 139.79 ? 197  ASP C CA  1 
ATOM   5650 C C   . ASP C 1 197 ? 12.066  -12.480 26.697 1.00 140.16 ? 197  ASP C C   1 
ATOM   5651 O O   . ASP C 1 197 ? 11.053  -13.175 26.672 1.00 143.60 ? 197  ASP C O   1 
ATOM   5652 C CB  . ASP C 1 197 ? 11.318  -10.064 26.857 1.00 141.16 ? 197  ASP C CB  1 
ATOM   5653 C CG  . ASP C 1 197 ? 12.225  -9.289  27.813 1.00 138.27 ? 197  ASP C CG  1 
ATOM   5654 O OD1 . ASP C 1 197 ? 13.099  -9.917  28.451 1.00 136.30 ? 197  ASP C OD1 1 
ATOM   5655 O OD2 . ASP C 1 197 ? 12.068  -8.051  27.927 1.00 138.79 ? 197  ASP C OD2 1 
ATOM   5656 N N   . LEU C 1 198 ? 13.201  -12.881 27.256 1.00 77.99  ? 198  LEU C N   1 
ATOM   5657 C CA  . LEU C 1 198 ? 13.363  -14.224 27.801 1.00 77.91  ? 198  LEU C CA  1 
ATOM   5658 C C   . LEU C 1 198 ? 13.274  -14.205 29.318 1.00 79.49  ? 198  LEU C C   1 
ATOM   5659 O O   . LEU C 1 198 ? 14.077  -13.549 29.973 1.00 77.72  ? 198  LEU C O   1 
ATOM   5660 C CB  . LEU C 1 198 ? 14.722  -14.799 27.385 1.00 74.55  ? 198  LEU C CB  1 
ATOM   5661 C CG  . LEU C 1 198 ? 15.062  -14.840 25.894 1.00 74.46  ? 198  LEU C CG  1 
ATOM   5662 C CD1 . LEU C 1 198 ? 16.427  -15.468 25.672 1.00 73.06  ? 198  LEU C CD1 1 
ATOM   5663 C CD2 . LEU C 1 198 ? 13.991  -15.594 25.126 1.00 77.42  ? 198  LEU C CD2 1 
ATOM   5664 N N   . THR C 1 199 ? 12.309  -14.930 29.878 1.00 80.65  ? 199  THR C N   1 
ATOM   5665 C CA  . THR C 1 199 ? 12.133  -14.970 31.329 1.00 81.12  ? 199  THR C CA  1 
ATOM   5666 C C   . THR C 1 199 ? 13.432  -15.340 32.027 1.00 81.66  ? 199  THR C C   1 
ATOM   5667 O O   . THR C 1 199 ? 14.032  -16.376 31.740 1.00 79.61  ? 199  THR C O   1 
ATOM   5668 C CB  . THR C 1 199 ? 11.068  -15.992 31.752 1.00 87.47  ? 199  THR C CB  1 
ATOM   5669 O OG1 . THR C 1 199 ? 9.961   -15.938 30.849 1.00 90.30  ? 199  THR C OG1 1 
ATOM   5670 C CG2 . THR C 1 199 ? 10.576  -15.693 33.149 1.00 94.49  ? 199  THR C CG2 1 
ATOM   5671 N N   . LEU C 1 200 ? 13.861  -14.488 32.949 1.00 83.95  ? 200  LEU C N   1 
ATOM   5672 C CA  . LEU C 1 200 ? 15.061  -14.751 33.723 1.00 82.70  ? 200  LEU C CA  1 
ATOM   5673 C C   . LEU C 1 200 ? 14.668  -15.245 35.098 1.00 89.43  ? 200  LEU C C   1 
ATOM   5674 O O   . LEU C 1 200 ? 13.680  -14.777 35.667 1.00 95.62  ? 200  LEU C O   1 
ATOM   5675 C CB  . LEU C 1 200 ? 15.885  -13.481 33.875 1.00 80.10  ? 200  LEU C CB  1 
ATOM   5676 C CG  . LEU C 1 200 ? 16.309  -12.783 32.593 1.00 75.11  ? 200  LEU C CG  1 
ATOM   5677 C CD1 . LEU C 1 200 ? 17.151  -11.591 32.957 1.00 73.78  ? 200  LEU C CD1 1 
ATOM   5678 C CD2 . LEU C 1 200 ? 17.075  -13.744 31.703 1.00 89.49  ? 200  LEU C CD2 1 
ATOM   5679 N N   . THR C 1 201 ? 15.438  -16.185 35.638 1.00 87.51  ? 201  THR C N   1 
ATOM   5680 C CA  . THR C 1 201 ? 15.179  -16.659 36.990 1.00 95.23  ? 201  THR C CA  1 
ATOM   5681 C C   . THR C 1 201 ? 15.271  -15.472 37.940 1.00 98.76  ? 201  THR C C   1 
ATOM   5682 O O   . THR C 1 201 ? 14.593  -15.429 38.960 1.00 107.26 ? 201  THR C O   1 
ATOM   5683 C CB  . THR C 1 201 ? 16.152  -17.779 37.437 1.00 95.80  ? 201  THR C CB  1 
ATOM   5684 O OG1 . THR C 1 201 ? 17.358  -17.205 37.948 1.00 94.74  ? 201  THR C OG1 1 
ATOM   5685 C CG2 . THR C 1 201 ? 16.488  -18.700 36.288 1.00 90.24  ? 201  THR C CG2 1 
ATOM   5686 N N   . ARG C 1 202 ? 16.101  -14.496 37.587 1.00 129.03 ? 202  ARG C N   1 
ATOM   5687 C CA  . ARG C 1 202 ? 16.242  -13.303 38.410 1.00 132.08 ? 202  ARG C CA  1 
ATOM   5688 C C   . ARG C 1 202 ? 16.514  -12.054 37.579 1.00 126.04 ? 202  ARG C C   1 
ATOM   5689 O O   . ARG C 1 202 ? 17.587  -11.892 37.000 1.00 120.40 ? 202  ARG C O   1 
ATOM   5690 C CB  . ARG C 1 202 ? 17.332  -13.502 39.453 1.00 132.84 ? 202  ARG C CB  1 
ATOM   5691 C CG  . ARG C 1 202 ? 17.377  -12.410 40.490 1.00 133.63 ? 202  ARG C CG  1 
ATOM   5692 C CD  . ARG C 1 202 ? 18.464  -12.686 41.504 1.00 131.22 ? 202  ARG C CD  1 
ATOM   5693 N NE  . ARG C 1 202 ? 18.774  -11.498 42.287 1.00 129.71 ? 202  ARG C NE  1 
ATOM   5694 C CZ  . ARG C 1 202 ? 18.106  -11.128 43.374 1.00 134.83 ? 202  ARG C CZ  1 
ATOM   5695 N NH1 . ARG C 1 202 ? 17.084  -11.856 43.807 1.00 142.21 ? 202  ARG C NH1 1 
ATOM   5696 N NH2 . ARG C 1 202 ? 18.459  -10.029 44.029 1.00 133.65 ? 202  ARG C NH2 1 
ATOM   5697 N N   . SER C 1 203 ? 15.526  -11.169 37.552 1.00 82.61  ? 203  SER C N   1 
ATOM   5698 C CA  . SER C 1 203 ? 15.518  -10.021 36.662 1.00 79.73  ? 203  SER C CA  1 
ATOM   5699 C C   . SER C 1 203 ? 15.794  -8.727  37.425 1.00 79.97  ? 203  SER C C   1 
ATOM   5700 O O   . SER C 1 203 ? 16.274  -7.744  36.863 1.00 78.09  ? 203  SER C O   1 
ATOM   5701 C CB  . SER C 1 203 ? 14.164  -9.959  35.951 1.00 80.03  ? 203  SER C CB  1 
ATOM   5702 O OG  . SER C 1 203 ? 14.007  -8.752  35.234 1.00 82.35  ? 203  SER C OG  1 
ATOM   5703 N N   . ARG C 1 204 ? 15.483  -8.733  38.714 1.00 123.09 ? 204  ARG C N   1 
ATOM   5704 C CA  . ARG C 1 204 ? 15.789  -7.606  39.582 1.00 126.56 ? 204  ARG C CA  1 
ATOM   5705 C C   . ARG C 1 204 ? 16.904  -7.966  40.543 1.00 124.44 ? 204  ARG C C   1 
ATOM   5706 O O   . ARG C 1 204 ? 16.985  -9.092  41.025 1.00 124.24 ? 204  ARG C O   1 
ATOM   5707 C CB  . ARG C 1 204 ? 14.561  -7.197  40.395 1.00 136.65 ? 204  ARG C CB  1 
ATOM   5708 C CG  . ARG C 1 204 ? 13.974  -5.850  40.031 1.00 136.73 ? 204  ARG C CG  1 
ATOM   5709 C CD  . ARG C 1 204 ? 14.932  -4.715  40.356 1.00 134.40 ? 204  ARG C CD  1 
ATOM   5710 N NE  . ARG C 1 204 ? 14.260  -3.418  40.317 1.00 137.35 ? 204  ARG C NE  1 
ATOM   5711 C CZ  . ARG C 1 204 ? 13.568  -2.967  39.274 1.00 134.39 ? 204  ARG C CZ  1 
ATOM   5712 N NH1 . ARG C 1 204 ? 13.439  -3.717  38.186 1.00 128.00 ? 204  ARG C NH1 1 
ATOM   5713 N NH2 . ARG C 1 204 ? 12.992  -1.772  39.321 1.00 136.50 ? 204  ARG C NH2 1 
ATOM   5714 N N   . SER C 1 205 ? 17.769  -7.001  40.811 1.00 136.84 ? 205  SER C N   1 
ATOM   5715 C CA  . SER C 1 205 ? 18.723  -7.107  41.899 1.00 133.29 ? 205  SER C CA  1 
ATOM   5716 C C   . SER C 1 205 ? 18.726  -5.755  42.584 1.00 135.91 ? 205  SER C C   1 
ATOM   5717 O O   . SER C 1 205 ? 19.350  -4.815  42.093 1.00 132.73 ? 205  SER C O   1 
ATOM   5718 C CB  . SER C 1 205 ? 20.117  -7.433  41.372 1.00 125.52 ? 205  SER C CB  1 
ATOM   5719 O OG  . SER C 1 205 ? 21.102  -7.131  42.344 1.00 123.94 ? 205  SER C OG  1 
ATOM   5720 N N   . PRO C 1 206 ? 17.997  -5.634  43.705 1.00 149.12 ? 206  PRO C N   1 
ATOM   5721 C CA  . PRO C 1 206 ? 17.918  -4.307  44.320 1.00 153.41 ? 206  PRO C CA  1 
ATOM   5722 C C   . PRO C 1 206 ? 19.290  -3.736  44.699 1.00 146.51 ? 206  PRO C C   1 
ATOM   5723 O O   . PRO C 1 206 ? 19.444  -2.515  44.703 1.00 148.16 ? 206  PRO C O   1 
ATOM   5724 C CB  . PRO C 1 206 ? 17.039  -4.545  45.554 1.00 162.67 ? 206  PRO C CB  1 
ATOM   5725 C CG  . PRO C 1 206 ? 16.186  -5.720  45.176 1.00 166.30 ? 206  PRO C CG  1 
ATOM   5726 C CD  . PRO C 1 206 ? 17.099  -6.602  44.359 1.00 155.68 ? 206  PRO C CD  1 
ATOM   5727 N N   . ILE C 1 207 ? 20.270  -4.589  44.994 1.00 92.94  ? 207  ILE C N   1 
ATOM   5728 C CA  . ILE C 1 207 ? 21.623  -4.108  45.307 1.00 88.55  ? 207  ILE C CA  1 
ATOM   5729 C C   . ILE C 1 207 ? 22.743  -4.869  44.583 1.00 85.45  ? 207  ILE C C   1 
ATOM   5730 O O   . ILE C 1 207 ? 23.253  -5.876  45.083 1.00 86.80  ? 207  ILE C O   1 
ATOM   5731 C CB  . ILE C 1 207 ? 21.894  -4.107  46.825 1.00 91.34  ? 207  ILE C CB  1 
ATOM   5732 C CG1 . ILE C 1 207 ? 21.195  -2.917  47.487 1.00 97.21  ? 207  ILE C CG1 1 
ATOM   5733 C CG2 . ILE C 1 207 ? 23.391  -4.049  47.107 1.00 91.71  ? 207  ILE C CG2 1 
ATOM   5734 C CD1 . ILE C 1 207 ? 20.839  -3.143  48.954 1.00 102.72 ? 207  ILE C CD1 1 
ATOM   5735 N N   . PHE C 1 208 ? 23.116  -4.371  43.403 1.00 105.99 ? 208  PHE C N   1 
ATOM   5736 C CA  . PHE C 1 208 ? 24.177  -4.955  42.580 1.00 102.51 ? 208  PHE C CA  1 
ATOM   5737 C C   . PHE C 1 208 ? 25.506  -4.318  42.945 1.00 102.60 ? 208  PHE C C   1 
ATOM   5738 O O   . PHE C 1 208 ? 25.659  -3.100  42.855 1.00 102.67 ? 208  PHE C O   1 
ATOM   5739 C CB  . PHE C 1 208 ? 23.874  -4.734  41.093 1.00 100.19 ? 208  PHE C CB  1 
ATOM   5740 C CG  . PHE C 1 208 ? 24.973  -5.191  40.162 1.00 97.89  ? 208  PHE C CG  1 
ATOM   5741 C CD1 . PHE C 1 208 ? 25.527  -6.453  40.283 1.00 98.97  ? 208  PHE C CD1 1 
ATOM   5742 C CD2 . PHE C 1 208 ? 25.428  -4.365  39.146 1.00 96.40  ? 208  PHE C CD2 1 
ATOM   5743 C CE1 . PHE C 1 208 ? 26.526  -6.872  39.421 1.00 99.44  ? 208  PHE C CE1 1 
ATOM   5744 C CE2 . PHE C 1 208 ? 26.427  -4.782  38.281 1.00 96.01  ? 208  PHE C CE2 1 
ATOM   5745 C CZ  . PHE C 1 208 ? 26.975  -6.036  38.419 1.00 97.93  ? 208  PHE C CZ  1 
ATOM   5746 N N   . SER C 1 209 ? 26.468  -5.136  43.360 1.00 128.98 ? 209  SER C N   1 
ATOM   5747 C CA  . SER C 1 209 ? 27.726  -4.595  43.867 1.00 131.72 ? 209  SER C CA  1 
ATOM   5748 C C   . SER C 1 209 ? 29.006  -5.273  43.375 1.00 135.24 ? 209  SER C C   1 
ATOM   5749 O O   . SER C 1 209 ? 30.057  -4.641  43.364 1.00 138.48 ? 209  SER C O   1 
ATOM   5750 C CB  . SER C 1 209 ? 27.710  -4.527  45.401 1.00 134.97 ? 209  SER C CB  1 
ATOM   5751 O OG  . SER C 1 209 ? 26.987  -5.610  45.960 1.00 136.00 ? 209  SER C OG  1 
ATOM   5752 N N   . LEU C 1 210 ? 28.936  -6.539  42.973 1.00 101.11 ? 210  LEU C N   1 
ATOM   5753 C CA  . LEU C 1 210 ? 30.144  -7.235  42.522 1.00 107.48 ? 210  LEU C CA  1 
ATOM   5754 C C   . LEU C 1 210 ? 29.976  -7.968  41.189 1.00 106.33 ? 210  LEU C C   1 
ATOM   5755 O O   . LEU C 1 210 ? 30.407  -7.483  40.143 1.00 105.66 ? 210  LEU C O   1 
ATOM   5756 C CB  . LEU C 1 210 ? 30.635  -8.204  43.594 1.00 115.44 ? 210  LEU C CB  1 
ATOM   5757 C CG  . LEU C 1 210 ? 30.571  -7.672  45.024 1.00 116.34 ? 210  LEU C CG  1 
ATOM   5758 C CD1 . LEU C 1 210 ? 30.908  -8.775  46.002 1.00 124.54 ? 210  LEU C CD1 1 
ATOM   5759 C CD2 . LEU C 1 210 ? 31.495  -6.485  45.223 1.00 118.64 ? 210  LEU C CD2 1 
ATOM   5760 N N   . SER C 1 211 ? 29.369  -9.148  41.228 1.00 89.96  ? 211  SER C N   1 
ATOM   5761 C CA  . SER C 1 211 ? 29.078  -9.878  40.003 1.00 88.84  ? 211  SER C CA  1 
ATOM   5762 C C   . SER C 1 211 ? 27.670  -10.451 40.033 1.00 84.49  ? 211  SER C C   1 
ATOM   5763 O O   . SER C 1 211 ? 27.148  -10.793 41.092 1.00 85.63  ? 211  SER C O   1 
ATOM   5764 C CB  . SER C 1 211 ? 30.090  -10.996 39.778 1.00 98.67  ? 211  SER C CB  1 
ATOM   5765 O OG  . SER C 1 211 ? 29.784  -11.713 38.596 1.00 97.30  ? 211  SER C OG  1 
ATOM   5766 N N   . TRP C 1 212 ? 27.061  -10.552 38.860 1.00 96.21  ? 212  TRP C N   1 
ATOM   5767 C CA  . TRP C 1 212 ? 25.708  -11.066 38.744 1.00 93.87  ? 212  TRP C CA  1 
ATOM   5768 C C   . TRP C 1 212 ? 25.645  -11.995 37.546 1.00 94.97  ? 212  TRP C C   1 
ATOM   5769 O O   . TRP C 1 212 ? 25.937  -11.583 36.427 1.00 92.91  ? 212  TRP C O   1 
ATOM   5770 C CB  . TRP C 1 212 ? 24.721  -9.904  38.596 1.00 88.96  ? 212  TRP C CB  1 
ATOM   5771 C CG  . TRP C 1 212 ? 23.283  -10.304 38.461 1.00 89.01  ? 212  TRP C CG  1 
ATOM   5772 C CD1 . TRP C 1 212 ? 22.772  -11.561 38.558 1.00 92.09  ? 212  TRP C CD1 1 
ATOM   5773 C CD2 . TRP C 1 212 ? 22.165  -9.431  38.245 1.00 88.19  ? 212  TRP C CD2 1 
ATOM   5774 N NE1 . TRP C 1 212 ? 21.409  -11.533 38.392 1.00 93.07  ? 212  TRP C NE1 1 
ATOM   5775 C CE2 . TRP C 1 212 ? 21.009  -10.236 38.201 1.00 91.38  ? 212  TRP C CE2 1 
ATOM   5776 C CE3 . TRP C 1 212 ? 22.028  -8.050  38.075 1.00 86.92  ? 212  TRP C CE3 1 
ATOM   5777 C CZ2 . TRP C 1 212 ? 19.734  -9.708  37.996 1.00 94.38  ? 212  TRP C CZ2 1 
ATOM   5778 C CZ3 . TRP C 1 212 ? 20.759  -7.526  37.869 1.00 89.89  ? 212  TRP C CZ3 1 
ATOM   5779 C CH2 . TRP C 1 212 ? 19.630  -8.355  37.834 1.00 94.07  ? 212  TRP C CH2 1 
ATOM   5780 N N   . THR C 1 213 ? 25.293  -13.254 37.784 1.00 81.29  ? 213  THR C N   1 
ATOM   5781 C CA  . THR C 1 213 ? 25.136  -14.207 36.694 1.00 79.97  ? 213  THR C CA  1 
ATOM   5782 C C   . THR C 1 213 ? 23.669  -14.371 36.347 1.00 77.93  ? 213  THR C C   1 
ATOM   5783 O O   . THR C 1 213 ? 22.898  -14.946 37.113 1.00 79.69  ? 213  THR C O   1 
ATOM   5784 C CB  . THR C 1 213 ? 25.731  -15.571 37.033 1.00 80.71  ? 213  THR C CB  1 
ATOM   5785 O OG1 . THR C 1 213 ? 27.119  -15.416 37.343 1.00 84.89  ? 213  THR C OG1 1 
ATOM   5786 C CG2 . THR C 1 213 ? 25.592  -16.504 35.847 1.00 81.02  ? 213  THR C CG2 1 
ATOM   5787 N N   . VAL C 1 214 ? 23.289  -13.850 35.187 1.00 104.49 ? 214  VAL C N   1 
ATOM   5788 C CA  . VAL C 1 214 ? 21.895  -13.848 34.773 1.00 102.35 ? 214  VAL C CA  1 
ATOM   5789 C C   . VAL C 1 214 ? 21.547  -15.156 34.082 1.00 101.57 ? 214  VAL C C   1 
ATOM   5790 O O   . VAL C 1 214 ? 22.359  -15.697 33.334 1.00 100.93 ? 214  VAL C O   1 
ATOM   5791 C CB  . VAL C 1 214 ? 21.605  -12.686 33.821 1.00 98.97  ? 214  VAL C CB  1 
ATOM   5792 C CG1 . VAL C 1 214 ? 20.143  -12.325 33.889 1.00 98.98  ? 214  VAL C CG1 1 
ATOM   5793 C CG2 . VAL C 1 214 ? 22.452  -11.488 34.193 1.00 99.27  ? 214  VAL C CG2 1 
ATOM   5794 N N   . MET C 1 215 ? 20.341  -15.663 34.331 1.00 90.06  ? 215  MET C N   1 
ATOM   5795 C CA  . MET C 1 215 ? 19.948  -16.956 33.782 1.00 89.99  ? 215  MET C CA  1 
ATOM   5796 C C   . MET C 1 215 ? 18.563  -16.973 33.169 1.00 89.35  ? 215  MET C C   1 
ATOM   5797 O O   . MET C 1 215 ? 17.611  -16.424 33.722 1.00 91.64  ? 215  MET C O   1 
ATOM   5798 C CB  . MET C 1 215 ? 20.016  -18.034 34.856 1.00 94.41  ? 215  MET C CB  1 
ATOM   5799 C CG  . MET C 1 215 ? 21.346  -18.117 35.553 1.00 96.60  ? 215  MET C CG  1 
ATOM   5800 S SD  . MET C 1 215 ? 21.233  -19.164 37.014 1.00 103.74 ? 215  MET C SD  1 
ATOM   5801 C CE  . MET C 1 215 ? 22.589  -18.506 37.983 1.00 107.30 ? 215  MET C CE  1 
ATOM   5802 N N   . HIS C 1 216 ? 18.468  -17.624 32.020 1.00 77.40  ? 216  HIS C N   1 
ATOM   5803 C CA  . HIS C 1 216 ? 17.194  -17.891 31.396 1.00 77.86  ? 216  HIS C CA  1 
ATOM   5804 C C   . HIS C 1 216 ? 17.042  -19.393 31.279 1.00 79.36  ? 216  HIS C C   1 
ATOM   5805 O O   . HIS C 1 216 ? 17.586  -20.001 30.357 1.00 77.81  ? 216  HIS C O   1 
ATOM   5806 C CB  . HIS C 1 216 ? 17.137  -17.263 30.008 1.00 75.21  ? 216  HIS C CB  1 
ATOM   5807 C CG  . HIS C 1 216 ? 16.034  -17.798 29.156 1.00 76.32  ? 216  HIS C CG  1 
ATOM   5808 N ND1 . HIS C 1 216 ? 14.716  -17.453 29.337 1.00 78.89  ? 216  HIS C ND1 1 
ATOM   5809 C CD2 . HIS C 1 216 ? 16.053  -18.664 28.107 1.00 76.28  ? 216  HIS C CD2 1 
ATOM   5810 C CE1 . HIS C 1 216 ? 13.966  -18.073 28.443 1.00 80.25  ? 216  HIS C CE1 1 
ATOM   5811 N NE2 . HIS C 1 216 ? 14.762  -18.812 27.685 1.00 78.47  ? 216  HIS C NE2 1 
ATOM   5812 N N   . PRO C 1 217 ? 16.324  -20.006 32.231 1.00 83.03  ? 217  PRO C N   1 
ATOM   5813 C CA  . PRO C 1 217 ? 16.006  -21.430 32.137 1.00 81.99  ? 217  PRO C CA  1 
ATOM   5814 C C   . PRO C 1 217 ? 15.348  -21.697 30.796 1.00 83.57  ? 217  PRO C C   1 
ATOM   5815 O O   . PRO C 1 217 ? 14.566  -20.868 30.323 1.00 83.43  ? 217  PRO C O   1 
ATOM   5816 C CB  . PRO C 1 217 ? 14.994  -21.633 33.273 1.00 88.05  ? 217  PRO C CB  1 
ATOM   5817 C CG  . PRO C 1 217 ? 14.535  -20.236 33.645 1.00 84.72  ? 217  PRO C CG  1 
ATOM   5818 C CD  . PRO C 1 217 ? 15.752  -19.409 33.445 1.00 83.97  ? 217  PRO C CD  1 
ATOM   5819 N N   . ILE C 1 218 ? 15.675  -22.823 30.178 1.00 88.18  ? 218  ILE C N   1 
ATOM   5820 C CA  . ILE C 1 218 ? 15.062  -23.180 28.911 1.00 87.88  ? 218  ILE C CA  1 
ATOM   5821 C C   . ILE C 1 218 ? 14.100  -24.332 29.137 1.00 84.03  ? 218  ILE C C   1 
ATOM   5822 O O   . ILE C 1 218 ? 14.507  -25.435 29.496 1.00 93.03  ? 218  ILE C O   1 
ATOM   5823 C CB  . ILE C 1 218 ? 16.110  -23.570 27.859 1.00 85.81  ? 218  ILE C CB  1 
ATOM   5824 C CG1 . ILE C 1 218 ? 17.209  -22.506 27.781 1.00 83.44  ? 218  ILE C CG1 1 
ATOM   5825 C CG2 . ILE C 1 218 ? 15.447  -23.762 26.507 1.00 86.58  ? 218  ILE C CG2 1 
ATOM   5826 C CD1 . ILE C 1 218 ? 18.204  -22.729 26.666 1.00 83.50  ? 218  ILE C CD1 1 
ATOM   5827 N N   . ASP C 1 219 ? 12.816  -24.059 28.948 1.00 126.59 ? 219  ASP C N   1 
ATOM   5828 C CA  . ASP C 1 219 ? 11.778  -25.064 29.124 1.00 131.67 ? 219  ASP C CA  1 
ATOM   5829 C C   . ASP C 1 219 ? 10.753  -24.886 28.018 1.00 133.43 ? 219  ASP C C   1 
ATOM   5830 O O   . ASP C 1 219 ? 10.987  -24.124 27.081 1.00 130.47 ? 219  ASP C O   1 
ATOM   5831 C CB  . ASP C 1 219 ? 11.111  -24.898 30.481 1.00 137.23 ? 219  ASP C CB  1 
ATOM   5832 C CG  . ASP C 1 219 ? 10.344  -23.597 30.595 1.00 139.28 ? 219  ASP C CG  1 
ATOM   5833 O OD1 . ASP C 1 219 ? 10.217  -22.883 29.579 1.00 136.37 ? 219  ASP C OD1 1 
ATOM   5834 O OD2 . ASP C 1 219 ? 9.863   -23.284 31.702 1.00 144.80 ? 219  ASP C OD2 1 
ATOM   5835 N N   . HIS C 1 220 ? 9.609   -25.556 28.123 1.00 118.13 ? 220  HIS C N   1 
ATOM   5836 C CA  . HIS C 1 220 ? 8.635   -25.483 27.036 1.00 120.94 ? 220  HIS C CA  1 
ATOM   5837 C C   . HIS C 1 220 ? 8.132   -24.067 26.741 1.00 121.51 ? 220  HIS C C   1 
ATOM   5838 O O   . HIS C 1 220 ? 7.449   -23.849 25.741 1.00 123.79 ? 220  HIS C O   1 
ATOM   5839 C CB  . HIS C 1 220 ? 7.468   -26.475 27.206 1.00 128.51 ? 220  HIS C CB  1 
ATOM   5840 C CG  . HIS C 1 220 ? 7.124   -26.790 28.627 1.00 133.93 ? 220  HIS C CG  1 
ATOM   5841 N ND1 . HIS C 1 220 ? 7.449   -27.991 29.222 1.00 135.31 ? 220  HIS C ND1 1 
ATOM   5842 C CD2 . HIS C 1 220 ? 6.460   -26.074 29.568 1.00 139.77 ? 220  HIS C CD2 1 
ATOM   5843 C CE1 . HIS C 1 220 ? 7.013   -27.996 30.470 1.00 141.98 ? 220  HIS C CE1 1 
ATOM   5844 N NE2 . HIS C 1 220 ? 6.410   -26.845 30.704 1.00 145.04 ? 220  HIS C NE2 1 
ATOM   5845 N N   . HIS C 1 221 ? 8.485   -23.103 27.584 1.00 89.27  ? 221  HIS C N   1 
ATOM   5846 C CA  . HIS C 1 221 ? 8.082   -21.719 27.334 1.00 89.72  ? 221  HIS C CA  1 
ATOM   5847 C C   . HIS C 1 221 ? 9.177   -20.836 26.722 1.00 87.09  ? 221  HIS C C   1 
ATOM   5848 O O   . HIS C 1 221 ? 8.892   -19.770 26.177 1.00 87.35  ? 221  HIS C O   1 
ATOM   5849 C CB  . HIS C 1 221 ? 7.517   -21.075 28.599 1.00 94.68  ? 221  HIS C CB  1 
ATOM   5850 C CG  . HIS C 1 221 ? 6.222   -21.674 29.053 1.00 97.88  ? 221  HIS C CG  1 
ATOM   5851 N ND1 . HIS C 1 221 ? 5.763   -21.566 30.344 1.00 104.86 ? 221  HIS C ND1 1 
ATOM   5852 C CD2 . HIS C 1 221 ? 5.302   -22.406 28.382 1.00 102.95 ? 221  HIS C CD2 1 
ATOM   5853 C CE1 . HIS C 1 221 ? 4.606   -22.192 30.452 1.00 114.27 ? 221  HIS C CE1 1 
ATOM   5854 N NE2 . HIS C 1 221 ? 4.302   -22.715 29.277 1.00 112.99 ? 221  HIS C NE2 1 
ATOM   5855 N N   . SER C 1 222 ? 10.425  -21.277 26.807 1.00 93.51  ? 222  SER C N   1 
ATOM   5856 C CA  . SER C 1 222 ? 11.519  -20.512 26.233 1.00 88.53  ? 222  SER C CA  1 
ATOM   5857 C C   . SER C 1 222 ? 11.468  -20.537 24.713 1.00 88.95  ? 222  SER C C   1 
ATOM   5858 O O   . SER C 1 222 ? 11.386  -21.600 24.108 1.00 90.37  ? 222  SER C O   1 
ATOM   5859 C CB  . SER C 1 222 ? 12.863  -21.054 26.704 1.00 84.90  ? 222  SER C CB  1 
ATOM   5860 O OG  . SER C 1 222 ? 13.918  -20.345 26.083 1.00 81.64  ? 222  SER C OG  1 
ATOM   5861 N N   . PRO C 1 223 ? 11.525  -19.358 24.088 1.00 82.17  ? 223  PRO C N   1 
ATOM   5862 C CA  . PRO C 1 223 ? 11.501  -19.308 22.626 1.00 84.14  ? 223  PRO C CA  1 
ATOM   5863 C C   . PRO C 1 223 ? 12.695  -20.037 22.023 1.00 82.59  ? 223  PRO C C   1 
ATOM   5864 O O   . PRO C 1 223 ? 12.740  -20.227 20.811 1.00 85.59  ? 223  PRO C O   1 
ATOM   5865 C CB  . PRO C 1 223 ? 11.582  -17.807 22.327 1.00 83.94  ? 223  PRO C CB  1 
ATOM   5866 C CG  . PRO C 1 223 ? 11.087  -17.143 23.567 1.00 83.31  ? 223  PRO C CG  1 
ATOM   5867 C CD  . PRO C 1 223 ? 11.552  -18.015 24.690 1.00 80.95  ? 223  PRO C CD  1 
ATOM   5868 N N   . ILE C 1 224 ? 13.648  -20.441 22.855 1.00 78.24  ? 224  ILE C N   1 
ATOM   5869 C CA  . ILE C 1 224 ? 14.797  -21.197 22.368 1.00 78.12  ? 224  ILE C CA  1 
ATOM   5870 C C   . ILE C 1 224 ? 14.747  -22.649 22.836 1.00 88.37  ? 224  ILE C C   1 
ATOM   5871 O O   . ILE C 1 224 ? 15.767  -23.332 22.897 1.00 88.04  ? 224  ILE C O   1 
ATOM   5872 C CB  . ILE C 1 224 ? 16.138  -20.549 22.773 1.00 85.68  ? 224  ILE C CB  1 
ATOM   5873 C CG1 . ILE C 1 224 ? 16.206  -20.346 24.284 1.00 82.58  ? 224  ILE C CG1 1 
ATOM   5874 C CG2 . ILE C 1 224 ? 16.317  -19.226 22.059 1.00 76.58  ? 224  ILE C CG2 1 
ATOM   5875 C CD1 . ILE C 1 224 ? 17.436  -19.599 24.738 1.00 80.82  ? 224  ILE C CD1 1 
ATOM   5876 N N   . TYR C 1 225 ? 13.543  -23.113 23.151 1.00 87.28  ? 225  TYR C N   1 
ATOM   5877 C CA  . TYR C 1 225 ? 13.334  -24.479 23.609 1.00 88.39  ? 225  TYR C CA  1 
ATOM   5878 C C   . TYR C 1 225 ? 13.636  -25.501 22.526 1.00 90.58  ? 225  TYR C C   1 
ATOM   5879 O O   . TYR C 1 225 ? 13.227  -25.340 21.378 1.00 93.41  ? 225  TYR C O   1 
ATOM   5880 C CB  . TYR C 1 225 ? 11.893  -24.668 24.066 1.00 91.55  ? 225  TYR C CB  1 
ATOM   5881 C CG  . TYR C 1 225 ? 11.616  -26.060 24.572 1.00 93.63  ? 225  TYR C CG  1 
ATOM   5882 C CD1 . TYR C 1 225 ? 12.257  -26.541 25.704 1.00 92.30  ? 225  TYR C CD1 1 
ATOM   5883 C CD2 . TYR C 1 225 ? 10.719  -26.895 23.921 1.00 97.71  ? 225  TYR C CD2 1 
ATOM   5884 C CE1 . TYR C 1 225 ? 12.012  -27.813 26.179 1.00 94.95  ? 225  TYR C CE1 1 
ATOM   5885 C CE2 . TYR C 1 225 ? 10.466  -28.173 24.390 1.00 100.07 ? 225  TYR C CE2 1 
ATOM   5886 C CZ  . TYR C 1 225 ? 11.117  -28.625 25.519 1.00 98.64  ? 225  TYR C CZ  1 
ATOM   5887 O OH  . TYR C 1 225 ? 10.876  -29.892 25.996 1.00 101.66 ? 225  TYR C OH  1 
ATOM   5888 N N   . GLY C 1 226 ? 14.337  -26.567 22.901 1.00 169.35 ? 226  GLY C N   1 
ATOM   5889 C CA  . GLY C 1 226 ? 14.666  -27.624 21.964 1.00 172.19 ? 226  GLY C CA  1 
ATOM   5890 C C   . GLY C 1 226 ? 15.253  -27.058 20.689 1.00 174.34 ? 226  GLY C C   1 
ATOM   5891 O O   . GLY C 1 226 ? 14.841  -27.408 19.584 1.00 178.45 ? 226  GLY C O   1 
ATOM   5892 N N   . GLU C 1 227 ? 16.220  -26.166 20.856 1.00 100.41 ? 227  GLU C N   1 
ATOM   5893 C CA  . GLU C 1 227 ? 16.889  -25.523 19.742 1.00 103.71 ? 227  GLU C CA  1 
ATOM   5894 C C   . GLU C 1 227 ? 18.353  -25.917 19.795 1.00 105.32 ? 227  GLU C C   1 
ATOM   5895 O O   . GLU C 1 227 ? 18.980  -25.833 20.848 1.00 102.15 ? 227  GLU C O   1 
ATOM   5896 C CB  . GLU C 1 227 ? 16.765  -24.007 19.883 1.00 101.54 ? 227  GLU C CB  1 
ATOM   5897 C CG  . GLU C 1 227 ? 16.934  -23.228 18.597 1.00 106.23 ? 227  GLU C CG  1 
ATOM   5898 C CD  . GLU C 1 227 ? 15.614  -22.985 17.899 1.00 108.70 ? 227  GLU C CD  1 
ATOM   5899 O OE1 . GLU C 1 227 ? 14.596  -22.832 18.606 1.00 105.65 ? 227  GLU C OE1 1 
ATOM   5900 O OE2 . GLU C 1 227 ? 15.593  -22.940 16.651 1.00 114.93 ? 227  GLU C OE2 1 
ATOM   5901 N N   . THR C 1 228 ? 18.901  -26.366 18.673 1.00 134.09 ? 228  THR C N   1 
ATOM   5902 C CA  . THR C 1 228 ? 20.332  -26.625 18.616 1.00 137.74 ? 228  THR C CA  1 
ATOM   5903 C C   . THR C 1 228 ? 21.066  -25.392 18.150 1.00 140.66 ? 228  THR C C   1 
ATOM   5904 O O   . THR C 1 228 ? 20.487  -24.314 18.007 1.00 138.66 ? 228  THR C O   1 
ATOM   5905 C CB  . THR C 1 228 ? 20.701  -27.756 17.645 1.00 145.24 ? 228  THR C CB  1 
ATOM   5906 O OG1 . THR C 1 228 ? 20.146  -27.483 16.350 1.00 150.67 ? 228  THR C OG1 1 
ATOM   5907 C CG2 . THR C 1 228 ? 20.204  -29.096 18.164 1.00 143.07 ? 228  THR C CG2 1 
ATOM   5908 N N   . ASP C 1 229 ? 22.355  -25.568 17.908 1.00 124.79 ? 229  ASP C N   1 
ATOM   5909 C CA  . ASP C 1 229 ? 23.159  -24.511 17.349 1.00 130.08 ? 229  ASP C CA  1 
ATOM   5910 C C   . ASP C 1 229 ? 22.718  -24.249 15.915 1.00 137.23 ? 229  ASP C C   1 
ATOM   5911 O O   . ASP C 1 229 ? 22.461  -23.106 15.533 1.00 137.81 ? 229  ASP C O   1 
ATOM   5912 C CB  . ASP C 1 229 ? 24.629  -24.903 17.390 1.00 137.03 ? 229  ASP C CB  1 
ATOM   5913 C CG  . ASP C 1 229 ? 25.532  -23.777 16.966 1.00 143.25 ? 229  ASP C CG  1 
ATOM   5914 O OD1 . ASP C 1 229 ? 25.062  -22.914 16.197 1.00 145.27 ? 229  ASP C OD1 1 
ATOM   5915 O OD2 . ASP C 1 229 ? 26.703  -23.746 17.400 1.00 146.87 ? 229  ASP C OD2 1 
ATOM   5916 N N   . GLU C 1 230 ? 22.628  -25.316 15.128 1.00 122.12 ? 230  GLU C N   1 
ATOM   5917 C CA  . GLU C 1 230 ? 22.229  -25.206 13.732 1.00 130.72 ? 230  GLU C CA  1 
ATOM   5918 C C   . GLU C 1 230 ? 20.985  -24.335 13.580 1.00 125.35 ? 230  GLU C C   1 
ATOM   5919 O O   . GLU C 1 230 ? 20.944  -23.429 12.744 1.00 122.24 ? 230  GLU C O   1 
ATOM   5920 C CB  . GLU C 1 230 ? 21.982  -26.594 13.138 1.00 135.77 ? 230  GLU C CB  1 
ATOM   5921 N N   . THR C 1 231 ? 19.978  -24.607 14.402 1.00 114.14 ? 231  THR C N   1 
ATOM   5922 C CA  . THR C 1 231 ? 18.712  -23.882 14.343 1.00 110.60 ? 231  THR C CA  1 
ATOM   5923 C C   . THR C 1 231 ? 18.852  -22.395 14.682 1.00 106.28 ? 231  THR C C   1 
ATOM   5924 O O   . THR C 1 231 ? 18.112  -21.559 14.161 1.00 105.16 ? 231  THR C O   1 
ATOM   5925 C CB  . THR C 1 231 ? 17.677  -24.513 15.284 1.00 102.72 ? 231  THR C CB  1 
ATOM   5926 O OG1 . THR C 1 231 ? 18.280  -24.738 16.562 1.00 96.27  ? 231  THR C OG1 1 
ATOM   5927 C CG2 . THR C 1 231 ? 17.194  -25.840 14.731 1.00 106.53 ? 231  THR C CG2 1 
ATOM   5928 N N   . LEU C 1 232 ? 19.794  -22.067 15.559 1.00 138.10 ? 232  LEU C N   1 
ATOM   5929 C CA  . LEU C 1 232 ? 20.011  -20.675 15.935 1.00 132.73 ? 232  LEU C CA  1 
ATOM   5930 C C   . LEU C 1 232 ? 20.617  -19.871 14.791 1.00 131.26 ? 232  LEU C C   1 
ATOM   5931 O O   . LEU C 1 232 ? 20.119  -18.799 14.452 1.00 127.29 ? 232  LEU C O   1 
ATOM   5932 C CB  . LEU C 1 232 ? 20.874  -20.568 17.194 1.00 129.64 ? 232  LEU C CB  1 
ATOM   5933 C CG  . LEU C 1 232 ? 20.133  -20.749 18.521 1.00 121.03 ? 232  LEU C CG  1 
ATOM   5934 C CD1 . LEU C 1 232 ? 21.077  -20.565 19.697 1.00 117.40 ? 232  LEU C CD1 1 
ATOM   5935 C CD2 . LEU C 1 232 ? 18.967  -19.779 18.619 1.00 117.68 ? 232  LEU C CD2 1 
ATOM   5936 N N   . ARG C 1 233 ? 21.688  -20.388 14.197 1.00 109.95 ? 233  ARG C N   1 
ATOM   5937 C CA  . ARG C 1 233 ? 22.278  -19.747 13.028 1.00 110.12 ? 233  ARG C CA  1 
ATOM   5938 C C   . ARG C 1 233 ? 21.214  -19.515 11.963 1.00 109.57 ? 233  ARG C C   1 
ATOM   5939 O O   . ARG C 1 233 ? 21.189  -18.475 11.305 1.00 106.77 ? 233  ARG C O   1 
ATOM   5940 C CB  . ARG C 1 233 ? 23.405  -20.606 12.454 1.00 118.83 ? 233  ARG C CB  1 
ATOM   5941 C CG  . ARG C 1 233 ? 24.577  -20.779 13.395 1.00 122.75 ? 233  ARG C CG  1 
ATOM   5942 C CD  . ARG C 1 233 ? 25.848  -21.148 12.649 1.00 133.17 ? 233  ARG C CD  1 
ATOM   5943 N NE  . ARG C 1 233 ? 27.023  -20.674 13.371 1.00 136.11 ? 233  ARG C NE  1 
ATOM   5944 C CZ  . ARG C 1 233 ? 27.502  -21.248 14.470 1.00 141.21 ? 233  ARG C CZ  1 
ATOM   5945 N NH1 . ARG C 1 233 ? 26.912  -22.322 14.965 1.00 143.65 ? 233  ARG C NH1 1 
ATOM   5946 N NH2 . ARG C 1 233 ? 28.573  -20.752 15.072 1.00 143.17 ? 233  ARG C NH2 1 
ATOM   5947 N N   . ASN C 1 234 ? 20.329  -20.495 11.822 1.00 114.97 ? 234  ASN C N   1 
ATOM   5948 C CA  . ASN C 1 234 ? 19.324  -20.515 10.764 1.00 117.30 ? 234  ASN C CA  1 
ATOM   5949 C C   . ASN C 1 234 ? 18.286  -19.409 10.825 1.00 114.08 ? 234  ASN C C   1 
ATOM   5950 O O   . ASN C 1 234 ? 17.761  -18.984 9.796  1.00 116.31 ? 234  ASN C O   1 
ATOM   5951 C CB  . ASN C 1 234 ? 18.608  -21.861 10.749 1.00 123.63 ? 234  ASN C CB  1 
ATOM   5952 C CG  . ASN C 1 234 ? 19.365  -22.905 9.972  1.00 130.36 ? 234  ASN C CG  1 
ATOM   5953 O OD1 . ASN C 1 234 ? 20.454  -22.643 9.458  1.00 131.04 ? 234  ASN C OD1 1 
ATOM   5954 N ND2 . ASN C 1 234 ? 18.791  -24.099 9.872  1.00 136.99 ? 234  ASN C ND2 1 
ATOM   5955 N N   . SER C 1 235 ? 17.966  -18.970 12.034 1.00 120.89 ? 235  SER C N   1 
ATOM   5956 C CA  . SER C 1 235 ? 17.032  -17.873 12.215 1.00 120.09 ? 235  SER C CA  1 
ATOM   5957 C C   . SER C 1 235 ? 17.817  -16.574 12.314 1.00 114.52 ? 235  SER C C   1 
ATOM   5958 O O   . SER C 1 235 ? 17.262  -15.516 12.613 1.00 113.95 ? 235  SER C O   1 
ATOM   5959 C CB  . SER C 1 235 ? 16.191  -18.104 13.468 1.00 121.27 ? 235  SER C CB  1 
ATOM   5960 O OG  . SER C 1 235 ? 16.926  -18.839 14.432 1.00 118.74 ? 235  SER C OG  1 
ATOM   5961 N N   . HIS C 1 236 ? 19.116  -16.669 12.042 1.00 192.41 ? 236  HIS C N   1 
ATOM   5962 C CA  . HIS C 1 236 ? 20.019  -15.535 12.162 1.00 188.22 ? 236  HIS C CA  1 
ATOM   5963 C C   . HIS C 1 236 ? 19.732  -14.824 13.477 1.00 184.29 ? 236  HIS C C   1 
ATOM   5964 O O   . HIS C 1 236 ? 19.505  -13.616 13.504 1.00 182.87 ? 236  HIS C O   1 
ATOM   5965 C CB  . HIS C 1 236 ? 19.834  -14.579 10.980 1.00 189.56 ? 236  HIS C CB  1 
ATOM   5966 C CG  . HIS C 1 236 ? 20.959  -13.605 10.806 1.00 187.13 ? 236  HIS C CG  1 
ATOM   5967 N ND1 . HIS C 1 236 ? 21.319  -12.698 11.778 1.00 183.12 ? 236  HIS C ND1 1 
ATOM   5968 C CD2 . HIS C 1 236 ? 21.798  -13.390 9.762  1.00 189.28 ? 236  HIS C CD2 1 
ATOM   5969 C CE1 . HIS C 1 236 ? 22.335  -11.972 11.347 1.00 182.99 ? 236  HIS C CE1 1 
ATOM   5970 N NE2 . HIS C 1 236 ? 22.643  -12.369 10.127 1.00 186.91 ? 236  HIS C NE2 1 
ATOM   5971 N N   . SER C 1 237 ? 19.739  -15.584 14.567 1.00 108.26 ? 237  SER C N   1 
ATOM   5972 C CA  . SER C 1 237 ? 19.284  -15.072 15.858 1.00 105.67 ? 237  SER C CA  1 
ATOM   5973 C C   . SER C 1 237 ? 20.412  -14.572 16.758 1.00 101.29 ? 237  SER C C   1 
ATOM   5974 O O   . SER C 1 237 ? 21.451  -15.219 16.894 1.00 101.97 ? 237  SER C O   1 
ATOM   5975 C CB  . SER C 1 237 ? 18.455  -16.130 16.594 1.00 108.61 ? 237  SER C CB  1 
ATOM   5976 O OG  . SER C 1 237 ? 19.158  -17.353 16.685 1.00 110.20 ? 237  SER C OG  1 
ATOM   5977 N N   . GLU C 1 238 ? 20.182  -13.415 17.375 1.00 124.03 ? 238  GLU C N   1 
ATOM   5978 C CA  . GLU C 1 238 ? 21.138  -12.821 18.297 1.00 120.39 ? 238  GLU C CA  1 
ATOM   5979 C C   . GLU C 1 238 ? 20.505  -12.614 19.666 1.00 119.07 ? 238  GLU C C   1 
ATOM   5980 O O   . GLU C 1 238 ? 19.299  -12.776 19.836 1.00 121.79 ? 238  GLU C O   1 
ATOM   5981 C CB  . GLU C 1 238 ? 21.619  -11.478 17.762 1.00 119.03 ? 238  GLU C CB  1 
ATOM   5982 C CG  . GLU C 1 238 ? 22.004  -11.489 16.301 1.00 121.35 ? 238  GLU C CG  1 
ATOM   5983 C CD  . GLU C 1 238 ? 22.388  -10.112 15.816 1.00 121.01 ? 238  GLU C CD  1 
ATOM   5984 O OE1 . GLU C 1 238 ? 21.893  -9.123  16.401 1.00 120.12 ? 238  GLU C OE1 1 
ATOM   5985 O OE2 . GLU C 1 238 ? 23.183  -10.016 14.857 1.00 122.83 ? 238  GLU C OE2 1 
ATOM   5986 N N   . PHE C 1 239 ? 21.329  -12.243 20.639 1.00 83.17  ? 239  PHE C N   1 
ATOM   5987 C CA  . PHE C 1 239 ? 20.851  -11.992 21.992 1.00 82.08  ? 239  PHE C CA  1 
ATOM   5988 C C   . PHE C 1 239 ? 21.309  -10.634 22.510 1.00 79.49  ? 239  PHE C C   1 
ATOM   5989 O O   . PHE C 1 239 ? 22.502  -10.338 22.562 1.00 77.89  ? 239  PHE C O   1 
ATOM   5990 C CB  . PHE C 1 239 ? 21.285  -13.116 22.928 1.00 82.25  ? 239  PHE C CB  1 
ATOM   5991 C CG  . PHE C 1 239 ? 20.787  -14.462 22.504 1.00 84.60  ? 239  PHE C CG  1 
ATOM   5992 C CD1 . PHE C 1 239 ? 21.445  -15.176 21.518 1.00 88.32  ? 239  PHE C CD1 1 
ATOM   5993 C CD2 . PHE C 1 239 ? 19.645  -15.004 23.069 1.00 81.89  ? 239  PHE C CD2 1 
ATOM   5994 C CE1 . PHE C 1 239 ? 20.981  -16.408 21.113 1.00 91.08  ? 239  PHE C CE1 1 
ATOM   5995 C CE2 . PHE C 1 239 ? 19.179  -16.240 22.669 1.00 83.07  ? 239  PHE C CE2 1 
ATOM   5996 C CZ  . PHE C 1 239 ? 19.847  -16.941 21.690 1.00 87.52  ? 239  PHE C CZ  1 
ATOM   5997 N N   . LEU C 1 240 ? 20.335  -9.818  22.891 1.00 82.52  ? 240  LEU C N   1 
ATOM   5998 C CA  . LEU C 1 240 ? 20.568  -8.447  23.304 1.00 81.72  ? 240  LEU C CA  1 
ATOM   5999 C C   . LEU C 1 240 ? 20.370  -8.283  24.805 1.00 79.37  ? 240  LEU C C   1 
ATOM   6000 O O   . LEU C 1 240 ? 19.329  -8.647  25.335 1.00 77.71  ? 240  LEU C O   1 
ATOM   6001 C CB  . LEU C 1 240 ? 19.592  -7.540  22.572 1.00 74.03  ? 240  LEU C CB  1 
ATOM   6002 C CG  . LEU C 1 240 ? 19.874  -6.055  22.748 1.00 74.74  ? 240  LEU C CG  1 
ATOM   6003 C CD1 . LEU C 1 240 ? 21.369  -5.799  22.655 1.00 82.86  ? 240  LEU C CD1 1 
ATOM   6004 C CD2 . LEU C 1 240 ? 19.123  -5.256  21.707 1.00 79.55  ? 240  LEU C CD2 1 
ATOM   6005 N N   . VAL C 1 241 ? 21.361  -7.728  25.491 1.00 71.39  ? 241  VAL C N   1 
ATOM   6006 C CA  . VAL C 1 241 ? 21.252  -7.520  26.928 1.00 75.99  ? 241  VAL C CA  1 
ATOM   6007 C C   . VAL C 1 241 ? 21.187  -6.043  27.262 1.00 76.01  ? 241  VAL C C   1 
ATOM   6008 O O   . VAL C 1 241 ? 22.070  -5.273  26.878 1.00 70.10  ? 241  VAL C O   1 
ATOM   6009 C CB  . VAL C 1 241 ? 22.451  -8.119  27.689 1.00 75.32  ? 241  VAL C CB  1 
ATOM   6010 C CG1 . VAL C 1 241 ? 22.298  -7.880  29.179 1.00 74.15  ? 241  VAL C CG1 1 
ATOM   6011 C CG2 . VAL C 1 241 ? 22.589  -9.602  27.397 1.00 76.13  ? 241  VAL C CG2 1 
ATOM   6012 N N   . LEU C 1 242 ? 20.146  -5.644  27.982 1.00 73.68  ? 242  LEU C N   1 
ATOM   6013 C CA  . LEU C 1 242 ? 20.085  -4.288  28.511 1.00 74.15  ? 242  LEU C CA  1 
ATOM   6014 C C   . LEU C 1 242 ? 20.144  -4.293  30.030 1.00 73.23  ? 242  LEU C C   1 
ATOM   6015 O O   . LEU C 1 242 ? 19.292  -4.880  30.689 1.00 73.64  ? 242  LEU C O   1 
ATOM   6016 C CB  . LEU C 1 242 ? 18.818  -3.568  28.062 1.00 75.52  ? 242  LEU C CB  1 
ATOM   6017 C CG  . LEU C 1 242 ? 18.566  -2.287  28.863 1.00 75.99  ? 242  LEU C CG  1 
ATOM   6018 C CD1 . LEU C 1 242 ? 19.787  -1.378  28.814 1.00 76.04  ? 242  LEU C CD1 1 
ATOM   6019 C CD2 . LEU C 1 242 ? 17.340  -1.548  28.375 1.00 78.12  ? 242  LEU C CD2 1 
ATOM   6020 N N   . PHE C 1 243 ? 21.155  -3.632  30.579 1.00 75.17  ? 243  PHE C N   1 
ATOM   6021 C CA  . PHE C 1 243 ? 21.265  -3.458  32.019 1.00 70.51  ? 243  PHE C CA  1 
ATOM   6022 C C   . PHE C 1 243 ? 21.016  -2.010  32.396 1.00 70.87  ? 243  PHE C C   1 
ATOM   6023 O O   . PHE C 1 243 ? 21.479  -1.098  31.710 1.00 70.99  ? 243  PHE C O   1 
ATOM   6024 C CB  . PHE C 1 243 ? 22.656  -3.840  32.515 1.00 69.67  ? 243  PHE C CB  1 
ATOM   6025 C CG  . PHE C 1 243 ? 22.943  -3.354  33.906 1.00 70.60  ? 243  PHE C CG  1 
ATOM   6026 C CD1 . PHE C 1 243 ? 22.772  -4.186  34.994 1.00 73.08  ? 243  PHE C CD1 1 
ATOM   6027 C CD2 . PHE C 1 243 ? 23.354  -2.053  34.130 1.00 70.48  ? 243  PHE C CD2 1 
ATOM   6028 C CE1 . PHE C 1 243 ? 23.023  -3.735  36.278 1.00 74.19  ? 243  PHE C CE1 1 
ATOM   6029 C CE2 . PHE C 1 243 ? 23.601  -1.600  35.413 1.00 72.53  ? 243  PHE C CE2 1 
ATOM   6030 C CZ  . PHE C 1 243 ? 23.436  -2.443  36.486 1.00 72.44  ? 243  PHE C CZ  1 
ATOM   6031 N N   . THR C 1 244 ? 20.304  -1.798  33.498 1.00 72.03  ? 244  THR C N   1 
ATOM   6032 C CA  . THR C 1 244 ? 20.088  -0.449  34.009 1.00 73.80  ? 244  THR C CA  1 
ATOM   6033 C C   . THR C 1 244 ? 19.956  -0.459  35.529 1.00 75.76  ? 244  THR C C   1 
ATOM   6034 O O   . THR C 1 244 ? 19.575  -1.465  36.121 1.00 74.15  ? 244  THR C O   1 
ATOM   6035 C CB  . THR C 1 244 ? 18.835  0.221   33.393 1.00 76.26  ? 244  THR C CB  1 
ATOM   6036 O OG1 . THR C 1 244 ? 17.654  -0.279  34.028 1.00 77.59  ? 244  THR C OG1 1 
ATOM   6037 C CG2 . THR C 1 244 ? 18.739  -0.054  31.906 1.00 74.10  ? 244  THR C CG2 1 
ATOM   6038 N N   . GLY C 1 245 ? 20.269  0.669   36.156 1.00 102.14 ? 245  GLY C N   1 
ATOM   6039 C CA  . GLY C 1 245 ? 20.195  0.781   37.600 1.00 107.21 ? 245  GLY C CA  1 
ATOM   6040 C C   . GLY C 1 245 ? 20.589  2.168   38.065 1.00 109.20 ? 245  GLY C C   1 
ATOM   6041 O O   . GLY C 1 245 ? 21.044  2.986   37.269 1.00 106.33 ? 245  GLY C O   1 
ATOM   6042 N N   . HIS C 1 246 ? 20.413  2.434   39.355 1.00 79.50  ? 246  HIS C N   1 
ATOM   6043 C CA  . HIS C 1 246 ? 20.760  3.732   39.921 1.00 79.88  ? 246  HIS C CA  1 
ATOM   6044 C C   . HIS C 1 246 ? 22.127  3.691   40.603 1.00 81.35  ? 246  HIS C C   1 
ATOM   6045 O O   . HIS C 1 246 ? 22.294  3.048   41.636 1.00 84.80  ? 246  HIS C O   1 
ATOM   6046 C CB  . HIS C 1 246 ? 19.693  4.185   40.911 1.00 87.38  ? 246  HIS C CB  1 
ATOM   6047 C CG  . HIS C 1 246 ? 20.001  5.493   41.563 1.00 91.19  ? 246  HIS C CG  1 
ATOM   6048 N ND1 . HIS C 1 246 ? 19.420  6.680   41.162 1.00 91.33  ? 246  HIS C ND1 1 
ATOM   6049 C CD2 . HIS C 1 246 ? 20.840  5.807   42.577 1.00 95.50  ? 246  HIS C CD2 1 
ATOM   6050 C CE1 . HIS C 1 246 ? 19.887  7.665   41.909 1.00 95.22  ? 246  HIS C CE1 1 
ATOM   6051 N NE2 . HIS C 1 246 ? 20.746  7.168   42.773 1.00 97.89  ? 246  HIS C NE2 1 
ATOM   6052 N N   . HIS C 1 247 ? 23.099  4.388   40.020 1.00 78.62  ? 247  HIS C N   1 
ATOM   6053 C CA  . HIS C 1 247 ? 24.479  4.323   40.485 1.00 79.67  ? 247  HIS C CA  1 
ATOM   6054 C C   . HIS C 1 247 ? 24.721  5.260   41.646 1.00 84.94  ? 247  HIS C C   1 
ATOM   6055 O O   . HIS C 1 247 ? 24.530  6.472   41.523 1.00 86.67  ? 247  HIS C O   1 
ATOM   6056 C CB  . HIS C 1 247 ? 25.446  4.661   39.351 1.00 76.69  ? 247  HIS C CB  1 
ATOM   6057 C CG  . HIS C 1 247 ? 26.775  3.987   39.476 1.00 81.20  ? 247  HIS C CG  1 
ATOM   6058 N ND1 . HIS C 1 247 ? 27.599  4.170   40.569 1.00 82.38  ? 247  HIS C ND1 1 
ATOM   6059 C CD2 . HIS C 1 247 ? 27.422  3.130   38.656 1.00 77.24  ? 247  HIS C CD2 1 
ATOM   6060 C CE1 . HIS C 1 247 ? 28.694  3.452   40.409 1.00 80.32  ? 247  HIS C CE1 1 
ATOM   6061 N NE2 . HIS C 1 247 ? 28.619  2.812   39.262 1.00 77.42  ? 247  HIS C NE2 1 
ATOM   6062 N N   . GLU C 1 248 ? 25.150  4.702   42.773 1.00 100.25 ? 248  GLU C N   1 
ATOM   6063 C CA  . GLU C 1 248 ? 25.441  5.530   43.938 1.00 104.70 ? 248  GLU C CA  1 
ATOM   6064 C C   . GLU C 1 248 ? 26.557  6.532   43.679 1.00 106.15 ? 248  GLU C C   1 
ATOM   6065 O O   . GLU C 1 248 ? 26.510  7.655   44.166 1.00 112.50 ? 248  GLU C O   1 
ATOM   6066 C CB  . GLU C 1 248 ? 25.791  4.682   45.137 1.00 102.46 ? 248  GLU C CB  1 
ATOM   6067 C CG  . GLU C 1 248 ? 24.530  4.155   45.851 1.00 105.11 ? 248  GLU C CG  1 
ATOM   6068 C CD  . GLU C 1 248 ? 24.855  3.178   46.965 1.00 102.87 ? 248  GLU C CD  1 
ATOM   6069 O OE1 . GLU C 1 248 ? 25.991  3.243   47.479 1.00 101.71 ? 248  GLU C OE1 1 
ATOM   6070 O OE2 . GLU C 1 248 ? 23.985  2.359   47.340 1.00 103.58 ? 248  GLU C OE2 1 
ATOM   6071 N N   . ALA C 1 249 ? 27.556  6.130   42.902 1.00 101.51 ? 249  ALA C N   1 
ATOM   6072 C CA  . ALA C 1 249 ? 28.637  7.039   42.528 1.00 104.42 ? 249  ALA C CA  1 
ATOM   6073 C C   . ALA C 1 249 ? 28.084  8.374   42.033 1.00 109.16 ? 249  ALA C C   1 
ATOM   6074 O O   . ALA C 1 249 ? 28.456  9.436   42.526 1.00 113.65 ? 249  ALA C O   1 
ATOM   6075 C CB  . ALA C 1 249 ? 29.515  6.409   41.456 1.00 100.97 ? 249  ALA C CB  1 
ATOM   6076 N N   . PHE C 1 250 ? 27.178  8.312   41.065 1.00 94.41  ? 250  PHE C N   1 
ATOM   6077 C CA  . PHE C 1 250 ? 26.685  9.519   40.420 1.00 92.37  ? 250  PHE C CA  1 
ATOM   6078 C C   . PHE C 1 250 ? 25.359  9.999   41.000 1.00 94.16  ? 250  PHE C C   1 
ATOM   6079 O O   . PHE C 1 250 ? 24.906  11.096  40.683 1.00 93.95  ? 250  PHE C O   1 
ATOM   6080 C CB  . PHE C 1 250 ? 26.567  9.288   38.913 1.00 86.86  ? 250  PHE C CB  1 
ATOM   6081 C CG  . PHE C 1 250 ? 27.777  8.642   38.316 1.00 86.67  ? 250  PHE C CG  1 
ATOM   6082 C CD1 . PHE C 1 250 ? 27.737  7.331   37.876 1.00 84.24  ? 250  PHE C CD1 1 
ATOM   6083 C CD2 . PHE C 1 250 ? 28.968  9.337   38.227 1.00 90.14  ? 250  PHE C CD2 1 
ATOM   6084 C CE1 . PHE C 1 250 ? 28.858  6.734   37.335 1.00 85.48  ? 250  PHE C CE1 1 
ATOM   6085 C CE2 . PHE C 1 250 ? 30.092  8.747   37.692 1.00 91.94  ? 250  PHE C CE2 1 
ATOM   6086 C CZ  . PHE C 1 250 ? 30.039  7.444   37.245 1.00 89.76  ? 250  PHE C CZ  1 
ATOM   6087 N N   . ALA C 1 251 ? 24.747  9.188   41.857 1.00 95.35  ? 251  ALA C N   1 
ATOM   6088 C CA  . ALA C 1 251 ? 23.430  9.512   42.398 1.00 99.00  ? 251  ALA C CA  1 
ATOM   6089 C C   . ALA C 1 251 ? 22.480  9.791   41.241 1.00 94.31  ? 251  ALA C C   1 
ATOM   6090 O O   . ALA C 1 251 ? 21.699  10.740  41.268 1.00 96.63  ? 251  ALA C O   1 
ATOM   6091 C CB  . ALA C 1 251 ? 23.515  10.712  43.321 1.00 105.28 ? 251  ALA C CB  1 
ATOM   6092 N N   . GLN C 1 252 ? 22.561  8.941   40.226 1.00 102.87 ? 252  GLN C N   1 
ATOM   6093 C CA  . GLN C 1 252 ? 21.879  9.162   38.966 1.00 98.68  ? 252  GLN C CA  1 
ATOM   6094 C C   . GLN C 1 252 ? 21.753  7.810   38.279 1.00 94.73  ? 252  GLN C C   1 
ATOM   6095 O O   . GLN C 1 252 ? 22.502  6.882   38.583 1.00 94.27  ? 252  GLN C O   1 
ATOM   6096 C CB  . GLN C 1 252 ? 22.706  10.126  38.115 1.00 96.29  ? 252  GLN C CB  1 
ATOM   6097 C CG  . GLN C 1 252 ? 22.055  10.619  36.838 1.00 93.76  ? 252  GLN C CG  1 
ATOM   6098 C CD  . GLN C 1 252 ? 22.996  11.497  36.025 1.00 92.86  ? 252  GLN C CD  1 
ATOM   6099 O OE1 . GLN C 1 252 ? 24.143  11.716  36.413 1.00 94.15  ? 252  GLN C OE1 1 
ATOM   6100 N NE2 . GLN C 1 252 ? 22.513  12.005  34.895 1.00 91.86  ? 252  GLN C NE2 1 
ATOM   6101 N N   . ASN C 1 253 ? 20.800  7.686   37.366 1.00 94.25  ? 253  ASN C N   1 
ATOM   6102 C CA  . ASN C 1 253 ? 20.611  6.418   36.681 1.00 90.98  ? 253  ASN C CA  1 
ATOM   6103 C C   . ASN C 1 253 ? 21.672  6.146   35.622 1.00 87.01  ? 253  ASN C C   1 
ATOM   6104 O O   . ASN C 1 253 ? 22.193  7.067   34.989 1.00 86.64  ? 253  ASN C O   1 
ATOM   6105 C CB  . ASN C 1 253 ? 19.207  6.314   36.090 1.00 91.40  ? 253  ASN C CB  1 
ATOM   6106 C CG  . ASN C 1 253 ? 18.240  5.624   37.023 1.00 95.75  ? 253  ASN C CG  1 
ATOM   6107 O OD1 . ASN C 1 253 ? 17.774  4.519   36.745 1.00 94.79  ? 253  ASN C OD1 1 
ATOM   6108 N ND2 . ASN C 1 253 ? 17.949  6.260   38.150 1.00 101.60 ? 253  ASN C ND2 1 
ATOM   6109 N N   . VAL C 1 254 ? 21.992  4.870   35.447 1.00 80.50  ? 254  VAL C N   1 
ATOM   6110 C CA  . VAL C 1 254 ? 22.988  4.448   34.476 1.00 78.39  ? 254  VAL C CA  1 
ATOM   6111 C C   . VAL C 1 254 ? 22.457  3.251   33.711 1.00 76.07  ? 254  VAL C C   1 
ATOM   6112 O O   . VAL C 1 254 ? 21.528  2.586   34.158 1.00 76.16  ? 254  VAL C O   1 
ATOM   6113 C CB  . VAL C 1 254 ? 24.280  4.008   35.166 1.00 79.95  ? 254  VAL C CB  1 
ATOM   6114 C CG1 . VAL C 1 254 ? 25.017  5.201   35.732 1.00 82.73  ? 254  VAL C CG1 1 
ATOM   6115 C CG2 . VAL C 1 254 ? 23.971  2.990   36.253 1.00 81.11  ? 254  VAL C CG2 1 
ATOM   6116 N N   . HIS C 1 255 ? 23.041  2.974   32.553 1.00 86.77  ? 255  HIS C N   1 
ATOM   6117 C CA  . HIS C 1 255 ? 22.747  1.726   31.874 1.00 85.19  ? 255  HIS C CA  1 
ATOM   6118 C C   . HIS C 1 255 ? 23.859  1.319   30.947 1.00 86.23  ? 255  HIS C C   1 
ATOM   6119 O O   . HIS C 1 255 ? 24.814  2.062   30.699 1.00 88.71  ? 255  HIS C O   1 
ATOM   6120 C CB  . HIS C 1 255 ? 21.447  1.811   31.068 1.00 84.54  ? 255  HIS C CB  1 
ATOM   6121 C CG  . HIS C 1 255 ? 21.431  2.927   30.060 1.00 86.09  ? 255  HIS C CG  1 
ATOM   6122 N ND1 . HIS C 1 255 ? 20.562  3.997   30.170 1.00 87.59  ? 255  HIS C ND1 1 
ATOM   6123 C CD2 . HIS C 1 255 ? 22.170  3.160   28.950 1.00 87.69  ? 255  HIS C CD2 1 
ATOM   6124 C CE1 . HIS C 1 255 ? 20.777  4.831   29.174 1.00 89.67  ? 255  HIS C CE1 1 
ATOM   6125 N NE2 . HIS C 1 255 ? 21.730  4.360   28.412 1.00 90.16  ? 255  HIS C NE2 1 
ATOM   6126 N N   . ALA C 1 256 ? 23.704  0.109   30.441 1.00 80.12  ? 256  ALA C N   1 
ATOM   6127 C CA  . ALA C 1 256 ? 24.708  -0.520  29.633 1.00 80.77  ? 256  ALA C CA  1 
ATOM   6128 C C   . ALA C 1 256 ? 24.006  -1.553  28.783 1.00 79.88  ? 256  ALA C C   1 
ATOM   6129 O O   . ALA C 1 256 ? 23.089  -2.227  29.241 1.00 77.56  ? 256  ALA C O   1 
ATOM   6130 C CB  . ALA C 1 256 ? 25.712  -1.179  30.519 1.00 78.64  ? 256  ALA C CB  1 
ATOM   6131 N N   . ARG C 1 257 ? 24.425  -1.676  27.536 1.00 94.28  ? 257  ARG C N   1 
ATOM   6132 C CA  . ARG C 1 257 ? 23.885  -2.725  26.700 1.00 93.45  ? 257  ARG C CA  1 
ATOM   6133 C C   . ARG C 1 257 ? 24.986  -3.503  26.033 1.00 91.63  ? 257  ARG C C   1 
ATOM   6134 O O   . ARG C 1 257 ? 26.116  -3.031  25.877 1.00 92.56  ? 257  ARG C O   1 
ATOM   6135 C CB  . ARG C 1 257 ? 22.984  -2.137  25.648 1.00 97.33  ? 257  ARG C CB  1 
ATOM   6136 C CG  . ARG C 1 257 ? 23.433  -0.788  25.304 1.00 100.28 ? 257  ARG C CG  1 
ATOM   6137 C CD  . ARG C 1 257 ? 22.700  -0.333  24.151 1.00 104.32 ? 257  ARG C CD  1 
ATOM   6138 N NE  . ARG C 1 257 ? 23.083  1.011   23.796 1.00 108.33 ? 257  ARG C NE  1 
ATOM   6139 C CZ  . ARG C 1 257 ? 23.629  1.398   22.645 1.00 110.40 ? 257  ARG C CZ  1 
ATOM   6140 N NH1 . ARG C 1 257 ? 23.848  0.563   21.619 1.00 107.69 ? 257  ARG C NH1 1 
ATOM   6141 N NH2 . ARG C 1 257 ? 23.910  2.680   22.509 1.00 115.28 ? 257  ARG C NH2 1 
ATOM   6142 N N   . HIS C 1 258 ? 24.625  -4.712  25.636 1.00 83.43  ? 258  HIS C N   1 
ATOM   6143 C CA  . HIS C 1 258 ? 25.549  -5.622  25.004 1.00 83.75  ? 258  HIS C CA  1 
ATOM   6144 C C   . HIS C 1 258 ? 24.748  -6.533  24.093 1.00 83.92  ? 258  HIS C C   1 
ATOM   6145 O O   . HIS C 1 258 ? 23.545  -6.693  24.278 1.00 83.88  ? 258  HIS C O   1 
ATOM   6146 C CB  . HIS C 1 258 ? 26.284  -6.436  26.067 1.00 84.00  ? 258  HIS C CB  1 
ATOM   6147 C CG  . HIS C 1 258 ? 27.472  -7.179  25.542 1.00 87.54  ? 258  HIS C CG  1 
ATOM   6148 N ND1 . HIS C 1 258 ? 28.634  -6.548  25.161 1.00 90.88  ? 258  HIS C ND1 1 
ATOM   6149 C CD2 . HIS C 1 258 ? 27.677  -8.503  25.342 1.00 88.82  ? 258  HIS C CD2 1 
ATOM   6150 C CE1 . HIS C 1 258 ? 29.506  -7.449  24.743 1.00 94.37  ? 258  HIS C CE1 1 
ATOM   6151 N NE2 . HIS C 1 258 ? 28.950  -8.644  24.844 1.00 93.18  ? 258  HIS C NE2 1 
ATOM   6152 N N   . ALA C 1 259 ? 25.409  -7.116  23.103 1.00 84.45  ? 259  ALA C N   1 
ATOM   6153 C CA  . ALA C 1 259 ? 24.743  -8.044  22.206 1.00 85.18  ? 259  ALA C CA  1 
ATOM   6154 C C   . ALA C 1 259 ? 25.632  -9.248  21.946 1.00 87.92  ? 259  ALA C C   1 
ATOM   6155 O O   . ALA C 1 259 ? 26.858  -9.127  21.911 1.00 90.98  ? 259  ALA C O   1 
ATOM   6156 C CB  . ALA C 1 259 ? 24.385  -7.359  20.907 1.00 86.46  ? 259  ALA C CB  1 
ATOM   6157 N N   . TYR C 1 260 ? 25.007  -10.409 21.767 1.00 74.77  ? 260  TYR C N   1 
ATOM   6158 C CA  . TYR C 1 260 ? 25.725  -11.640 21.453 1.00 74.77  ? 260  TYR C CA  1 
ATOM   6159 C C   . TYR C 1 260 ? 25.172  -12.261 20.180 1.00 76.42  ? 260  TYR C C   1 
ATOM   6160 O O   . TYR C 1 260 ? 23.973  -12.189 19.917 1.00 77.76  ? 260  TYR C O   1 
ATOM   6161 C CB  . TYR C 1 260 ? 25.579  -12.655 22.582 1.00 75.94  ? 260  TYR C CB  1 
ATOM   6162 C CG  . TYR C 1 260 ? 26.146  -12.221 23.909 1.00 73.79  ? 260  TYR C CG  1 
ATOM   6163 C CD1 . TYR C 1 260 ? 25.308  -11.910 24.971 1.00 73.37  ? 260  TYR C CD1 1 
ATOM   6164 C CD2 . TYR C 1 260 ? 27.515  -12.140 24.110 1.00 76.26  ? 260  TYR C CD2 1 
ATOM   6165 C CE1 . TYR C 1 260 ? 25.812  -11.528 26.193 1.00 72.89  ? 260  TYR C CE1 1 
ATOM   6166 C CE2 . TYR C 1 260 ? 28.030  -11.753 25.331 1.00 75.65  ? 260  TYR C CE2 1 
ATOM   6167 C CZ  . TYR C 1 260 ? 27.169  -11.449 26.369 1.00 75.13  ? 260  TYR C CZ  1 
ATOM   6168 O OH  . TYR C 1 260 ? 27.659  -11.062 27.592 1.00 73.94  ? 260  TYR C OH  1 
ATOM   6169 N N   . SER C 1 261 ? 26.043  -12.885 19.396 1.00 91.36  ? 261  SER C N   1 
ATOM   6170 C CA  . SER C 1 261 ? 25.598  -13.609 18.212 1.00 93.80  ? 261  SER C CA  1 
ATOM   6171 C C   . SER C 1 261 ? 25.478  -15.094 18.523 1.00 98.11  ? 261  SER C C   1 
ATOM   6172 O O   . SER C 1 261 ? 26.012  -15.568 19.521 1.00 100.84 ? 261  SER C O   1 
ATOM   6173 C CB  . SER C 1 261 ? 26.560  -13.380 17.048 1.00 98.67  ? 261  SER C CB  1 
ATOM   6174 O OG  . SER C 1 261 ? 27.907  -13.484 17.473 1.00 104.86 ? 261  SER C OG  1 
ATOM   6175 N N   . CYS C 1 262 ? 24.768  -15.825 17.672 1.00 126.33 ? 262  CYS C N   1 
ATOM   6176 C CA  . CYS C 1 262 ? 24.576  -17.258 17.870 1.00 131.52 ? 262  CYS C CA  1 
ATOM   6177 C C   . CYS C 1 262 ? 25.879  -17.957 18.259 1.00 139.83 ? 262  CYS C C   1 
ATOM   6178 O O   . CYS C 1 262 ? 25.888  -18.844 19.112 1.00 141.73 ? 262  CYS C O   1 
ATOM   6179 C CB  . CYS C 1 262 ? 23.981  -17.895 16.610 1.00 134.42 ? 262  CYS C CB  1 
ATOM   6180 S SG  . CYS C 1 262 ? 24.435  -17.065 15.059 1.00 134.71 ? 262  CYS C SG  1 
ATOM   6181 N N   . ASP C 1 263 ? 26.980  -17.528 17.649 1.00 111.16 ? 263  ASP C N   1 
ATOM   6182 C CA  . ASP C 1 263 ? 28.271  -18.195 17.807 1.00 119.73 ? 263  ASP C CA  1 
ATOM   6183 C C   . ASP C 1 263 ? 29.045  -17.804 19.066 1.00 113.65 ? 263  ASP C C   1 
ATOM   6184 O O   . ASP C 1 263 ? 30.152  -18.289 19.287 1.00 114.94 ? 263  ASP C O   1 
ATOM   6185 C CB  . ASP C 1 263 ? 29.147  -17.922 16.587 1.00 128.43 ? 263  ASP C CB  1 
ATOM   6186 C CG  . ASP C 1 263 ? 29.477  -16.454 16.432 1.00 124.30 ? 263  ASP C CG  1 
ATOM   6187 O OD1 . ASP C 1 263 ? 28.573  -15.682 16.046 1.00 114.33 ? 263  ASP C OD1 1 
ATOM   6188 O OD2 . ASP C 1 263 ? 30.637  -16.071 16.697 1.00 128.78 ? 263  ASP C OD2 1 
ATOM   6189 N N   . GLU C 1 264 ? 28.485  -16.919 19.881 1.00 123.89 ? 264  GLU C N   1 
ATOM   6190 C CA  . GLU C 1 264 ? 29.144  -16.545 21.128 1.00 117.67 ? 264  GLU C CA  1 
ATOM   6191 C C   . GLU C 1 264 ? 28.491  -17.292 22.278 1.00 113.54 ? 264  GLU C C   1 
ATOM   6192 O O   . GLU C 1 264 ? 28.740  -17.013 23.452 1.00 109.71 ? 264  GLU C O   1 
ATOM   6193 C CB  . GLU C 1 264 ? 29.080  -15.036 21.353 1.00 114.31 ? 264  GLU C CB  1 
ATOM   6194 C CG  . GLU C 1 264 ? 29.016  -14.241 20.067 1.00 118.32 ? 264  GLU C CG  1 
ATOM   6195 C CD  . GLU C 1 264 ? 29.898  -13.013 20.092 1.00 119.06 ? 264  GLU C CD  1 
ATOM   6196 O OE1 . GLU C 1 264 ? 31.033  -13.106 20.608 1.00 120.49 ? 264  GLU C OE1 1 
ATOM   6197 O OE2 . GLU C 1 264 ? 29.463  -11.960 19.581 1.00 116.01 ? 264  GLU C OE2 1 
ATOM   6198 N N   . ILE C 1 265 ? 27.638  -18.242 21.918 1.00 108.57 ? 265  ILE C N   1 
ATOM   6199 C CA  . ILE C 1 265 ? 27.041  -19.146 22.879 1.00 107.26 ? 265  ILE C CA  1 
ATOM   6200 C C   . ILE C 1 265 ? 27.901  -20.396 22.978 1.00 113.00 ? 265  ILE C C   1 
ATOM   6201 O O   . ILE C 1 265 ? 28.034  -21.150 22.014 1.00 118.64 ? 265  ILE C O   1 
ATOM   6202 C CB  . ILE C 1 265 ? 25.636  -19.560 22.447 1.00 105.70 ? 265  ILE C CB  1 
ATOM   6203 C CG1 . ILE C 1 265 ? 24.742  -18.329 22.294 1.00 101.31 ? 265  ILE C CG1 1 
ATOM   6204 C CG2 . ILE C 1 265 ? 25.045  -20.542 23.442 1.00 100.93 ? 265  ILE C CG2 1 
ATOM   6205 C CD1 . ILE C 1 265 ? 23.353  -18.659 21.801 1.00 99.12  ? 265  ILE C CD1 1 
ATOM   6206 N N   . ILE C 1 266 ? 28.491  -20.606 24.148 1.00 82.06  ? 266  ILE C N   1 
ATOM   6207 C CA  . ILE C 1 266 ? 29.334  -21.770 24.387 1.00 88.49  ? 266  ILE C CA  1 
ATOM   6208 C C   . ILE C 1 266 ? 28.507  -22.897 24.998 1.00 85.24  ? 266  ILE C C   1 
ATOM   6209 O O   . ILE C 1 266 ? 28.260  -22.910 26.205 1.00 84.88  ? 266  ILE C O   1 
ATOM   6210 C CB  . ILE C 1 266 ? 30.508  -21.409 25.316 1.00 90.38  ? 266  ILE C CB  1 
ATOM   6211 C CG1 . ILE C 1 266 ? 31.637  -20.768 24.508 1.00 89.15  ? 266  ILE C CG1 1 
ATOM   6212 C CG2 . ILE C 1 266 ? 31.022  -22.633 26.056 1.00 89.12  ? 266  ILE C CG2 1 
ATOM   6213 C CD1 . ILE C 1 266 ? 32.695  -20.100 25.363 1.00 88.02  ? 266  ILE C CD1 1 
ATOM   6214 N N   . TRP C 1 267 ? 28.071  -23.837 24.162 1.00 113.67 ? 267  TRP C N   1 
ATOM   6215 C CA  . TRP C 1 267 ? 27.209  -24.918 24.629 1.00 109.31 ? 267  TRP C CA  1 
ATOM   6216 C C   . TRP C 1 267 ? 27.944  -25.864 25.577 1.00 112.20 ? 267  TRP C C   1 
ATOM   6217 O O   . TRP C 1 267 ? 29.061  -26.299 25.300 1.00 120.04 ? 267  TRP C O   1 
ATOM   6218 C CB  . TRP C 1 267 ? 26.625  -25.698 23.453 1.00 111.14 ? 267  TRP C CB  1 
ATOM   6219 C CG  . TRP C 1 267 ? 25.804  -24.863 22.531 1.00 109.14 ? 267  TRP C CG  1 
ATOM   6220 C CD1 . TRP C 1 267 ? 26.266  -23.980 21.602 1.00 113.96 ? 267  TRP C CD1 1 
ATOM   6221 C CD2 . TRP C 1 267 ? 24.374  -24.840 22.433 1.00 103.25 ? 267  TRP C CD2 1 
ATOM   6222 N NE1 . TRP C 1 267 ? 25.213  -23.402 20.933 1.00 111.14 ? 267  TRP C NE1 1 
ATOM   6223 C CE2 . TRP C 1 267 ? 24.041  -23.913 21.424 1.00 104.61 ? 267  TRP C CE2 1 
ATOM   6224 C CE3 . TRP C 1 267 ? 23.344  -25.510 23.099 1.00 98.21  ? 267  TRP C CE3 1 
ATOM   6225 C CZ2 . TRP C 1 267 ? 22.720  -23.640 21.068 1.00 100.95 ? 267  TRP C CZ2 1 
ATOM   6226 C CZ3 . TRP C 1 267 ? 22.033  -25.239 22.741 1.00 94.90  ? 267  TRP C CZ3 1 
ATOM   6227 C CH2 . TRP C 1 267 ? 21.734  -24.313 21.736 1.00 96.20  ? 267  TRP C CH2 1 
ATOM   6228 N N   . GLY C 1 268 ? 27.306  -26.176 26.699 1.00 124.11 ? 268  GLY C N   1 
ATOM   6229 C CA  . GLY C 1 268 ? 27.880  -27.069 27.687 1.00 127.18 ? 268  GLY C CA  1 
ATOM   6230 C C   . GLY C 1 268 ? 28.854  -26.369 28.612 1.00 129.87 ? 268  GLY C C   1 
ATOM   6231 O O   . GLY C 1 268 ? 29.263  -26.924 29.631 1.00 132.55 ? 268  GLY C O   1 
ATOM   6232 N N   . GLY C 1 269 ? 29.223  -25.143 28.257 1.00 134.12 ? 269  GLY C N   1 
ATOM   6233 C CA  . GLY C 1 269 ? 30.175  -24.381 29.043 1.00 137.29 ? 269  GLY C CA  1 
ATOM   6234 C C   . GLY C 1 269 ? 29.656  -24.024 30.422 1.00 132.73 ? 269  GLY C C   1 
ATOM   6235 O O   . GLY C 1 269 ? 28.451  -24.032 30.669 1.00 126.52 ? 269  GLY C O   1 
ATOM   6236 N N   . HIS C 1 270 ? 30.578  -23.721 31.328 1.00 166.58 ? 270  HIS C N   1 
ATOM   6237 C CA  . HIS C 1 270 ? 30.233  -23.236 32.655 1.00 164.25 ? 270  HIS C CA  1 
ATOM   6238 C C   . HIS C 1 270 ? 31.157  -22.087 32.979 1.00 167.37 ? 270  HIS C C   1 
ATOM   6239 O O   . HIS C 1 270 ? 32.367  -22.209 32.831 1.00 174.84 ? 270  HIS C O   1 
ATOM   6240 C CB  . HIS C 1 270 ? 30.424  -24.334 33.700 1.00 168.69 ? 270  HIS C CB  1 
ATOM   6241 C CG  . HIS C 1 270 ? 29.509  -25.502 33.528 1.00 166.28 ? 270  HIS C CG  1 
ATOM   6242 N ND1 . HIS C 1 270 ? 29.930  -26.717 33.033 1.00 170.51 ? 270  HIS C ND1 1 
ATOM   6243 C CD2 . HIS C 1 270 ? 28.181  -25.642 33.782 1.00 160.94 ? 270  HIS C CD2 1 
ATOM   6244 C CE1 . HIS C 1 270 ? 28.909  -27.555 32.991 1.00 167.29 ? 270  HIS C CE1 1 
ATOM   6245 N NE2 . HIS C 1 270 ? 27.838  -26.926 33.439 1.00 161.76 ? 270  HIS C NE2 1 
ATOM   6246 N N   . PHE C 1 271 ? 30.603  -20.965 33.415 1.00 90.31  ? 271  PHE C N   1 
ATOM   6247 C CA  . PHE C 1 271 ? 31.449  -19.864 33.833 1.00 93.48  ? 271  PHE C CA  1 
ATOM   6248 C C   . PHE C 1 271 ? 32.287  -20.316 35.005 1.00 96.16  ? 271  PHE C C   1 
ATOM   6249 O O   . PHE C 1 271 ? 31.779  -20.916 35.948 1.00 100.62 ? 271  PHE C O   1 
ATOM   6250 C CB  . PHE C 1 271 ? 30.621  -18.632 34.197 1.00 87.37  ? 271  PHE C CB  1 
ATOM   6251 C CG  . PHE C 1 271 ? 30.157  -17.857 33.008 1.00 86.70  ? 271  PHE C CG  1 
ATOM   6252 C CD1 . PHE C 1 271 ? 28.831  -17.886 32.614 1.00 81.37  ? 271  PHE C CD1 1 
ATOM   6253 C CD2 . PHE C 1 271 ? 31.056  -17.124 32.260 1.00 86.12  ? 271  PHE C CD2 1 
ATOM   6254 C CE1 . PHE C 1 271 ? 28.408  -17.181 31.504 1.00 80.57  ? 271  PHE C CE1 1 
ATOM   6255 C CE2 . PHE C 1 271 ? 30.638  -16.420 31.151 1.00 81.07  ? 271  PHE C CE2 1 
ATOM   6256 C CZ  . PHE C 1 271 ? 29.312  -16.449 30.774 1.00 80.25  ? 271  PHE C CZ  1 
ATOM   6257 N N   . VAL C 1 272 ? 33.583  -20.053 34.919 1.00 94.84  ? 272  VAL C N   1 
ATOM   6258 C CA  . VAL C 1 272 ? 34.466  -20.296 36.038 1.00 101.41 ? 272  VAL C CA  1 
ATOM   6259 C C   . VAL C 1 272 ? 34.055  -19.390 37.181 1.00 99.23  ? 272  VAL C C   1 
ATOM   6260 O O   . VAL C 1 272 ? 33.221  -18.473 36.998 1.00 93.99  ? 272  VAL C O   1 
ATOM   6261 C CB  . VAL C 1 272 ? 35.940  -20.045 35.667 1.00 104.38 ? 272  VAL C CB  1 
ATOM   6262 C CG1 . VAL C 1 272 ? 36.784  -19.722 36.901 1.00 112.07 ? 272  VAL C CG1 1 
ATOM   6263 C CG2 . VAL C 1 272 ? 36.501  -21.235 34.912 1.00 110.53 ? 272  VAL C CG2 1 
ATOM   6264 N N   . ASP C 1 273 ? 34.644  -19.668 38.344 1.00 134.80 ? 273  ASP C N   1 
ATOM   6265 C CA  . ASP C 1 273 ? 34.328  -18.827 39.476 1.00 134.34 ? 273  ASP C CA  1 
ATOM   6266 C C   . ASP C 1 273 ? 35.407  -17.787 39.678 1.00 139.95 ? 273  ASP C C   1 
ATOM   6267 O O   . ASP C 1 273 ? 36.594  -18.047 39.434 1.00 148.25 ? 273  ASP C O   1 
ATOM   6268 C CB  . ASP C 1 273 ? 34.161  -19.643 40.748 1.00 139.52 ? 273  ASP C CB  1 
ATOM   6269 C CG  . ASP C 1 273 ? 33.507  -18.848 41.874 1.00 139.29 ? 273  ASP C CG  1 
ATOM   6270 O OD1 . ASP C 1 273 ? 33.143  -17.676 41.649 1.00 134.01 ? 273  ASP C OD1 1 
ATOM   6271 O OD2 . ASP C 1 273 ? 33.351  -19.387 42.988 1.00 145.34 ? 273  ASP C OD2 1 
ATOM   6272 N N   . VAL C 1 274 ? 34.979  -16.613 40.129 1.00 115.28 ? 274  VAL C N   1 
ATOM   6273 C CA  . VAL C 1 274 ? 35.864  -15.482 40.330 1.00 119.74 ? 274  VAL C CA  1 
ATOM   6274 C C   . VAL C 1 274 ? 35.922  -15.128 41.815 1.00 125.36 ? 274  VAL C C   1 
ATOM   6275 O O   . VAL C 1 274 ? 36.532  -14.128 42.219 1.00 129.20 ? 274  VAL C O   1 
ATOM   6276 C CB  . VAL C 1 274 ? 35.351  -14.280 39.550 1.00 111.61 ? 274  VAL C CB  1 
ATOM   6277 C CG1 . VAL C 1 274 ? 35.528  -14.495 38.063 1.00 109.11 ? 274  VAL C CG1 1 
ATOM   6278 C CG2 . VAL C 1 274 ? 33.888  -14.059 39.868 1.00 103.22 ? 274  VAL C CG2 1 
ATOM   6279 N N   . PHE C 1 275 ? 35.261  -15.951 42.621 1.00 130.92 ? 275  PHE C N   1 
ATOM   6280 C CA  . PHE C 1 275 ? 35.242  -15.745 44.057 1.00 133.25 ? 275  PHE C CA  1 
ATOM   6281 C C   . PHE C 1 275 ? 36.183  -16.704 44.761 1.00 132.68 ? 275  PHE C C   1 
ATOM   6282 O O   . PHE C 1 275 ? 36.119  -17.922 44.593 1.00 133.62 ? 275  PHE C O   1 
ATOM   6283 C CB  . PHE C 1 275 ? 33.823  -15.840 44.607 1.00 130.11 ? 275  PHE C CB  1 
ATOM   6284 C CG  . PHE C 1 275 ? 32.945  -14.706 44.181 1.00 128.65 ? 275  PHE C CG  1 
ATOM   6285 C CD1 . PHE C 1 275 ? 31.886  -14.921 43.320 1.00 130.49 ? 275  PHE C CD1 1 
ATOM   6286 C CD2 . PHE C 1 275 ? 33.191  -13.422 44.622 1.00 124.46 ? 275  PHE C CD2 1 
ATOM   6287 C CE1 . PHE C 1 275 ? 31.083  -13.882 42.921 1.00 133.00 ? 275  PHE C CE1 1 
ATOM   6288 C CE2 . PHE C 1 275 ? 32.390  -12.384 44.225 1.00 130.94 ? 275  PHE C CE2 1 
ATOM   6289 C CZ  . PHE C 1 275 ? 31.336  -12.613 43.373 1.00 127.44 ? 275  PHE C CZ  1 
ATOM   6290 N N   . THR C 1 276 ? 37.056  -16.115 45.562 1.00 202.19 ? 276  THR C N   1 
ATOM   6291 C CA  . THR C 1 276 ? 38.206  -16.795 46.112 1.00 213.89 ? 276  THR C CA  1 
ATOM   6292 C C   . THR C 1 276 ? 38.253  -16.605 47.613 1.00 228.27 ? 276  THR C C   1 
ATOM   6293 O O   . THR C 1 276 ? 37.615  -15.707 48.156 1.00 228.86 ? 276  THR C O   1 
ATOM   6294 C CB  . THR C 1 276 ? 39.492  -16.197 45.517 1.00 213.41 ? 276  THR C CB  1 
ATOM   6295 O OG1 . THR C 1 276 ? 39.504  -16.412 44.101 1.00 201.77 ? 276  THR C OG1 1 
ATOM   6296 C CG2 . THR C 1 276 ? 40.727  -16.824 46.135 1.00 226.28 ? 276  THR C CG2 1 
ATOM   6297 N N   . THR C 1 277 ? 39.003  -17.464 48.285 1.00 255.22 ? 277  THR C N   1 
ATOM   6298 C CA  . THR C 1 277 ? 39.368  -17.212 49.664 1.00 268.49 ? 277  THR C CA  1 
ATOM   6299 C C   . THR C 1 277 ? 40.873  -16.987 49.715 1.00 275.94 ? 277  THR C C   1 
ATOM   6300 O O   . THR C 1 277 ? 41.654  -17.838 49.295 1.00 279.36 ? 277  THR C O   1 
ATOM   6301 C CB  . THR C 1 277 ? 38.977  -18.376 50.581 1.00 273.09 ? 277  THR C CB  1 
ATOM   6302 O OG1 . THR C 1 277 ? 37.699  -18.888 50.184 1.00 266.70 ? 277  THR C OG1 1 
ATOM   6303 C CG2 . THR C 1 277 ? 38.908  -17.908 52.025 1.00 273.22 ? 277  THR C CG2 1 
ATOM   6304 N N   . LEU C 1 278 ? 41.277  -15.825 50.211 1.00 296.60 ? 278  LEU C N   1 
ATOM   6305 C CA  . LEU C 1 278 ? 42.687  -15.483 50.283 1.00 305.20 ? 278  LEU C CA  1 
ATOM   6306 C C   . LEU C 1 278 ? 43.391  -16.388 51.280 1.00 315.25 ? 278  LEU C C   1 
ATOM   6307 O O   . LEU C 1 278 ? 42.741  -17.109 52.037 1.00 314.64 ? 278  LEU C O   1 
ATOM   6308 C CB  . LEU C 1 278 ? 42.855  -14.016 50.683 1.00 304.17 ? 278  LEU C CB  1 
ATOM   6309 C CG  . LEU C 1 278 ? 42.324  -13.033 49.640 1.00 295.73 ? 278  LEU C CG  1 
ATOM   6310 C CD1 . LEU C 1 278 ? 42.418  -11.599 50.119 1.00 296.09 ? 278  LEU C CD1 1 
ATOM   6311 C CD2 . LEU C 1 278 ? 43.076  -13.203 48.336 1.00 291.49 ? 278  LEU C CD2 1 
ATOM   6312 N N   . PRO C 1 279 ? 44.729  -16.378 51.267 1.00 251.84 ? 279  PRO C N   1 
ATOM   6313 C CA  . PRO C 1 279 ? 45.465  -17.032 52.346 1.00 263.20 ? 279  PRO C CA  1 
ATOM   6314 C C   . PRO C 1 279 ? 45.034  -16.415 53.668 1.00 261.50 ? 279  PRO C C   1 
ATOM   6315 O O   . PRO C 1 279 ? 44.871  -17.115 54.664 1.00 264.94 ? 279  PRO C O   1 
ATOM   6316 C CB  . PRO C 1 279 ? 46.923  -16.665 52.037 1.00 272.87 ? 279  PRO C CB  1 
ATOM   6317 C CG  . PRO C 1 279 ? 46.829  -15.498 51.091 1.00 263.85 ? 279  PRO C CG  1 
ATOM   6318 C CD  . PRO C 1 279 ? 45.645  -15.828 50.259 1.00 252.70 ? 279  PRO C CD  1 
ATOM   6319 N N   . ASP C 1 280 ? 44.824  -15.103 53.655 1.00 256.48 ? 280  ASP C N   1 
ATOM   6320 C CA  . ASP C 1 280 ? 44.414  -14.371 54.846 1.00 255.93 ? 280  ASP C CA  1 
ATOM   6321 C C   . ASP C 1 280 ? 43.063  -14.849 55.375 1.00 247.37 ? 280  ASP C C   1 
ATOM   6322 O O   . ASP C 1 280 ? 42.733  -14.629 56.536 1.00 248.46 ? 280  ASP C O   1 
ATOM   6323 C CB  . ASP C 1 280 ? 44.370  -12.867 54.554 1.00 252.65 ? 280  ASP C CB  1 
ATOM   6324 C CG  . ASP C 1 280 ? 43.978  -12.045 55.771 1.00 253.62 ? 280  ASP C CG  1 
ATOM   6325 O OD1 . ASP C 1 280 ? 43.973  -12.598 56.889 1.00 258.25 ? 280  ASP C OD1 1 
ATOM   6326 O OD2 . ASP C 1 280 ? 43.683  -10.843 55.615 1.00 250.65 ? 280  ASP C OD2 1 
ATOM   6327 N N   . GLY C 1 281 ? 42.284  -15.507 54.525 1.00 294.30 ? 281  GLY C N   1 
ATOM   6328 C CA  . GLY C 1 281 ? 40.951  -15.933 54.910 1.00 287.06 ? 281  GLY C CA  1 
ATOM   6329 C C   . GLY C 1 281 ? 39.938  -14.852 54.596 1.00 277.09 ? 281  GLY C C   1 
ATOM   6330 O O   . GLY C 1 281 ? 38.799  -14.882 55.059 1.00 271.88 ? 281  GLY C O   1 
ATOM   6331 N N   . ARG C 1 282 ? 40.371  -13.884 53.801 1.00 247.19 ? 282  ARG C N   1 
ATOM   6332 C CA  . ARG C 1 282 ? 39.504  -12.805 53.361 1.00 239.06 ? 282  ARG C CA  1 
ATOM   6333 C C   . ARG C 1 282 ? 39.012  -13.083 51.945 1.00 232.82 ? 282  ARG C C   1 
ATOM   6334 O O   . ARG C 1 282 ? 39.794  -13.449 51.070 1.00 235.71 ? 282  ARG C O   1 
ATOM   6335 C CB  . ARG C 1 282 ? 40.252  -11.474 53.426 1.00 242.99 ? 282  ARG C CB  1 
ATOM   6336 C CG  . ARG C 1 282 ? 41.744  -11.602 53.175 1.00 252.56 ? 282  ARG C CG  1 
ATOM   6337 C CD  . ARG C 1 282 ? 42.439  -10.258 53.280 1.00 258.72 ? 282  ARG C CD  1 
ATOM   6338 N NE  . ARG C 1 282 ? 43.682  -10.222 52.517 1.00 265.92 ? 282  ARG C NE  1 
ATOM   6339 C CZ  . ARG C 1 282 ? 44.177  -9.118  51.971 1.00 268.43 ? 282  ARG C CZ  1 
ATOM   6340 N NH1 . ARG C 1 282 ? 43.526  -7.974  52.110 1.00 263.49 ? 282  ARG C NH1 1 
ATOM   6341 N NH2 . ARG C 1 282 ? 45.309  -9.157  51.283 1.00 270.58 ? 282  ARG C NH2 1 
ATOM   6342 N N   . ARG C 1 283 ? 37.710  -12.926 51.731 1.00 183.14 ? 283  ARG C N   1 
ATOM   6343 C CA  . ARG C 1 283 ? 37.109  -13.155 50.420 1.00 178.00 ? 283  ARG C CA  1 
ATOM   6344 C C   . ARG C 1 283 ? 37.640  -12.149 49.404 1.00 175.00 ? 283  ARG C C   1 
ATOM   6345 O O   . ARG C 1 283 ? 38.112  -11.075 49.774 1.00 177.29 ? 283  ARG C O   1 
ATOM   6346 C CB  . ARG C 1 283 ? 35.586  -13.068 50.515 1.00 167.65 ? 283  ARG C CB  1 
ATOM   6347 C CG  . ARG C 1 283 ? 34.948  -14.180 51.328 1.00 169.40 ? 283  ARG C CG  1 
ATOM   6348 C CD  . ARG C 1 283 ? 34.372  -15.259 50.429 1.00 164.16 ? 283  ARG C CD  1 
ATOM   6349 N N   . ALA C 1 284 ? 37.559  -12.499 48.124 1.00 204.23 ? 284  ALA C N   1 
ATOM   6350 C CA  . ALA C 1 284 ? 38.140  -11.674 47.069 1.00 195.37 ? 284  ALA C CA  1 
ATOM   6351 C C   . ALA C 1 284 ? 37.448  -11.866 45.724 1.00 178.88 ? 284  ALA C C   1 
ATOM   6352 O O   . ALA C 1 284 ? 36.672  -12.799 45.545 1.00 174.82 ? 284  ALA C O   1 
ATOM   6353 C CB  . ALA C 1 284 ? 39.619  -11.976 46.938 1.00 201.91 ? 284  ALA C CB  1 
ATOM   6354 N N   . LEU C 1 285 ? 37.739  -10.976 44.780 1.00 139.70 ? 285  LEU C N   1 
ATOM   6355 C CA  . LEU C 1 285 ? 37.222  -11.101 43.417 1.00 125.74 ? 285  LEU C CA  1 
ATOM   6356 C C   . LEU C 1 285 ? 38.335  -11.016 42.388 1.00 122.63 ? 285  LEU C C   1 
ATOM   6357 O O   . LEU C 1 285 ? 39.006  -9.994  42.248 1.00 122.78 ? 285  LEU C O   1 
ATOM   6358 C CB  . LEU C 1 285 ? 36.172  -10.021 43.143 1.00 153.98 ? 285  LEU C CB  1 
ATOM   6359 C CG  . LEU C 1 285 ? 35.592  -9.984  41.727 1.00 153.72 ? 285  LEU C CG  1 
ATOM   6360 C CD1 . LEU C 1 285 ? 34.845  -11.273 41.420 1.00 157.41 ? 285  LEU C CD1 1 
ATOM   6361 C CD2 . LEU C 1 285 ? 34.684  -8.777  41.549 1.00 152.75 ? 285  LEU C CD2 1 
ATOM   6362 N N   . ASP C 1 286 ? 38.506  -12.108 41.658 1.00 150.51 ? 286  ASP C N   1 
ATOM   6363 C CA  . ASP C 1 286 ? 39.541  -12.188 40.648 1.00 152.20 ? 286  ASP C CA  1 
ATOM   6364 C C   . ASP C 1 286 ? 38.921  -11.986 39.281 1.00 138.71 ? 286  ASP C C   1 
ATOM   6365 O O   . ASP C 1 286 ? 38.237  -12.859 38.752 1.00 135.36 ? 286  ASP C O   1 
ATOM   6366 C CB  . ASP C 1 286 ? 40.257  -13.531 40.710 1.00 162.69 ? 286  ASP C CB  1 
ATOM   6367 C CG  . ASP C 1 286 ? 41.454  -13.607 39.772 1.00 163.37 ? 286  ASP C CG  1 
ATOM   6368 O OD1 . ASP C 1 286 ? 41.715  -12.648 39.016 1.00 150.85 ? 286  ASP C OD1 1 
ATOM   6369 O OD2 . ASP C 1 286 ? 42.140  -14.649 39.800 1.00 172.67 ? 286  ASP C OD2 1 
ATOM   6370 N N   . LEU C 1 287 ? 39.162  -10.819 38.704 1.00 120.17 ? 287  LEU C N   1 
ATOM   6371 C CA  . LEU C 1 287 ? 38.614  -10.500 37.384 1.00 105.55 ? 287  LEU C CA  1 
ATOM   6372 C C   . LEU C 1 287 ? 39.404  -11.006 36.231 1.00 101.15 ? 287  LEU C C   1 
ATOM   6373 O O   . LEU C 1 287 ? 39.284  -10.637 35.081 1.00 96.63  ? 287  LEU C O   1 
ATOM   6374 C CB  . LEU C 1 287 ? 38.412  -9.014  37.243 1.00 97.24  ? 287  LEU C CB  1 
ATOM   6375 C CG  . LEU C 1 287 ? 37.374  -8.432  38.202 1.00 100.32 ? 287  LEU C CG  1 
ATOM   6376 C CD1 . LEU C 1 287 ? 37.215  -6.941  37.970 1.00 92.78  ? 287  LEU C CD1 1 
ATOM   6377 C CD2 . LEU C 1 287 ? 36.070  -9.144  38.026 1.00 99.12  ? 287  LEU C CD2 1 
ATOM   6378 N N   . GLY C 1 288 ? 40.285  -11.877 36.576 1.00 100.27 ? 288  GLY C N   1 
ATOM   6379 C CA  . GLY C 1 288 ? 40.917  -12.530 35.488 1.00 103.39 ? 288  GLY C CA  1 
ATOM   6380 C C   . GLY C 1 288 ? 39.933  -13.585 35.031 1.00 100.45 ? 288  GLY C C   1 
ATOM   6381 O O   . GLY C 1 288 ? 39.782  -13.847 33.842 1.00 98.50  ? 288  GLY C O   1 
ATOM   6382 N N   . LYS C 1 289 ? 39.259  -14.204 35.992 1.00 179.06 ? 289  LYS C N   1 
ATOM   6383 C CA  . LYS C 1 289 ? 38.427  -15.358 35.692 1.00 181.54 ? 289  LYS C CA  1 
ATOM   6384 C C   . LYS C 1 289 ? 37.122  -14.983 35.002 1.00 170.37 ? 289  LYS C C   1 
ATOM   6385 O O   . LYS C 1 289 ? 36.480  -15.829 34.386 1.00 169.31 ? 289  LYS C O   1 
ATOM   6386 C CB  . LYS C 1 289 ? 38.155  -16.127 36.978 1.00 192.20 ? 289  LYS C CB  1 
ATOM   6387 C CG  . LYS C 1 289 ? 39.419  -16.279 37.792 1.00 205.01 ? 289  LYS C CG  1 
ATOM   6388 C CD  . LYS C 1 289 ? 39.202  -17.088 39.039 1.00 210.35 ? 289  LYS C CD  1 
ATOM   6389 C CE  . LYS C 1 289 ? 40.485  -17.152 39.834 1.00 224.06 ? 289  LYS C CE  1 
ATOM   6390 N NZ  . LYS C 1 289 ? 41.577  -17.652 38.956 1.00 233.67 ? 289  LYS C NZ  1 
ATOM   6391 N N   . PHE C 1 290 ? 36.745  -13.711 35.081 1.00 116.70 ? 290  PHE C N   1 
ATOM   6392 C CA  . PHE C 1 290 ? 35.418  -13.280 34.640 1.00 108.27 ? 290  PHE C CA  1 
ATOM   6393 C C   . PHE C 1 290 ? 34.992  -13.774 33.261 1.00 101.38 ? 290  PHE C C   1 
ATOM   6394 O O   . PHE C 1 290 ? 33.828  -14.118 33.056 1.00 99.50  ? 290  PHE C O   1 
ATOM   6395 C CB  . PHE C 1 290 ? 35.268  -11.762 34.699 1.00 101.19 ? 290  PHE C CB  1 
ATOM   6396 C CG  . PHE C 1 290 ? 33.863  -11.294 34.439 1.00 95.03  ? 290  PHE C CG  1 
ATOM   6397 C CD1 . PHE C 1 290 ? 32.856  -11.547 35.356 1.00 97.30  ? 290  PHE C CD1 1 
ATOM   6398 C CD2 . PHE C 1 290 ? 33.546  -10.611 33.277 1.00 86.06  ? 290  PHE C CD2 1 
ATOM   6399 C CE1 . PHE C 1 290 ? 31.564  -11.127 35.122 1.00 90.95  ? 290  PHE C CE1 1 
ATOM   6400 C CE2 . PHE C 1 290 ? 32.255  -10.184 33.039 1.00 81.65  ? 290  PHE C CE2 1 
ATOM   6401 C CZ  . PHE C 1 290 ? 31.262  -10.443 33.964 1.00 84.53  ? 290  PHE C CZ  1 
ATOM   6402 N N   . HIS C 1 291 ? 35.919  -13.797 32.312 1.00 109.25 ? 291  HIS C N   1 
ATOM   6403 C CA  . HIS C 1 291 ? 35.579  -14.204 30.953 1.00 104.76 ? 291  HIS C CA  1 
ATOM   6404 C C   . HIS C 1 291 ? 35.856  -15.674 30.707 1.00 111.07 ? 291  HIS C C   1 
ATOM   6405 O O   . HIS C 1 291 ? 35.650  -16.172 29.603 1.00 109.23 ? 291  HIS C O   1 
ATOM   6406 C CB  . HIS C 1 291 ? 36.340  -13.364 29.932 1.00 100.37 ? 291  HIS C CB  1 
ATOM   6407 C CG  . HIS C 1 291 ? 35.858  -11.954 29.839 1.00 94.68  ? 291  HIS C CG  1 
ATOM   6408 N ND1 . HIS C 1 291 ? 34.612  -11.631 29.336 1.00 90.47  ? 291  HIS C ND1 1 
ATOM   6409 C CD2 . HIS C 1 291 ? 36.440  -10.789 30.187 1.00 93.57  ? 291  HIS C CD2 1 
ATOM   6410 C CE1 . HIS C 1 291 ? 34.458  -10.321 29.380 1.00 87.41  ? 291  HIS C CE1 1 
ATOM   6411 N NE2 . HIS C 1 291 ? 35.545  -9.782  29.887 1.00 89.11  ? 291  HIS C NE2 1 
ATOM   6412 N N   . GLU C 1 292 ? 36.322  -16.370 31.732 1.00 147.79 ? 292  GLU C N   1 
ATOM   6413 C CA  . GLU C 1 292 ? 36.712  -17.755 31.552 1.00 155.81 ? 292  GLU C CA  1 
ATOM   6414 C C   . GLU C 1 292 ? 35.555  -18.726 31.689 1.00 159.88 ? 292  GLU C C   1 
ATOM   6415 O O   . GLU C 1 292 ? 34.839  -18.731 32.682 1.00 160.08 ? 292  GLU C O   1 
ATOM   6416 C CB  . GLU C 1 292 ? 37.847  -18.121 32.495 1.00 166.44 ? 292  GLU C CB  1 
ATOM   6417 C CG  . GLU C 1 292 ? 39.197  -17.777 31.918 1.00 164.65 ? 292  GLU C CG  1 
ATOM   6418 C CD  . GLU C 1 292 ? 40.324  -18.027 32.888 1.00 175.43 ? 292  GLU C CD  1 
ATOM   6419 O OE1 . GLU C 1 292 ? 40.134  -18.829 33.826 1.00 187.18 ? 292  GLU C OE1 1 
ATOM   6420 O OE2 . GLU C 1 292 ? 41.400  -17.420 32.709 1.00 173.63 ? 292  GLU C OE2 1 
ATOM   6421 N N   . ILE C 1 293 ? 35.398  -19.555 30.666 1.00 135.87 ? 293  ILE C N   1 
ATOM   6422 C CA  . ILE C 1 293 ? 34.334  -20.542 30.639 1.00 136.92 ? 293  ILE C CA  1 
ATOM   6423 C C   . ILE C 1 293 ? 34.910  -21.950 30.589 1.00 146.27 ? 293  ILE C C   1 
ATOM   6424 O O   . ILE C 1 293 ? 35.547  -22.365 29.636 1.00 149.83 ? 293  ILE C O   1 
ATOM   6425 C CB  . ILE C 1 293 ? 33.419  -20.338 29.435 1.00 129.67 ? 293  ILE C CB  1 
ATOM   6426 C CG1 . ILE C 1 293 ? 32.964  -18.887 29.363 1.00 120.74 ? 293  ILE C CG1 1 
ATOM   6427 C CG2 . ILE C 1 293 ? 32.224  -21.283 29.498 1.00 126.60 ? 293  ILE C CG2 1 
ATOM   6428 C CD1 . ILE C 1 293 ? 31.896  -18.634 28.353 1.00 114.16 ? 293  ILE C CD1 1 
ATOM   6429 N N   . ALA C 1 294 ? 34.684  -22.708 31.640 1.00 164.78 ? 294  ALA C N   1 
ATOM   6430 C CA  . ALA C 1 294 ? 35.080  -24.103 31.702 1.00 170.61 ? 294  ALA C CA  1 
ATOM   6431 C C   . ALA C 1 294 ? 34.330  -24.916 30.663 1.00 167.11 ? 294  ALA C C   1 
ATOM   6432 O O   . ALA C 1 294 ? 33.229  -24.553 30.265 1.00 158.20 ? 294  ALA C O   1 
ATOM   6433 C CB  . ALA C 1 294 ? 34.788  -24.641 33.080 1.00 169.32 ? 294  ALA C CB  1 
ATOM   6434 N N   . GLN C 1 295 ? 34.938  -26.000 30.199 1.00 160.01 ? 295  GLN C N   1 
ATOM   6435 C CA  . GLN C 1 295 ? 34.327  -26.822 29.161 1.00 158.33 ? 295  GLN C CA  1 
ATOM   6436 C C   . GLN C 1 295 ? 34.810  -28.270 29.228 1.00 165.66 ? 295  GLN C C   1 
ATOM   6437 O O   . GLN C 1 295 ? 35.990  -28.524 29.481 1.00 176.12 ? 295  GLN C O   1 
ATOM   6438 C CB  . GLN C 1 295 ? 34.623  -26.228 27.785 1.00 162.26 ? 295  GLN C CB  1 
ATOM   6439 C CG  . GLN C 1 295 ? 33.880  -26.898 26.670 1.00 160.37 ? 295  GLN C CG  1 
ATOM   6440 C CD  . GLN C 1 295 ? 33.426  -25.921 25.616 1.00 157.39 ? 295  GLN C CD  1 
ATOM   6441 O OE1 . GLN C 1 295 ? 34.132  -24.967 25.286 1.00 154.69 ? 295  GLN C OE1 1 
ATOM   6442 N NE2 . GLN C 1 295 ? 32.235  -26.153 25.078 1.00 150.55 ? 295  GLN C NE2 1 
ATOM   6443 N N   . PRO D 1 12  ? -14.854 17.445  13.632 1.00 164.67 ? 12   PRO D N   1 
ATOM   6444 C CA  . PRO D 1 12  ? -15.159 17.974  14.967 1.00 167.12 ? 12   PRO D CA  1 
ATOM   6445 C C   . PRO D 1 12  ? -14.500 17.141  16.062 1.00 170.59 ? 12   PRO D C   1 
ATOM   6446 O O   . PRO D 1 12  ? -15.181 16.730  16.999 1.00 173.84 ? 12   PRO D O   1 
ATOM   6447 C CB  . PRO D 1 12  ? -16.676 17.820  15.053 1.00 168.87 ? 12   PRO D CB  1 
ATOM   6448 C CG  . PRO D 1 12  ? -16.980 16.627  14.193 1.00 168.97 ? 12   PRO D CG  1 
ATOM   6449 C CD  . PRO D 1 12  ? -15.913 16.553  13.127 1.00 165.70 ? 12   PRO D CD  1 
ATOM   6450 N N   . ARG D 1 13  ? -13.196 16.907  15.948 1.00 141.74 ? 13   ARG D N   1 
ATOM   6451 C CA  . ARG D 1 13  ? -12.503 15.976  16.836 1.00 145.52 ? 13   ARG D CA  1 
ATOM   6452 C C   . ARG D 1 13  ? -12.211 16.531  18.227 1.00 148.16 ? 13   ARG D C   1 
ATOM   6453 O O   . ARG D 1 13  ? -11.823 17.691  18.381 1.00 146.89 ? 13   ARG D O   1 
ATOM   6454 C CB  . ARG D 1 13  ? -11.214 15.467  16.182 1.00 145.38 ? 13   ARG D CB  1 
ATOM   6455 C CG  . ARG D 1 13  ? -10.358 16.553  15.552 1.00 142.33 ? 13   ARG D CG  1 
ATOM   6456 C CD  . ARG D 1 13  ? -9.383  15.963  14.539 1.00 141.95 ? 13   ARG D CD  1 
ATOM   6457 N NE  . ARG D 1 13  ? -8.495  14.971  15.140 1.00 146.48 ? 13   ARG D NE  1 
ATOM   6458 C CZ  . ARG D 1 13  ? -7.569  14.290  14.470 1.00 147.68 ? 13   ARG D CZ  1 
ATOM   6459 N NH1 . ARG D 1 13  ? -7.406  14.491  13.169 1.00 142.00 ? 13   ARG D NH1 1 
ATOM   6460 N NH2 . ARG D 1 13  ? -6.805  13.407  15.100 1.00 152.76 ? 13   ARG D NH2 1 
ATOM   6461 N N   . ILE D 1 14  ? -12.402 15.682  19.234 1.00 164.00 ? 14   ILE D N   1 
ATOM   6462 C CA  . ILE D 1 14  ? -12.116 16.032  20.620 1.00 167.28 ? 14   ILE D CA  1 
ATOM   6463 C C   . ILE D 1 14  ? -10.621 16.212  20.812 1.00 168.24 ? 14   ILE D C   1 
ATOM   6464 O O   . ILE D 1 14  ? -10.179 17.127  21.502 1.00 169.11 ? 14   ILE D O   1 
ATOM   6465 C CB  . ILE D 1 14  ? -12.570 14.927  21.594 1.00 171.65 ? 14   ILE D CB  1 
ATOM   6466 C CG1 . ILE D 1 14  ? -13.914 14.332  21.163 1.00 171.29 ? 14   ILE D CG1 1 
ATOM   6467 C CG2 . ILE D 1 14  ? -12.593 15.451  23.027 1.00 174.96 ? 14   ILE D CG2 1 
ATOM   6468 C CD1 . ILE D 1 14  ? -14.915 15.350  20.663 1.00 168.34 ? 14   ILE D CD1 1 
ATOM   6469 N N   . LEU D 1 15  ? -9.846  15.318  20.207 1.00 101.16 ? 15   LEU D N   1 
ATOM   6470 C CA  . LEU D 1 15  ? -8.395  15.360  20.324 1.00 103.12 ? 15   LEU D CA  1 
ATOM   6471 C C   . LEU D 1 15  ? -7.737  15.656  18.987 1.00 99.84  ? 15   LEU D C   1 
ATOM   6472 O O   . LEU D 1 15  ? -8.132  15.113  17.955 1.00 97.67  ? 15   LEU D O   1 
ATOM   6473 C CB  . LEU D 1 15  ? -7.868  14.035  20.870 1.00 108.09 ? 15   LEU D CB  1 
ATOM   6474 C CG  . LEU D 1 15  ? -8.255  13.697  22.307 1.00 112.24 ? 15   LEU D CG  1 
ATOM   6475 C CD1 . LEU D 1 15  ? -8.016  12.222  22.597 1.00 116.65 ? 15   LEU D CD1 1 
ATOM   6476 C CD2 . LEU D 1 15  ? -7.480  14.576  23.272 1.00 114.56 ? 15   LEU D CD2 1 
ATOM   6477 N N   . ASN D 1 16  ? -6.727  16.518  19.015 1.00 119.30 ? 16   ASN D N   1 
ATOM   6478 C CA  . ASN D 1 16  ? -5.963  16.843  17.819 1.00 116.83 ? 16   ASN D CA  1 
ATOM   6479 C C   . ASN D 1 16  ? -4.882  15.806  17.559 1.00 119.96 ? 16   ASN D C   1 
ATOM   6480 O O   . ASN D 1 16  ? -4.575  14.986  18.423 1.00 124.34 ? 16   ASN D O   1 
ATOM   6481 C CB  . ASN D 1 16  ? -5.318  18.221  17.956 1.00 114.72 ? 16   ASN D CB  1 
ATOM   6482 C CG  . ASN D 1 16  ? -6.315  19.298  18.330 1.00 113.29 ? 16   ASN D CG  1 
ATOM   6483 O OD1 . ASN D 1 16  ? -7.463  19.280  17.888 1.00 110.37 ? 16   ASN D OD1 1 
ATOM   6484 N ND2 . ASN D 1 16  ? -5.877  20.249  19.147 1.00 114.95 ? 16   ASN D ND2 1 
ATOM   6485 N N   . SER D 1 17  ? -4.301  15.858  16.366 1.00 120.88 ? 17   SER D N   1 
ATOM   6486 C CA  . SER D 1 17  ? -3.250  14.929  15.985 1.00 122.25 ? 17   SER D CA  1 
ATOM   6487 C C   . SER D 1 17  ? -2.076  15.026  16.946 1.00 122.18 ? 17   SER D C   1 
ATOM   6488 O O   . SER D 1 17  ? -1.487  14.015  17.317 1.00 122.20 ? 17   SER D O   1 
ATOM   6489 C CB  . SER D 1 17  ? -2.784  15.218  14.560 1.00 115.88 ? 17   SER D CB  1 
ATOM   6490 O OG  . SER D 1 17  ? -3.893  15.438  13.708 1.00 111.37 ? 17   SER D OG  1 
ATOM   6491 N N   . ASP D 1 18  ? -1.742  16.245  17.353 1.00 150.77 ? 18   ASP D N   1 
ATOM   6492 C CA  . ASP D 1 18  ? -0.622  16.453  18.263 1.00 146.15 ? 18   ASP D CA  1 
ATOM   6493 C C   . ASP D 1 18  ? -0.907  15.871  19.648 1.00 150.67 ? 18   ASP D C   1 
ATOM   6494 O O   . ASP D 1 18  ? -0.038  15.865  20.521 1.00 147.98 ? 18   ASP D O   1 
ATOM   6495 C CB  . ASP D 1 18  ? -0.261  17.940  18.361 1.00 143.07 ? 18   ASP D CB  1 
ATOM   6496 C CG  . ASP D 1 18  ? -1.250  18.732  19.197 1.00 149.07 ? 18   ASP D CG  1 
ATOM   6497 O OD1 . ASP D 1 18  ? -2.425  18.845  18.789 1.00 152.47 ? 18   ASP D OD1 1 
ATOM   6498 O OD2 . ASP D 1 18  ? -0.846  19.255  20.258 1.00 148.41 ? 18   ASP D OD2 1 
ATOM   6499 N N   . GLY D 1 19  ? -2.127  15.379  19.840 1.00 61.30  ? 19   GLY D N   1 
ATOM   6500 C CA  . GLY D 1 19  ? -2.511  14.756  21.096 1.00 66.50  ? 19   GLY D CA  1 
ATOM   6501 C C   . GLY D 1 19  ? -3.118  15.705  22.117 1.00 70.98  ? 19   GLY D C   1 
ATOM   6502 O O   . GLY D 1 19  ? -3.566  15.279  23.183 1.00 75.81  ? 19   GLY D O   1 
ATOM   6503 N N   . SER D 1 20  ? -3.123  16.994  21.795 1.00 127.86 ? 20   SER D N   1 
ATOM   6504 C CA  . SER D 1 20  ? -3.693  18.006  22.675 1.00 130.71 ? 20   SER D CA  1 
ATOM   6505 C C   . SER D 1 20  ? -5.206  17.982  22.563 1.00 129.13 ? 20   SER D C   1 
ATOM   6506 O O   . SER D 1 20  ? -5.748  17.966  21.459 1.00 124.69 ? 20   SER D O   1 
ATOM   6507 C CB  . SER D 1 20  ? -3.178  19.393  22.290 1.00 127.00 ? 20   SER D CB  1 
ATOM   6508 O OG  . SER D 1 20  ? -3.549  19.715  20.960 1.00 122.84 ? 20   SER D OG  1 
ATOM   6509 N N   . SER D 1 21  ? -5.896  17.975  23.699 1.00 133.21 ? 21   SER D N   1 
ATOM   6510 C CA  . SER D 1 21  ? -7.352  17.976  23.662 1.00 130.66 ? 21   SER D CA  1 
ATOM   6511 C C   . SER D 1 21  ? -7.851  19.273  23.029 1.00 126.18 ? 21   SER D C   1 
ATOM   6512 O O   . SER D 1 21  ? -7.192  20.312  23.102 1.00 126.05 ? 21   SER D O   1 
ATOM   6513 C CB  . SER D 1 21  ? -7.953  17.763  25.052 1.00 134.59 ? 21   SER D CB  1 
ATOM   6514 O OG  . SER D 1 21  ? -7.957  18.968  25.791 1.00 134.27 ? 21   SER D OG  1 
ATOM   6515 N N   . ASN D 1 22  ? -9.018  19.195  22.405 1.00 137.14 ? 22   ASN D N   1 
ATOM   6516 C CA  . ASN D 1 22  ? -9.509  20.246  21.529 1.00 132.78 ? 22   ASN D CA  1 
ATOM   6517 C C   . ASN D 1 22  ? -10.783 20.864  22.078 1.00 133.19 ? 22   ASN D C   1 
ATOM   6518 O O   . ASN D 1 22  ? -11.847 20.760  21.468 1.00 131.04 ? 22   ASN D O   1 
ATOM   6519 C CB  . ASN D 1 22  ? -9.773  19.654  20.145 1.00 129.09 ? 22   ASN D CB  1 
ATOM   6520 C CG  . ASN D 1 22  ? -9.971  20.706  19.084 1.00 124.62 ? 22   ASN D CG  1 
ATOM   6521 O OD1 . ASN D 1 22  ? -9.609  21.867  19.266 1.00 124.17 ? 22   ASN D OD1 1 
ATOM   6522 N ND2 . ASN D 1 22  ? -10.542 20.302  17.956 1.00 121.57 ? 22   ASN D ND2 1 
ATOM   6523 N N   . ILE D 1 23  ? -10.668 21.507  23.234 1.00 117.66 ? 23   ILE D N   1 
ATOM   6524 C CA  . ILE D 1 23  ? -11.826 22.050  23.931 1.00 119.39 ? 23   ILE D CA  1 
ATOM   6525 C C   . ILE D 1 23  ? -11.645 23.535  24.239 1.00 119.80 ? 23   ILE D C   1 
ATOM   6526 O O   . ILE D 1 23  ? -10.521 24.012  24.385 1.00 120.26 ? 23   ILE D O   1 
ATOM   6527 C CB  . ILE D 1 23  ? -12.076 21.281  25.241 1.00 124.27 ? 23   ILE D CB  1 
ATOM   6528 C CG1 . ILE D 1 23  ? -12.137 19.774  24.973 1.00 124.36 ? 23   ILE D CG1 1 
ATOM   6529 C CG2 . ILE D 1 23  ? -13.347 21.748  25.896 1.00 125.24 ? 23   ILE D CG2 1 
ATOM   6530 C CD1 . ILE D 1 23  ? -13.268 19.356  24.062 1.00 121.66 ? 23   ILE D CD1 1 
ATOM   6531 N N   . THR D 1 24  ? -12.754 24.265  24.324 1.00 163.98 ? 24   THR D N   1 
ATOM   6532 C CA  . THR D 1 24  ? -12.725 25.672  24.710 1.00 165.25 ? 24   THR D CA  1 
ATOM   6533 C C   . THR D 1 24  ? -12.787 25.784  26.230 1.00 170.91 ? 24   THR D C   1 
ATOM   6534 O O   . THR D 1 24  ? -13.734 25.308  26.850 1.00 171.95 ? 24   THR D O   1 
ATOM   6535 C CB  . THR D 1 24  ? -13.924 26.441  24.121 1.00 164.00 ? 24   THR D CB  1 
ATOM   6536 O OG1 . THR D 1 24  ? -14.094 26.098  22.738 1.00 159.19 ? 24   THR D OG1 1 
ATOM   6537 C CG2 . THR D 1 24  ? -13.718 27.944  24.256 1.00 164.85 ? 24   THR D CG2 1 
ATOM   6538 N N   . ARG D 1 25  ? -11.783 26.409  26.834 1.00 140.27 ? 25   ARG D N   1 
ATOM   6539 C CA  . ARG D 1 25  ? -11.750 26.538  28.289 1.00 142.24 ? 25   ARG D CA  1 
ATOM   6540 C C   . ARG D 1 25  ? -12.431 27.827  28.758 1.00 144.64 ? 25   ARG D C   1 
ATOM   6541 O O   . ARG D 1 25  ? -12.196 28.901  28.205 1.00 145.31 ? 25   ARG D O   1 
ATOM   6542 C CB  . ARG D 1 25  ? -10.306 26.496  28.794 1.00 59.17  ? 25   ARG D CB  1 
ATOM   6543 N N   . LEU D 1 26  ? -13.277 27.711  29.778 1.00 160.23 ? 26   LEU D N   1 
ATOM   6544 C CA  . LEU D 1 26  ? -14.076 28.839  30.250 1.00 163.37 ? 26   LEU D CA  1 
ATOM   6545 C C   . LEU D 1 26  ? -13.743 29.216  31.691 1.00 165.72 ? 26   LEU D C   1 
ATOM   6546 O O   . LEU D 1 26  ? -14.205 28.568  32.631 1.00 166.62 ? 26   LEU D O   1 
ATOM   6547 C CB  . LEU D 1 26  ? -15.568 28.511  30.138 1.00 164.64 ? 26   LEU D CB  1 
ATOM   6548 C CG  . LEU D 1 26  ? -16.070 27.994  28.788 1.00 162.80 ? 26   LEU D CG  1 
ATOM   6549 C CD1 . LEU D 1 26  ? -17.577 27.797  28.820 1.00 165.29 ? 26   LEU D CD1 1 
ATOM   6550 C CD2 . LEU D 1 26  ? -15.680 28.942  27.668 1.00 162.48 ? 26   LEU D CD2 1 
ATOM   6551 N N   . GLY D 1 27  ? -12.952 30.272  31.863 1.00 140.91 ? 27   GLY D N   1 
ATOM   6552 C CA  . GLY D 1 27  ? -12.550 30.703  33.190 1.00 143.37 ? 27   GLY D CA  1 
ATOM   6553 C C   . GLY D 1 27  ? -12.692 32.195  33.410 1.00 146.96 ? 27   GLY D C   1 
ATOM   6554 O O   . GLY D 1 27  ? -11.850 32.816  34.061 1.00 148.59 ? 27   GLY D O   1 
ATOM   6555 N N   . TRP D 1 33  ? -1.826  37.026  38.173 1.00 150.68 ? 33   TRP D N   1 
ATOM   6556 C CA  . TRP D 1 33  ? -0.803  37.945  37.681 1.00 148.47 ? 33   TRP D CA  1 
ATOM   6557 C C   . TRP D 1 33  ? 0.601   37.529  38.125 1.00 145.54 ? 33   TRP D C   1 
ATOM   6558 O O   . TRP D 1 33  ? 1.491   37.351  37.295 1.00 136.97 ? 33   TRP D O   1 
ATOM   6559 C CB  . TRP D 1 33  ? -1.107  39.382  38.119 1.00 152.44 ? 33   TRP D CB  1 
ATOM   6560 N N   . LEU D 1 34  ? 0.797   37.376  39.433 1.00 165.89 ? 34   LEU D N   1 
ATOM   6561 C CA  . LEU D 1 34  ? 2.069   36.898  39.971 1.00 163.98 ? 34   LEU D CA  1 
ATOM   6562 C C   . LEU D 1 34  ? 1.903   35.492  40.535 1.00 168.10 ? 34   LEU D C   1 
ATOM   6563 O O   . LEU D 1 34  ? 2.852   34.893  41.043 1.00 167.78 ? 34   LEU D O   1 
ATOM   6564 C CB  . LEU D 1 34  ? 2.581   37.840  41.061 1.00 169.15 ? 34   LEU D CB  1 
ATOM   6565 C CG  . LEU D 1 34  ? 2.940   39.250  40.592 1.00 164.92 ? 34   LEU D CG  1 
ATOM   6566 C CD1 . LEU D 1 34  ? 3.316   40.138  41.770 1.00 171.58 ? 34   LEU D CD1 1 
ATOM   6567 C CD2 . LEU D 1 34  ? 4.066   39.197  39.573 1.00 154.31 ? 34   LEU D CD2 1 
ATOM   6568 N N   . ASP D 1 35  ? 0.683   34.976  40.426 1.00 212.55 ? 35   ASP D N   1 
ATOM   6569 C CA  . ASP D 1 35  ? 0.307   33.689  41.000 1.00 211.44 ? 35   ASP D CA  1 
ATOM   6570 C C   . ASP D 1 35  ? 1.242   32.542  40.602 1.00 211.83 ? 35   ASP D C   1 
ATOM   6571 O O   . ASP D 1 35  ? 1.748   31.817  41.459 1.00 214.71 ? 35   ASP D O   1 
ATOM   6572 C CB  . ASP D 1 35  ? -1.131  33.354  40.596 1.00 206.77 ? 35   ASP D CB  1 
ATOM   6573 C CG  . ASP D 1 35  ? -1.844  32.494  41.623 1.00 206.46 ? 35   ASP D CG  1 
ATOM   6574 O OD1 . ASP D 1 35  ? -1.284  32.281  42.719 1.00 209.95 ? 35   ASP D OD1 1 
ATOM   6575 O OD2 . ASP D 1 35  ? -2.971  32.037  41.337 1.00 203.11 ? 35   ASP D OD2 1 
ATOM   6576 N N   . ASP D 1 36  ? 1.467   32.383  39.302 1.00 151.74 ? 36   ASP D N   1 
ATOM   6577 C CA  . ASP D 1 36  ? 2.221   31.246  38.783 1.00 145.96 ? 36   ASP D CA  1 
ATOM   6578 C C   . ASP D 1 36  ? 3.586   31.682  38.255 1.00 137.54 ? 36   ASP D C   1 
ATOM   6579 O O   . ASP D 1 36  ? 3.932   31.406  37.110 1.00 129.52 ? 36   ASP D O   1 
ATOM   6580 C CB  . ASP D 1 36  ? 1.421   30.571  37.667 1.00 142.64 ? 36   ASP D CB  1 
ATOM   6581 C CG  . ASP D 1 36  ? 1.793   29.120  37.477 1.00 140.58 ? 36   ASP D CG  1 
ATOM   6582 O OD1 . ASP D 1 36  ? 2.861   28.711  37.973 1.00 139.49 ? 36   ASP D OD1 1 
ATOM   6583 O OD2 . ASP D 1 36  ? 1.012   28.388  36.832 1.00 140.44 ? 36   ASP D OD2 1 
ATOM   6584 N N   . HIS D 1 37  ? 4.363   32.353  39.098 1.00 130.35 ? 37   HIS D N   1 
ATOM   6585 C CA  . HIS D 1 37  ? 5.598   32.990  38.648 1.00 123.32 ? 37   HIS D CA  1 
ATOM   6586 C C   . HIS D 1 37  ? 6.567   32.043  37.931 1.00 116.12 ? 37   HIS D C   1 
ATOM   6587 O O   . HIS D 1 37  ? 7.037   32.347  36.832 1.00 107.97 ? 37   HIS D O   1 
ATOM   6588 C CB  . HIS D 1 37  ? 6.289   33.741  39.802 1.00 128.46 ? 37   HIS D CB  1 
ATOM   6589 C CG  . HIS D 1 37  ? 7.111   32.866  40.704 1.00 132.50 ? 37   HIS D CG  1 
ATOM   6590 N ND1 . HIS D 1 37  ? 6.580   31.802  41.397 1.00 139.09 ? 37   HIS D ND1 1 
ATOM   6591 C CD2 . HIS D 1 37  ? 8.421   32.919  41.038 1.00 131.54 ? 37   HIS D CD2 1 
ATOM   6592 C CE1 . HIS D 1 37  ? 7.530   31.225  42.111 1.00 142.01 ? 37   HIS D CE1 1 
ATOM   6593 N NE2 . HIS D 1 37  ? 8.660   31.883  41.911 1.00 137.65 ? 37   HIS D NE2 1 
ATOM   6594 N N   . TYR D 1 38  ? 6.848   30.893  38.536 1.00 114.96 ? 38   TYR D N   1 
ATOM   6595 C CA  . TYR D 1 38  ? 7.868   29.996  38.008 1.00 109.24 ? 38   TYR D CA  1 
ATOM   6596 C C   . TYR D 1 38  ? 7.463   29.385  36.676 1.00 102.50 ? 38   TYR D C   1 
ATOM   6597 O O   . TYR D 1 38  ? 8.242   29.379  35.723 1.00 94.75  ? 38   TYR D O   1 
ATOM   6598 C CB  . TYR D 1 38  ? 8.196   28.897  39.011 1.00 115.56 ? 38   TYR D CB  1 
ATOM   6599 C CG  . TYR D 1 38  ? 9.246   27.939  38.507 1.00 110.48 ? 38   TYR D CG  1 
ATOM   6600 C CD1 . TYR D 1 38  ? 10.514  28.388  38.170 1.00 105.27 ? 38   TYR D CD1 1 
ATOM   6601 C CD2 . TYR D 1 38  ? 8.970   26.589  38.363 1.00 111.27 ? 38   TYR D CD2 1 
ATOM   6602 C CE1 . TYR D 1 38  ? 11.480  27.519  37.705 1.00 101.05 ? 38   TYR D CE1 1 
ATOM   6603 C CE2 . TYR D 1 38  ? 9.926   25.713  37.900 1.00 106.88 ? 38   TYR D CE2 1 
ATOM   6604 C CZ  . TYR D 1 38  ? 11.180  26.184  37.573 1.00 101.80 ? 38   TYR D CZ  1 
ATOM   6605 O OH  . TYR D 1 38  ? 12.139  25.312  37.111 1.00 97.73  ? 38   TYR D OH  1 
ATOM   6606 N N   . HIS D 1 39  ? 6.244   28.862  36.619 1.00 101.15 ? 39   HIS D N   1 
ATOM   6607 C CA  . HIS D 1 39  ? 5.691   28.340  35.376 1.00 95.93  ? 39   HIS D CA  1 
ATOM   6608 C C   . HIS D 1 39  ? 5.782   29.398  34.285 1.00 89.15  ? 39   HIS D C   1 
ATOM   6609 O O   . HIS D 1 39  ? 6.358   29.174  33.220 1.00 81.77  ? 39   HIS D O   1 
ATOM   6610 C CB  . HIS D 1 39  ? 4.232   27.931  35.593 1.00 102.29 ? 39   HIS D CB  1 
ATOM   6611 C CG  . HIS D 1 39  ? 3.442   27.784  34.326 1.00 98.34  ? 39   HIS D CG  1 
ATOM   6612 N ND1 . HIS D 1 39  ? 2.967   28.864  33.619 1.00 95.98  ? 39   HIS D ND1 1 
ATOM   6613 C CD2 . HIS D 1 39  ? 3.033   26.680  33.658 1.00 97.05  ? 39   HIS D CD2 1 
ATOM   6614 C CE1 . HIS D 1 39  ? 2.307   28.434  32.557 1.00 93.60  ? 39   HIS D CE1 1 
ATOM   6615 N NE2 . HIS D 1 39  ? 2.331   27.113  32.556 1.00 94.11  ? 39   HIS D NE2 1 
ATOM   6616 N N   . ASP D 1 40  ? 5.217   30.563  34.574 1.00 137.97 ? 40   ASP D N   1 
ATOM   6617 C CA  . ASP D 1 40  ? 5.162   31.653  33.613 1.00 132.74 ? 40   ASP D CA  1 
ATOM   6618 C C   . ASP D 1 40  ? 6.534   31.993  33.042 1.00 125.17 ? 40   ASP D C   1 
ATOM   6619 O O   . ASP D 1 40  ? 6.667   32.236  31.846 1.00 118.81 ? 40   ASP D O   1 
ATOM   6620 C CB  . ASP D 1 40  ? 4.529   32.890  34.251 1.00 138.05 ? 40   ASP D CB  1 
ATOM   6621 C CG  . ASP D 1 40  ? 3.084   32.663  34.650 1.00 145.59 ? 40   ASP D CG  1 
ATOM   6622 O OD1 . ASP D 1 40  ? 2.517   31.620  34.259 1.00 145.99 ? 40   ASP D OD1 1 
ATOM   6623 O OD2 . ASP D 1 40  ? 2.516   33.525  35.354 1.00 151.41 ? 40   ASP D OD2 1 
ATOM   6624 N N   . LEU D 1 41  ? 7.552   32.006  33.896 1.00 83.30  ? 41   LEU D N   1 
ATOM   6625 C CA  . LEU D 1 41  ? 8.902   32.337  33.448 1.00 77.67  ? 41   LEU D CA  1 
ATOM   6626 C C   . LEU D 1 41  ? 9.455   31.303  32.472 1.00 76.82  ? 41   LEU D C   1 
ATOM   6627 O O   . LEU D 1 41  ? 10.174  31.647  31.537 1.00 76.92  ? 41   LEU D O   1 
ATOM   6628 C CB  . LEU D 1 41  ? 9.843   32.519  34.640 1.00 81.64  ? 41   LEU D CB  1 
ATOM   6629 C CG  . LEU D 1 41  ? 9.683   33.863  35.350 1.00 85.12  ? 41   LEU D CG  1 
ATOM   6630 C CD1 . LEU D 1 41  ? 10.386  33.866  36.696 1.00 91.53  ? 41   LEU D CD1 1 
ATOM   6631 C CD2 . LEU D 1 41  ? 10.198  34.980  34.461 1.00 82.83  ? 41   LEU D CD2 1 
ATOM   6632 N N   . LEU D 1 42  ? 9.111   30.038  32.686 1.00 106.20 ? 42   LEU D N   1 
ATOM   6633 C CA  . LEU D 1 42  ? 9.551   28.978  31.792 1.00 101.01 ? 42   LEU D CA  1 
ATOM   6634 C C   . LEU D 1 42  ? 8.659   28.892  30.560 1.00 97.62  ? 42   LEU D C   1 
ATOM   6635 O O   . LEU D 1 42  ? 9.042   28.305  29.551 1.00 92.22  ? 42   LEU D O   1 
ATOM   6636 C CB  . LEU D 1 42  ? 9.552   27.627  32.511 1.00 105.38 ? 42   LEU D CB  1 
ATOM   6637 C CG  . LEU D 1 42  ? 10.497  27.437  33.696 1.00 109.65 ? 42   LEU D CG  1 
ATOM   6638 C CD1 . LEU D 1 42  ? 10.521  25.976  34.121 1.00 112.94 ? 42   LEU D CD1 1 
ATOM   6639 C CD2 . LEU D 1 42  ? 11.889  27.912  33.333 1.00 104.40 ? 42   LEU D CD2 1 
ATOM   6640 N N   . THR D 1 43  ? 7.471   29.479  30.644 1.00 116.26 ? 43   THR D N   1 
ATOM   6641 C CA  . THR D 1 43  ? 6.461   29.316  29.603 1.00 114.89 ? 43   THR D CA  1 
ATOM   6642 C C   . THR D 1 43  ? 6.525   30.434  28.569 1.00 110.04 ? 43   THR D C   1 
ATOM   6643 O O   . THR D 1 43  ? 6.126   30.265  27.418 1.00 107.11 ? 43   THR D O   1 
ATOM   6644 C CB  . THR D 1 43  ? 5.053   29.274  30.224 1.00 122.48 ? 43   THR D CB  1 
ATOM   6645 O OG1 . THR D 1 43  ? 4.930   28.105  31.042 1.00 126.97 ? 43   THR D OG1 1 
ATOM   6646 C CG2 . THR D 1 43  ? 3.977   29.243  29.148 1.00 122.16 ? 43   THR D CG2 1 
ATOM   6647 N N   . VAL D 1 44  ? 7.037   31.577  28.996 1.00 115.79 ? 44   VAL D N   1 
ATOM   6648 C CA  . VAL D 1 44  ? 7.111   32.765  28.161 1.00 116.82 ? 44   VAL D CA  1 
ATOM   6649 C C   . VAL D 1 44  ? 8.021   32.570  26.945 1.00 119.00 ? 44   VAL D C   1 
ATOM   6650 O O   . VAL D 1 44  ? 8.920   31.733  26.970 1.00 120.33 ? 44   VAL D O   1 
ATOM   6651 C CB  . VAL D 1 44  ? 7.611   33.945  29.002 1.00 117.72 ? 44   VAL D CB  1 
ATOM   6652 C CG1 . VAL D 1 44  ? 8.188   35.016  28.127 1.00 119.55 ? 44   VAL D CG1 1 
ATOM   6653 C CG2 . VAL D 1 44  ? 6.484   34.482  29.870 1.00 115.80 ? 44   VAL D CG2 1 
ATOM   6654 N N   . SER D 1 45  ? 7.782   33.337  25.882 1.00 116.11 ? 45   SER D N   1 
ATOM   6655 C CA  . SER D 1 45  ? 8.632   33.290  24.689 1.00 118.44 ? 45   SER D CA  1 
ATOM   6656 C C   . SER D 1 45  ? 9.990   33.924  24.969 1.00 120.89 ? 45   SER D C   1 
ATOM   6657 O O   . SER D 1 45  ? 10.083  34.878  25.743 1.00 120.86 ? 45   SER D O   1 
ATOM   6658 C CB  . SER D 1 45  ? 7.965   34.016  23.517 1.00 118.52 ? 45   SER D CB  1 
ATOM   6659 O OG  . SER D 1 45  ? 8.109   35.423  23.633 1.00 119.05 ? 45   SER D OG  1 
ATOM   6660 N N   . TRP D 1 46  ? 11.041  33.405  24.340 1.00 87.78  ? 46   TRP D N   1 
ATOM   6661 C CA  . TRP D 1 46  ? 12.382  33.925  24.602 1.00 87.94  ? 46   TRP D CA  1 
ATOM   6662 C C   . TRP D 1 46  ? 12.448  35.452  24.535 1.00 88.54  ? 46   TRP D C   1 
ATOM   6663 O O   . TRP D 1 46  ? 12.947  36.089  25.465 1.00 89.34  ? 46   TRP D O   1 
ATOM   6664 C CB  . TRP D 1 46  ? 13.434  33.278  23.696 1.00 90.89  ? 46   TRP D CB  1 
ATOM   6665 C CG  . TRP D 1 46  ? 13.889  31.932  24.184 1.00 91.41  ? 46   TRP D CG  1 
ATOM   6666 C CD1 . TRP D 1 46  ? 13.614  30.724  23.618 1.00 91.07  ? 46   TRP D CD1 1 
ATOM   6667 C CD2 . TRP D 1 46  ? 14.688  31.656  25.346 1.00 92.63  ? 46   TRP D CD2 1 
ATOM   6668 N NE1 . TRP D 1 46  ? 14.193  29.715  24.349 1.00 91.84  ? 46   TRP D NE1 1 
ATOM   6669 C CE2 . TRP D 1 46  ? 14.856  30.261  25.414 1.00 92.82  ? 46   TRP D CE2 1 
ATOM   6670 C CE3 . TRP D 1 46  ? 15.274  32.457  26.331 1.00 93.80  ? 46   TRP D CE3 1 
ATOM   6671 C CZ2 . TRP D 1 46  ? 15.589  29.645  26.429 1.00 94.13  ? 46   TRP D CZ2 1 
ATOM   6672 C CZ3 . TRP D 1 46  ? 16.003  31.841  27.340 1.00 95.24  ? 46   TRP D CZ3 1 
ATOM   6673 C CH2 . TRP D 1 46  ? 16.153  30.450  27.379 1.00 95.22  ? 46   TRP D CH2 1 
ATOM   6674 N N   . PRO D 1 47  ? 11.938  36.045  23.441 1.00 106.79 ? 47   PRO D N   1 
ATOM   6675 C CA  . PRO D 1 47  ? 11.863  37.507  23.382 1.00 107.11 ? 47   PRO D CA  1 
ATOM   6676 C C   . PRO D 1 47  ? 11.388  38.079  24.712 1.00 105.50 ? 47   PRO D C   1 
ATOM   6677 O O   . PRO D 1 47  ? 12.116  38.835  25.362 1.00 107.04 ? 47   PRO D O   1 
ATOM   6678 C CB  . PRO D 1 47  ? 10.799  37.750  22.316 1.00 105.84 ? 47   PRO D CB  1 
ATOM   6679 C CG  . PRO D 1 47  ? 10.922  36.591  21.401 1.00 106.42 ? 47   PRO D CG  1 
ATOM   6680 C CD  . PRO D 1 47  ? 11.384  35.415  22.229 1.00 106.42 ? 47   PRO D CD  1 
ATOM   6681 N N   . VAL D 1 48  ? 10.176  37.706  25.112 1.00 87.43  ? 48   VAL D N   1 
ATOM   6682 C CA  . VAL D 1 48  ? 9.587   38.206  26.350 1.00 87.29  ? 48   VAL D CA  1 
ATOM   6683 C C   . VAL D 1 48  ? 10.466  37.934  27.574 1.00 88.40  ? 48   VAL D C   1 
ATOM   6684 O O   . VAL D 1 48  ? 10.727  38.840  28.373 1.00 89.23  ? 48   VAL D O   1 
ATOM   6685 C CB  . VAL D 1 48  ? 8.190   37.611  26.589 1.00 84.44  ? 48   VAL D CB  1 
ATOM   6686 C CG1 . VAL D 1 48  ? 7.639   38.072  27.937 1.00 84.75  ? 48   VAL D CG1 1 
ATOM   6687 C CG2 . VAL D 1 48  ? 7.249   37.984  25.461 1.00 83.71  ? 48   VAL D CG2 1 
ATOM   6688 N N   . PHE D 1 49  ? 10.915  36.689  27.718 1.00 88.18  ? 49   PHE D N   1 
ATOM   6689 C CA  . PHE D 1 49  ? 11.780  36.308  28.832 1.00 89.58  ? 49   PHE D CA  1 
ATOM   6690 C C   . PHE D 1 49  ? 12.976  37.245  28.945 1.00 92.85  ? 49   PHE D C   1 
ATOM   6691 O O   . PHE D 1 49  ? 13.268  37.765  30.025 1.00 93.76  ? 49   PHE D O   1 
ATOM   6692 C CB  . PHE D 1 49  ? 12.249  34.863  28.675 1.00 90.05  ? 49   PHE D CB  1 
ATOM   6693 C CG  . PHE D 1 49  ? 13.291  34.441  29.676 1.00 92.18  ? 49   PHE D CG  1 
ATOM   6694 C CD1 . PHE D 1 49  ? 12.947  34.179  30.992 1.00 91.00  ? 49   PHE D CD1 1 
ATOM   6695 C CD2 . PHE D 1 49  ? 14.610  34.282  29.292 1.00 91.13  ? 49   PHE D CD2 1 
ATOM   6696 C CE1 . PHE D 1 49  ? 13.902  33.780  31.907 1.00 93.24  ? 49   PHE D CE1 1 
ATOM   6697 C CE2 . PHE D 1 49  ? 15.568  33.882  30.202 1.00 93.50  ? 49   PHE D CE2 1 
ATOM   6698 C CZ  . PHE D 1 49  ? 15.214  33.630  31.511 1.00 92.29  ? 49   PHE D CZ  1 
ATOM   6699 N N   . ILE D 1 50  ? 13.658  37.464  27.826 1.00 91.43  ? 50   ILE D N   1 
ATOM   6700 C CA  . ILE D 1 50  ? 14.808  38.363  27.788 1.00 94.86  ? 50   ILE D CA  1 
ATOM   6701 C C   . ILE D 1 50  ? 14.413  39.784  28.188 1.00 94.55  ? 50   ILE D C   1 
ATOM   6702 O O   . ILE D 1 50  ? 15.120  40.442  28.956 1.00 96.80  ? 50   ILE D O   1 
ATOM   6703 C CB  . ILE D 1 50  ? 15.454  38.391  26.397 1.00 94.46  ? 50   ILE D CB  1 
ATOM   6704 C CG1 . ILE D 1 50  ? 15.719  36.966  25.908 1.00 94.77  ? 50   ILE D CG1 1 
ATOM   6705 C CG2 . ILE D 1 50  ? 16.742  39.181  26.436 1.00 98.43  ? 50   ILE D CG2 1 
ATOM   6706 C CD1 . ILE D 1 50  ? 16.217  36.894  24.482 1.00 96.70  ? 50   ILE D CD1 1 
ATOM   6707 N N   . THR D 1 51  ? 13.281  40.244  27.662 1.00 96.89  ? 51   THR D N   1 
ATOM   6708 C CA  . THR D 1 51  ? 12.728  41.547  28.015 1.00 96.32  ? 51   THR D CA  1 
ATOM   6709 C C   . THR D 1 51  ? 12.561  41.688  29.517 1.00 96.00  ? 51   THR D C   1 
ATOM   6710 O O   . THR D 1 51  ? 13.077  42.627  30.119 1.00 97.99  ? 51   THR D O   1 
ATOM   6711 C CB  . THR D 1 51  ? 11.353  41.752  27.378 1.00 93.47  ? 51   THR D CB  1 
ATOM   6712 O OG1 . THR D 1 51  ? 11.478  41.698  25.953 1.00 94.03  ? 51   THR D OG1 1 
ATOM   6713 C CG2 . THR D 1 51  ? 10.771  43.096  27.784 1.00 93.12  ? 51   THR D CG2 1 
ATOM   6714 N N   . LEU D 1 52  ? 11.819  40.752  30.102 1.00 132.24 ? 52   LEU D N   1 
ATOM   6715 C CA  . LEU D 1 52  ? 11.576  40.710  31.540 1.00 131.80 ? 52   LEU D CA  1 
ATOM   6716 C C   . LEU D 1 52  ? 12.858  40.855  32.326 1.00 135.12 ? 52   LEU D C   1 
ATOM   6717 O O   . LEU D 1 52  ? 12.965  41.687  33.228 1.00 136.38 ? 52   LEU D O   1 
ATOM   6718 C CB  . LEU D 1 52  ? 10.941  39.379  31.918 1.00 129.48 ? 52   LEU D CB  1 
ATOM   6719 C CG  . LEU D 1 52  ? 9.450   39.261  31.652 1.00 126.24 ? 52   LEU D CG  1 
ATOM   6720 C CD1 . LEU D 1 52  ? 8.945   37.941  32.191 1.00 124.36 ? 52   LEU D CD1 1 
ATOM   6721 C CD2 . LEU D 1 52  ? 8.734   40.426  32.308 1.00 125.78 ? 52   LEU D CD2 1 
ATOM   6722 N N   . ILE D 1 53  ? 13.819  40.006  31.994 1.00 94.87  ? 53   ILE D N   1 
ATOM   6723 C CA  . ILE D 1 53  ? 15.130  40.061  32.607 1.00 98.66  ? 53   ILE D CA  1 
ATOM   6724 C C   . ILE D 1 53  ? 15.729  41.455  32.449 1.00 101.37 ? 53   ILE D C   1 
ATOM   6725 O O   . ILE D 1 53  ? 16.088  42.102  33.434 1.00 103.31 ? 53   ILE D O   1 
ATOM   6726 C CB  . ILE D 1 53  ? 16.053  39.004  31.993 1.00 100.37 ? 53   ILE D CB  1 
ATOM   6727 C CG1 . ILE D 1 53  ? 15.668  37.622  32.525 1.00 98.47  ? 53   ILE D CG1 1 
ATOM   6728 C CG2 . ILE D 1 53  ? 17.508  39.324  32.289 1.00 105.12 ? 53   ILE D CG2 1 
ATOM   6729 C CD1 . ILE D 1 53  ? 16.611  36.527  32.112 1.00 100.50 ? 53   ILE D CD1 1 
ATOM   6730 N N   . THR D 1 54  ? 15.818  41.918  31.206 1.00 98.00  ? 54   THR D N   1 
ATOM   6731 C CA  . THR D 1 54  ? 16.284  43.271  30.926 1.00 100.26 ? 54   THR D CA  1 
ATOM   6732 C C   . THR D 1 54  ? 15.578  44.297  31.812 1.00 99.39  ? 54   THR D C   1 
ATOM   6733 O O   . THR D 1 54  ? 16.222  45.016  32.573 1.00 102.24 ? 54   THR D O   1 
ATOM   6734 C CB  . THR D 1 54  ? 16.047  43.651  29.459 1.00 99.44  ? 54   THR D CB  1 
ATOM   6735 O OG1 . THR D 1 54  ? 16.491  42.586  28.609 1.00 97.95  ? 54   THR D OG1 1 
ATOM   6736 C CG2 . THR D 1 54  ? 16.800  44.923  29.116 1.00 100.72 ? 54   THR D CG2 1 
ATOM   6737 N N   . GLY D 1 55  ? 14.254  44.365  31.703 1.00 171.41 ? 55   GLY D N   1 
ATOM   6738 C CA  . GLY D 1 55  ? 13.469  45.255  32.538 1.00 170.55 ? 55   GLY D CA  1 
ATOM   6739 C C   . GLY D 1 55  ? 13.939  45.204  33.979 1.00 172.56 ? 55   GLY D C   1 
ATOM   6740 O O   . GLY D 1 55  ? 14.372  46.211  34.537 1.00 175.09 ? 55   GLY D O   1 
ATOM   6741 N N   . LEU D 1 56  ? 13.862  44.019  34.575 1.00 108.96 ? 56   LEU D N   1 
ATOM   6742 C CA  . LEU D 1 56  ? 14.321  43.809  35.941 1.00 110.84 ? 56   LEU D CA  1 
ATOM   6743 C C   . LEU D 1 56  ? 15.713  44.403  36.156 1.00 115.62 ? 56   LEU D C   1 
ATOM   6744 O O   . LEU D 1 56  ? 15.956  45.122  37.125 1.00 117.93 ? 56   LEU D O   1 
ATOM   6745 C CB  . LEU D 1 56  ? 14.327  42.315  36.257 1.00 109.58 ? 56   LEU D CB  1 
ATOM   6746 C CG  . LEU D 1 56  ? 14.797  41.916  37.654 1.00 111.61 ? 56   LEU D CG  1 
ATOM   6747 C CD1 . LEU D 1 56  ? 14.328  42.927  38.688 1.00 112.32 ? 56   LEU D CD1 1 
ATOM   6748 C CD2 . LEU D 1 56  ? 14.313  40.514  38.000 1.00 109.06 ? 56   LEU D CD2 1 
ATOM   6749 N N   . TYR D 1 57  ? 16.614  44.095  35.232 1.00 109.88 ? 57   TYR D N   1 
ATOM   6750 C CA  . TYR D 1 57  ? 17.988  44.581  35.245 1.00 114.74 ? 57   TYR D CA  1 
ATOM   6751 C C   . TYR D 1 57  ? 18.059  46.107  35.331 1.00 116.59 ? 57   TYR D C   1 
ATOM   6752 O O   . TYR D 1 57  ? 18.584  46.664  36.299 1.00 119.85 ? 57   TYR D O   1 
ATOM   6753 C CB  . TYR D 1 57  ? 18.675  44.077  33.977 1.00 115.54 ? 57   TYR D CB  1 
ATOM   6754 C CG  . TYR D 1 57  ? 20.102  44.512  33.776 1.00 120.74 ? 57   TYR D CG  1 
ATOM   6755 C CD1 . TYR D 1 57  ? 21.041  44.382  34.786 1.00 124.84 ? 57   TYR D CD1 1 
ATOM   6756 C CD2 . TYR D 1 57  ? 20.518  45.014  32.553 1.00 121.82 ? 57   TYR D CD2 1 
ATOM   6757 C CE1 . TYR D 1 57  ? 22.349  44.766  34.590 1.00 130.02 ? 57   TYR D CE1 1 
ATOM   6758 C CE2 . TYR D 1 57  ? 21.822  45.400  32.347 1.00 126.79 ? 57   TYR D CE2 1 
ATOM   6759 C CZ  . TYR D 1 57  ? 22.734  45.275  33.368 1.00 130.94 ? 57   TYR D CZ  1 
ATOM   6760 O OH  . TYR D 1 57  ? 24.038  45.660  33.163 1.00 136.32 ? 57   TYR D OH  1 
ATOM   6761 N N   . LEU D 1 58  ? 17.528  46.775  34.312 1.00 106.50 ? 58   LEU D N   1 
ATOM   6762 C CA  . LEU D 1 58  ? 17.496  48.230  34.278 1.00 107.83 ? 58   LEU D CA  1 
ATOM   6763 C C   . LEU D 1 58  ? 16.843  48.761  35.543 1.00 107.52 ? 58   LEU D C   1 
ATOM   6764 O O   . LEU D 1 58  ? 17.454  49.514  36.300 1.00 109.01 ? 58   LEU D O   1 
ATOM   6765 C CB  . LEU D 1 58  ? 16.740  48.718  33.044 1.00 105.06 ? 58   LEU D CB  1 
ATOM   6766 C CG  . LEU D 1 58  ? 17.270  48.129  31.737 1.00 105.15 ? 58   LEU D CG  1 
ATOM   6767 C CD1 . LEU D 1 58  ? 16.727  48.884  30.545 1.00 103.75 ? 58   LEU D CD1 1 
ATOM   6768 C CD2 . LEU D 1 58  ? 18.786  48.155  31.730 1.00 107.58 ? 58   LEU D CD2 1 
ATOM   6769 N N   . VAL D 1 59  ? 15.600  48.350  35.768 1.00 111.80 ? 59   VAL D N   1 
ATOM   6770 C CA  . VAL D 1 59  ? 14.869  48.734  36.968 1.00 111.34 ? 59   VAL D CA  1 
ATOM   6771 C C   . VAL D 1 59  ? 15.767  48.768  38.204 1.00 107.31 ? 59   VAL D C   1 
ATOM   6772 O O   . VAL D 1 59  ? 16.016  49.835  38.762 1.00 110.17 ? 59   VAL D O   1 
ATOM   6773 C CB  . VAL D 1 59  ? 13.672  47.798  37.227 1.00 107.18 ? 59   VAL D CB  1 
ATOM   6774 C CG1 . VAL D 1 59  ? 13.052  48.085  38.586 1.00 107.25 ? 59   VAL D CG1 1 
ATOM   6775 C CG2 . VAL D 1 59  ? 12.640  47.948  36.122 1.00 103.70 ? 59   VAL D CG2 1 
ATOM   6776 N N   . THR D 1 60  ? 16.265  47.609  38.624 1.00 123.54 ? 60   THR D N   1 
ATOM   6777 C CA  . THR D 1 60  ? 17.035  47.533  39.868 1.00 127.43 ? 60   THR D CA  1 
ATOM   6778 C C   . THR D 1 60  ? 18.218  48.509  39.914 1.00 132.70 ? 60   THR D C   1 
ATOM   6779 O O   . THR D 1 60  ? 18.494  49.104  40.960 1.00 135.89 ? 60   THR D O   1 
ATOM   6780 C CB  . THR D 1 60  ? 17.539  46.103  40.172 1.00 127.67 ? 60   THR D CB  1 
ATOM   6781 O OG1 . THR D 1 60  ? 18.681  45.810  39.360 1.00 130.32 ? 60   THR D OG1 1 
ATOM   6782 C CG2 . THR D 1 60  ? 16.445  45.080  39.919 1.00 122.56 ? 60   THR D CG2 1 
ATOM   6783 N N   . ASN D 1 61  ? 18.917  48.671  38.793 1.00 112.08 ? 61   ASN D N   1 
ATOM   6784 C CA  . ASN D 1 61  ? 20.007  49.642  38.723 1.00 115.52 ? 61   ASN D CA  1 
ATOM   6785 C C   . ASN D 1 61  ? 19.531  51.064  38.980 1.00 116.03 ? 61   ASN D C   1 
ATOM   6786 O O   . ASN D 1 61  ? 20.180  51.829  39.691 1.00 120.47 ? 61   ASN D O   1 
ATOM   6787 C CB  . ASN D 1 61  ? 20.707  49.579  37.371 1.00 116.31 ? 61   ASN D CB  1 
ATOM   6788 C CG  . ASN D 1 61  ? 21.770  48.513  37.319 1.00 112.84 ? 61   ASN D CG  1 
ATOM   6789 O OD1 . ASN D 1 61  ? 22.742  48.546  38.075 1.00 117.64 ? 61   ASN D OD1 1 
ATOM   6790 N ND2 . ASN D 1 61  ? 21.597  47.560  36.418 1.00 116.21 ? 61   ASN D ND2 1 
ATOM   6791 N N   . ALA D 1 62  ? 18.400  51.415  38.380 1.00 121.05 ? 62   ALA D N   1 
ATOM   6792 C CA  . ALA D 1 62  ? 17.781  52.704  38.629 1.00 121.07 ? 62   ALA D CA  1 
ATOM   6793 C C   . ALA D 1 62  ? 17.535  52.854  40.124 1.00 122.66 ? 62   ALA D C   1 
ATOM   6794 O O   . ALA D 1 62  ? 17.928  53.849  40.730 1.00 126.41 ? 62   ALA D O   1 
ATOM   6795 C CB  . ALA D 1 62  ? 16.482  52.819  37.862 1.00 116.08 ? 62   ALA D CB  1 
ATOM   6796 N N   . LEU D 1 63  ? 16.889  51.854  40.716 1.00 113.89 ? 63   LEU D N   1 
ATOM   6797 C CA  . LEU D 1 63  ? 16.651  51.849  42.155 1.00 115.34 ? 63   LEU D CA  1 
ATOM   6798 C C   . LEU D 1 63  ? 17.943  52.122  42.910 1.00 121.33 ? 63   LEU D C   1 
ATOM   6799 O O   . LEU D 1 63  ? 18.007  53.017  43.751 1.00 124.51 ? 63   LEU D O   1 
ATOM   6800 C CB  . LEU D 1 63  ? 16.058  50.512  42.603 1.00 112.17 ? 63   LEU D CB  1 
ATOM   6801 C CG  . LEU D 1 63  ? 14.592  50.257  42.257 1.00 112.86 ? 63   LEU D CG  1 
ATOM   6802 C CD1 . LEU D 1 63  ? 14.214  48.829  42.614 1.00 110.21 ? 63   LEU D CD1 1 
ATOM   6803 C CD2 . LEU D 1 63  ? 13.695  51.255  42.971 1.00 112.90 ? 63   LEU D CD2 1 
ATOM   6804 N N   . PHE D 1 64  ? 18.974  51.344  42.601 1.00 125.36 ? 64   PHE D N   1 
ATOM   6805 C CA  . PHE D 1 64  ? 20.267  51.526  43.244 1.00 131.55 ? 64   PHE D CA  1 
ATOM   6806 C C   . PHE D 1 64  ? 20.824  52.933  43.032 1.00 135.41 ? 64   PHE D C   1 
ATOM   6807 O O   . PHE D 1 64  ? 21.268  53.573  43.985 1.00 139.89 ? 64   PHE D O   1 
ATOM   6808 C CB  . PHE D 1 64  ? 21.267  50.460  42.793 1.00 133.03 ? 64   PHE D CB  1 
ATOM   6809 C CG  . PHE D 1 64  ? 21.405  49.320  43.760 1.00 133.69 ? 64   PHE D CG  1 
ATOM   6810 C CD1 . PHE D 1 64  ? 20.638  48.176  43.624 1.00 128.82 ? 64   PHE D CD1 1 
ATOM   6811 C CD2 . PHE D 1 64  ? 22.294  49.402  44.818 1.00 139.40 ? 64   PHE D CD2 1 
ATOM   6812 C CE1 . PHE D 1 64  ? 20.766  47.131  44.523 1.00 129.44 ? 64   PHE D CE1 1 
ATOM   6813 C CE2 . PHE D 1 64  ? 22.425  48.361  45.719 1.00 140.19 ? 64   PHE D CE2 1 
ATOM   6814 C CZ  . PHE D 1 64  ? 21.662  47.225  45.571 1.00 135.09 ? 64   PHE D CZ  1 
ATOM   6815 N N   . ALA D 1 65  ? 20.793  53.412  41.792 1.00 123.30 ? 65   ALA D N   1 
ATOM   6816 C CA  . ALA D 1 65  ? 21.210  54.780  41.499 1.00 126.42 ? 65   ALA D CA  1 
ATOM   6817 C C   . ALA D 1 65  ? 20.577  55.752  42.490 1.00 127.41 ? 65   ALA D C   1 
ATOM   6818 O O   . ALA D 1 65  ? 21.275  56.529  43.138 1.00 132.68 ? 65   ALA D O   1 
ATOM   6819 C CB  . ALA D 1 65  ? 20.845  55.159  40.074 1.00 123.11 ? 65   ALA D CB  1 
ATOM   6820 N N   . LEU D 1 66  ? 19.253  55.698  42.605 1.00 170.39 ? 66   LEU D N   1 
ATOM   6821 C CA  . LEU D 1 66  ? 18.530  56.534  43.559 1.00 171.09 ? 66   LEU D CA  1 
ATOM   6822 C C   . LEU D 1 66  ? 19.111  56.414  44.958 1.00 175.81 ? 66   LEU D C   1 
ATOM   6823 O O   . LEU D 1 66  ? 19.327  57.417  45.635 1.00 179.86 ? 66   LEU D O   1 
ATOM   6824 C CB  . LEU D 1 66  ? 17.046  56.171  43.583 1.00 165.49 ? 66   LEU D CB  1 
ATOM   6825 C CG  . LEU D 1 66  ? 16.160  56.924  42.593 1.00 162.06 ? 66   LEU D CG  1 
ATOM   6826 C CD1 . LEU D 1 66  ? 16.789  56.926  41.214 1.00 161.59 ? 66   LEU D CD1 1 
ATOM   6827 C CD2 . LEU D 1 66  ? 14.765  56.322  42.557 1.00 156.72 ? 66   LEU D CD2 1 
ATOM   6828 N N   . ALA D 1 67  ? 19.352  55.181  45.391 1.00 160.72 ? 67   ALA D N   1 
ATOM   6829 C CA  . ALA D 1 67  ? 19.983  54.942  46.679 1.00 165.52 ? 67   ALA D CA  1 
ATOM   6830 C C   . ALA D 1 67  ? 21.255  55.771  46.797 1.00 172.23 ? 67   ALA D C   1 
ATOM   6831 O O   . ALA D 1 67  ? 21.496  56.411  47.820 1.00 176.80 ? 67   ALA D O   1 
ATOM   6832 C CB  . ALA D 1 67  ? 20.290  53.469  46.850 1.00 164.55 ? 67   ALA D CB  1 
ATOM   6833 N N   . TYR D 1 68  ? 22.061  55.769  45.740 1.00 146.85 ? 68   TYR D N   1 
ATOM   6834 C CA  . TYR D 1 68  ? 23.294  56.549  45.727 1.00 153.34 ? 68   TYR D CA  1 
ATOM   6835 C C   . TYR D 1 68  ? 23.031  58.045  45.840 1.00 155.08 ? 68   TYR D C   1 
ATOM   6836 O O   . TYR D 1 68  ? 23.474  58.694  46.786 1.00 160.32 ? 68   TYR D O   1 
ATOM   6837 C CB  . TYR D 1 68  ? 24.130  56.226  44.489 1.00 153.62 ? 68   TYR D CB  1 
ATOM   6838 C CG  . TYR D 1 68  ? 24.834  54.903  44.615 1.00 154.78 ? 68   TYR D CG  1 
ATOM   6839 C CD1 . TYR D 1 68  ? 24.554  53.858  43.750 1.00 150.00 ? 68   TYR D CD1 1 
ATOM   6840 C CD2 . TYR D 1 68  ? 25.754  54.688  45.630 1.00 160.87 ? 68   TYR D CD2 1 
ATOM   6841 C CE1 . TYR D 1 68  ? 25.188  52.648  43.877 1.00 151.20 ? 68   TYR D CE1 1 
ATOM   6842 C CE2 . TYR D 1 68  ? 26.393  53.479  45.767 1.00 162.17 ? 68   TYR D CE2 1 
ATOM   6843 C CZ  . TYR D 1 68  ? 26.107  52.463  44.888 1.00 157.27 ? 68   TYR D CZ  1 
ATOM   6844 O OH  . TYR D 1 68  ? 26.743  51.254  45.021 1.00 158.75 ? 68   TYR D OH  1 
ATOM   6845 N N   . LEU D 1 69  ? 22.287  58.583  44.885 1.00 147.32 ? 69   LEU D N   1 
ATOM   6846 C CA  . LEU D 1 69  ? 21.888  59.975  44.943 1.00 148.64 ? 69   LEU D CA  1 
ATOM   6847 C C   . LEU D 1 69  ? 21.348  60.307  46.318 1.00 150.48 ? 69   LEU D C   1 
ATOM   6848 O O   . LEU D 1 69  ? 21.698  61.327  46.904 1.00 155.37 ? 69   LEU D O   1 
ATOM   6849 C CB  . LEU D 1 69  ? 20.812  60.247  43.904 1.00 142.57 ? 69   LEU D CB  1 
ATOM   6850 C CG  . LEU D 1 69  ? 21.332  60.115  42.481 1.00 141.21 ? 69   LEU D CG  1 
ATOM   6851 C CD1 . LEU D 1 69  ? 20.324  60.668  41.499 1.00 136.42 ? 69   LEU D CD1 1 
ATOM   6852 C CD2 . LEU D 1 69  ? 22.645  60.857  42.378 1.00 147.39 ? 69   LEU D CD2 1 
ATOM   6853 N N   . ALA D 1 70  ? 20.482  59.439  46.826 1.00 143.70 ? 70   ALA D N   1 
ATOM   6854 C CA  . ALA D 1 70  ? 19.852  59.659  48.118 1.00 144.73 ? 70   ALA D CA  1 
ATOM   6855 C C   . ALA D 1 70  ? 20.882  60.065  49.158 1.00 152.21 ? 70   ALA D C   1 
ATOM   6856 O O   . ALA D 1 70  ? 20.642  60.965  49.956 1.00 155.26 ? 70   ALA D O   1 
ATOM   6857 C CB  . ALA D 1 70  ? 19.120  58.420  48.561 1.00 140.62 ? 70   ALA D CB  1 
ATOM   6858 N N   . CYS D 1 71  ? 22.029  59.395  49.149 1.00 169.58 ? 71   CYS D N   1 
ATOM   6859 C CA  . CYS D 1 71  ? 23.134  59.772  50.020 1.00 177.36 ? 71   CYS D CA  1 
ATOM   6860 C C   . CYS D 1 71  ? 23.685  61.131  49.604 1.00 181.34 ? 71   CYS D C   1 
ATOM   6861 O O   . CYS D 1 71  ? 24.043  61.953  50.441 1.00 187.13 ? 71   CYS D O   1 
ATOM   6862 C CB  . CYS D 1 71  ? 24.234  58.711  49.983 1.00 180.01 ? 71   CYS D CB  1 
ATOM   6863 S SG  . CYS D 1 71  ? 23.720  57.092  50.592 1.00 176.17 ? 71   CYS D SG  1 
ATOM   6864 N N   . GLY D 1 72  ? 23.755  61.353  48.298 1.00 177.16 ? 72   GLY D N   1 
ATOM   6865 C CA  . GLY D 1 72  ? 24.133  62.645  47.763 1.00 177.97 ? 72   GLY D CA  1 
ATOM   6866 C C   . GLY D 1 72  ? 25.612  62.769  47.469 1.00 174.35 ? 72   GLY D C   1 
ATOM   6867 O O   . GLY D 1 72  ? 26.431  62.803  48.382 1.00 168.44 ? 72   GLY D O   1 
ATOM   6868 N N   . ASP D 1 73  ? 25.953  62.826  46.187 1.00 188.73 ? 73   ASP D N   1 
ATOM   6869 C CA  . ASP D 1 73  ? 27.319  63.122  45.766 1.00 185.89 ? 73   ASP D CA  1 
ATOM   6870 C C   . ASP D 1 73  ? 28.350  62.203  46.404 1.00 180.43 ? 73   ASP D C   1 
ATOM   6871 O O   . ASP D 1 73  ? 29.362  62.667  46.922 1.00 175.38 ? 73   ASP D O   1 
ATOM   6872 C CB  . ASP D 1 73  ? 27.670  64.569  46.112 1.00 183.43 ? 73   ASP D CB  1 
ATOM   6873 C CG  . ASP D 1 73  ? 26.806  65.571  45.382 1.00 188.64 ? 73   ASP D CG  1 
ATOM   6874 O OD1 . ASP D 1 73  ? 26.003  65.155  44.524 1.00 194.27 ? 73   ASP D OD1 1 
ATOM   6875 O OD2 . ASP D 1 73  ? 26.934  66.778  45.667 1.00 187.12 ? 73   ASP D OD2 1 
ATOM   6876 N N   . VAL D 1 74  ? 28.099  60.902  46.368 1.00 155.94 ? 74   VAL D N   1 
ATOM   6877 C CA  . VAL D 1 74  ? 29.014  59.954  46.988 1.00 150.82 ? 74   VAL D CA  1 
ATOM   6878 C C   . VAL D 1 74  ? 29.818  59.160  45.974 1.00 152.21 ? 74   VAL D C   1 
ATOM   6879 O O   . VAL D 1 74  ? 30.434  58.156  46.316 1.00 149.08 ? 74   VAL D O   1 
ATOM   6880 C CB  . VAL D 1 74  ? 28.280  58.981  47.926 1.00 149.51 ? 74   VAL D CB  1 
ATOM   6881 C CG1 . VAL D 1 74  ? 28.389  59.451  49.362 1.00 147.06 ? 74   VAL D CG1 1 
ATOM   6882 C CG2 . VAL D 1 74  ? 26.832  58.839  47.516 1.00 155.54 ? 74   VAL D CG2 1 
ATOM   6883 N N   . ILE D 1 75  ? 29.817  59.610  44.728 1.00 163.26 ? 75   ILE D N   1 
ATOM   6884 C CA  . ILE D 1 75  ? 30.586  58.925  43.703 1.00 164.86 ? 75   ILE D CA  1 
ATOM   6885 C C   . ILE D 1 75  ? 31.586  59.833  43.013 1.00 164.22 ? 75   ILE D C   1 
ATOM   6886 O O   . ILE D 1 75  ? 31.231  60.861  42.441 1.00 167.20 ? 75   ILE D O   1 
ATOM   6887 C CB  . ILE D 1 75  ? 29.684  58.259  42.661 1.00 171.71 ? 75   ILE D CB  1 
ATOM   6888 C CG1 . ILE D 1 75  ? 28.904  57.119  43.309 1.00 171.84 ? 75   ILE D CG1 1 
ATOM   6889 C CG2 . ILE D 1 75  ? 30.514  57.729  41.504 1.00 173.75 ? 75   ILE D CG2 1 
ATOM   6890 C CD1 . ILE D 1 75  ? 27.686  56.722  42.531 1.00 178.72 ? 75   ILE D CD1 1 
ATOM   6891 N N   . GLU D 1 76  ? 32.846  59.431  43.082 1.00 188.70 ? 76   GLU D N   1 
ATOM   6892 C CA  . GLU D 1 76  ? 33.920  60.134  42.411 1.00 187.79 ? 76   GLU D CA  1 
ATOM   6893 C C   . GLU D 1 76  ? 33.544  60.435  40.968 1.00 194.21 ? 76   GLU D C   1 
ATOM   6894 O O   . GLU D 1 76  ? 32.914  59.619  40.297 1.00 198.90 ? 76   GLU D O   1 
ATOM   6895 C CB  . GLU D 1 76  ? 35.189  59.282  42.439 1.00 184.12 ? 76   GLU D CB  1 
ATOM   6896 C CG  . GLU D 1 76  ? 36.455  60.074  42.224 1.00 180.93 ? 76   GLU D CG  1 
ATOM   6897 C CD  . GLU D 1 76  ? 36.628  61.157  43.268 1.00 176.29 ? 76   GLU D CD  1 
ATOM   6898 O OE1 . GLU D 1 76  ? 36.533  60.838  44.472 1.00 172.24 ? 76   GLU D OE1 1 
ATOM   6899 O OE2 . GLU D 1 76  ? 36.853  62.326  42.887 1.00 176.71 ? 76   GLU D OE2 1 
ATOM   6900 N N   . ASN D 1 77  ? 33.926  61.616  40.500 1.00 143.03 ? 77   ASN D N   1 
ATOM   6901 C CA  . ASN D 1 77  ? 33.784  61.972  39.093 1.00 143.34 ? 77   ASN D CA  1 
ATOM   6902 C C   . ASN D 1 77  ? 32.372  61.839  38.539 1.00 149.75 ? 77   ASN D C   1 
ATOM   6903 O O   . ASN D 1 77  ? 32.183  61.595  37.347 1.00 145.73 ? 77   ASN D O   1 
ATOM   6904 C CB  . ASN D 1 77  ? 34.756  61.152  38.248 1.00 143.83 ? 77   ASN D CB  1 
ATOM   6905 C CG  . ASN D 1 77  ? 36.189  61.594  38.427 1.00 138.67 ? 77   ASN D CG  1 
ATOM   6906 O OD1 . ASN D 1 77  ? 36.579  62.669  37.972 1.00 138.61 ? 77   ASN D OD1 1 
ATOM   6907 N ND2 . ASN D 1 77  ? 36.985  60.769  39.094 1.00 140.20 ? 77   ASN D ND2 1 
ATOM   6908 N N   . ALA D 1 78  ? 31.382  62.003  39.406 1.00 149.35 ? 78   ALA D N   1 
ATOM   6909 C CA  . ALA D 1 78  ? 29.994  61.988  38.975 1.00 155.26 ? 78   ALA D CA  1 
ATOM   6910 C C   . ALA D 1 78  ? 29.464  63.412  38.945 1.00 156.45 ? 78   ALA D C   1 
ATOM   6911 O O   . ALA D 1 78  ? 29.620  64.162  39.909 1.00 152.21 ? 78   ALA D O   1 
ATOM   6912 C CB  . ALA D 1 78  ? 29.157  61.129  39.907 1.00 154.78 ? 78   ALA D CB  1 
ATOM   6913 N N   . ARG D 1 79  ? 28.856  63.793  37.828 1.00 149.05 ? 79   ARG D N   1 
ATOM   6914 C CA  . ARG D 1 79  ? 28.177  65.072  37.762 1.00 149.25 ? 79   ARG D CA  1 
ATOM   6915 C C   . ARG D 1 79  ? 27.209  65.128  38.932 1.00 156.95 ? 79   ARG D C   1 
ATOM   6916 O O   . ARG D 1 79  ? 26.424  64.202  39.135 1.00 159.10 ? 79   ARG D O   1 
ATOM   6917 C CB  . ARG D 1 79  ? 27.443  65.228  36.429 1.00 156.14 ? 79   ARG D CB  1 
ATOM   6918 C CG  . ARG D 1 79  ? 28.371  65.197  35.227 1.00 157.40 ? 79   ARG D CG  1 
ATOM   6919 C CD  . ARG D 1 79  ? 27.676  65.661  33.960 1.00 154.40 ? 79   ARG D CD  1 
ATOM   6920 N NE  . ARG D 1 79  ? 26.876  64.607  33.345 1.00 159.90 ? 79   ARG D NE  1 
ATOM   6921 C CZ  . ARG D 1 79  ? 25.568  64.456  33.526 1.00 163.63 ? 79   ARG D CZ  1 
ATOM   6922 N NH1 . ARG D 1 79  ? 24.900  65.295  34.309 1.00 162.51 ? 79   ARG D NH1 1 
ATOM   6923 N NH2 . ARG D 1 79  ? 24.924  63.465  32.922 1.00 168.59 ? 79   ARG D NH2 1 
ATOM   6924 N N   . PRO D 1 80  ? 27.286  66.203  39.727 1.00 203.42 ? 80   PRO D N   1 
ATOM   6925 C CA  . PRO D 1 80  ? 26.457  66.367  40.924 1.00 201.86 ? 80   PRO D CA  1 
ATOM   6926 C C   . PRO D 1 80  ? 24.973  66.134  40.648 1.00 207.71 ? 80   PRO D C   1 
ATOM   6927 O O   . PRO D 1 80  ? 24.425  66.673  39.686 1.00 212.66 ? 80   PRO D O   1 
ATOM   6928 C CB  . PRO D 1 80  ? 26.711  67.822  41.319 1.00 199.22 ? 80   PRO D CB  1 
ATOM   6929 C CG  . PRO D 1 80  ? 28.094  68.086  40.841 1.00 196.29 ? 80   PRO D CG  1 
ATOM   6930 C CD  . PRO D 1 80  ? 28.228  67.321  39.552 1.00 200.55 ? 80   PRO D CD  1 
ATOM   6931 N N   . GLY D 1 81  ? 24.344  65.321  41.492 1.00 156.39 ? 81   GLY D N   1 
ATOM   6932 C CA  . GLY D 1 81  ? 22.927  65.031  41.384 1.00 161.49 ? 81   GLY D CA  1 
ATOM   6933 C C   . GLY D 1 81  ? 22.456  64.672  39.988 1.00 168.13 ? 81   GLY D C   1 
ATOM   6934 O O   . GLY D 1 81  ? 21.394  65.122  39.561 1.00 173.03 ? 81   GLY D O   1 
ATOM   6935 N N   . SER D 1 82  ? 23.236  63.867  39.270 1.00 208.08 ? 82   SER D N   1 
ATOM   6936 C CA  . SER D 1 82  ? 22.813  63.406  37.950 1.00 208.81 ? 82   SER D CA  1 
ATOM   6937 C C   . SER D 1 82  ? 22.539  61.907  37.963 1.00 206.13 ? 82   SER D C   1 
ATOM   6938 O O   . SER D 1 82  ? 23.419  61.098  38.270 1.00 203.36 ? 82   SER D O   1 
ATOM   6939 C CB  . SER D 1 82  ? 23.840  63.749  36.871 1.00 209.54 ? 82   SER D CB  1 
ATOM   6940 O OG  . SER D 1 82  ? 24.534  62.593  36.438 1.00 206.90 ? 82   SER D OG  1 
ATOM   6941 N N   . PHE D 1 83  ? 21.304  61.552  37.627 1.00 165.79 ? 83   PHE D N   1 
ATOM   6942 C CA  . PHE D 1 83  ? 20.851  60.168  37.665 1.00 163.66 ? 83   PHE D CA  1 
ATOM   6943 C C   . PHE D 1 83  ? 21.624  59.272  36.705 1.00 162.04 ? 83   PHE D C   1 
ATOM   6944 O O   . PHE D 1 83  ? 22.004  58.158  37.059 1.00 159.11 ? 83   PHE D O   1 
ATOM   6945 C CB  . PHE D 1 83  ? 19.363  60.097  37.332 1.00 166.03 ? 83   PHE D CB  1 
ATOM   6946 C CG  . PHE D 1 83  ? 18.832  58.700  37.242 1.00 164.49 ? 83   PHE D CG  1 
ATOM   6947 C CD1 . PHE D 1 83  ? 18.633  57.947  38.386 1.00 162.07 ? 83   PHE D CD1 1 
ATOM   6948 C CD2 . PHE D 1 83  ? 18.533  58.137  36.013 1.00 165.62 ? 83   PHE D CD2 1 
ATOM   6949 C CE1 . PHE D 1 83  ? 18.145  56.657  38.306 1.00 160.77 ? 83   PHE D CE1 1 
ATOM   6950 C CE2 . PHE D 1 83  ? 18.045  56.852  35.926 1.00 164.41 ? 83   PHE D CE2 1 
ATOM   6951 C CZ  . PHE D 1 83  ? 17.849  56.109  37.075 1.00 161.97 ? 83   PHE D CZ  1 
ATOM   6952 N N   . THR D 1 84  ? 21.844  59.759  35.488 1.00 173.14 ? 84   THR D N   1 
ATOM   6953 C CA  . THR D 1 84  ? 22.584  59.004  34.488 1.00 171.70 ? 84   THR D CA  1 
ATOM   6954 C C   . THR D 1 84  ? 23.873  58.491  35.100 1.00 168.40 ? 84   THR D C   1 
ATOM   6955 O O   . THR D 1 84  ? 24.084  57.286  35.214 1.00 165.70 ? 84   THR D O   1 
ATOM   6956 C CB  . THR D 1 84  ? 22.949  59.884  33.290 1.00 174.08 ? 84   THR D CB  1 
ATOM   6957 O OG1 . THR D 1 84  ? 21.803  60.638  32.881 1.00 177.78 ? 84   THR D OG1 1 
ATOM   6958 C CG2 . THR D 1 84  ? 23.432  59.030  32.130 1.00 172.82 ? 84   THR D CG2 1 
ATOM   6959 N N   . ASP D 1 85  ? 24.737  59.420  35.490 1.00 184.54 ? 85   ASP D N   1 
ATOM   6960 C CA  . ASP D 1 85  ? 26.010  59.070  36.104 1.00 182.13 ? 85   ASP D CA  1 
ATOM   6961 C C   . ASP D 1 85  ? 25.832  57.994  37.176 1.00 179.45 ? 85   ASP D C   1 
ATOM   6962 O O   . ASP D 1 85  ? 26.511  56.967  37.156 1.00 176.92 ? 85   ASP D O   1 
ATOM   6963 C CB  . ASP D 1 85  ? 26.677  60.315  36.695 1.00 183.69 ? 85   ASP D CB  1 
ATOM   6964 C CG  . ASP D 1 85  ? 27.090  61.315  35.628 1.00 186.05 ? 85   ASP D CG  1 
ATOM   6965 O OD1 . ASP D 1 85  ? 26.432  61.362  34.567 1.00 187.40 ? 85   ASP D OD1 1 
ATOM   6966 O OD2 . ASP D 1 85  ? 28.073  62.056  35.850 1.00 186.82 ? 85   ASP D OD2 1 
ATOM   6967 N N   . ALA D 1 86  ? 24.911  58.230  38.104 1.00 169.09 ? 86   ALA D N   1 
ATOM   6968 C CA  . ALA D 1 86  ? 24.639  57.273  39.171 1.00 166.80 ? 86   ALA D CA  1 
ATOM   6969 C C   . ALA D 1 86  ? 24.209  55.920  38.609 1.00 165.06 ? 86   ALA D C   1 
ATOM   6970 O O   . ALA D 1 86  ? 24.715  54.878  39.023 1.00 162.42 ? 86   ALA D O   1 
ATOM   6971 C CB  . ALA D 1 86  ? 23.579  57.821  40.117 1.00 168.04 ? 86   ALA D CB  1 
ATOM   6972 N N   . PHE D 1 87  ? 23.271  55.946  37.668 1.00 142.15 ? 87   PHE D N   1 
ATOM   6973 C CA  . PHE D 1 87  ? 22.783  54.730  37.026 1.00 141.07 ? 87   PHE D CA  1 
ATOM   6974 C C   . PHE D 1 87  ? 23.920  53.921  36.410 1.00 139.96 ? 87   PHE D C   1 
ATOM   6975 O O   . PHE D 1 87  ? 24.112  52.750  36.742 1.00 137.36 ? 87   PHE D O   1 
ATOM   6976 C CB  . PHE D 1 87  ? 21.753  55.069  35.950 1.00 144.08 ? 87   PHE D CB  1 
ATOM   6977 C CG  . PHE D 1 87  ? 21.299  53.879  35.152 1.00 143.50 ? 87   PHE D CG  1 
ATOM   6978 C CD1 . PHE D 1 87  ? 20.267  53.074  35.611 1.00 138.62 ? 87   PHE D CD1 1 
ATOM   6979 C CD2 . PHE D 1 87  ? 21.905  53.563  33.945 1.00 143.13 ? 87   PHE D CD2 1 
ATOM   6980 C CE1 . PHE D 1 87  ? 19.845  51.980  34.880 1.00 138.35 ? 87   PHE D CE1 1 
ATOM   6981 C CE2 . PHE D 1 87  ? 21.487  52.470  33.210 1.00 142.68 ? 87   PHE D CE2 1 
ATOM   6982 C CZ  . PHE D 1 87  ? 20.456  51.678  33.679 1.00 139.32 ? 87   PHE D CZ  1 
ATOM   6983 N N   . PHE D 1 88  ? 24.664  54.547  35.505 1.00 142.39 ? 88   PHE D N   1 
ATOM   6984 C CA  . PHE D 1 88  ? 25.786  53.879  34.858 1.00 144.17 ? 88   PHE D CA  1 
ATOM   6985 C C   . PHE D 1 88  ? 26.810  53.392  35.867 1.00 148.27 ? 88   PHE D C   1 
ATOM   6986 O O   . PHE D 1 88  ? 27.351  52.304  35.717 1.00 145.76 ? 88   PHE D O   1 
ATOM   6987 C CB  . PHE D 1 88  ? 26.444  54.779  33.816 1.00 147.12 ? 88   PHE D CB  1 
ATOM   6988 C CG  . PHE D 1 88  ? 25.678  54.863  32.535 1.00 147.78 ? 88   PHE D CG  1 
ATOM   6989 C CD1 . PHE D 1 88  ? 25.079  56.046  32.148 1.00 151.21 ? 88   PHE D CD1 1 
ATOM   6990 C CD2 . PHE D 1 88  ? 25.542  53.750  31.725 1.00 147.74 ? 88   PHE D CD2 1 
ATOM   6991 C CE1 . PHE D 1 88  ? 24.367  56.122  30.969 1.00 153.44 ? 88   PHE D CE1 1 
ATOM   6992 C CE2 . PHE D 1 88  ? 24.829  53.816  30.544 1.00 148.59 ? 88   PHE D CE2 1 
ATOM   6993 C CZ  . PHE D 1 88  ? 24.240  55.005  30.164 1.00 152.22 ? 88   PHE D CZ  1 
ATOM   6994 N N   . PHE D 1 89  ? 27.076  54.189  36.897 1.00 161.47 ? 89   PHE D N   1 
ATOM   6995 C CA  . PHE D 1 89  ? 27.951  53.729  37.964 1.00 159.56 ? 89   PHE D CA  1 
ATOM   6996 C C   . PHE D 1 89  ? 27.397  52.444  38.553 1.00 157.28 ? 89   PHE D C   1 
ATOM   6997 O O   . PHE D 1 89  ? 28.118  51.466  38.745 1.00 154.98 ? 89   PHE D O   1 
ATOM   6998 C CB  . PHE D 1 89  ? 28.075  54.762  39.077 1.00 161.10 ? 89   PHE D CB  1 
ATOM   6999 C CG  . PHE D 1 89  ? 28.772  54.237  40.295 1.00 159.47 ? 89   PHE D CG  1 
ATOM   7000 C CD1 . PHE D 1 89  ? 30.109  53.889  40.239 1.00 158.53 ? 89   PHE D CD1 1 
ATOM   7001 C CD2 . PHE D 1 89  ? 28.087  54.060  41.486 1.00 158.99 ? 89   PHE D CD2 1 
ATOM   7002 C CE1 . PHE D 1 89  ? 30.758  53.395  41.354 1.00 157.45 ? 89   PHE D CE1 1 
ATOM   7003 C CE2 . PHE D 1 89  ? 28.731  53.573  42.609 1.00 157.70 ? 89   PHE D CE2 1 
ATOM   7004 C CZ  . PHE D 1 89  ? 30.067  53.238  42.542 1.00 157.07 ? 89   PHE D CZ  1 
ATOM   7005 N N   . SER D 1 90  ? 26.101  52.464  38.839 1.00 181.06 ? 90   SER D N   1 
ATOM   7006 C CA  . SER D 1 90  ? 25.421  51.315  39.411 1.00 179.27 ? 90   SER D CA  1 
ATOM   7007 C C   . SER D 1 90  ? 25.595  50.065  38.560 1.00 177.38 ? 90   SER D C   1 
ATOM   7008 O O   . SER D 1 90  ? 25.797  48.980  39.093 1.00 175.09 ? 90   SER D O   1 
ATOM   7009 C CB  . SER D 1 90  ? 23.938  51.617  39.607 1.00 181.03 ? 90   SER D CB  1 
ATOM   7010 O OG  . SER D 1 90  ? 23.191  50.420  39.678 1.00 179.69 ? 90   SER D OG  1 
ATOM   7011 N N   . VAL D 1 91  ? 25.515  50.198  37.239 1.00 148.89 ? 91   VAL D N   1 
ATOM   7012 C CA  . VAL D 1 91  ? 25.727  49.022  36.400 1.00 147.09 ? 91   VAL D CA  1 
ATOM   7013 C C   . VAL D 1 91  ? 27.183  48.561  36.498 1.00 144.70 ? 91   VAL D C   1 
ATOM   7014 O O   . VAL D 1 91  ? 27.443  47.390  36.769 1.00 142.30 ? 91   VAL D O   1 
ATOM   7015 C CB  . VAL D 1 91  ? 25.284  49.214  34.920 1.00 148.81 ? 91   VAL D CB  1 
ATOM   7016 C CG1 . VAL D 1 91  ? 24.029  50.070  34.840 1.00 152.09 ? 91   VAL D CG1 1 
ATOM   7017 C CG2 . VAL D 1 91  ? 26.399  49.810  34.083 1.00 148.95 ? 91   VAL D CG2 1 
ATOM   7018 N N   . GLN D 1 92  ? 28.126  49.483  36.311 1.00 147.99 ? 92   GLN D N   1 
ATOM   7019 C CA  . GLN D 1 92  ? 29.544  49.145  36.393 1.00 146.27 ? 92   GLN D CA  1 
ATOM   7020 C C   . GLN D 1 92  ? 29.830  48.452  37.701 1.00 144.60 ? 92   GLN D C   1 
ATOM   7021 O O   . GLN D 1 92  ? 30.704  47.593  37.781 1.00 142.57 ? 92   GLN D O   1 
ATOM   7022 C CB  . GLN D 1 92  ? 30.412  50.392  36.311 1.00 148.07 ? 92   GLN D CB  1 
ATOM   7023 C CG  . GLN D 1 92  ? 29.828  51.472  35.456 1.00 150.68 ? 92   GLN D CG  1 
ATOM   7024 C CD  . GLN D 1 92  ? 30.883  52.296  34.775 1.00 151.77 ? 92   GLN D CD  1 
ATOM   7025 O OE1 . GLN D 1 92  ? 31.961  52.523  35.324 1.00 151.60 ? 92   GLN D OE1 1 
ATOM   7026 N NE2 . GLN D 1 92  ? 30.584  52.749  33.564 1.00 153.08 ? 92   GLN D NE2 1 
ATOM   7027 N N   . THR D 1 93  ? 29.093  48.840  38.733 1.00 160.59 ? 93   THR D N   1 
ATOM   7028 C CA  . THR D 1 93  ? 29.289  48.263  40.048 1.00 159.35 ? 93   THR D CA  1 
ATOM   7029 C C   . THR D 1 93  ? 28.627  46.885  40.135 1.00 157.27 ? 93   THR D C   1 
ATOM   7030 O O   . THR D 1 93  ? 29.259  45.920  40.556 1.00 155.30 ? 93   THR D O   1 
ATOM   7031 C CB  . THR D 1 93  ? 28.765  49.201  41.157 1.00 161.11 ? 93   THR D CB  1 
ATOM   7032 O OG1 . THR D 1 93  ? 29.561  49.052  42.337 1.00 160.56 ? 93   THR D OG1 1 
ATOM   7033 C CG2 . THR D 1 93  ? 27.326  48.895  41.481 1.00 161.10 ? 93   THR D CG2 1 
ATOM   7034 N N   . MET D 1 94  ? 27.371  46.783  39.708 1.00 134.95 ? 94   MET D N   1 
ATOM   7035 C CA  . MET D 1 94  ? 26.630  45.533  39.851 1.00 133.36 ? 94   MET D CA  1 
ATOM   7036 C C   . MET D 1 94  ? 27.082  44.437  38.888 1.00 131.49 ? 94   MET D C   1 
ATOM   7037 O O   . MET D 1 94  ? 26.995  43.255  39.207 1.00 129.62 ? 94   MET D O   1 
ATOM   7038 C CB  . MET D 1 94  ? 25.126  45.755  39.706 1.00 135.12 ? 94   MET D CB  1 
ATOM   7039 C CG  . MET D 1 94  ? 24.330  44.467  39.791 1.00 133.76 ? 94   MET D CG  1 
ATOM   7040 S SD  . MET D 1 94  ? 22.624  44.705  39.293 1.00 136.51 ? 94   MET D SD  1 
ATOM   7041 C CE  . MET D 1 94  ? 22.879  45.598  37.769 1.00 138.74 ? 94   MET D CE  1 
ATOM   7042 N N   . ALA D 1 95  ? 27.544  44.825  37.706 1.00 128.87 ? 95   ALA D N   1 
ATOM   7043 C CA  . ALA D 1 95  ? 28.078  43.864  36.750 1.00 126.97 ? 95   ALA D CA  1 
ATOM   7044 C C   . ALA D 1 95  ? 29.534  43.650  37.102 1.00 125.29 ? 95   ALA D C   1 
ATOM   7045 O O   . ALA D 1 95  ? 30.233  42.836  36.502 1.00 123.48 ? 95   ALA D O   1 
ATOM   7046 C CB  . ALA D 1 95  ? 27.948  44.397  35.347 1.00 128.43 ? 95   ALA D CB  1 
ATOM   7047 N N   . THR D 1 96  ? 29.978  44.421  38.084 1.00 138.12 ? 96   THR D N   1 
ATOM   7048 C CA  . THR D 1 96  ? 31.339  44.357  38.583 1.00 137.34 ? 96   THR D CA  1 
ATOM   7049 C C   . THR D 1 96  ? 32.394  44.618  37.511 1.00 137.30 ? 96   THR D C   1 
ATOM   7050 O O   . THR D 1 96  ? 33.476  44.063  37.592 1.00 136.00 ? 96   THR D O   1 
ATOM   7051 C CB  . THR D 1 96  ? 31.634  43.000  39.250 1.00 134.98 ? 96   THR D CB  1 
ATOM   7052 O OG1 . THR D 1 96  ? 31.772  42.002  38.237 1.00 132.81 ? 96   THR D OG1 1 
ATOM   7053 C CG2 . THR D 1 96  ? 30.502  42.599  40.190 1.00 134.88 ? 96   THR D CG2 1 
ATOM   7054 N N   . ILE D 1 97  ? 32.093  45.460  36.524 1.00 132.71 ? 97   ILE D N   1 
ATOM   7055 C CA  . ILE D 1 97  ? 33.124  45.890  35.582 1.00 132.99 ? 97   ILE D CA  1 
ATOM   7056 C C   . ILE D 1 97  ? 34.081  46.801  36.330 1.00 134.56 ? 97   ILE D C   1 
ATOM   7057 O O   . ILE D 1 97  ? 35.294  46.747  36.137 1.00 134.26 ? 97   ILE D O   1 
ATOM   7058 C CB  . ILE D 1 97  ? 32.554  46.666  34.388 1.00 134.63 ? 97   ILE D CB  1 
ATOM   7059 C CG1 . ILE D 1 97  ? 31.333  45.951  33.812 1.00 134.09 ? 97   ILE D CG1 1 
ATOM   7060 C CG2 . ILE D 1 97  ? 33.629  46.864  33.322 1.00 134.40 ? 97   ILE D CG2 1 
ATOM   7061 C CD1 . ILE D 1 97  ? 30.508  46.816  32.899 1.00 136.54 ? 97   ILE D CD1 1 
ATOM   7062 N N   . GLY D 1 98  ? 33.516  47.643  37.188 1.00 171.70 ? 98   GLY D N   1 
ATOM   7063 C CA  . GLY D 1 98  ? 34.301  48.526  38.026 1.00 173.51 ? 98   GLY D CA  1 
ATOM   7064 C C   . GLY D 1 98  ? 35.406  49.225  37.269 1.00 174.74 ? 98   GLY D C   1 
ATOM   7065 O O   . GLY D 1 98  ? 36.573  49.080  37.612 1.00 174.78 ? 98   GLY D O   1 
ATOM   7066 N N   . TYR D 1 99  ? 35.035  49.986  36.243 1.00 137.72 ? 99   TYR D N   1 
ATOM   7067 C CA  . TYR D 1 99  ? 36.003  50.720  35.431 1.00 144.79 ? 99   TYR D CA  1 
ATOM   7068 C C   . TYR D 1 99  ? 37.002  51.507  36.264 1.00 146.90 ? 99   TYR D C   1 
ATOM   7069 O O   . TYR D 1 99  ? 38.202  51.334  36.106 1.00 147.04 ? 99   TYR D O   1 
ATOM   7070 C CB  . TYR D 1 99  ? 35.300  51.676  34.472 1.00 146.49 ? 99   TYR D CB  1 
ATOM   7071 C CG  . TYR D 1 99  ? 34.787  51.030  33.208 1.00 145.02 ? 99   TYR D CG  1 
ATOM   7072 C CD1 . TYR D 1 99  ? 33.502  51.285  32.752 1.00 145.98 ? 99   TYR D CD1 1 
ATOM   7073 C CD2 . TYR D 1 99  ? 35.585  50.167  32.469 1.00 142.91 ? 99   TYR D CD2 1 
ATOM   7074 C CE1 . TYR D 1 99  ? 33.024  50.703  31.596 1.00 145.09 ? 99   TYR D CE1 1 
ATOM   7075 C CE2 . TYR D 1 99  ? 35.114  49.576  31.309 1.00 147.44 ? 99   TYR D CE2 1 
ATOM   7076 C CZ  . TYR D 1 99  ? 33.833  49.848  30.878 1.00 142.97 ? 99   TYR D CZ  1 
ATOM   7077 O OH  . TYR D 1 99  ? 33.356  49.266  29.727 1.00 147.83 ? 99   TYR D OH  1 
ATOM   7078 N N   . GLY D 1 100 ? 36.516  52.405  37.117 1.00 200.70 ? 100  GLY D N   1 
ATOM   7079 C CA  . GLY D 1 100 ? 37.411  53.126  38.007 1.00 202.99 ? 100  GLY D CA  1 
ATOM   7080 C C   . GLY D 1 100 ? 37.345  54.644  37.988 1.00 206.11 ? 100  GLY D C   1 
ATOM   7081 O O   . GLY D 1 100 ? 38.014  55.301  38.785 1.00 208.30 ? 100  GLY D O   1 
ATOM   7082 N N   . LYS D 1 101 ? 36.559  55.210  37.077 1.00 137.10 ? 101  LYS D N   1 
ATOM   7083 C CA  . LYS D 1 101 ? 36.325  56.648  37.084 1.00 136.49 ? 101  LYS D CA  1 
ATOM   7084 C C   . LYS D 1 101 ? 35.418  56.964  38.253 1.00 136.87 ? 101  LYS D C   1 
ATOM   7085 O O   . LYS D 1 101 ? 35.807  57.643  39.203 1.00 136.35 ? 101  LYS D O   1 
ATOM   7086 C CB  . LYS D 1 101 ? 35.653  57.098  35.788 1.00 136.81 ? 101  LYS D CB  1 
ATOM   7087 N N   . LEU D 1 102 ? 34.198  56.453  38.164 1.00 172.19 ? 102  LEU D N   1 
ATOM   7088 C CA  . LEU D 1 102 ? 33.227  56.574  39.232 1.00 168.40 ? 102  LEU D CA  1 
ATOM   7089 C C   . LEU D 1 102 ? 33.606  55.588  40.329 1.00 167.33 ? 102  LEU D C   1 
ATOM   7090 O O   . LEU D 1 102 ? 33.835  54.409  40.063 1.00 168.79 ? 102  LEU D O   1 
ATOM   7091 C CB  . LEU D 1 102 ? 31.833  56.281  38.686 1.00 167.35 ? 102  LEU D CB  1 
ATOM   7092 C CG  . LEU D 1 102 ? 31.659  56.778  37.247 1.00 169.76 ? 102  LEU D CG  1 
ATOM   7093 C CD1 . LEU D 1 102 ? 30.355  56.284  36.646 1.00 169.25 ? 102  LEU D CD1 1 
ATOM   7094 C CD2 . LEU D 1 102 ? 31.753  58.297  37.171 1.00 169.44 ? 102  LEU D CD2 1 
ATOM   7095 N N   . ILE D 1 103 ? 33.695  56.086  41.556 1.00 125.00 ? 103  ILE D N   1 
ATOM   7096 C CA  . ILE D 1 103 ? 34.145  55.292  42.689 1.00 123.88 ? 103  ILE D CA  1 
ATOM   7097 C C   . ILE D 1 103 ? 33.297  55.664  43.889 1.00 120.16 ? 103  ILE D C   1 
ATOM   7098 O O   . ILE D 1 103 ? 32.822  56.792  43.984 1.00 118.88 ? 103  ILE D O   1 
ATOM   7099 C CB  . ILE D 1 103 ? 35.616  55.607  43.030 1.00 125.54 ? 103  ILE D CB  1 
ATOM   7100 C CG1 . ILE D 1 103 ? 36.501  55.457  41.795 1.00 129.50 ? 103  ILE D CG1 1 
ATOM   7101 C CG2 . ILE D 1 103 ? 36.129  54.721  44.159 1.00 124.67 ? 103  ILE D CG2 1 
ATOM   7102 C CD1 . ILE D 1 103 ? 37.918  55.924  42.019 1.00 129.02 ? 103  ILE D CD1 1 
ATOM   7103 N N   . PRO D 1 104 ? 33.095  54.719  44.814 1.00 129.93 ? 104  PRO D N   1 
ATOM   7104 C CA  . PRO D 1 104 ? 32.383  55.067  46.046 1.00 126.59 ? 104  PRO D CA  1 
ATOM   7105 C C   . PRO D 1 104 ? 33.151  56.077  46.905 1.00 125.91 ? 104  PRO D C   1 
ATOM   7106 O O   . PRO D 1 104 ? 34.378  56.180  46.819 1.00 127.83 ? 104  PRO D O   1 
ATOM   7107 C CB  . PRO D 1 104 ? 32.283  53.719  46.772 1.00 125.60 ? 104  PRO D CB  1 
ATOM   7108 C CG  . PRO D 1 104 ? 33.391  52.899  46.177 1.00 128.49 ? 104  PRO D CG  1 
ATOM   7109 C CD  . PRO D 1 104 ? 33.356  53.274  44.740 1.00 130.93 ? 104  PRO D CD  1 
ATOM   7110 N N   . ILE D 1 105 ? 32.418  56.822  47.724 1.00 164.98 ? 105  ILE D N   1 
ATOM   7111 C CA  . ILE D 1 105 ? 33.018  57.744  48.678 1.00 163.93 ? 105  ILE D CA  1 
ATOM   7112 C C   . ILE D 1 105 ? 32.289  57.655  50.008 1.00 160.89 ? 105  ILE D C   1 
ATOM   7113 O O   . ILE D 1 105 ? 31.091  57.930  50.086 1.00 159.24 ? 105  ILE D O   1 
ATOM   7114 C CB  . ILE D 1 105 ? 32.943  59.192  48.183 1.00 164.17 ? 105  ILE D CB  1 
ATOM   7115 C CG1 . ILE D 1 105 ? 33.843  59.384  46.963 1.00 167.36 ? 105  ILE D CG1 1 
ATOM   7116 C CG2 . ILE D 1 105 ? 33.334  60.154  49.295 1.00 162.63 ? 105  ILE D CG2 1 
ATOM   7117 C CD1 . ILE D 1 105 ? 33.610  60.691  46.241 1.00 167.87 ? 105  ILE D CD1 1 
ATOM   7118 N N   . GLY D 1 106 ? 33.011  57.266  51.052 1.00 149.53 ? 106  GLY D N   1 
ATOM   7119 C CA  . GLY D 1 106 ? 32.434  57.187  52.380 1.00 146.80 ? 106  GLY D CA  1 
ATOM   7120 C C   . GLY D 1 106 ? 31.702  55.885  52.634 1.00 145.87 ? 106  GLY D C   1 
ATOM   7121 O O   . GLY D 1 106 ? 31.386  55.152  51.700 1.00 147.04 ? 106  GLY D O   1 
ATOM   7122 N N   . PRO D 1 107 ? 31.418  55.599  53.910 1.00 154.98 ? 107  PRO D N   1 
ATOM   7123 C CA  . PRO D 1 107 ? 30.809  54.335  54.337 1.00 154.00 ? 107  PRO D CA  1 
ATOM   7124 C C   . PRO D 1 107 ? 29.493  54.033  53.626 1.00 153.67 ? 107  PRO D C   1 
ATOM   7125 O O   . PRO D 1 107 ? 29.314  52.923  53.127 1.00 154.43 ? 107  PRO D O   1 
ATOM   7126 C CB  . PRO D 1 107 ? 30.565  54.556  55.831 1.00 151.63 ? 107  PRO D CB  1 
ATOM   7127 C CG  . PRO D 1 107 ? 31.558  55.601  56.228 1.00 151.93 ? 107  PRO D CG  1 
ATOM   7128 C CD  . PRO D 1 107 ? 31.663  56.506  55.043 1.00 153.47 ? 107  PRO D CD  1 
ATOM   7129 N N   . LEU D 1 108 ? 28.588  55.005  53.585 1.00 189.10 ? 108  LEU D N   1 
ATOM   7130 C CA  . LEU D 1 108 ? 27.283  54.799  52.965 1.00 188.80 ? 108  LEU D CA  1 
ATOM   7131 C C   . LEU D 1 108 ? 27.415  54.362  51.510 1.00 191.04 ? 108  LEU D C   1 
ATOM   7132 O O   . LEU D 1 108 ? 26.818  53.367  51.094 1.00 191.33 ? 108  LEU D O   1 
ATOM   7133 C CB  . LEU D 1 108 ? 26.431  56.065  53.065 1.00 187.76 ? 108  LEU D CB  1 
ATOM   7134 C CG  . LEU D 1 108 ? 26.241  56.584  54.489 1.00 185.70 ? 108  LEU D CG  1 
ATOM   7135 C CD1 . LEU D 1 108 ? 25.171  57.664  54.527 1.00 184.72 ? 108  LEU D CD1 1 
ATOM   7136 C CD2 . LEU D 1 108 ? 25.891  55.435  55.425 1.00 184.47 ? 108  LEU D CD2 1 
ATOM   7137 N N   . ALA D 1 109 ? 28.202  55.107  50.743 1.00 137.66 ? 109  ALA D N   1 
ATOM   7138 C CA  . ALA D 1 109 ? 28.436  54.769  49.346 1.00 140.04 ? 109  ALA D CA  1 
ATOM   7139 C C   . ALA D 1 109 ? 28.846  53.309  49.199 1.00 141.02 ? 109  ALA D C   1 
ATOM   7140 O O   . ALA D 1 109 ? 28.215  52.549  48.469 1.00 141.65 ? 109  ALA D O   1 
ATOM   7141 C CB  . ALA D 1 109 ? 29.500  55.674  48.753 1.00 141.89 ? 109  ALA D CB  1 
ATOM   7142 N N   . ASN D 1 110 ? 29.901  52.926  49.910 1.00 115.41 ? 110  ASN D N   1 
ATOM   7143 C CA  . ASN D 1 110 ? 30.481  51.594  49.781 1.00 116.75 ? 110  ASN D CA  1 
ATOM   7144 C C   . ASN D 1 110 ? 29.586  50.460  50.261 1.00 115.28 ? 110  ASN D C   1 
ATOM   7145 O O   . ASN D 1 110 ? 29.542  49.399  49.643 1.00 116.50 ? 110  ASN D O   1 
ATOM   7146 C CB  . ASN D 1 110 ? 31.822  51.531  50.501 1.00 117.40 ? 110  ASN D CB  1 
ATOM   7147 C CG  . ASN D 1 110 ? 32.844  52.449  49.892 1.00 119.39 ? 110  ASN D CG  1 
ATOM   7148 O OD1 . ASN D 1 110 ? 33.401  52.160  48.836 1.00 122.07 ? 110  ASN D OD1 1 
ATOM   7149 N ND2 . ASN D 1 110 ? 33.106  53.565  50.558 1.00 118.25 ? 110  ASN D ND2 1 
ATOM   7150 N N   . THR D 1 111 ? 28.885  50.665  51.370 1.00 188.94 ? 111  THR D N   1 
ATOM   7151 C CA  . THR D 1 111 ? 27.978  49.635  51.852 1.00 187.58 ? 111  THR D CA  1 
ATOM   7152 C C   . THR D 1 111 ? 27.006  49.287  50.734 1.00 188.42 ? 111  THR D C   1 
ATOM   7153 O O   . THR D 1 111 ? 26.842  48.118  50.384 1.00 189.11 ? 111  THR D O   1 
ATOM   7154 C CB  . THR D 1 111 ? 27.206  50.077  53.100 1.00 184.96 ? 111  THR D CB  1 
ATOM   7155 O OG1 . THR D 1 111 ? 28.122  50.624  54.054 1.00 184.38 ? 111  THR D OG1 1 
ATOM   7156 C CG2 . THR D 1 111 ? 26.483  48.890  53.724 1.00 183.71 ? 111  THR D CG2 1 
ATOM   7157 N N   . LEU D 1 112 ? 26.376  50.312  50.167 1.00 143.28 ? 112  LEU D N   1 
ATOM   7158 C CA  . LEU D 1 112 ? 25.517  50.136  49.000 1.00 144.22 ? 112  LEU D CA  1 
ATOM   7159 C C   . LEU D 1 112 ? 26.230  49.347  47.907 1.00 146.78 ? 112  LEU D C   1 
ATOM   7160 O O   . LEU D 1 112 ? 25.617  48.536  47.208 1.00 147.59 ? 112  LEU D O   1 
ATOM   7161 C CB  . LEU D 1 112 ? 25.081  51.492  48.446 1.00 144.39 ? 112  LEU D CB  1 
ATOM   7162 C CG  . LEU D 1 112 ? 23.850  52.134  49.076 1.00 142.32 ? 112  LEU D CG  1 
ATOM   7163 C CD1 . LEU D 1 112 ? 23.503  53.409  48.331 1.00 142.87 ? 112  LEU D CD1 1 
ATOM   7164 C CD2 . LEU D 1 112 ? 22.682  51.159  49.057 1.00 141.74 ? 112  LEU D CD2 1 
ATOM   7165 N N   . VAL D 1 113 ? 27.527  49.597  47.760 1.00 135.03 ? 113  VAL D N   1 
ATOM   7166 C CA  . VAL D 1 113 ? 28.330  48.893  46.769 1.00 137.84 ? 113  VAL D CA  1 
ATOM   7167 C C   . VAL D 1 113 ? 28.362  47.398  47.058 1.00 137.88 ? 113  VAL D C   1 
ATOM   7168 O O   . VAL D 1 113 ? 27.938  46.588  46.236 1.00 139.03 ? 113  VAL D O   1 
ATOM   7169 C CB  . VAL D 1 113 ? 29.778  49.427  46.725 1.00 139.50 ? 113  VAL D CB  1 
ATOM   7170 C CG1 . VAL D 1 113 ? 30.627  48.576  45.797 1.00 142.53 ? 113  VAL D CG1 1 
ATOM   7171 C CG2 . VAL D 1 113 ? 29.797  50.883  46.289 1.00 139.79 ? 113  VAL D CG2 1 
ATOM   7172 N N   . THR D 1 114 ? 28.857  47.040  48.238 1.00 137.84 ? 114  THR D N   1 
ATOM   7173 C CA  . THR D 1 114 ? 29.026  45.639  48.603 1.00 137.96 ? 114  THR D CA  1 
ATOM   7174 C C   . THR D 1 114 ? 27.677  44.919  48.648 1.00 136.63 ? 114  THR D C   1 
ATOM   7175 O O   . THR D 1 114 ? 27.614  43.688  48.627 1.00 137.03 ? 114  THR D O   1 
ATOM   7176 C CB  . THR D 1 114 ? 29.733  45.490  49.965 1.00 136.65 ? 114  THR D CB  1 
ATOM   7177 O OG1 . THR D 1 114 ? 28.753  45.329  50.993 1.00 133.91 ? 114  THR D OG1 1 
ATOM   7178 C CG2 . THR D 1 114 ? 30.578  46.713  50.269 1.00 136.72 ? 114  THR D CG2 1 
ATOM   7179 N N   . LEU D 1 115 ? 26.601  45.697  48.714 1.00 142.28 ? 115  LEU D N   1 
ATOM   7180 C CA  . LEU D 1 115 ? 25.253  45.148  48.714 1.00 141.13 ? 115  LEU D CA  1 
ATOM   7181 C C   . LEU D 1 115 ? 24.835  44.849  47.287 1.00 143.11 ? 115  LEU D C   1 
ATOM   7182 O O   . LEU D 1 115 ? 24.304  43.781  46.983 1.00 143.48 ? 115  LEU D O   1 
ATOM   7183 C CB  . LEU D 1 115 ? 24.276  46.149  49.316 1.00 139.07 ? 115  LEU D CB  1 
ATOM   7184 C CG  . LEU D 1 115 ? 23.017  45.506  49.879 1.00 137.38 ? 115  LEU D CG  1 
ATOM   7185 C CD1 . LEU D 1 115 ? 23.287  45.088  51.314 1.00 135.57 ? 115  LEU D CD1 1 
ATOM   7186 C CD2 . LEU D 1 115 ? 21.841  46.465  49.793 1.00 136.45 ? 115  LEU D CD2 1 
ATOM   7187 N N   . GLU D 1 116 ? 25.076  45.816  46.413 1.00 120.69 ? 116  GLU D N   1 
ATOM   7188 C CA  . GLU D 1 116 ? 24.773  45.660  45.006 1.00 122.75 ? 116  GLU D CA  1 
ATOM   7189 C C   . GLU D 1 116 ? 25.484  44.436  44.457 1.00 124.75 ? 116  GLU D C   1 
ATOM   7190 O O   . GLU D 1 116 ? 24.853  43.536  43.911 1.00 125.28 ? 116  GLU D O   1 
ATOM   7191 C CB  . GLU D 1 116 ? 25.206  46.902  44.243 1.00 124.05 ? 116  GLU D CB  1 
ATOM   7192 C CG  . GLU D 1 116 ? 24.584  47.006  42.878 1.00 125.74 ? 116  GLU D CG  1 
ATOM   7193 C CD  . GLU D 1 116 ? 24.439  48.440  42.444 1.00 125.90 ? 116  GLU D CD  1 
ATOM   7194 O OE1 . GLU D 1 116 ? 25.172  49.291  42.990 1.00 125.52 ? 116  GLU D OE1 1 
ATOM   7195 O OE2 . GLU D 1 116 ? 23.594  48.722  41.569 1.00 126.40 ? 116  GLU D OE2 1 
ATOM   7196 N N   . ALA D 1 117 ? 26.802  44.415  44.609 1.00 119.06 ? 117  ALA D N   1 
ATOM   7197 C CA  . ALA D 1 117 ? 27.608  43.287  44.174 1.00 121.30 ? 117  ALA D CA  1 
ATOM   7198 C C   . ALA D 1 117 ? 26.858  41.990  44.429 1.00 120.43 ? 117  ALA D C   1 
ATOM   7199 O O   . ALA D 1 117 ? 26.418  41.317  43.496 1.00 121.88 ? 117  ALA D O   1 
ATOM   7200 C CB  . ALA D 1 117 ? 28.933  43.286  44.902 1.00 110.37 ? 117  ALA D CB  1 
ATOM   7201 N N   . LEU D 1 118 ? 26.696  41.660  45.704 1.00 110.54 ? 118  LEU D N   1 
ATOM   7202 C CA  . LEU D 1 118 ? 25.954  40.479  46.114 1.00 118.99 ? 118  LEU D CA  1 
ATOM   7203 C C   . LEU D 1 118 ? 24.666  40.341  45.313 1.00 119.04 ? 118  LEU D C   1 
ATOM   7204 O O   . LEU D 1 118 ? 24.388  39.290  44.753 1.00 120.11 ? 118  LEU D O   1 
ATOM   7205 C CB  . LEU D 1 118 ? 25.627  40.568  47.600 1.00 116.10 ? 118  LEU D CB  1 
ATOM   7206 C CG  . LEU D 1 118 ? 24.670  39.504  48.126 1.00 114.63 ? 118  LEU D CG  1 
ATOM   7207 C CD1 . LEU D 1 118 ? 25.427  38.244  48.493 1.00 115.01 ? 118  LEU D CD1 1 
ATOM   7208 C CD2 . LEU D 1 118 ? 23.900  40.022  49.322 1.00 111.85 ? 118  LEU D CD2 1 
ATOM   7209 N N   . CYS D 1 119 ? 23.882  41.412  45.267 1.00 143.24 ? 119  CYS D N   1 
ATOM   7210 C CA  . CYS D 1 119 ? 22.653  41.435  44.481 1.00 143.26 ? 119  CYS D CA  1 
ATOM   7211 C C   . CYS D 1 119 ? 22.901  41.019  43.042 1.00 146.10 ? 119  CYS D C   1 
ATOM   7212 O O   . CYS D 1 119 ? 22.196  40.175  42.494 1.00 146.78 ? 119  CYS D O   1 
ATOM   7213 C CB  . CYS D 1 119 ? 22.047  42.836  44.494 1.00 142.30 ? 119  CYS D CB  1 
ATOM   7214 S SG  . CYS D 1 119 ? 20.815  43.106  45.766 1.00 139.25 ? 119  CYS D SG  1 
ATOM   7215 N N   . GLY D 1 120 ? 23.898  41.633  42.425 1.00 122.90 ? 120  GLY D N   1 
ATOM   7216 C CA  . GLY D 1 120 ? 24.238  41.317  41.054 1.00 125.94 ? 120  GLY D CA  1 
ATOM   7217 C C   . GLY D 1 120 ? 24.407  39.831  40.827 1.00 127.18 ? 120  GLY D C   1 
ATOM   7218 O O   . GLY D 1 120 ? 23.727  39.236  39.992 1.00 128.26 ? 120  GLY D O   1 
ATOM   7219 N N   . MET D 1 121 ? 25.314  39.226  41.585 1.00 90.14  ? 121  MET D N   1 
ATOM   7220 C CA  . MET D 1 121 ? 25.604  37.802  41.445 1.00 90.21  ? 121  MET D CA  1 
ATOM   7221 C C   . MET D 1 121 ? 24.393  36.901  41.717 1.00 85.36  ? 121  MET D C   1 
ATOM   7222 O O   . MET D 1 121 ? 24.139  35.957  40.982 1.00 84.48  ? 121  MET D O   1 
ATOM   7223 C CB  . MET D 1 121 ? 26.800  37.406  42.318 1.00 94.06  ? 121  MET D CB  1 
ATOM   7224 N N   . LEU D 1 122 ? 23.647  37.197  42.772 1.00 131.96 ? 122  LEU D N   1 
ATOM   7225 C CA  . LEU D 1 122 ? 22.421  36.463  43.059 1.00 127.73 ? 122  LEU D CA  1 
ATOM   7226 C C   . LEU D 1 122 ? 21.514  36.483  41.849 1.00 125.59 ? 122  LEU D C   1 
ATOM   7227 O O   . LEU D 1 122 ? 20.938  35.473  41.470 1.00 123.59 ? 122  LEU D O   1 
ATOM   7228 C CB  . LEU D 1 122 ? 21.676  37.097  44.228 1.00 126.01 ? 122  LEU D CB  1 
ATOM   7229 C CG  . LEU D 1 122 ? 22.330  37.009  45.602 1.00 128.30 ? 122  LEU D CG  1 
ATOM   7230 C CD1 . LEU D 1 122 ? 21.302  37.310  46.680 1.00 126.39 ? 122  LEU D CD1 1 
ATOM   7231 C CD2 . LEU D 1 122 ? 22.935  35.634  45.812 1.00 128.19 ? 122  LEU D CD2 1 
ATOM   7232 N N   . GLY D 1 123 ? 21.375  37.658  41.254 1.00 124.08 ? 123  GLY D N   1 
ATOM   7233 C CA  . GLY D 1 123 ? 20.585  37.801  40.050 1.00 123.18 ? 123  GLY D CA  1 
ATOM   7234 C C   . GLY D 1 123 ? 21.083  36.846  38.991 1.00 125.00 ? 123  GLY D C   1 
ATOM   7235 O O   . GLY D 1 123 ? 20.310  36.122  38.375 1.00 123.41 ? 123  GLY D O   1 
ATOM   7236 N N   . LEU D 1 124 ? 22.392  36.839  38.785 1.00 76.57  ? 124  LEU D N   1 
ATOM   7237 C CA  . LEU D 1 124 ? 22.999  35.909  37.845 1.00 77.48  ? 124  LEU D CA  1 
ATOM   7238 C C   . LEU D 1 124 ? 22.620  34.468  38.165 1.00 76.78  ? 124  LEU D C   1 
ATOM   7239 O O   . LEU D 1 124 ? 22.254  33.694  37.284 1.00 74.63  ? 124  LEU D O   1 
ATOM   7240 C CB  . LEU D 1 124 ? 24.518  36.028  37.876 1.00 84.10  ? 124  LEU D CB  1 
ATOM   7241 C CG  . LEU D 1 124 ? 25.152  35.188  36.765 1.00 85.93  ? 124  LEU D CG  1 
ATOM   7242 C CD1 . LEU D 1 124 ? 25.008  35.914  35.442 1.00 83.95  ? 124  LEU D CD1 1 
ATOM   7243 C CD2 . LEU D 1 124 ? 26.608  34.860  37.041 1.00 90.35  ? 124  LEU D CD2 1 
ATOM   7244 N N   . ALA D 1 125 ? 22.731  34.111  39.437 1.00 113.68 ? 125  ALA D N   1 
ATOM   7245 C CA  . ALA D 1 125 ? 22.399  32.770  39.889 1.00 107.50 ? 125  ALA D CA  1 
ATOM   7246 C C   . ALA D 1 125 ? 20.966  32.419  39.528 1.00 102.79 ? 125  ALA D C   1 
ATOM   7247 O O   . ALA D 1 125 ? 20.684  31.307  39.104 1.00 99.33  ? 125  ALA D O   1 
ATOM   7248 C CB  . ALA D 1 125 ? 22.597  32.663  41.378 1.00 105.58 ? 125  ALA D CB  1 
ATOM   7249 N N   . VAL D 1 126 ? 20.063  33.376  39.700 1.00 120.49 ? 126  VAL D N   1 
ATOM   7250 C CA  . VAL D 1 126 ? 18.652  33.162  39.398 1.00 116.97 ? 126  VAL D CA  1 
ATOM   7251 C C   . VAL D 1 126 ? 18.409  33.116  37.895 1.00 119.49 ? 126  VAL D C   1 
ATOM   7252 O O   . VAL D 1 126 ? 17.658  32.274  37.399 1.00 116.24 ? 126  VAL D O   1 
ATOM   7253 C CB  . VAL D 1 126 ? 17.770  34.259  40.024 1.00 117.52 ? 126  VAL D CB  1 
ATOM   7254 C CG1 . VAL D 1 126 ? 16.342  34.158  39.509 1.00 115.22 ? 126  VAL D CG1 1 
ATOM   7255 C CG2 . VAL D 1 126 ? 17.803  34.156  41.535 1.00 114.83 ? 126  VAL D CG2 1 
ATOM   7256 N N   . ALA D 1 127 ? 19.051  34.027  37.175 1.00 82.41  ? 127  ALA D N   1 
ATOM   7257 C CA  . ALA D 1 127 ? 18.927  34.077  35.725 1.00 83.58  ? 127  ALA D CA  1 
ATOM   7258 C C   . ALA D 1 127 ? 19.424  32.775  35.111 1.00 82.99  ? 127  ALA D C   1 
ATOM   7259 O O   . ALA D 1 127 ? 18.735  32.159  34.299 1.00 79.69  ? 127  ALA D O   1 
ATOM   7260 C CB  . ALA D 1 127 ? 19.705  35.258  35.172 1.00 85.54  ? 127  ALA D CB  1 
ATOM   7261 N N   . ALA D 1 128 ? 20.623  32.363  35.510 1.00 94.97  ? 128  ALA D N   1 
ATOM   7262 C CA  . ALA D 1 128 ? 21.212  31.119  35.035 1.00 93.74  ? 128  ALA D CA  1 
ATOM   7263 C C   . ALA D 1 128 ? 20.228  29.962  35.143 1.00 88.10  ? 128  ALA D C   1 
ATOM   7264 O O   . ALA D 1 128 ? 19.928  29.309  34.145 1.00 86.33  ? 128  ALA D O   1 
ATOM   7265 C CB  . ALA D 1 128 ? 22.474  30.804  35.808 1.00 94.93  ? 128  ALA D CB  1 
ATOM   7266 N N   . SER D 1 129 ? 19.736  29.708  36.355 1.00 99.13  ? 129  SER D N   1 
ATOM   7267 C CA  . SER D 1 129 ? 18.820  28.597  36.604 1.00 92.88  ? 129  SER D CA  1 
ATOM   7268 C C   . SER D 1 129 ? 17.653  28.638  35.638 1.00 93.00  ? 129  SER D C   1 
ATOM   7269 O O   . SER D 1 129 ? 17.340  27.643  34.989 1.00 91.41  ? 129  SER D O   1 
ATOM   7270 C CB  . SER D 1 129 ? 18.288  28.651  38.032 1.00 87.95  ? 129  SER D CB  1 
ATOM   7271 O OG  . SER D 1 129 ? 19.263  29.172  38.914 1.00 90.26  ? 129  SER D OG  1 
ATOM   7272 N N   . LEU D 1 130 ? 17.001  29.792  35.554 1.00 80.62  ? 130  LEU D N   1 
ATOM   7273 C CA  . LEU D 1 130 ? 15.916  29.969  34.602 1.00 78.47  ? 130  LEU D CA  1 
ATOM   7274 C C   . LEU D 1 130 ? 16.395  29.596  33.204 1.00 79.40  ? 130  LEU D C   1 
ATOM   7275 O O   . LEU D 1 130 ? 15.870  28.669  32.596 1.00 76.45  ? 130  LEU D O   1 
ATOM   7276 C CB  . LEU D 1 130 ? 15.385  31.399  34.648 1.00 80.42  ? 130  LEU D CB  1 
ATOM   7277 C CG  . LEU D 1 130 ? 14.629  31.676  35.946 1.00 79.04  ? 130  LEU D CG  1 
ATOM   7278 C CD1 . LEU D 1 130 ? 14.389  33.157  36.138 1.00 82.14  ? 130  LEU D CD1 1 
ATOM   7279 C CD2 . LEU D 1 130 ? 13.319  30.908  35.971 1.00 74.05  ? 130  LEU D CD2 1 
ATOM   7280 N N   . ILE D 1 131 ? 17.407  30.302  32.706 1.00 70.37  ? 131  ILE D N   1 
ATOM   7281 C CA  . ILE D 1 131 ? 17.989  29.973  31.411 1.00 72.11  ? 131  ILE D CA  1 
ATOM   7282 C C   . ILE D 1 131 ? 18.144  28.469  31.271 1.00 69.48  ? 131  ILE D C   1 
ATOM   7283 O O   . ILE D 1 131 ? 17.547  27.868  30.390 1.00 67.66  ? 131  ILE D O   1 
ATOM   7284 C CB  . ILE D 1 131 ? 19.371  30.615  31.203 1.00 77.62  ? 131  ILE D CB  1 
ATOM   7285 C CG1 . ILE D 1 131 ? 19.324  32.114  31.491 1.00 80.74  ? 131  ILE D CG1 1 
ATOM   7286 C CG2 . ILE D 1 131 ? 19.852  30.377  29.780 1.00 80.28  ? 131  ILE D CG2 1 
ATOM   7287 C CD1 . ILE D 1 131 ? 18.686  32.921  30.392 1.00 81.15  ? 131  ILE D CD1 1 
ATOM   7288 N N   . TYR D 1 132 ? 18.939  27.858  32.145 1.00 74.80  ? 132  TYR D N   1 
ATOM   7289 C CA  . TYR D 1 132 ? 19.170  26.418  32.066 1.00 73.11  ? 132  TYR D CA  1 
ATOM   7290 C C   . TYR D 1 132 ? 17.872  25.615  32.102 1.00 68.01  ? 132  TYR D C   1 
ATOM   7291 O O   . TYR D 1 132 ? 17.701  24.663  31.346 1.00 66.63  ? 132  TYR D O   1 
ATOM   7292 C CB  . TYR D 1 132 ? 20.091  25.928  33.180 1.00 74.53  ? 132  TYR D CB  1 
ATOM   7293 C CG  . TYR D 1 132 ? 20.147  24.414  33.250 1.00 72.61  ? 132  TYR D CG  1 
ATOM   7294 C CD1 . TYR D 1 132 ? 21.265  23.713  32.805 1.00 75.45  ? 132  TYR D CD1 1 
ATOM   7295 C CD2 . TYR D 1 132 ? 19.070  23.683  33.745 1.00 66.29  ? 132  TYR D CD2 1 
ATOM   7296 C CE1 . TYR D 1 132 ? 21.312  22.331  32.863 1.00 72.52  ? 132  TYR D CE1 1 
ATOM   7297 C CE2 . TYR D 1 132 ? 19.107  22.302  33.804 1.00 64.88  ? 132  TYR D CE2 1 
ATOM   7298 C CZ  . TYR D 1 132 ? 20.228  21.630  33.363 1.00 67.98  ? 132  TYR D CZ  1 
ATOM   7299 O OH  . TYR D 1 132 ? 20.260  20.254  33.427 1.00 68.40  ? 132  TYR D OH  1 
ATOM   7300 N N   . ALA D 1 133 ? 16.969  25.984  33.001 1.00 79.56  ? 133  ALA D N   1 
ATOM   7301 C CA  . ALA D 1 133 ? 15.696  25.286  33.127 1.00 75.15  ? 133  ALA D CA  1 
ATOM   7302 C C   . ALA D 1 133 ? 14.925  25.309  31.812 1.00 74.11  ? 133  ALA D C   1 
ATOM   7303 O O   . ALA D 1 133 ? 14.438  24.277  31.356 1.00 71.86  ? 133  ALA D O   1 
ATOM   7304 C CB  . ALA D 1 133 ? 14.865  25.890  34.246 1.00 73.64  ? 133  ALA D CB  1 
ATOM   7305 N N   . ARG D 1 134 ? 14.809  26.485  31.200 1.00 90.23  ? 134  ARG D N   1 
ATOM   7306 C CA  . ARG D 1 134 ? 14.112  26.580  29.921 1.00 90.14  ? 134  ARG D CA  1 
ATOM   7307 C C   . ARG D 1 134 ? 14.949  26.078  28.749 1.00 92.83  ? 134  ARG D C   1 
ATOM   7308 O O   . ARG D 1 134 ? 14.408  25.567  27.773 1.00 92.22  ? 134  ARG D O   1 
ATOM   7309 C CB  . ARG D 1 134 ? 13.579  27.993  29.651 1.00 91.99  ? 134  ARG D CB  1 
ATOM   7310 C CG  . ARG D 1 134 ? 14.238  29.114  30.419 1.00 94.68  ? 134  ARG D CG  1 
ATOM   7311 C CD  . ARG D 1 134 ? 13.435  30.378  30.206 1.00 95.85  ? 134  ARG D CD  1 
ATOM   7312 N NE  . ARG D 1 134 ? 13.095  30.514  28.793 1.00 97.46  ? 134  ARG D NE  1 
ATOM   7313 C CZ  . ARG D 1 134 ? 11.987  31.084  28.333 1.00 90.31  ? 134  ARG D CZ  1 
ATOM   7314 N NH1 . ARG D 1 134 ? 11.088  31.577  29.173 1.00 84.09  ? 134  ARG D NH1 1 
ATOM   7315 N NH2 . ARG D 1 134 ? 11.773  31.152  27.026 1.00 88.40  ? 134  ARG D NH2 1 
ATOM   7316 N N   . PHE D 1 135 ? 16.265  26.205  28.853 1.00 93.64  ? 135  PHE D N   1 
ATOM   7317 C CA  . PHE D 1 135 ? 17.140  25.838  27.749 1.00 97.23  ? 135  PHE D CA  1 
ATOM   7318 C C   . PHE D 1 135 ? 17.257  24.325  27.578 1.00 95.55  ? 135  PHE D C   1 
ATOM   7319 O O   . PHE D 1 135 ? 17.272  23.822  26.458 1.00 96.97  ? 135  PHE D O   1 
ATOM   7320 C CB  . PHE D 1 135 ? 18.525  26.474  27.923 1.00 101.93 ? 135  PHE D CB  1 
ATOM   7321 C CG  . PHE D 1 135 ? 19.335  26.514  26.660 1.00 106.72 ? 135  PHE D CG  1 
ATOM   7322 C CD1 . PHE D 1 135 ? 18.950  27.324  25.604 1.00 109.38 ? 135  PHE D CD1 1 
ATOM   7323 C CD2 . PHE D 1 135 ? 20.481  25.746  26.527 1.00 109.12 ? 135  PHE D CD2 1 
ATOM   7324 C CE1 . PHE D 1 135 ? 19.689  27.364  24.432 1.00 114.45 ? 135  PHE D CE1 1 
ATOM   7325 C CE2 . PHE D 1 135 ? 21.226  25.780  25.359 1.00 114.00 ? 135  PHE D CE2 1 
ATOM   7326 C CZ  . PHE D 1 135 ? 20.828  26.592  24.309 1.00 116.75 ? 135  PHE D CZ  1 
ATOM   7327 N N   . THR D 1 136 ? 17.332  23.598  28.688 1.00 126.73 ? 136  THR D N   1 
ATOM   7328 C CA  . THR D 1 136 ? 17.578  22.155  28.631 1.00 125.97 ? 136  THR D CA  1 
ATOM   7329 C C   . THR D 1 136 ? 16.323  21.321  28.433 1.00 121.96 ? 136  THR D C   1 
ATOM   7330 O O   . THR D 1 136 ? 15.974  20.477  29.262 1.00 119.12 ? 136  THR D O   1 
ATOM   7331 C CB  . THR D 1 136 ? 18.337  21.630  29.868 1.00 126.04 ? 136  THR D CB  1 
ATOM   7332 O OG1 . THR D 1 136 ? 17.713  22.118  31.062 1.00 123.55 ? 136  THR D OG1 1 
ATOM   7333 C CG2 . THR D 1 136 ? 19.797  22.075  29.827 1.00 130.89 ? 136  THR D CG2 1 
ATOM   7334 N N   . ARG D 1 137 ? 15.647  21.567  27.325 1.00 148.89 ? 137  ARG D N   1 
ATOM   7335 C CA  . ARG D 1 137 ? 14.564  20.706  26.909 1.00 145.88 ? 137  ARG D CA  1 
ATOM   7336 C C   . ARG D 1 137 ? 14.909  20.170  25.525 1.00 148.39 ? 137  ARG D C   1 
ATOM   7337 O O   . ARG D 1 137 ? 14.779  20.860  24.518 1.00 150.97 ? 137  ARG D O   1 
ATOM   7338 C CB  . ARG D 1 137 ? 13.255  21.475  26.882 1.00 143.50 ? 137  ARG D CB  1 
ATOM   7339 C CG  . ARG D 1 137 ? 12.998  22.225  28.154 1.00 141.53 ? 137  ARG D CG  1 
ATOM   7340 C CD  . ARG D 1 137 ? 11.855  23.166  27.943 1.00 140.25 ? 137  ARG D CD  1 
ATOM   7341 N NE  . ARG D 1 137 ? 11.440  23.826  29.168 1.00 138.31 ? 137  ARG D NE  1 
ATOM   7342 C CZ  . ARG D 1 137 ? 10.280  24.455  29.297 1.00 133.29 ? 137  ARG D CZ  1 
ATOM   7343 N NH1 . ARG D 1 137 ? 9.433   24.493  28.275 1.00 128.68 ? 137  ARG D NH1 1 
ATOM   7344 N NH2 . ARG D 1 137 ? 9.962   25.038  30.443 1.00 127.92 ? 137  ARG D NH2 1 
ATOM   7345 N N   . PRO D 1 138 ? 14.416  18.167  25.909 1.00 101.50 ? 138  PRO D N   1 
ATOM   7346 C CA  . PRO D 1 138 ? 14.783  17.404  24.721 1.00 95.42  ? 138  PRO D CA  1 
ATOM   7347 C C   . PRO D 1 138 ? 13.504  17.140  23.963 1.00 87.60  ? 138  PRO D C   1 
ATOM   7348 O O   . PRO D 1 138 ? 12.446  17.502  24.465 1.00 87.46  ? 138  PRO D O   1 
ATOM   7349 C CB  . PRO D 1 138 ? 15.333  16.108  25.312 1.00 93.87  ? 138  PRO D CB  1 
ATOM   7350 C CG  . PRO D 1 138 ? 15.798  16.487  26.672 1.00 98.14  ? 138  PRO D CG  1 
ATOM   7351 C CD  . PRO D 1 138 ? 14.805  17.486  27.149 1.00 108.61 ? 138  PRO D CD  1 
ATOM   7352 N N   . THR D 1 139 ? 13.588  16.541  22.785 1.00 93.66  ? 139  THR D N   1 
ATOM   7353 C CA  . THR D 1 139 ? 12.394  16.086  22.094 1.00 87.55  ? 139  THR D CA  1 
ATOM   7354 C C   . THR D 1 139 ? 12.700  14.727  21.512 1.00 85.23  ? 139  THR D C   1 
ATOM   7355 O O   . THR D 1 139 ? 13.646  14.589  20.744 1.00 85.74  ? 139  THR D O   1 
ATOM   7356 C CB  . THR D 1 139 ? 12.000  17.032  20.955 1.00 84.48  ? 139  THR D CB  1 
ATOM   7357 O OG1 . THR D 1 139 ? 13.182  17.461  20.270 1.00 86.47  ? 139  THR D OG1 1 
ATOM   7358 C CG2 . THR D 1 139 ? 11.273  18.247  21.499 1.00 85.73  ? 139  THR D CG2 1 
ATOM   7359 N N   . ALA D 1 140 ? 11.923  13.718  21.893 1.00 83.18  ? 140  ALA D N   1 
ATOM   7360 C CA  . ALA D 1 140 ? 12.084  12.395  21.307 1.00 79.66  ? 140  ALA D CA  1 
ATOM   7361 C C   . ALA D 1 140 ? 12.106  12.534  19.787 1.00 77.97  ? 140  ALA D C   1 
ATOM   7362 O O   . ALA D 1 140 ? 11.210  13.147  19.198 1.00 75.60  ? 140  ALA D O   1 
ATOM   7363 C CB  . ALA D 1 140 ? 10.957  11.490  21.739 1.00 77.02  ? 140  ALA D CB  1 
ATOM   7364 N N   . GLY D 1 141 ? 13.133  11.985  19.151 1.00 107.85 ? 141  GLY D N   1 
ATOM   7365 C CA  . GLY D 1 141 ? 13.230  12.073  17.707 1.00 107.75 ? 141  GLY D CA  1 
ATOM   7366 C C   . GLY D 1 141 ? 12.224  11.160  17.040 1.00 104.15 ? 141  GLY D C   1 
ATOM   7367 O O   . GLY D 1 141 ? 12.483  10.630  15.966 1.00 101.26 ? 141  GLY D O   1 
ATOM   7368 N N   . VAL D 1 142 ? 11.065  10.988  17.669 1.00 72.40  ? 142  VAL D N   1 
ATOM   7369 C CA  . VAL D 1 142 ? 10.123  9.943   17.269 1.00 69.38  ? 142  VAL D CA  1 
ATOM   7370 C C   . VAL D 1 142 ? 9.074   10.372  16.246 1.00 70.17  ? 142  VAL D C   1 
ATOM   7371 O O   . VAL D 1 142 ? 8.422   11.405  16.403 1.00 69.76  ? 142  VAL D O   1 
ATOM   7372 C CB  . VAL D 1 142 ? 9.403   9.353   18.486 1.00 68.37  ? 142  VAL D CB  1 
ATOM   7373 C CG1 . VAL D 1 142 ? 8.553   8.172   18.069 1.00 65.77  ? 142  VAL D CG1 1 
ATOM   7374 C CG2 . VAL D 1 142 ? 10.410  8.923   19.515 1.00 66.19  ? 142  VAL D CG2 1 
ATOM   7375 N N   . LEU D 1 143 ? 8.913   9.553   15.208 1.00 71.02  ? 143  LEU D N   1 
ATOM   7376 C CA  . LEU D 1 143 ? 7.920   9.779   14.161 1.00 72.88  ? 143  LEU D CA  1 
ATOM   7377 C C   . LEU D 1 143 ? 6.803   8.737   14.225 1.00 71.21  ? 143  LEU D C   1 
ATOM   7378 O O   . LEU D 1 143 ? 7.073   7.542   14.350 1.00 67.84  ? 143  LEU D O   1 
ATOM   7379 C CB  . LEU D 1 143 ? 8.586   9.719   12.787 1.00 72.61  ? 143  LEU D CB  1 
ATOM   7380 C CG  . LEU D 1 143 ? 7.626   9.737   11.599 1.00 74.75  ? 143  LEU D CG  1 
ATOM   7381 C CD1 . LEU D 1 143 ? 7.033   11.125  11.432 1.00 81.44  ? 143  LEU D CD1 1 
ATOM   7382 C CD2 . LEU D 1 143 ? 8.334   9.292   10.333 1.00 72.09  ? 143  LEU D CD2 1 
ATOM   7383 N N   . PHE D 1 144 ? 5.554   9.185   14.125 1.00 74.37  ? 144  PHE D N   1 
ATOM   7384 C CA  . PHE D 1 144 ? 4.414   8.272   14.170 1.00 73.84  ? 144  PHE D CA  1 
ATOM   7385 C C   . PHE D 1 144 ? 3.864   7.984   12.787 1.00 76.91  ? 144  PHE D C   1 
ATOM   7386 O O   . PHE D 1 144 ? 3.651   8.898   11.990 1.00 80.57  ? 144  PHE D O   1 
ATOM   7387 C CB  . PHE D 1 144 ? 3.283   8.854   15.012 1.00 72.49  ? 144  PHE D CB  1 
ATOM   7388 C CG  . PHE D 1 144 ? 3.636   9.054   16.452 1.00 70.29  ? 144  PHE D CG  1 
ATOM   7389 C CD1 . PHE D 1 144 ? 4.423   10.127  16.846 1.00 70.35  ? 144  PHE D CD1 1 
ATOM   7390 C CD2 . PHE D 1 144 ? 3.167   8.183   17.419 1.00 69.45  ? 144  PHE D CD2 1 
ATOM   7391 C CE1 . PHE D 1 144 ? 4.746   10.316  18.177 1.00 70.12  ? 144  PHE D CE1 1 
ATOM   7392 C CE2 . PHE D 1 144 ? 3.483   8.369   18.749 1.00 69.53  ? 144  PHE D CE2 1 
ATOM   7393 C CZ  . PHE D 1 144 ? 4.274   9.436   19.129 1.00 70.14  ? 144  PHE D CZ  1 
ATOM   7394 N N   . SER D 1 145 ? 3.616   6.712   12.506 1.00 72.09  ? 145  SER D N   1 
ATOM   7395 C CA  . SER D 1 145 ? 2.932   6.355   11.278 1.00 73.29  ? 145  SER D CA  1 
ATOM   7396 C C   . SER D 1 145 ? 1.668   7.199   11.194 1.00 78.90  ? 145  SER D C   1 
ATOM   7397 O O   . SER D 1 145 ? 0.901   7.277   12.146 1.00 79.02  ? 145  SER D O   1 
ATOM   7398 C CB  . SER D 1 145 ? 2.599   4.861   11.245 1.00 71.45  ? 145  SER D CB  1 
ATOM   7399 O OG  . SER D 1 145 ? 1.869   4.463   12.392 1.00 72.38  ? 145  SER D OG  1 
ATOM   7400 N N   . SER D 1 146 ? 1.470   7.851   10.056 1.00 72.20  ? 146  SER D N   1 
ATOM   7401 C CA  . SER D 1 146 ? 0.323   8.724   9.856  1.00 69.78  ? 146  SER D CA  1 
ATOM   7402 C C   . SER D 1 146 ? -1.005  7.986   10.022 1.00 71.06  ? 146  SER D C   1 
ATOM   7403 O O   . SER D 1 146 ? -2.028  8.597   10.325 1.00 73.59  ? 146  SER D O   1 
ATOM   7404 C CB  . SER D 1 146 ? 0.395   9.362   8.468  1.00 73.39  ? 146  SER D CB  1 
ATOM   7405 O OG  . SER D 1 146 ? 0.550   8.374   7.463  1.00 73.00  ? 146  SER D OG  1 
ATOM   7406 N N   . ARG D 1 147 ? -0.983  6.671   9.822  1.00 100.78 ? 147  ARG D N   1 
ATOM   7407 C CA  . ARG D 1 147 ? -2.198  5.874   9.889  1.00 102.72 ? 147  ARG D CA  1 
ATOM   7408 C C   . ARG D 1 147 ? -2.050  4.719   10.852 1.00 99.41  ? 147  ARG D C   1 
ATOM   7409 O O   . ARG D 1 147 ? -0.940  4.350   11.234 1.00 95.23  ? 147  ARG D O   1 
ATOM   7410 C CB  . ARG D 1 147 ? -2.535  5.291   8.517  1.00 103.33 ? 147  ARG D CB  1 
ATOM   7411 C CG  . ARG D 1 147 ? -2.938  6.297   7.468  1.00 107.92 ? 147  ARG D CG  1 
ATOM   7412 C CD  . ARG D 1 147 ? -4.254  6.965   7.817  1.00 111.71 ? 147  ARG D CD  1 
ATOM   7413 N NE  . ARG D 1 147 ? -4.498  8.118   6.954  1.00 113.09 ? 147  ARG D NE  1 
ATOM   7414 C CZ  . ARG D 1 147 ? -3.765  9.230   6.979  1.00 113.36 ? 147  ARG D CZ  1 
ATOM   7415 N NH1 . ARG D 1 147 ? -2.744  9.331   7.820  1.00 112.05 ? 147  ARG D NH1 1 
ATOM   7416 N NH2 . ARG D 1 147 ? -4.042  10.240  6.163  1.00 115.49 ? 147  ARG D NH2 1 
ATOM   7417 N N   . MET D 1 148 ? -3.189  4.153   11.238 1.00 91.99  ? 148  MET D N   1 
ATOM   7418 C CA  . MET D 1 148 ? -3.223  2.847   11.872 1.00 90.71  ? 148  MET D CA  1 
ATOM   7419 C C   . MET D 1 148 ? -3.786  1.886   10.849 1.00 92.80  ? 148  MET D C   1 
ATOM   7420 O O   . MET D 1 148 ? -4.304  2.301   9.811  1.00 95.01  ? 148  MET D O   1 
ATOM   7421 C CB  . MET D 1 148 ? -4.131  2.847   13.094 1.00 90.47  ? 148  MET D CB  1 
ATOM   7422 C CG  . MET D 1 148 ? -4.013  4.075   13.954 1.00 87.28  ? 148  MET D CG  1 
ATOM   7423 S SD  . MET D 1 148 ? -4.766  3.813   15.566 1.00 85.36  ? 148  MET D SD  1 
ATOM   7424 C CE  . MET D 1 148 ? -3.645  2.604   16.262 1.00 81.31  ? 148  MET D CE  1 
ATOM   7425 N N   . VAL D 1 149 ? -3.679  0.598   11.133 1.00 74.67  ? 149  VAL D N   1 
ATOM   7426 C CA  . VAL D 1 149 ? -4.312  -0.397  10.291 1.00 78.38  ? 149  VAL D CA  1 
ATOM   7427 C C   . VAL D 1 149 ? -4.876  -1.490  11.173 1.00 81.98  ? 149  VAL D C   1 
ATOM   7428 O O   . VAL D 1 149 ? -4.341  -1.776  12.247 1.00 77.58  ? 149  VAL D O   1 
ATOM   7429 C CB  . VAL D 1 149 ? -3.325  -1.022  9.294  1.00 77.07  ? 149  VAL D CB  1 
ATOM   7430 C CG1 . VAL D 1 149 ? -2.337  0.015   8.812  1.00 72.53  ? 149  VAL D CG1 1 
ATOM   7431 C CG2 . VAL D 1 149 ? -2.591  -2.183  9.931  1.00 77.74  ? 149  VAL D CG2 1 
ATOM   7432 N N   . ILE D 1 150 ? -5.976  -2.082  10.730 1.00 73.12  ? 150  ILE D N   1 
ATOM   7433 C CA  . ILE D 1 150 ? -6.506  -3.256  11.390 1.00 75.11  ? 150  ILE D CA  1 
ATOM   7434 C C   . ILE D 1 150 ? -6.367  -4.400  10.410 1.00 80.51  ? 150  ILE D C   1 
ATOM   7435 O O   . ILE D 1 150 ? -6.910  -4.361  9.314  1.00 84.49  ? 150  ILE D O   1 
ATOM   7436 C CB  . ILE D 1 150 ? -7.964  -3.066  11.819 1.00 78.30  ? 150  ILE D CB  1 
ATOM   7437 C CG1 . ILE D 1 150 ? -8.055  -1.924  12.830 1.00 73.46  ? 150  ILE D CG1 1 
ATOM   7438 C CG2 . ILE D 1 150 ? -8.502  -4.342  12.427 1.00 78.82  ? 150  ILE D CG2 1 
ATOM   7439 C CD1 . ILE D 1 150 ? -9.406  -1.758  13.463 1.00 76.38  ? 150  ILE D CD1 1 
ATOM   7440 N N   . SER D 1 151 ? -5.593  -5.402  10.791 1.00 95.83  ? 151  SER D N   1 
ATOM   7441 C CA  . SER D 1 151 ? -5.341  -6.521  9.907  1.00 101.13 ? 151  SER D CA  1 
ATOM   7442 C C   . SER D 1 151 ? -4.992  -7.758  10.712 1.00 97.09  ? 151  SER D C   1 
ATOM   7443 O O   . SER D 1 151 ? -4.617  -7.668  11.878 1.00 90.39  ? 151  SER D O   1 
ATOM   7444 C CB  . SER D 1 151 ? -4.208  -6.193  8.937  1.00 103.28 ? 151  SER D CB  1 
ATOM   7445 O OG  . SER D 1 151 ? -2.964  -6.596  9.468  1.00 97.31  ? 151  SER D OG  1 
ATOM   7446 N N   . ASP D 1 152 ? -5.117  -8.914  10.076 1.00 106.96 ? 152  ASP D N   1 
ATOM   7447 C CA  . ASP D 1 152 ? -4.814  -10.180 10.716 1.00 104.40 ? 152  ASP D CA  1 
ATOM   7448 C C   . ASP D 1 152 ? -3.328  -10.368 10.892 1.00 99.90  ? 152  ASP D C   1 
ATOM   7449 O O   . ASP D 1 152 ? -2.576  -10.371 9.928  1.00 103.36 ? 152  ASP D O   1 
ATOM   7450 C CB  . ASP D 1 152 ? -5.353  -11.337 9.878  1.00 112.40 ? 152  ASP D CB  1 
ATOM   7451 C CG  . ASP D 1 152 ? -6.835  -11.541 10.058 1.00 116.72 ? 152  ASP D CG  1 
ATOM   7452 O OD1 . ASP D 1 152 ? -7.551  -10.542 10.270 1.00 116.70 ? 152  ASP D OD1 1 
ATOM   7453 O OD2 . ASP D 1 152 ? -7.282  -12.705 9.997  1.00 120.66 ? 152  ASP D OD2 1 
ATOM   7454 N N   . PHE D 1 153 ? -2.911  -10.526 12.137 1.00 133.11 ? 153  PHE D N   1 
ATOM   7455 C CA  . PHE D 1 153 ? -1.560  -10.944 12.427 1.00 130.03 ? 153  PHE D CA  1 
ATOM   7456 C C   . PHE D 1 153 ? -1.661  -12.110 13.388 1.00 128.80 ? 153  PHE D C   1 
ATOM   7457 O O   . PHE D 1 153 ? -2.448  -12.078 14.331 1.00 127.44 ? 153  PHE D O   1 
ATOM   7458 C CB  . PHE D 1 153 ? -0.758  -9.794  13.022 1.00 124.73 ? 153  PHE D CB  1 
ATOM   7459 C CG  . PHE D 1 153 ? 0.509   -10.222 13.682 1.00 121.52 ? 153  PHE D CG  1 
ATOM   7460 C CD1 . PHE D 1 153 ? 1.708   -10.196 12.997 1.00 122.46 ? 153  PHE D CD1 1 
ATOM   7461 C CD2 . PHE D 1 153 ? 0.504   -10.642 14.993 1.00 118.85 ? 153  PHE D CD2 1 
ATOM   7462 C CE1 . PHE D 1 153 ? 2.873   -10.584 13.611 1.00 120.44 ? 153  PHE D CE1 1 
ATOM   7463 C CE2 . PHE D 1 153 ? 1.665   -11.027 15.607 1.00 117.25 ? 153  PHE D CE2 1 
ATOM   7464 C CZ  . PHE D 1 153 ? 2.851   -11.000 14.916 1.00 117.88 ? 153  PHE D CZ  1 
ATOM   7465 N N   . GLU D 1 154 ? -0.885  -13.152 13.127 1.00 156.51 ? 154  GLU D N   1 
ATOM   7466 C CA  . GLU D 1 154 ? -0.893  -14.334 13.971 1.00 156.20 ? 154  GLU D CA  1 
ATOM   7467 C C   . GLU D 1 154 ? -2.304  -14.731 14.381 1.00 158.20 ? 154  GLU D C   1 
ATOM   7468 O O   . GLU D 1 154 ? -2.577  -14.973 15.554 1.00 156.53 ? 154  GLU D O   1 
ATOM   7469 C CB  . GLU D 1 154 ? -0.047  -14.083 15.207 1.00 151.52 ? 154  GLU D CB  1 
ATOM   7470 C CG  . GLU D 1 154 ? 0.919   -15.193 15.523 1.00 152.19 ? 154  GLU D CG  1 
ATOM   7471 C CD  . GLU D 1 154 ? 2.291   -14.652 15.839 1.00 149.66 ? 154  GLU D CD  1 
ATOM   7472 O OE1 . GLU D 1 154 ? 2.371   -13.488 16.269 1.00 146.71 ? 154  GLU D OE1 1 
ATOM   7473 O OE2 . GLU D 1 154 ? 3.289   -15.373 15.648 1.00 151.18 ? 154  GLU D OE2 1 
ATOM   7474 N N   . GLY D 1 155 ? -3.205  -14.762 13.408 1.00 107.83 ? 155  GLY D N   1 
ATOM   7475 C CA  . GLY D 1 155 ? -4.508  -15.374 13.589 1.00 111.61 ? 155  GLY D CA  1 
ATOM   7476 C C   . GLY D 1 155 ? -5.546  -14.626 14.402 1.00 110.44 ? 155  GLY D C   1 
ATOM   7477 O O   . GLY D 1 155 ? -6.555  -15.199 14.788 1.00 113.51 ? 155  GLY D O   1 
ATOM   7478 N N   . LYS D 1 156 ? -5.310  -13.353 14.669 1.00 86.32  ? 156  LYS D N   1 
ATOM   7479 C CA  . LYS D 1 156 ? -6.330  -12.517 15.275 1.00 86.51  ? 156  LYS D CA  1 
ATOM   7480 C C   . LYS D 1 156 ? -6.189  -11.134 14.674 1.00 85.17  ? 156  LYS D C   1 
ATOM   7481 O O   . LYS D 1 156 ? -5.078  -10.662 14.471 1.00 81.68  ? 156  LYS D O   1 
ATOM   7482 C CB  . LYS D 1 156 ? -6.166  -12.475 16.799 1.00 90.99  ? 156  LYS D CB  1 
ATOM   7483 N N   . PRO D 1 157 ? -7.311  -10.480 14.366 1.00 101.08 ? 157  PRO D N   1 
ATOM   7484 C CA  . PRO D 1 157 ? -7.186  -9.127  13.828 1.00 100.47 ? 157  PRO D CA  1 
ATOM   7485 C C   . PRO D 1 157 ? -6.414  -8.270  14.814 1.00 93.97  ? 157  PRO D C   1 
ATOM   7486 O O   . PRO D 1 157 ? -6.666  -8.341  16.013 1.00 92.33  ? 157  PRO D O   1 
ATOM   7487 C CB  . PRO D 1 157 ? -8.636  -8.655  13.740 1.00 105.34 ? 157  PRO D CB  1 
ATOM   7488 C CG  . PRO D 1 157 ? -9.436  -9.887  13.711 1.00 110.37 ? 157  PRO D CG  1 
ATOM   7489 C CD  . PRO D 1 157 ? -8.712  -10.882 14.538 1.00 106.50 ? 157  PRO D CD  1 
ATOM   7490 N N   . THR D 1 158 ? -5.468  -7.487  14.321 1.00 98.43  ? 158  THR D N   1 
ATOM   7491 C CA  . THR D 1 158 ? -4.702  -6.630  15.202 1.00 93.07  ? 158  THR D CA  1 
ATOM   7492 C C   . THR D 1 158 ? -4.673  -5.192  14.723 1.00 92.54  ? 158  THR D C   1 
ATOM   7493 O O   . THR D 1 158 ? -4.382  -4.904  13.564 1.00 94.82  ? 158  THR D O   1 
ATOM   7494 C CB  . THR D 1 158 ? -3.265  -7.138  15.390 1.00 89.66  ? 158  THR D CB  1 
ATOM   7495 O OG1 . THR D 1 158 ? -3.292  -8.531  15.727 1.00 90.86  ? 158  THR D OG1 1 
ATOM   7496 C CG2 . THR D 1 158 ? -2.587  -6.361  16.505 1.00 85.53  ? 158  THR D CG2 1 
ATOM   7497 N N   . LEU D 1 159 ? -5.001  -4.293  15.638 1.00 76.29  ? 159  LEU D N   1 
ATOM   7498 C CA  . LEU D 1 159 ? -4.815  -2.879  15.413 1.00 75.05  ? 159  LEU D CA  1 
ATOM   7499 C C   . LEU D 1 159 ? -3.336  -2.599  15.608 1.00 70.68  ? 159  LEU D C   1 
ATOM   7500 O O   . LEU D 1 159 ? -2.746  -3.020  16.603 1.00 74.10  ? 159  LEU D O   1 
ATOM   7501 C CB  . LEU D 1 159 ? -5.631  -2.082  16.427 1.00 75.06  ? 159  LEU D CB  1 
ATOM   7502 C CG  . LEU D 1 159 ? -5.525  -0.564  16.324 1.00 74.04  ? 159  LEU D CG  1 
ATOM   7503 C CD1 . LEU D 1 159 ? -6.161  -0.088  15.027 1.00 78.32  ? 159  LEU D CD1 1 
ATOM   7504 C CD2 . LEU D 1 159 ? -6.174  0.098   17.531 1.00 74.46  ? 159  LEU D CD2 1 
ATOM   7505 N N   . MET D 1 160 ? -2.725  -1.914  14.653 1.00 80.10  ? 160  MET D N   1 
ATOM   7506 C CA  . MET D 1 160 ? -1.341  -1.502  14.823 1.00 76.69  ? 160  MET D CA  1 
ATOM   7507 C C   . MET D 1 160 ? -1.021  -0.147  14.216 1.00 76.83  ? 160  MET D C   1 
ATOM   7508 O O   . MET D 1 160 ? -1.741  0.359   13.357 1.00 80.42  ? 160  MET D O   1 
ATOM   7509 C CB  . MET D 1 160 ? -0.370  -2.567  14.303 1.00 77.24  ? 160  MET D CB  1 
ATOM   7510 C CG  . MET D 1 160 ? -0.885  -3.413  13.159 1.00 82.19  ? 160  MET D CG  1 
ATOM   7511 S SD  . MET D 1 160 ? 0.029   -4.975  13.065 1.00 82.58  ? 160  MET D SD  1 
ATOM   7512 C CE  . MET D 1 160 ? -1.149  -6.005  12.193 1.00 88.77  ? 160  MET D CE  1 
ATOM   7513 N N   . MET D 1 161 ? 0.061   0.438   14.716 1.00 74.31  ? 161  MET D N   1 
ATOM   7514 C CA  . MET D 1 161 ? 0.702   1.599   14.122 1.00 74.57  ? 161  MET D CA  1 
ATOM   7515 C C   . MET D 1 161 ? 2.181   1.436   14.426 1.00 71.93  ? 161  MET D C   1 
ATOM   7516 O O   . MET D 1 161 ? 2.568   0.463   15.077 1.00 71.20  ? 161  MET D O   1 
ATOM   7517 C CB  . MET D 1 161 ? 0.144   2.910   14.691 1.00 73.52  ? 161  MET D CB  1 
ATOM   7518 C CG  . MET D 1 161 ? -0.123  2.928   16.195 1.00 71.14  ? 161  MET D CG  1 
ATOM   7519 S SD  . MET D 1 161 ? 1.282   3.442   17.214 1.00 68.48  ? 161  MET D SD  1 
ATOM   7520 C CE  . MET D 1 161 ? 2.154   4.523   16.076 1.00 68.81  ? 161  MET D CE  1 
ATOM   7521 N N   . ARG D 1 162 ? 3.019   2.354   13.961 1.00 71.77  ? 162  ARG D N   1 
ATOM   7522 C CA  . ARG D 1 162 ? 4.442   2.194   14.227 1.00 69.08  ? 162  ARG D CA  1 
ATOM   7523 C C   . ARG D 1 162 ? 5.234   3.476   14.429 1.00 67.25  ? 162  ARG D C   1 
ATOM   7524 O O   . ARG D 1 162 ? 4.925   4.519   13.857 1.00 68.34  ? 162  ARG D O   1 
ATOM   7525 C CB  . ARG D 1 162 ? 5.091   1.331   13.153 1.00 69.07  ? 162  ARG D CB  1 
ATOM   7526 C CG  . ARG D 1 162 ? 4.797   1.766   11.738 1.00 69.36  ? 162  ARG D CG  1 
ATOM   7527 C CD  . ARG D 1 162 ? 5.490   0.825   10.782 1.00 69.91  ? 162  ARG D CD  1 
ATOM   7528 N NE  . ARG D 1 162 ? 5.435   1.272   9.399  1.00 69.90  ? 162  ARG D NE  1 
ATOM   7529 C CZ  . ARG D 1 162 ? 6.084   0.668   8.412  1.00 70.55  ? 162  ARG D CZ  1 
ATOM   7530 N NH1 . ARG D 1 162 ? 6.836   -0.398  8.669  1.00 72.01  ? 162  ARG D NH1 1 
ATOM   7531 N NH2 . ARG D 1 162 ? 5.986   1.125   7.173  1.00 70.65  ? 162  ARG D NH2 1 
ATOM   7532 N N   . LEU D 1 163 ? 6.265   3.368   15.258 1.00 82.29  ? 163  LEU D N   1 
ATOM   7533 C CA  . LEU D 1 163 ? 7.141   4.482   15.568 1.00 81.26  ? 163  LEU D CA  1 
ATOM   7534 C C   . LEU D 1 163 ? 8.489   4.279   14.911 1.00 79.29  ? 163  LEU D C   1 
ATOM   7535 O O   . LEU D 1 163 ? 9.010   3.164   14.880 1.00 78.76  ? 163  LEU D O   1 
ATOM   7536 C CB  . LEU D 1 163 ? 7.379   4.554   17.071 1.00 81.09  ? 163  LEU D CB  1 
ATOM   7537 C CG  . LEU D 1 163 ? 6.192   4.461   18.017 1.00 83.10  ? 163  LEU D CG  1 
ATOM   7538 C CD1 . LEU D 1 163 ? 6.627   3.768   19.296 1.00 82.43  ? 163  LEU D CD1 1 
ATOM   7539 C CD2 . LEU D 1 163 ? 5.644   5.841   18.303 1.00 84.72  ? 163  LEU D CD2 1 
ATOM   7540 N N   . ALA D 1 164 ? 9.068   5.360   14.408 1.00 72.55  ? 164  ALA D N   1 
ATOM   7541 C CA  . ALA D 1 164 ? 10.446  5.320   13.953 1.00 70.98  ? 164  ALA D CA  1 
ATOM   7542 C C   . ALA D 1 164 ? 11.270  6.358   14.703 1.00 71.44  ? 164  ALA D C   1 
ATOM   7543 O O   . ALA D 1 164 ? 10.872  7.515   14.813 1.00 74.11  ? 164  ALA D O   1 
ATOM   7544 C CB  . ALA D 1 164 ? 10.527  5.551   12.455 1.00 71.28  ? 164  ALA D CB  1 
ATOM   7545 N N   . ASN D 1 165 ? 12.407  5.922   15.236 1.00 80.52  ? 165  ASN D N   1 
ATOM   7546 C CA  . ASN D 1 165 ? 13.378  6.812   15.858 1.00 81.18  ? 165  ASN D CA  1 
ATOM   7547 C C   . ASN D 1 165 ? 14.091  7.599   14.772 1.00 82.22  ? 165  ASN D C   1 
ATOM   7548 O O   . ASN D 1 165 ? 14.600  7.017   13.821 1.00 80.93  ? 165  ASN D O   1 
ATOM   7549 C CB  . ASN D 1 165 ? 14.384  5.983   16.662 1.00 79.76  ? 165  ASN D CB  1 
ATOM   7550 C CG  . ASN D 1 165 ? 15.520  6.814   17.230 1.00 80.58  ? 165  ASN D CG  1 
ATOM   7551 O OD1 . ASN D 1 165 ? 15.624  8.009   16.969 1.00 82.67  ? 165  ASN D OD1 1 
ATOM   7552 N ND2 . ASN D 1 165 ? 16.381  6.176   18.020 1.00 80.00  ? 165  ASN D ND2 1 
ATOM   7553 N N   . LEU D 1 166 ? 14.127  8.920   14.908 1.00 71.09  ? 166  LEU D N   1 
ATOM   7554 C CA  . LEU D 1 166 ? 14.678  9.778   13.858 1.00 73.86  ? 166  LEU D CA  1 
ATOM   7555 C C   . LEU D 1 166 ? 16.150  10.121  14.043 1.00 74.31  ? 166  LEU D C   1 
ATOM   7556 O O   . LEU D 1 166 ? 16.744  10.785  13.198 1.00 67.38  ? 166  LEU D O   1 
ATOM   7557 C CB  . LEU D 1 166 ? 13.867  11.068  13.722 1.00 70.36  ? 166  LEU D CB  1 
ATOM   7558 C CG  . LEU D 1 166 ? 12.531  10.861  13.019 1.00 70.78  ? 166  LEU D CG  1 
ATOM   7559 C CD1 . LEU D 1 166 ? 11.868  12.176  12.709 1.00 68.19  ? 166  LEU D CD1 1 
ATOM   7560 C CD2 . LEU D 1 166 ? 12.767  10.073  11.750 1.00 67.44  ? 166  LEU D CD2 1 
ATOM   7561 N N   . ARG D 1 167 ? 16.737  9.674   15.145 1.00 69.73  ? 167  ARG D N   1 
ATOM   7562 C CA  . ARG D 1 167 ? 18.133  9.973   15.424 1.00 70.65  ? 167  ARG D CA  1 
ATOM   7563 C C   . ARG D 1 167 ? 18.956  8.707   15.608 1.00 67.14  ? 167  ARG D C   1 
ATOM   7564 O O   . ARG D 1 167 ? 18.415  7.624   15.843 1.00 66.66  ? 167  ARG D O   1 
ATOM   7565 C CB  . ARG D 1 167 ? 18.247  10.839  16.673 1.00 74.03  ? 167  ARG D CB  1 
ATOM   7566 C CG  . ARG D 1 167 ? 17.469  12.122  16.607 1.00 79.84  ? 167  ARG D CG  1 
ATOM   7567 C CD  . ARG D 1 167 ? 17.348  12.717  17.984 1.00 83.26  ? 167  ARG D CD  1 
ATOM   7568 N NE  . ARG D 1 167 ? 16.964  14.121  17.945 1.00 91.66  ? 167  ARG D NE  1 
ATOM   7569 C CZ  . ARG D 1 167 ? 16.127  14.672  18.813 1.00 96.25  ? 167  ARG D CZ  1 
ATOM   7570 N NH1 . ARG D 1 167 ? 15.587  13.922  19.764 1.00 92.24  ? 167  ARG D NH1 1 
ATOM   7571 N NH2 . ARG D 1 167 ? 15.818  15.958  18.724 1.00 98.05  ? 167  ARG D NH2 1 
ATOM   7572 N N   . ILE D 1 168 ? 20.271  8.861   15.514 1.00 68.26  ? 168  ILE D N   1 
ATOM   7573 C CA  . ILE D 1 168 ? 21.204  7.755   15.658 1.00 67.65  ? 168  ILE D CA  1 
ATOM   7574 C C   . ILE D 1 168 ? 21.232  7.248   17.095 1.00 68.66  ? 168  ILE D C   1 
ATOM   7575 O O   . ILE D 1 168 ? 21.459  6.063   17.343 1.00 68.34  ? 168  ILE D O   1 
ATOM   7576 C CB  . ILE D 1 168 ? 22.626  8.183   15.260 1.00 69.53  ? 168  ILE D CB  1 
ATOM   7577 C CG1 . ILE D 1 168 ? 22.583  9.304   14.217 1.00 68.80  ? 168  ILE D CG1 1 
ATOM   7578 C CG2 . ILE D 1 168 ? 23.410  6.990   14.742 1.00 68.89  ? 168  ILE D CG2 1 
ATOM   7579 C CD1 . ILE D 1 168 ? 22.151  10.668  14.763 1.00 69.45  ? 168  ILE D CD1 1 
ATOM   7580 N N   . GLU D 1 169 ? 21.003  8.158   18.037 1.00 82.27  ? 169  GLU D N   1 
ATOM   7581 C CA  . GLU D 1 169 ? 21.007  7.820   19.454 1.00 82.24  ? 169  GLU D CA  1 
ATOM   7582 C C   . GLU D 1 169 ? 19.832  6.908   19.800 1.00 80.35  ? 169  GLU D C   1 
ATOM   7583 O O   . GLU D 1 169 ? 18.815  6.911   19.110 1.00 79.49  ? 169  GLU D O   1 
ATOM   7584 C CB  . GLU D 1 169 ? 20.979  9.092   20.303 1.00 85.26  ? 169  GLU D CB  1 
ATOM   7585 C CG  . GLU D 1 169 ? 22.215  9.971   20.146 1.00 88.48  ? 169  GLU D CG  1 
ATOM   7586 C CD  . GLU D 1 169 ? 22.280  10.672  18.800 1.00 90.10  ? 169  GLU D CD  1 
ATOM   7587 O OE1 . GLU D 1 169 ? 21.266  10.667  18.071 1.00 89.15  ? 169  GLU D OE1 1 
ATOM   7588 O OE2 . GLU D 1 169 ? 23.347  11.235  18.471 1.00 92.82  ? 169  GLU D OE2 1 
ATOM   7589 N N   . GLN D 1 170 ? 19.974  6.127   20.866 1.00 90.32  ? 170  GLN D N   1 
ATOM   7590 C CA  . GLN D 1 170 ? 18.972  5.126   21.201 1.00 89.58  ? 170  GLN D CA  1 
ATOM   7591 C C   . GLN D 1 170 ? 18.108  5.565   22.370 1.00 89.93  ? 170  GLN D C   1 
ATOM   7592 O O   . GLN D 1 170 ? 18.524  6.382   23.189 1.00 91.18  ? 170  GLN D O   1 
ATOM   7593 C CB  . GLN D 1 170 ? 19.657  3.809   21.539 1.00 91.02  ? 170  GLN D CB  1 
ATOM   7594 C CG  . GLN D 1 170 ? 20.979  3.631   20.833 1.00 92.15  ? 170  GLN D CG  1 
ATOM   7595 C CD  . GLN D 1 170 ? 21.277  2.180   20.563 1.00 94.96  ? 170  GLN D CD  1 
ATOM   7596 O OE1 . GLN D 1 170 ? 21.335  1.365   21.483 1.00 97.71  ? 170  GLN D OE1 1 
ATOM   7597 N NE2 . GLN D 1 170 ? 21.454  1.840   19.291 1.00 95.41  ? 170  GLN D NE2 1 
ATOM   7598 N N   . ILE D 1 171 ? 16.903  5.016   22.451 1.00 76.79  ? 171  ILE D N   1 
ATOM   7599 C CA  . ILE D 1 171 ? 16.026  5.314   23.570 1.00 77.53  ? 171  ILE D CA  1 
ATOM   7600 C C   . ILE D 1 171 ? 15.871  4.081   24.458 1.00 78.29  ? 171  ILE D C   1 
ATOM   7601 O O   . ILE D 1 171 ? 15.520  3.004   23.984 1.00 78.70  ? 171  ILE D O   1 
ATOM   7602 C CB  . ILE D 1 171 ? 14.665  5.815   23.082 1.00 77.54  ? 171  ILE D CB  1 
ATOM   7603 C CG1 . ILE D 1 171 ? 14.870  6.926   22.054 1.00 68.03  ? 171  ILE D CG1 1 
ATOM   7604 C CG2 . ILE D 1 171 ? 13.826  6.306   24.249 1.00 69.13  ? 171  ILE D CG2 1 
ATOM   7605 C CD1 . ILE D 1 171 ? 13.602  7.624   21.650 1.00 72.25  ? 171  ILE D CD1 1 
ATOM   7606 N N   . ILE D 1 172 ? 16.145  4.239   25.746 1.00 84.24  ? 172  ILE D N   1 
ATOM   7607 C CA  . ILE D 1 172 ? 16.179  3.091   26.641 1.00 85.97  ? 172  ILE D CA  1 
ATOM   7608 C C   . ILE D 1 172 ? 14.919  2.947   27.488 1.00 86.78  ? 172  ILE D C   1 
ATOM   7609 O O   . ILE D 1 172 ? 14.296  3.935   27.884 1.00 86.47  ? 172  ILE D O   1 
ATOM   7610 C CB  . ILE D 1 172 ? 17.419  3.115   27.545 1.00 87.47  ? 172  ILE D CB  1 
ATOM   7611 C CG1 . ILE D 1 172 ? 17.398  4.364   28.426 1.00 87.50  ? 172  ILE D CG1 1 
ATOM   7612 C CG2 . ILE D 1 172 ? 18.681  3.064   26.695 1.00 87.54  ? 172  ILE D CG2 1 
ATOM   7613 C CD1 . ILE D 1 172 ? 17.940  4.143   29.811 1.00 89.65  ? 172  ILE D CD1 1 
ATOM   7614 N N   . GLU D 1 173 ? 14.566  1.697   27.768 1.00 109.35 ? 173  GLU D N   1 
ATOM   7615 C CA  . GLU D 1 173 ? 13.311  1.375   28.427 1.00 110.66 ? 173  GLU D CA  1 
ATOM   7616 C C   . GLU D 1 173 ? 12.206  2.261   27.881 1.00 108.68 ? 173  GLU D C   1 
ATOM   7617 O O   . GLU D 1 173 ? 11.478  2.915   28.629 1.00 109.08 ? 173  GLU D O   1 
ATOM   7618 C CB  . GLU D 1 173 ? 13.430  1.508   29.946 1.00 112.24 ? 173  GLU D CB  1 
ATOM   7619 C CG  . GLU D 1 173 ? 13.653  2.924   30.438 1.00 110.81 ? 173  GLU D CG  1 
ATOM   7620 C CD  . GLU D 1 173 ? 13.652  3.026   31.952 1.00 112.86 ? 173  GLU D CD  1 
ATOM   7621 O OE1 . GLU D 1 173 ? 13.611  1.973   32.630 1.00 115.27 ? 173  GLU D OE1 1 
ATOM   7622 O OE2 . GLU D 1 173 ? 13.694  4.166   32.463 1.00 113.02 ? 173  GLU D OE2 1 
ATOM   7623 N N   . ALA D 1 174 ? 12.106  2.288   26.558 1.00 71.66  ? 174  ALA D N   1 
ATOM   7624 C CA  . ALA D 1 174 ? 11.036  3.000   25.889 1.00 70.75  ? 174  ALA D CA  1 
ATOM   7625 C C   . ALA D 1 174 ? 9.763   2.191   26.058 1.00 72.53  ? 174  ALA D C   1 
ATOM   7626 O O   . ALA D 1 174 ? 9.809   0.968   26.110 1.00 74.47  ? 174  ALA D O   1 
ATOM   7627 C CB  . ALA D 1 174 ? 11.366  3.181   24.415 1.00 69.15  ? 174  ALA D CB  1 
ATOM   7628 N N   . ASP D 1 175 ? 8.628   2.870   26.164 1.00 102.45 ? 175  ASP D N   1 
ATOM   7629 C CA  . ASP D 1 175 ? 7.352   2.174   26.239 1.00 104.46 ? 175  ASP D CA  1 
ATOM   7630 C C   . ASP D 1 175 ? 6.208   3.038   25.731 1.00 105.05 ? 175  ASP D C   1 
ATOM   7631 O O   . ASP D 1 175 ? 6.317   4.264   25.680 1.00 105.09 ? 175  ASP D O   1 
ATOM   7632 C CB  . ASP D 1 175 ? 7.083   1.649   27.655 1.00 106.82 ? 175  ASP D CB  1 
ATOM   7633 C CG  . ASP D 1 175 ? 6.813   2.751   28.653 1.00 107.34 ? 175  ASP D CG  1 
ATOM   7634 O OD1 . ASP D 1 175 ? 6.192   3.771   28.280 1.00 107.70 ? 175  ASP D OD1 1 
ATOM   7635 O OD2 . ASP D 1 175 ? 7.213   2.584   29.823 1.00 108.33 ? 175  ASP D OD2 1 
ATOM   7636 N N   . VAL D 1 176 ? 5.112   2.390   25.358 1.00 76.02  ? 176  VAL D N   1 
ATOM   7637 C CA  . VAL D 1 176 ? 4.043   3.081   24.659 1.00 75.56  ? 176  VAL D CA  1 
ATOM   7638 C C   . VAL D 1 176 ? 2.651   2.660   25.145 1.00 78.81  ? 176  VAL D C   1 
ATOM   7639 O O   . VAL D 1 176 ? 2.442   1.518   25.537 1.00 80.21  ? 176  VAL D O   1 
ATOM   7640 C CB  . VAL D 1 176 ? 4.191   2.879   23.135 1.00 74.11  ? 176  VAL D CB  1 
ATOM   7641 C CG1 . VAL D 1 176 ? 3.810   1.477   22.756 1.00 75.47  ? 176  VAL D CG1 1 
ATOM   7642 C CG2 . VAL D 1 176 ? 3.361   3.891   22.368 1.00 75.09  ? 176  VAL D CG2 1 
ATOM   7643 N N   . HIS D 1 177 ? 1.714   3.608   25.136 1.00 99.16  ? 177  HIS D N   1 
ATOM   7644 C CA  . HIS D 1 177 ? 0.332   3.354   25.528 1.00 102.81 ? 177  HIS D CA  1 
ATOM   7645 C C   . HIS D 1 177 ? -0.598  3.622   24.375 1.00 103.26 ? 177  HIS D C   1 
ATOM   7646 O O   . HIS D 1 177 ? -0.527  4.676   23.743 1.00 102.43 ? 177  HIS D O   1 
ATOM   7647 C CB  . HIS D 1 177 ? -0.089  4.270   26.666 1.00 105.85 ? 177  HIS D CB  1 
ATOM   7648 C CG  . HIS D 1 177 ? 0.562   3.953   27.969 1.00 105.11 ? 177  HIS D CG  1 
ATOM   7649 N ND1 . HIS D 1 177 ? 0.001   3.097   28.890 1.00 107.03 ? 177  HIS D ND1 1 
ATOM   7650 C CD2 . HIS D 1 177 ? 1.727   4.382   28.511 1.00 103.17 ? 177  HIS D CD2 1 
ATOM   7651 C CE1 . HIS D 1 177 ? 0.791   3.011   29.944 1.00 106.23 ? 177  HIS D CE1 1 
ATOM   7652 N NE2 . HIS D 1 177 ? 1.845   3.781   29.739 1.00 103.79 ? 177  HIS D NE2 1 
ATOM   7653 N N   . LEU D 1 178 ? -1.490  2.678   24.114 1.00 83.51  ? 178  LEU D N   1 
ATOM   7654 C CA  . LEU D 1 178 ? -2.481  2.864   23.071 1.00 82.30  ? 178  LEU D CA  1 
ATOM   7655 C C   . LEU D 1 178 ? -3.845  3.014   23.707 1.00 87.16  ? 178  LEU D C   1 
ATOM   7656 O O   . LEU D 1 178 ? -4.425  2.046   24.179 1.00 90.41  ? 178  LEU D O   1 
ATOM   7657 C CB  . LEU D 1 178 ? -2.474  1.691   22.097 1.00 79.73  ? 178  LEU D CB  1 
ATOM   7658 C CG  . LEU D 1 178 ? -3.169  2.005   20.777 1.00 78.24  ? 178  LEU D CG  1 
ATOM   7659 C CD1 . LEU D 1 178 ? -3.013  3.482   20.433 1.00 77.16  ? 178  LEU D CD1 1 
ATOM   7660 C CD2 . LEU D 1 178 ? -2.618  1.120   19.672 1.00 75.95  ? 178  LEU D CD2 1 
ATOM   7661 N N   . VAL D 1 179 ? -4.361  4.232   23.726 1.00 72.75  ? 179  VAL D N   1 
ATOM   7662 C CA  . VAL D 1 179 ? -5.610  4.475   24.422 1.00 76.09  ? 179  VAL D CA  1 
ATOM   7663 C C   . VAL D 1 179 ? -6.749  4.861   23.488 1.00 76.16  ? 179  VAL D C   1 
ATOM   7664 O O   . VAL D 1 179 ? -6.676  5.831   22.734 1.00 73.83  ? 179  VAL D O   1 
ATOM   7665 C CB  . VAL D 1 179 ? -5.439  5.505   25.547 1.00 75.26  ? 179  VAL D CB  1 
ATOM   7666 C CG1 . VAL D 1 179 ? -6.775  5.818   26.183 1.00 80.24  ? 179  VAL D CG1 1 
ATOM   7667 C CG2 . VAL D 1 179 ? -4.479  4.965   26.583 1.00 75.12  ? 179  VAL D CG2 1 
ATOM   7668 N N   . LEU D 1 180 ? -7.799  4.056   23.551 1.00 75.08  ? 180  LEU D N   1 
ATOM   7669 C CA  . LEU D 1 180 ? -9.036  4.323   22.851 1.00 77.49  ? 180  LEU D CA  1 
ATOM   7670 C C   . LEU D 1 180 ? -9.886  5.275   23.672 1.00 79.13  ? 180  LEU D C   1 
ATOM   7671 O O   . LEU D 1 180 ? -10.142 5.059   24.838 1.00 78.09  ? 180  LEU D O   1 
ATOM   7672 C CB  . LEU D 1 180 ? -9.798  3.016   22.656 1.00 75.73  ? 180  LEU D CB  1 
ATOM   7673 C CG  . LEU D 1 180 ? -11.320 3.120   22.560 1.00 81.14  ? 180  LEU D CG  1 
ATOM   7674 C CD1 . LEU D 1 180 ? -11.725 3.778   21.250 1.00 79.45  ? 180  LEU D CD1 1 
ATOM   7675 C CD2 . LEU D 1 180 ? -11.957 1.744   22.698 1.00 77.18  ? 180  LEU D CD2 1 
ATOM   7676 N N   . VAL D 1 181 ? -10.344 6.341   23.052 1.00 79.65  ? 181  VAL D N   1 
ATOM   7677 C CA  . VAL D 1 181 ? -11.279 7.234   23.710 1.00 79.79  ? 181  VAL D CA  1 
ATOM   7678 C C   . VAL D 1 181 ? -12.572 7.278   22.922 1.00 80.97  ? 181  VAL D C   1 
ATOM   7679 O O   . VAL D 1 181 ? -12.568 7.530   21.720 1.00 78.43  ? 181  VAL D O   1 
ATOM   7680 C CB  . VAL D 1 181 ? -10.719 8.666   23.868 1.00 79.76  ? 181  VAL D CB  1 
ATOM   7681 C CG1 . VAL D 1 181 ? -11.700 9.523   24.640 1.00 86.04  ? 181  VAL D CG1 1 
ATOM   7682 C CG2 . VAL D 1 181 ? -9.366  8.630   24.576 1.00 76.89  ? 181  VAL D CG2 1 
ATOM   7683 N N   . ARG D 1 182 ? -13.684 7.026   23.600 1.00 99.36  ? 182  ARG D N   1 
ATOM   7684 C CA  . ARG D 1 182 ? -14.976 7.001   22.927 1.00 101.16 ? 182  ARG D CA  1 
ATOM   7685 C C   . ARG D 1 182 ? -16.137 7.270   23.896 1.00 105.23 ? 182  ARG D C   1 
ATOM   7686 O O   . ARG D 1 182 ? -15.949 7.140   25.119 1.00 108.32 ? 182  ARG D O   1 
ATOM   7687 C CB  . ARG D 1 182 ? -15.182 5.640   22.280 1.00 98.71  ? 182  ARG D CB  1 
ATOM   7688 C CG  . ARG D 1 182 ? -15.439 4.561   23.292 1.00 100.91 ? 182  ARG D CG  1 
ATOM   7689 C CD  . ARG D 1 182 ? -15.961 3.309   22.642 1.00 100.02 ? 182  ARG D CD  1 
ATOM   7690 N NE  . ARG D 1 182 ? -16.162 2.275   23.644 1.00 102.98 ? 182  ARG D NE  1 
ATOM   7691 C CZ  . ARG D 1 182 ? -16.045 0.977   23.400 1.00 103.43 ? 182  ARG D CZ  1 
ATOM   7692 N NH1 . ARG D 1 182 ? -15.722 0.560   22.181 1.00 101.05 ? 182  ARG D NH1 1 
ATOM   7693 N NH2 . ARG D 1 182 ? -16.242 0.099   24.375 1.00 106.99 ? 182  ARG D NH2 1 
ATOM   7694 N N   . SER D 1 183 ? -17.313 7.629   23.354 1.00 124.42 ? 183  SER D N   1 
ATOM   7695 C CA  . SER D 1 183 ? -18.500 7.967   24.144 1.00 131.29 ? 183  SER D CA  1 
ATOM   7696 C C   . SER D 1 183 ? -19.263 6.706   24.517 1.00 125.70 ? 183  SER D C   1 
ATOM   7697 O O   . SER D 1 183 ? -19.328 5.757   23.734 1.00 121.57 ? 183  SER D O   1 
ATOM   7698 C CB  . SER D 1 183 ? -19.402 8.913   23.357 1.00 122.61 ? 183  SER D CB  1 
ATOM   7699 O OG  . SER D 1 183 ? -18.627 9.926   22.739 1.00 121.87 ? 183  SER D OG  1 
ATOM   7700 N N   . GLU D 1 184 ? -19.815 6.687   25.728 1.00 127.70 ? 184  GLU D N   1 
ATOM   7701 C CA  . GLU D 1 184 ? -20.560 5.527   26.213 1.00 129.46 ? 184  GLU D CA  1 
ATOM   7702 C C   . GLU D 1 184 ? -21.795 5.916   27.036 1.00 136.68 ? 184  GLU D C   1 
ATOM   7703 O O   . GLU D 1 184 ? -22.028 7.095   27.315 1.00 140.33 ? 184  GLU D O   1 
ATOM   7704 C CB  . GLU D 1 184 ? -19.657 4.597   27.055 1.00 130.54 ? 184  GLU D CB  1 
ATOM   7705 C CG  . GLU D 1 184 ? -18.306 4.213   26.424 1.00 135.43 ? 184  GLU D CG  1 
ATOM   7706 C CD  . GLU D 1 184 ? -17.662 2.965   27.049 1.00 135.59 ? 184  GLU D CD  1 
ATOM   7707 O OE1 . GLU D 1 184 ? -17.478 2.909   28.286 1.00 138.47 ? 184  GLU D OE1 1 
ATOM   7708 O OE2 . GLU D 1 184 ? -17.323 2.037   26.286 1.00 133.66 ? 184  GLU D OE2 1 
ATOM   7709 N N   . ILE D 1 185 ? -22.553 4.891   27.445 1.00 133.82 ? 185  ILE D N   1 
ATOM   7710 C CA  . ILE D 1 185 ? -23.695 5.021   28.365 1.00 142.17 ? 185  ILE D CA  1 
ATOM   7711 C C   . ILE D 1 185 ? -23.609 4.062   29.555 1.00 144.18 ? 185  ILE D C   1 
ATOM   7712 O O   . ILE D 1 185 ? -23.458 2.854   29.375 1.00 144.31 ? 185  ILE D O   1 
ATOM   7713 C CB  . ILE D 1 185 ? -25.038 4.718   27.672 1.00 137.70 ? 185  ILE D CB  1 
ATOM   7714 C CG1 . ILE D 1 185 ? -25.313 5.748   26.591 1.00 134.26 ? 185  ILE D CG1 1 
ATOM   7715 C CG2 . ILE D 1 185 ? -26.178 4.737   28.683 1.00 143.90 ? 185  ILE D CG2 1 
ATOM   7716 C CD1 . ILE D 1 185 ? -25.167 7.144   27.090 1.00 137.89 ? 185  ILE D CD1 1 
ATOM   7717 N N   . SER D 1 186 ? -23.735 4.605   30.764 1.00 202.85 ? 186  SER D N   1 
ATOM   7718 C CA  . SER D 1 186 ? -23.766 3.804   31.986 1.00 206.89 ? 186  SER D CA  1 
ATOM   7719 C C   . SER D 1 186 ? -25.132 3.143   32.152 1.00 214.49 ? 186  SER D C   1 
ATOM   7720 O O   . SER D 1 186 ? -26.098 3.553   31.509 1.00 218.19 ? 186  SER D O   1 
ATOM   7721 C CB  . SER D 1 186 ? -23.477 4.698   33.191 1.00 211.15 ? 186  SER D CB  1 
ATOM   7722 O OG  . SER D 1 186 ? -23.677 4.003   34.403 1.00 216.75 ? 186  SER D OG  1 
ATOM   7723 N N   . GLN D 1 187 ? -25.219 2.121   33.000 1.00 186.11 ? 187  GLN D N   1 
ATOM   7724 C CA  . GLN D 1 187 ? -26.517 1.530   33.309 1.00 195.08 ? 187  GLN D CA  1 
ATOM   7725 C C   . GLN D 1 187 ? -27.424 2.635   33.836 1.00 204.25 ? 187  GLN D C   1 
ATOM   7726 O O   . GLN D 1 187 ? -28.601 2.715   33.480 1.00 211.26 ? 187  GLN D O   1 
ATOM   7727 C CB  . GLN D 1 187 ? -26.391 0.418   34.350 1.00 199.07 ? 187  GLN D CB  1 
ATOM   7728 C CG  . GLN D 1 187 ? -25.562 -0.777  33.907 1.00 192.54 ? 187  GLN D CG  1 
ATOM   7729 C CD  . GLN D 1 187 ? -25.432 -1.821  34.998 1.00 198.17 ? 187  GLN D CD  1 
ATOM   7730 O OE1 . GLN D 1 187 ? -26.136 -1.771  36.008 1.00 207.27 ? 187  GLN D OE1 1 
ATOM   7731 N NE2 . GLN D 1 187 ? -24.529 -2.775  34.802 1.00 194.02 ? 187  GLN D NE2 1 
ATOM   7732 N N   . GLU D 1 188 ? -26.853 3.491   34.679 1.00 199.51 ? 188  GLU D N   1 
ATOM   7733 C CA  . GLU D 1 188 ? -27.555 4.646   35.228 1.00 208.66 ? 188  GLU D CA  1 
ATOM   7734 C C   . GLU D 1 188 ? -27.845 5.684   34.152 1.00 207.73 ? 188  GLU D C   1 
ATOM   7735 O O   . GLU D 1 188 ? -28.519 6.680   34.407 1.00 216.49 ? 188  GLU D O   1 
ATOM   7736 C CB  . GLU D 1 188 ? -26.732 5.297   36.343 1.00 208.88 ? 188  GLU D CB  1 
ATOM   7737 C CG  . GLU D 1 188 ? -26.461 4.399   37.537 1.00 211.73 ? 188  GLU D CG  1 
ATOM   7738 C CD  . GLU D 1 188 ? -25.360 3.397   37.274 1.00 202.27 ? 188  GLU D CD  1 
ATOM   7739 O OE1 . GLU D 1 188 ? -24.499 3.673   36.418 1.00 192.93 ? 188  GLU D OE1 1 
ATOM   7740 O OE2 . GLU D 1 188 ? -25.349 2.336   37.930 1.00 205.35 ? 188  GLU D OE2 1 
ATOM   7741 N N   . GLY D 1 189 ? -27.318 5.457   32.954 1.00 193.73 ? 189  GLY D N   1 
ATOM   7742 C CA  . GLY D 1 189 ? -27.580 6.338   31.831 1.00 192.95 ? 189  GLY D CA  1 
ATOM   7743 C C   . GLY D 1 189 ? -26.795 7.637   31.842 1.00 190.43 ? 189  GLY D C   1 
ATOM   7744 O O   . GLY D 1 189 ? -27.268 8.654   31.333 1.00 195.22 ? 189  GLY D O   1 
ATOM   7745 N N   . MET D 1 190 ? -25.603 7.616   32.429 1.00 233.08 ? 190  MET D N   1 
ATOM   7746 C CA  . MET D 1 190 ? -24.684 8.736   32.287 1.00 229.29 ? 190  MET D CA  1 
ATOM   7747 C C   . MET D 1 190 ? -23.956 8.565   30.959 1.00 219.72 ? 190  MET D C   1 
ATOM   7748 O O   . MET D 1 190 ? -23.386 7.506   30.699 1.00 213.09 ? 190  MET D O   1 
ATOM   7749 C CB  . MET D 1 190 ? -23.683 8.770   33.444 1.00 227.19 ? 190  MET D CB  1 
ATOM   7750 N N   . VAL D 1 191 ? -23.991 9.587   30.108 1.00 150.08 ? 191  VAL D N   1 
ATOM   7751 C CA  . VAL D 1 191 ? -23.316 9.506   28.811 1.00 142.04 ? 191  VAL D CA  1 
ATOM   7752 C C   . VAL D 1 191 ? -21.976 10.242  28.809 1.00 136.88 ? 191  VAL D C   1 
ATOM   7753 O O   . VAL D 1 191 ? -21.911 11.451  28.585 1.00 137.15 ? 191  VAL D O   1 
ATOM   7754 C CB  . VAL D 1 191 ? -24.215 9.992   27.644 1.00 139.11 ? 191  VAL D CB  1 
ATOM   7755 C CG1 . VAL D 1 191 ? -24.666 11.426  27.856 1.00 135.98 ? 191  VAL D CG1 1 
ATOM   7756 C CG2 . VAL D 1 191 ? -23.493 9.833   26.316 1.00 128.27 ? 191  VAL D CG2 1 
ATOM   7757 N N   . PHE D 1 192 ? -20.906 9.489   29.048 1.00 198.36 ? 192  PHE D N   1 
ATOM   7758 C CA  . PHE D 1 192 ? -19.584 10.064  29.266 1.00 194.76 ? 192  PHE D CA  1 
ATOM   7759 C C   . PHE D 1 192 ? -18.565 9.655   28.201 1.00 187.59 ? 192  PHE D C   1 
ATOM   7760 O O   . PHE D 1 192 ? -18.824 8.778   27.377 1.00 184.75 ? 192  PHE D O   1 
ATOM   7761 C CB  . PHE D 1 192 ? -19.064 9.637   30.639 1.00 195.39 ? 192  PHE D CB  1 
ATOM   7762 C CG  . PHE D 1 192 ? -19.005 8.143   30.823 1.00 192.98 ? 192  PHE D CG  1 
ATOM   7763 C CD1 . PHE D 1 192 ? -17.828 7.448   30.592 1.00 187.78 ? 192  PHE D CD1 1 
ATOM   7764 C CD2 . PHE D 1 192 ? -20.128 7.433   31.222 1.00 197.24 ? 192  PHE D CD2 1 
ATOM   7765 C CE1 . PHE D 1 192 ? -17.769 6.071   30.760 1.00 186.92 ? 192  PHE D CE1 1 
ATOM   7766 C CE2 . PHE D 1 192 ? -20.076 6.055   31.391 1.00 195.89 ? 192  PHE D CE2 1 
ATOM   7767 C CZ  . PHE D 1 192 ? -18.894 5.374   31.159 1.00 190.74 ? 192  PHE D CZ  1 
ATOM   7768 N N   . ARG D 1 193 ? -17.406 10.308  28.232 1.00 169.97 ? 193  ARG D N   1 
ATOM   7769 C CA  . ARG D 1 193 ? -16.263 9.906   27.425 1.00 164.74 ? 193  ARG D CA  1 
ATOM   7770 C C   . ARG D 1 193 ? -15.383 9.028   28.292 1.00 163.33 ? 193  ARG D C   1 
ATOM   7771 O O   . ARG D 1 193 ? -14.961 9.426   29.367 1.00 165.44 ? 193  ARG D O   1 
ATOM   7772 C CB  . ARG D 1 193 ? -15.458 11.123  26.967 1.00 164.86 ? 193  ARG D CB  1 
ATOM   7773 C CG  . ARG D 1 193 ? -16.141 11.986  25.916 1.00 149.27 ? 193  ARG D CG  1 
ATOM   7774 C CD  . ARG D 1 193 ? -16.110 11.326  24.548 1.00 137.06 ? 193  ARG D CD  1 
ATOM   7775 N NE  . ARG D 1 193 ? -14.816 11.471  23.888 1.00 128.02 ? 193  ARG D NE  1 
ATOM   7776 C CZ  . ARG D 1 193 ? -14.520 10.932  22.711 1.00 118.77 ? 193  ARG D CZ  1 
ATOM   7777 N NH1 . ARG D 1 193 ? -15.426 10.207  22.068 1.00 116.97 ? 193  ARG D NH1 1 
ATOM   7778 N NH2 . ARG D 1 193 ? -13.319 11.112  22.175 1.00 115.90 ? 193  ARG D NH2 1 
ATOM   7779 N N   . ARG D 1 194 ? -15.094 7.825   27.832 1.00 142.92 ? 194  ARG D N   1 
ATOM   7780 C CA  . ARG D 1 194 ? -14.256 6.927   28.608 1.00 143.59 ? 194  ARG D CA  1 
ATOM   7781 C C   . ARG D 1 194 ? -12.963 6.561   27.903 1.00 138.28 ? 194  ARG D C   1 
ATOM   7782 O O   . ARG D 1 194 ? -12.898 6.501   26.678 1.00 132.84 ? 194  ARG D O   1 
ATOM   7783 C CB  . ARG D 1 194 ? -15.011 5.652   28.957 1.00 144.28 ? 194  ARG D CB  1 
ATOM   7784 C CG  . ARG D 1 194 ? -14.371 4.867   30.077 1.00 147.13 ? 194  ARG D CG  1 
ATOM   7785 C CD  . ARG D 1 194 ? -15.114 3.573   30.315 1.00 147.85 ? 194  ARG D CD  1 
ATOM   7786 N NE  . ARG D 1 194 ? -15.101 3.188   31.721 1.00 151.39 ? 194  ARG D NE  1 
ATOM   7787 C CZ  . ARG D 1 194 ? -16.061 2.470   32.290 1.00 154.99 ? 194  ARG D CZ  1 
ATOM   7788 N NH1 . ARG D 1 194 ? -17.099 2.075   31.564 1.00 155.43 ? 194  ARG D NH1 1 
ATOM   7789 N NH2 . ARG D 1 194 ? -15.993 2.152   33.576 1.00 158.59 ? 194  ARG D NH2 1 
ATOM   7790 N N   . PHE D 1 195 ? -11.939 6.304   28.706 1.00 111.87 ? 195  PHE D N   1 
ATOM   7791 C CA  . PHE D 1 195 ? -10.636 5.903   28.207 1.00 106.20 ? 195  PHE D CA  1 
ATOM   7792 C C   . PHE D 1 195 ? -10.465 4.410   28.407 1.00 105.06 ? 195  PHE D C   1 
ATOM   7793 O O   . PHE D 1 195 ? -10.728 3.887   29.493 1.00 106.40 ? 195  PHE D O   1 
ATOM   7794 C CB  . PHE D 1 195 ? -9.527  6.654   28.948 1.00 107.82 ? 195  PHE D CB  1 
ATOM   7795 C CG  . PHE D 1 195 ? -9.477  8.131   28.647 1.00 107.86 ? 195  PHE D CG  1 
ATOM   7796 C CD1 . PHE D 1 195 ? -8.271  8.751   28.371 1.00 104.64 ? 195  PHE D CD1 1 
ATOM   7797 C CD2 . PHE D 1 195 ? -10.634 8.900   28.642 1.00 111.25 ? 195  PHE D CD2 1 
ATOM   7798 C CE1 . PHE D 1 195 ? -8.207  10.112  28.097 1.00 103.60 ? 195  PHE D CE1 1 
ATOM   7799 C CE2 . PHE D 1 195 ? -10.583 10.265  28.367 1.00 111.92 ? 195  PHE D CE2 1 
ATOM   7800 C CZ  . PHE D 1 195 ? -9.367  10.871  28.094 1.00 108.49 ? 195  PHE D CZ  1 
ATOM   7801 N N   . HIS D 1 196 ? -10.033 3.737   27.346 1.00 113.08 ? 196  HIS D N   1 
ATOM   7802 C CA  . HIS D 1 196 ? -9.673  2.335   27.461 1.00 110.17 ? 196  HIS D CA  1 
ATOM   7803 C C   . HIS D 1 196 ? -8.229  2.159   27.043 1.00 103.56 ? 196  HIS D C   1 
ATOM   7804 O O   . HIS D 1 196 ? -7.889  2.361   25.873 1.00 99.41  ? 196  HIS D O   1 
ATOM   7805 C CB  . HIS D 1 196 ? -10.550 1.470   26.561 1.00 111.62 ? 196  HIS D CB  1 
ATOM   7806 C CG  . HIS D 1 196 ? -11.958 1.335   27.032 1.00 116.31 ? 196  HIS D CG  1 
ATOM   7807 N ND1 . HIS D 1 196 ? -12.953 2.217   26.674 1.00 117.38 ? 196  HIS D ND1 1 
ATOM   7808 C CD2 . HIS D 1 196 ? -12.550 0.411   27.835 1.00 119.72 ? 196  HIS D CD2 1 
ATOM   7809 C CE1 . HIS D 1 196 ? -14.094 1.850   27.235 1.00 121.83 ? 196  HIS D CE1 1 
ATOM   7810 N NE2 . HIS D 1 196 ? -13.870 0.759   27.943 1.00 122.92 ? 196  HIS D NE2 1 
ATOM   7811 N N   . ASP D 1 197 ? -7.371  1.793   27.987 1.00 128.98 ? 197  ASP D N   1 
ATOM   7812 C CA  . ASP D 1 197 ? -6.019  1.423   27.617 1.00 123.53 ? 197  ASP D CA  1 
ATOM   7813 C C   . ASP D 1 197 ? -6.143  0.054   26.958 1.00 124.12 ? 197  ASP D C   1 
ATOM   7814 O O   . ASP D 1 197 ? -6.823  -0.827  27.480 1.00 128.26 ? 197  ASP D O   1 
ATOM   7815 C CB  . ASP D 1 197 ? -5.091  1.389   28.834 1.00 121.58 ? 197  ASP D CB  1 
ATOM   7816 C CG  . ASP D 1 197 ? -3.653  1.779   28.487 1.00 116.33 ? 197  ASP D CG  1 
ATOM   7817 O OD1 . ASP D 1 197 ? -3.156  1.353   27.419 1.00 113.86 ? 197  ASP D OD1 1 
ATOM   7818 O OD2 . ASP D 1 197 ? -3.021  2.516   29.278 1.00 115.21 ? 197  ASP D OD2 1 
ATOM   7819 N N   . LEU D 1 198 ? -5.518  -0.106  25.795 1.00 83.90  ? 198  LEU D N   1 
ATOM   7820 C CA  . LEU D 1 198 ? -5.651  -1.324  25.000 1.00 82.48  ? 198  LEU D CA  1 
ATOM   7821 C C   . LEU D 1 198 ? -4.421  -2.209  25.155 1.00 80.56  ? 198  LEU D C   1 
ATOM   7822 O O   . LEU D 1 198 ? -3.309  -1.785  24.852 1.00 76.55  ? 198  LEU D O   1 
ATOM   7823 C CB  . LEU D 1 198 ? -5.842  -0.971  23.522 1.00 77.12  ? 198  LEU D CB  1 
ATOM   7824 C CG  . LEU D 1 198 ? -6.967  -0.003  23.153 1.00 78.94  ? 198  LEU D CG  1 
ATOM   7825 C CD1 . LEU D 1 198 ? -7.044  0.191   21.644 1.00 75.25  ? 198  LEU D CD1 1 
ATOM   7826 C CD2 . LEU D 1 198 ? -8.288  -0.502  23.698 1.00 85.33  ? 198  LEU D CD2 1 
ATOM   7827 N N   . THR D 1 199 ? -4.618  -3.438  25.621 1.00 88.81  ? 199  THR D N   1 
ATOM   7828 C CA  . THR D 1 199 ? -3.504  -4.359  25.823 1.00 88.32  ? 199  THR D CA  1 
ATOM   7829 C C   . THR D 1 199 ? -2.682  -4.513  24.557 1.00 81.18  ? 199  THR D C   1 
ATOM   7830 O O   . THR D 1 199 ? -3.203  -4.913  23.519 1.00 78.60  ? 199  THR D O   1 
ATOM   7831 C CB  . THR D 1 199 ? -3.985  -5.762  26.218 1.00 92.49  ? 199  THR D CB  1 
ATOM   7832 O OG1 . THR D 1 199 ? -5.062  -5.662  27.154 1.00 99.86  ? 199  THR D OG1 1 
ATOM   7833 C CG2 . THR D 1 199 ? -2.854  -6.546  26.845 1.00 94.69  ? 199  THR D CG2 1 
ATOM   7834 N N   . LEU D 1 200 ? -1.394  -4.206  24.647 1.00 77.31  ? 200  LEU D N   1 
ATOM   7835 C CA  . LEU D 1 200 ? -0.494  -4.380  23.515 1.00 76.83  ? 200  LEU D CA  1 
ATOM   7836 C C   . LEU D 1 200 ? 0.271   -5.684  23.658 1.00 77.84  ? 200  LEU D C   1 
ATOM   7837 O O   . LEU D 1 200 ? 0.638   -6.074  24.767 1.00 77.45  ? 200  LEU D O   1 
ATOM   7838 C CB  . LEU D 1 200 ? 0.499   -3.224  23.439 1.00 74.58  ? 200  LEU D CB  1 
ATOM   7839 C CG  . LEU D 1 200 ? -0.097  -1.826  23.361 1.00 73.90  ? 200  LEU D CG  1 
ATOM   7840 C CD1 . LEU D 1 200 ? 1.026   -0.834  23.259 1.00 71.86  ? 200  LEU D CD1 1 
ATOM   7841 C CD2 . LEU D 1 200 ? -1.033  -1.710  22.170 1.00 71.37  ? 200  LEU D CD2 1 
ATOM   7842 N N   . THR D 1 201 ? 0.518   -6.360  22.540 1.00 79.06  ? 201  THR D N   1 
ATOM   7843 C CA  . THR D 1 201 ? 1.311   -7.583  22.585 1.00 80.16  ? 201  THR D CA  1 
ATOM   7844 C C   . THR D 1 201 ? 2.703   -7.252  23.103 1.00 80.97  ? 201  THR D C   1 
ATOM   7845 O O   . THR D 1 201 ? 3.343   -8.071  23.758 1.00 78.55  ? 201  THR D O   1 
ATOM   7846 C CB  . THR D 1 201 ? 1.465   -8.249  21.206 1.00 77.55  ? 201  THR D CB  1 
ATOM   7847 O OG1 . THR D 1 201 ? 2.568   -7.659  20.507 1.00 75.01  ? 201  THR D OG1 1 
ATOM   7848 C CG2 . THR D 1 201 ? 0.211   -8.099  20.383 1.00 76.89  ? 201  THR D CG2 1 
ATOM   7849 N N   . ARG D 1 202 ? 3.171   -6.046  22.806 1.00 97.44  ? 202  ARG D N   1 
ATOM   7850 C CA  . ARG D 1 202 ? 4.447   -5.613  23.342 1.00 99.08  ? 202  ARG D CA  1 
ATOM   7851 C C   . ARG D 1 202 ? 4.466   -4.137  23.671 1.00 98.86  ? 202  ARG D C   1 
ATOM   7852 O O   . ARG D 1 202 ? 4.195   -3.278  22.844 1.00 94.95  ? 202  ARG D O   1 
ATOM   7853 C CB  . ARG D 1 202 ? 5.579   -5.975  22.403 1.00 96.96  ? 202  ARG D CB  1 
ATOM   7854 C CG  . ARG D 1 202 ? 6.933   -5.656  22.963 1.00 99.71  ? 202  ARG D CG  1 
ATOM   7855 C CD  . ARG D 1 202 ? 7.992   -6.003  21.957 1.00 98.24  ? 202  ARG D CD  1 
ATOM   7856 N NE  . ARG D 1 202 ? 9.281   -5.453  22.340 1.00 100.79 ? 202  ARG D NE  1 
ATOM   7857 C CZ  . ARG D 1 202 ? 10.143  -6.076  23.134 1.00 105.95 ? 202  ARG D CZ  1 
ATOM   7858 N NH1 . ARG D 1 202 ? 9.851   -7.275  23.622 1.00 108.82 ? 202  ARG D NH1 1 
ATOM   7859 N NH2 . ARG D 1 202 ? 11.298  -5.499  23.440 1.00 107.61 ? 202  ARG D NH2 1 
ATOM   7860 N N   . SER D 1 203 ? 4.853   -3.877  24.906 1.00 85.37  ? 203  SER D N   1 
ATOM   7861 C CA  . SER D 1 203 ? 4.692   -2.573  25.513 1.00 80.78  ? 203  SER D CA  1 
ATOM   7862 C C   . SER D 1 203 ? 6.037   -1.980  25.937 1.00 77.28  ? 203  SER D C   1 
ATOM   7863 O O   . SER D 1 203 ? 6.189   -0.766  26.024 1.00 73.24  ? 203  SER D O   1 
ATOM   7864 C CB  . SER D 1 203 ? 3.769   -2.737  26.715 1.00 83.81  ? 203  SER D CB  1 
ATOM   7865 O OG  . SER D 1 203 ? 3.695   -1.565  27.501 1.00 80.41  ? 203  SER D OG  1 
ATOM   7866 N N   . ARG D 1 204 ? 7.011   -2.851  26.186 1.00 107.54 ? 204  ARG D N   1 
ATOM   7867 C CA  . ARG D 1 204 ? 8.378   -2.433  26.472 1.00 105.01 ? 204  ARG D CA  1 
ATOM   7868 C C   . ARG D 1 204 ? 9.313   -2.752  25.322 1.00 104.84 ? 204  ARG D C   1 
ATOM   7869 O O   . ARG D 1 204 ? 9.195   -3.791  24.680 1.00 109.38 ? 204  ARG D O   1 
ATOM   7870 C CB  . ARG D 1 204 ? 8.899   -3.147  27.712 1.00 109.19 ? 204  ARG D CB  1 
ATOM   7871 C CG  . ARG D 1 204 ? 9.066   -2.256  28.906 1.00 106.47 ? 204  ARG D CG  1 
ATOM   7872 C CD  . ARG D 1 204 ? 10.129  -1.208  28.657 1.00 101.77 ? 204  ARG D CD  1 
ATOM   7873 N NE  . ARG D 1 204 ? 10.523  -0.576  29.909 1.00 101.06 ? 204  ARG D NE  1 
ATOM   7874 C CZ  . ARG D 1 204 ? 9.673   0.032   30.728 1.00 100.84 ? 204  ARG D CZ  1 
ATOM   7875 N NH1 . ARG D 1 204 ? 8.380   0.084   30.428 1.00 101.25 ? 204  ARG D NH1 1 
ATOM   7876 N NH2 . ARG D 1 204 ? 10.111  0.582   31.852 1.00 100.84 ? 204  ARG D NH2 1 
ATOM   7877 N N   . SER D 1 205 ? 10.249  -1.851  25.067 1.00 114.97 ? 205  SER D N   1 
ATOM   7878 C CA  . SER D 1 205 ? 11.366  -2.140  24.186 1.00 115.32 ? 205  SER D CA  1 
ATOM   7879 C C   . SER D 1 205 ? 12.590  -1.571  24.868 1.00 113.55 ? 205  SER D C   1 
ATOM   7880 O O   . SER D 1 205 ? 12.806  -0.361  24.844 1.00 109.15 ? 205  SER D O   1 
ATOM   7881 C CB  . SER D 1 205 ? 11.178  -1.486  22.821 1.00 111.70 ? 205  SER D CB  1 
ATOM   7882 O OG  . SER D 1 205 ? 12.412  -1.416  22.127 1.00 110.64 ? 205  SER D OG  1 
ATOM   7883 N N   . PRO D 1 206 ? 13.380  -2.434  25.518 1.00 105.86 ? 206  PRO D N   1 
ATOM   7884 C CA  . PRO D 1 206 ? 14.479  -1.881  26.309 1.00 104.46 ? 206  PRO D CA  1 
ATOM   7885 C C   . PRO D 1 206 ? 15.460  -1.077  25.470 1.00 100.84 ? 206  PRO D C   1 
ATOM   7886 O O   . PRO D 1 206 ? 16.041  -0.112  25.962 1.00 98.14  ? 206  PRO D O   1 
ATOM   7887 C CB  . PRO D 1 206 ? 15.135  -3.128  26.900 1.00 111.42 ? 206  PRO D CB  1 
ATOM   7888 C CG  . PRO D 1 206 ? 13.997  -4.087  27.045 1.00 116.32 ? 206  PRO D CG  1 
ATOM   7889 C CD  . PRO D 1 206 ? 13.179  -3.867  25.790 1.00 113.48 ? 206  PRO D CD  1 
ATOM   7890 N N   . ILE D 1 207 ? 15.633  -1.452  24.212 1.00 74.81  ? 207  ILE D N   1 
ATOM   7891 C CA  . ILE D 1 207 ? 16.481  -0.661  23.334 1.00 71.65  ? 207  ILE D CA  1 
ATOM   7892 C C   . ILE D 1 207 ? 15.746  -0.269  22.060 1.00 70.23  ? 207  ILE D C   1 
ATOM   7893 O O   . ILE D 1 207 ? 15.873  -0.928  21.031 1.00 70.92  ? 207  ILE D O   1 
ATOM   7894 C CB  . ILE D 1 207 ? 17.809  -1.384  23.041 1.00 75.55  ? 207  ILE D CB  1 
ATOM   7895 C CG1 . ILE D 1 207 ? 18.740  -1.219  24.237 1.00 76.71  ? 207  ILE D CG1 1 
ATOM   7896 C CG2 . ILE D 1 207 ? 18.488  -0.823  21.802 1.00 73.26  ? 207  ILE D CG2 1 
ATOM   7897 C CD1 . ILE D 1 207 ? 19.744  -2.323  24.392 1.00 85.91  ? 207  ILE D CD1 1 
ATOM   7898 N N   . PHE D 1 208 ? 14.952  0.797   22.139 1.00 85.28  ? 208  PHE D N   1 
ATOM   7899 C CA  . PHE D 1 208 ? 14.308  1.319   20.942 1.00 83.21  ? 208  PHE D CA  1 
ATOM   7900 C C   . PHE D 1 208 ? 15.336  2.107   20.152 1.00 81.44  ? 208  PHE D C   1 
ATOM   7901 O O   . PHE D 1 208 ? 15.882  3.093   20.648 1.00 80.41  ? 208  PHE D O   1 
ATOM   7902 C CB  . PHE D 1 208 ? 13.111  2.206   21.283 1.00 81.78  ? 208  PHE D CB  1 
ATOM   7903 C CG  . PHE D 1 208 ? 12.467  2.842   20.078 1.00 80.53  ? 208  PHE D CG  1 
ATOM   7904 C CD1 . PHE D 1 208 ? 12.139  2.082   18.971 1.00 81.12  ? 208  PHE D CD1 1 
ATOM   7905 C CD2 . PHE D 1 208 ? 12.180  4.196   20.057 1.00 79.99  ? 208  PHE D CD2 1 
ATOM   7906 C CE1 . PHE D 1 208 ? 11.544  2.662   17.867 1.00 80.33  ? 208  PHE D CE1 1 
ATOM   7907 C CE2 . PHE D 1 208 ? 11.584  4.776   18.955 1.00 80.06  ? 208  PHE D CE2 1 
ATOM   7908 C CZ  . PHE D 1 208 ? 11.266  4.009   17.862 1.00 79.80  ? 208  PHE D CZ  1 
ATOM   7909 N N   . SER D 1 209 ? 15.606  1.669   18.925 1.00 88.82  ? 209  SER D N   1 
ATOM   7910 C CA  . SER D 1 209 ? 16.683  2.269   18.146 1.00 87.82  ? 209  SER D CA  1 
ATOM   7911 C C   . SER D 1 209 ? 16.356  2.567   16.686 1.00 86.85  ? 209  SER D C   1 
ATOM   7912 O O   . SER D 1 209 ? 16.977  3.444   16.098 1.00 85.90  ? 209  SER D O   1 
ATOM   7913 C CB  . SER D 1 209 ? 17.970  1.438   18.254 1.00 90.37  ? 209  SER D CB  1 
ATOM   7914 O OG  . SER D 1 209 ? 17.689  0.049   18.331 1.00 94.21  ? 209  SER D OG  1 
ATOM   7915 N N   . LEU D 1 210 ? 15.395  1.861   16.095 1.00 77.09  ? 210  LEU D N   1 
ATOM   7916 C CA  . LEU D 1 210 ? 15.076  2.091   14.678 1.00 76.45  ? 210  LEU D CA  1 
ATOM   7917 C C   . LEU D 1 210 ? 13.582  2.246   14.401 1.00 76.19  ? 210  LEU D C   1 
ATOM   7918 O O   . LEU D 1 210 ? 13.086  3.357   14.223 1.00 75.13  ? 210  LEU D O   1 
ATOM   7919 C CB  . LEU D 1 210 ? 15.652  0.980   13.797 1.00 78.90  ? 210  LEU D CB  1 
ATOM   7920 C CG  . LEU D 1 210 ? 17.060  0.517   14.164 1.00 80.92  ? 210  LEU D CG  1 
ATOM   7921 C CD1 . LEU D 1 210 ? 17.439  -0.702  13.347 1.00 85.40  ? 210  LEU D CD1 1 
ATOM   7922 C CD2 . LEU D 1 210 ? 18.075  1.630   13.983 1.00 78.79  ? 210  LEU D CD2 1 
ATOM   7923 N N   . SER D 1 211 ? 12.870  1.129   14.339 1.00 79.70  ? 211  SER D N   1 
ATOM   7924 C CA  . SER D 1 211 ? 11.429  1.180   14.166 1.00 79.98  ? 211  SER D CA  1 
ATOM   7925 C C   . SER D 1 211 ? 10.738  0.200   15.095 1.00 82.52  ? 211  SER D C   1 
ATOM   7926 O O   . SER D 1 211 ? 11.284  -0.856  15.415 1.00 85.49  ? 211  SER D O   1 
ATOM   7927 C CB  . SER D 1 211 ? 11.045  0.891   12.718 1.00 80.88  ? 211  SER D CB  1 
ATOM   7928 O OG  . SER D 1 211 ? 9.639   0.929   12.554 1.00 81.74  ? 211  SER D OG  1 
ATOM   7929 N N   . TRP D 1 212 ? 9.531   0.550   15.522 1.00 84.58  ? 212  TRP D N   1 
ATOM   7930 C CA  . TRP D 1 212 ? 8.763   -0.303  16.409 1.00 87.42  ? 212  TRP D CA  1 
ATOM   7931 C C   . TRP D 1 212 ? 7.316   -0.328  15.947 1.00 88.70  ? 212  TRP D C   1 
ATOM   7932 O O   . TRP D 1 212 ? 6.684   0.731   15.881 1.00 86.99  ? 212  TRP D O   1 
ATOM   7933 C CB  . TRP D 1 212 ? 8.879   0.214   17.848 1.00 86.25  ? 212  TRP D CB  1 
ATOM   7934 C CG  . TRP D 1 212 ? 8.125   -0.574  18.874 1.00 89.28  ? 212  TRP D CG  1 
ATOM   7935 C CD1 . TRP D 1 212 ? 7.451   -1.749  18.683 1.00 92.69  ? 212  TRP D CD1 1 
ATOM   7936 C CD2 . TRP D 1 212 ? 8.005   -0.266  20.268 1.00 89.08  ? 212  TRP D CD2 1 
ATOM   7937 N NE1 . TRP D 1 212 ? 6.901   -2.176  19.867 1.00 93.54  ? 212  TRP D NE1 1 
ATOM   7938 C CE2 . TRP D 1 212 ? 7.229   -1.286  20.856 1.00 93.16  ? 212  TRP D CE2 1 
ATOM   7939 C CE3 . TRP D 1 212 ? 8.470   0.776   21.076 1.00 86.60  ? 212  TRP D CE3 1 
ATOM   7940 C CZ2 . TRP D 1 212 ? 6.908   -1.295  22.215 1.00 94.28  ? 212  TRP D CZ2 1 
ATOM   7941 C CZ3 . TRP D 1 212 ? 8.148   0.766   22.427 1.00 87.71  ? 212  TRP D CZ3 1 
ATOM   7942 C CH2 . TRP D 1 212 ? 7.375   -0.264  22.981 1.00 91.24  ? 212  TRP D CH2 1 
ATOM   7943 N N   . THR D 1 213 ? 6.803   -1.523  15.632 1.00 72.00  ? 213  THR D N   1 
ATOM   7944 C CA  . THR D 1 213 ? 5.407   -1.655  15.230 1.00 72.41  ? 213  THR D CA  1 
ATOM   7945 C C   . THR D 1 213 ? 4.585   -2.160  16.399 1.00 70.94  ? 213  THR D C   1 
ATOM   7946 O O   . THR D 1 213 ? 4.696   -3.316  16.806 1.00 71.57  ? 213  THR D O   1 
ATOM   7947 C CB  . THR D 1 213 ? 5.226   -2.598  14.041 1.00 69.12  ? 213  THR D CB  1 
ATOM   7948 O OG1 . THR D 1 213 ? 5.999   -2.125  12.934 1.00 69.19  ? 213  THR D OG1 1 
ATOM   7949 C CG2 . THR D 1 213 ? 3.771   -2.650  13.631 1.00 70.22  ? 213  THR D CG2 1 
ATOM   7950 N N   . VAL D 1 214 ? 3.756   -1.279  16.940 1.00 105.68 ? 214  VAL D N   1 
ATOM   7951 C CA  . VAL D 1 214 ? 2.976   -1.599  18.122 1.00 105.68 ? 214  VAL D CA  1 
ATOM   7952 C C   . VAL D 1 214 ? 1.683   -2.292  17.729 1.00 106.86 ? 214  VAL D C   1 
ATOM   7953 O O   . VAL D 1 214 ? 1.067   -1.939  16.726 1.00 107.70 ? 214  VAL D O   1 
ATOM   7954 C CB  . VAL D 1 214 ? 2.647   -0.337  18.924 1.00 105.27 ? 214  VAL D CB  1 
ATOM   7955 C CG1 . VAL D 1 214 ? 2.411   -0.700  20.370 1.00 107.13 ? 214  VAL D CG1 1 
ATOM   7956 C CG2 . VAL D 1 214 ? 3.785   0.659   18.817 1.00 104.47 ? 214  VAL D CG2 1 
ATOM   7957 N N   . MET D 1 215 ? 1.268   -3.278  18.519 1.00 75.00  ? 215  MET D N   1 
ATOM   7958 C CA  . MET D 1 215 ? 0.081   -4.052  18.178 1.00 76.78  ? 215  MET D CA  1 
ATOM   7959 C C   . MET D 1 215 ? -0.871  -4.271  19.340 1.00 78.60  ? 215  MET D C   1 
ATOM   7960 O O   . MET D 1 215 ? -0.459  -4.569  20.463 1.00 79.59  ? 215  MET D O   1 
ATOM   7961 C CB  . MET D 1 215 ? 0.477   -5.407  17.609 1.00 77.79  ? 215  MET D CB  1 
ATOM   7962 C CG  . MET D 1 215 ? 1.432   -5.326  16.452 1.00 77.71  ? 215  MET D CG  1 
ATOM   7963 S SD  . MET D 1 215 ? 2.112   -6.951  16.093 1.00 79.57  ? 215  MET D SD  1 
ATOM   7964 C CE  . MET D 1 215 ? 3.646   -6.494  15.289 1.00 79.68  ? 215  MET D CE  1 
ATOM   7965 N N   . HIS D 1 216 ? -2.155  -4.127  19.045 1.00 75.52  ? 216  HIS D N   1 
ATOM   7966 C CA  . HIS D 1 216 ? -3.195  -4.471  19.983 1.00 74.03  ? 216  HIS D CA  1 
ATOM   7967 C C   . HIS D 1 216 ? -4.045  -5.552  19.352 1.00 76.38  ? 216  HIS D C   1 
ATOM   7968 O O   . HIS D 1 216 ? -4.918  -5.253  18.542 1.00 77.99  ? 216  HIS D O   1 
ATOM   7969 C CB  . HIS D 1 216 ? -4.059  -3.253  20.286 1.00 75.28  ? 216  HIS D CB  1 
ATOM   7970 C CG  . HIS D 1 216 ? -5.359  -3.591  20.932 1.00 79.78  ? 216  HIS D CG  1 
ATOM   7971 N ND1 . HIS D 1 216 ? -5.465  -3.963  22.248 1.00 83.10  ? 216  HIS D ND1 1 
ATOM   7972 C CD2 . HIS D 1 216 ? -6.628  -3.618  20.435 1.00 82.81  ? 216  HIS D CD2 1 
ATOM   7973 C CE1 . HIS D 1 216 ? -6.732  -4.205  22.548 1.00 87.75  ? 216  HIS D CE1 1 
ATOM   7974 N NE2 . HIS D 1 216 ? -7.449  -3.997  21.451 1.00 87.41  ? 216  HIS D NE2 1 
ATOM   7975 N N   . PRO D 1 217 ? -3.772  -6.819  19.697 1.00 87.50  ? 217  PRO D N   1 
ATOM   7976 C CA  . PRO D 1 217 ? -4.624  -7.920  19.249 1.00 90.62  ? 217  PRO D CA  1 
ATOM   7977 C C   . PRO D 1 217 ? -6.063  -7.618  19.627 1.00 94.42  ? 217  PRO D C   1 
ATOM   7978 O O   . PRO D 1 217 ? -6.311  -7.060  20.701 1.00 95.65  ? 217  PRO D O   1 
ATOM   7979 C CB  . PRO D 1 217 ? -4.105  -9.113  20.063 1.00 91.70  ? 217  PRO D CB  1 
ATOM   7980 C CG  . PRO D 1 217 ? -3.282  -8.498  21.174 1.00 90.53  ? 217  PRO D CG  1 
ATOM   7981 C CD  . PRO D 1 217 ? -2.671  -7.305  20.534 1.00 86.77  ? 217  PRO D CD  1 
ATOM   7982 N N   . ILE D 1 218 ? -6.998  -7.956  18.749 1.00 79.91  ? 218  ILE D N   1 
ATOM   7983 C CA  . ILE D 1 218 ? -8.402  -7.738  19.044 1.00 84.55  ? 218  ILE D CA  1 
ATOM   7984 C C   . ILE D 1 218 ? -9.065  -9.077  19.304 1.00 88.79  ? 218  ILE D C   1 
ATOM   7985 O O   . ILE D 1 218 ? -9.163  -9.912  18.410 1.00 90.22  ? 218  ILE D O   1 
ATOM   7986 C CB  . ILE D 1 218 ? -9.122  -7.009  17.897 1.00 86.61  ? 218  ILE D CB  1 
ATOM   7987 C CG1 . ILE D 1 218 ? -8.337  -5.762  17.481 1.00 82.58  ? 218  ILE D CG1 1 
ATOM   7988 C CG2 . ILE D 1 218 ? -10.535 -6.637  18.319 1.00 91.88  ? 218  ILE D CG2 1 
ATOM   7989 C CD1 . ILE D 1 218 ? -9.057  -4.881  16.482 1.00 85.63  ? 218  ILE D CD1 1 
ATOM   7990 N N   . ASP D 1 219 ? -9.498  -9.283  20.541 1.00 128.57 ? 219  ASP D N   1 
ATOM   7991 C CA  . ASP D 1 219 ? -10.156 -10.520 20.934 1.00 133.45 ? 219  ASP D CA  1 
ATOM   7992 C C   . ASP D 1 219 ? -11.310 -10.173 21.860 1.00 139.43 ? 219  ASP D C   1 
ATOM   7993 O O   . ASP D 1 219 ? -11.642 -8.999  22.009 1.00 139.66 ? 219  ASP D O   1 
ATOM   7994 C CB  . ASP D 1 219 ? -9.169  -11.436 21.646 1.00 132.12 ? 219  ASP D CB  1 
ATOM   7995 C CG  . ASP D 1 219 ? -8.697  -10.865 22.966 1.00 132.78 ? 219  ASP D CG  1 
ATOM   7996 O OD1 . ASP D 1 219 ? -9.232  -9.822  23.396 1.00 134.59 ? 219  ASP D OD1 1 
ATOM   7997 O OD2 . ASP D 1 219 ? -7.790  -11.459 23.580 1.00 132.48 ? 219  ASP D OD2 1 
ATOM   7998 N N   . HIS D 1 220 ? -11.913 -11.168 22.503 1.00 130.16 ? 220  HIS D N   1 
ATOM   7999 C CA  . HIS D 1 220 ? -13.078 -10.877 23.339 1.00 137.56 ? 220  HIS D CA  1 
ATOM   8000 C C   . HIS D 1 220 ? -12.802 -9.899  24.484 1.00 138.63 ? 220  HIS D C   1 
ATOM   8001 O O   . HIS D 1 220 ? -13.733 -9.457  25.152 1.00 145.19 ? 220  HIS D O   1 
ATOM   8002 C CB  . HIS D 1 220 ? -13.770 -12.145 23.853 1.00 144.61 ? 220  HIS D CB  1 
ATOM   8003 C CG  . HIS D 1 220 ? -12.853 -13.304 24.043 1.00 142.67 ? 220  HIS D CG  1 
ATOM   8004 N ND1 . HIS D 1 220 ? -12.776 -14.346 23.145 1.00 141.50 ? 220  HIS D ND1 1 
ATOM   8005 C CD2 . HIS D 1 220 ? -11.967 -13.597 25.032 1.00 142.78 ? 220  HIS D CD2 1 
ATOM   8006 C CE1 . HIS D 1 220 ? -11.879 -15.224 23.564 1.00 140.26 ? 220  HIS D CE1 1 
ATOM   8007 N NE2 . HIS D 1 220 ? -11.380 -14.790 24.707 1.00 141.16 ? 220  HIS D NE2 1 
ATOM   8008 N N   . HIS D 1 221 ? -11.540 -9.542  24.699 1.00 147.26 ? 221  HIS D N   1 
ATOM   8009 C CA  . HIS D 1 221 ? -11.220 -8.569  25.742 1.00 149.06 ? 221  HIS D CA  1 
ATOM   8010 C C   . HIS D 1 221 ? -10.961 -7.154  25.221 1.00 144.02 ? 221  HIS D C   1 
ATOM   8011 O O   . HIS D 1 221 ? -10.996 -6.191  25.986 1.00 146.67 ? 221  HIS D O   1 
ATOM   8012 C CB  . HIS D 1 221 ? -10.052 -9.046  26.606 1.00 149.26 ? 221  HIS D CB  1 
ATOM   8013 C CG  . HIS D 1 221 ? -10.372 -10.254 27.429 1.00 156.69 ? 221  HIS D CG  1 
ATOM   8014 N ND1 . HIS D 1 221 ? -9.401  -11.098 27.930 1.00 157.31 ? 221  HIS D ND1 1 
ATOM   8015 C CD2 . HIS D 1 221 ? -11.558 -10.770 27.823 1.00 164.55 ? 221  HIS D CD2 1 
ATOM   8016 C CE1 . HIS D 1 221 ? -9.976  -12.069 28.605 1.00 165.24 ? 221  HIS D CE1 1 
ATOM   8017 N NE2 . HIS D 1 221 ? -11.284 -11.903 28.559 1.00 169.71 ? 221  HIS D NE2 1 
ATOM   8018 N N   . SER D 1 222 ? -10.706 -7.025  23.924 1.00 93.41  ? 222  SER D N   1 
ATOM   8019 C CA  . SER D 1 222 ? -10.472 -5.710  23.340 1.00 89.23  ? 222  SER D CA  1 
ATOM   8020 C C   . SER D 1 222 ? -11.749 -4.882  23.312 1.00 94.00  ? 222  SER D C   1 
ATOM   8021 O O   . SER D 1 222 ? -12.776 -5.336  22.817 1.00 97.91  ? 222  SER D O   1 
ATOM   8022 C CB  . SER D 1 222 ? -9.916  -5.837  21.926 1.00 83.33  ? 222  SER D CB  1 
ATOM   8023 O OG  . SER D 1 222 ? -9.771  -4.556  21.342 1.00 80.26  ? 222  SER D OG  1 
ATOM   8024 N N   . PRO D 1 223 ? -11.687 -3.655  23.839 1.00 95.25  ? 223  PRO D N   1 
ATOM   8025 C CA  . PRO D 1 223 ? -12.875 -2.800  23.829 1.00 98.95  ? 223  PRO D CA  1 
ATOM   8026 C C   . PRO D 1 223 ? -13.341 -2.506  22.409 1.00 96.63  ? 223  PRO D C   1 
ATOM   8027 O O   . PRO D 1 223 ? -14.409 -1.925  22.230 1.00 98.31  ? 223  PRO D O   1 
ATOM   8028 C CB  . PRO D 1 223 ? -12.390 -1.518  24.509 1.00 97.62  ? 223  PRO D CB  1 
ATOM   8029 C CG  . PRO D 1 223 ? -11.215 -1.940  25.320 1.00 97.79  ? 223  PRO D CG  1 
ATOM   8030 C CD  . PRO D 1 223 ? -10.553 -3.017  24.523 1.00 92.27  ? 223  PRO D CD  1 
ATOM   8031 N N   . ILE D 1 224 ? -12.553 -2.901  21.415 1.00 83.62  ? 224  ILE D N   1 
ATOM   8032 C CA  . ILE D 1 224 ? -12.946 -2.706  20.022 1.00 83.67  ? 224  ILE D CA  1 
ATOM   8033 C C   . ILE D 1 224 ? -13.250 -4.033  19.350 1.00 78.55  ? 224  ILE D C   1 
ATOM   8034 O O   . ILE D 1 224 ? -13.189 -4.150  18.131 1.00 78.56  ? 224  ILE D O   1 
ATOM   8035 C CB  . ILE D 1 224 ? -11.880 -1.936  19.211 1.00 77.68  ? 224  ILE D CB  1 
ATOM   8036 C CG1 . ILE D 1 224 ? -10.523 -2.632  19.303 1.00 76.91  ? 224  ILE D CG1 1 
ATOM   8037 C CG2 . ILE D 1 224 ? -11.781 -0.494  19.695 1.00 76.74  ? 224  ILE D CG2 1 
ATOM   8038 C CD1 . ILE D 1 224 ? -9.394  -1.851  18.658 1.00 79.07  ? 224  ILE D CD1 1 
ATOM   8039 N N   . TYR D 1 225 ? -13.591 -5.026  20.162 1.00 87.32  ? 225  TYR D N   1 
ATOM   8040 C CA  . TYR D 1 225 ? -13.929 -6.355  19.667 1.00 90.03  ? 225  TYR D CA  1 
ATOM   8041 C C   . TYR D 1 225 ? -15.207 -6.362  18.841 1.00 95.98  ? 225  TYR D C   1 
ATOM   8042 O O   . TYR D 1 225 ? -16.207 -5.763  19.229 1.00 97.62  ? 225  TYR D O   1 
ATOM   8043 C CB  . TYR D 1 225 ? -14.096 -7.321  20.835 1.00 92.97  ? 225  TYR D CB  1 
ATOM   8044 C CG  . TYR D 1 225 ? -14.431 -8.721  20.396 1.00 95.86  ? 225  TYR D CG  1 
ATOM   8045 C CD1 . TYR D 1 225 ? -13.526 -9.465  19.661 1.00 91.42  ? 225  TYR D CD1 1 
ATOM   8046 C CD2 . TYR D 1 225 ? -15.652 -9.301  20.716 1.00 103.79 ? 225  TYR D CD2 1 
ATOM   8047 C CE1 . TYR D 1 225 ? -13.820 -10.745 19.255 1.00 94.56  ? 225  TYR D CE1 1 
ATOM   8048 C CE2 . TYR D 1 225 ? -15.957 -10.585 20.314 1.00 106.85 ? 225  TYR D CE2 1 
ATOM   8049 C CZ  . TYR D 1 225 ? -15.036 -11.301 19.583 1.00 102.10 ? 225  TYR D CZ  1 
ATOM   8050 O OH  . TYR D 1 225 ? -15.329 -12.580 19.173 1.00 105.55 ? 225  TYR D OH  1 
ATOM   8051 N N   . GLY D 1 226 ? -15.176 -7.062  17.713 1.00 136.89 ? 226  GLY D N   1 
ATOM   8052 C CA  . GLY D 1 226 ? -16.342 -7.161  16.856 1.00 141.15 ? 226  GLY D CA  1 
ATOM   8053 C C   . GLY D 1 226 ? -16.942 -5.796  16.593 1.00 137.77 ? 226  GLY D C   1 
ATOM   8054 O O   . GLY D 1 226 ? -18.146 -5.586  16.729 1.00 138.23 ? 226  GLY D O   1 
ATOM   8055 N N   . GLU D 1 227 ? -16.080 -4.860  16.220 1.00 110.31 ? 227  GLU D N   1 
ATOM   8056 C CA  . GLU D 1 227 ? -16.485 -3.500  15.929 1.00 106.03 ? 227  GLU D CA  1 
ATOM   8057 C C   . GLU D 1 227 ? -16.164 -3.228  14.470 1.00 104.64 ? 227  GLU D C   1 
ATOM   8058 O O   . GLU D 1 227 ? -15.055 -3.505  14.016 1.00 104.48 ? 227  GLU D O   1 
ATOM   8059 C CB  . GLU D 1 227 ? -15.693 -2.538  16.812 1.00 102.77 ? 227  GLU D CB  1 
ATOM   8060 C CG  . GLU D 1 227 ? -16.325 -1.175  17.006 1.00 100.13 ? 227  GLU D CG  1 
ATOM   8061 C CD  . GLU D 1 227 ? -17.192 -1.120  18.245 1.00 101.90 ? 227  GLU D CD  1 
ATOM   8062 O OE1 . GLU D 1 227 ? -16.855 -1.813  19.227 1.00 104.13 ? 227  GLU D OE1 1 
ATOM   8063 O OE2 . GLU D 1 227 ? -18.200 -0.381  18.242 1.00 101.54 ? 227  GLU D OE2 1 
ATOM   8064 N N   . THR D 1 228 ? -17.128 -2.702  13.725 1.00 110.81 ? 228  THR D N   1 
ATOM   8065 C CA  . THR D 1 228 ? -16.846 -2.287  12.358 1.00 109.73 ? 228  THR D CA  1 
ATOM   8066 C C   . THR D 1 228 ? -16.418 -0.842  12.331 1.00 105.50 ? 228  THR D C   1 
ATOM   8067 O O   . THR D 1 228 ? -16.215 -0.214  13.369 1.00 103.63 ? 228  THR D O   1 
ATOM   8068 C CB  . THR D 1 228 ? -18.062 -2.405  11.428 1.00 111.89 ? 228  THR D CB  1 
ATOM   8069 O OG1 . THR D 1 228 ? -19.173 -1.695  11.994 1.00 110.83 ? 228  THR D OG1 1 
ATOM   8070 C CG2 . THR D 1 228 ? -18.426 -3.863  11.194 1.00 117.23 ? 228  THR D CG2 1 
ATOM   8071 N N   . ASP D 1 229 ? -16.292 -0.318  11.123 1.00 170.59 ? 229  ASP D N   1 
ATOM   8072 C CA  . ASP D 1 229 ? -15.999 1.082   10.944 1.00 167.59 ? 229  ASP D CA  1 
ATOM   8073 C C   . ASP D 1 229 ? -17.195 1.908   11.401 1.00 167.38 ? 229  ASP D C   1 
ATOM   8074 O O   . ASP D 1 229 ? -17.050 2.850   12.182 1.00 165.82 ? 229  ASP D O   1 
ATOM   8075 C CB  . ASP D 1 229 ? -15.687 1.360   9.481  1.00 167.88 ? 229  ASP D CB  1 
ATOM   8076 C CG  . ASP D 1 229 ? -15.223 2.771   9.256  1.00 165.51 ? 229  ASP D CG  1 
ATOM   8077 O OD1 . ASP D 1 229 ? -15.595 3.641   10.070 1.00 164.40 ? 229  ASP D OD1 1 
ATOM   8078 O OD2 . ASP D 1 229 ? -14.486 3.012   8.276  1.00 165.42 ? 229  ASP D OD2 1 
ATOM   8079 N N   . GLU D 1 230 ? -18.376 1.544   10.912 1.00 107.42 ? 230  GLU D N   1 
ATOM   8080 C CA  . GLU D 1 230 ? -19.599 2.260   11.252 1.00 107.74 ? 230  GLU D CA  1 
ATOM   8081 C C   . GLU D 1 230 ? -19.711 2.479   12.758 1.00 107.18 ? 230  GLU D C   1 
ATOM   8082 O O   . GLU D 1 230 ? -19.997 3.586   13.215 1.00 106.57 ? 230  GLU D O   1 
ATOM   8083 C CB  . GLU D 1 230 ? -20.824 1.504   10.734 1.00 110.62 ? 230  GLU D CB  1 
ATOM   8084 N N   . THR D 1 231 ? -19.470 1.420   13.523 1.00 123.72 ? 231  THR D N   1 
ATOM   8085 C CA  . THR D 1 231 ? -19.578 1.471   14.979 1.00 124.02 ? 231  THR D CA  1 
ATOM   8086 C C   . THR D 1 231 ? -18.551 2.401   15.628 1.00 121.99 ? 231  THR D C   1 
ATOM   8087 O O   . THR D 1 231 ? -18.817 3.000   16.671 1.00 122.52 ? 231  THR D O   1 
ATOM   8088 C CB  . THR D 1 231 ? -19.430 0.071   15.588 1.00 126.27 ? 231  THR D CB  1 
ATOM   8089 O OG1 . THR D 1 231 ? -18.293 -0.576  15.007 1.00 126.02 ? 231  THR D OG1 1 
ATOM   8090 C CG2 . THR D 1 231 ? -20.667 -0.763  15.310 1.00 129.33 ? 231  THR D CG2 1 
ATOM   8091 N N   . LEU D 1 232 ? -17.377 2.516   15.018 1.00 106.29 ? 232  LEU D N   1 
ATOM   8092 C CA  . LEU D 1 232 ? -16.343 3.397   15.549 1.00 104.72 ? 232  LEU D CA  1 
ATOM   8093 C C   . LEU D 1 232 ? -16.713 4.867   15.383 1.00 104.48 ? 232  LEU D C   1 
ATOM   8094 O O   . LEU D 1 232 ? -16.639 5.636   16.340 1.00 105.18 ? 232  LEU D O   1 
ATOM   8095 C CB  . LEU D 1 232 ? -14.984 3.106   14.913 1.00 103.16 ? 232  LEU D CB  1 
ATOM   8096 C CG  . LEU D 1 232 ? -14.212 1.929   15.513 1.00 103.83 ? 232  LEU D CG  1 
ATOM   8097 C CD1 . LEU D 1 232 ? -12.859 1.773   14.839 1.00 102.44 ? 232  LEU D CD1 1 
ATOM   8098 C CD2 . LEU D 1 232 ? -14.040 2.113   17.009 1.00 104.46 ? 232  LEU D CD2 1 
ATOM   8099 N N   . ARG D 1 233 ? -17.106 5.259   14.174 1.00 141.37 ? 233  ARG D N   1 
ATOM   8100 C CA  . ARG D 1 233 ? -17.579 6.620   13.946 1.00 142.18 ? 233  ARG D CA  1 
ATOM   8101 C C   . ARG D 1 233 ? -18.684 6.963   14.937 1.00 144.23 ? 233  ARG D C   1 
ATOM   8102 O O   . ARG D 1 233 ? -18.743 8.074   15.461 1.00 145.69 ? 233  ARG D O   1 
ATOM   8103 C CB  . ARG D 1 233 ? -18.094 6.790   12.514 1.00 142.56 ? 233  ARG D CB  1 
ATOM   8104 C CG  . ARG D 1 233 ? -17.033 6.579   11.451 1.00 141.26 ? 233  ARG D CG  1 
ATOM   8105 C CD  . ARG D 1 233 ? -17.408 7.236   10.130 1.00 142.41 ? 233  ARG D CD  1 
ATOM   8106 N NE  . ARG D 1 233 ? -16.209 7.626   9.394  1.00 141.58 ? 233  ARG D NE  1 
ATOM   8107 C CZ  . ARG D 1 233 ? -15.434 6.775   8.732  1.00 140.79 ? 233  ARG D CZ  1 
ATOM   8108 N NH1 . ARG D 1 233 ? -15.739 5.489   8.701  1.00 141.16 ? 233  ARG D NH1 1 
ATOM   8109 N NH2 . ARG D 1 233 ? -14.356 7.207   8.094  1.00 140.26 ? 233  ARG D NH2 1 
ATOM   8110 N N   . ASN D 1 234 ? -19.542 5.983   15.199 1.00 129.12 ? 234  ASN D N   1 
ATOM   8111 C CA  . ASN D 1 234 ? -20.741 6.168   16.012 1.00 131.33 ? 234  ASN D CA  1 
ATOM   8112 C C   . ASN D 1 234 ? -20.495 6.518   17.467 1.00 132.65 ? 234  ASN D C   1 
ATOM   8113 O O   . ASN D 1 234 ? -21.301 7.204   18.092 1.00 135.06 ? 234  ASN D O   1 
ATOM   8114 C CB  . ASN D 1 234 ? -21.615 4.920   15.949 1.00 132.14 ? 234  ASN D CB  1 
ATOM   8115 C CG  . ASN D 1 234 ? -22.506 4.902   14.734 1.00 132.62 ? 234  ASN D CG  1 
ATOM   8116 O OD1 . ASN D 1 234 ? -22.461 5.811   13.904 1.00 132.34 ? 234  ASN D OD1 1 
ATOM   8117 N ND2 . ASN D 1 234 ? -23.331 3.867   14.621 1.00 133.97 ? 234  ASN D ND2 1 
ATOM   8118 N N   . SER D 1 235 ? -19.398 6.015   18.013 1.00 88.91  ? 235  SER D N   1 
ATOM   8119 C CA  . SER D 1 235 ? -19.024 6.333   19.379 1.00 90.60  ? 235  SER D CA  1 
ATOM   8120 C C   . SER D 1 235 ? -18.081 7.528   19.364 1.00 90.52  ? 235  SER D C   1 
ATOM   8121 O O   . SER D 1 235 ? -17.505 7.893   20.389 1.00 92.11  ? 235  SER D O   1 
ATOM   8122 C CB  . SER D 1 235 ? -18.365 5.122   20.034 1.00 90.29  ? 235  SER D CB  1 
ATOM   8123 O OG  . SER D 1 235 ? -17.692 4.333   19.067 1.00 87.88  ? 235  SER D OG  1 
ATOM   8124 N N   . HIS D 1 236 ? -17.946 8.138   18.189 1.00 136.16 ? 236  HIS D N   1 
ATOM   8125 C CA  . HIS D 1 236 ? -17.020 9.244   17.988 1.00 136.39 ? 236  HIS D CA  1 
ATOM   8126 C C   . HIS D 1 236 ? -15.694 8.897   18.653 1.00 135.32 ? 236  HIS D C   1 
ATOM   8127 O O   . HIS D 1 236 ? -15.170 9.668   19.457 1.00 137.44 ? 236  HIS D O   1 
ATOM   8128 C CB  . HIS D 1 236 ? -17.595 10.543  18.564 1.00 140.47 ? 236  HIS D CB  1 
ATOM   8129 C CG  . HIS D 1 236 ? -16.914 11.781  18.066 1.00 141.83 ? 236  HIS D CG  1 
ATOM   8130 N ND1 . HIS D 1 236 ? -15.573 12.025  18.258 1.00 141.19 ? 236  HIS D ND1 1 
ATOM   8131 C CD2 . HIS D 1 236 ? -17.395 12.856  17.389 1.00 144.38 ? 236  HIS D CD2 1 
ATOM   8132 C CE1 . HIS D 1 236 ? -15.250 13.189  17.717 1.00 142.59 ? 236  HIS D CE1 1 
ATOM   8133 N NE2 . HIS D 1 236 ? -16.345 13.710  17.185 1.00 145.46 ? 236  HIS D NE2 1 
ATOM   8134 N N   . SER D 1 237 ? -15.160 7.727   18.314 1.00 84.69  ? 237  SER D N   1 
ATOM   8135 C CA  . SER D 1 237 ? -13.995 7.182   19.010 1.00 83.78  ? 237  SER D CA  1 
ATOM   8136 C C   . SER D 1 237 ? -12.660 7.485   18.328 1.00 79.70  ? 237  SER D C   1 
ATOM   8137 O O   . SER D 1 237 ? -12.521 7.357   17.110 1.00 78.87  ? 237  SER D O   1 
ATOM   8138 C CB  . SER D 1 237 ? -14.151 5.671   19.218 1.00 83.49  ? 237  SER D CB  1 
ATOM   8139 O OG  . SER D 1 237 ? -14.434 5.012   18.000 1.00 81.92  ? 237  SER D OG  1 
ATOM   8140 N N   . GLU D 1 238 ? -11.681 7.880   19.136 1.00 117.10 ? 238  GLU D N   1 
ATOM   8141 C CA  . GLU D 1 238 ? -10.342 8.168   18.647 1.00 113.32 ? 238  GLU D CA  1 
ATOM   8142 C C   . GLU D 1 238 ? -9.314  7.287   19.348 1.00 108.62 ? 238  GLU D C   1 
ATOM   8143 O O   . GLU D 1 238 ? -9.633  6.581   20.302 1.00 110.39 ? 238  GLU D O   1 
ATOM   8144 C CB  . GLU D 1 238 ? -9.999  9.637   18.884 1.00 112.60 ? 238  GLU D CB  1 
ATOM   8145 C CG  . GLU D 1 238 ? -11.088 10.618  18.476 1.00 117.90 ? 238  GLU D CG  1 
ATOM   8146 C CD  . GLU D 1 238 ? -10.719 12.046  18.819 1.00 117.73 ? 238  GLU D CD  1 
ATOM   8147 O OE1 . GLU D 1 238 ? -9.938  12.237  19.774 1.00 114.77 ? 238  GLU D OE1 1 
ATOM   8148 O OE2 . GLU D 1 238 ? -11.204 12.974  18.138 1.00 121.03 ? 238  GLU D OE2 1 
ATOM   8149 N N   . PHE D 1 239 ? -8.075  7.340   18.872 1.00 83.85  ? 239  PHE D N   1 
ATOM   8150 C CA  . PHE D 1 239 ? -6.996  6.562   19.464 1.00 79.95  ? 239  PHE D CA  1 
ATOM   8151 C C   . PHE D 1 239 ? -5.780  7.427   19.772 1.00 76.57  ? 239  PHE D C   1 
ATOM   8152 O O   . PHE D 1 239 ? -5.222  8.092   18.896 1.00 74.62  ? 239  PHE D O   1 
ATOM   8153 C CB  . PHE D 1 239 ? -6.624  5.393   18.558 1.00 78.15  ? 239  PHE D CB  1 
ATOM   8154 C CG  . PHE D 1 239 ? -7.767  4.466   18.288 1.00 82.05  ? 239  PHE D CG  1 
ATOM   8155 C CD1 . PHE D 1 239 ? -8.703  4.770   17.318 1.00 86.19  ? 239  PHE D CD1 1 
ATOM   8156 C CD2 . PHE D 1 239 ? -7.917  3.300   19.017 1.00 82.62  ? 239  PHE D CD2 1 
ATOM   8157 C CE1 . PHE D 1 239 ? -9.761  3.924   17.072 1.00 90.76  ? 239  PHE D CE1 1 
ATOM   8158 C CE2 . PHE D 1 239 ? -8.976  2.447   18.775 1.00 86.71  ? 239  PHE D CE2 1 
ATOM   8159 C CZ  . PHE D 1 239 ? -9.899  2.761   17.801 1.00 90.79  ? 239  PHE D CZ  1 
ATOM   8160 N N   . LEU D 1 240 ? -5.382  7.402   21.038 1.00 75.39  ? 240  LEU D N   1 
ATOM   8161 C CA  . LEU D 1 240 ? -4.325  8.253   21.552 1.00 73.89  ? 240  LEU D CA  1 
ATOM   8162 C C   . LEU D 1 240 ? -3.077  7.440   21.857 1.00 71.30  ? 240  LEU D C   1 
ATOM   8163 O O   . LEU D 1 240 ? -3.145  6.452   22.573 1.00 72.94  ? 240  LEU D O   1 
ATOM   8164 C CB  . LEU D 1 240 ? -4.806  8.929   22.831 1.00 78.74  ? 240  LEU D CB  1 
ATOM   8165 C CG  . LEU D 1 240 ? -3.881  10.020  23.344 1.00 78.67  ? 240  LEU D CG  1 
ATOM   8166 C CD1 . LEU D 1 240 ? -3.367  10.850  22.175 1.00 74.51  ? 240  LEU D CD1 1 
ATOM   8167 C CD2 . LEU D 1 240 ? -4.606  10.889  24.346 1.00 84.67  ? 240  LEU D CD2 1 
ATOM   8168 N N   . VAL D 1 241 ? -1.937  7.855   21.319 1.00 70.39  ? 241  VAL D N   1 
ATOM   8169 C CA  . VAL D 1 241 ? -0.689  7.147   21.573 1.00 73.47  ? 241  VAL D CA  1 
ATOM   8170 C C   . VAL D 1 241 ? 0.268   7.999   22.382 1.00 69.93  ? 241  VAL D C   1 
ATOM   8171 O O   . VAL D 1 241 ? 0.587   9.126   21.999 1.00 73.77  ? 241  VAL D O   1 
ATOM   8172 C CB  . VAL D 1 241 ? 0.032   6.763   20.270 1.00 69.99  ? 241  VAL D CB  1 
ATOM   8173 C CG1 . VAL D 1 241 ? 1.330   6.045   20.586 1.00 69.11  ? 241  VAL D CG1 1 
ATOM   8174 C CG2 . VAL D 1 241 ? -0.860  5.901   19.395 1.00 70.06  ? 241  VAL D CG2 1 
ATOM   8175 N N   . LEU D 1 242 ? 0.732   7.460   23.501 1.00 73.34  ? 242  LEU D N   1 
ATOM   8176 C CA  . LEU D 1 242 ? 1.773   8.124   24.264 1.00 70.07  ? 242  LEU D CA  1 
ATOM   8177 C C   . LEU D 1 242 ? 3.038   7.286   24.279 1.00 72.81  ? 242  LEU D C   1 
ATOM   8178 O O   . LEU D 1 242 ? 3.034   6.156   24.751 1.00 71.69  ? 242  LEU D O   1 
ATOM   8179 C CB  . LEU D 1 242 ? 1.327   8.388   25.697 1.00 75.74  ? 242  LEU D CB  1 
ATOM   8180 C CG  . LEU D 1 242 ? 2.478   8.751   26.635 1.00 77.10  ? 242  LEU D CG  1 
ATOM   8181 C CD1 . LEU D 1 242 ? 3.307   9.900   26.066 1.00 77.10  ? 242  LEU D CD1 1 
ATOM   8182 C CD2 . LEU D 1 242 ? 1.952   9.099   28.013 1.00 81.64  ? 242  LEU D CD2 1 
ATOM   8183 N N   . PHE D 1 243 ? 4.121   7.851   23.760 1.00 70.58  ? 243  PHE D N   1 
ATOM   8184 C CA  . PHE D 1 243 ? 5.421   7.205   23.816 1.00 69.83  ? 243  PHE D CA  1 
ATOM   8185 C C   . PHE D 1 243 ? 6.329   7.936   24.780 1.00 70.92  ? 243  PHE D C   1 
ATOM   8186 O O   . PHE D 1 243 ? 6.334   9.165   24.817 1.00 73.01  ? 243  PHE D O   1 
ATOM   8187 C CB  . PHE D 1 243 ? 6.088   7.214   22.451 1.00 67.60  ? 243  PHE D CB  1 
ATOM   8188 C CG  . PHE D 1 243 ? 7.549   6.895   22.507 1.00 76.30  ? 243  PHE D CG  1 
ATOM   8189 C CD1 . PHE D 1 243 ? 7.998   5.608   22.276 1.00 73.11  ? 243  PHE D CD1 1 
ATOM   8190 C CD2 . PHE D 1 243 ? 8.474   7.873   22.820 1.00 77.55  ? 243  PHE D CD2 1 
ATOM   8191 C CE1 . PHE D 1 243 ? 9.349   5.305   22.339 1.00 69.80  ? 243  PHE D CE1 1 
ATOM   8192 C CE2 . PHE D 1 243 ? 9.824   7.574   22.888 1.00 74.85  ? 243  PHE D CE2 1 
ATOM   8193 C CZ  . PHE D 1 243 ? 10.261  6.288   22.647 1.00 70.26  ? 243  PHE D CZ  1 
ATOM   8194 N N   . THR D 1 244 ? 7.114   7.185   25.544 1.00 73.48  ? 244  THR D N   1 
ATOM   8195 C CA  . THR D 1 244 ? 8.102   7.784   26.438 1.00 74.35  ? 244  THR D CA  1 
ATOM   8196 C C   . THR D 1 244 ? 9.307   6.866   26.614 1.00 74.21  ? 244  THR D C   1 
ATOM   8197 O O   . THR D 1 244 ? 9.200   5.655   26.463 1.00 72.14  ? 244  THR D O   1 
ATOM   8198 C CB  . THR D 1 244 ? 7.511   8.111   27.831 1.00 77.89  ? 244  THR D CB  1 
ATOM   8199 O OG1 . THR D 1 244 ? 7.436   6.919   28.619 1.00 75.69  ? 244  THR D OG1 1 
ATOM   8200 C CG2 . THR D 1 244 ? 6.119   8.706   27.711 1.00 82.41  ? 244  THR D CG2 1 
ATOM   8201 N N   . GLY D 1 245 ? 10.454  7.448   26.942 1.00 96.42  ? 245  GLY D N   1 
ATOM   8202 C CA  . GLY D 1 245 ? 11.672  6.679   27.121 1.00 93.81  ? 245  GLY D CA  1 
ATOM   8203 C C   . GLY D 1 245 ? 12.835  7.569   27.507 1.00 95.14  ? 245  GLY D C   1 
ATOM   8204 O O   . GLY D 1 245 ? 12.708  8.791   27.508 1.00 98.52  ? 245  GLY D O   1 
ATOM   8205 N N   . HIS D 1 246 ? 13.968  6.962   27.838 1.00 75.10  ? 246  HIS D N   1 
ATOM   8206 C CA  . HIS D 1 246 ? 15.147  7.723   28.221 1.00 74.18  ? 246  HIS D CA  1 
ATOM   8207 C C   . HIS D 1 246 ? 16.112  7.855   27.050 1.00 72.90  ? 246  HIS D C   1 
ATOM   8208 O O   . HIS D 1 246 ? 16.706  6.869   26.619 1.00 73.12  ? 246  HIS D O   1 
ATOM   8209 C CB  . HIS D 1 246 ? 15.847  7.061   29.398 1.00 76.69  ? 246  HIS D CB  1 
ATOM   8210 C CG  . HIS D 1 246 ? 17.097  7.757   29.818 1.00 78.51  ? 246  HIS D CG  1 
ATOM   8211 N ND1 . HIS D 1 246 ? 17.147  8.607   30.903 1.00 79.55  ? 246  HIS D ND1 1 
ATOM   8212 C CD2 . HIS D 1 246 ? 18.348  7.743   29.295 1.00 78.04  ? 246  HIS D CD2 1 
ATOM   8213 C CE1 . HIS D 1 246 ? 18.376  9.082   31.030 1.00 81.15  ? 246  HIS D CE1 1 
ATOM   8214 N NE2 . HIS D 1 246 ? 19.120  8.573   30.069 1.00 78.66  ? 246  HIS D NE2 1 
ATOM   8215 N N   . HIS D 1 247 ? 16.273  9.076   26.544 1.00 78.89  ? 247  HIS D N   1 
ATOM   8216 C CA  . HIS D 1 247 ? 17.063  9.314   25.338 1.00 78.23  ? 247  HIS D CA  1 
ATOM   8217 C C   . HIS D 1 247 ? 18.547  9.431   25.639 1.00 78.92  ? 247  HIS D C   1 
ATOM   8218 O O   . HIS D 1 247 ? 18.962  10.300  26.399 1.00 82.66  ? 247  HIS D O   1 
ATOM   8219 C CB  . HIS D 1 247 ? 16.592  10.583  24.630 1.00 81.00  ? 247  HIS D CB  1 
ATOM   8220 C CG  . HIS D 1 247 ? 16.798  10.556  23.151 1.00 79.59  ? 247  HIS D CG  1 
ATOM   8221 N ND1 . HIS D 1 247 ? 18.044  10.396  22.580 1.00 78.39  ? 247  HIS D ND1 1 
ATOM   8222 C CD2 . HIS D 1 247 ? 15.924  10.664  22.126 1.00 79.60  ? 247  HIS D CD2 1 
ATOM   8223 C CE1 . HIS D 1 247 ? 17.922  10.408  21.265 1.00 77.54  ? 247  HIS D CE1 1 
ATOM   8224 N NE2 . HIS D 1 247 ? 16.651  10.570  20.960 1.00 78.21  ? 247  HIS D NE2 1 
ATOM   8225 N N   . GLU D 1 248 ? 19.345  8.556   25.040 1.00 108.17 ? 248  GLU D N   1 
ATOM   8226 C CA  . GLU D 1 248 ? 20.786  8.595   25.246 1.00 109.26 ? 248  GLU D CA  1 
ATOM   8227 C C   . GLU D 1 248 ? 21.394  9.918   24.789 1.00 112.68 ? 248  GLU D C   1 
ATOM   8228 O O   . GLU D 1 248 ? 22.318  10.429  25.418 1.00 115.61 ? 248  GLU D O   1 
ATOM   8229 C CB  . GLU D 1 248 ? 21.471  7.405   24.569 1.00 107.07 ? 248  GLU D CB  1 
ATOM   8230 C CG  . GLU D 1 248 ? 21.412  6.127   25.400 1.00 106.68 ? 248  GLU D CG  1 
ATOM   8231 C CD  . GLU D 1 248 ? 21.987  4.913   24.683 1.00 106.65 ? 248  GLU D CD  1 
ATOM   8232 O OE1 . GLU D 1 248 ? 22.811  5.085   23.757 1.00 106.84 ? 248  GLU D OE1 1 
ATOM   8233 O OE2 . GLU D 1 248 ? 21.614  3.778   25.051 1.00 107.44 ? 248  GLU D OE2 1 
ATOM   8234 N N   . ALA D 1 249 ? 20.870  10.477  23.704 1.00 77.54  ? 249  ALA D N   1 
ATOM   8235 C CA  . ALA D 1 249 ? 21.340  11.770  23.215 1.00 72.79  ? 249  ALA D CA  1 
ATOM   8236 C C   . ALA D 1 249 ? 21.397  12.791  24.345 1.00 74.00  ? 249  ALA D C   1 
ATOM   8237 O O   . ALA D 1 249 ? 22.427  13.419  24.583 1.00 75.78  ? 249  ALA D O   1 
ATOM   8238 C CB  . ALA D 1 249 ? 20.441  12.276  22.100 1.00 72.68  ? 249  ALA D CB  1 
ATOM   8239 N N   . PHE D 1 250 ? 20.287  12.939  25.055 1.00 74.56  ? 250  PHE D N   1 
ATOM   8240 C CA  . PHE D 1 250 ? 20.172  13.979  26.065 1.00 77.21  ? 250  PHE D CA  1 
ATOM   8241 C C   . PHE D 1 250 ? 20.459  13.473  27.472 1.00 78.55  ? 250  PHE D C   1 
ATOM   8242 O O   . PHE D 1 250 ? 20.592  14.268  28.398 1.00 81.79  ? 250  PHE D O   1 
ATOM   8243 C CB  . PHE D 1 250 ? 18.785  14.617  25.991 1.00 76.96  ? 250  PHE D CB  1 
ATOM   8244 C CG  . PHE D 1 250 ? 18.365  14.965  24.592 1.00 78.08  ? 250  PHE D CG  1 
ATOM   8245 C CD1 . PHE D 1 250 ? 17.364  14.251  23.948 1.00 73.31  ? 250  PHE D CD1 1 
ATOM   8246 C CD2 . PHE D 1 250 ? 18.997  15.987  23.910 1.00 84.37  ? 250  PHE D CD2 1 
ATOM   8247 C CE1 . PHE D 1 250 ? 16.986  14.569  22.659 1.00 74.53  ? 250  PHE D CE1 1 
ATOM   8248 C CE2 . PHE D 1 250 ? 18.628  16.307  22.618 1.00 85.85  ? 250  PHE D CE2 1 
ATOM   8249 C CZ  . PHE D 1 250 ? 17.623  15.598  21.991 1.00 80.72  ? 250  PHE D CZ  1 
ATOM   8250 N N   . ALA D 1 251 ? 20.569  12.155  27.629 1.00 91.63  ? 251  ALA D N   1 
ATOM   8251 C CA  . ALA D 1 251 ? 20.762  11.554  28.948 1.00 90.69  ? 251  ALA D CA  1 
ATOM   8252 C C   . ALA D 1 251 ? 19.644  12.021  29.866 1.00 93.79  ? 251  ALA D C   1 
ATOM   8253 O O   . ALA D 1 251 ? 19.866  12.382  31.020 1.00 97.21  ? 251  ALA D O   1 
ATOM   8254 C CB  . ALA D 1 251 ? 22.117  11.939  29.516 1.00 93.78  ? 251  ALA D CB  1 
ATOM   8255 N N   . GLN D 1 252 ? 18.433  12.005  29.329 1.00 79.17  ? 252  GLN D N   1 
ATOM   8256 C CA  . GLN D 1 252 ? 17.287  12.607  29.979 1.00 79.59  ? 252  GLN D CA  1 
ATOM   8257 C C   . GLN D 1 252 ? 16.038  11.981  29.371 1.00 79.82  ? 252  GLN D C   1 
ATOM   8258 O O   . GLN D 1 252 ? 16.082  11.439  28.263 1.00 75.71  ? 252  GLN D O   1 
ATOM   8259 C CB  . GLN D 1 252 ? 17.319  14.110  29.727 1.00 81.65  ? 252  GLN D CB  1 
ATOM   8260 C CG  . GLN D 1 252 ? 16.316  14.929  30.493 1.00 85.33  ? 252  GLN D CG  1 
ATOM   8261 C CD  . GLN D 1 252 ? 16.368  16.389  30.089 1.00 85.62  ? 252  GLN D CD  1 
ATOM   8262 O OE1 . GLN D 1 252 ? 17.148  16.777  29.214 1.00 86.95  ? 252  GLN D OE1 1 
ATOM   8263 N NE2 . GLN D 1 252 ? 15.538  17.209  30.723 1.00 94.25  ? 252  GLN D NE2 1 
ATOM   8264 N N   . ASN D 1 253 ? 14.926  12.037  30.089 1.00 108.89 ? 253  ASN D N   1 
ATOM   8265 C CA  . ASN D 1 253 ? 13.706  11.432  29.579 1.00 106.11 ? 253  ASN D CA  1 
ATOM   8266 C C   . ASN D 1 253 ? 13.040  12.254  28.488 1.00 109.64 ? 253  ASN D C   1 
ATOM   8267 O O   . ASN D 1 253 ? 13.116  13.483  28.485 1.00 116.79 ? 253  ASN D O   1 
ATOM   8268 C CB  . ASN D 1 253 ? 12.725  11.132  30.709 1.00 107.18 ? 253  ASN D CB  1 
ATOM   8269 C CG  . ASN D 1 253 ? 12.861  9.718   31.230 1.00 101.75 ? 253  ASN D CG  1 
ATOM   8270 O OD1 . ASN D 1 253 ? 11.960  8.893   31.060 1.00 99.46  ? 253  ASN D OD1 1 
ATOM   8271 N ND2 . ASN D 1 253 ? 14.000  9.420   31.847 1.00 100.64 ? 253  ASN D ND2 1 
ATOM   8272 N N   . VAL D 1 254 ? 12.394  11.561  27.558 1.00 75.37  ? 254  VAL D N   1 
ATOM   8273 C CA  . VAL D 1 254 ? 11.709  12.204  26.450 1.00 74.95  ? 254  VAL D CA  1 
ATOM   8274 C C   . VAL D 1 254 ? 10.348  11.564  26.275 1.00 73.41  ? 254  VAL D C   1 
ATOM   8275 O O   . VAL D 1 254 ? 10.111  10.468  26.765 1.00 72.32  ? 254  VAL D O   1 
ATOM   8276 C CB  . VAL D 1 254 ? 12.478  12.013  25.137 1.00 71.65  ? 254  VAL D CB  1 
ATOM   8277 C CG1 . VAL D 1 254 ? 13.747  12.841  25.132 1.00 74.71  ? 254  VAL D CG1 1 
ATOM   8278 C CG2 . VAL D 1 254 ? 12.795  10.544  24.924 1.00 78.87  ? 254  VAL D CG2 1 
ATOM   8279 N N   . HIS D 1 255 ? 9.448   12.246  25.584 1.00 78.87  ? 255  HIS D N   1 
ATOM   8280 C CA  . HIS D 1 255 ? 8.207   11.613  25.177 1.00 76.76  ? 255  HIS D CA  1 
ATOM   8281 C C   . HIS D 1 255 ? 7.602   12.291  23.980 1.00 73.72  ? 255  HIS D C   1 
ATOM   8282 O O   . HIS D 1 255 ? 8.055   13.341  23.522 1.00 73.05  ? 255  HIS D O   1 
ATOM   8283 C CB  . HIS D 1 255 ? 7.173   11.613  26.303 1.00 80.81  ? 255  HIS D CB  1 
ATOM   8284 C CG  . HIS D 1 255 ? 6.863   12.984  26.841 1.00 87.46  ? 255  HIS D CG  1 
ATOM   8285 N ND1 . HIS D 1 255 ? 7.168   13.341  28.143 1.00 94.90  ? 255  HIS D ND1 1 
ATOM   8286 C CD2 . HIS D 1 255 ? 6.298   14.070  26.275 1.00 84.50  ? 255  HIS D CD2 1 
ATOM   8287 C CE1 . HIS D 1 255 ? 6.813   14.590  28.336 1.00 96.00  ? 255  HIS D CE1 1 
ATOM   8288 N NE2 . HIS D 1 255 ? 6.277   15.069  27.242 1.00 89.71  ? 255  HIS D NE2 1 
ATOM   8289 N N   . ALA D 1 256 ? 6.555   11.655  23.488 1.00 76.98  ? 256  ALA D N   1 
ATOM   8290 C CA  . ALA D 1 256 ? 5.915   12.066  22.272 1.00 72.57  ? 256  ALA D CA  1 
ATOM   8291 C C   . ALA D 1 256 ? 4.508   11.520  22.314 1.00 71.76  ? 256  ALA D C   1 
ATOM   8292 O O   . ALA D 1 256 ? 4.279   10.407  22.776 1.00 72.44  ? 256  ALA D O   1 
ATOM   8293 C CB  . ALA D 1 256 ? 6.657   11.492  21.103 1.00 69.67  ? 256  ALA D CB  1 
ATOM   8294 N N   . ARG D 1 257 ? 3.556   12.301  21.837 1.00 84.96  ? 257  ARG D N   1 
ATOM   8295 C CA  . ARG D 1 257 ? 2.206   11.792  21.736 1.00 84.82  ? 257  ARG D CA  1 
ATOM   8296 C C   . ARG D 1 257 ? 1.640   12.039  20.369 1.00 82.54  ? 257  ARG D C   1 
ATOM   8297 O O   . ARG D 1 257 ? 2.097   12.911  19.627 1.00 81.89  ? 257  ARG D O   1 
ATOM   8298 C CB  . ARG D 1 257 ? 1.327   12.450  22.761 1.00 88.85  ? 257  ARG D CB  1 
ATOM   8299 C CG  . ARG D 1 257 ? 1.819   13.797  23.045 1.00 90.53  ? 257  ARG D CG  1 
ATOM   8300 C CD  . ARG D 1 257 ? 0.849   14.483  23.863 1.00 95.14  ? 257  ARG D CD  1 
ATOM   8301 N NE  . ARG D 1 257 ? 1.308   15.806  24.206 1.00 97.45  ? 257  ARG D NE  1 
ATOM   8302 C CZ  . ARG D 1 257 ? 0.716   16.954  23.886 1.00 97.04  ? 257  ARG D CZ  1 
ATOM   8303 N NH1 . ARG D 1 257 ? -0.447  17.025  23.223 1.00 95.20  ? 257  ARG D NH1 1 
ATOM   8304 N NH2 . ARG D 1 257 ? 1.300   18.065  24.296 1.00 99.52  ? 257  ARG D NH2 1 
ATOM   8305 N N   . HIS D 1 258 ? 0.628   11.249  20.054 1.00 75.87  ? 258  HIS D N   1 
ATOM   8306 C CA  . HIS D 1 258 ? -0.029  11.318  18.771 1.00 75.57  ? 258  HIS D CA  1 
ATOM   8307 C C   . HIS D 1 258 ? -1.463  10.856  18.962 1.00 77.58  ? 258  HIS D C   1 
ATOM   8308 O O   . HIS D 1 258 ? -1.769  10.152  19.922 1.00 78.45  ? 258  HIS D O   1 
ATOM   8309 C CB  . HIS D 1 258 ? 0.696   10.427  17.764 1.00 73.98  ? 258  HIS D CB  1 
ATOM   8310 C CG  . HIS D 1 258 ? 0.281   10.660  16.344 1.00 75.64  ? 258  HIS D CG  1 
ATOM   8311 N ND1 . HIS D 1 258 ? 0.632   11.804  15.651 1.00 76.96  ? 258  HIS D ND1 1 
ATOM   8312 C CD2 . HIS D 1 258 ? -0.443  9.909   15.495 1.00 77.51  ? 258  HIS D CD2 1 
ATOM   8313 C CE1 . HIS D 1 258 ? 0.134   11.736  14.431 1.00 80.10  ? 258  HIS D CE1 1 
ATOM   8314 N NE2 . HIS D 1 258 ? -0.524  10.601  14.303 1.00 80.66  ? 258  HIS D NE2 1 
ATOM   8315 N N   . ALA D 1 259 ? -2.343  11.262  18.057 1.00 73.28  ? 259  ALA D N   1 
ATOM   8316 C CA  . ALA D 1 259 ? -3.730  10.833  18.118 1.00 71.21  ? 259  ALA D CA  1 
ATOM   8317 C C   . ALA D 1 259 ? -4.231  10.473  16.727 1.00 73.08  ? 259  ALA D C   1 
ATOM   8318 O O   . ALA D 1 259 ? -3.811  11.063  15.727 1.00 73.75  ? 259  ALA D O   1 
ATOM   8319 C CB  . ALA D 1 259 ? -4.593  11.915  18.730 1.00 74.34  ? 259  ALA D CB  1 
ATOM   8320 N N   . TYR D 1 260 ? -5.131  9.497   16.673 1.00 75.15  ? 260  TYR D N   1 
ATOM   8321 C CA  . TYR D 1 260 ? -5.737  9.065   15.418 1.00 78.83  ? 260  TYR D CA  1 
ATOM   8322 C C   . TYR D 1 260 ? -7.251  9.120   15.532 1.00 83.85  ? 260  TYR D C   1 
ATOM   8323 O O   . TYR D 1 260 ? -7.807  8.848   16.593 1.00 84.02  ? 260  TYR D O   1 
ATOM   8324 C CB  . TYR D 1 260 ? -5.331  7.630   15.083 1.00 77.66  ? 260  TYR D CB  1 
ATOM   8325 C CG  . TYR D 1 260 ? -3.855  7.414   14.864 1.00 73.91  ? 260  TYR D CG  1 
ATOM   8326 C CD1 . TYR D 1 260 ? -3.099  6.701   15.782 1.00 69.99  ? 260  TYR D CD1 1 
ATOM   8327 C CD2 . TYR D 1 260 ? -3.220  7.906   13.732 1.00 75.53  ? 260  TYR D CD2 1 
ATOM   8328 C CE1 . TYR D 1 260 ? -1.758  6.488   15.586 1.00 67.51  ? 260  TYR D CE1 1 
ATOM   8329 C CE2 . TYR D 1 260 ? -1.874  7.697   13.528 1.00 73.07  ? 260  TYR D CE2 1 
ATOM   8330 C CZ  . TYR D 1 260 ? -1.151  6.987   14.462 1.00 68.85  ? 260  TYR D CZ  1 
ATOM   8331 O OH  . TYR D 1 260 ? 0.190   6.770   14.279 1.00 67.17  ? 260  TYR D OH  1 
ATOM   8332 N N   . SER D 1 261 ? -7.921  9.460   14.438 1.00 96.01  ? 261  SER D N   1 
ATOM   8333 C CA  . SER D 1 261 ? -9.377  9.431   14.410 1.00 99.14  ? 261  SER D CA  1 
ATOM   8334 C C   . SER D 1 261 ? -9.858  8.136   13.772 1.00 100.03 ? 261  SER D C   1 
ATOM   8335 O O   . SER D 1 261 ? -9.087  7.438   13.118 1.00 98.86  ? 261  SER D O   1 
ATOM   8336 C CB  . SER D 1 261 ? -9.929  10.638  13.654 1.00 102.46 ? 261  SER D CB  1 
ATOM   8337 O OG  . SER D 1 261 ? -9.207  10.861  12.457 1.00 102.73 ? 261  SER D OG  1 
ATOM   8338 N N   . CYS D 1 262 ? -11.130 7.811   13.972 1.00 135.42 ? 262  CYS D N   1 
ATOM   8339 C CA  . CYS D 1 262 ? -11.702 6.590   13.416 1.00 134.99 ? 262  CYS D CA  1 
ATOM   8340 C C   . CYS D 1 262 ? -11.302 6.380   11.955 1.00 134.37 ? 262  CYS D C   1 
ATOM   8341 O O   . CYS D 1 262 ? -11.012 5.259   11.536 1.00 134.16 ? 262  CYS D O   1 
ATOM   8342 C CB  . CYS D 1 262 ? -13.227 6.609   13.558 1.00 136.52 ? 262  CYS D CB  1 
ATOM   8343 S SG  . CYS D 1 262 ? -13.958 8.270   13.530 1.00 138.47 ? 262  CYS D SG  1 
ATOM   8344 N N   . ASP D 1 263 ? -11.261 7.470   11.194 1.00 146.93 ? 263  ASP D N   1 
ATOM   8345 C CA  . ASP D 1 263 ? -11.028 7.408   9.752  1.00 147.17 ? 263  ASP D CA  1 
ATOM   8346 C C   . ASP D 1 263 ? -9.562  7.292   9.338  1.00 146.00 ? 263  ASP D C   1 
ATOM   8347 O O   . ASP D 1 263 ? -9.259  7.262   8.147  1.00 146.59 ? 263  ASP D O   1 
ATOM   8348 C CB  . ASP D 1 263 ? -11.613 8.641   9.076  1.00 148.94 ? 263  ASP D CB  1 
ATOM   8349 C CG  . ASP D 1 263 ? -10.923 9.911   9.512  1.00 149.49 ? 263  ASP D CG  1 
ATOM   8350 O OD1 . ASP D 1 263 ? -11.151 10.334  10.664 1.00 150.02 ? 263  ASP D OD1 1 
ATOM   8351 O OD2 . ASP D 1 263 ? -10.149 10.482  8.712  1.00 149.98 ? 263  ASP D OD2 1 
ATOM   8352 N N   . GLU D 1 264 ? -8.651  7.254   10.303 1.00 102.37 ? 264  GLU D N   1 
ATOM   8353 C CA  . GLU D 1 264 ? -7.238  7.075   9.980  1.00 101.32 ? 264  GLU D CA  1 
ATOM   8354 C C   . GLU D 1 264 ? -6.852  5.624   10.213 1.00 100.84 ? 264  GLU D C   1 
ATOM   8355 O O   . GLU D 1 264 ? -5.673  5.263   10.198 1.00 100.13 ? 264  GLU D O   1 
ATOM   8356 C CB  . GLU D 1 264 ? -6.361  8.008   10.811 1.00 100.85 ? 264  GLU D CB  1 
ATOM   8357 C CG  . GLU D 1 264 ? -7.064  9.284   11.218 1.00 102.20 ? 264  GLU D CG  1 
ATOM   8358 C CD  . GLU D 1 264 ? -6.182  10.506  11.084 1.00 101.86 ? 264  GLU D CD  1 
ATOM   8359 O OE1 . GLU D 1 264 ? -5.446  10.599  10.079 1.00 103.06 ? 264  GLU D OE1 1 
ATOM   8360 O OE2 . GLU D 1 264 ? -6.238  11.382  11.973 1.00 101.14 ? 264  GLU D OE2 1 
ATOM   8361 N N   . ILE D 1 265 ? -7.870  4.803   10.443 1.00 94.28  ? 265  ILE D N   1 
ATOM   8362 C CA  . ILE D 1 265 ? -7.702  3.367   10.536 1.00 95.19  ? 265  ILE D CA  1 
ATOM   8363 C C   . ILE D 1 265 ? -7.939  2.752   9.165  1.00 97.03  ? 265  ILE D C   1 
ATOM   8364 O O   . ILE D 1 265 ? -9.048  2.806   8.632  1.00 98.31  ? 265  ILE D O   1 
ATOM   8365 C CB  . ILE D 1 265 ? -8.698  2.754   11.520 1.00 96.19  ? 265  ILE D CB  1 
ATOM   8366 C CG1 . ILE D 1 265 ? -8.524  3.371   12.908 1.00 94.15  ? 265  ILE D CG1 1 
ATOM   8367 C CG2 . ILE D 1 265 ? -8.526  1.246   11.573 1.00 98.23  ? 265  ILE D CG2 1 
ATOM   8368 C CD1 . ILE D 1 265 ? -9.516  2.855   13.926 1.00 95.03  ? 265  ILE D CD1 1 
ATOM   8369 N N   . ILE D 1 266 ? -6.889  2.175   8.596  1.00 78.82  ? 266  ILE D N   1 
ATOM   8370 C CA  . ILE D 1 266 ? -6.969  1.531   7.296  1.00 80.17  ? 266  ILE D CA  1 
ATOM   8371 C C   . ILE D 1 266 ? -7.256  0.044   7.473  1.00 81.99  ? 266  ILE D C   1 
ATOM   8372 O O   . ILE D 1 266 ? -6.350  -0.743  7.743  1.00 79.53  ? 266  ILE D O   1 
ATOM   8373 C CB  . ILE D 1 266 ? -5.662  1.734   6.516  1.00 75.83  ? 266  ILE D CB  1 
ATOM   8374 C CG1 . ILE D 1 266 ? -5.665  3.108   5.848  1.00 76.90  ? 266  ILE D CG1 1 
ATOM   8375 C CG2 . ILE D 1 266 ? -5.469  0.642   5.479  1.00 76.49  ? 266  ILE D CG2 1 
ATOM   8376 C CD1 . ILE D 1 266 ? -4.314  3.523   5.302  1.00 76.67  ? 266  ILE D CD1 1 
ATOM   8377 N N   . TRP D 1 267 ? -8.523  -0.337  7.334  1.00 82.33  ? 267  TRP D N   1 
ATOM   8378 C CA  . TRP D 1 267 ? -8.921  -1.726  7.540  1.00 86.09  ? 267  TRP D CA  1 
ATOM   8379 C C   . TRP D 1 267 ? -8.357  -2.651  6.466  1.00 87.82  ? 267  TRP D C   1 
ATOM   8380 O O   . TRP D 1 267 ? -8.442  -2.367  5.273  1.00 88.43  ? 267  TRP D O   1 
ATOM   8381 C CB  . TRP D 1 267 ? -10.443 -1.856  7.598  1.00 88.70  ? 267  TRP D CB  1 
ATOM   8382 C CG  . TRP D 1 267 ? -11.071 -1.056  8.692  1.00 85.43  ? 267  TRP D CG  1 
ATOM   8383 C CD1 . TRP D 1 267 ? -11.270 0.291   8.706  1.00 82.26  ? 267  TRP D CD1 1 
ATOM   8384 C CD2 . TRP D 1 267 ? -11.594 -1.554  9.929  1.00 85.92  ? 267  TRP D CD2 1 
ATOM   8385 N NE1 . TRP D 1 267 ? -11.881 0.669   9.879  1.00 80.85  ? 267  TRP D NE1 1 
ATOM   8386 C CE2 . TRP D 1 267 ? -12.092 -0.445  10.647 1.00 82.88  ? 267  TRP D CE2 1 
ATOM   8387 C CE3 . TRP D 1 267 ? -11.691 -2.824  10.504 1.00 89.34  ? 267  TRP D CE3 1 
ATOM   8388 C CZ2 . TRP D 1 267 ? -12.676 -0.572  11.909 1.00 82.95  ? 267  TRP D CZ2 1 
ATOM   8389 C CZ3 . TRP D 1 267 ? -12.273 -2.948  11.759 1.00 89.29  ? 267  TRP D CZ3 1 
ATOM   8390 C CH2 . TRP D 1 267 ? -12.757 -1.830  12.445 1.00 86.02  ? 267  TRP D CH2 1 
ATOM   8391 N N   . GLY D 1 268 ? -7.779  -3.761  6.902  1.00 81.05  ? 268  GLY D N   1 
ATOM   8392 C CA  . GLY D 1 268 ? -7.205  -4.732  5.992  1.00 83.81  ? 268  GLY D CA  1 
ATOM   8393 C C   . GLY D 1 268 ? -5.805  -4.364  5.545  1.00 78.09  ? 268  GLY D C   1 
ATOM   8394 O O   . GLY D 1 268 ? -5.097  -5.182  4.955  1.00 80.27  ? 268  GLY D O   1 
ATOM   8395 N N   . GLY D 1 269 ? -5.402  -3.131  5.829  1.00 118.59 ? 269  GLY D N   1 
ATOM   8396 C CA  . GLY D 1 269 ? -4.094  -2.649  5.428  1.00 113.33 ? 269  GLY D CA  1 
ATOM   8397 C C   . GLY D 1 269 ? -2.953  -3.378  6.110  1.00 112.20 ? 269  GLY D C   1 
ATOM   8398 O O   . GLY D 1 269 ? -3.132  -4.002  7.155  1.00 114.47 ? 269  GLY D O   1 
ATOM   8399 N N   . HIS D 1 270 ? -1.775  -3.308  5.503  1.00 125.66 ? 270  HIS D N   1 
ATOM   8400 C CA  . HIS D 1 270 ? -0.563  -3.846  6.096  1.00 124.63 ? 270  HIS D CA  1 
ATOM   8401 C C   . HIS D 1 270 ? 0.539   -2.833  5.895  1.00 118.27 ? 270  HIS D C   1 
ATOM   8402 O O   . HIS D 1 270 ? 0.745   -2.362  4.785  1.00 117.07 ? 270  HIS D O   1 
ATOM   8403 C CB  . HIS D 1 270 ? -0.161  -5.151  5.414  1.00 130.78 ? 270  HIS D CB  1 
ATOM   8404 C CG  . HIS D 1 270 ? -1.143  -6.263  5.607  1.00 138.95 ? 270  HIS D CG  1 
ATOM   8405 N ND1 . HIS D 1 270 ? -1.990  -6.691  4.609  1.00 144.32 ? 270  HIS D ND1 1 
ATOM   8406 C CD2 . HIS D 1 270 ? -1.417  -7.036  6.688  1.00 143.44 ? 270  HIS D CD2 1 
ATOM   8407 C CE1 . HIS D 1 270 ? -2.742  -7.681  5.062  1.00 152.02 ? 270  HIS D CE1 1 
ATOM   8408 N NE2 . HIS D 1 270 ? -2.411  -7.906  6.323  1.00 151.74 ? 270  HIS D NE2 1 
ATOM   8409 N N   . PHE D 1 271 ? 1.247   -2.485  6.959  1.00 76.79  ? 271  PHE D N   1 
ATOM   8410 C CA  . PHE D 1 271 ? 2.380   -1.589  6.807  1.00 71.69  ? 271  PHE D CA  1 
ATOM   8411 C C   . PHE D 1 271 ? 3.397   -2.240  5.905  1.00 72.94  ? 271  PHE D C   1 
ATOM   8412 O O   . PHE D 1 271 ? 3.731   -3.412  6.075  1.00 77.20  ? 271  PHE D O   1 
ATOM   8413 C CB  . PHE D 1 271 ? 3.001   -1.239  8.157  1.00 72.47  ? 271  PHE D CB  1 
ATOM   8414 C CG  . PHE D 1 271 ? 2.240   -0.194  8.901  1.00 70.73  ? 271  PHE D CG  1 
ATOM   8415 C CD1 . PHE D 1 271 ? 1.482   -0.524  10.012 1.00 72.43  ? 271  PHE D CD1 1 
ATOM   8416 C CD2 . PHE D 1 271 ? 2.252   1.116   8.468  1.00 68.70  ? 271  PHE D CD2 1 
ATOM   8417 C CE1 . PHE D 1 271 ? 0.768   0.438   10.687 1.00 71.82  ? 271  PHE D CE1 1 
ATOM   8418 C CE2 . PHE D 1 271 ? 1.540   2.078   9.138  1.00 69.03  ? 271  PHE D CE2 1 
ATOM   8419 C CZ  . PHE D 1 271 ? 0.797   1.739   10.250 1.00 70.46  ? 271  PHE D CZ  1 
ATOM   8420 N N   . VAL D 1 272 ? 3.863   -1.482  4.924  1.00 82.56  ? 272  VAL D N   1 
ATOM   8421 C CA  . VAL D 1 272 ? 4.936   -1.943  4.067  1.00 83.51  ? 272  VAL D CA  1 
ATOM   8422 C C   . VAL D 1 272 ? 6.176   -2.109  4.926  1.00 81.84  ? 272  VAL D C   1 
ATOM   8423 O O   . VAL D 1 272 ? 6.204   -1.681  6.078  1.00 79.21  ? 272  VAL D O   1 
ATOM   8424 C CB  . VAL D 1 272 ? 5.207   -0.951  2.928  1.00 80.98  ? 272  VAL D CB  1 
ATOM   8425 C CG1 . VAL D 1 272 ? 6.633   -1.088  2.407  1.00 80.27  ? 272  VAL D CG1 1 
ATOM   8426 C CG2 . VAL D 1 272 ? 4.196   -1.144  1.817  1.00 84.31  ? 272  VAL D CG2 1 
ATOM   8427 N N   . ASP D 1 273 ? 7.192   -2.748  4.367  1.00 116.52 ? 273  ASP D N   1 
ATOM   8428 C CA  . ASP D 1 273 ? 8.421   -2.905  5.109  1.00 115.79 ? 273  ASP D CA  1 
ATOM   8429 C C   . ASP D 1 273 ? 9.412   -1.826  4.686  1.00 110.93 ? 273  ASP D C   1 
ATOM   8430 O O   . ASP D 1 273 ? 9.505   -1.406  3.571  1.00 110.07 ? 273  ASP D O   1 
ATOM   8431 C CB  . ASP D 1 273 ? 9.039   -4.276  4.863  1.00 122.93 ? 273  ASP D CB  1 
ATOM   8432 C CG  . ASP D 1 273 ? 10.117  -4.617  5.878  1.00 123.58 ? 273  ASP D CG  1 
ATOM   8433 O OD1 . ASP D 1 273 ? 10.361  -3.788  6.777  1.00 117.96 ? 273  ASP D OD1 1 
ATOM   8434 O OD2 . ASP D 1 273 ? 10.724  -5.705  5.776  1.00 130.58 ? 273  ASP D OD2 1 
ATOM   8435 N N   . VAL D 1 274 ? 10.173  -1.307  5.599  1.00 85.89  ? 274  VAL D N   1 
ATOM   8436 C CA  . VAL D 1 274 ? 11.249  -0.365  5.337  1.00 82.50  ? 274  VAL D CA  1 
ATOM   8437 C C   . VAL D 1 274 ? 12.584  -1.016  5.650  1.00 84.29  ? 274  VAL D C   1 
ATOM   8438 O O   . VAL D 1 274 ? 13.620  -0.353  5.707  1.00 81.91  ? 274  VAL D O   1 
ATOM   8439 C CB  . VAL D 1 274 ? 11.105  0.867   6.252  1.00 78.51  ? 274  VAL D CB  1 
ATOM   8440 C CG1 . VAL D 1 274 ? 9.964   1.722   5.747  1.00 77.97  ? 274  VAL D CG1 1 
ATOM   8441 C CG2 . VAL D 1 274 ? 10.875  0.434   7.683  1.00 78.72  ? 274  VAL D CG2 1 
ATOM   8442 N N   . PHE D 1 275 ? 12.544  -2.321  5.881  1.00 88.72  ? 275  PHE D N   1 
ATOM   8443 C CA  . PHE D 1 275 ? 13.740  -3.078  6.222  1.00 104.89 ? 275  PHE D CA  1 
ATOM   8444 C C   . PHE D 1 275 ? 14.202  -3.918  5.047  1.00 111.93 ? 275  PHE D C   1 
ATOM   8445 O O   . PHE D 1 275 ? 13.436  -4.675  4.452  1.00 107.88 ? 275  PHE D O   1 
ATOM   8446 C CB  . PHE D 1 275 ? 13.523  -3.931  7.473  1.00 110.75 ? 275  PHE D CB  1 
ATOM   8447 C CG  . PHE D 1 275 ? 13.371  -3.124  8.715  1.00 107.32 ? 275  PHE D CG  1 
ATOM   8448 C CD1 . PHE D 1 275 ? 12.151  -3.028  9.350  1.00 97.68  ? 275  PHE D CD1 1 
ATOM   8449 C CD2 . PHE D 1 275 ? 14.443  -2.423  9.221  1.00 113.74 ? 275  PHE D CD2 1 
ATOM   8450 C CE1 . PHE D 1 275 ? 12.013  -2.264  10.483 1.00 94.99  ? 275  PHE D CE1 1 
ATOM   8451 C CE2 . PHE D 1 275 ? 14.311  -1.661  10.350 1.00 110.34 ? 275  PHE D CE2 1 
ATOM   8452 C CZ  . PHE D 1 275 ? 13.096  -1.578  10.983 1.00 101.15 ? 275  PHE D CZ  1 
ATOM   8453 N N   . THR D 1 276 ? 15.473  -3.757  4.718  1.00 84.25  ? 276  THR D N   1 
ATOM   8454 C CA  . THR D 1 276 ? 16.028  -4.288  3.495  1.00 82.71  ? 276  THR D CA  1 
ATOM   8455 C C   . THR D 1 276 ? 17.284  -5.065  3.788  1.00 89.71  ? 276  THR D C   1 
ATOM   8456 O O   . THR D 1 276 ? 17.858  -4.955  4.865  1.00 95.02  ? 276  THR D O   1 
ATOM   8457 C CB  . THR D 1 276 ? 16.411  -3.147  2.578  1.00 79.00  ? 276  THR D CB  1 
ATOM   8458 O OG1 . THR D 1 276 ? 15.231  -2.415  2.239  1.00 76.15  ? 276  THR D OG1 1 
ATOM   8459 C CG2 . THR D 1 276 ? 17.064  -3.673  1.322  1.00 78.55  ? 276  THR D CG2 1 
ATOM   8460 N N   . THR D 1 277 ? 17.702  -5.869  2.824  1.00 91.05  ? 277  THR D N   1 
ATOM   8461 C CA  . THR D 1 277 ? 19.010  -6.475  2.877  1.00 89.23  ? 277  THR D CA  1 
ATOM   8462 C C   . THR D 1 277 ? 19.793  -5.915  1.708  1.00 88.32  ? 277  THR D C   1 
ATOM   8463 O O   . THR D 1 277 ? 19.371  -6.014  0.557  1.00 84.78  ? 277  THR D O   1 
ATOM   8464 C CB  . THR D 1 277 ? 18.933  -7.995  2.773  1.00 91.84  ? 277  THR D CB  1 
ATOM   8465 O OG1 . THR D 1 277 ? 17.829  -8.470  3.554  1.00 91.79  ? 277  THR D OG1 1 
ATOM   8466 C CG2 . THR D 1 277 ? 20.223  -8.616  3.275  1.00 100.30 ? 277  THR D CG2 1 
ATOM   8467 N N   . LEU D 1 278 ? 20.923  -5.295  2.010  1.00 92.26  ? 278  LEU D N   1 
ATOM   8468 C CA  . LEU D 1 278 ? 21.744  -4.697  0.974  1.00 92.47  ? 278  LEU D CA  1 
ATOM   8469 C C   . LEU D 1 278 ? 22.343  -5.786  0.103  1.00 96.20  ? 278  LEU D C   1 
ATOM   8470 O O   . LEU D 1 278 ? 22.252  -6.972  0.430  1.00 99.06  ? 278  LEU D O   1 
ATOM   8471 C CB  . LEU D 1 278 ? 22.853  -3.849  1.594  1.00 97.27  ? 278  LEU D CB  1 
ATOM   8472 C CG  . LEU D 1 278 ? 22.349  -2.630  2.357  1.00 93.68  ? 278  LEU D CG  1 
ATOM   8473 C CD1 . LEU D 1 278 ? 23.496  -1.900  2.997  1.00 98.51  ? 278  LEU D CD1 1 
ATOM   8474 C CD2 . LEU D 1 278 ? 21.599  -1.710  1.433  1.00 86.31  ? 278  LEU D CD2 1 
ATOM   8475 N N   . PRO D 1 279 ? 22.947  -5.389  -1.022 1.00 110.31 ? 279  PRO D N   1 
ATOM   8476 C CA  . PRO D 1 279 ? 23.734  -6.337  -1.805 1.00 115.68 ? 279  PRO D CA  1 
ATOM   8477 C C   . PRO D 1 279 ? 24.843  -6.860  -0.910 1.00 124.89 ? 279  PRO D C   1 
ATOM   8478 O O   . PRO D 1 279 ? 25.163  -8.044  -0.935 1.00 129.77 ? 279  PRO D O   1 
ATOM   8479 C CB  . PRO D 1 279 ? 24.327  -5.451  -2.905 1.00 115.51 ? 279  PRO D CB  1 
ATOM   8480 C CG  . PRO D 1 279 ? 24.298  -4.079  -2.318 1.00 112.41 ? 279  PRO D CG  1 
ATOM   8481 C CD  . PRO D 1 279 ? 22.994  -4.047  -1.616 1.00 106.11 ? 279  PRO D CD  1 
ATOM   8482 N N   . ASP D 1 280 ? 25.400  -5.969  -0.097 1.00 131.68 ? 280  ASP D N   1 
ATOM   8483 C CA  . ASP D 1 280 ? 26.478  -6.323  0.816  1.00 139.96 ? 280  ASP D CA  1 
ATOM   8484 C C   . ASP D 1 280 ? 26.052  -7.406  1.806  1.00 141.58 ? 280  ASP D C   1 
ATOM   8485 O O   . ASP D 1 280 ? 26.889  -8.097  2.377  1.00 148.81 ? 280  ASP D O   1 
ATOM   8486 C CB  . ASP D 1 280 ? 26.977  -5.077  1.561  1.00 140.35 ? 280  ASP D CB  1 
ATOM   8487 C CG  . ASP D 1 280 ? 28.130  -5.382  2.503  1.00 148.50 ? 280  ASP D CG  1 
ATOM   8488 O OD1 . ASP D 1 280 ? 28.683  -6.498  2.425  1.00 154.60 ? 280  ASP D OD1 1 
ATOM   8489 O OD2 . ASP D 1 280 ? 28.493  -4.509  3.319  1.00 148.80 ? 280  ASP D OD2 1 
ATOM   8490 N N   . GLY D 1 281 ? 24.748  -7.560  2.002  1.00 116.19 ? 281  GLY D N   1 
ATOM   8491 C CA  . GLY D 1 281 ? 24.241  -8.487  2.998  1.00 117.62 ? 281  GLY D CA  1 
ATOM   8492 C C   . GLY D 1 281 ? 24.106  -7.816  4.353  1.00 117.66 ? 281  GLY D C   1 
ATOM   8493 O O   . GLY D 1 281 ? 23.909  -8.466  5.377  1.00 120.33 ? 281  GLY D O   1 
ATOM   8494 N N   . ARG D 1 282 ? 24.224  -6.497  4.361  1.00 151.68 ? 282  ARG D N   1 
ATOM   8495 C CA  . ARG D 1 282 ? 24.042  -5.729  5.582  1.00 151.18 ? 282  ARG D CA  1 
ATOM   8496 C C   . ARG D 1 282 ? 22.615  -5.193  5.591  1.00 143.93 ? 282  ARG D C   1 
ATOM   8497 O O   . ARG D 1 282 ? 22.178  -4.634  4.603  1.00 138.54 ? 282  ARG D O   1 
ATOM   8498 C CB  . ARG D 1 282 ? 25.054  -4.583  5.617  1.00 152.78 ? 282  ARG D CB  1 
ATOM   8499 C CG  . ARG D 1 282 ? 25.463  -4.086  4.233  1.00 151.15 ? 282  ARG D CG  1 
ATOM   8500 C CD  . ARG D 1 282 ? 26.510  -2.978  4.315  1.00 153.55 ? 282  ARG D CD  1 
ATOM   8501 N NE  . ARG D 1 282 ? 26.484  -2.092  3.150  1.00 149.70 ? 282  ARG D NE  1 
ATOM   8502 C CZ  . ARG D 1 282 ? 26.832  -0.809  3.191  1.00 148.17 ? 282  ARG D CZ  1 
ATOM   8503 N NH1 . ARG D 1 282 ? 27.228  -0.277  4.337  1.00 149.97 ? 282  ARG D NH1 1 
ATOM   8504 N NH2 . ARG D 1 282 ? 26.778  -0.058  2.098  1.00 144.77 ? 282  ARG D NH2 1 
ATOM   8505 N N   . ARG D 1 283 ? 21.868  -5.368  6.676  1.00 108.84 ? 283  ARG D N   1 
ATOM   8506 C CA  . ARG D 1 283 ? 20.478  -4.891  6.703  1.00 102.78 ? 283  ARG D CA  1 
ATOM   8507 C C   . ARG D 1 283 ? 20.461  -3.371  6.603  1.00 99.15  ? 283  ARG D C   1 
ATOM   8508 O O   . ARG D 1 283 ? 21.482  -2.744  6.832  1.00 101.73 ? 283  ARG D O   1 
ATOM   8509 C CB  . ARG D 1 283 ? 19.734  -5.430  7.944  1.00 105.05 ? 283  ARG D CB  1 
ATOM   8510 C CG  . ARG D 1 283 ? 18.574  -4.594  8.568  1.00 102.28 ? 283  ARG D CG  1 
ATOM   8511 C CD  . ARG D 1 283 ? 17.538  -5.596  9.163  1.00 102.82 ? 283  ARG D CD  1 
ATOM   8512 N NE  . ARG D 1 283 ? 16.882  -5.285  10.448 1.00 105.26 ? 283  ARG D NE  1 
ATOM   8513 C CZ  . ARG D 1 283 ? 17.443  -4.654  11.478 1.00 108.85 ? 283  ARG D CZ  1 
ATOM   8514 N NH1 . ARG D 1 283 ? 18.684  -4.237  11.388 1.00 110.07 ? 283  ARG D NH1 1 
ATOM   8515 N NH2 . ARG D 1 283 ? 16.767  -4.447  12.606 1.00 111.49 ? 283  ARG D NH2 1 
ATOM   8516 N N   . ALA D 1 284 ? 19.314  -2.791  6.248  1.00 98.25  ? 284  ALA D N   1 
ATOM   8517 C CA  . ALA D 1 284 ? 19.187  -1.350  5.982  1.00 94.05  ? 284  ALA D CA  1 
ATOM   8518 C C   . ALA D 1 284 ? 17.808  -0.770  6.327  1.00 88.69  ? 284  ALA D C   1 
ATOM   8519 O O   . ALA D 1 284 ? 16.853  -1.512  6.471  1.00 85.83  ? 284  ALA D O   1 
ATOM   8520 C CB  . ALA D 1 284 ? 19.529  -1.051  4.540  1.00 90.53  ? 284  ALA D CB  1 
ATOM   8521 N N   . LEU D 1 285 ? 17.720  0.553   6.481  1.00 79.05  ? 285  LEU D N   1 
ATOM   8522 C CA  . LEU D 1 285 ? 16.425  1.224   6.690  1.00 77.57  ? 285  LEU D CA  1 
ATOM   8523 C C   . LEU D 1 285 ? 16.109  2.313   5.666  1.00 73.63  ? 285  LEU D C   1 
ATOM   8524 O O   . LEU D 1 285 ? 16.883  3.256   5.492  1.00 72.60  ? 285  LEU D O   1 
ATOM   8525 C CB  . LEU D 1 285 ? 16.377  1.825   8.097  1.00 81.77  ? 285  LEU D CB  1 
ATOM   8526 C CG  . LEU D 1 285 ? 15.120  2.623   8.451  1.00 80.71  ? 285  LEU D CG  1 
ATOM   8527 C CD1 . LEU D 1 285 ? 13.891  1.727   8.419  1.00 81.87  ? 285  LEU D CD1 1 
ATOM   8528 C CD2 . LEU D 1 285 ? 15.269  3.288   9.810  1.00 82.69  ? 285  LEU D CD2 1 
ATOM   8529 N N   . ASP D 1 286 ? 14.964  2.180   5.008  1.00 103.10 ? 286  ASP D N   1 
ATOM   8530 C CA  . ASP D 1 286 ? 14.536  3.084   3.962  1.00 102.63 ? 286  ASP D CA  1 
ATOM   8531 C C   . ASP D 1 286 ? 13.270  3.773   4.475  1.00 101.72 ? 286  ASP D C   1 
ATOM   8532 O O   . ASP D 1 286 ? 12.185  3.262   4.200  1.00 102.75 ? 286  ASP D O   1 
ATOM   8533 C CB  . ASP D 1 286 ? 14.169  2.243   2.733  1.00 105.04 ? 286  ASP D CB  1 
ATOM   8534 C CG  . ASP D 1 286 ? 14.111  3.057   1.449  1.00 105.33 ? 286  ASP D CG  1 
ATOM   8535 O OD1 . ASP D 1 286 ? 14.157  4.320   1.537  1.00 104.36 ? 286  ASP D OD1 1 
ATOM   8536 O OD2 . ASP D 1 286 ? 14.017  2.433   0.360  1.00 107.49 ? 286  ASP D OD2 1 
ATOM   8537 N N   . LEU D 1 287 ? 13.397  4.838   5.289  1.00 70.14  ? 287  LEU D N   1 
ATOM   8538 C CA  . LEU D 1 287 ? 12.284  5.491   6.013  1.00 68.78  ? 287  LEU D CA  1 
ATOM   8539 C C   . LEU D 1 287 ? 11.287  6.201   5.094  1.00 69.06  ? 287  LEU D C   1 
ATOM   8540 O O   . LEU D 1 287 ? 10.453  6.968   5.566  1.00 69.13  ? 287  LEU D O   1 
ATOM   8541 C CB  . LEU D 1 287 ? 12.812  6.468   7.074  1.00 68.91  ? 287  LEU D CB  1 
ATOM   8542 C CG  . LEU D 1 287 ? 13.340  5.977   8.427  1.00 66.87  ? 287  LEU D CG  1 
ATOM   8543 C CD1 . LEU D 1 287 ? 13.684  7.177   9.268  1.00 67.87  ? 287  LEU D CD1 1 
ATOM   8544 C CD2 . LEU D 1 287 ? 12.324  5.102   9.143  1.00 66.23  ? 287  LEU D CD2 1 
ATOM   8545 N N   . GLY D 1 288 ? 11.388  5.997   3.786  1.00 77.20  ? 288  GLY D N   1 
ATOM   8546 C CA  . GLY D 1 288 ? 10.381  6.540   2.893  1.00 79.81  ? 288  GLY D CA  1 
ATOM   8547 C C   . GLY D 1 288 ? 9.126   5.679   2.871  1.00 80.08  ? 288  GLY D C   1 
ATOM   8548 O O   . GLY D 1 288 ? 7.993   6.130   2.649  1.00 82.57  ? 288  GLY D O   1 
ATOM   8549 N N   . LYS D 1 289 ? 9.337   4.401   3.119  1.00 115.59 ? 289  LYS D N   1 
ATOM   8550 C CA  . LYS D 1 289 ? 8.248   3.451   3.150  1.00 116.85 ? 289  LYS D CA  1 
ATOM   8551 C C   . LYS D 1 289 ? 7.436   3.567   4.434  1.00 116.67 ? 289  LYS D C   1 
ATOM   8552 O O   . LYS D 1 289 ? 6.332   3.040   4.524  1.00 118.35 ? 289  LYS D O   1 
ATOM   8553 C CB  . LYS D 1 289 ? 8.816   2.048   2.998  1.00 117.45 ? 289  LYS D CB  1 
ATOM   8554 C CG  . LYS D 1 289 ? 9.823   1.963   1.883  1.00 117.92 ? 289  LYS D CG  1 
ATOM   8555 C CD  . LYS D 1 289 ? 10.455  0.606   1.783  1.00 120.52 ? 289  LYS D CD  1 
ATOM   8556 C CE  . LYS D 1 289 ? 11.508  0.704   0.720  1.00 121.33 ? 289  LYS D CE  1 
ATOM   8557 N NZ  . LYS D 1 289 ? 10.863  1.237   -0.555 1.00 121.93 ? 289  LYS D NZ  1 
ATOM   8558 N N   . PHE D 1 290 ? 7.976   4.274   5.421  1.00 85.95  ? 290  PHE D N   1 
ATOM   8559 C CA  . PHE D 1 290 ? 7.408   4.282   6.769  1.00 85.78  ? 290  PHE D CA  1 
ATOM   8560 C C   . PHE D 1 290 ? 5.906   4.534   6.831  1.00 88.32  ? 290  PHE D C   1 
ATOM   8561 O O   . PHE D 1 290 ? 5.208   3.936   7.654  1.00 88.70  ? 290  PHE D O   1 
ATOM   8562 C CB  . PHE D 1 290 ? 8.132   5.280   7.670  1.00 84.89  ? 290  PHE D CB  1 
ATOM   8563 C CG  . PHE D 1 290 ? 7.697   5.208   9.102  1.00 84.63  ? 290  PHE D CG  1 
ATOM   8564 C CD1 . PHE D 1 290 ? 8.023   4.110   9.878  1.00 83.07  ? 290  PHE D CD1 1 
ATOM   8565 C CD2 . PHE D 1 290 ? 6.954   6.228   9.669  1.00 87.02  ? 290  PHE D CD2 1 
ATOM   8566 C CE1 . PHE D 1 290 ? 7.626   4.032   11.196 1.00 83.07  ? 290  PHE D CE1 1 
ATOM   8567 C CE2 . PHE D 1 290 ? 6.554   6.158   10.986 1.00 87.05  ? 290  PHE D CE2 1 
ATOM   8568 C CZ  . PHE D 1 290 ? 6.892   5.057   11.752 1.00 84.65  ? 290  PHE D CZ  1 
ATOM   8569 N N   . HIS D 1 291 ? 5.409   5.417   5.972  1.00 77.92  ? 291  HIS D N   1 
ATOM   8570 C CA  . HIS D 1 291 ? 3.988   5.762   6.001  1.00 81.42  ? 291  HIS D CA  1 
ATOM   8571 C C   . HIS D 1 291 ? 3.155   4.951   5.022  1.00 82.88  ? 291  HIS D C   1 
ATOM   8572 O O   . HIS D 1 291 ? 1.942   5.146   4.910  1.00 86.23  ? 291  HIS D O   1 
ATOM   8573 C CB  . HIS D 1 291 ? 3.787   7.249   5.740  1.00 85.51  ? 291  HIS D CB  1 
ATOM   8574 C CG  . HIS D 1 291 ? 4.229   8.125   6.870  1.00 86.28  ? 291  HIS D CG  1 
ATOM   8575 N ND1 . HIS D 1 291 ? 3.573   8.141   8.090  1.00 87.19  ? 291  HIS D ND1 1 
ATOM   8576 C CD2 . HIS D 1 291 ? 5.240   9.004   6.970  1.00 86.94  ? 291  HIS D CD2 1 
ATOM   8577 C CE1 . HIS D 1 291 ? 4.180   9.001   8.885  1.00 88.40  ? 291  HIS D CE1 1 
ATOM   8578 N NE2 . HIS D 1 291 ? 5.189   9.543   8.244  1.00 88.45  ? 291  HIS D NE2 1 
ATOM   8579 N N   . GLU D 1 292 ? 3.818   4.037   4.325  1.00 132.97 ? 292  GLU D N   1 
ATOM   8580 C CA  . GLU D 1 292 ? 3.165   3.275   3.277  1.00 135.19 ? 292  GLU D CA  1 
ATOM   8581 C C   . GLU D 1 292 ? 2.441   2.051   3.766  1.00 136.57 ? 292  GLU D C   1 
ATOM   8582 O O   . GLU D 1 292 ? 3.026   1.186   4.443  1.00 135.50 ? 292  GLU D O   1 
ATOM   8583 C CB  . GLU D 1 292 ? 4.127   2.942   2.138  1.00 134.46 ? 292  GLU D CB  1 
ATOM   8584 C CG  . GLU D 1 292 ? 4.229   4.034   1.098  1.00 135.68 ? 292  GLU D CG  1 
ATOM   8585 C CD  . GLU D 1 292 ? 5.297   3.758   0.070  1.00 134.82 ? 292  GLU D CD  1 
ATOM   8586 O OE1 . GLU D 1 292 ? 5.713   2.593   -0.063 1.00 134.55 ? 292  GLU D OE1 1 
ATOM   8587 O OE2 . GLU D 1 292 ? 5.733   4.712   -0.601 1.00 135.38 ? 292  GLU D OE2 1 
ATOM   8588 N N   . ILE D 1 293 ? 1.151   2.056   3.432  1.00 74.84  ? 293  ILE D N   1 
ATOM   8589 C CA  . ILE D 1 293 ? 0.358   0.921   3.837  1.00 73.14  ? 293  ILE D CA  1 
ATOM   8590 C C   . ILE D 1 293 ? -0.178  0.123   2.645  1.00 76.77  ? 293  ILE D C   1 
ATOM   8591 O O   . ILE D 1 293 ? -0.983  0.633   1.861  1.00 79.24  ? 293  ILE D O   1 
ATOM   8592 C CB  . ILE D 1 293 ? -0.816  1.355   4.699  1.00 75.04  ? 293  ILE D CB  1 
ATOM   8593 C CG1 . ILE D 1 293 ? -0.354  2.247   5.850  1.00 72.42  ? 293  ILE D CG1 1 
ATOM   8594 C CG2 . ILE D 1 293 ? -1.577  0.140   5.214  1.00 77.80  ? 293  ILE D CG2 1 
ATOM   8595 C CD1 . ILE D 1 293 ? -1.423  2.534   6.851  1.00 74.60  ? 293  ILE D CD1 1 
ATOM   8596 N N   . ALA D 1 294 ? 0.270   -1.123  2.510  1.00 103.71 ? 294  ALA D N   1 
ATOM   8597 C CA  . ALA D 1 294 ? -0.222  -2.013  1.461  1.00 108.49 ? 294  ALA D CA  1 
ATOM   8598 C C   . ALA D 1 294 ? -1.709  -2.291  1.646  1.00 112.92 ? 294  ALA D C   1 
ATOM   8599 O O   . ALA D 1 294 ? -2.220  -2.255  2.763  1.00 113.01 ? 294  ALA D O   1 
ATOM   8600 C CB  . ALA D 1 294 ? 0.559   -3.320  1.456  1.00 111.06 ? 294  ALA D CB  1 
ATOM   8601 N N   . GLN D 1 295 ? -2.400  -2.588  0.553  1.00 138.87 ? 295  GLN D N   1 
ATOM   8602 C CA  . GLN D 1 295 ? -3.830  -2.834  0.618  1.00 143.72 ? 295  GLN D CA  1 
ATOM   8603 C C   . GLN D 1 295 ? -4.304  -3.711  -0.534 1.00 149.77 ? 295  GLN D C   1 
ATOM   8604 O O   . GLN D 1 295 ? -3.836  -3.568  -1.662 1.00 149.50 ? 295  GLN D O   1 
ATOM   8605 C CB  . GLN D 1 295 ? -4.587  -1.508  0.631  1.00 142.47 ? 295  GLN D CB  1 
ATOM   8606 C CG  . GLN D 1 295 ? -6.062  -1.660  0.900  1.00 147.41 ? 295  GLN D CG  1 
ATOM   8607 C CD  . GLN D 1 295 ? -6.615  -0.535  1.743  1.00 146.22 ? 295  GLN D CD  1 
ATOM   8608 O OE1 . GLN D 1 295 ? -6.205  0.620   1.616  1.00 143.67 ? 295  GLN D OE1 1 
ATOM   8609 N NE2 . GLN D 1 295 ? -7.550  -0.870  2.621  1.00 149.10 ? 295  GLN D NE2 1 
HETATM 8610 K K   . K   E 2 .   ? 39.735  48.688  36.990 1.00 139.52 ? 1296 K   A K   1 
HETATM 8611 K K   . K   F 2 .   ? 36.472  43.922  36.997 1.00 120.32 ? 1297 K   A K   1 
HETATM 8612 K K   . K   G 2 .   ? 34.319  40.962  36.959 1.00 114.52 ? 1298 K   A K   1 
HETATM 8613 K K   . K   H 2 .   ? 19.373  18.038  37.555 1.00 98.21  ? 1299 K   C K   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 20  ? 2.5704 3.1331 1.7716 -0.5874 0.0829  0.1199  20  SER A N   
2    C CA  . SER A 20  ? 2.5801 3.1258 1.7873 -0.5237 0.0611  0.0923  20  SER A CA  
3    C C   . SER A 20  ? 2.6002 3.1325 1.7957 -0.4825 0.0461  0.0952  20  SER A C   
4    O O   . SER A 20  ? 2.6055 3.1543 1.7717 -0.4741 0.0467  0.1434  20  SER A O   
6    N N   . SER A 21  ? 2.0007 2.5087 1.2244 -0.4556 0.0338  0.0472  21  SER A N   
7    C CA  . SER A 21  ? 2.0076 2.5169 1.2355 -0.4147 0.0247  0.0469  21  SER A CA  
8    C C   . SER A 21  ? 2.0140 2.5188 1.2505 -0.3565 0.0036  0.0175  21  SER A C   
9    O O   . SER A 21  ? 2.0135 2.5009 1.2805 -0.3515 0.0011  -0.0221 21  SER A O   
11   N N   . ASN A 22  ? 2.2254 2.7441 1.4316 -0.3139 -0.0098 0.0406  22  ASN A N   
12   C CA  . ASN A 22  ? 2.2373 2.7520 1.4445 -0.2583 -0.0305 0.0140  22  ASN A CA  
13   C C   . ASN A 22  ? 2.2309 2.7653 1.4574 -0.2169 -0.0384 0.0110  22  ASN A C   
14   O O   . ASN A 22  ? 2.2174 2.7775 1.4440 -0.2083 -0.0325 0.0478  22  ASN A O   
15   C CB  . ASN A 22  ? 2.2510 2.7730 1.4149 -0.2217 -0.0386 0.0466  22  ASN A CB  
16   N N   . ILE A 23  ? 1.6367 2.1649 0.8848 -0.1912 -0.0500 -0.0308 23  ILE A N   
17   C CA  . ILE A 23  ? 1.6211 2.1813 0.8984 -0.1520 -0.0526 -0.0351 23  ILE A CA  
18   C C   . ILE A 23  ? 1.6309 2.1771 0.9255 -0.1386 -0.0643 -0.0825 23  ILE A C   
19   O O   . ILE A 23  ? 1.6496 2.1575 0.9361 -0.1618 -0.0707 -0.1102 23  ILE A O   
20   C CB  . ILE A 23  ? 1.5960 2.1673 0.9102 -0.1870 -0.0270 -0.0292 23  ILE A CB  
21   C CG1 . ILE A 23  ? 1.5783 2.1919 0.8930 -0.1639 -0.0217 0.0199  23  ILE A CG1 
22   C CG2 . ILE A 23  ? 1.5777 2.1620 0.9366 -0.1760 -0.0192 -0.0590 23  ILE A CG2 
23   C CD1 . ILE A 23  ? 1.5520 2.2041 0.9214 -0.1593 0.0003  0.0216  23  ILE A CD1 
24   N N   . THR A 24  ? 1.9514 2.5339 1.2749 -0.1011 -0.0661 -0.0898 24  THR A N   
25   C CA  . THR A 24  ? 1.9608 2.5324 1.2979 -0.0918 -0.0770 -0.1303 24  THR A CA  
26   C C   . THR A 24  ? 1.9348 2.5139 1.3189 -0.1172 -0.0545 -0.1420 24  THR A C   
27   O O   . THR A 24  ? 1.8996 2.5344 1.3199 -0.0933 -0.0392 -0.1272 24  THR A O   
28   C CB  . THR A 24  ? 1.9655 2.5768 1.2954 -0.0255 -0.0978 -0.1318 24  THR A CB  
29   O OG1 . THR A 24  ? 1.9947 2.5959 1.2759 0.0026  -0.1144 -0.1118 24  THR A OG1 
30   C CG2 . THR A 24  ? 1.9841 2.5787 1.3179 -0.0213 -0.1123 -0.1736 24  THR A CG2 
31   N N   . ARG A 25  ? 1.7040 2.2301 1.0915 -0.1624 -0.0505 -0.1648 25  ARG A N   
32   C CA  . ARG A 25  ? 1.6868 2.2058 1.1112 -0.1920 -0.0250 -0.1680 25  ARG A CA  
33   C C   . ARG A 25  ? 1.6845 2.2215 1.1273 -0.1677 -0.0317 -0.1843 25  ARG A C   
34   O O   . ARG A 25  ? 1.7109 2.2092 1.1372 -0.1682 -0.0559 -0.2095 25  ARG A O   
35   C CB  . ARG A 25  ? 1.6983 2.1481 1.1178 -0.2482 -0.0183 -0.1776 25  ARG A CB  
36   C CG  . ARG A 25  ? 1.6958 2.1325 1.1024 -0.2827 -0.0051 -0.1604 25  ARG A CG  
37   C CD  . ARG A 25  ? 1.7090 2.0829 1.1158 -0.3313 -0.0025 -0.1735 25  ARG A CD  
38   N NE  . ARG A 25  ? 1.7080 2.0721 1.1079 -0.3736 0.0172  -0.1565 25  ARG A NE  
39   C CZ  . ARG A 25  ? 1.7024 2.0452 1.1152 -0.4133 0.0482  -0.1458 25  ARG A CZ  
40   N NH1 . ARG A 25  ? 1.6918 2.0216 1.1267 -0.4153 0.0667  -0.1456 25  ARG A NH1 
41   N NH2 . ARG A 25  ? 1.7067 2.0414 1.1086 -0.4531 0.0637  -0.1324 25  ARG A NH2 
42   N N   . LEU A 26  ? 2.0308 2.6321 1.5128 -0.1476 -0.0080 -0.1678 26  LEU A N   
43   C CA  . LEU A 26  ? 2.0159 2.6496 1.5215 -0.1286 -0.0068 -0.1760 26  LEU A CA  
44   C C   . LEU A 26  ? 1.9984 2.6092 1.5327 -0.1734 0.0293  -0.1641 26  LEU A C   
45   O O   . LEU A 26  ? 1.9555 2.6126 1.5327 -0.1811 0.0721  -0.1386 26  LEU A O   
46   C CB  . LEU A 26  ? 1.9730 2.7072 1.5148 -0.0748 0.0014  -0.1611 26  LEU A CB  
47   C CG  . LEU A 26  ? 1.9802 2.7343 1.4934 -0.0283 -0.0277 -0.1579 26  LEU A CG  
48   C CD1 . LEU A 26  ? 1.9199 2.7759 1.4813 0.0265  -0.0155 -0.1337 26  LEU A CD1 
49   C CD2 . LEU A 26  ? 2.0248 2.7433 1.4883 -0.0065 -0.0698 -0.1869 26  LEU A CD2 
50   N N   . GLY A 27  ? 1.9402 2.4787 1.4527 -0.2011 0.0137  -0.1786 27  GLY A N   
51   C CA  . GLY A 27  ? 1.9270 2.4275 1.4571 -0.2428 0.0452  -0.1600 27  GLY A CA  
52   C C   . GLY A 27  ? 1.9591 2.3637 1.4605 -0.2714 0.0197  -0.1736 27  GLY A C   
53   O O   . GLY A 27  ? 1.9656 2.3435 1.4661 -0.2752 0.0106  -0.1718 27  GLY A O   
54   N N   . TRP A 33  ? 2.1502 2.1124 1.6381 -0.2857 -0.2060 -0.2341 33  TRP A N   
55   C CA  . TRP A 33  ? 2.1934 2.1266 1.7008 -0.2634 -0.2517 -0.2609 33  TRP A CA  
56   C C   . TRP A 33  ? 2.1471 2.0146 1.6884 -0.2723 -0.2608 -0.2412 33  TRP A C   
57   O O   . TRP A 33  ? 2.1716 2.0412 1.7459 -0.2626 -0.2762 -0.2659 33  TRP A O   
58   C CB  . TRP A 33  ? 2.2114 2.1396 1.7048 -0.2449 -0.2810 -0.2636 33  TRP A CB  
59   N N   . LEU A 34  ? 2.4123 2.2248 1.9483 -0.2889 -0.2488 -0.1927 34  LEU A N   
60   C CA  . LEU A 34  ? 2.3679 2.1116 1.9323 -0.2951 -0.2549 -0.1652 34  LEU A CA  
61   C C   . LEU A 34  ? 2.3248 2.0504 1.8756 -0.3307 -0.2058 -0.1319 34  LEU A C   
62   O O   . LEU A 34  ? 2.2903 1.9566 1.8573 -0.3403 -0.2022 -0.1045 34  LEU A O   
63   C CB  . LEU A 34  ? 2.3471 2.0244 1.9130 -0.2836 -0.2821 -0.1261 34  LEU A CB  
64   C CG  . LEU A 34  ? 2.3894 2.0729 1.9733 -0.2487 -0.3347 -0.1571 34  LEU A CG  
65   C CD1 . LEU A 34  ? 2.3722 1.9891 1.9503 -0.2410 -0.3601 -0.1085 34  LEU A CD1 
66   C CD2 . LEU A 34  ? 2.3999 2.0928 2.0398 -0.2254 -0.3617 -0.1960 34  LEU A CD2 
67   N N   . ASP A 35  ? 3.4153 3.1939 2.9390 -0.3477 -0.1681 -0.1344 35  ASP A N   
68   C CA  . ASP A 35  ? 3.3783 3.1477 2.8878 -0.3828 -0.1155 -0.1033 35  ASP A CA  
69   C C   . ASP A 35  ? 3.3687 3.1121 2.8949 -0.3998 -0.1082 -0.1092 35  ASP A C   
70   O O   . ASP A 35  ? 3.3334 3.0152 2.8558 -0.4227 -0.0844 -0.0715 35  ASP A O   
71   C CB  . ASP A 35  ? 3.3864 3.2368 2.8791 -0.3880 -0.0839 -0.1170 35  ASP A CB  
72   C CG  . ASP A 35  ? 3.3382 3.1857 2.8190 -0.4191 -0.0252 -0.0730 35  ASP A CG  
73   O OD1 . ASP A 35  ? 3.3109 3.0877 2.7875 -0.4382 -0.0071 -0.0279 35  ASP A OD1 
74   O OD2 . ASP A 35  ? 3.3311 3.2478 2.8096 -0.4223 0.0047  -0.0803 35  ASP A OD2 
75   N N   . ASP A 36  ? 2.2409 2.0327 1.7844 -0.3897 -0.1256 -0.1533 36  ASP A N   
76   C CA  . ASP A 36  ? 2.2362 2.0252 1.7965 -0.4096 -0.1140 -0.1608 36  ASP A CA  
77   C C   . ASP A 36  ? 2.2408 2.0180 1.8496 -0.3866 -0.1536 -0.1797 36  ASP A C   
78   O O   . ASP A 36  ? 2.2772 2.1052 1.9101 -0.3842 -0.1590 -0.2102 36  ASP A O   
79   C CB  . ASP A 36  ? 2.2824 2.1464 1.8292 -0.4201 -0.0950 -0.1870 36  ASP A CB  
80   C CG  . ASP A 36  ? 2.2713 2.1318 1.8184 -0.4561 -0.0657 -0.1805 36  ASP A CG  
81   O OD1 . ASP A 36  ? 2.2356 2.0422 1.8010 -0.4682 -0.0662 -0.1655 36  ASP A OD1 
82   O OD2 . ASP A 36  ? 2.3004 2.2119 1.8290 -0.4710 -0.0435 -0.1885 36  ASP A OD2 
83   N N   . HIS A 37  ? 2.3403 2.0545 1.9679 -0.3687 -0.1789 -0.1566 37  HIS A N   
84   C CA  . HIS A 37  ? 2.3367 2.0479 2.0230 -0.3359 -0.2212 -0.1741 37  HIS A CA  
85   C C   . HIS A 37  ? 2.3249 2.0613 2.0565 -0.3445 -0.2148 -0.1884 37  HIS A C   
86   O O   . HIS A 37  ? 2.3539 2.1505 2.1313 -0.3258 -0.2313 -0.2233 37  HIS A O   
87   C CB  . HIS A 37  ? 2.2696 1.9000 1.9685 -0.3143 -0.2493 -0.1353 37  HIS A CB  
88   C CG  . HIS A 37  ? 2.1721 1.7296 1.8775 -0.3283 -0.2353 -0.0909 37  HIS A CG  
89   N ND1 . HIS A 37  ? 2.1807 1.7057 1.8382 -0.3691 -0.1873 -0.0596 37  HIS A ND1 
90   C CD2 . HIS A 37  ? 2.0061 1.5153 1.7612 -0.3043 -0.2624 -0.0706 37  HIS A CD2 
91   C CE1 . HIS A 37  ? 2.0590 1.5128 1.7290 -0.3723 -0.1841 -0.0223 37  HIS A CE1 
92   N NE2 . HIS A 37  ? 1.9395 1.3828 1.6695 -0.3313 -0.2311 -0.0270 37  HIS A NE2 
93   N N   . TYR A 38  ? 1.8219 1.5167 1.5411 -0.3748 -0.1867 -0.1600 38  TYR A N   
94   C CA  . TYR A 38  ? 1.7989 1.5143 1.5634 -0.3843 -0.1813 -0.1687 38  TYR A CA  
95   C C   . TYR A 38  ? 1.8549 1.6608 1.6189 -0.4049 -0.1608 -0.2032 38  TYR A C   
96   O O   . TYR A 38  ? 1.8683 1.7330 1.6901 -0.3936 -0.1706 -0.2260 38  TYR A O   
97   C CB  . TYR A 38  ? 1.7290 1.3722 1.4699 -0.4151 -0.1533 -0.1295 38  TYR A CB  
98   C CG  . TYR A 38  ? 1.6683 1.3352 1.4549 -0.4269 -0.1473 -0.1380 38  TYR A CG  
99   C CD1 . TYR A 38  ? 1.5405 1.2278 1.4102 -0.3889 -0.1817 -0.1471 38  TYR A CD1 
100  C CD2 . TYR A 38  ? 1.7035 1.3793 1.4560 -0.4755 -0.1062 -0.1365 38  TYR A CD2 
101  C CE1 . TYR A 38  ? 1.4908 1.2137 1.4117 -0.3986 -0.1737 -0.1538 38  TYR A CE1 
102  C CE2 . TYR A 38  ? 1.6480 1.3514 1.4415 -0.4896 -0.0998 -0.1437 38  TYR A CE2 
103  C CZ  . TYR A 38  ? 1.5449 1.2753 1.4241 -0.4509 -0.1327 -0.1521 38  TYR A CZ  
104  O OH  . TYR A 38  ? 1.4791 1.2502 1.4076 -0.4643 -0.1236 -0.1581 38  TYR A OH  
105  N N   . HIS A 39  ? 1.5023 1.3226 1.2051 -0.4340 -0.1301 -0.2016 39  HIS A N   
106  C CA  . HIS A 39  ? 1.5703 1.4706 1.2619 -0.4510 -0.1122 -0.2251 39  HIS A CA  
107  C C   . HIS A 39  ? 1.6338 1.5957 1.3584 -0.4156 -0.1386 -0.2560 39  HIS A C   
108  O O   . HIS A 39  ? 1.6750 1.6985 1.4391 -0.4164 -0.1361 -0.2720 39  HIS A O   
109  C CB  . HIS A 39  ? 1.5926 1.4969 1.2192 -0.4719 -0.0838 -0.2156 39  HIS A CB  
110  C CG  . HIS A 39  ? 1.6765 1.6587 1.2861 -0.4739 -0.0755 -0.2345 39  HIS A CG  
111  N ND1 . HIS A 39  ? 1.7410 1.7638 1.3513 -0.4393 -0.0975 -0.2552 39  HIS A ND1 
112  C CD2 . HIS A 39  ? 1.7159 1.7375 1.3035 -0.5052 -0.0481 -0.2307 39  HIS A CD2 
113  C CE1 . HIS A 39  ? 1.8204 1.9019 1.4090 -0.4472 -0.0829 -0.2600 39  HIS A CE1 
114  N NE2 . HIS A 39  ? 1.8056 1.8894 1.3811 -0.4868 -0.0542 -0.2441 39  HIS A NE2 
115  N N   . ASP A 40  ? 1.3702 1.3170 1.0789 -0.3863 -0.1605 -0.2620 40  ASP A N   
116  C CA  . ASP A 40  ? 1.4025 1.3982 1.1319 -0.3528 -0.1836 -0.2920 40  ASP A CA  
117  C C   . ASP A 40  ? 1.3973 1.4204 1.2078 -0.3309 -0.2022 -0.3076 40  ASP A C   
118  O O   . ASP A 40  ? 1.4757 1.5663 1.3129 -0.3210 -0.1989 -0.3294 40  ASP A O   
119  C CB  . ASP A 40  ? 1.4019 1.3639 1.1053 -0.3261 -0.2079 -0.2935 40  ASP A CB  
120  C CG  . ASP A 40  ? 1.4200 1.3817 1.0571 -0.3413 -0.1862 -0.2811 40  ASP A CG  
121  O OD1 . ASP A 40  ? 1.4300 1.4212 1.0420 -0.3677 -0.1552 -0.2750 40  ASP A OD1 
122  O OD2 . ASP A 40  ? 1.4471 1.3848 1.0620 -0.3261 -0.1994 -0.2755 40  ASP A OD2 
123  N N   . LEU A 41  ? 1.2692 1.2431 1.1232 -0.3211 -0.2191 -0.2921 41  LEU A N   
124  C CA  . LEU A 41  ? 1.1880 1.1944 1.1352 -0.2935 -0.2377 -0.3042 41  LEU A CA  
125  C C   . LEU A 41  ? 1.1359 1.2170 1.1234 -0.3172 -0.2083 -0.3100 41  LEU A C   
126  O O   . LEU A 41  ? 1.0497 1.2025 1.1108 -0.2975 -0.2099 -0.3285 41  LEU A O   
127  C CB  . LEU A 41  ? 1.1560 1.0886 1.1407 -0.2731 -0.2643 -0.2784 41  LEU A CB  
128  C CG  . LEU A 41  ? 1.1569 1.0347 1.1328 -0.2381 -0.3021 -0.2733 41  LEU A CG  
129  C CD1 . LEU A 41  ? 1.1528 0.9409 1.1421 -0.2251 -0.3226 -0.2309 41  LEU A CD1 
130  C CD2 . LEU A 41  ? 1.1197 1.0542 1.1637 -0.1972 -0.3280 -0.3076 41  LEU A CD2 
131  N N   . LEU A 42  ? 1.3280 1.3971 1.2697 -0.3612 -0.1782 -0.2923 42  LEU A N   
132  C CA  . LEU A 42  ? 1.3087 1.4492 1.2780 -0.3913 -0.1483 -0.2935 42  LEU A CA  
133  C C   . LEU A 42  ? 1.4297 1.6396 1.3615 -0.4067 -0.1255 -0.3040 42  LEU A C   
134  O O   . LEU A 42  ? 1.4075 1.6945 1.3705 -0.4254 -0.1015 -0.3039 42  LEU A O   
135  C CB  . LEU A 42  ? 1.3333 1.4294 1.2644 -0.4353 -0.1251 -0.2697 42  LEU A CB  
136  C CG  . LEU A 42  ? 1.1742 1.1973 1.1360 -0.4262 -0.1396 -0.2498 42  LEU A CG  
137  C CD1 . LEU A 42  ? 1.1553 1.1502 1.0799 -0.4760 -0.1078 -0.2306 42  LEU A CD1 
138  C CD2 . LEU A 42  ? 1.0101 1.0797 1.0830 -0.3871 -0.1621 -0.2593 42  LEU A CD2 
139  N N   . THR A 43  ? 1.1846 1.3693 1.0504 -0.3977 -0.1319 -0.3081 43  THR A N   
140  C CA  . THR A 43  ? 1.2827 1.5179 1.0988 -0.4095 -0.1115 -0.3094 43  THR A CA  
141  C C   . THR A 43  ? 1.2964 1.5831 1.1415 -0.3748 -0.1207 -0.3299 43  THR A C   
142  O O   . THR A 43  ? 1.3714 1.7169 1.2001 -0.3826 -0.0990 -0.3260 43  THR A O   
143  C CB  . THR A 43  ? 1.2984 1.4867 1.0305 -0.4156 -0.1101 -0.3003 43  THR A CB  
144  O OG1 . THR A 43  ? 1.3036 1.4524 1.0081 -0.4529 -0.0910 -0.2792 43  THR A OG1 
145  C CG2 . THR A 43  ? 1.4063 1.6441 1.0906 -0.4163 -0.0954 -0.2983 43  THR A CG2 
146  N N   . VAL A 44  ? 1.2917 1.3677 1.2777 -0.1766 0.1223  -0.4242 44  VAL A N   
147  C CA  . VAL A 44  ? 1.4353 1.4361 1.3442 -0.1746 0.0925  -0.4139 44  VAL A CA  
148  C C   . VAL A 44  ? 1.5603 1.5297 1.4151 -0.1511 0.0743  -0.4275 44  VAL A C   
149  O O   . VAL A 44  ? 1.5414 1.5475 1.4067 -0.1447 0.0807  -0.4332 44  VAL A O   
150  C CB  . VAL A 44  ? 1.4688 1.4374 1.3514 -0.2096 0.0788  -0.3761 44  VAL A CB  
151  C CG1 . VAL A 44  ? 1.6425 1.5350 1.4499 -0.2088 0.0480  -0.3675 44  VAL A CG1 
152  C CG2 . VAL A 44  ? 1.3825 1.3685 1.3002 -0.2274 0.0900  -0.3621 44  VAL A CG2 
153  N N   . SER A 45  ? 1.5659 1.4738 1.3666 -0.1375 0.0521  -0.4331 45  SER A N   
154  C CA  . SER A 45  ? 1.7053 1.5762 1.4542 -0.1144 0.0332  -0.4409 45  SER A CA  
155  C C   . SER A 45  ? 1.7983 1.6367 1.5122 -0.1343 0.0168  -0.4056 45  SER A C   
156  O O   . SER A 45  ? 1.8068 1.6198 1.5149 -0.1650 0.0104  -0.3788 45  SER A O   
157  C CB  . SER A 45  ? 1.8273 1.6397 1.5346 -0.0960 0.0137  -0.4575 45  SER A CB  
158  O OG  . SER A 45  ? 1.8850 1.6368 1.5585 -0.1184 -0.0072 -0.4347 45  SER A OG  
159  N N   . TRP A 46  ? 1.4229 1.2665 1.1146 -0.1166 0.0106  -0.4043 46  TRP A N   
160  C CA  . TRP A 46  ? 1.5103 1.3306 1.1730 -0.1342 -0.0035 -0.3665 46  TRP A CA  
161  C C   . TRP A 46  ? 1.6470 1.3823 1.2718 -0.1547 -0.0260 -0.3420 46  TRP A C   
162  O O   . TRP A 46  ? 1.6426 1.3689 1.2679 -0.1871 -0.0285 -0.3120 46  TRP A O   
163  C CB  . TRP A 46  ? 1.5988 1.4330 1.2375 -0.1067 -0.0100 -0.3654 46  TRP A CB  
164  C CG  . TRP A 46  ? 1.4668 1.3999 1.1459 -0.1006 0.0115  -0.3774 46  TRP A CG  
165  C CD1 . TRP A 46  ? 1.4077 1.4013 1.1093 -0.0695 0.0265  -0.4155 46  TRP A CD1 
166  C CD2 . TRP A 46  ? 1.3806 1.3698 1.0868 -0.1271 0.0209  -0.3559 46  TRP A CD2 
167  N NE1 . TRP A 46  ? 1.2918 1.3786 1.0365 -0.0750 0.0452  -0.4214 46  TRP A NE1 
168  C CE2 . TRP A 46  ? 1.2715 1.3579 1.0196 -0.1100 0.0416  -0.3851 46  TRP A CE2 
169  C CE3 . TRP A 46  ? 1.3872 1.3575 1.0879 -0.1639 0.0140  -0.3177 46  TRP A CE3 
170  C CZ2 . TRP A 46  ? 1.1929 1.3606 0.9797 -0.1285 0.0547  -0.3785 46  TRP A CZ2 
171  C CZ3 . TRP A 46  ? 1.2836 1.3308 1.0181 -0.1820 0.0265  -0.3084 46  TRP A CZ3 
172  C CH2 . TRP A 46  ? 1.2002 1.3462 0.9783 -0.1643 0.0463  -0.3393 46  TRP A CH2 
173  N N   . PRO A 47  ? 1.6327 1.3090 1.2281 -0.1364 -0.0419 -0.3581 47  PRO A N   
174  C CA  . PRO A 47  ? 1.6911 1.2937 1.2613 -0.1564 -0.0613 -0.3441 47  PRO A CA  
175  C C   . PRO A 47  ? 1.6077 1.2280 1.2015 -0.1932 -0.0523 -0.3312 47  PRO A C   
176  O O   . PRO A 47  ? 1.6347 1.2309 1.2190 -0.2222 -0.0592 -0.3009 47  PRO A O   
177  C CB  . PRO A 47  ? 1.6768 1.2504 1.2360 -0.1321 -0.0697 -0.3800 47  PRO A CB  
178  C CG  . PRO A 47  ? 1.7047 1.3058 1.2609 -0.0940 -0.0646 -0.4015 47  PRO A CG  
179  C CD  . PRO A 47  ? 1.6419 1.3206 1.2296 -0.0973 -0.0425 -0.3937 47  PRO A CD  
180  N N   . VAL A 48  ? 1.4705 1.1356 1.0970 -0.1915 -0.0362 -0.3524 48  VAL A N   
181  C CA  . VAL A 48  ? 1.3894 1.0800 1.0428 -0.2227 -0.0258 -0.3395 48  VAL A CA  
182  C C   . VAL A 48  ? 1.3561 1.0805 1.0283 -0.2494 -0.0152 -0.3098 48  VAL A C   
183  O O   . VAL A 48  ? 1.3761 1.0832 1.0415 -0.2808 -0.0203 -0.2860 48  VAL A O   
184  C CB  . VAL A 48  ? 1.2727 1.0184 0.9684 -0.2123 -0.0060 -0.3618 48  VAL A CB  
185  C CG1 . VAL A 48  ? 1.2042 0.9839 0.9320 -0.2434 0.0065  -0.3421 48  VAL A CG1 
186  C CG2 . VAL A 48  ? 1.2985 1.0172 0.9753 -0.1894 -0.0175 -0.3909 48  VAL A CG2 
187  N N   . PHE A 49  ? 1.5697 1.3475 1.2674 -0.2371 -0.0003 -0.3144 49  PHE A N   
188  C CA  . PHE A 49  ? 1.4904 1.3109 1.2099 -0.2603 0.0096  -0.2913 49  PHE A CA  
189  C C   . PHE A 49  ? 1.6257 1.3962 1.3031 -0.2824 -0.0101 -0.2572 49  PHE A C   
190  O O   . PHE A 49  ? 1.5905 1.3667 1.2745 -0.3151 -0.0085 -0.2336 49  PHE A O   
191  C CB  . PHE A 49  ? 1.4155 1.3008 1.1629 -0.2389 0.0243  -0.3076 49  PHE A CB  
192  C CG  . PHE A 49  ? 1.3509 1.2868 1.1185 -0.2604 0.0316  -0.2873 49  PHE A CG  
193  C CD1 . PHE A 49  ? 1.2021 1.1901 1.0219 -0.2840 0.0504  -0.2844 49  PHE A CD1 
194  C CD2 . PHE A 49  ? 1.4411 1.3786 1.1790 -0.2560 0.0201  -0.2705 49  PHE A CD2 
195  C CE1 . PHE A 49  ? 1.1430 1.1821 0.9835 -0.3039 0.0563  -0.2695 49  PHE A CE1 
196  C CE2 . PHE A 49  ? 1.3800 1.3736 1.1370 -0.2758 0.0261  -0.2529 49  PHE A CE2 
197  C CZ  . PHE A 49  ? 1.2294 1.2737 1.0374 -0.3003 0.0438  -0.2549 49  PHE A CZ  
198  N N   . ILE A 50  ? 1.5909 1.3126 1.2280 -0.2642 -0.0280 -0.2537 50  ILE A N   
199  C CA  . ILE A 50  ? 1.7452 1.4140 1.3471 -0.2822 -0.0463 -0.2190 50  ILE A CA  
200  C C   . ILE A 50  ? 1.7652 1.3788 1.3546 -0.3108 -0.0564 -0.2101 50  ILE A C   
201  O O   . ILE A 50  ? 1.7885 1.3885 1.3709 -0.3419 -0.0608 -0.1811 50  ILE A O   
202  C CB  . ILE A 50  ? 1.8779 1.4995 1.4457 -0.2534 -0.0630 -0.2167 50  ILE A CB  
203  C CG1 . ILE A 50  ? 1.8563 1.5416 1.4358 -0.2211 -0.0522 -0.2317 50  ILE A CG1 
204  C CG2 . ILE A 50  ? 1.9999 1.5752 1.5421 -0.2720 -0.0785 -0.1747 50  ILE A CG2 
205  C CD1 . ILE A 50  ? 1.9766 1.6239 1.5245 -0.1877 -0.0668 -0.2314 50  ILE A CD1 
206  N N   . THR A 51  ? 1.6483 1.2369 1.2362 -0.3002 -0.0598 -0.2370 51  THR A N   
207  C CA  . THR A 51  ? 1.6109 1.1638 1.1925 -0.3249 -0.0675 -0.2368 51  THR A CA  
208  C C   . THR A 51  ? 1.5514 1.1504 1.1571 -0.3582 -0.0535 -0.2201 51  THR A C   
209  O O   . THR A 51  ? 1.5735 1.1464 1.1672 -0.3888 -0.0606 -0.1990 51  THR A O   
210  C CB  . THR A 51  ? 1.5542 1.1055 1.1409 -0.3068 -0.0683 -0.2721 51  THR A CB  
211  O OG1 . THR A 51  ? 1.6119 1.1177 1.1758 -0.2759 -0.0827 -0.2904 51  THR A OG1 
212  C CG2 . THR A 51  ? 1.5239 1.0547 1.1074 -0.3327 -0.0753 -0.2747 51  THR A CG2 
213  N N   . LEU A 52  ? 1.8205 1.4879 1.4639 -0.3517 -0.0329 -0.2305 52  LEU A N   
214  C CA  . LEU A 52  ? 1.6871 1.4064 1.3629 -0.3792 -0.0169 -0.2154 52  LEU A CA  
215  C C   . LEU A 52  ? 1.7052 1.4234 1.3715 -0.4065 -0.0200 -0.1846 52  LEU A C   
216  O O   . LEU A 52  ? 1.7022 1.4159 1.3653 -0.4383 -0.0214 -0.1666 52  LEU A O   
217  C CB  . LEU A 52  ? 1.5087 1.3011 1.2355 -0.3632 0.0071  -0.2292 52  LEU A CB  
218  C CG  . LEU A 52  ? 1.4396 1.2540 1.1917 -0.3458 0.0172  -0.2520 52  LEU A CG  
219  C CD1 . LEU A 52  ? 1.2678 1.1549 1.0819 -0.3346 0.0440  -0.2614 52  LEU A CD1 
220  C CD2 . LEU A 52  ? 1.4358 1.2475 1.1863 -0.3696 0.0150  -0.2412 52  LEU A CD2 
221  N N   . ILE A 53  ? 1.3210 1.0516 0.9842 -0.3936 -0.0205 -0.1790 53  ILE A N   
222  C CA  . ILE A 53  ? 1.3515 1.0878 1.0044 -0.4163 -0.0248 -0.1487 53  ILE A CA  
223  C C   . ILE A 53  ? 1.5316 1.1931 1.1442 -0.4382 -0.0446 -0.1268 53  ILE A C   
224  O O   . ILE A 53  ? 1.5246 1.1866 1.1354 -0.4719 -0.0449 -0.1061 53  ILE A O   
225  C CB  . ILE A 53  ? 1.3693 1.1324 1.0202 -0.3931 -0.0251 -0.1473 53  ILE A CB  
226  C CG1 . ILE A 53  ? 1.2519 1.1042 0.9545 -0.3817 -0.0022 -0.1685 53  ILE A CG1 
227  C CG2 . ILE A 53  ? 1.4604 1.2142 1.0883 -0.4138 -0.0360 -0.1105 53  ILE A CG2 
228  C CD1 . ILE A 53  ? 1.2480 1.1487 0.9551 -0.3625 0.0001  -0.1701 53  ILE A CD1 
229  N N   . THR A 54  ? 1.6872 1.2851 1.2717 -0.4190 -0.0603 -0.1334 54  THR A N   
230  C CA  . THR A 54  ? 1.7396 1.2616 1.2959 -0.4374 -0.0779 -0.1189 54  THR A CA  
231  C C   . THR A 54  ? 1.6787 1.1985 1.2410 -0.4683 -0.0753 -0.1235 54  THR A C   
232  O O   . THR A 54  ? 1.7082 1.2147 1.2630 -0.5008 -0.0785 -0.1004 54  THR A O   
233  C CB  . THR A 54  ? 1.7744 1.2328 1.3127 -0.4095 -0.0925 -0.1377 54  THR A CB  
234  O OG1 . THR A 54  ? 1.8240 1.2965 1.3586 -0.3757 -0.0925 -0.1382 54  THR A OG1 
235  C CG2 . THR A 54  ? 1.8498 1.2292 1.3689 -0.4274 -0.1097 -0.1198 54  THR A CG2 
236  N N   . GLY A 55  ? 2.0428 1.5809 1.6190 -0.4575 -0.0693 -0.1526 55  GLY A N   
237  C CA  . GLY A 55  ? 1.9894 1.5429 1.5744 -0.4830 -0.0650 -0.1577 55  GLY A CA  
238  C C   . GLY A 55  ? 1.9795 1.5743 1.5761 -0.5151 -0.0544 -0.1311 55  GLY A C   
239  O O   . GLY A 55  ? 2.0103 1.5817 1.5936 -0.5460 -0.0605 -0.1173 55  GLY A O   
240  N N   . LEU A 56  ? 1.8846 1.5425 1.5095 -0.5081 -0.0382 -0.1267 56  LEU A N   
241  C CA  . LEU A 56  ? 1.8044 1.5090 1.4466 -0.5362 -0.0275 -0.1042 56  LEU A CA  
242  C C   . LEU A 56  ? 1.9190 1.5849 1.5313 -0.5619 -0.0407 -0.0767 56  LEU A C   
243  O O   . LEU A 56  ? 1.9130 1.5824 1.5211 -0.5950 -0.0404 -0.0613 56  LEU A O   
244  C CB  . LEU A 56  ? 1.6497 1.4211 1.3301 -0.5199 -0.0106 -0.1078 56  LEU A CB  
245  C CG  . LEU A 56  ? 1.5231 1.3526 1.2313 -0.5459 0.0017  -0.0897 56  LEU A CG  
246  C CD1 . LEU A 56  ? 1.4995 1.3332 1.2088 -0.5769 0.0044  -0.0787 56  LEU A CD1 
247  C CD2 . LEU A 56  ? 1.3448 1.2483 1.1095 -0.5281 0.0231  -0.1050 56  LEU A CD2 
248  N N   . TYR A 57  ? 1.5372 1.1690 1.1301 -0.5455 -0.0516 -0.0693 57  TYR A N   
249  C CA  . TYR A 57  ? 1.6669 1.2615 1.2345 -0.5646 -0.0642 -0.0385 57  TYR A CA  
250  C C   . TYR A 57  ? 1.7144 1.2465 1.2618 -0.5918 -0.0753 -0.0334 57  TYR A C   
251  O O   . TYR A 57  ? 1.7357 1.2730 1.2786 -0.6259 -0.0749 -0.0138 57  TYR A O   
252  C CB  . TYR A 57  ? 1.7624 1.3278 1.3156 -0.5342 -0.0740 -0.0336 57  TYR A CB  
253  C CG  . TYR A 57  ? 1.8759 1.4018 1.4067 -0.5474 -0.0870 0.0034  57  TYR A CG  
254  C CD1 . TYR A 57  ? 1.9166 1.4807 1.4485 -0.5750 -0.0843 0.0332  57  TYR A CD1 
255  C CD2 . TYR A 57  ? 1.9478 1.4012 1.4605 -0.5310 -0.1015 0.0099  57  TYR A CD2 
256  C CE1 . TYR A 57  ? 2.0268 1.5592 1.5405 -0.5867 -0.0956 0.0713  57  TYR A CE1 
257  C CE2 . TYR A 57  ? 2.0571 1.4748 1.5561 -0.5417 -0.1119 0.0492  57  TYR A CE2 
258  C CZ  . TYR A 57  ? 2.0971 1.5556 1.5958 -0.5697 -0.1088 0.0811  57  TYR A CZ  
259  O OH  . TYR A 57  ? 2.2115 1.6384 1.6987 -0.5805 -0.1186 0.1244  57  TYR A OH  
260  N N   . LEU A 58  ? 1.7606 1.2373 1.2987 -0.5767 -0.0848 -0.0545 58  LEU A N   
261  C CA  . LEU A 58  ? 1.7851 1.2067 1.3125 -0.6002 -0.0943 -0.0594 58  LEU A CA  
262  C C   . LEU A 58  ? 1.7288 1.1946 1.2654 -0.6298 -0.0842 -0.0644 58  LEU A C   
263  O O   . LEU A 58  ? 1.7679 1.2229 1.2967 -0.6635 -0.0859 -0.0472 58  LEU A O   
264  C CB  . LEU A 58  ? 1.7768 1.1530 1.3030 -0.5762 -0.1034 -0.0924 58  LEU A CB  
265  C CG  . LEU A 58  ? 1.8322 1.1682 1.3507 -0.5425 -0.1128 -0.0892 58  LEU A CG  
266  C CD1 . LEU A 58  ? 1.8446 1.1224 1.3628 -0.5260 -0.1250 -0.1203 58  LEU A CD1 
267  C CD2 . LEU A 58  ? 1.9318 1.2352 1.4395 -0.5541 -0.1196 -0.0477 58  LEU A CD2 
268  N N   . VAL A 59  ? 1.8280 1.3466 1.3830 -0.6163 -0.0728 -0.0862 59  VAL A N   
269  C CA  . VAL A 59  ? 1.7744 1.3472 1.3432 -0.6394 -0.0610 -0.0878 59  VAL A CA  
270  C C   . VAL A 59  ? 1.8024 1.3968 1.3688 -0.6727 -0.0565 -0.0580 59  VAL A C   
271  O O   . VAL A 59  ? 1.8363 1.4157 1.3912 -0.7036 -0.0600 -0.0531 59  VAL A O   
272  C CB  . VAL A 59  ? 1.6706 1.3130 1.2699 -0.6175 -0.0446 -0.1000 59  VAL A CB  
273  C CG1 . VAL A 59  ? 1.5623 1.2673 1.1811 -0.6412 -0.0305 -0.0919 59  VAL A CG1 
274  C CG2 . VAL A 59  ? 1.6542 1.2837 1.2552 -0.5890 -0.0488 -0.1312 59  VAL A CG2 
275  N N   . THR A 60  ? 1.7084 1.3421 1.2876 -0.6670 -0.0488 -0.0411 60  THR A N   
276  C CA  . THR A 60  ? 1.6778 1.3449 1.2592 -0.6980 -0.0439 -0.0157 60  THR A CA  
277  C C   . THR A 60  ? 1.8281 1.4402 1.3791 -0.7272 -0.0576 0.0049  60  THR A C   
278  O O   . THR A 60  ? 1.8223 1.4498 1.3689 -0.7605 -0.0552 0.0170  60  THR A O   
279  C CB  . THR A 60  ? 1.5733 1.2936 1.1765 -0.6863 -0.0353 -0.0050 60  THR A CB  
280  O OG1 . THR A 60  ? 1.6967 1.3822 1.2797 -0.6766 -0.0474 0.0093  60  THR A OG1 
281  C CG2 . THR A 60  ? 1.4287 1.1942 1.0674 -0.6542 -0.0214 -0.0275 60  THR A CG2 
282  N N   . ASN A 61  ? 1.6500 1.1991 1.1831 -0.7144 -0.0710 0.0103  61  ASN A N   
283  C CA  . ASN A 61  ? 1.7440 1.2339 1.2559 -0.7403 -0.0830 0.0314  61  ASN A CA  
284  C C   . ASN A 61  ? 1.7448 1.2041 1.2518 -0.7653 -0.0851 0.0142  61  ASN A C   
285  O O   . ASN A 61  ? 1.7954 1.2423 1.2931 -0.7998 -0.0870 0.0294  61  ASN A O   
286  C CB  . ASN A 61  ? 1.8152 1.2418 1.3174 -0.7174 -0.0957 0.0403  61  ASN A CB  
287  C CG  . ASN A 61  ? 1.8705 1.3242 1.3703 -0.7076 -0.0966 0.0717  61  ASN A CG  
288  O OD1 . ASN A 61  ? 1.9260 1.3967 1.4197 -0.7336 -0.0974 0.1019  61  ASN A OD1 
289  N ND2 . ASN A 61  ? 1.8627 1.3268 1.3678 -0.6699 -0.0966 0.0636  61  ASN A ND2 
290  N N   . ALA A 62  ? 1.8803 1.3325 1.3951 -0.7477 -0.0848 -0.0195 62  ALA A N   
291  C CA  . ALA A 62  ? 1.8783 1.3224 1.3938 -0.7686 -0.0851 -0.0431 62  ALA A CA  
292  C C   . ALA A 62  ? 1.8498 1.3591 1.3678 -0.7974 -0.0731 -0.0348 62  ALA A C   
293  O O   . ALA A 62  ? 1.8975 1.3953 1.4072 -0.8308 -0.0744 -0.0318 62  ALA A O   
294  C CB  . ALA A 62  ? 1.8230 1.2756 1.3497 -0.7420 -0.0848 -0.0806 62  ALA A CB  
295  N N   . LEU A 63  ? 1.7750 1.3535 1.3086 -0.7842 -0.0606 -0.0315 63  LEU A N   
296  C CA  . LEU A 63  ? 1.6993 1.3438 1.2415 -0.8082 -0.0481 -0.0204 63  LEU A CA  
297  C C   . LEU A 63  ? 1.7653 1.3952 1.2908 -0.8422 -0.0522 0.0067  63  LEU A C   
298  O O   . LEU A 63  ? 1.7891 1.4299 1.3067 -0.8738 -0.0502 0.0076  63  LEU A O   
299  C CB  . LEU A 63  ? 1.5319 1.2442 1.1028 -0.7873 -0.0339 -0.0149 63  LEU A CB  
300  C CG  . LEU A 63  ? 1.4382 1.1872 1.0327 -0.7594 -0.0247 -0.0371 63  LEU A CG  
301  C CD1 . LEU A 63  ? 1.3260 1.1322 0.9566 -0.7385 -0.0100 -0.0301 63  LEU A CD1 
302  C CD2 . LEU A 63  ? 1.4151 1.2042 1.0136 -0.7770 -0.0181 -0.0460 63  LEU A CD2 
303  N N   . PHE A 64  ? 1.8929 1.5042 1.4133 -0.8355 -0.0578 0.0286  64  PHE A N   
304  C CA  . PHE A 64  ? 1.9673 1.5696 1.4724 -0.8662 -0.0627 0.0578  64  PHE A CA  
305  C C   . PHE A 64  ? 2.1005 1.6367 1.5863 -0.8929 -0.0723 0.0582  64  PHE A C   
306  O O   . PHE A 64  ? 2.1392 1.6854 1.6156 -0.9280 -0.0709 0.0684  64  PHE A O   
307  C CB  . PHE A 64  ? 1.9987 1.5998 1.5032 -0.8506 -0.0678 0.0814  64  PHE A CB  
308  C CG  . PHE A 64  ? 1.8296 1.5115 1.3528 -0.8521 -0.0577 0.0918  64  PHE A CG  
309  C CD1 . PHE A 64  ? 1.6649 1.3962 1.2172 -0.8216 -0.0473 0.0764  64  PHE A CD1 
310  C CD2 . PHE A 64  ? 1.8072 1.5181 1.3238 -0.8850 -0.0580 0.1145  64  PHE A CD2 
311  C CE1 . PHE A 64  ? 1.4863 1.2942 1.0664 -0.8237 -0.0367 0.0812  64  PHE A CE1 
312  C CE2 . PHE A 64  ? 1.6237 1.4134 1.1639 -0.8871 -0.0490 0.1196  64  PHE A CE2 
313  C CZ  . PHE A 64  ? 1.4650 1.3033 1.0399 -0.8565 -0.0379 0.1018  64  PHE A CZ  
314  N N   . ALA A 65  ? 1.9554 1.4252 1.4395 -0.8765 -0.0815 0.0451  65  ALA A N   
315  C CA  . ALA A 65  ? 2.0275 1.4329 1.5055 -0.9001 -0.0889 0.0383  65  ALA A CA  
316  C C   . ALA A 65  ? 2.0144 1.4549 1.4922 -0.9297 -0.0812 0.0175  65  ALA A C   
317  O O   . ALA A 65  ? 2.0783 1.5056 1.5475 -0.9649 -0.0817 0.0278  65  ALA A O   
318  C CB  . ALA A 65  ? 2.0337 1.3778 1.5210 -0.8743 -0.0970 0.0138  65  ALA A CB  
319  N N   . LEU A 66  ? 2.2164 1.7068 1.7047 -0.9148 -0.0733 -0.0106 66  LEU A N   
320  C CA  . LEU A 66  ? 2.2053 1.7463 1.6951 -0.9383 -0.0645 -0.0291 66  LEU A CA  
321  C C   . LEU A 66  ? 2.2237 1.8070 1.7036 -0.9691 -0.0580 -0.0027 66  LEU A C   
322  O O   . LEU A 66  ? 2.2749 1.8619 1.7464 -1.0021 -0.0563 -0.0082 66  LEU A O   
323  C CB  . LEU A 66  ? 2.1173 1.7237 1.6229 -0.9131 -0.0552 -0.0507 66  LEU A CB  
324  C CG  . LEU A 66  ? 2.1128 1.7037 1.6280 -0.8974 -0.0594 -0.0906 66  LEU A CG  
325  C CD1 . LEU A 66  ? 2.1503 1.6539 1.6648 -0.8808 -0.0733 -0.0960 66  LEU A CD1 
326  C CD2 . LEU A 66  ? 2.0256 1.6851 1.5574 -0.8683 -0.0503 -0.1032 66  LEU A CD2 
327  N N   . ALA A 67  ? 2.0688 1.6884 1.5525 -0.9584 -0.0540 0.0224  67  ALA A N   
328  C CA  . ALA A 67  ? 2.0276 1.6891 1.5051 -0.9861 -0.0492 0.0470  67  ALA A CA  
329  C C   . ALA A 67  ? 2.1888 1.7976 1.6451 -1.0201 -0.0583 0.0623  67  ALA A C   
330  O O   . ALA A 67  ? 2.2054 1.8373 1.6517 -1.0537 -0.0547 0.0657  67  ALA A O   
331  C CB  . ALA A 67  ? 1.9261 1.6232 1.4163 -0.9678 -0.0464 0.0682  67  ALA A CB  
332  N N   . TYR A 68  ? 1.9411 1.4802 1.3930 -1.0109 -0.0694 0.0729  68  TYR A N   
333  C CA  . TYR A 68  ? 2.0450 1.5281 1.4840 -1.0409 -0.0773 0.0919  68  TYR A CA  
334  C C   . TYR A 68  ? 2.0855 1.5408 1.5244 -1.0672 -0.0758 0.0644  68  TYR A C   
335  O O   . TYR A 68  ? 2.1358 1.6047 1.5642 -1.1033 -0.0728 0.0698  68  TYR A O   
336  C CB  . TYR A 68  ? 2.0940 1.5103 1.5354 -1.0211 -0.0882 0.1121  68  TYR A CB  
337  C CG  . TYR A 68  ? 2.0961 1.5481 1.5340 -1.0079 -0.0901 0.1464  68  TYR A CG  
338  C CD1 . TYR A 68  ? 2.0532 1.5111 1.5004 -0.9677 -0.0916 0.1457  68  TYR A CD1 
339  C CD2 . TYR A 68  ? 2.1447 1.6335 1.5718 -1.0361 -0.0900 0.1757  68  TYR A CD2 
340  C CE1 . TYR A 68  ? 2.0628 1.5651 1.5109 -0.9558 -0.0923 0.1717  68  TYR A CE1 
341  C CE2 . TYR A 68  ? 2.1535 1.6882 1.5817 -1.0247 -0.0916 0.2022  68  TYR A CE2 
342  C CZ  . TYR A 68  ? 2.1137 1.6569 1.5537 -0.9844 -0.0923 0.1991  68  TYR A CZ  
343  O OH  . TYR A 68  ? 2.0379 1.6371 1.4828 -0.9729 -0.0929 0.2207  68  TYR A OH  
344  N N   . LEU A 69  ? 2.3347 1.7575 1.7875 -1.0493 -0.0774 0.0312  69  LEU A N   
345  C CA  . LEU A 69  ? 2.3718 1.7824 1.8320 -1.0713 -0.0747 -0.0046 69  LEU A CA  
346  C C   . LEU A 69  ? 2.3561 1.8459 1.8068 -1.0954 -0.0637 -0.0138 69  LEU A C   
347  O O   . LEU A 69  ? 2.4230 1.9097 1.8694 -1.1302 -0.0610 -0.0233 69  LEU A O   
348  C CB  . LEU A 69  ? 2.3302 1.7305 1.8092 -1.0427 -0.0761 -0.0450 69  LEU A CB  
349  C CG  . LEU A 69  ? 2.3573 1.6734 1.8493 -1.0203 -0.0873 -0.0410 69  LEU A CG  
350  C CD1 . LEU A 69  ? 2.3332 1.6373 1.8467 -0.9994 -0.0894 -0.0888 69  LEU A CD1 
351  C CD2 . LEU A 69  ? 2.4623 1.7067 1.9593 -1.0493 -0.0921 -0.0219 69  LEU A CD2 
352  N N   . ALA A 70  ? 2.2502 1.8124 1.7012 -1.0761 -0.0564 -0.0109 70  ALA A N   
353  C CA  . ALA A 70  ? 2.2293 1.8738 1.6761 -1.0936 -0.0448 -0.0162 70  ALA A CA  
354  C C   . ALA A 70  ? 2.3025 1.9478 1.7312 -1.1345 -0.0444 0.0039  70  ALA A C   
355  O O   . ALA A 70  ? 2.3387 2.0198 1.7618 -1.1610 -0.0377 -0.0125 70  ALA A O   
356  C CB  . ALA A 70  ? 2.0811 1.7928 1.5377 -1.0680 -0.0370 -0.0018 70  ALA A CB  
357  N N   . CYS A 71  ? 2.3807 1.9934 1.8004 -1.1393 -0.0515 0.0389  71  CYS A N   
358  C CA  . CYS A 71  ? 2.4613 2.0688 1.8635 -1.1785 -0.0531 0.0605  71  CYS A CA  
359  C C   . CYS A 71  ? 2.5541 2.0957 1.9558 -1.2049 -0.0567 0.0448  71  CYS A C   
360  O O   . CYS A 71  ? 2.6169 2.1708 2.0080 -1.2411 -0.0528 0.0405  71  CYS A O   
361  C CB  . CYS A 71  ? 2.4776 2.0731 1.8738 -1.1746 -0.0606 0.1020  71  CYS A CB  
362  S SG  . CYS A 71  ? 2.2443 1.9239 1.6517 -1.1481 -0.0545 0.1152  71  CYS A SG  
363  N N   . GLY A 72  ? 2.8790 2.6121 2.3177 -0.7001 -1.2055 0.0780  72  GLY A N   
364  C CA  . GLY A 72  ? 2.9794 2.7446 2.4770 -0.6988 -1.1577 0.0384  72  GLY A CA  
365  C C   . GLY A 72  ? 2.9916 2.7919 2.5978 -0.6878 -1.1240 0.0341  72  GLY A C   
366  O O   . GLY A 72  ? 2.9702 2.7775 2.6038 -0.6717 -1.1480 0.0137  72  GLY A O   
367  N N   . ASP A 73  ? 2.5870 2.4090 2.2529 -0.6958 -1.0680 0.0537  73  ASP A N   
368  C CA  . ASP A 73  ? 2.6338 2.4826 2.4003 -0.6845 -1.0269 0.0512  73  ASP A CA  
369  C C   . ASP A 73  ? 2.5509 2.4051 2.3396 -0.6662 -1.0505 0.0744  73  ASP A C   
370  O O   . ASP A 73  ? 2.5568 2.4255 2.3997 -0.6539 -1.0428 0.0525  73  ASP A O   
371  C CB  . ASP A 73  ? 2.7438 2.6056 2.5595 -0.6808 -1.0085 -0.0077 73  ASP A CB  
372  C CG  . ASP A 73  ? 2.8401 2.7105 2.6532 -0.6932 -0.9805 -0.0369 73  ASP A CG  
373  O OD1 . ASP A 73  ? 2.8241 2.6923 2.5992 -0.7068 -0.9693 -0.0085 73  ASP A OD1 
374  O OD2 . ASP A 73  ? 2.9356 2.8205 2.7898 -0.6887 -0.9695 -0.0926 73  ASP A OD2 
375  N N   . VAL A 74  ? 2.0195 1.8664 1.7711 -0.6641 -1.0783 0.1160  74  VAL A N   
376  C CA  . VAL A 74  ? 1.9354 1.7963 1.7066 -0.6425 -1.1068 0.1352  74  VAL A CA  
377  C C   . VAL A 74  ? 1.9212 1.8055 1.7452 -0.6284 -1.0726 0.1767  74  VAL A C   
378  O O   . VAL A 74  ? 1.8042 1.7061 1.6380 -0.6073 -1.0980 0.1985  74  VAL A O   
379  C CB  . VAL A 74  ? 1.8264 1.6669 1.5259 -0.6417 -1.1759 0.1443  74  VAL A CB  
380  C CG1 . VAL A 74  ? 1.8180 1.6524 1.4938 -0.6330 -1.2234 0.1020  74  VAL A CG1 
381  C CG2 . VAL A 74  ? 1.8291 1.6363 1.4590 -0.6658 -1.1820 0.1570  74  VAL A CG2 
382  N N   . ILE A 75  ? 1.8229 1.7108 1.6813 -0.6361 -1.0179 0.1838  75  ILE A N   
383  C CA  . ILE A 75  ? 1.8064 1.7142 1.7120 -0.6176 -0.9851 0.2188  75  ILE A CA  
384  C C   . ILE A 75  ? 1.8471 1.7622 1.8234 -0.6087 -0.9268 0.2143  75  ILE A C   
385  O O   . ILE A 75  ? 1.6884 1.5952 1.6831 -0.6262 -0.8931 0.1918  75  ILE A O   
386  C CB  . ILE A 75  ? 1.7986 1.7047 1.6823 -0.6304 -0.9768 0.2384  75  ILE A CB  
387  C CG1 . ILE A 75  ? 1.7588 1.6562 1.5865 -0.6354 -1.0319 0.2520  75  ILE A CG1 
388  C CG2 . ILE A 75  ? 1.8277 1.7561 1.7653 -0.6066 -0.9396 0.2641  75  ILE A CG2 
389  C CD1 . ILE A 75  ? 1.7515 1.6386 1.5457 -0.6612 -1.0247 0.2615  75  ILE A CD1 
390  N N   . GLU A 76  ? 2.2328 2.1639 2.2491 -0.5797 -0.9157 0.2362  76  GLU A N   
391  C CA  . GLU A 76  ? 2.2753 2.2060 2.3577 -0.5673 -0.8586 0.2428  76  GLU A CA  
392  C C   . GLU A 76  ? 2.4110 2.3338 2.5141 -0.5746 -0.8178 0.2473  76  GLU A C   
393  O O   . GLU A 76  ? 2.4274 2.3572 2.5035 -0.5741 -0.8284 0.2622  76  GLU A O   
394  C CB  . GLU A 76  ? 2.1588 2.1096 2.2631 -0.5285 -0.8539 0.2803  76  GLU A CB  
395  C CG  . GLU A 76  ? 2.1220 2.0656 2.2876 -0.5159 -0.8000 0.2882  76  GLU A CG  
396  C CD  . GLU A 76  ? 2.0829 2.0203 2.2709 -0.5374 -0.7979 0.2490  76  GLU A CD  
397  O OE1 . GLU A 76  ? 2.0187 1.9724 2.1769 -0.5383 -0.8440 0.2327  76  GLU A OE1 
398  O OE2 . GLU A 76  ? 2.1180 2.0363 2.3583 -0.5521 -0.7521 0.2297  76  GLU A OE2 
399  N N   . ASN A 77  ? 1.7690 1.6797 1.9263 -0.5819 -0.7717 0.2299  77  ASN A N   
400  C CA  . ASN A 77  ? 1.6886 1.5943 1.8789 -0.5838 -0.7309 0.2314  77  ASN A CA  
401  C C   . ASN A 77  ? 1.7067 1.6204 1.8557 -0.6082 -0.7454 0.2149  77  ASN A C   
402  O O   . ASN A 77  ? 1.7814 1.7019 1.9434 -0.6044 -0.7242 0.2228  77  ASN A O   
403  C CB  . ASN A 77  ? 1.6744 1.5824 1.8863 -0.5468 -0.7090 0.2746  77  ASN A CB  
404  C CG  . ASN A 77  ? 1.7081 1.6017 1.9711 -0.5247 -0.6738 0.2929  77  ASN A CG  
405  O OD1 . ASN A 77  ? 1.7380 1.6108 2.0579 -0.5321 -0.6309 0.2803  77  ASN A OD1 
406  N ND2 . ASN A 77  ? 1.6649 1.5709 1.9111 -0.4975 -0.6907 0.3222  77  ASN A ND2 
407  N N   . ALA A 78  ? 2.6252 2.5382 2.7222 -0.6319 -0.7811 0.1911  78  ALA A N   
408  C CA  . ALA A 78  ? 2.6626 2.5811 2.7135 -0.6577 -0.7910 0.1768  78  ALA A CA  
409  C C   . ALA A 78  ? 2.7677 2.6881 2.8356 -0.6778 -0.7737 0.1306  78  ALA A C   
410  O O   . ALA A 78  ? 2.7930 2.7067 2.8659 -0.6797 -0.7851 0.1027  78  ALA A O   
411  C CB  . ALA A 78  ? 2.5222 2.4340 2.4944 -0.6676 -0.8434 0.1862  78  ALA A CB  
412  N N   . ARG A 79  ? 1.8913 1.8270 1.9736 -0.6903 -0.7471 0.1166  79  ARG A N   
413  C CA  . ARG A 79  ? 1.9831 1.9316 2.0768 -0.7073 -0.7359 0.0684  79  ARG A CA  
414  C C   . ARG A 79  ? 1.9038 1.8450 1.9159 -0.7204 -0.7786 0.0525  79  ARG A C   
415  O O   . ARG A 79  ? 1.9088 1.8423 1.8456 -0.7303 -0.8063 0.0774  79  ARG A O   
416  C CB  . ARG A 79  ? 2.0364 2.0115 2.1396 -0.7202 -0.7105 0.0572  79  ARG A CB  
417  C CG  . ARG A 79  ? 2.1275 2.1067 2.3091 -0.7033 -0.6723 0.0684  79  ARG A CG  
418  C CD  . ARG A 79  ? 2.2078 2.2203 2.4135 -0.7158 -0.6480 0.0405  79  ARG A CD  
419  N NE  . ARG A 79  ? 2.1216 2.1509 2.2749 -0.7272 -0.6553 0.0595  79  ARG A NE  
420  C CZ  . ARG A 79  ? 2.0593 2.1054 2.1424 -0.7537 -0.6708 0.0510  79  ARG A CZ  
421  N NH1 . ARG A 79  ? 2.0694 2.1181 2.1180 -0.7665 -0.6845 0.0238  79  ARG A NH1 
422  N NH2 . ARG A 79  ? 1.9958 2.0563 2.0431 -0.7662 -0.6715 0.0684  79  ARG A NH2 
423  N N   . PRO A 80  ? 2.0141 1.9554 2.0437 -0.7185 -0.7848 0.0095  80  PRO A N   
424  C CA  . PRO A 80  ? 1.9564 1.8878 1.9081 -0.7232 -0.8290 -0.0123 80  PRO A CA  
425  C C   . PRO A 80  ? 1.9187 1.8547 1.7823 -0.7412 -0.8431 -0.0084 80  PRO A C   
426  O O   . PRO A 80  ? 1.9900 1.9540 1.8702 -0.7512 -0.8145 -0.0261 80  PRO A O   
427  C CB  . PRO A 80  ? 2.0725 2.0189 2.0830 -0.7169 -0.8178 -0.0744 80  PRO A CB  
428  C CG  . PRO A 80  ? 2.1574 2.1042 2.2759 -0.7073 -0.7770 -0.0688 80  PRO A CG  
429  C CD  . PRO A 80  ? 2.1512 2.1000 2.2817 -0.7093 -0.7502 -0.0235 80  PRO A CD  
430  N N   . GLY A 81  ? 3.4004 3.3091 3.1725 -0.7452 -0.8866 0.0153  81  GLY A N   
431  C CA  . GLY A 81  ? 3.3716 3.2742 3.0496 -0.7636 -0.9003 0.0264  81  GLY A CA  
432  C C   . GLY A 81  ? 3.3920 3.3189 3.0813 -0.7824 -0.8626 0.0462  81  GLY A C   
433  O O   . GLY A 81  ? 3.4382 3.3835 3.0851 -0.7972 -0.8513 0.0313  81  GLY A O   
434  N N   . SER A 82  ? 1.2307 2.0212 1.8197 -1.3402 -0.4630 0.1053  82  SER A N   
435  C CA  . SER A 82  ? 1.2491 1.9583 1.8025 -1.3209 -0.4440 0.0230  82  SER A CA  
436  C C   . SER A 82  ? 1.2283 1.9120 1.7923 -1.2671 -0.4181 0.0220  82  SER A C   
437  O O   . SER A 82  ? 1.2261 1.8875 1.8222 -1.2259 -0.4130 0.0494  82  SER A O   
438  C CB  . SER A 82  ? 1.2909 1.9217 1.8518 -1.3109 -0.4478 -0.0226 82  SER A CB  
439  O OG  . SER A 82  ? 1.2805 1.8524 1.8655 -1.2522 -0.4333 -0.0321 82  SER A OG  
440  N N   . PHE A 83  ? 1.5556 2.2411 2.0918 -1.2720 -0.4019 -0.0109 83  PHE A N   
441  C CA  . PHE A 83  ? 1.5410 2.2069 2.0880 -1.2296 -0.3789 -0.0123 83  PHE A CA  
442  C C   . PHE A 83  ? 1.5614 2.1387 2.1207 -1.1824 -0.3719 -0.0528 83  PHE A C   
443  O O   . PHE A 83  ? 1.5650 2.1213 2.1435 -1.1445 -0.3649 -0.0323 83  PHE A O   
444  C CB  . PHE A 83  ? 1.5355 2.2193 2.0550 -1.2500 -0.3631 -0.0443 83  PHE A CB  
445  C CG  . PHE A 83  ? 1.5248 2.1827 2.0601 -1.2102 -0.3398 -0.0517 83  PHE A CG  
446  C CD1 . PHE A 83  ? 1.5196 2.2118 2.0670 -1.1844 -0.3279 0.0085  83  PHE A CD1 
447  C CD2 . PHE A 83  ? 1.5526 2.1458 2.0857 -1.1902 -0.3253 -0.1142 83  PHE A CD2 
448  C CE1 . PHE A 83  ? 1.5282 2.1867 2.0841 -1.1474 -0.3057 0.0003  83  PHE A CE1 
449  C CE2 . PHE A 83  ? 1.5427 2.1124 2.0949 -1.1579 -0.3080 -0.1198 83  PHE A CE2 
450  C CZ  . PHE A 83  ? 1.5276 2.1290 2.0926 -1.1420 -0.3005 -0.0658 83  PHE A CZ  
451  N N   . THR A 84  ? 1.5611 2.0870 2.1117 -1.1878 -0.3737 -0.1095 84  THR A N   
452  C CA  . THR A 84  ? 1.5889 2.0386 2.1600 -1.1468 -0.3709 -0.1444 84  THR A CA  
453  C C   . THR A 84  ? 1.5848 2.0216 2.1775 -1.1180 -0.3838 -0.1006 84  THR A C   
454  O O   . THR A 84  ? 1.6006 2.0084 2.2010 -1.0829 -0.3797 -0.0939 84  THR A O   
455  C CB  . THR A 84  ? 1.6377 2.0450 2.2127 -1.1620 -0.3732 -0.1946 84  THR A CB  
456  O OG1 . THR A 84  ? 1.6601 2.0845 2.2079 -1.2020 -0.3602 -0.2327 84  THR A OG1 
457  C CG2 . THR A 84  ? 1.6638 2.0024 2.2704 -1.1214 -0.3685 -0.2307 84  THR A CG2 
458  N N   . ASP A 85  ? 1.6704 2.1273 2.2730 -1.1371 -0.3995 -0.0714 85  ASP A N   
459  C CA  . ASP A 85  ? 1.6884 2.1393 2.3164 -1.1156 -0.4087 -0.0254 85  ASP A CA  
460  C C   . ASP A 85  ? 1.7001 2.1665 2.3167 -1.0815 -0.3922 0.0211  85  ASP A C   
461  O O   . ASP A 85  ? 1.7531 2.1678 2.3598 -1.0367 -0.3863 0.0268  85  ASP A O   
462  C CB  . ASP A 85  ? 1.6827 2.1785 2.3292 -1.1487 -0.4244 0.0151  85  ASP A CB  
463  C CG  . ASP A 85  ? 1.7055 2.1639 2.3539 -1.1688 -0.4358 -0.0280 85  ASP A CG  
464  O OD1 . ASP A 85  ? 1.7120 2.1328 2.3422 -1.1715 -0.4269 -0.0886 85  ASP A OD1 
465  O OD2 . ASP A 85  ? 1.7192 2.1858 2.3946 -1.1831 -0.4505 0.0002  85  ASP A OD2 
466  N N   . ALA A 86  ? 1.9166 2.4482 2.5246 -1.0979 -0.3822 0.0559  86  ALA A N   
467  C CA  . ALA A 86  ? 1.9396 2.4833 2.5344 -1.0602 -0.3583 0.1043  86  ALA A CA  
468  C C   . ALA A 86  ? 1.9664 2.4478 2.5449 -1.0286 -0.3459 0.0625  86  ALA A C   
469  O O   . ALA A 86  ? 2.0286 2.4664 2.5898 -0.9842 -0.3322 0.0822  86  ALA A O   
470  C CB  . ALA A 86  ? 1.9003 2.5295 2.4970 -1.0880 -0.3514 0.1465  86  ALA A CB  
471  N N   . PHE A 87  ? 0.9734 1.4486 1.5562 -1.0531 -0.3499 0.0053  87  PHE A N   
472  C CA  . PHE A 87  ? 0.9935 1.4160 1.5735 -1.0301 -0.3420 -0.0352 87  PHE A CA  
473  C C   . PHE A 87  ? 1.0288 1.3744 1.6063 -0.9960 -0.3543 -0.0543 87  PHE A C   
474  O O   . PHE A 87  ? 1.0923 1.3952 1.6483 -0.9600 -0.3460 -0.0437 87  PHE A O   
475  C CB  . PHE A 87  ? 0.9949 1.4216 1.5866 -1.0601 -0.3424 -0.0927 87  PHE A CB  
476  C CG  . PHE A 87  ? 0.9746 1.3485 1.5735 -1.0344 -0.3357 -0.1320 87  PHE A CG  
477  C CD1 . PHE A 87  ? 0.9676 1.3562 1.5709 -1.0325 -0.3188 -0.1241 87  PHE A CD1 
478  C CD2 . PHE A 87  ? 1.0067 1.3200 1.6171 -1.0140 -0.3474 -0.1722 87  PHE A CD2 
479  C CE1 . PHE A 87  ? 0.9936 1.3348 1.6103 -1.0123 -0.3153 -0.1580 87  PHE A CE1 
480  C CE2 . PHE A 87  ? 1.0035 1.2756 1.6305 -0.9934 -0.3456 -0.2027 87  PHE A CE2 
481  C CZ  . PHE A 87  ? 0.9978 1.2827 1.6267 -0.9933 -0.3304 -0.1967 87  PHE A CZ  
482  N N   . PHE A 88  ? 1.4781 1.8034 2.0747 -1.0089 -0.3743 -0.0823 88  PHE A N   
483  C CA  . PHE A 88  ? 1.5438 1.8024 2.1401 -0.9795 -0.3901 -0.0961 88  PHE A CA  
484  C C   . PHE A 88  ? 1.6228 1.8620 2.1830 -0.9425 -0.3838 -0.0434 88  PHE A C   
485  O O   . PHE A 88  ? 1.6601 1.8395 2.1937 -0.9098 -0.3882 -0.0485 88  PHE A O   
486  C CB  . PHE A 88  ? 1.5323 1.7774 2.1572 -0.9947 -0.4070 -0.1235 88  PHE A CB  
487  C CG  . PHE A 88  ? 1.5159 1.7424 2.1553 -0.9948 -0.4013 -0.1764 88  PHE A CG  
488  C CD1 . PHE A 88  ? 1.4812 1.7352 2.1244 -1.0234 -0.3904 -0.1974 88  PHE A CD1 
489  C CD2 . PHE A 88  ? 1.5489 1.7307 2.2012 -0.9703 -0.4064 -0.2046 88  PHE A CD2 
490  C CE1 . PHE A 88  ? 1.4985 1.7340 2.1612 -1.0260 -0.3786 -0.2466 88  PHE A CE1 
491  C CE2 . PHE A 88  ? 1.5471 1.7186 2.2294 -0.9713 -0.3976 -0.2479 88  PHE A CE2 
492  C CZ  . PHE A 88  ? 1.5246 1.7220 2.2135 -0.9983 -0.3805 -0.2696 88  PHE A CZ  
493  N N   . PHE A 89  ? 0.9787 1.2672 1.5363 -0.9484 -0.3731 0.0089  89  PHE A N   
494  C CA  . PHE A 89  ? 1.0430 1.3166 1.5688 -0.9099 -0.3566 0.0655  89  PHE A CA  
495  C C   . PHE A 89  ? 1.0918 1.3338 1.5804 -0.8792 -0.3341 0.0712  89  PHE A C   
496  O O   . PHE A 89  ? 1.1335 1.3112 1.5788 -0.8413 -0.3273 0.0781  89  PHE A O   
497  C CB  . PHE A 89  ? 1.0060 1.3520 1.5494 -0.9231 -0.3446 0.1284  89  PHE A CB  
498  C CG  . PHE A 89  ? 1.0884 1.4245 1.6053 -0.8797 -0.3161 0.1928  89  PHE A CG  
499  C CD1 . PHE A 89  ? 1.1672 1.4486 1.6593 -0.8464 -0.3150 0.2069  89  PHE A CD1 
500  C CD2 . PHE A 89  ? 1.0809 1.4589 1.5968 -0.8698 -0.2865 0.2410  89  PHE A CD2 
501  C CE1 . PHE A 89  ? 1.2276 1.4926 1.6888 -0.8037 -0.2814 0.2653  89  PHE A CE1 
502  C CE2 . PHE A 89  ? 1.1674 1.5308 1.6622 -0.8260 -0.2522 0.3018  89  PHE A CE2 
503  C CZ  . PHE A 89  ? 1.2526 1.5567 1.7168 -0.7925 -0.2478 0.3122  89  PHE A CZ  
504  N N   . SER A 90  ? 2.0646 2.3490 2.5666 -0.8975 -0.3219 0.0679  90  SER A N   
505  C CA  . SER A 90  ? 2.1135 2.3717 2.5898 -0.8728 -0.2980 0.0743  90  SER A CA  
506  C C   . SER A 90  ? 2.1334 2.3060 2.5841 -0.8543 -0.3116 0.0240  90  SER A C   
507  O O   . SER A 90  ? 2.1606 2.2768 2.5672 -0.8215 -0.2954 0.0345  90  SER A O   
508  C CB  . SER A 90  ? 2.0290 2.3494 2.5322 -0.9010 -0.2872 0.0730  90  SER A CB  
509  O OG  . SER A 90  ? 2.0715 2.3527 2.5609 -0.8836 -0.2719 0.0568  90  SER A OG  
510  N N   . VAL A 91  ? 1.6293 1.7896 2.1078 -0.8758 -0.3411 -0.0295 91  VAL A N   
511  C CA  . VAL A 91  ? 1.5695 1.6557 2.0328 -0.8612 -0.3606 -0.0712 91  VAL A CA  
512  C C   . VAL A 91  ? 1.5725 1.5970 1.9861 -0.8300 -0.3710 -0.0561 91  VAL A C   
513  O O   . VAL A 91  ? 1.5797 1.5385 1.9401 -0.8040 -0.3683 -0.0579 91  VAL A O   
514  C CB  . VAL A 91  ? 1.5028 1.5925 2.0201 -0.8885 -0.3872 -0.1266 91  VAL A CB  
515  C CG1 . VAL A 91  ? 1.5246 1.6827 2.0836 -0.9224 -0.3725 -0.1365 91  VAL A CG1 
516  C CG2 . VAL A 91  ? 1.4768 1.5529 2.0110 -0.8914 -0.4129 -0.1372 91  VAL A CG2 
517  N N   . GLN A 92  ? 1.8008 1.8435 2.2269 -0.8336 -0.3813 -0.0403 92  GLN A N   
518  C CA  . GLN A 92  ? 1.8105 1.7998 2.1899 -0.8040 -0.3891 -0.0210 92  GLN A CA  
519  C C   . GLN A 92  ? 1.8737 1.8309 2.1859 -0.7685 -0.3549 0.0210  92  GLN A C   
520  O O   . GLN A 92  ? 1.8912 1.7765 2.1377 -0.7390 -0.3569 0.0238  92  GLN A O   
521  C CB  . GLN A 92  ? 1.8265 1.8533 2.2367 -0.8134 -0.3947 0.0044  92  GLN A CB  
522  C CG  . GLN A 92  ? 1.8033 1.8821 2.2845 -0.8549 -0.4102 -0.0255 92  GLN A CG  
523  C CD  . GLN A 92  ? 1.7916 1.8688 2.3026 -0.8621 -0.4297 -0.0240 92  GLN A CD  
524  O OE1 . GLN A 92  ? 1.8242 1.8945 2.3140 -0.8427 -0.4238 0.0187  92  GLN A OE1 
525  N NE2 . GLN A 92  ? 1.7483 1.8297 2.3124 -0.8885 -0.4492 -0.0686 92  GLN A NE2 
526  N N   . THR A 93  ? 1.3297 1.3392 1.6566 -0.7712 -0.3217 0.0557  93  THR A N   
527  C CA  . THR A 93  ? 1.3354 1.3187 1.6105 -0.7352 -0.2800 0.1018  93  THR A CA  
528  C C   . THR A 93  ? 1.3972 1.3142 1.6281 -0.7214 -0.2705 0.0728  93  THR A C   
529  O O   . THR A 93  ? 1.4374 1.2737 1.5930 -0.6882 -0.2550 0.0780  93  THR A O   
530  C CB  . THR A 93  ? 1.3938 1.4638 1.7118 -0.7423 -0.2483 0.1592  93  THR A CB  
531  O OG1 . THR A 93  ? 1.4654 1.5178 1.7473 -0.7029 -0.2086 0.2198  93  THR A OG1 
532  C CG2 . THR A 93  ? 1.3978 1.4966 1.7371 -0.7550 -0.2329 0.1523  93  THR A CG2 
533  N N   . MET A 94  ? 1.7379 1.6835 2.0119 -0.7481 -0.2793 0.0409  94  MET A N   
534  C CA  . MET A 94  ? 1.7402 1.6293 1.9849 -0.7391 -0.2689 0.0172  94  MET A CA  
535  C C   . MET A 94  ? 1.7041 1.5056 1.9063 -0.7365 -0.3056 -0.0342 94  MET A C   
536  O O   . MET A 94  ? 1.7379 1.4629 1.8830 -0.7198 -0.2962 -0.0464 94  MET A O   
537  C CB  . MET A 94  ? 1.7158 1.6656 2.0238 -0.7680 -0.2648 0.0042  94  MET A CB  
538  C CG  . MET A 94  ? 1.7122 1.6043 2.0010 -0.7613 -0.2549 -0.0195 94  MET A CG  
539  S SD  . MET A 94  ? 1.6712 1.6296 2.0392 -0.7975 -0.2571 -0.0429 94  MET A SD  
540  C CE  . MET A 94  ? 1.6017 1.6004 2.0204 -0.8305 -0.3030 -0.0843 94  MET A CE  
541  N N   . ALA A 95  ? 1.2808 1.0927 1.5132 -0.7549 -0.3483 -0.0634 95  ALA A N   
542  C CA  . ALA A 95  ? 1.4792 1.2183 1.6789 -0.7542 -0.3897 -0.1037 95  ALA A CA  
543  C C   . ALA A 95  ? 1.5340 1.2150 1.6512 -0.7240 -0.3891 -0.0807 95  ALA A C   
544  O O   . ALA A 95  ? 1.5419 1.1550 1.6081 -0.7185 -0.4224 -0.1038 95  ALA A O   
545  C CB  . ALA A 95  ? 1.3980 1.1767 1.6748 -0.7833 -0.4308 -0.1368 95  ALA A CB  
546  N N   . THR A 96  ? 1.7861 1.4993 1.8933 -0.7058 -0.3511 -0.0308 96  THR A N   
547  C CA  . THR A 96  ? 1.8470 1.5148 1.8811 -0.6736 -0.3383 0.0018  96  THR A CA  
548  C C   . THR A 96  ? 1.8129 1.4711 1.8505 -0.6794 -0.3831 -0.0114 96  THR A C   
549  O O   . THR A 96  ? 1.8644 1.4559 1.8207 -0.6551 -0.3874 -0.0030 96  THR A O   
550  C CB  . THR A 96  ? 1.9314 1.4944 1.8544 -0.6430 -0.3165 -0.0016 96  THR A CB  
551  O OG1 . THR A 96  ? 1.9124 1.4089 1.7980 -0.6556 -0.3658 -0.0529 96  THR A OG1 
552  C CG2 . THR A 96  ? 1.9586 1.5232 1.8874 -0.6384 -0.2737 0.0065  96  THR A CG2 
553  N N   . ILE A 97  ? 2.0290 1.7499 2.1570 -0.7103 -0.4134 -0.0303 97  ILE A N   
554  C CA  . ILE A 97  ? 2.0027 1.7218 2.1475 -0.7132 -0.4485 -0.0327 97  ILE A CA  
555  C C   . ILE A 97  ? 2.0480 1.7919 2.1832 -0.6947 -0.4205 0.0215  97  ILE A C   
556  O O   . ILE A 97  ? 2.0735 1.7822 2.1683 -0.6760 -0.4310 0.0390  97  ILE A O   
557  C CB  . ILE A 97  ? 1.9196 1.6968 2.1695 -0.7489 -0.4778 -0.0639 97  ILE A CB  
558  C CG1 . ILE A 97  ? 1.8733 1.6459 2.1536 -0.7689 -0.4934 -0.1094 97  ILE A CG1 
559  C CG2 . ILE A 97  ? 1.8949 1.6565 2.1626 -0.7485 -0.5153 -0.0678 97  ILE A CG2 
560  C CD1 . ILE A 97  ? 1.8080 1.6438 2.1908 -0.8020 -0.5032 -0.1362 97  ILE A CD1 
561  N N   . GLY A 98  ? 2.4938 2.3022 2.6697 -0.7014 -0.3858 0.0516  98  GLY A N   
562  C CA  . GLY A 98  ? 2.5431 2.3861 2.7240 -0.6869 -0.3569 0.1101  98  GLY A CA  
563  C C   . GLY A 98  ? 2.5245 2.3747 2.7336 -0.6912 -0.3826 0.1183  98  GLY A C   
564  O O   . GLY A 98  ? 2.5710 2.3865 2.7298 -0.6616 -0.3710 0.1538  98  GLY A O   
565  N N   . TYR A 99  ? 1.9860 1.8780 2.2750 -0.7269 -0.4133 0.0870  99  TYR A N   
566  C CA  . TYR A 99  ? 1.9650 1.8626 2.2940 -0.7337 -0.4370 0.0923  99  TYR A CA  
567  C C   . TYR A 99  ? 2.0220 1.9429 2.3509 -0.7184 -0.4120 0.1550  99  TYR A C   
568  O O   . TYR A 99  ? 2.0412 1.9247 2.3382 -0.6945 -0.4169 0.1781  99  TYR A O   
569  C CB  . TYR A 99  ? 1.9119 1.8585 2.3340 -0.7765 -0.4580 0.0555  99  TYR A CB  
570  C CG  . TYR A 99  ? 1.8464 1.7646 2.2900 -0.7881 -0.4901 -0.0015 99  TYR A CG  
571  C CD1 . TYR A 99  ? 1.8107 1.7625 2.3065 -0.8192 -0.4917 -0.0423 99  TYR A CD1 
572  C CD2 . TYR A 99  ? 1.8294 1.6902 2.2429 -0.7684 -0.5188 -0.0103 99  TYR A CD2 
573  C CE1 . TYR A 99  ? 1.7521 1.6823 2.2793 -0.8283 -0.5172 -0.0889 99  TYR A CE1 
574  C CE2 . TYR A 99  ? 1.7731 1.6155 2.2194 -0.7802 -0.5507 -0.0554 99  TYR A CE2 
575  C CZ  . TYR A 99  ? 1.7307 1.6086 2.2387 -0.8091 -0.5478 -0.0938 99  TYR A CZ  
576  O OH  . TYR A 99  ? 1.6754 1.5392 2.2272 -0.8192 -0.5754 -0.1334 99  TYR A OH  
577  N N   . GLY A 100 ? 1.6344 1.6213 2.0043 -0.7342 -0.3875 0.1859  100 GLY A N   
578  C CA  . GLY A 100 ? 1.6961 1.7125 2.0764 -0.7204 -0.3621 0.2530  100 GLY A CA  
579  C C   . GLY A 100 ? 1.7079 1.7999 2.1778 -0.7601 -0.3697 0.2714  100 GLY A C   
580  O O   . GLY A 100 ? 1.7614 1.8877 2.2525 -0.7531 -0.3497 0.3324  100 GLY A O   
581  N N   . LYS A 101 ? 1.8888 1.9734 2.2314 -0.3915 -0.3440 0.1851  101 LYS A N   
582  C CA  . LYS A 101 ? 1.9427 2.0309 2.3255 -0.3731 -0.3681 0.1642  101 LYS A CA  
583  C C   . LYS A 101 ? 2.0630 2.1123 2.4157 -0.3845 -0.3872 0.1712  101 LYS A C   
584  O O   . LYS A 101 ? 2.0307 2.0363 2.4286 -0.3711 -0.4006 0.1785  101 LYS A O   
585  C CB  . LYS A 101 ? 2.0369 2.1870 2.4008 -0.3722 -0.3733 0.1353  101 LYS A CB  
586  C CG  . LYS A 101 ? 1.9181 2.1040 2.3419 -0.3481 -0.3651 0.1196  101 LYS A CG  
587  C CD  . LYS A 101 ? 1.8781 2.0419 2.3829 -0.3193 -0.3832 0.1079  101 LYS A CD  
588  C CE  . LYS A 101 ? 1.7252 1.9226 2.2954 -0.2943 -0.3696 0.0957  101 LYS A CE  
589  N NZ  . LYS A 101 ? 1.6676 1.8405 2.3303 -0.2652 -0.3835 0.0874  101 LYS A NZ  
590  N N   . LEU A 102 ? 1.2370 1.3040 1.5149 -0.4083 -0.3869 0.1700  102 LEU A N   
591  C CA  . LEU A 102 ? 1.3658 1.4007 1.6034 -0.4207 -0.4001 0.1790  102 LEU A CA  
592  C C   . LEU A 102 ? 1.2994 1.2828 1.5235 -0.4359 -0.3851 0.2123  102 LEU A C   
593  O O   . LEU A 102 ? 1.2485 1.2373 1.4451 -0.4518 -0.3629 0.2254  102 LEU A O   
594  C CB  . LEU A 102 ? 1.5387 1.6122 1.7028 -0.4383 -0.3991 0.1694  102 LEU A CB  
595  C CG  . LEU A 102 ? 1.5673 1.7004 1.7360 -0.4266 -0.4014 0.1416  102 LEU A CG  
596  C CD1 . LEU A 102 ? 1.7218 1.8925 1.8180 -0.4442 -0.3936 0.1386  102 LEU A CD1 
597  C CD2 . LEU A 102 ? 1.5947 1.7291 1.8091 -0.3983 -0.4290 0.1162  102 LEU A CD2 
598  N N   . ILE A 103 ? 1.3831 1.3158 1.6280 -0.4299 -0.3979 0.2255  103 ILE A N   
599  C CA  . ILE A 103 ? 1.2746 1.1512 1.5125 -0.4402 -0.3844 0.2591  103 ILE A CA  
600  C C   . ILE A 103 ? 1.3144 1.1551 1.5266 -0.4479 -0.3988 0.2699  103 ILE A C   
601  O O   . ILE A 103 ? 1.3763 1.2246 1.6058 -0.4347 -0.4237 0.2517  103 ILE A O   
602  C CB  . ILE A 103 ? 1.1037 0.9454 1.4199 -0.4152 -0.3811 0.2714  103 ILE A CB  
603  C CG1 . ILE A 103 ? 1.0659 0.9475 1.4161 -0.4007 -0.3682 0.2580  103 ILE A CG1 
604  C CG2 . ILE A 103 ? 1.0087 0.7900 1.3128 -0.4232 -0.3643 0.3086  103 ILE A CG2 
605  C CD1 . ILE A 103 ? 0.9261 0.7797 1.3609 -0.3701 -0.3640 0.2678  103 ILE A CD1 
606  N N   . PRO A 104 ? 1.5694 1.3710 1.7391 -0.4684 -0.3835 0.2990  104 PRO A N   
607  C CA  . PRO A 104 ? 1.5933 1.3576 1.7421 -0.4741 -0.3946 0.3130  104 PRO A CA  
608  C C   . PRO A 104 ? 1.4835 1.2049 1.7033 -0.4506 -0.4125 0.3206  104 PRO A C   
609  O O   . PRO A 104 ? 1.3533 1.0579 1.6344 -0.4334 -0.4074 0.3271  104 PRO A O   
610  C CB  . PRO A 104 ? 1.5546 1.2833 1.6519 -0.4998 -0.3690 0.3450  104 PRO A CB  
611  C CG  . PRO A 104 ? 1.4574 1.1870 1.5740 -0.4976 -0.3501 0.3506  104 PRO A CG  
612  C CD  . PRO A 104 ? 1.5285 1.3220 1.6599 -0.4887 -0.3561 0.3181  104 PRO A CD  
613  N N   . ILE A 105 ? 1.6782 1.3832 1.8915 -0.4483 -0.4329 0.3202  105 ILE A N   
614  C CA  . ILE A 105 ? 1.5836 1.2452 1.8632 -0.4289 -0.4515 0.3300  105 ILE A CA  
615  C C   . ILE A 105 ? 1.6081 1.2297 1.8490 -0.4415 -0.4539 0.3539  105 ILE A C   
616  O O   . ILE A 105 ? 1.7489 1.3912 1.9395 -0.4482 -0.4654 0.3415  105 ILE A O   
617  C CB  . ILE A 105 ? 1.6402 1.3305 1.9732 -0.4045 -0.4853 0.2943  105 ILE A CB  
618  C CG1 . ILE A 105 ? 1.5924 1.3166 1.9779 -0.3886 -0.4815 0.2737  105 ILE A CG1 
619  C CG2 . ILE A 105 ? 1.5669 1.2123 1.9647 -0.3876 -0.5083 0.3042  105 ILE A CG2 
620  C CD1 . ILE A 105 ? 1.6779 1.4397 2.1025 -0.3676 -0.5122 0.2336  105 ILE A CD1 
621  N N   . GLY A 106 ? 1.4717 1.0354 1.7342 -0.4425 -0.4412 0.3898  106 GLY A N   
622  C CA  . GLY A 106 ? 1.4789 1.0004 1.7104 -0.4534 -0.4412 0.4167  106 GLY A CA  
623  C C   . GLY A 106 ? 1.5288 1.0447 1.6721 -0.4834 -0.4126 0.4367  106 GLY A C   
624  O O   . GLY A 106 ? 1.5913 1.1450 1.6929 -0.4969 -0.3981 0.4236  106 GLY A O   
625  N N   . PRO A 107 ? 1.7340 1.2026 1.8513 -0.4942 -0.4041 0.4690  107 PRO A N   
626  C CA  . PRO A 107 ? 1.7624 1.2154 1.8023 -0.5229 -0.3743 0.4932  107 PRO A CA  
627  C C   . PRO A 107 ? 1.9353 1.4419 1.9081 -0.5392 -0.3704 0.4714  107 PRO A C   
628  O O   . PRO A 107 ? 1.9578 1.4781 1.8871 -0.5597 -0.3464 0.4745  107 PRO A O   
629  C CB  . PRO A 107 ? 1.7307 1.1312 1.7651 -0.5249 -0.3747 0.5253  107 PRO A CB  
630  C CG  . PRO A 107 ? 1.6194 0.9924 1.7412 -0.4976 -0.3970 0.5284  107 PRO A CG  
631  C CD  . PRO A 107 ? 1.6764 1.1030 1.8418 -0.4789 -0.4229 0.4850  107 PRO A CD  
632  N N   . LEU A 108 ? 2.0679 1.6036 2.0340 -0.5285 -0.3939 0.4501  108 LEU A N   
633  C CA  . LEU A 108 ? 2.2397 1.8242 2.1425 -0.5386 -0.3894 0.4322  108 LEU A CA  
634  C C   . LEU A 108 ? 2.2747 1.9085 2.1741 -0.5425 -0.3822 0.4080  108 LEU A C   
635  O O   . LEU A 108 ? 2.3396 1.9939 2.1881 -0.5637 -0.3588 0.4118  108 LEU A O   
636  C CB  . LEU A 108 ? 2.3652 1.9727 2.2671 -0.5179 -0.4201 0.4097  108 LEU A CB  
637  C CG  . LEU A 108 ? 2.3444 1.9078 2.2514 -0.5121 -0.4306 0.4316  108 LEU A CG  
638  C CD1 . LEU A 108 ? 2.5022 2.0944 2.3903 -0.4925 -0.4588 0.4076  108 LEU A CD1 
639  C CD2 . LEU A 108 ? 2.3176 1.8453 2.1718 -0.5384 -0.3959 0.4711  108 LEU A CD2 
640  N N   . ALA A 109 ? 2.0084 1.6614 1.9659 -0.5218 -0.4019 0.3839  109 ALA A N   
641  C CA  . ALA A 109 ? 2.0346 1.7348 1.9949 -0.5230 -0.3956 0.3614  109 ALA A CA  
642  C C   . ALA A 109 ? 1.9690 1.6580 1.9048 -0.5469 -0.3638 0.3815  109 ALA A C   
643  O O   . ALA A 109 ? 2.0588 1.7835 1.9510 -0.5640 -0.3483 0.3751  109 ALA A O   
644  C CB  . ALA A 109 ? 1.9571 1.6664 1.9933 -0.4973 -0.4161 0.3405  109 ALA A CB  
645  N N   . ASN A 110 ? 1.9230 1.5609 1.8878 -0.5465 -0.3547 0.4065  110 ASN A N   
646  C CA  . ASN A 110 ? 1.8523 1.4744 1.7992 -0.5638 -0.3281 0.4236  110 ASN A CA  
647  C C   . ASN A 110 ? 1.9156 1.5264 1.7933 -0.5944 -0.3048 0.4428  110 ASN A C   
648  O O   . ASN A 110 ? 1.9389 1.5679 1.7890 -0.6125 -0.2872 0.4411  110 ASN A O   
649  C CB  . ASN A 110 ? 1.6768 1.2415 1.6695 -0.5505 -0.3239 0.4478  110 ASN A CB  
650  C CG  . ASN A 110 ? 1.6040 1.1817 1.6716 -0.5205 -0.3403 0.4305  110 ASN A CG  
651  O OD1 . ASN A 110 ? 1.5943 1.2045 1.6771 -0.5151 -0.3350 0.4147  110 ASN A OD1 
652  N ND2 . ASN A 110 ? 1.5558 1.1089 1.6743 -0.5004 -0.3601 0.4336  110 ASN A ND2 
653  N N   . THR A 111 ? 1.9446 1.5256 1.7969 -0.6002 -0.3044 0.4612  111 THR A N   
654  C CA  . THR A 111 ? 2.0094 1.5806 1.7987 -0.6285 -0.2801 0.4800  111 THR A CA  
655  C C   . THR A 111 ? 2.1590 1.7928 1.9145 -0.6406 -0.2741 0.4574  111 THR A C   
656  O O   . THR A 111 ? 2.1803 1.8220 1.9072 -0.6635 -0.2529 0.4623  111 THR A O   
657  C CB  . THR A 111 ? 2.0436 1.5843 1.8102 -0.6292 -0.2812 0.4999  111 THR A CB  
658  O OG1 . THR A 111 ? 1.9099 1.3974 1.7186 -0.6136 -0.2913 0.5188  111 THR A OG1 
659  C CG2 . THR A 111 ? 2.0799 1.6001 1.7877 -0.6586 -0.2508 0.5251  111 THR A CG2 
660  N N   . LEU A 112 ? 1.3461 1.0231 1.1070 -0.6239 -0.2934 0.4327  112 LEU A N   
661  C CA  . LEU A 112 ? 1.4880 1.2264 1.2236 -0.6290 -0.2894 0.4108  112 LEU A CA  
662  C C   . LEU A 112 ? 1.4492 1.2122 1.2005 -0.6379 -0.2806 0.4001  112 LEU A C   
663  O O   . LEU A 112 ? 1.5382 1.3350 1.2608 -0.6560 -0.2644 0.3963  112 LEU A O   
664  C CB  . LEU A 112 ? 1.5821 1.3584 1.3320 -0.6018 -0.3163 0.3827  112 LEU A CB  
665  C CG  . LEU A 112 ? 1.7041 1.4828 1.4174 -0.5933 -0.3226 0.3848  112 LEU A CG  
666  C CD1 . LEU A 112 ? 1.8021 1.6212 1.5279 -0.5642 -0.3510 0.3523  112 LEU A CD1 
667  C CD2 . LEU A 112 ? 1.8167 1.6119 1.4718 -0.6154 -0.2933 0.3988  112 LEU A CD2 
668  N N   . VAL A 113 ? 1.7105 1.4573 1.5103 -0.6235 -0.2908 0.3961  113 VAL A N   
669  C CA  . VAL A 113 ? 1.6672 1.4357 1.4840 -0.6275 -0.2831 0.3864  113 VAL A CA  
670  C C   . VAL A 113 ? 1.6437 1.3891 1.4268 -0.6558 -0.2584 0.4064  113 VAL A C   
671  O O   . VAL A 113 ? 1.7222 1.5046 1.4840 -0.6733 -0.2468 0.3980  113 VAL A O   
672  C CB  . VAL A 113 ? 1.5217 1.2695 1.3984 -0.6030 -0.2949 0.3835  113 VAL A CB  
673  C CG1 . VAL A 113 ? 1.4750 1.2414 1.3632 -0.6062 -0.2838 0.3771  113 VAL A CG1 
674  C CG2 . VAL A 113 ? 1.5502 1.3252 1.4676 -0.5755 -0.3204 0.3593  113 VAL A CG2 
675  N N   . THR A 114 ? 1.8488 1.5319 1.6282 -0.6597 -0.2508 0.4332  114 THR A N   
676  C CA  . THR A 114 ? 1.8112 1.4635 1.5602 -0.6838 -0.2290 0.4521  114 THR A CA  
677  C C   . THR A 114 ? 1.9434 1.6145 1.6435 -0.7125 -0.2125 0.4564  114 THR A C   
678  O O   . THR A 114 ? 1.9501 1.6127 1.6259 -0.7362 -0.1952 0.4642  114 THR A O   
679  C CB  . THR A 114 ? 1.6761 1.2527 1.4264 -0.6802 -0.2232 0.4831  114 THR A CB  
680  O OG1 . THR A 114 ? 1.7250 1.2759 1.4361 -0.6975 -0.2120 0.5035  114 THR A OG1 
681  C CG2 . THR A 114 ? 1.5788 1.1358 1.3816 -0.6481 -0.2420 0.4834  114 THR A CG2 
682  N N   . LEU A 115 ? 1.3520 1.0482 1.0395 -0.7083 -0.2179 0.4511  115 LEU A N   
683  C CA  . LEU A 115 ? 1.4868 1.2053 1.1322 -0.7299 -0.2002 0.4560  115 LEU A CA  
684  C C   . LEU A 115 ? 1.5924 1.3761 1.2391 -0.7356 -0.1985 0.4329  115 LEU A C   
685  O O   . LEU A 115 ? 1.6057 1.4043 1.2321 -0.7603 -0.1797 0.4369  115 LEU A O   
686  C CB  . LEU A 115 ? 1.5668 1.2878 1.1960 -0.7174 -0.2062 0.4598  115 LEU A CB  
687  C CG  . LEU A 115 ? 1.6658 1.3840 1.2493 -0.7382 -0.1813 0.4784  115 LEU A CG  
688  C CD1 . LEU A 115 ? 1.5673 1.2187 1.1365 -0.7492 -0.1688 0.5094  115 LEU A CD1 
689  C CD2 . LEU A 115 ? 1.7703 1.5228 1.3356 -0.7211 -0.1874 0.4704  115 LEU A CD2 
690  N N   . GLU A 116 ? 2.0545 1.8766 1.7283 -0.7123 -0.2182 0.4091  116 GLU A N   
691  C CA  . GLU A 116 ? 2.0668 1.9513 1.7453 -0.7140 -0.2178 0.3877  116 GLU A CA  
692  C C   . GLU A 116 ? 2.0134 1.9011 1.7005 -0.7327 -0.2075 0.3869  116 GLU A C   
693  O O   . GLU A 116 ? 2.0298 1.9462 1.7013 -0.7544 -0.1926 0.3864  116 GLU A O   
694  C CB  . GLU A 116 ? 2.0676 1.9828 1.7790 -0.6840 -0.2413 0.3633  116 GLU A CB  
695  C CG  . GLU A 116 ? 2.1028 2.0841 1.8110 -0.6815 -0.2407 0.3431  116 GLU A CG  
696  C CD  . GLU A 116 ? 2.1398 2.1463 1.8621 -0.6508 -0.2626 0.3224  116 GLU A CD  
697  O OE1 . GLU A 116 ? 2.1200 2.0969 1.8704 -0.6315 -0.2810 0.3191  116 GLU A OE1 
698  O OE2 . GLU A 116 ? 2.1913 2.2455 1.8980 -0.6450 -0.2614 0.3100  116 GLU A OE2 
699  N N   . ALA A 117 ? 1.4937 1.3516 1.2079 -0.7224 -0.2156 0.3871  117 ALA A N   
700  C CA  . ALA A 117 ? 1.4460 1.3013 1.1664 -0.7348 -0.2084 0.3859  117 ALA A CA  
701  C C   . ALA A 117 ? 1.4696 1.3179 1.1563 -0.7683 -0.1886 0.3984  117 ALA A C   
702  O O   . ALA A 117 ? 1.4862 1.3790 1.1710 -0.7840 -0.1821 0.3875  117 ALA A O   
703  C CB  . ALA A 117 ? 1.3098 1.1090 1.0486 -0.7204 -0.2129 0.3975  117 ALA A CB  
704  N N   . LEU A 118 ? 1.7689 1.5612 1.4323 -0.7790 -0.1785 0.4220  118 LEU A N   
705  C CA  . LEU A 118 ? 1.7884 1.5672 1.4212 -0.8108 -0.1579 0.4360  118 LEU A CA  
706  C C   . LEU A 118 ? 1.8453 1.6827 1.4702 -0.8245 -0.1484 0.4273  118 LEU A C   
707  O O   . LEU A 118 ? 1.8541 1.7134 1.4777 -0.8474 -0.1379 0.4234  118 LEU A O   
708  C CB  . LEU A 118 ? 1.7966 1.5165 1.4042 -0.8153 -0.1477 0.4630  118 LEU A CB  
709  C CG  . LEU A 118 ? 1.8478 1.5545 1.4242 -0.8469 -0.1233 0.4794  118 LEU A CG  
710  C CD1 . LEU A 118 ? 1.7864 1.4491 1.3543 -0.8649 -0.1158 0.4875  118 LEU A CD1 
711  C CD2 . LEU A 118 ? 1.8792 1.5540 1.4315 -0.8457 -0.1128 0.5022  118 LEU A CD2 
712  N N   . CYS A 119 ? 1.6613 1.5229 1.2822 -0.8087 -0.1524 0.4247  119 CYS A N   
713  C CA  . CYS A 119 ? 1.7179 1.6353 1.3309 -0.8140 -0.1428 0.4182  119 CYS A CA  
714  C C   . CYS A 119 ? 1.7023 1.6738 1.3383 -0.8181 -0.1467 0.3978  119 CYS A C   
715  O O   . CYS A 119 ? 1.6954 1.6971 1.3294 -0.8390 -0.1316 0.3988  119 CYS A O   
716  C CB  . CYS A 119 ? 1.7648 1.7007 1.3719 -0.7863 -0.1536 0.4127  119 CYS A CB  
717  S SG  . CYS A 119 ? 1.8276 1.7346 1.3966 -0.7873 -0.1376 0.4371  119 CYS A SG  
718  N N   . GLY A 120 ? 2.0539 2.0385 1.7152 -0.7972 -0.1662 0.3802  120 GLY A N   
719  C CA  . GLY A 120 ? 2.0490 2.0854 1.7330 -0.7981 -0.1704 0.3612  120 GLY A CA  
720  C C   . GLY A 120 ? 2.0284 2.0644 1.7140 -0.8273 -0.1594 0.3637  120 GLY A C   
721  O O   . GLY A 120 ? 2.0055 2.0859 1.6955 -0.8433 -0.1500 0.3593  120 GLY A O   
722  N N   . MET A 121 ? 2.1120 1.3651 1.2864 -0.4907 -0.5694 0.1992  121 MET A N   
723  C CA  . MET A 121 ? 2.0521 1.4263 1.2675 -0.5028 -0.5351 0.1648  121 MET A CA  
724  C C   . MET A 121 ? 2.0332 1.3996 1.2623 -0.5016 -0.4923 0.1151  121 MET A C   
725  O O   . MET A 121 ? 1.9980 1.4191 1.2361 -0.4973 -0.4653 0.0865  121 MET A O   
726  C CB  . MET A 121 ? 2.0299 1.5056 1.2906 -0.5297 -0.5377 0.1704  121 MET A CB  
727  N N   . LEU A 122 ? 2.0855 1.3851 1.3177 -0.5054 -0.4857 0.1057  122 LEU A N   
728  C CA  . LEU A 122 ? 2.0789 1.3566 1.3229 -0.5019 -0.4461 0.0626  122 LEU A CA  
729  C C   . LEU A 122 ? 2.0802 1.3036 1.2859 -0.4762 -0.4390 0.0536  122 LEU A C   
730  O O   . LEU A 122 ? 2.0565 1.3176 1.2775 -0.4735 -0.4037 0.0161  122 LEU A O   
731  C CB  . LEU A 122 ? 2.0214 1.2107 1.2623 -0.5034 -0.4482 0.0657  122 LEU A CB  
732  C CG  . LEU A 122 ? 2.0084 1.2417 1.2906 -0.5286 -0.4486 0.0689  122 LEU A CG  
733  C CD1 . LEU A 122 ? 1.9271 1.0817 1.2130 -0.5281 -0.4365 0.0601  122 LEU A CD1 
734  C CD2 . LEU A 122 ? 2.0344 1.3980 1.3713 -0.5494 -0.4164 0.0354  122 LEU A CD2 
735  N N   . GLY A 123 ? 2.3265 1.4592 1.4827 -0.4575 -0.4725 0.0878  123 GLY A N   
736  C CA  . GLY A 123 ? 2.3349 1.4122 1.4513 -0.4322 -0.4699 0.0838  123 GLY A CA  
737  C C   . GLY A 123 ? 2.3171 1.4911 1.4467 -0.4310 -0.4543 0.0699  123 GLY A C   
738  O O   . GLY A 123 ? 2.3002 1.4806 1.4279 -0.4205 -0.4257 0.0392  123 GLY A O   
739  N N   . LEU A 124 ? 1.6336 0.8860 0.7776 -0.4419 -0.4732 0.0936  124 LEU A N   
740  C CA  . LEU A 124 ? 1.5891 0.9473 0.7495 -0.4430 -0.4597 0.0836  124 LEU A CA  
741  C C   . LEU A 124 ? 1.5515 0.9924 0.7540 -0.4562 -0.4137 0.0320  124 LEU A C   
742  O O   . LEU A 124 ? 1.5293 1.0069 0.7312 -0.4474 -0.3907 0.0080  124 LEU A O   
743  C CB  . LEU A 124 ? 1.5761 1.0195 0.7560 -0.4577 -0.4838 0.1153  124 LEU A CB  
744  C CG  . LEU A 124 ? 1.5347 1.0843 0.7262 -0.4557 -0.4738 0.1115  124 LEU A CG  
745  C CD1 . LEU A 124 ? 1.5566 1.0441 0.7025 -0.4290 -0.4950 0.1405  124 LEU A CD1 
746  C CD2 . LEU A 124 ? 1.5095 1.1772 0.7370 -0.4765 -0.4842 0.1289  124 LEU A CD2 
747  N N   . ALA A 125 ? 1.6684 1.1397 0.9091 -0.4779 -0.4001 0.0150  125 ALA A N   
748  C CA  . ALA A 125 ? 1.6413 1.1897 0.9278 -0.4933 -0.3553 -0.0353 125 ALA A CA  
749  C C   . ALA A 125 ? 1.6548 1.1402 0.9272 -0.4764 -0.3260 -0.0679 125 ALA A C   
750  O O   . ALA A 125 ? 1.6325 1.1830 0.9266 -0.4787 -0.2920 -0.1055 125 ALA A O   
751  C CB  . ALA A 125 ? 1.6481 1.2123 0.9731 -0.5162 -0.3479 -0.0441 125 ALA A CB  
752  N N   . VAL A 126 ? 1.9489 1.3089 1.1851 -0.4598 -0.3392 -0.0533 126 VAL A N   
753  C CA  . VAL A 126 ? 1.9659 1.2569 1.1858 -0.4420 -0.3139 -0.0801 126 VAL A CA  
754  C C   . VAL A 126 ? 1.9568 1.2390 1.1413 -0.4199 -0.3164 -0.0777 126 VAL A C   
755  O O   . VAL A 126 ? 1.9501 1.2484 1.1413 -0.4129 -0.2837 -0.1125 126 VAL A O   
756  C CB  . VAL A 126 ? 1.9984 1.1597 1.1880 -0.4301 -0.3292 -0.0625 126 VAL A CB  
757  C CG1 . VAL A 126 ? 1.9793 1.0660 1.1448 -0.4080 -0.3077 -0.0841 126 VAL A CG1 
758  C CG2 . VAL A 126 ? 1.9608 1.1299 1.1896 -0.4506 -0.3186 -0.0709 126 VAL A CG2 
759  N N   . ALA A 127 ? 2.0022 1.2584 1.1505 -0.4088 -0.3547 -0.0360 127 ALA A N   
760  C CA  . ALA A 127 ? 1.9957 1.2435 1.1104 -0.3874 -0.3603 -0.0282 127 ALA A CA  
761  C C   . ALA A 127 ? 1.9518 1.3269 1.0989 -0.3964 -0.3338 -0.0547 127 ALA A C   
762  O O   . ALA A 127 ? 1.9454 1.3258 1.0850 -0.3837 -0.3102 -0.0795 127 ALA A O   
763  C CB  . ALA A 127 ? 2.0126 1.2219 1.0922 -0.3777 -0.4054 0.0226  127 ALA A CB  
764  N N   . ALA A 128 ? 1.8478 1.3275 1.0309 -0.4186 -0.3378 -0.0492 128 ALA A N   
765  C CA  . ALA A 128 ? 1.8062 1.4202 1.0241 -0.4309 -0.3136 -0.0741 128 ALA A CA  
766  C C   . ALA A 128 ? 1.8018 1.4406 1.0447 -0.4342 -0.2665 -0.1292 128 ALA A C   
767  O O   . ALA A 128 ? 1.7889 1.4628 1.0266 -0.4241 -0.2484 -0.1477 128 ALA A O   
768  C CB  . ALA A 128 ? 1.7825 1.4990 1.0418 -0.4581 -0.3198 -0.0675 128 ALA A CB  
769  N N   . SER A 129 ? 1.7576 1.3790 1.0295 -0.4483 -0.2462 -0.1546 129 SER A N   
770  C CA  . SER A 129 ? 1.7623 1.4068 1.0652 -0.4536 -0.1992 -0.2077 129 SER A CA  
771  C C   . SER A 129 ? 1.7818 1.3529 1.0487 -0.4269 -0.1881 -0.2180 129 SER A C   
772  O O   . SER A 129 ? 1.7719 1.4011 1.0526 -0.4257 -0.1582 -0.2513 129 SER A O   
773  C CB  . SER A 129 ? 1.7889 1.3888 1.1186 -0.4661 -0.1847 -0.2231 129 SER A CB  
774  O OG  . SER A 129 ? 1.7816 1.4016 1.1249 -0.4831 -0.2098 -0.1964 129 SER A OG  
775  N N   . LEU A 130 ? 1.4283 0.8731 0.6494 -0.4059 -0.2120 -0.1900 130 LEU A N   
776  C CA  . LEU A 130 ? 1.4481 0.8160 0.6299 -0.3789 -0.2059 -0.1948 130 LEU A CA  
777  C C   . LEU A 130 ? 1.4219 0.8523 0.5892 -0.3692 -0.2090 -0.1902 130 LEU A C   
778  O O   . LEU A 130 ? 1.4171 0.8874 0.5950 -0.3652 -0.1777 -0.2240 130 LEU A O   
779  C CB  . LEU A 130 ? 1.4821 0.7139 0.6132 -0.3589 -0.2389 -0.1583 130 LEU A CB  
780  C CG  . LEU A 130 ? 1.5134 0.6776 0.6573 -0.3647 -0.2290 -0.1679 130 LEU A CG  
781  C CD1 . LEU A 130 ? 1.5462 0.5923 0.6441 -0.3505 -0.2670 -0.1278 130 LEU A CD1 
782  C CD2 . LEU A 130 ? 1.5335 0.6759 0.6906 -0.3572 -0.1867 -0.2100 130 LEU A CD2 
783  N N   . ILE A 131 ? 1.8238 1.2660 0.9696 -0.3659 -0.2460 -0.1479 131 ILE A N   
784  C CA  . ILE A 131 ? 1.7989 1.3091 0.9348 -0.3576 -0.2505 -0.1383 131 ILE A CA  
785  C C   . ILE A 131 ? 1.7700 1.4076 0.9506 -0.3737 -0.2115 -0.1822 131 ILE A C   
786  O O   . ILE A 131 ? 1.7696 1.4206 0.9427 -0.3615 -0.1900 -0.2042 131 ILE A O   
787  C CB  . ILE A 131 ? 1.7827 1.3327 0.9132 -0.3624 -0.2885 -0.0917 131 ILE A CB  
788  C CG1 . ILE A 131 ? 1.8183 1.2484 0.9104 -0.3508 -0.3274 -0.0495 131 ILE A CG1 
789  C CG2 . ILE A 131 ? 1.7620 1.3698 0.8785 -0.3494 -0.2936 -0.0774 131 ILE A CG2 
790  C CD1 . ILE A 131 ? 1.8440 1.1763 0.8830 -0.3206 -0.3436 -0.0286 131 ILE A CD1 
791  N N   . TYR A 132 ? 1.3480 1.0805 0.5755 -0.4016 -0.2021 -0.1959 132 TYR A N   
792  C CA  . TYR A 132 ? 1.3222 1.1838 0.5951 -0.4198 -0.1653 -0.2392 132 TYR A CA  
793  C C   . TYR A 132 ? 1.3473 1.1831 0.6316 -0.4156 -0.1232 -0.2885 132 TYR A C   
794  O O   . TYR A 132 ? 1.3395 1.2427 0.6346 -0.4144 -0.0975 -0.3172 132 TYR A O   
795  C CB  . TYR A 132 ? 1.3018 1.2570 0.6250 -0.4516 -0.1593 -0.2505 132 TYR A CB  
796  C CG  . TYR A 132 ? 1.2850 1.3648 0.6583 -0.4723 -0.1164 -0.3033 132 TYR A CG  
797  C CD1 . TYR A 132 ? 1.2466 1.4651 0.6432 -0.4869 -0.1156 -0.3044 132 TYR A CD1 
798  C CD2 . TYR A 132 ? 1.3122 1.3723 0.7104 -0.4770 -0.0758 -0.3521 132 TYR A CD2 
799  C CE1 . TYR A 132 ? 1.2351 1.5703 0.6774 -0.5068 -0.0759 -0.3551 132 TYR A CE1 
800  C CE2 . TYR A 132 ? 1.3051 1.4778 0.7507 -0.4966 -0.0352 -0.4028 132 TYR A CE2 
801  C CZ  . TYR A 132 ? 1.2663 1.5769 0.7332 -0.5120 -0.0356 -0.4052 132 TYR A CZ  
802  O OH  . TYR A 132 ? 1.2628 1.6887 0.7773 -0.5328 0.0052  -0.4579 132 TYR A OH  
803  N N   . ALA A 133 ? 1.5230 1.2640 0.8069 -0.4135 -0.1156 -0.2979 133 ALA A N   
804  C CA  . ALA A 133 ? 1.5539 1.2636 0.8516 -0.4092 -0.0752 -0.3424 133 ALA A CA  
805  C C   . ALA A 133 ? 1.5648 1.2313 0.8232 -0.3820 -0.0716 -0.3431 133 ALA A C   
806  O O   . ALA A 133 ? 1.5703 1.2884 0.8480 -0.3830 -0.0367 -0.3822 133 ALA A O   
807  C CB  . ALA A 133 ? 1.5903 1.1931 0.8871 -0.4070 -0.0738 -0.3415 133 ALA A CB  
808  N N   . ARG A 134 ? 1.7250 1.2975 0.9291 -0.3581 -0.1071 -0.3007 134 ARG A N   
809  C CA  . ARG A 134 ? 1.7360 1.2640 0.9005 -0.3313 -0.1059 -0.2983 134 ARG A CA  
810  C C   . ARG A 134 ? 1.7032 1.3301 0.8659 -0.3300 -0.1101 -0.2912 134 ARG A C   
811  O O   . ARG A 134 ? 1.7095 1.3458 0.8601 -0.3158 -0.0929 -0.3075 134 ARG A O   
812  C CB  . ARG A 134 ? 1.7601 1.1489 0.8673 -0.3054 -0.1392 -0.2593 134 ARG A CB  
813  C CG  . ARG A 134 ? 1.7615 1.1047 0.8578 -0.3115 -0.1767 -0.2196 134 ARG A CG  
814  C CD  . ARG A 134 ? 1.7968 0.9980 0.8395 -0.2863 -0.2011 -0.1923 134 ARG A CD  
815  N NE  . ARG A 134 ? 1.8002 0.9752 0.8041 -0.2614 -0.2057 -0.1838 134 ARG A NE  
816  C CZ  . ARG A 134 ? 1.8327 0.9006 0.7955 -0.2367 -0.2077 -0.1811 134 ARG A CZ  
817  N NH1 . ARG A 134 ? 1.8643 0.8422 0.8189 -0.2334 -0.2055 -0.1858 134 ARG A NH1 
818  N NH2 . ARG A 134 ? 1.8345 0.8877 0.7649 -0.2151 -0.2112 -0.1735 134 ARG A NH2 
819  N N   . PHE A 135 ? 1.8268 1.5309 1.0030 -0.3449 -0.1320 -0.2665 135 PHE A N   
820  C CA  . PHE A 135 ? 1.7948 1.5942 0.9689 -0.3427 -0.1394 -0.2527 135 PHE A CA  
821  C C   . PHE A 135 ? 1.7773 1.7085 0.9956 -0.3602 -0.0998 -0.2997 135 PHE A C   
822  O O   . PHE A 135 ? 1.7682 1.7504 0.9781 -0.3503 -0.0912 -0.3045 135 PHE A O   
823  C CB  . PHE A 135 ? 1.7686 1.6093 0.9439 -0.3522 -0.1761 -0.2081 135 PHE A CB  
824  C CG  . PHE A 135 ? 1.7451 1.6473 0.9045 -0.3411 -0.1932 -0.1778 135 PHE A CG  
825  C CD1 . PHE A 135 ? 1.7632 1.5800 0.8738 -0.3116 -0.2129 -0.1475 135 PHE A CD1 
826  C CD2 . PHE A 135 ? 1.7070 1.7543 0.9013 -0.3600 -0.1889 -0.1792 135 PHE A CD2 
827  C CE1 . PHE A 135 ? 1.7453 1.6181 0.8437 -0.3005 -0.2273 -0.1179 135 PHE A CE1 
828  C CE2 . PHE A 135 ? 1.6872 1.7946 0.8688 -0.3490 -0.2040 -0.1487 135 PHE A CE2 
829  C CZ  . PHE A 135 ? 1.7072 1.7257 0.8414 -0.3189 -0.2229 -0.1173 135 PHE A CZ  
830  N N   . THR A 136 ? 1.9564 1.9429 1.2227 -0.3866 -0.0750 -0.3352 136 THR A N   
831  C CA  . THR A 136 ? 1.9415 2.0628 1.2548 -0.4074 -0.0379 -0.3815 136 THR A CA  
832  C C   . THR A 136 ? 1.9769 2.0794 1.3002 -0.4019 0.0041  -0.4309 136 THR A C   
833  O O   . THR A 136 ? 1.9951 2.1314 1.3627 -0.4215 0.0387  -0.4758 136 THR A O   
834  C CB  . THR A 136 ? 1.9258 2.1325 1.2920 -0.4409 -0.0274 -0.4008 136 THR A CB  
835  O OG1 . THR A 136 ? 1.9548 2.0660 1.3268 -0.4443 -0.0254 -0.4054 136 THR A OG1 
836  C CG2 . THR A 136 ? 1.8843 2.1600 1.2501 -0.4502 -0.0625 -0.3585 136 THR A CG2 
837  N N   . ARG A 137 ? 2.3786 2.4280 1.6623 -0.3752 0.0019  -0.4224 137 ARG A N   
838  C CA  . ARG A 137 ? 2.4145 2.4523 1.7053 -0.3679 0.0407  -0.4666 137 ARG A CA  
839  C C   . ARG A 137 ? 2.4041 2.5121 1.6817 -0.3571 0.0461  -0.4686 137 ARG A C   
840  O O   . ARG A 137 ? 2.3921 2.4622 1.6257 -0.3347 0.0171  -0.4278 137 ARG A O   
841  C CB  . ARG A 137 ? 2.4547 2.3384 1.7069 -0.3423 0.0361  -0.4573 137 ARG A CB  
842  C CG  . ARG A 137 ? 2.4690 2.2704 1.7256 -0.3481 0.0265  -0.4479 137 ARG A CG  
843  C CD  . ARG A 137 ? 2.5041 2.1603 1.7142 -0.3196 0.0161  -0.4312 137 ARG A CD  
844  N NE  . ARG A 137 ? 2.5260 2.0969 1.7400 -0.3233 0.0106  -0.4249 137 ARG A NE  
845  C CZ  . ARG A 137 ? 2.5640 2.0134 1.7497 -0.3032 0.0110  -0.4208 137 ARG A CZ  
846  N NH1 . ARG A 137 ? 2.5842 1.9836 1.7359 -0.2784 0.0168  -0.4235 137 ARG A NH1 
847  N NH2 . ARG A 137 ? 2.5827 1.9635 1.7746 -0.3079 0.0058  -0.4136 137 ARG A NH2 
848  N N   . PRO A 138 ? 1.1171 1.4406 1.4975 -0.4161 -0.0145 -0.1153 138 PRO A N   
849  C CA  . PRO A 138 ? 1.0903 1.3747 1.4412 -0.3822 0.0088  -0.1489 138 PRO A CA  
850  C C   . PRO A 138 ? 1.1340 1.4008 1.4344 -0.3739 0.0115  -0.1847 138 PRO A C   
851  O O   . PRO A 138 ? 1.0717 1.3567 1.3611 -0.3931 -0.0027 -0.1822 138 PRO A O   
852  C CB  . PRO A 138 ? 0.9015 1.2244 1.2961 -0.3506 0.0363  -0.1298 138 PRO A CB  
853  C CG  . PRO A 138 ? 0.8928 1.2632 1.3437 -0.3657 0.0305  -0.0830 138 PRO A CG  
854  C CD  . PRO A 138 ? 0.9512 1.3375 1.3959 -0.4023 0.0004  -0.0755 138 PRO A CD  
855  N N   . THR A 139 ? 1.1835 1.4189 1.4554 -0.3457 0.0295  -0.2143 139 THR A N   
856  C CA  . THR A 139 ? 1.2015 1.4331 1.4361 -0.3316 0.0385  -0.2424 139 THR A CA  
857  C C   . THR A 139 ? 1.0692 1.3135 1.3176 -0.2956 0.0635  -0.2498 139 THR A C   
858  O O   . THR A 139 ? 1.0882 1.3046 1.3348 -0.2793 0.0719  -0.2566 139 THR A O   
859  C CB  . THR A 139 ? 1.4292 1.5980 1.5993 -0.3371 0.0321  -0.2732 139 THR A CB  
860  O OG1 . THR A 139 ? 1.4827 1.6041 1.6450 -0.3320 0.0327  -0.2776 139 THR A OG1 
861  C CG2 . THR A 139 ? 1.5883 1.7409 1.7262 -0.3764 0.0048  -0.2704 139 THR A CG2 
862  N N   . ALA A 140 ? 1.1979 1.4825 1.4582 -0.2857 0.0730  -0.2463 140 ALA A N   
863  C CA  . ALA A 140 ? 1.0982 1.3932 1.3649 -0.2578 0.0917  -0.2522 140 ALA A CA  
864  C C   . ALA A 140 ? 1.1945 1.4576 1.4320 -0.2405 0.0990  -0.2779 140 ALA A C   
865  O O   . ALA A 140 ? 1.3153 1.5630 1.5182 -0.2432 0.0976  -0.2967 140 ALA A O   
866  C CB  . ALA A 140 ? 1.0173 1.3506 1.2858 -0.2560 0.0967  -0.2498 140 ALA A CB  
867  N N   . GLY A 141 ? 1.2638 1.5142 1.5122 -0.2210 0.1081  -0.2770 141 GLY A N   
868  C CA  . GLY A 141 ? 1.3574 1.5813 1.5844 -0.1999 0.1168  -0.2962 141 GLY A CA  
869  C C   . GLY A 141 ? 1.3144 1.5722 1.5390 -0.1831 0.1285  -0.3038 141 GLY A C   
870  O O   . GLY A 141 ? 1.3218 1.5808 1.5497 -0.1598 0.1387  -0.3076 141 GLY A O   
871  N N   . VAL A 142 ? 1.1340 1.4229 1.3554 -0.1957 0.1263  -0.3028 142 VAL A N   
872  C CA  . VAL A 142 ? 1.0690 1.4000 1.2960 -0.1852 0.1357  -0.3028 142 VAL A CA  
873  C C   . VAL A 142 ? 1.1883 1.5192 1.3879 -0.1725 0.1473  -0.3203 142 VAL A C   
874  O O   . VAL A 142 ? 1.3127 1.6195 1.4786 -0.1833 0.1445  -0.3328 142 VAL A O   
875  C CB  . VAL A 142 ? 0.9722 1.3375 1.2097 -0.2037 0.1294  -0.2894 142 VAL A CB  
876  C CG1 . VAL A 142 ? 0.9106 1.3176 1.1548 -0.1967 0.1367  -0.2858 142 VAL A CG1 
877  C CG2 . VAL A 142 ? 0.8858 1.2459 1.1448 -0.2107 0.1239  -0.2705 142 VAL A CG2 
878  N N   . LEU A 143 ? 1.0530 1.4112 1.2658 -0.1496 0.1605  -0.3184 143 LEU A N   
879  C CA  . LEU A 143 ? 1.0615 1.4295 1.2551 -0.1301 0.1783  -0.3295 143 LEU A CA  
880  C C   . LEU A 143 ? 1.0745 1.5064 1.2868 -0.1332 0.1831  -0.3177 143 LEU A C   
881  O O   . LEU A 143 ? 0.9405 1.4097 1.1863 -0.1370 0.1770  -0.2999 143 LEU A O   
882  C CB  . LEU A 143 ? 1.1262 1.4828 1.3268 -0.0969 0.1927  -0.3308 143 LEU A CB  
883  C CG  . LEU A 143 ? 1.2373 1.6147 1.4277 -0.0678 0.2176  -0.3350 143 LEU A CG  
884  C CD1 . LEU A 143 ? 1.4684 1.7861 1.5965 -0.0641 0.2281  -0.3591 143 LEU A CD1 
885  C CD2 . LEU A 143 ? 1.2521 1.6404 1.4691 -0.0335 0.2304  -0.3249 143 LEU A CD2 
886  N N   . PHE A 144 ? 1.1784 1.6180 1.3635 -0.1337 0.1933  -0.3269 144 PHE A N   
887  C CA  . PHE A 144 ? 1.1094 1.6098 1.3101 -0.1385 0.1987  -0.3146 144 PHE A CA  
888  C C   . PHE A 144 ? 1.1754 1.7104 1.3852 -0.1075 0.2236  -0.3107 144 PHE A C   
889  O O   . PHE A 144 ? 1.3508 1.8526 1.5276 -0.0838 0.2430  -0.3261 144 PHE A O   
890  C CB  . PHE A 144 ? 1.1733 1.6683 1.3403 -0.1600 0.1948  -0.3226 144 PHE A CB  
891  C CG  . PHE A 144 ? 1.1026 1.5791 1.2695 -0.1898 0.1714  -0.3189 144 PHE A CG  
892  C CD1 . PHE A 144 ? 1.1712 1.5948 1.3197 -0.1977 0.1603  -0.3285 144 PHE A CD1 
893  C CD2 . PHE A 144 ? 0.9842 1.4959 1.1695 -0.2096 0.1610  -0.3027 144 PHE A CD2 
894  C CE1 . PHE A 144 ? 1.1058 1.5227 1.2629 -0.2228 0.1408  -0.3187 144 PHE A CE1 
895  C CE2 . PHE A 144 ? 0.9327 1.4293 1.1203 -0.2312 0.1437  -0.2954 144 PHE A CE2 
896  C CZ  . PHE A 144 ? 0.9858 1.4401 1.1636 -0.2368 0.1342  -0.3018 144 PHE A CZ  
897  N N   . SER A 145 ? 1.0751 1.6751 1.3273 -0.1077 0.2234  -0.2878 145 SER A N   
898  C CA  . SER A 145 ? 1.1272 1.7786 1.3987 -0.0807 0.2474  -0.2758 145 SER A CA  
899  C C   . SER A 145 ? 1.2858 1.9281 1.5141 -0.0737 0.2685  -0.2903 145 SER A C   
900  O O   . SER A 145 ? 1.2757 1.9180 1.4831 -0.1007 0.2588  -0.2944 145 SER A O   
901  C CB  . SER A 145 ? 0.9857 1.7136 1.3059 -0.0954 0.2375  -0.2451 145 SER A CB  
902  O OG  . SER A 145 ? 0.9223 1.6606 1.2320 -0.1300 0.2222  -0.2423 145 SER A OG  
903  N N   . SER A 146 ? 1.1482 1.7771 1.3579 -0.0359 0.2985  -0.2975 146 SER A N   
904  C CA  . SER A 146 ? 1.2130 1.8174 1.3666 -0.0248 0.3227  -0.3138 146 SER A CA  
905  C C   . SER A 146 ? 1.1654 1.8424 1.3365 -0.0360 0.3306  -0.2957 146 SER A C   
906  O O   . SER A 146 ? 1.3082 1.9662 1.4297 -0.0418 0.3412  -0.3083 146 SER A O   
907  C CB  . SER A 146 ? 1.4263 2.0023 1.5566 0.0254  0.3593  -0.3207 146 SER A CB  
908  O OG  . SER A 146 ? 1.3347 1.9877 1.5322 0.0533  0.3747  -0.2903 146 SER A OG  
909  N N   . ARG A 147 ? 1.4828 2.2402 1.7208 -0.0419 0.3235  -0.2648 147 ARG A N   
910  C CA  . ARG A 147 ? 1.4417 2.2735 1.7023 -0.0547 0.3296  -0.2423 147 ARG A CA  
911  C C   . ARG A 147 ? 1.2385 2.1057 1.5348 -0.0976 0.2943  -0.2239 147 ARG A C   
912  O O   . ARG A 147 ? 1.1249 1.9718 1.4389 -0.1102 0.2696  -0.2228 147 ARG A O   
913  C CB  . ARG A 147 ? 1.4690 2.3770 1.7778 -0.0193 0.3595  -0.2133 147 ARG A CB  
914  C CG  . ARG A 147 ? 1.7106 2.5909 1.9811 0.0300  0.4043  -0.2258 147 ARG A CG  
915  C CD  . ARG A 147 ? 1.8794 2.7396 2.0886 0.0258  0.4235  -0.2409 147 ARG A CD  
916  N NE  . ARG A 147 ? 2.1665 2.9669 2.3137 0.0717  0.4647  -0.2612 147 ARG A NE  
917  C CZ  . ARG A 147 ? 2.3145 3.0126 2.4007 0.0816  0.4625  -0.2941 147 ARG A CZ  
918  N NH1 . ARG A 147 ? 2.1778 2.8341 2.2669 0.0498  0.4224  -0.3073 147 ARG A NH1 
919  N NH2 . ARG A 147 ? 2.6192 3.2533 2.6380 0.1234  0.5013  -0.3121 147 ARG A NH2 
920  N N   . MET A 148 ? 1.5176 2.4319 1.8181 -0.1191 0.2937  -0.2092 148 MET A N   
921  C CA  . MET A 148 ? 1.3664 2.3228 1.7017 -0.1559 0.2654  -0.1845 148 MET A CA  
922  C C   . MET A 148 ? 1.3473 2.3961 1.7364 -0.1480 0.2781  -0.1478 148 MET A C   
923  O O   . MET A 148 ? 1.4509 2.5325 1.8482 -0.1128 0.3125  -0.1424 148 MET A O   
924  C CB  . MET A 148 ? 1.3756 2.3186 1.6773 -0.1895 0.2527  -0.1899 148 MET A CB  
925  C CG  . MET A 148 ? 1.4504 2.3166 1.6969 -0.1922 0.2489  -0.2223 148 MET A CG  
926  S SD  . MET A 148 ? 1.4205 2.2738 1.6415 -0.2350 0.2247  -0.2203 148 MET A SD  
927  C CE  . MET A 148 ? 1.2547 2.1009 1.5069 -0.2578 0.1933  -0.2044 148 MET A CE  
928  N N   . VAL A 149 ? 1.3889 2.4781 1.8127 -0.1808 0.2508  -0.1203 149 VAL A N   
929  C CA  . VAL A 149 ? 1.3717 2.5563 1.8498 -0.1843 0.2560  -0.0790 149 VAL A CA  
930  C C   . VAL A 149 ? 1.3210 2.5249 1.7987 -0.2351 0.2264  -0.0595 149 VAL A C   
931  O O   . VAL A 149 ? 1.2773 2.4218 1.7248 -0.2636 0.1976  -0.0722 149 VAL A O   
932  C CB  . VAL A 149 ? 1.3128 2.5359 1.8456 -0.1703 0.2488  -0.0543 149 VAL A CB  
933  C CG1 . VAL A 149 ? 1.3526 2.5201 1.8706 -0.1288 0.2651  -0.0813 149 VAL A CG1 
934  C CG2 . VAL A 149 ? 1.2197 2.4304 1.7594 -0.2139 0.2042  -0.0399 149 VAL A CG2 
935  N N   . ILE A 150 ? 0.9128 2.1970 1.4212 -0.2449 0.2358  -0.0274 150 ILE A N   
936  C CA  . ILE A 150 ? 0.8867 2.1948 1.3989 -0.2955 0.2058  -0.0018 150 ILE A CA  
937  C C   . ILE A 150 ? 0.8496 2.2446 1.4284 -0.3070 0.1935  0.0459  150 ILE A C   
938  O O   . ILE A 150 ? 0.8711 2.3506 1.4994 -0.2820 0.2207  0.0726  150 ILE A O   
939  C CB  . ILE A 150 ? 0.8651 2.1942 1.3551 -0.3076 0.2210  0.0003  150 ILE A CB  
940  C CG1 . ILE A 150 ? 0.9105 2.1530 1.3341 -0.3002 0.2274  -0.0440 150 ILE A CG1 
941  C CG2 . ILE A 150 ? 0.8583 2.2113 1.3523 -0.3615 0.1890  0.0305  150 ILE A CG2 
942  C CD1 . ILE A 150 ? 0.9935 2.2430 1.3855 -0.3174 0.2357  -0.0438 150 ILE A CD1 
943  N N   . SER A 151 ? 1.3660 2.7383 1.9441 -0.3436 0.1526  0.0584  151 SER A N   
944  C CA  . SER A 151 ? 1.3464 2.7947 1.9834 -0.3617 0.1322  0.1056  151 SER A CA  
945  C C   . SER A 151 ? 1.3676 2.7751 1.9751 -0.4206 0.0826  0.1190  151 SER A C   
946  O O   . SER A 151 ? 1.3874 2.6982 1.9307 -0.4356 0.0682  0.0877  151 SER A O   
947  C CB  . SER A 151 ? 1.3066 2.7637 1.9788 -0.3227 0.1403  0.1056  151 SER A CB  
948  O OG  . SER A 151 ? 1.2868 2.6690 1.9277 -0.3422 0.1061  0.0922  151 SER A OG  
949  N N   . ASP A 152 ? 1.4271 2.9075 2.0797 -0.4538 0.0571  0.1683  152 ASP A N   
950  C CA  . ASP A 152 ? 1.4998 2.9382 2.1171 -0.5145 0.0071  0.1857  152 ASP A CA  
951  C C   . ASP A 152 ? 1.5044 2.8648 2.0903 -0.5145 -0.0168 0.1689  152 ASP A C   
952  O O   . ASP A 152 ? 1.4646 2.8653 2.0964 -0.4940 -0.0176 0.1840  152 ASP A O   
953  C CB  . ASP A 152 ? 1.5362 3.0809 2.2139 -0.5535 -0.0169 0.2483  152 ASP A CB  
954  C CG  . ASP A 152 ? 1.5763 3.1776 2.2648 -0.5762 -0.0072 0.2699  152 ASP A CG  
955  O OD1 . ASP A 152 ? 1.5488 3.1506 2.2293 -0.5411 0.0335  0.2436  152 ASP A OD1 
956  O OD2 . ASP A 152 ? 1.6534 3.2956 2.3541 -0.6319 -0.0420 0.3141  152 ASP A OD2 
957  N N   . PHE A 153 ? 1.5590 2.8067 2.0653 -0.5357 -0.0345 0.1395  153 PHE A N   
958  C CA  . PHE A 153 ? 1.6059 2.7722 2.0704 -0.5455 -0.0610 0.1290  153 PHE A CA  
959  C C   . PHE A 153 ? 1.7668 2.8598 2.1598 -0.6040 -0.0997 0.1385  153 PHE A C   
960  O O   . PHE A 153 ? 1.8173 2.8714 2.1683 -0.6178 -0.0948 0.1261  153 PHE A O   
961  C CB  . PHE A 153 ? 1.5457 2.6319 1.9765 -0.5014 -0.0357 0.0794  153 PHE A CB  
962  C CG  . PHE A 153 ? 1.6241 2.6069 1.9930 -0.5141 -0.0591 0.0645  153 PHE A CG  
963  C CD1 . PHE A 153 ? 1.6030 2.5814 1.9886 -0.4967 -0.0653 0.0660  153 PHE A CD1 
964  C CD2 . PHE A 153 ? 1.7381 2.6247 2.0285 -0.5407 -0.0724 0.0501  153 PHE A CD2 
965  C CE1 . PHE A 153 ? 1.6946 2.5749 2.0178 -0.5073 -0.0841 0.0528  153 PHE A CE1 
966  C CE2 . PHE A 153 ? 1.8373 2.6243 2.0649 -0.5479 -0.0884 0.0373  153 PHE A CE2 
967  C CZ  . PHE A 153 ? 1.8160 2.5999 2.0589 -0.5321 -0.0943 0.0383  153 PHE A CZ  
968  N N   . GLU A 154 ? 1.4294 2.5004 1.8043 -0.6390 -0.1389 0.1621  154 GLU A N   
969  C CA  . GLU A 154 ? 1.6372 2.6227 1.9300 -0.6968 -0.1783 0.1718  154 GLU A CA  
970  C C   . GLU A 154 ? 1.6969 2.7093 1.9835 -0.7313 -0.1822 0.1892  154 GLU A C   
971  O O   . GLU A 154 ? 1.8223 2.7413 2.0309 -0.7504 -0.1872 0.1717  154 GLU A O   
972  C CB  . GLU A 154 ? 1.7138 2.5586 1.9159 -0.6827 -0.1721 0.1283  154 GLU A CB  
973  C CG  . GLU A 154 ? 1.9323 2.6792 2.0549 -0.7214 -0.2120 0.1362  154 GLU A CG  
974  C CD  . GLU A 154 ? 1.9200 2.5860 2.0073 -0.6838 -0.1979 0.1030  154 GLU A CD  
975  O OE1 . GLU A 154 ? 1.7789 2.4337 1.8789 -0.6355 -0.1594 0.0690  154 GLU A OE1 
976  O OE2 . GLU A 154 ? 2.0642 2.6782 2.1098 -0.7045 -0.2265 0.1127  154 GLU A OE2 
977  N N   . GLY A 155 ? 1.9735 3.1155 2.3441 -0.7355 -0.1768 0.2254  155 GLY A N   
978  C CA  . GLY A 155 ? 2.0543 3.2368 2.4268 -0.7786 -0.1884 0.2547  155 GLY A CA  
979  C C   . GLY A 155 ? 2.0191 3.1869 2.3731 -0.7600 -0.1552 0.2286  155 GLY A C   
980  O O   . GLY A 155 ? 2.1250 3.2982 2.4595 -0.8003 -0.1683 0.2486  155 GLY A O   
981  N N   . LYS A 156 ? 1.7339 2.8813 2.0915 -0.7021 -0.1147 0.1860  156 LYS A N   
982  C CA  . LYS A 156 ? 1.6940 2.8452 2.0454 -0.6811 -0.0820 0.1648  156 LYS A CA  
983  C C   . LYS A 156 ? 1.5279 2.7266 1.9299 -0.6175 -0.0383 0.1401  156 LYS A C   
984  O O   . LYS A 156 ? 1.4661 2.6329 1.8696 -0.5869 -0.0328 0.1189  156 LYS A O   
985  C CB  . LYS A 156 ? 1.7945 2.8167 2.0546 -0.6876 -0.0864 0.1313  156 LYS A CB  
986  N N   . PRO A 157 ? 1.3683 2.6381 1.8060 -0.5982 -0.0069 0.1433  157 PRO A N   
987  C CA  . PRO A 157 ? 1.2583 2.5560 1.7280 -0.5383 0.0351  0.1172  157 PRO A CA  
988  C C   . PRO A 157 ? 1.2366 2.4284 1.6500 -0.5141 0.0420  0.0683  157 PRO A C   
989  O O   . PRO A 157 ? 1.2979 2.4192 1.6548 -0.5330 0.0326  0.0532  157 PRO A O   
990  C CB  . PRO A 157 ? 1.2761 2.6342 1.7611 -0.5313 0.0640  0.1241  157 PRO A CB  
991  C CG  . PRO A 157 ? 1.3543 2.7595 1.8504 -0.5848 0.0378  0.1685  157 PRO A CG  
992  C CD  . PRO A 157 ? 1.4363 2.7529 1.8772 -0.6290 -0.0068 0.1684  157 PRO A CD  
993  N N   . THR A 158 ? 1.1972 2.3785 1.6273 -0.4731 0.0578  0.0471  158 THR A N   
994  C CA  . THR A 158 ? 1.1771 2.2666 1.5612 -0.4513 0.0642  0.0052  158 THR A CA  
995  C C   . THR A 158 ? 1.1219 2.2239 1.5229 -0.4017 0.1002  -0.0214 158 THR A C   
996  O O   . THR A 158 ? 1.0871 2.2400 1.5325 -0.3733 0.1159  -0.0139 158 THR A O   
997  C CB  . THR A 158 ? 1.1797 2.2054 1.5430 -0.4578 0.0401  0.0006  158 THR A CB  
998  O OG1 . THR A 158 ? 1.2769 2.2830 1.6141 -0.5066 0.0049  0.0268  158 THR A OG1 
999  C CG2 . THR A 158 ? 1.1730 2.1056 1.4877 -0.4406 0.0465  -0.0366 158 THR A CG2 
1000 N N   . LEU A 159 ? 1.1749 2.2268 1.5364 -0.3925 0.1121  -0.0504 159 LEU A N   
1001 C CA  . LEU A 159 ? 1.1594 2.1953 1.5172 -0.3521 0.1394  -0.0804 159 LEU A CA  
1002 C C   . LEU A 159 ? 1.1128 2.0868 1.4610 -0.3383 0.1303  -0.0994 159 LEU A C   
1003 O O   . LEU A 159 ? 1.1120 2.0265 1.4298 -0.3572 0.1100  -0.1039 159 LEU A O   
1004 C CB  . LEU A 159 ? 1.2080 2.2093 1.5240 -0.3552 0.1476  -0.1007 159 LEU A CB  
1005 C CG  . LEU A 159 ? 1.2345 2.2083 1.5333 -0.3216 0.1707  -0.1319 159 LEU A CG  
1006 C CD1 . LEU A 159 ? 1.2893 2.3212 1.6103 -0.2931 0.2018  -0.1276 159 LEU A CD1 
1007 C CD2 . LEU A 159 ? 1.2873 2.2199 1.5422 -0.3336 0.1682  -0.1476 159 LEU A CD2 
1008 N N   . MET A 160 ? 1.1413 2.1267 1.5129 -0.3037 0.1473  -0.1087 160 MET A N   
1009 C CA  . MET A 160 ? 1.1081 2.0341 1.4695 -0.2889 0.1414  -0.1275 160 MET A CA  
1010 C C   . MET A 160 ? 1.1313 2.0425 1.4927 -0.2497 0.1663  -0.1517 160 MET A C   
1011 O O   . MET A 160 ? 1.1844 2.1362 1.5582 -0.2275 0.1911  -0.1510 160 MET A O   
1012 C CB  . MET A 160 ? 1.0764 2.0120 1.4615 -0.2978 0.1212  -0.1064 160 MET A CB  
1013 C CG  . MET A 160 ? 1.0776 2.1001 1.5109 -0.3030 0.1202  -0.0712 160 MET A CG  
1014 S SD  . MET A 160 ? 1.0824 2.1015 1.5225 -0.3377 0.0807  -0.0412 160 MET A SD  
1015 C CE  . MET A 160 ? 1.1026 2.2306 1.5927 -0.3626 0.0738  0.0062  160 MET A CE  
1016 N N   . MET A 161 ? 0.9775 1.8245 1.3193 -0.2421 0.1604  -0.1723 161 MET A N   
1017 C CA  . MET A 161 ? 1.0127 1.8320 1.3514 -0.2093 0.1772  -0.1933 161 MET A CA  
1018 C C   . MET A 161 ? 0.9635 1.7348 1.3014 -0.2102 0.1609  -0.1971 161 MET A C   
1019 O O   . MET A 161 ? 0.9206 1.6805 1.2553 -0.2339 0.1404  -0.1844 161 MET A O   
1020 C CB  . MET A 161 ? 1.0896 1.8714 1.3894 -0.2043 0.1890  -0.2190 161 MET A CB  
1021 C CG  . MET A 161 ? 1.0688 1.8182 1.3414 -0.2328 0.1722  -0.2236 161 MET A CG  
1022 S SD  . MET A 161 ? 1.0306 1.7097 1.2900 -0.2359 0.1569  -0.2363 161 MET A SD  
1023 C CE  . MET A 161 ? 1.0880 1.7426 1.3486 -0.2034 0.1718  -0.2546 161 MET A CE  
1024 N N   . ARG A 162 ? 1.0208 1.7581 1.3556 -0.1850 0.1705  -0.2137 162 ARG A N   
1025 C CA  . ARG A 162 ? 0.9827 1.6763 1.3171 -0.1855 0.1566  -0.2152 162 ARG A CA  
1026 C C   . ARG A 162 ? 1.0242 1.6595 1.3387 -0.1706 0.1626  -0.2386 162 ARG A C   
1027 O O   . ARG A 162 ? 1.1089 1.7348 1.4121 -0.1510 0.1792  -0.2540 162 ARG A O   
1028 C CB  . ARG A 162 ? 0.9623 1.6879 1.3299 -0.1760 0.1517  -0.1949 162 ARG A CB  
1029 C CG  . ARG A 162 ? 1.0133 1.7789 1.4070 -0.1429 0.1736  -0.1916 162 ARG A CG  
1030 C CD  . ARG A 162 ? 0.9872 1.7905 1.4198 -0.1369 0.1641  -0.1651 162 ARG A CD  
1031 N NE  . ARG A 162 ? 1.0452 1.8833 1.5070 -0.0978 0.1874  -0.1586 162 ARG A NE  
1032 C CZ  . ARG A 162 ? 1.0387 1.9125 1.5397 -0.0842 0.1825  -0.1340 162 ARG A CZ  
1033 N NH1 . ARG A 162 ? 0.9861 1.8609 1.4954 -0.1110 0.1523  -0.1156 162 ARG A NH1 
1034 N NH2 . ARG A 162 ? 1.1070 2.0115 1.6347 -0.0432 0.2082  -0.1264 162 ARG A NH2 
1035 N N   . LEU A 163 ? 1.0181 1.6105 1.3239 -0.1811 0.1490  -0.2394 163 LEU A N   
1036 C CA  . LEU A 163 ? 1.0513 1.5912 1.3430 -0.1732 0.1506  -0.2555 163 LEU A CA  
1037 C C   . LEU A 163 ? 1.0494 1.5693 1.3537 -0.1585 0.1482  -0.2514 163 LEU A C   
1038 O O   . LEU A 163 ? 1.0063 1.5346 1.3204 -0.1653 0.1377  -0.2352 163 LEU A O   
1039 C CB  . LEU A 163 ? 1.0156 1.5254 1.2929 -0.1938 0.1399  -0.2542 163 LEU A CB  
1040 C CG  . LEU A 163 ? 1.0064 1.5332 1.2721 -0.2129 0.1370  -0.2515 163 LEU A CG  
1041 C CD1 . LEU A 163 ? 0.9636 1.4693 1.2228 -0.2281 0.1273  -0.2382 163 LEU A CD1 
1042 C CD2 . LEU A 163 ? 1.0723 1.5852 1.3213 -0.2145 0.1407  -0.2668 163 LEU A CD2 
1043 N N   . ALA A 164 ? 0.8191 1.3060 1.1167 -0.1407 0.1563  -0.2656 164 ALA A N   
1044 C CA  . ALA A 164 ? 0.8292 1.2873 1.1344 -0.1283 0.1533  -0.2625 164 ALA A CA  
1045 C C   . ALA A 164 ? 0.8635 1.2668 1.1516 -0.1341 0.1500  -0.2734 164 ALA A C   
1046 O O   . ALA A 164 ? 0.9402 1.3215 1.2096 -0.1349 0.1543  -0.2886 164 ALA A O   
1047 C CB  . ALA A 164 ? 0.9021 1.3713 1.2191 -0.0982 0.1663  -0.2638 164 ALA A CB  
1048 N N   . ASN A 165 ? 0.9736 1.3544 1.2653 -0.1402 0.1418  -0.2633 165 ASN A N   
1049 C CA  . ASN A 165 ? 1.0045 1.3402 1.2885 -0.1445 0.1396  -0.2669 165 ASN A CA  
1050 C C   . ASN A 165 ? 1.1018 1.4072 1.3825 -0.1253 0.1446  -0.2763 165 ASN A C   
1051 O O   . ASN A 165 ? 1.1120 1.4230 1.4029 -0.1084 0.1465  -0.2702 165 ASN A O   
1052 C CB  . ASN A 165 ? 0.9549 1.2759 1.2410 -0.1518 0.1344  -0.2506 165 ASN A CB  
1053 C CG  . ASN A 165 ? 0.9874 1.2689 1.2726 -0.1540 0.1347  -0.2482 165 ASN A CG  
1054 O OD1 . ASN A 165 ? 1.0516 1.3138 1.3344 -0.1533 0.1348  -0.2586 165 ASN A OD1 
1055 N ND2 . ASN A 165 ? 0.9658 1.2314 1.2487 -0.1573 0.1353  -0.2330 165 ASN A ND2 
1056 N N   . LEU A 166 ? 0.9988 1.2691 1.2625 -0.1293 0.1449  -0.2891 166 LEU A N   
1057 C CA  . LEU A 166 ? 0.9650 1.1943 1.2143 -0.1113 0.1505  -0.3004 166 LEU A CA  
1058 C C   . LEU A 166 ? 0.9941 1.1826 1.2458 -0.1140 0.1445  -0.2936 166 LEU A C   
1059 O O   . LEU A 166 ? 1.1184 1.2666 1.3567 -0.0998 0.1478  -0.3008 166 LEU A O   
1060 C CB  . LEU A 166 ? 1.1100 1.3096 1.3247 -0.1154 0.1532  -0.3198 166 LEU A CB  
1061 C CG  . LEU A 166 ? 1.1454 1.3745 1.3500 -0.1003 0.1669  -0.3287 166 LEU A CG  
1062 C CD1 . LEU A 166 ? 1.3507 1.5318 1.5053 -0.0999 0.1725  -0.3501 166 LEU A CD1 
1063 C CD2 . LEU A 166 ? 1.1390 1.3916 1.3643 -0.0681 0.1798  -0.3214 166 LEU A CD2 
1064 N N   . ARG A 167 ? 1.3868 1.5826 1.6530 -0.1304 0.1379  -0.2783 167 ARG A N   
1065 C CA  . ARG A 167 ? 1.4167 1.5782 1.6869 -0.1336 0.1348  -0.2682 167 ARG A CA  
1066 C C   . ARG A 167 ? 1.3404 1.5118 1.6221 -0.1276 0.1363  -0.2511 167 ARG A C   
1067 O O   . ARG A 167 ? 1.2604 1.4631 1.5454 -0.1285 0.1365  -0.2454 167 ARG A O   
1068 C CB  . ARG A 167 ? 1.4159 1.5690 1.6893 -0.1586 0.1279  -0.2609 167 ARG A CB  
1069 C CG  . ARG A 167 ? 1.5197 1.6550 1.7725 -0.1722 0.1209  -0.2758 167 ARG A CG  
1070 C CD  . ARG A 167 ? 1.4903 1.6382 1.7554 -0.2005 0.1107  -0.2618 167 ARG A CD  
1071 N NE  . ARG A 167 ? 1.6104 1.7268 1.8500 -0.2210 0.0975  -0.2719 167 ARG A NE  
1072 C CZ  . ARG A 167 ? 1.6291 1.7633 1.8670 -0.2455 0.0859  -0.2679 167 ARG A CZ  
1073 N NH1 . ARG A 167 ? 1.4998 1.6844 1.7637 -0.2480 0.0888  -0.2540 167 ARG A NH1 
1074 N NH2 . ARG A 167 ? 1.7646 1.8613 1.9698 -0.2682 0.0701  -0.2769 167 ARG A NH2 
1075 N N   . ILE A 168 ? 1.1158 1.2543 1.3973 -0.1238 0.1365  -0.2425 168 ILE A N   
1076 C CA  . ILE A 168 ? 1.0866 1.2207 1.3675 -0.1184 0.1381  -0.2266 168 ILE A CA  
1077 C C   . ILE A 168 ? 1.0266 1.1694 1.3074 -0.1314 0.1422  -0.2123 168 ILE A C   
1078 O O   . ILE A 168 ? 1.0122 1.1547 1.2801 -0.1292 0.1439  -0.2025 168 ILE A O   
1079 C CB  . ILE A 168 ? 1.1057 1.1984 1.3831 -0.1115 0.1389  -0.2200 168 ILE A CB  
1080 C CG1 . ILE A 168 ? 1.1529 1.2211 1.4262 -0.1031 0.1368  -0.2349 168 ILE A CG1 
1081 C CG2 . ILE A 168 ? 1.1156 1.2016 1.3840 -0.0999 0.1377  -0.2089 168 ILE A CG2 
1082 C CD1 . ILE A 168 ? 1.1671 1.2212 1.4368 -0.1212 0.1336  -0.2434 168 ILE A CD1 
1083 N N   . GLU A 169 ? 1.3057 1.4527 1.5975 -0.1450 0.1433  -0.2093 169 GLU A N   
1084 C CA  . GLU A 169 ? 1.2555 1.4134 1.5525 -0.1530 0.1507  -0.1918 169 GLU A CA  
1085 C C   . GLU A 169 ? 1.1911 1.3761 1.4795 -0.1552 0.1503  -0.1951 169 GLU A C   
1086 O O   . GLU A 169 ? 1.1700 1.3758 1.4575 -0.1562 0.1433  -0.2107 169 GLU A O   
1087 C CB  . GLU A 169 ? 1.2573 1.4232 1.5763 -0.1686 0.1487  -0.1829 169 GLU A CB  
1088 C CG  . GLU A 169 ? 1.3346 1.4729 1.6626 -0.1717 0.1481  -0.1737 169 GLU A CG  
1089 C CD  . GLU A 169 ? 1.3806 1.4915 1.6954 -0.1696 0.1380  -0.1944 169 GLU A CD  
1090 O OE1 . GLU A 169 ? 1.3947 1.5127 1.6972 -0.1657 0.1329  -0.2152 169 GLU A OE1 
1091 O OE2 . GLU A 169 ? 1.3985 1.4785 1.7135 -0.1701 0.1370  -0.1884 169 GLU A OE2 
1092 N N   . GLN A 170 ? 1.2915 1.4728 1.5706 -0.1549 0.1597  -0.1792 170 GLN A N   
1093 C CA  . GLN A 170 ? 1.2615 1.4571 1.5240 -0.1581 0.1588  -0.1806 170 GLN A CA  
1094 C C   . GLN A 170 ? 1.2151 1.4353 1.4920 -0.1669 0.1620  -0.1732 170 GLN A C   
1095 O O   . GLN A 170 ? 1.2137 1.4373 1.5121 -0.1688 0.1680  -0.1589 170 GLN A O   
1096 C CB  . GLN A 170 ? 1.3310 1.4912 1.5573 -0.1512 0.1666  -0.1688 170 GLN A CB  
1097 C CG  . GLN A 170 ? 1.3957 1.5226 1.6094 -0.1422 0.1673  -0.1662 170 GLN A CG  
1098 C CD  . GLN A 170 ? 1.4468 1.5419 1.6149 -0.1416 0.1636  -0.1626 170 GLN A CD  
1099 O OE1 . GLN A 170 ? 1.4710 1.5351 1.6024 -0.1413 0.1733  -0.1522 170 GLN A OE1 
1100 N NE2 . GLN A 170 ? 1.4647 1.5637 1.6312 -0.1417 0.1487  -0.1692 170 GLN A NE2 
1101 N N   . ILE A 171 ? 0.8433 1.0839 1.1109 -0.1734 0.1570  -0.1796 171 ILE A N   
1102 C CA  . ILE A 171 ? 0.8100 1.0732 1.0881 -0.1813 0.1591  -0.1709 171 ILE A CA  
1103 C C   . ILE A 171 ? 0.7887 1.0326 1.0376 -0.1768 0.1689  -0.1580 171 ILE A C   
1104 O O   . ILE A 171 ? 0.8184 1.0504 1.0374 -0.1793 0.1638  -0.1649 171 ILE A O   
1105 C CB  . ILE A 171 ? 0.7683 1.0662 1.0543 -0.1934 0.1465  -0.1875 171 ILE A CB  
1106 C CG1 . ILE A 171 ? 0.7846 1.0833 1.0823 -0.1947 0.1390  -0.2032 171 ILE A CG1 
1107 C CG2 . ILE A 171 ? 0.8040 1.1256 1.1027 -0.2036 0.1458  -0.1763 171 ILE A CG2 
1108 C CD1 . ILE A 171 ? 0.7896 1.1121 1.0863 -0.2046 0.1303  -0.2195 171 ILE A CD1 
1109 N N   . ILE A 172 ? 0.8722 1.1107 1.1281 -0.1702 0.1831  -0.1365 172 ILE A N   
1110 C CA  . ILE A 172 ? 0.8227 1.0261 1.0406 -0.1603 0.1979  -0.1227 172 ILE A CA  
1111 C C   . ILE A 172 ? 0.8430 1.0663 1.0608 -0.1662 0.1970  -0.1166 172 ILE A C   
1112 O O   . ILE A 172 ? 0.8749 1.1411 1.1311 -0.1736 0.1914  -0.1117 172 ILE A O   
1113 C CB  . ILE A 172 ? 0.8518 1.0250 1.0674 -0.1405 0.2222  -0.0986 172 ILE A CB  
1114 C CG1 . ILE A 172 ? 0.8264 1.0437 1.0980 -0.1396 0.2277  -0.0776 172 ILE A CG1 
1115 C CG2 . ILE A 172 ? 0.8611 1.0060 1.0661 -0.1351 0.2232  -0.1043 172 ILE A CG2 
1116 C CD1 . ILE A 172 ? 0.8686 1.0701 1.1399 -0.1168 0.2572  -0.0443 172 ILE A CD1 
1117 N N   . GLU A 173 ? 1.6077 1.7945 1.7767 -0.1650 0.2008  -0.1159 173 GLU A N   
1118 C CA  . GLU A 173 ? 1.6167 1.8147 1.7764 -0.1722 0.1982  -0.1118 173 GLU A CA  
1119 C C   . GLU A 173 ? 1.4952 1.7543 1.6939 -0.1903 0.1790  -0.1254 173 GLU A C   
1120 O O   . GLU A 173 ? 1.4591 1.7497 1.6826 -0.1938 0.1782  -0.1155 173 GLU A O   
1121 C CB  . GLU A 173 ? 1.6715 1.8596 1.8365 -0.1539 0.2203  -0.0842 173 GLU A CB  
1122 C CG  . GLU A 173 ? 1.5735 1.8138 1.8036 -0.1511 0.2223  -0.0687 173 GLU A CG  
1123 C CD  . GLU A 173 ? 1.6263 1.8693 1.8705 -0.1318 0.2440  -0.0349 173 GLU A CD  
1124 O OE1 . GLU A 173 ? 1.7595 1.9514 1.9551 -0.1154 0.2623  -0.0254 173 GLU A OE1 
1125 O OE2 . GLU A 173 ? 1.5533 1.8475 1.8554 -0.1334 0.2422  -0.0155 173 GLU A OE2 
1126 N N   . ALA A 174 ? 1.0565 1.3303 1.2580 -0.2004 0.1645  -0.1462 174 ALA A N   
1127 C CA  . ALA A 174 ? 0.9811 1.3026 1.2062 -0.2145 0.1501  -0.1612 174 ALA A CA  
1128 C C   . ALA A 174 ? 1.0034 1.3335 1.2060 -0.2266 0.1443  -0.1617 174 ALA A C   
1129 O O   . ALA A 174 ? 1.0760 1.3735 1.2415 -0.2284 0.1450  -0.1574 174 ALA A O   
1130 C CB  . ALA A 174 ? 0.9535 1.2839 1.1858 -0.2150 0.1421  -0.1797 174 ALA A CB  
1131 N N   . ASP A 175 ? 1.6350 2.0041 1.8542 -0.2374 0.1373  -0.1658 175 ASP A N   
1132 C CA  . ASP A 175 ? 1.6579 2.0398 1.8578 -0.2506 0.1314  -0.1657 175 ASP A CA  
1133 C C   . ASP A 175 ? 1.6182 2.0466 1.8353 -0.2620 0.1230  -0.1779 175 ASP A C   
1134 O O   . ASP A 175 ? 1.5950 2.0381 1.8333 -0.2613 0.1210  -0.1833 175 ASP A O   
1135 C CB  . ASP A 175 ? 1.7226 2.0803 1.9039 -0.2481 0.1388  -0.1456 175 ASP A CB  
1136 C CG  . ASP A 175 ? 1.6938 2.0767 1.9057 -0.2457 0.1406  -0.1332 175 ASP A CG  
1137 O OD1 . ASP A 175 ? 1.6445 2.0662 1.8785 -0.2566 0.1301  -0.1433 175 ASP A OD1 
1138 O OD2 . ASP A 175 ? 1.7388 2.1010 1.9499 -0.2326 0.1528  -0.1113 175 ASP A OD2 
1139 N N   . VAL A 176 ? 0.7860 1.2335 0.9889 -0.2742 0.1179  -0.1809 176 VAL A N   
1140 C CA  . VAL A 176 ? 0.7731 1.2614 0.9847 -0.2822 0.1139  -0.1938 176 VAL A CA  
1141 C C   . VAL A 176 ? 0.7880 1.2953 0.9847 -0.2975 0.1101  -0.1865 176 VAL A C   
1142 O O   . VAL A 176 ? 0.8237 1.3153 1.0006 -0.3044 0.1086  -0.1748 176 VAL A O   
1143 C CB  . VAL A 176 ? 0.7794 1.2848 0.9976 -0.2768 0.1150  -0.2068 176 VAL A CB  
1144 C CG1 . VAL A 176 ? 0.7724 1.2861 0.9786 -0.2865 0.1109  -0.1978 176 VAL A CG1 
1145 C CG2 . VAL A 176 ? 0.7730 1.3087 0.9965 -0.2760 0.1177  -0.2220 176 VAL A CG2 
1146 N N   . HIS A 177 ? 1.6688 2.2031 1.8684 -0.3042 0.1078  -0.1931 177 HIS A N   
1147 C CA  . HIS A 177 ? 1.7125 2.2677 1.8974 -0.3193 0.1044  -0.1867 177 HIS A CA  
1148 C C   . HIS A 177 ? 1.7356 2.3265 1.9173 -0.3230 0.1077  -0.2004 177 HIS A C   
1149 O O   . HIS A 177 ? 1.7556 2.3511 1.9392 -0.3161 0.1111  -0.2160 177 HIS A O   
1150 C CB  . HIS A 177 ? 1.7312 2.2871 1.9169 -0.3252 0.0987  -0.1783 177 HIS A CB  
1151 C CG  . HIS A 177 ? 1.7288 2.2579 1.9197 -0.3188 0.0995  -0.1574 177 HIS A CG  
1152 N ND1 . HIS A 177 ? 1.7552 2.2727 1.9293 -0.3232 0.0999  -0.1396 177 HIS A ND1 
1153 C CD2 . HIS A 177 ? 1.7100 2.2201 1.9196 -0.3060 0.1030  -0.1493 177 HIS A CD2 
1154 C CE1 . HIS A 177 ? 1.7706 2.2608 1.9512 -0.3097 0.1059  -0.1216 177 HIS A CE1 
1155 N NE2 . HIS A 177 ? 1.7436 2.2328 1.9484 -0.2993 0.1083  -0.1260 177 HIS A NE2 
1156 N N   . LEU A 178 ? 0.9075 1.5203 1.0805 -0.3339 0.1080  -0.1929 178 LEU A N   
1157 C CA  . LEU A 178 ? 0.9406 1.5940 1.1126 -0.3353 0.1155  -0.2005 178 LEU A CA  
1158 C C   . LEU A 178 ? 0.9730 1.6420 1.1256 -0.3515 0.1130  -0.1941 178 LEU A C   
1159 O O   . LEU A 178 ? 0.9814 1.6559 1.1260 -0.3665 0.1080  -0.1782 178 LEU A O   
1160 C CB  . LEU A 178 ? 0.9160 1.5958 1.1007 -0.3369 0.1178  -0.1920 178 LEU A CB  
1161 C CG  . LEU A 178 ? 0.9433 1.6698 1.1383 -0.3275 0.1322  -0.1982 178 LEU A CG  
1162 C CD1 . LEU A 178 ? 0.9881 1.6994 1.1740 -0.3094 0.1426  -0.2203 178 LEU A CD1 
1163 C CD2 . LEU A 178 ? 0.8986 1.6513 1.1208 -0.3207 0.1340  -0.1890 178 LEU A CD2 
1164 N N   . VAL A 179 ? 0.9027 1.5732 1.0417 -0.3506 0.1150  -0.2058 179 VAL A N   
1165 C CA  . VAL A 179 ? 0.9337 1.6151 1.0504 -0.3670 0.1105  -0.1988 179 VAL A CA  
1166 C C   . VAL A 179 ? 0.9285 1.6397 1.0256 -0.3673 0.1235  -0.2081 179 VAL A C   
1167 O O   . VAL A 179 ? 0.9834 1.6874 1.0669 -0.3552 0.1328  -0.2265 179 VAL A O   
1168 C CB  . VAL A 179 ? 0.9335 1.5905 1.0428 -0.3727 0.0975  -0.1968 179 VAL A CB  
1169 C CG1 . VAL A 179 ? 0.9792 1.6488 1.0631 -0.3903 0.0911  -0.1887 179 VAL A CG1 
1170 C CG2 . VAL A 179 ? 0.8810 1.5145 1.0101 -0.3695 0.0902  -0.1806 179 VAL A CG2 
1171 N N   . LEU A 180 ? 1.0309 1.7711 1.1224 -0.3807 0.1256  -0.1938 180 LEU A N   
1172 C CA  . LEU A 180 ? 1.1090 1.8808 1.1800 -0.3823 0.1401  -0.1968 180 LEU A CA  
1173 C C   . LEU A 180 ? 1.1137 1.8694 1.1468 -0.3953 0.1323  -0.1998 180 LEU A C   
1174 O O   . LEU A 180 ? 1.0840 1.8294 1.1141 -0.4116 0.1159  -0.1852 180 LEU A O   
1175 C CB  . LEU A 180 ? 1.1152 1.9273 1.1985 -0.3959 0.1428  -0.1753 180 LEU A CB  
1176 C CG  . LEU A 180 ? 1.1784 2.0208 1.2361 -0.4075 0.1522  -0.1684 180 LEU A CG  
1177 C CD1 . LEU A 180 ? 1.2502 2.1178 1.2990 -0.3867 0.1792  -0.1812 180 LEU A CD1 
1178 C CD2 . LEU A 180 ? 1.2014 2.0753 1.2716 -0.4290 0.1471  -0.1420 180 LEU A CD2 
1179 N N   . VAL A 181 ? 1.3018 2.0502 1.3014 -0.3877 0.1438  -0.2176 181 VAL A N   
1180 C CA  . VAL A 181 ? 1.3236 2.0564 1.2777 -0.4038 0.1353  -0.2197 181 VAL A CA  
1181 C C   . VAL A 181 ? 1.3918 2.1491 1.3114 -0.4021 0.1575  -0.2219 181 VAL A C   
1182 O O   . VAL A 181 ? 1.4541 2.2166 1.3653 -0.3797 0.1826  -0.2355 181 VAL A O   
1183 C CB  . VAL A 181 ? 1.3468 2.0327 1.2727 -0.4034 0.1238  -0.2379 181 VAL A CB  
1184 C CG1 . VAL A 181 ? 1.3775 2.0477 1.2555 -0.4264 0.1080  -0.2349 181 VAL A CG1 
1185 C CG2 . VAL A 181 ? 1.2925 1.9617 1.2591 -0.4025 0.1059  -0.2321 181 VAL A CG2 
1186 N N   . ARG A 182 ? 1.2026 1.9753 1.1043 -0.4230 0.1504  -0.2061 182 ARG A N   
1187 C CA  . ARG A 182 ? 1.2744 2.0737 1.1434 -0.4225 0.1731  -0.2043 182 ARG A CA  
1188 C C   . ARG A 182 ? 1.2844 2.0780 1.1126 -0.4478 0.1594  -0.1936 182 ARG A C   
1189 O O   . ARG A 182 ? 1.2343 2.0162 1.0735 -0.4659 0.1325  -0.1801 182 ARG A O   
1190 C CB  . ARG A 182 ? 1.1919 2.0475 1.1046 -0.4183 0.1893  -0.1854 182 ARG A CB  
1191 C CG  . ARG A 182 ? 1.1474 2.0175 1.0830 -0.4437 0.1685  -0.1599 182 ARG A CG  
1192 C CD  . ARG A 182 ? 1.1932 2.1184 1.1584 -0.4491 0.1814  -0.1379 182 ARG A CD  
1193 N NE  . ARG A 182 ? 1.1676 2.0910 1.1432 -0.4757 0.1594  -0.1148 182 ARG A NE  
1194 C CZ  . ARG A 182 ? 1.1892 2.1393 1.1972 -0.4873 0.1555  -0.0942 182 ARG A CZ  
1195 N NH1 . ARG A 182 ? 1.2311 2.2231 1.2738 -0.4747 0.1711  -0.0909 182 ARG A NH1 
1196 N NH2 . ARG A 182 ? 1.1854 2.1169 1.1884 -0.5121 0.1350  -0.0751 182 ARG A NH2 
1197 N N   . SER A 183 ? 1.5230 1.7340 1.1028 -0.1570 0.4450  -0.6779 183 SER A N   
1198 C CA  . SER A 183 ? 1.4684 1.9126 1.1331 -0.1797 0.4680  -0.6269 183 SER A CA  
1199 C C   . SER A 183 ? 1.5441 2.0354 1.3111 -0.1315 0.4572  -0.5666 183 SER A C   
1200 O O   . SER A 183 ? 1.6259 2.0102 1.4196 -0.0874 0.4300  -0.5871 183 SER A O   
1201 C CB  . SER A 183 ? 1.4088 1.9803 1.0927 -0.2144 0.4716  -0.6738 183 SER A CB  
1202 O OG  . SER A 183 ? 1.3685 1.8581 0.9636 -0.2521 0.4715  -0.7437 183 SER A OG  
1203 N N   . GLU A 184 ? 1.5425 2.1919 1.3668 -0.1390 0.4780  -0.4948 184 GLU A N   
1204 C CA  . GLU A 184 ? 1.6291 2.3283 1.5560 -0.0981 0.4693  -0.4285 184 GLU A CA  
1205 C C   . GLU A 184 ? 1.5999 2.5302 1.5955 -0.1209 0.4946  -0.3707 184 GLU A C   
1206 O O   . GLU A 184 ? 1.4990 2.5546 1.4596 -0.1612 0.5208  -0.3716 184 GLU A O   
1207 C CB  . GLU A 184 ? 1.6835 2.2961 1.6087 -0.0627 0.4592  -0.3865 184 GLU A CB  
1208 C CG  . GLU A 184 ? 1.7066 2.1074 1.5563 -0.0375 0.4378  -0.4383 184 GLU A CG  
1209 C CD  . GLU A 184 ? 1.7845 2.1086 1.6667 0.0159  0.4176  -0.4000 184 GLU A CD  
1210 O OE1 . GLU A 184 ? 1.7710 2.1880 1.6683 0.0107  0.4273  -0.3464 184 GLU A OE1 
1211 O OE2 . GLU A 184 ? 1.8590 2.0382 1.7545 0.0667  0.3898  -0.4284 184 GLU A OE2 
1212 N N   . ILE A 185 ? 1.2591 2.2501 1.3538 -0.0951 0.4881  -0.3228 185 ILE A N   
1213 C CA  . ILE A 185 ? 1.2135 2.4209 1.3742 -0.1103 0.5123  -0.2562 185 ILE A CA  
1214 C C   . ILE A 185 ? 1.2565 2.4826 1.4686 -0.0806 0.5113  -0.1702 185 ILE A C   
1215 O O   . ILE A 185 ? 1.3170 2.4243 1.5802 -0.0393 0.4866  -0.1491 185 ILE A O   
1216 C CB  . ILE A 185 ? 1.1832 2.4736 1.4229 -0.1083 0.5099  -0.2514 185 ILE A CB  
1217 C CG1 . ILE A 185 ? 1.1292 2.4358 1.3196 -0.1376 0.5076  -0.3406 185 ILE A CG1 
1218 C CG2 . ILE A 185 ? 1.1370 2.6465 1.4465 -0.1174 0.5360  -0.1674 185 ILE A CG2 
1219 C CD1 . ILE A 185 ? 1.0542 2.4849 1.1850 -0.1796 0.5323  -0.3644 185 ILE A CD1 
1220 N N   . SER A 186 ? 1.7007 3.0782 1.9006 -0.0982 0.5357  -0.1267 186 SER A N   
1221 C CA  . SER A 186 ? 1.7081 3.1258 1.9550 -0.0688 0.5325  -0.0442 186 SER A CA  
1222 C C   . SER A 186 ? 1.6480 3.1659 2.0018 -0.0538 0.5358  0.0290  186 SER A C   
1223 O O   . SER A 186 ? 1.5997 3.2062 1.9794 -0.0744 0.5491  0.0171  186 SER A O   
1224 C CB  . SER A 186 ? 1.6835 3.2402 1.8740 -0.0909 0.5578  -0.0304 186 SER A CB  
1225 O OG  . SER A 186 ? 1.6679 3.2839 1.9031 -0.0596 0.5525  0.0495  186 SER A OG  
1226 N N   . GLN A 187 ? 2.1299 3.6344 2.5484 -0.0179 0.5221  0.1042  187 GLN A N   
1227 C CA  . GLN A 187 ? 2.0898 3.6958 2.6085 -0.0077 0.5294  0.1874  187 GLN A CA  
1228 C C   . GLN A 187 ? 2.0206 3.8525 2.5189 -0.0383 0.5673  0.2137  187 GLN A C   
1229 O O   . GLN A 187 ? 1.9745 3.9162 2.5255 -0.0510 0.5834  0.2409  187 GLN A O   
1230 C CB  . GLN A 187 ? 2.1219 3.6911 2.7027 0.0342  0.5084  0.2663  187 GLN A CB  
1231 C CG  . GLN A 187 ? 2.1811 3.5455 2.8020 0.0738  0.4676  0.2429  187 GLN A CG  
1232 C CD  . GLN A 187 ? 2.2102 3.5514 2.8981 0.1176  0.4417  0.3156  187 GLN A CD  
1233 O OE1 . GLN A 187 ? 2.1958 3.6637 2.9100 0.1190  0.4540  0.3938  187 GLN A OE1 
1234 N NE2 . GLN A 187 ? 2.2553 3.4372 2.9714 0.1579  0.4030  0.2879  187 GLN A NE2 
1235 N N   . GLU A 188 ? 1.9063 3.8157 2.3286 -0.0487 0.5817  0.2010  188 GLU A N   
1236 C CA  . GLU A 188 ? 1.8368 3.9682 2.2317 -0.0728 0.6181  0.2103  188 GLU A CA  
1237 C C   . GLU A 188 ? 1.7935 3.9787 2.1592 -0.1111 0.6329  0.1307  188 GLU A C   
1238 O O   . GLU A 188 ? 1.7245 4.1047 2.0797 -0.1301 0.6613  0.1261  188 GLU A O   
1239 C CB  . GLU A 188 ? 1.8430 4.0319 2.1611 -0.0743 0.6281  0.1980  188 GLU A CB  
1240 C CG  . GLU A 188 ? 1.8813 4.0466 2.2205 -0.0332 0.6100  0.2708  188 GLU A CG  
1241 C CD  . GLU A 188 ? 1.9536 3.9002 2.2956 -0.0093 0.5702  0.2519  188 GLU A CD  
1242 O OE1 . GLU A 188 ? 1.9825 3.8082 2.2728 -0.0283 0.5631  0.1734  188 GLU A OE1 
1243 O OE2 . GLU A 188 ? 1.9862 3.8841 2.3832 0.0314  0.5444  0.3150  188 GLU A OE2 
1244 N N   . GLY A 189 ? 1.2230 3.2384 1.5756 -0.1178 0.6108  0.0634  189 GLY A N   
1245 C CA  . GLY A 189 ? 1.1959 3.2398 1.5229 -0.1491 0.6155  -0.0179 189 GLY A CA  
1246 C C   . GLY A 189 ? 1.1866 3.2516 1.4219 -0.1822 0.6280  -0.0976 189 GLY A C   
1247 O O   . GLY A 189 ? 1.1036 3.2809 1.3276 -0.2095 0.6400  -0.1515 189 GLY A O   
1248 N N   . MET A 190 ? 1.4801 3.4451 1.6546 -0.1808 0.6246  -0.1072 190 MET A N   
1249 C CA  . MET A 190 ? 1.4088 3.3497 1.4949 -0.2173 0.6347  -0.1880 190 MET A CA  
1250 C C   . MET A 190 ? 1.4165 3.1387 1.4634 -0.2219 0.6081  -0.2582 190 MET A C   
1251 O O   . MET A 190 ? 1.5067 3.0553 1.5590 -0.1912 0.5828  -0.2426 190 MET A O   
1252 C CB  . MET A 190 ? 1.3851 3.3164 1.4192 -0.2163 0.6431  -0.1702 190 MET A CB  
1253 N N   . VAL A 191 ? 1.0539 2.7860 1.0641 -0.2554 0.6111  -0.3380 191 VAL A N   
1254 C CA  . VAL A 191 ? 1.0694 2.5918 1.0324 -0.2571 0.5841  -0.4089 191 VAL A CA  
1255 C C   . VAL A 191 ? 1.0041 2.4116 0.8683 -0.2881 0.5897  -0.4641 191 VAL A C   
1256 O O   . VAL A 191 ? 0.9977 2.4648 0.8253 -0.3291 0.6032  -0.5245 191 VAL A O   
1257 C CB  . VAL A 191 ? 1.0519 2.6220 1.0404 -0.2666 0.5721  -0.4668 191 VAL A CB  
1258 C CG1 . VAL A 191 ? 0.9308 2.6955 0.9129 -0.3064 0.5950  -0.5093 191 VAL A CG1 
1259 C CG2 . VAL A 191 ? 1.0868 2.4270 1.0191 -0.2600 0.5400  -0.5406 191 VAL A CG2 
1260 N N   . PHE A 192 ? 1.5041 2.7494 1.3302 -0.2678 0.5783  -0.4436 192 PHE A N   
1261 C CA  . PHE A 192 ? 1.4545 2.6046 1.1886 -0.2970 0.5882  -0.4772 192 PHE A CA  
1262 C C   . PHE A 192 ? 1.5091 2.4054 1.1793 -0.2815 0.5614  -0.5175 192 PHE A C   
1263 O O   . PHE A 192 ? 1.5874 2.3782 1.2882 -0.2401 0.5332  -0.5192 192 PHE A O   
1264 C CB  . PHE A 192 ? 1.4568 2.6648 1.1906 -0.2863 0.6005  -0.4162 192 PHE A CB  
1265 C CG  . PHE A 192 ? 1.5671 2.6901 1.3498 -0.2276 0.5732  -0.3567 192 PHE A CG  
1266 C CD1 . PHE A 192 ? 1.6157 2.5514 1.3542 -0.2028 0.5515  -0.3637 192 PHE A CD1 
1267 C CD2 . PHE A 192 ? 1.6305 2.8633 1.5077 -0.1960 0.5687  -0.2941 192 PHE A CD2 
1268 C CE1 . PHE A 192 ? 1.7185 2.5842 1.5134 -0.1446 0.5232  -0.3169 192 PHE A CE1 
1269 C CE2 . PHE A 192 ? 1.7453 2.8960 1.6785 -0.1432 0.5418  -0.2430 192 PHE A CE2 
1270 C CZ  . PHE A 192 ? 1.7858 2.7557 1.6815 -0.1161 0.5177  -0.2584 192 PHE A CZ  
1271 N N   . ARG A 193 ? 1.9709 2.7757 1.5519 -0.3144 0.5723  -0.5505 193 ARG A N   
1272 C CA  . ARG A 193 ? 2.0298 2.5963 1.5366 -0.2977 0.5514  -0.5784 193 ARG A CA  
1273 C C   . ARG A 193 ? 2.0698 2.5815 1.5636 -0.2667 0.5471  -0.5272 193 ARG A C   
1274 O O   . ARG A 193 ? 2.0132 2.6262 1.4904 -0.2931 0.5702  -0.5028 193 ARG A O   
1275 C CB  . ARG A 193 ? 1.9889 2.4741 1.4018 -0.3540 0.5655  -0.6424 193 ARG A CB  
1276 C CG  . ARG A 193 ? 1.9651 2.4624 1.3824 -0.3775 0.5580  -0.7085 193 ARG A CG  
1277 C CD  . ARG A 193 ? 2.0555 2.3612 1.4519 -0.3339 0.5189  -0.7451 193 ARG A CD  
1278 N NE  . ARG A 193 ? 2.1079 2.1885 1.3971 -0.3397 0.5108  -0.7789 193 ARG A NE  
1279 C CZ  . ARG A 193 ? 2.1950 2.0815 1.4436 -0.2957 0.4775  -0.8121 193 ARG A CZ  
1280 N NH1 . ARG A 193 ? 2.2327 2.1290 1.5436 -0.2464 0.4497  -0.8211 193 ARG A NH1 
1281 N NH2 . ARG A 193 ? 2.2945 1.9806 1.4388 -0.3000 0.4730  -0.8364 193 ARG A NH2 
1282 N N   . ARG A 194 ? 1.6567 2.3874 1.5038 -0.4941 0.0712  -0.1601 194 ARG A N   
1283 C CA  . ARG A 194 ? 1.6103 2.3435 1.5065 -0.4924 0.0599  -0.1395 194 ARG A CA  
1284 C C   . ARG A 194 ? 1.5669 2.2973 1.5033 -0.4714 0.0716  -0.1507 194 ARG A C   
1285 O O   . ARG A 194 ? 1.5727 2.3162 1.5073 -0.4601 0.0915  -0.1660 194 ARG A O   
1286 C CB  . ARG A 194 ? 1.6196 2.3726 1.5166 -0.5027 0.0634  -0.1182 194 ARG A CB  
1287 C CG  . ARG A 194 ? 1.6107 2.3501 1.5333 -0.5051 0.0485  -0.0927 194 ARG A CG  
1288 C CD  . ARG A 194 ? 1.6424 2.3908 1.5546 -0.5181 0.0516  -0.0729 194 ARG A CD  
1289 N NE  . ARG A 194 ? 1.6754 2.4037 1.5874 -0.5238 0.0361  -0.0461 194 ARG A NE  
1290 C CZ  . ARG A 194 ? 1.7283 2.4571 1.6180 -0.5394 0.0329  -0.0261 194 ARG A CZ  
1291 N NH1 . ARG A 194 ? 1.7496 2.5031 1.6177 -0.5538 0.0433  -0.0286 194 ARG A NH1 
1292 N NH2 . ARG A 194 ? 1.7751 2.4802 1.6648 -0.5394 0.0207  -0.0009 194 ARG A NH2 
1293 N N   . PHE A 195 ? 1.6152 2.3296 1.5872 -0.4640 0.0614  -0.1421 195 PHE A N   
1294 C CA  . PHE A 195 ? 1.5788 2.2848 1.5844 -0.4453 0.0701  -0.1515 195 PHE A CA  
1295 C C   . PHE A 195 ? 1.5607 2.2672 1.5862 -0.4432 0.0743  -0.1363 195 PHE A C   
1296 O O   . PHE A 195 ? 1.5704 2.2642 1.5958 -0.4495 0.0653  -0.1154 195 PHE A O   
1297 C CB  . PHE A 195 ? 1.5696 2.2529 1.5972 -0.4388 0.0571  -0.1496 195 PHE A CB  
1298 C CG  . PHE A 195 ? 1.6038 2.2762 1.6101 -0.4442 0.0486  -0.1652 195 PHE A CG  
1299 C CD1 . PHE A 195 ? 1.6039 2.2579 1.6284 -0.4342 0.0464  -0.1758 195 PHE A CD1 
1300 C CD2 . PHE A 195 ? 1.6498 2.3235 1.6116 -0.4615 0.0413  -0.1684 195 PHE A CD2 
1301 C CE1 . PHE A 195 ? 1.6561 2.2901 1.6543 -0.4430 0.0355  -0.1894 195 PHE A CE1 
1302 C CE2 . PHE A 195 ? 1.7021 2.3520 1.6318 -0.4703 0.0304  -0.1835 195 PHE A CE2 
1303 C CZ  . PHE A 195 ? 1.7088 2.3375 1.6565 -0.4620 0.0267  -0.1938 195 PHE A CZ  
1304 N N   . HIS A 196 ? 1.4867 2.2034 1.5258 -0.4345 0.0870  -0.1453 196 HIS A N   
1305 C CA  . HIS A 196 ? 1.4829 2.1905 1.5351 -0.4357 0.0869  -0.1324 196 HIS A CA  
1306 C C   . HIS A 196 ? 1.4402 2.1289 1.5165 -0.4187 0.0897  -0.1411 196 HIS A C   
1307 O O   . HIS A 196 ? 1.4279 2.1348 1.5169 -0.4086 0.0993  -0.1558 196 HIS A O   
1308 C CB  . HIS A 196 ? 1.5185 2.2610 1.5665 -0.4476 0.0949  -0.1269 196 HIS A CB  
1309 C CG  . HIS A 196 ? 1.5557 2.3126 1.5788 -0.4675 0.0919  -0.1124 196 HIS A CG  
1310 N ND1 . HIS A 196 ? 1.5757 2.3592 1.5799 -0.4709 0.0993  -0.1191 196 HIS A ND1 
1311 C CD2 . HIS A 196 ? 1.5892 2.3323 1.5972 -0.4855 0.0827  -0.0910 196 HIS A CD2 
1312 C CE1 . HIS A 196 ? 1.6117 2.4028 1.5948 -0.4904 0.0945  -0.1017 196 HIS A CE1 
1313 N NE2 . HIS A 196 ? 1.6223 2.3892 1.6086 -0.4997 0.0840  -0.0842 196 HIS A NE2 
1314 N N   . ASP A 197 ? 1.6848 2.3356 1.7654 -0.4133 0.0837  -0.1306 197 ASP A N   
1315 C CA  . ASP A 197 ? 1.6483 2.2768 1.7446 -0.3993 0.0869  -0.1361 197 ASP A CA  
1316 C C   . ASP A 197 ? 1.6791 2.3107 1.7687 -0.4101 0.0868  -0.1298 197 ASP A C   
1317 O O   . ASP A 197 ? 1.7370 2.3562 1.8043 -0.4267 0.0810  -0.1138 197 ASP A O   
1318 C CB  . ASP A 197 ? 1.6419 2.2266 1.7402 -0.3877 0.0846  -0.1247 197 ASP A CB  
1319 C CG  . ASP A 197 ? 1.5953 2.1652 1.7154 -0.3692 0.0893  -0.1355 197 ASP A CG  
1320 O OD1 . ASP A 197 ? 1.5822 2.1559 1.7074 -0.3662 0.0927  -0.1462 197 ASP A OD1 
1321 O OD2 . ASP A 197 ? 1.5795 2.1373 1.7141 -0.3582 0.0889  -0.1304 197 ASP A OD2 
1322 N N   . LEU A 198 ? 0.9818 1.6300 1.0900 -0.4025 0.0914  -0.1400 198 LEU A N   
1323 C CA  . LEU A 198 ? 1.0208 1.6852 1.1301 -0.4161 0.0879  -0.1304 198 LEU A CA  
1324 C C   . LEU A 198 ? 1.0346 1.6523 1.1357 -0.4144 0.0808  -0.1259 198 LEU A C   
1325 O O   . LEU A 198 ? 0.9910 1.5971 1.1079 -0.3958 0.0849  -0.1371 198 LEU A O   
1326 C CB  . LEU A 198 ? 1.0113 1.7325 1.1489 -0.4080 0.0984  -0.1391 198 LEU A CB  
1327 C CG  . LEU A 198 ? 1.0252 1.7864 1.1622 -0.4048 0.1106  -0.1468 198 LEU A CG  
1328 C CD1 . LEU A 198 ? 1.0460 1.8566 1.2079 -0.3904 0.1263  -0.1522 198 LEU A CD1 
1329 C CD2 . LEU A 198 ? 1.0755 1.8509 1.1924 -0.4288 0.1059  -0.1301 198 LEU A CD2 
1330 N N   . THR A 199 ? 1.2488 1.8337 1.3186 -0.4350 0.0697  -0.1092 199 THR A N   
1331 C CA  . THR A 199 ? 1.2918 1.8177 1.3370 -0.4361 0.0622  -0.1046 199 THR A CA  
1332 C C   . THR A 199 ? 1.2689 1.8217 1.3420 -0.4310 0.0603  -0.1103 199 THR A C   
1333 O O   . THR A 199 ? 1.2528 1.8614 1.3486 -0.4443 0.0557  -0.1029 199 THR A O   
1334 C CB  . THR A 199 ? 1.3760 1.8619 1.3742 -0.4665 0.0471  -0.0855 199 THR A CB  
1335 O OG1 . THR A 199 ? 1.3948 1.8732 1.3728 -0.4749 0.0483  -0.0773 199 THR A OG1 
1336 C CG2 . THR A 199 ? 1.4107 1.8077 1.3614 -0.4631 0.0431  -0.0829 199 THR A CG2 
1337 N N   . LEU A 200 ? 0.9943 1.5102 1.0680 -0.4105 0.0648  -0.1200 200 LEU A N   
1338 C CA  . LEU A 200 ? 0.9384 1.4696 1.0341 -0.4039 0.0619  -0.1239 200 LEU A CA  
1339 C C   . LEU A 200 ? 1.0526 1.5243 1.1065 -0.4198 0.0469  -0.1125 200 LEU A C   
1340 O O   . LEU A 200 ? 1.0958 1.4938 1.1023 -0.4189 0.0478  -0.1101 200 LEU A O   
1341 C CB  . LEU A 200 ? 0.8457 1.3708 0.9652 -0.3732 0.0753  -0.1415 200 LEU A CB  
1342 C CG  . LEU A 200 ? 0.7926 1.3586 0.9406 -0.3590 0.0877  -0.1549 200 LEU A CG  
1343 C CD1 . LEU A 200 ? 0.7701 1.3213 0.9359 -0.3348 0.0960  -0.1694 200 LEU A CD1 
1344 C CD2 . LEU A 200 ? 0.7676 1.4014 0.9410 -0.3637 0.0907  -0.1551 200 LEU A CD2 
1345 N N   . THR A 201 ? 1.2333 1.7340 1.3010 -0.4335 0.0334  -0.1034 201 THR A N   
1346 C CA  . THR A 201 ? 1.3404 1.7801 1.3617 -0.4524 0.0149  -0.0924 201 THR A CA  
1347 C C   . THR A 201 ? 1.3286 1.7017 1.3277 -0.4261 0.0259  -0.1056 201 THR A C   
1348 O O   . THR A 201 ? 1.3895 1.6799 1.3269 -0.4339 0.0195  -0.1009 201 THR A O   
1349 C CB  . THR A 201 ? 1.3574 1.8496 1.4076 -0.4704 -0.0038 -0.0772 201 THR A CB  
1350 O OG1 . THR A 201 ? 1.2587 1.7667 1.3433 -0.4428 0.0045  -0.0879 201 THR A OG1 
1351 C CG2 . THR A 201 ? 1.2801 1.8679 1.3806 -0.4819 -0.0039 -0.0647 201 THR A CG2 
1352 N N   . ARG A 202 ? 1.4614 1.8662 1.5057 -0.3952 0.0435  -0.1212 202 ARG A N   
1353 C CA  . ARG A 202 ? 1.4516 1.8031 1.4835 -0.3699 0.0558  -0.1311 202 ARG A CA  
1354 C C   . ARG A 202 ? 1.3445 1.7222 1.4155 -0.3431 0.0753  -0.1448 202 ARG A C   
1355 O O   . ARG A 202 ? 1.2300 1.6619 1.3469 -0.3321 0.0796  -0.1548 202 ARG A O   
1356 C CB  . ARG A 202 ? 1.4580 1.8076 1.4976 -0.3666 0.0476  -0.1311 202 ARG A CB  
1357 C CG  . ARG A 202 ? 1.4733 1.7580 1.4884 -0.3450 0.0590  -0.1374 202 ARG A CG  
1358 C CD  . ARG A 202 ? 1.4881 1.7700 1.5070 -0.3445 0.0484  -0.1357 202 ARG A CD  
1359 N NE  . ARG A 202 ? 1.4842 1.7213 1.4953 -0.3190 0.0635  -0.1434 202 ARG A NE  
1360 C CZ  . ARG A 202 ? 1.5320 1.6850 1.4816 -0.3165 0.0682  -0.1391 202 ARG A CZ  
1361 N NH1 . ARG A 202 ? 1.5899 1.6853 1.4731 -0.3386 0.0575  -0.1293 202 ARG A NH1 
1362 N NH2 . ARG A 202 ? 1.5204 1.6421 1.4701 -0.2918 0.0847  -0.1436 202 ARG A NH2 
1363 N N   . SER A 203 ? 1.1864 1.5213 1.2355 -0.3330 0.0865  -0.1429 203 SER A N   
1364 C CA  . SER A 203 ? 1.0967 1.4576 1.1798 -0.3155 0.0996  -0.1495 203 SER A CA  
1365 C C   . SER A 203 ? 1.0786 1.4077 1.1692 -0.2916 0.1125  -0.1512 203 SER A C   
1366 O O   . SER A 203 ? 0.9904 1.3479 1.1178 -0.2797 0.1188  -0.1571 203 SER A O   
1367 C CB  . SER A 203 ? 1.1315 1.4829 1.1961 -0.3221 0.1019  -0.1394 203 SER A CB  
1368 O OG  . SER A 203 ? 1.0735 1.4423 1.1666 -0.3070 0.1117  -0.1398 203 SER A OG  
1369 N N   . ARG A 204 ? 1.3574 1.6241 1.4082 -0.2867 0.1157  -0.1444 204 ARG A N   
1370 C CA  . ARG A 204 ? 1.3595 1.5945 1.4141 -0.2640 0.1297  -0.1434 204 ARG A CA  
1371 C C   . ARG A 204 ? 1.3738 1.5988 1.4246 -0.2643 0.1226  -0.1504 204 ARG A C   
1372 O O   . ARG A 204 ? 1.4051 1.6157 1.4259 -0.2818 0.1080  -0.1487 204 ARG A O   
1373 C CB  . ARG A 204 ? 1.4193 1.5807 1.4231 -0.2520 0.1448  -0.1283 204 ARG A CB  
1374 C CG  . ARG A 204 ? 1.4271 1.5950 1.4580 -0.2299 0.1641  -0.1162 204 ARG A CG  
1375 C CD  . ARG A 204 ? 1.3860 1.5741 1.4600 -0.2136 0.1723  -0.1181 204 ARG A CD  
1376 N NE  . ARG A 204 ? 1.4005 1.5878 1.4962 -0.1924 0.1920  -0.0981 204 ARG A NE  
1377 C CZ  . ARG A 204 ? 1.3731 1.5967 1.4971 -0.1930 0.1922  -0.0863 204 ARG A CZ  
1378 N NH1 . ARG A 204 ? 1.3316 1.5882 1.4584 -0.2136 0.1754  -0.0955 204 ARG A NH1 
1379 N NH2 . ARG A 204 ? 1.3820 1.6114 1.5325 -0.1731 0.2095  -0.0621 204 ARG A NH2 
1380 N N   . SER A 205 ? 1.3352 1.5687 1.4170 -0.2471 0.1308  -0.1555 205 SER A N   
1381 C CA  . SER A 205 ? 1.3633 1.5753 1.4367 -0.2427 0.1273  -0.1588 205 SER A CA  
1382 C C   . SER A 205 ? 1.3827 1.5612 1.4582 -0.2204 0.1459  -0.1533 205 SER A C   
1383 O O   . SER A 205 ? 1.2803 1.4920 1.4016 -0.2107 0.1510  -0.1575 205 SER A O   
1384 C CB  . SER A 205 ? 1.2484 1.5180 1.3671 -0.2444 0.1171  -0.1711 205 SER A CB  
1385 O OG  . SER A 205 ? 1.2592 1.5098 1.3801 -0.2336 0.1175  -0.1730 205 SER A OG  
1386 N N   . PRO A 206 ? 1.7070 1.8161 1.7287 -0.2128 0.1571  -0.1423 206 PRO A N   
1387 C CA  . PRO A 206 ? 1.7091 1.7921 1.7367 -0.1887 0.1801  -0.1323 206 PRO A CA  
1388 C C   . PRO A 206 ? 1.6765 1.7785 1.7391 -0.1817 0.1784  -0.1390 206 PRO A C   
1389 O O   . PRO A 206 ? 1.6546 1.7666 1.7495 -0.1668 0.1930  -0.1312 206 PRO A O   
1390 C CB  . PRO A 206 ? 1.7619 1.7563 1.7103 -0.1816 0.1925  -0.1218 206 PRO A CB  
1391 C CG  . PRO A 206 ? 1.7940 1.7717 1.7010 -0.2022 0.1786  -0.1230 206 PRO A CG  
1392 C CD  . PRO A 206 ? 1.7505 1.7977 1.7000 -0.2254 0.1517  -0.1364 206 PRO A CD  
1393 N N   . ILE A 207 ? 1.1234 1.2331 1.1826 -0.1929 0.1602  -0.1502 207 ILE A N   
1394 C CA  . ILE A 207 ? 1.0813 1.2057 1.1714 -0.1851 0.1581  -0.1564 207 ILE A CA  
1395 C C   . ILE A 207 ? 0.9892 1.1674 1.1145 -0.1948 0.1394  -0.1702 207 ILE A C   
1396 O O   . ILE A 207 ? 1.0291 1.2053 1.1393 -0.2029 0.1248  -0.1710 207 ILE A O   
1397 C CB  . ILE A 207 ? 1.1272 1.1900 1.1709 -0.1786 0.1619  -0.1500 207 ILE A CB  
1398 C CG1 . ILE A 207 ? 1.1287 1.1474 1.1543 -0.1588 0.1894  -0.1354 207 ILE A CG1 
1399 C CG2 . ILE A 207 ? 1.1190 1.2003 1.1906 -0.1755 0.1522  -0.1571 207 ILE A CG2 
1400 C CD1 . ILE A 207 ? 1.1894 1.1274 1.1415 -0.1530 0.1977  -0.1275 207 ILE A CD1 
1401 N N   . PHE A 208 ? 1.2972 1.5219 1.4671 -0.1934 0.1404  -0.1786 208 PHE A N   
1402 C CA  . PHE A 208 ? 1.2264 1.4975 1.4266 -0.1960 0.1297  -0.1918 208 PHE A CA  
1403 C C   . PHE A 208 ? 1.2210 1.4864 1.4409 -0.1830 0.1314  -0.1976 208 PHE A C   
1404 O O   . PHE A 208 ? 1.2109 1.4661 1.4451 -0.1770 0.1396  -0.1974 208 PHE A O   
1405 C CB  . PHE A 208 ? 1.1583 1.4684 1.3817 -0.2014 0.1308  -0.1992 208 PHE A CB  
1406 C CG  . PHE A 208 ? 1.1202 1.4692 1.3672 -0.1992 0.1262  -0.2136 208 PHE A CG  
1407 C CD1 . PHE A 208 ? 1.1237 1.4963 1.3725 -0.1996 0.1192  -0.2138 208 PHE A CD1 
1408 C CD2 . PHE A 208 ? 1.1044 1.4645 1.3684 -0.1969 0.1293  -0.2244 208 PHE A CD2 
1409 C CE1 . PHE A 208 ? 1.1085 1.5166 1.3784 -0.1913 0.1210  -0.2241 208 PHE A CE1 
1410 C CE2 . PHE A 208 ? 1.1137 1.4970 1.3869 -0.1912 0.1293  -0.2386 208 PHE A CE2 
1411 C CZ  . PHE A 208 ? 1.1136 1.5218 1.3911 -0.1852 0.1280  -0.2382 208 PHE A CZ  
1412 N N   . SER A 209 ? 1.4082 1.6814 1.6302 -0.1797 0.1227  -0.1997 209 SER A N   
1413 C CA  . SER A 209 ? 1.4284 1.6877 1.6632 -0.1657 0.1242  -0.2030 209 SER A CA  
1414 C C   . SER A 209 ? 1.4141 1.7063 1.6730 -0.1560 0.1194  -0.2110 209 SER A C   
1415 O O   . SER A 209 ? 1.4360 1.7165 1.7072 -0.1427 0.1235  -0.2176 209 SER A O   
1416 C CB  . SER A 209 ? 1.5142 1.7278 1.7195 -0.1635 0.1231  -0.1909 209 SER A CB  
1417 O OG  . SER A 209 ? 1.5706 1.7751 1.7431 -0.1767 0.1127  -0.1816 209 SER A OG  
1418 N N   . LEU A 210 ? 1.0467 1.3789 1.3123 -0.1613 0.1121  -0.2081 210 LEU A N   
1419 C CA  . LEU A 210 ? 1.0455 1.4144 1.3378 -0.1464 0.1122  -0.2106 210 LEU A CA  
1420 C C   . LEU A 210 ? 1.0067 1.4255 1.3144 -0.1479 0.1167  -0.2156 210 LEU A C   
1421 O O   . LEU A 210 ? 1.0149 1.4364 1.3280 -0.1375 0.1282  -0.2308 210 LEU A O   
1422 C CB  . LEU A 210 ? 1.0833 1.4620 1.3783 -0.1460 0.0988  -0.1929 210 LEU A CB  
1423 C CG  . LEU A 210 ? 1.1493 1.4744 1.4165 -0.1495 0.0923  -0.1851 210 LEU A CG  
1424 C CD1 . LEU A 210 ? 1.2055 1.5425 1.4691 -0.1564 0.0734  -0.1652 210 LEU A CD1 
1425 C CD2 . LEU A 210 ? 1.1767 1.4681 1.4494 -0.1309 0.1029  -0.1943 210 LEU A CD2 
1426 N N   . SER A 211 ? 1.2326 1.6867 1.5422 -0.1625 0.1071  -0.2019 211 SER A N   
1427 C CA  . SER A 211 ? 1.2014 1.7050 1.5245 -0.1663 0.1122  -0.2032 211 SER A CA  
1428 C C   . SER A 211 ? 1.1874 1.6966 1.4917 -0.1942 0.1011  -0.1932 211 SER A C   
1429 O O   . SER A 211 ? 1.2222 1.7085 1.5058 -0.2100 0.0866  -0.1799 211 SER A O   
1430 C CB  . SER A 211 ? 1.2091 1.7689 1.5659 -0.1511 0.1145  -0.1912 211 SER A CB  
1431 O OG  . SER A 211 ? 1.1909 1.8002 1.5598 -0.1537 0.1228  -0.1902 211 SER A OG  
1432 N N   . TRP A 212 ? 0.9048 1.4373 1.2093 -0.2007 0.1079  -0.1995 212 TRP A N   
1433 C CA  . TRP A 212 ? 0.9066 1.4417 1.1912 -0.2263 0.0988  -0.1903 212 TRP A CA  
1434 C C   . TRP A 212 ? 0.8886 1.4837 1.1918 -0.2307 0.1034  -0.1869 212 TRP A C   
1435 O O   . TRP A 212 ? 0.8819 1.4900 1.1914 -0.2183 0.1181  -0.2013 212 TRP A O   
1436 C CB  . TRP A 212 ? 0.9076 1.3968 1.1668 -0.2311 0.1036  -0.1999 212 TRP A CB  
1437 C CG  . TRP A 212 ? 0.9314 1.4125 1.1648 -0.2532 0.0971  -0.1908 212 TRP A CG  
1438 C CD1 . TRP A 212 ? 0.9642 1.4658 1.1886 -0.2737 0.0846  -0.1760 212 TRP A CD1 
1439 C CD2 . TRP A 212 ? 0.9430 1.3907 1.1555 -0.2572 0.1022  -0.1928 212 TRP A CD2 
1440 N NE1 . TRP A 212 ? 1.0071 1.4824 1.2000 -0.2900 0.0822  -0.1716 212 TRP A NE1 
1441 C CE2 . TRP A 212 ? 0.9918 1.4354 1.1787 -0.2777 0.0942  -0.1812 212 TRP A CE2 
1442 C CE3 . TRP A 212 ? 0.9256 1.3493 1.1411 -0.2463 0.1119  -0.1999 212 TRP A CE3 
1443 C CZ2 . TRP A 212 ? 1.0274 1.4407 1.1902 -0.2828 0.0984  -0.1775 212 TRP A CZ2 
1444 C CZ3 . TRP A 212 ? 0.9468 1.3502 1.1457 -0.2523 0.1152  -0.1930 212 TRP A CZ3 
1445 C CH2 . TRP A 212 ? 0.9988 1.3954 1.1708 -0.2681 0.1098  -0.1825 212 TRP A CH2 
1446 N N   . THR A 213 ? 0.8514 1.4811 1.1598 -0.2498 0.0902  -0.1661 213 THR A N   
1447 C CA  . THR A 213 ? 0.8407 1.5321 1.1683 -0.2562 0.0952  -0.1579 213 THR A CA  
1448 C C   . THR A 213 ? 0.8618 1.5382 1.1591 -0.2839 0.0872  -0.1547 213 THR A C   
1449 O O   . THR A 213 ? 0.8594 1.5166 1.1341 -0.3096 0.0683  -0.1392 213 THR A O   
1450 C CB  . THR A 213 ? 0.8452 1.5995 1.2078 -0.2612 0.0858  -0.1308 213 THR A CB  
1451 O OG1 . THR A 213 ? 0.8366 1.6045 1.2287 -0.2310 0.0951  -0.1316 213 THR A OG1 
1452 C CG2 . THR A 213 ? 0.8390 1.6625 1.2252 -0.2652 0.0958  -0.1198 213 THR A CG2 
1453 N N   . VAL A 214 ? 1.1843 1.8632 1.4755 -0.2794 0.1007  -0.1689 214 VAL A N   
1454 C CA  . VAL A 214 ? 1.2109 1.8728 1.4736 -0.3018 0.0951  -0.1663 214 VAL A CA  
1455 C C   . VAL A 214 ? 1.2300 1.9491 1.5035 -0.3206 0.0916  -0.1489 214 VAL A C   
1456 O O   . VAL A 214 ? 1.2143 1.9912 1.5187 -0.3080 0.1042  -0.1464 214 VAL A O   
1457 C CB  . VAL A 214 ? 1.2028 1.8447 1.4546 -0.2917 0.1075  -0.1854 214 VAL A CB  
1458 C CG1 . VAL A 214 ? 1.2339 1.8371 1.4542 -0.3092 0.1002  -0.1805 214 VAL A CG1 
1459 C CG2 . VAL A 214 ? 1.1821 1.7914 1.4391 -0.2693 0.1146  -0.2013 214 VAL A CG2 
1460 N N   . MET A 215 ? 1.0857 1.7859 1.3312 -0.3497 0.0764  -0.1352 215 MET A N   
1461 C CA  . MET A 215 ? 1.1172 1.8703 1.3721 -0.3734 0.0696  -0.1144 215 MET A CA  
1462 C C   . MET A 215 ? 1.1753 1.9055 1.3956 -0.3947 0.0660  -0.1124 215 MET A C   
1463 O O   . MET A 215 ? 1.2294 1.8921 1.4088 -0.4028 0.0583  -0.1155 215 MET A O   
1464 C CB  . MET A 215 ? 1.1625 1.9252 1.4198 -0.3977 0.0462  -0.0889 215 MET A CB  
1465 C CG  . MET A 215 ? 1.1164 1.9047 1.4096 -0.3785 0.0465  -0.0853 215 MET A CG  
1466 S SD  . MET A 215 ? 1.2051 1.9834 1.4855 -0.4141 0.0107  -0.0548 215 MET A SD  
1467 C CE  . MET A 215 ? 1.1605 1.9251 1.4615 -0.3824 0.0144  -0.0635 215 MET A CE  
1468 N N   . HIS A 216 ? 1.1755 1.9618 1.4114 -0.4012 0.0738  -0.1053 216 HIS A N   
1469 C CA  . HIS A 216 ? 1.2442 2.0186 1.4504 -0.4253 0.0682  -0.0977 216 HIS A CA  
1470 C C   . HIS A 216 ? 1.2903 2.1193 1.5105 -0.4552 0.0562  -0.0685 216 HIS A C   
1471 O O   . HIS A 216 ? 1.2661 2.1682 1.5210 -0.4499 0.0699  -0.0605 216 HIS A O   
1472 C CB  . HIS A 216 ? 1.2294 2.0205 1.4366 -0.4099 0.0875  -0.1135 216 HIS A CB  
1473 C CG  . HIS A 216 ? 1.3026 2.1037 1.4891 -0.4339 0.0839  -0.1013 216 HIS A CG  
1474 N ND1 . HIS A 216 ? 1.3708 2.1136 1.5165 -0.4497 0.0727  -0.0984 216 HIS A ND1 
1475 C CD2 . HIS A 216 ? 1.3327 2.1949 1.5326 -0.4435 0.0919  -0.0894 216 HIS A CD2 
1476 C CE1 . HIS A 216 ? 1.4379 2.2030 1.5719 -0.4697 0.0714  -0.0860 216 HIS A CE1 
1477 N NE2 . HIS A 216 ? 1.4135 2.2523 1.5803 -0.4674 0.0829  -0.0804 216 HIS A NE2 
1478 N N   . PRO A 217 ? 1.2538 2.0453 1.4440 -0.4875 0.0307  -0.0506 217 PRO A N   
1479 C CA  . PRO A 217 ? 1.3260 2.1641 1.5242 -0.5252 0.0135  -0.0186 217 PRO A CA  
1480 C C   . PRO A 217 ? 1.3502 2.2210 1.5469 -0.5334 0.0249  -0.0147 217 PRO A C   
1481 O O   . PRO A 217 ? 1.3736 2.1956 1.5363 -0.5256 0.0327  -0.0321 217 PRO A O   
1482 C CB  . PRO A 217 ? 1.4758 2.2277 1.6115 -0.5590 -0.0153 -0.0092 217 PRO A CB  
1483 C CG  . PRO A 217 ? 1.4788 2.1419 1.5730 -0.5332 -0.0046 -0.0373 217 PRO A CG  
1484 C CD  . PRO A 217 ? 1.3234 2.0225 1.4646 -0.4923 0.0168  -0.0574 217 PRO A CD  
1485 N N   . ILE A 218 ? 0.9913 1.9478 1.2272 -0.5478 0.0266  0.0107  218 ILE A N   
1486 C CA  . ILE A 218 ? 1.0342 2.0248 1.2670 -0.5579 0.0377  0.0178  218 ILE A CA  
1487 C C   . ILE A 218 ? 1.1610 2.1515 1.3730 -0.6096 0.0103  0.0508  218 ILE A C   
1488 O O   . ILE A 218 ? 1.1743 2.2245 1.4208 -0.6334 -0.0040 0.0825  218 ILE A O   
1489 C CB  . ILE A 218 ? 0.9686 2.0568 1.2568 -0.5326 0.0672  0.0231  218 ILE A CB  
1490 C CG1 . ILE A 218 ? 0.8782 1.9573 1.1807 -0.4839 0.0913  -0.0083 218 ILE A CG1 
1491 C CG2 . ILE A 218 ? 1.0315 2.1423 1.3051 -0.5398 0.0814  0.0258  218 ILE A CG2 
1492 C CD1 . ILE A 218 ? 0.8635 2.0155 1.2014 -0.4527 0.1256  -0.0089 218 ILE A CD1 
1493 N N   . ASP A 219 ? 1.7434 2.6647 1.8981 -0.6278 0.0017  0.0457  219 ASP A N   
1494 C CA  . ASP A 219 ? 1.9036 2.8051 2.0237 -0.6785 -0.0251 0.0746  219 ASP A CA  
1495 C C   . ASP A 219 ? 1.9767 2.8619 2.0663 -0.6835 -0.0154 0.0715  219 ASP A C   
1496 O O   . ASP A 219 ? 1.8951 2.8001 1.9984 -0.6501 0.0108  0.0506  219 ASP A O   
1497 C CB  . ASP A 219 ? 2.0324 2.8269 2.0892 -0.6994 -0.0528 0.0728  219 ASP A CB  
1498 C CG  . ASP A 219 ? 2.0244 2.7202 2.0273 -0.6732 -0.0419 0.0428  219 ASP A CG  
1499 O OD1 . ASP A 219 ? 1.9653 2.6771 1.9797 -0.6466 -0.0189 0.0267  219 ASP A OD1 
1500 O OD2 . ASP A 219 ? 2.0798 2.6814 2.0273 -0.6793 -0.0562 0.0378  219 ASP A OD2 
1501 N N   . HIS A 220 ? 2.2193 3.0620 2.2619 -0.7265 -0.0380 0.0924  220 HIS A N   
1502 C CA  . HIS A 220 ? 2.2749 3.1059 2.2898 -0.7330 -0.0299 0.0936  220 HIS A CA  
1503 C C   . HIS A 220 ? 2.1767 2.9409 2.1596 -0.6967 -0.0137 0.0621  220 HIS A C   
1504 O O   . HIS A 220 ? 2.1639 2.9263 2.1305 -0.6956 -0.0047 0.0616  220 HIS A O   
1505 C CB  . HIS A 220 ? 2.4460 3.2344 2.4102 -0.7873 -0.0583 0.1232  220 HIS A CB  
1506 C CG  . HIS A 220 ? 2.5384 3.2428 2.4525 -0.8162 -0.0895 0.1309  220 HIS A CG  
1507 N ND1 . HIS A 220 ? 2.6199 3.3598 2.5482 -0.8599 -0.1172 0.1624  220 HIS A ND1 
1508 C CD2 . HIS A 220 ? 2.5233 3.1060 2.3676 -0.8087 -0.0973 0.1136  220 HIS A CD2 
1509 C CE1 . HIS A 220 ? 2.7156 3.3524 2.5780 -0.8806 -0.1434 0.1614  220 HIS A CE1 
1510 N NE2 . HIS A 220 ? 2.6491 3.1875 2.4579 -0.8479 -0.1293 0.1312  220 HIS A NE2 
1511 N N   . HIS A 221 ? 1.7145 2.4294 1.6917 -0.6678 -0.0102 0.0392  221 HIS A N   
1512 C CA  . HIS A 221 ? 1.6103 2.2731 1.5677 -0.6334 0.0047  0.0148  221 HIS A CA  
1513 C C   . HIS A 221 ? 1.4971 2.2141 1.5031 -0.5937 0.0282  -0.0086 221 HIS A C   
1514 O O   . HIS A 221 ? 1.4256 2.1217 1.4238 -0.5708 0.0394  -0.0239 221 HIS A O   
1515 C CB  . HIS A 221 ? 1.6097 2.1685 1.5182 -0.6264 -0.0042 0.0072  221 HIS A CB  
1516 C CG  . HIS A 221 ? 1.7340 2.2113 1.5729 -0.6598 -0.0234 0.0258  221 HIS A CG  
1517 N ND1 . HIS A 221 ? 1.7920 2.1703 1.5728 -0.6649 -0.0352 0.0256  221 HIS A ND1 
1518 C CD2 . HIS A 221 ? 1.8285 2.3013 1.6393 -0.6904 -0.0325 0.0453  221 HIS A CD2 
1519 C CE1 . HIS A 221 ? 1.9234 2.2334 1.6387 -0.6968 -0.0508 0.0431  221 HIS A CE1 
1520 N NE2 . HIS A 221 ? 1.9470 2.3144 1.6817 -0.7137 -0.0504 0.0560  221 HIS A NE2 
1521 N N   . SER A 222 ? 1.4972 2.2814 1.5511 -0.5864 0.0346  -0.0089 222 SER A N   
1522 C CA  . SER A 222 ? 1.3793 2.2049 1.4698 -0.5494 0.0573  -0.0313 222 SER A CA  
1523 C C   . SER A 222 ? 1.3737 2.2458 1.4682 -0.5452 0.0741  -0.0328 222 SER A C   
1524 O O   . SER A 222 ? 1.4414 2.3671 1.5457 -0.5655 0.0761  -0.0123 222 SER A O   
1525 C CB  . SER A 222 ? 1.2989 2.1817 1.4368 -0.5397 0.0622  -0.0281 222 SER A CB  
1526 O OG  . SER A 222 ? 1.2101 2.1232 1.3739 -0.5033 0.0860  -0.0500 222 SER A OG  
1527 N N   . PRO A 223 ? 1.1394 1.9910 1.2241 -0.5208 0.0855  -0.0552 223 PRO A N   
1528 C CA  . PRO A 223 ? 1.1542 2.0403 1.2316 -0.5178 0.1000  -0.0585 223 PRO A CA  
1529 C C   . PRO A 223 ? 1.1729 2.1333 1.2816 -0.5060 0.1217  -0.0574 223 PRO A C   
1530 O O   . PRO A 223 ? 1.2144 2.2064 1.3124 -0.5042 0.1373  -0.0573 223 PRO A O   
1531 C CB  . PRO A 223 ? 1.0876 1.9338 1.1515 -0.4943 0.1034  -0.0827 223 PRO A CB  
1532 C CG  . PRO A 223 ? 1.0525 1.8378 1.1106 -0.4916 0.0889  -0.0839 223 PRO A CG  
1533 C CD  . PRO A 223 ? 1.0673 1.8613 1.1438 -0.4986 0.0835  -0.0751 223 PRO A CD  
1534 N N   . ILE A 224 ? 1.3780 2.3645 1.5227 -0.4962 0.1243  -0.0548 224 ILE A N   
1535 C CA  . ILE A 224 ? 1.3903 2.4513 1.5704 -0.4804 0.1481  -0.0480 224 ILE A CA  
1536 C C   . ILE A 224 ? 1.3907 2.5106 1.6050 -0.5064 0.1394  -0.0117 224 ILE A C   
1537 O O   . ILE A 224 ? 1.3559 2.5412 1.6145 -0.4925 0.1544  0.0014  224 ILE A O   
1538 C CB  . ILE A 224 ? 1.3120 2.3697 1.5134 -0.4432 0.1622  -0.0698 224 ILE A CB  
1539 C CG1 . ILE A 224 ? 1.2182 2.2426 1.4346 -0.4471 0.1408  -0.0689 224 ILE A CG1 
1540 C CG2 . ILE A 224 ? 1.3380 2.3477 1.5045 -0.4213 0.1721  -0.1020 224 ILE A CG2 
1541 C CD1 . ILE A 224 ? 1.1496 2.1611 1.3829 -0.4122 0.1521  -0.0906 224 ILE A CD1 
1542 N N   . TYR A 225 ? 1.7862 2.8814 1.9785 -0.5448 0.1145  0.0071  225 TYR A N   
1543 C CA  . TYR A 225 ? 1.8182 2.9600 2.0346 -0.5800 0.0985  0.0448  225 TYR A CA  
1544 C C   . TYR A 225 ? 1.8666 3.1011 2.1132 -0.5842 0.1199  0.0702  225 TYR A C   
1545 O O   . TYR A 225 ? 1.9418 3.1791 2.1634 -0.5811 0.1356  0.0645  225 TYR A O   
1546 C CB  . TYR A 225 ? 1.9206 2.9969 2.0904 -0.6211 0.0676  0.0567  225 TYR A CB  
1547 C CG  . TYR A 225 ? 1.9877 3.1006 2.1725 -0.6656 0.0447  0.0967  225 TYR A CG  
1548 C CD1 . TYR A 225 ? 1.9415 3.0702 2.1554 -0.6742 0.0282  0.1104  225 TYR A CD1 
1549 C CD2 . TYR A 225 ? 2.1120 3.2437 2.2810 -0.7022 0.0371  0.1233  225 TYR A CD2 
1550 C CE1 . TYR A 225 ? 2.0212 3.1844 2.2482 -0.7208 0.0020  0.1508  225 TYR A CE1 
1551 C CE2 . TYR A 225 ? 2.1907 3.3559 2.3729 -0.7487 0.0125  0.1633  225 TYR A CE2 
1552 C CZ  . TYR A 225 ? 2.1466 3.3280 2.3579 -0.7591 -0.0063 0.1775  225 TYR A CZ  
1553 O OH  . TYR A 225 ? 2.2412 3.4568 2.4649 -0.8110 -0.0360 0.2209  225 TYR A OH  
1554 N N   . GLY A 226 ? 1.8560 3.1686 2.1570 -0.5916 0.1203  0.1016  226 GLY A N   
1555 C CA  . GLY A 226 ? 1.9044 3.3161 2.2435 -0.5939 0.1434  0.1332  226 GLY A CA  
1556 C C   . GLY A 226 ? 1.9363 3.3615 2.2634 -0.5502 0.1860  0.1090  226 GLY A C   
1557 O O   . GLY A 226 ? 2.0387 3.4904 2.3493 -0.5567 0.2025  0.1185  226 GLY A O   
1558 N N   . GLU A 227 ? 1.5161 2.9157 1.8446 -0.5069 0.2028  0.0774  227 GLU A N   
1559 C CA  . GLU A 227 ? 1.5816 2.9758 1.8863 -0.4649 0.2411  0.0504  227 GLU A CA  
1560 C C   . GLU A 227 ? 1.5544 3.0125 1.9091 -0.4237 0.2734  0.0590  227 GLU A C   
1561 O O   . GLU A 227 ? 1.4490 2.9071 1.8378 -0.4138 0.2623  0.0593  227 GLU A O   
1562 C CB  . GLU A 227 ? 1.5594 2.8553 1.8144 -0.4499 0.2316  0.0050  227 GLU A CB  
1563 C CG  . GLU A 227 ? 1.6800 2.9444 1.8838 -0.4259 0.2572  -0.0235 227 GLU A CG  
1564 C CD  . GLU A 227 ? 1.7067 2.9351 1.8620 -0.4560 0.2416  -0.0248 227 GLU A CD  
1565 O OE1 . GLU A 227 ? 1.6488 2.8397 1.7981 -0.4858 0.2084  -0.0195 227 GLU A OE1 
1566 O OE2 . GLU A 227 ? 1.7835 3.0165 1.9024 -0.4485 0.2633  -0.0305 227 GLU A OE2 
1567 N N   . THR A 228 ? 1.9902 3.5012 2.3474 -0.3976 0.3150  0.0680  228 THR A N   
1568 C CA  . THR A 228 ? 1.9982 3.5597 2.3945 -0.3486 0.3532  0.0739  228 THR A CA  
1569 C C   . THR A 228 ? 2.0754 3.5581 2.4160 -0.3053 0.3761  0.0254  228 THR A C   
1570 O O   . THR A 228 ? 2.0938 3.4899 2.3754 -0.3167 0.3571  -0.0101 228 THR A O   
1571 C CB  . THR A 228 ? 2.1134 3.7721 2.5397 -0.3331 0.3953  0.1110  228 THR A CB  
1572 O OG1 . THR A 228 ? 2.2797 3.9059 2.6390 -0.3346 0.4141  0.0944  228 THR A OG1 
1573 C CG2 . THR A 228 ? 2.0399 3.7936 2.5358 -0.3753 0.3736  0.1678  228 THR A CG2 
1574 N N   . ASP A 229 ? 1.6338 3.1474 1.9933 -0.2555 0.4172  0.0271  229 ASP A N   
1575 C CA  . ASP A 229 ? 1.7657 3.2021 2.0639 -0.2132 0.4436  -0.0162 229 ASP A CA  
1576 C C   . ASP A 229 ? 1.9776 3.3779 2.1988 -0.2134 0.4649  -0.0336 229 ASP A C   
1577 O O   . ASP A 229 ? 2.0449 3.3534 2.1950 -0.2179 0.4529  -0.0731 229 ASP A O   
1578 C CB  . ASP A 229 ? 1.8249 3.3029 2.1583 -0.1571 0.4870  -0.0051 229 ASP A CB  
1579 C CG  . ASP A 229 ? 1.9823 3.3657 2.2460 -0.1146 0.5108  -0.0511 229 ASP A CG  
1580 O OD1 . ASP A 229 ? 2.1128 3.4157 2.2949 -0.1257 0.5058  -0.0856 229 ASP A OD1 
1581 O OD2 . ASP A 229 ? 1.9906 3.3778 2.2789 -0.0721 0.5325  -0.0510 229 ASP A OD2 
1582 N N   . GLU A 230 ? 1.8560 3.3314 2.0923 -0.2103 0.4953  -0.0010 230 GLU A N   
1583 C CA  . GLU A 230 ? 2.0738 3.5207 2.2351 -0.2101 0.5188  -0.0130 230 GLU A CA  
1584 C C   . GLU A 230 ? 1.9607 3.3336 2.0664 -0.2554 0.4751  -0.0379 230 GLU A C   
1585 O O   . GLU A 230 ? 1.9568 3.2512 1.9797 -0.2495 0.4803  -0.0720 230 GLU A O   
1586 C CB  . GLU A 230 ? 2.1476 3.6986 2.3475 -0.2150 0.5467  0.0351  230 GLU A CB  
1587 N N   . THR A 231 ? 1.8168 3.2122 1.9656 -0.3008 0.4314  -0.0187 231 THR A N   
1588 C CA  . THR A 231 ? 1.7185 3.0514 1.8238 -0.3418 0.3911  -0.0347 231 THR A CA  
1589 C C   . THR A 231 ? 1.6191 2.8558 1.6828 -0.3348 0.3697  -0.0777 231 THR A C   
1590 O O   . THR A 231 ? 1.5351 2.7112 1.5429 -0.3534 0.3510  -0.0972 231 THR A O   
1591 C CB  . THR A 231 ? 1.6145 2.9817 1.7704 -0.3876 0.3513  -0.0043 231 THR A CB  
1592 O OG1 . THR A 231 ? 1.5144 2.9064 1.7320 -0.3806 0.3398  0.0055  231 THR A OG1 
1593 C CG2 . THR A 231 ? 1.7077 3.1575 1.8884 -0.4092 0.3636  0.0385  231 THR A CG2 
1594 N N   . LEU A 232 ? 2.3957 3.6221 2.4897 -0.3092 0.3713  -0.0889 232 LEU A N   
1595 C CA  . LEU A 232 ? 2.3132 3.4537 2.3735 -0.3025 0.3522  -0.1261 232 LEU A CA  
1596 C C   . LEU A 232 ? 2.3601 3.4377 2.3411 -0.2783 0.3760  -0.1584 232 LEU A C   
1597 O O   . LEU A 232 ? 2.2782 3.2875 2.2069 -0.2951 0.3533  -0.1817 232 LEU A O   
1598 C CB  . LEU A 232 ? 2.2631 3.4083 2.3752 -0.2828 0.3475  -0.1277 232 LEU A CB  
1599 C CG  . LEU A 232 ? 2.1136 3.2720 2.2764 -0.3140 0.3083  -0.1104 232 LEU A CG  
1600 C CD1 . LEU A 232 ? 2.0045 3.1607 2.2086 -0.2925 0.3053  -0.1141 232 LEU A CD1 
1601 C CD2 . LEU A 232 ? 2.0185 3.1117 2.1449 -0.3447 0.2735  -0.1257 232 LEU A CD2 
1602 N N   . ARG A 233 ? 1.4821 2.5802 1.4514 -0.2390 0.4215  -0.1576 233 ARG A N   
1603 C CA  . ARG A 233 ? 1.5600 2.5889 1.4380 -0.2162 0.4478  -0.1875 233 ARG A CA  
1604 C C   . ARG A 233 ? 1.5184 2.5219 1.3340 -0.2489 0.4350  -0.1908 233 ARG A C   
1605 O O   . ARG A 233 ? 1.5006 2.4225 1.2377 -0.2553 0.4247  -0.2198 233 ARG A O   
1606 C CB  . ARG A 233 ? 1.7579 2.8209 1.6302 -0.1673 0.5062  -0.1780 233 ARG A CB  
1607 C CG  . ARG A 233 ? 1.8304 2.9142 1.7588 -0.1288 0.5224  -0.1741 233 ARG A CG  
1608 C CD  . ARG A 233 ? 2.0463 3.1242 1.9389 -0.0709 0.5835  -0.1766 233 ARG A CD  
1609 N NE  . ARG A 233 ? 2.1028 3.1443 2.0072 -0.0341 0.5921  -0.1920 233 ARG A NE  
1610 C CZ  . ARG A 233 ? 2.1263 3.2377 2.1246 -0.0187 0.5920  -0.1658 233 ARG A CZ  
1611 N NH1 . ARG A 233 ? 2.0604 3.2807 2.1470 -0.0397 0.5820  -0.1227 233 ARG A NH1 
1612 N NH2 . ARG A 233 ? 2.1845 3.2546 2.1856 0.0152  0.5996  -0.1811 233 ARG A NH2 
1613 N N   . ASN A 234 ? 1.9155 2.9895 1.7668 -0.2723 0.4329  -0.1582 234 ASN A N   
1614 C CA  . ASN A 234 ? 1.9025 2.9655 1.6997 -0.3011 0.4260  -0.1543 234 ASN A CA  
1615 C C   . ASN A 234 ? 1.7611 2.7633 1.5281 -0.3388 0.3773  -0.1695 234 ASN A C   
1616 O O   . ASN A 234 ? 1.7669 2.7290 1.4641 -0.3550 0.3715  -0.1785 234 ASN A O   
1617 C CB  . ASN A 234 ? 1.9389 3.0943 1.7900 -0.3204 0.4318  -0.1118 234 ASN A CB  
1618 C CG  . ASN A 234 ? 2.1167 3.3288 1.9655 -0.2879 0.4871  -0.0931 234 ASN A CG  
1619 O OD1 . ASN A 234 ? 2.2195 3.3965 2.0220 -0.2462 0.5246  -0.1134 234 ASN A OD1 
1620 N ND2 . ASN A 234 ? 2.1732 3.4709 2.0690 -0.3061 0.4939  -0.0524 234 ASN A ND2 
1621 N N   . SER A 235 ? 1.7285 2.7264 1.5488 -0.3521 0.3431  -0.1690 235 SER A N   
1622 C CA  . SER A 235 ? 1.6101 2.5557 1.4124 -0.3817 0.3000  -0.1790 235 SER A CA  
1623 C C   . SER A 235 ? 1.5938 2.4676 1.3612 -0.3669 0.2925  -0.2119 235 SER A C   
1624 O O   . SER A 235 ? 1.5078 2.3401 1.2700 -0.3863 0.2577  -0.2197 235 SER A O   
1625 C CB  . SER A 235 ? 1.5168 2.4906 1.3883 -0.4030 0.2702  -0.1584 235 SER A CB  
1626 O OG  . SER A 235 ? 1.5465 2.5656 1.4792 -0.3848 0.2838  -0.1479 235 SER A OG  
1627 N N   . HIS A 236 ? 2.7247 3.5839 2.4674 -0.3318 0.3266  -0.2284 236 HIS A N   
1628 C CA  . HIS A 236 ? 2.7407 3.5274 2.4465 -0.3162 0.3227  -0.2592 236 HIS A CA  
1629 C C   . HIS A 236 ? 2.6181 3.3983 2.3824 -0.3284 0.2870  -0.2588 236 HIS A C   
1630 O O   . HIS A 236 ? 2.5691 3.2948 2.3079 -0.3447 0.2580  -0.2729 236 HIS A O   
1631 C CB  . HIS A 236 ? 2.7755 3.4878 2.3846 -0.3330 0.3108  -0.2798 236 HIS A CB  
1632 C CG  . HIS A 236 ? 2.8534 3.4836 2.4021 -0.3154 0.3156  -0.3117 236 HIS A CG  
1633 N ND1 . HIS A 236 ? 2.7982 3.3987 2.3777 -0.3158 0.2919  -0.3226 236 HIS A ND1 
1634 C CD2 . HIS A 236 ? 2.9985 3.5626 2.4504 -0.2982 0.3412  -0.3346 236 HIS A CD2 
1635 C CE1 . HIS A 236 ? 2.9064 3.4277 2.4138 -0.3018 0.3006  -0.3503 236 HIS A CE1 
1636 N NE2 . HIS A 236 ? 3.0325 3.5258 2.4577 -0.2906 0.3304  -0.3590 236 HIS A NE2 
1637 N N   . SER A 237 ? 1.8068 2.6437 1.6484 -0.3216 0.2892  -0.2399 237 SER A N   
1638 C CA  . SER A 237 ? 1.6932 2.5266 1.5880 -0.3347 0.2572  -0.2350 237 SER A CA  
1639 C C   . SER A 237 ? 1.7038 2.5123 1.6198 -0.3092 0.2614  -0.2508 237 SER A C   
1640 O O   . SER A 237 ? 1.7918 2.6228 1.7227 -0.2789 0.2907  -0.2511 237 SER A O   
1641 C CB  . SER A 237 ? 1.6505 2.5468 1.6059 -0.3503 0.2495  -0.2043 237 SER A CB  
1642 O OG  . SER A 237 ? 1.7404 2.6964 1.7287 -0.3307 0.2788  -0.1893 237 SER A OG  
1643 N N   . GLU A 238 ? 1.8113 2.5758 1.7309 -0.3206 0.2328  -0.2607 238 GLU A N   
1644 C CA  . GLU A 238 ? 1.8149 2.5517 1.7549 -0.3010 0.2322  -0.2741 238 GLU A CA  
1645 C C   . GLU A 238 ? 1.7091 2.4573 1.7064 -0.3131 0.2074  -0.2603 238 GLU A C   
1646 O O   . GLU A 238 ? 1.6397 2.4056 1.6522 -0.3366 0.1897  -0.2428 238 GLU A O   
1647 C CB  . GLU A 238 ? 1.8507 2.5138 1.7336 -0.3026 0.2227  -0.2996 238 GLU A CB  
1648 C CG  . GLU A 238 ? 1.9594 2.5891 1.7627 -0.2980 0.2413  -0.3153 238 GLU A CG  
1649 C CD  . GLU A 238 ? 2.0053 2.5543 1.7451 -0.3097 0.2229  -0.3380 238 GLU A CD  
1650 O OE1 . GLU A 238 ? 1.9300 2.4645 1.6936 -0.3313 0.1897  -0.3339 238 GLU A OE1 
1651 O OE2 . GLU A 238 ? 2.1322 2.6301 1.7957 -0.2979 0.2416  -0.3579 238 GLU A OE2 
1652 N N   . PHE A 239 ? 1.4682 2.1996 1.4908 -0.2958 0.2075  -0.2682 239 PHE A N   
1653 C CA  . PHE A 239 ? 1.3779 2.1107 1.4460 -0.3038 0.1872  -0.2569 239 PHE A CA  
1654 C C   . PHE A 239 ? 1.3645 2.0448 1.4282 -0.2996 0.1744  -0.2720 239 PHE A C   
1655 O O   . PHE A 239 ? 1.4326 2.0883 1.4860 -0.2786 0.1864  -0.2883 239 PHE A O   
1656 C CB  . PHE A 239 ? 1.3431 2.1207 1.4580 -0.2909 0.1975  -0.2422 239 PHE A CB  
1657 C CG  . PHE A 239 ? 1.3606 2.1964 1.4873 -0.3003 0.2066  -0.2212 239 PHE A CG  
1658 C CD1 . PHE A 239 ? 1.4745 2.3412 1.5877 -0.2836 0.2348  -0.2218 239 PHE A CD1 
1659 C CD2 . PHE A 239 ? 1.2852 2.1405 1.4318 -0.3259 0.1882  -0.1994 239 PHE A CD2 
1660 C CE1 . PHE A 239 ? 1.4986 2.4251 1.6270 -0.2937 0.2439  -0.1984 239 PHE A CE1 
1661 C CE2 . PHE A 239 ? 1.3178 2.2257 1.4743 -0.3393 0.1940  -0.1776 239 PHE A CE2 
1662 C CZ  . PHE A 239 ? 1.4173 2.3661 1.5691 -0.3239 0.2215  -0.1758 239 PHE A CZ  
1663 N N   . LEU A 240 ? 1.1260 1.7895 1.1980 -0.3188 0.1511  -0.2637 240 LEU A N   
1664 C CA  . LEU A 240 ? 1.1173 1.7383 1.1890 -0.3203 0.1366  -0.2714 240 LEU A CA  
1665 C C   . LEU A 240 ? 1.0112 1.6312 1.1258 -0.3152 0.1299  -0.2603 240 LEU A C   
1666 O O   . LEU A 240 ? 0.9377 1.5732 1.0703 -0.3245 0.1233  -0.2424 240 LEU A O   
1667 C CB  . LEU A 240 ? 1.1089 1.7160 1.1605 -0.3444 0.1164  -0.2647 240 LEU A CB  
1668 C CG  . LEU A 240 ? 1.1302 1.6993 1.1797 -0.3509 0.0994  -0.2688 240 LEU A CG  
1669 C CD1 . LEU A 240 ? 1.2126 1.7466 1.2374 -0.3357 0.1098  -0.2927 240 LEU A CD1 
1670 C CD2 . LEU A 240 ? 1.1518 1.7132 1.1739 -0.3764 0.0795  -0.2616 240 LEU A CD2 
1671 N N   . VAL A 241 ? 0.9311 1.5258 1.0551 -0.3006 0.1320  -0.2708 241 VAL A N   
1672 C CA  . VAL A 241 ? 0.8442 1.4318 1.0021 -0.2948 0.1269  -0.2610 241 VAL A CA  
1673 C C   . VAL A 241 ? 0.8361 1.3897 0.9984 -0.2999 0.1138  -0.2602 241 VAL A C   
1674 O O   . VAL A 241 ? 0.9167 1.4433 1.0628 -0.2977 0.1122  -0.2745 241 VAL A O   
1675 C CB  . VAL A 241 ? 0.8131 1.4045 0.9868 -0.2727 0.1398  -0.2679 241 VAL A CB  
1676 C CG1 . VAL A 241 ? 0.7931 1.3710 0.9932 -0.2693 0.1330  -0.2576 241 VAL A CG1 
1677 C CG2 . VAL A 241 ? 0.8156 1.4519 0.9953 -0.2674 0.1528  -0.2621 241 VAL A CG2 
1678 N N   . LEU A 242 ? 0.8577 1.4102 1.0398 -0.3065 0.1054  -0.2414 242 LEU A N   
1679 C CA  . LEU A 242 ? 0.8367 1.3664 1.0340 -0.3082 0.0963  -0.2339 242 LEU A CA  
1680 C C   . LEU A 242 ? 0.7629 1.2793 0.9831 -0.2941 0.1022  -0.2256 242 LEU A C   
1681 O O   . LEU A 242 ? 0.7492 1.2683 0.9728 -0.2925 0.1053  -0.2124 242 LEU A O   
1682 C CB  . LEU A 242 ? 0.8492 1.3875 1.0502 -0.3243 0.0841  -0.2141 242 LEU A CB  
1683 C CG  . LEU A 242 ? 0.8324 1.3771 1.0050 -0.3421 0.0738  -0.2214 242 LEU A CG  
1684 C CD1 . LEU A 242 ? 0.8253 1.3845 1.0067 -0.3581 0.0595  -0.1968 242 LEU A CD1 
1685 C CD2 . LEU A 242 ? 0.9257 1.4428 1.0810 -0.3459 0.0675  -0.2385 242 LEU A CD2 
1686 N N   . PHE A 243 ? 0.7790 1.2739 1.0074 -0.2849 0.1033  -0.2337 243 PHE A N   
1687 C CA  . PHE A 243 ? 0.7558 1.2331 1.0016 -0.2720 0.1085  -0.2256 243 PHE A CA  
1688 C C   . PHE A 243 ? 0.7487 1.2116 1.0129 -0.2747 0.1036  -0.2109 243 PHE A C   
1689 O O   . PHE A 243 ? 0.8620 1.3215 1.1266 -0.2852 0.0940  -0.2145 243 PHE A O   
1690 C CB  . PHE A 243 ? 0.7649 1.2305 1.0099 -0.2575 0.1148  -0.2418 243 PHE A CB  
1691 C CG  . PHE A 243 ? 0.8257 1.2667 1.0849 -0.2464 0.1177  -0.2344 243 PHE A CG  
1692 C CD1 . PHE A 243 ? 0.7889 1.2258 1.0472 -0.2384 0.1222  -0.2280 243 PHE A CD1 
1693 C CD2 . PHE A 243 ? 0.8442 1.2642 1.1140 -0.2470 0.1144  -0.2317 243 PHE A CD2 
1694 C CE1 . PHE A 243 ? 0.7784 1.1871 1.0416 -0.2285 0.1255  -0.2211 243 PHE A CE1 
1695 C CE2 . PHE A 243 ? 0.8187 1.2164 1.0999 -0.2363 0.1192  -0.2231 243 PHE A CE2 
1696 C CZ  . PHE A 243 ? 0.7890 1.1793 1.0648 -0.2258 0.1258  -0.2188 243 PHE A CZ  
1697 N N   . THR A 244 ? 1.0774 1.5296 1.3538 -0.2658 0.1104  -0.1926 244 THR A N   
1698 C CA  . THR A 244 ? 1.0696 1.5139 1.3703 -0.2638 0.1108  -0.1731 244 THR A CA  
1699 C C   . THR A 244 ? 1.0482 1.4660 1.3504 -0.2456 0.1251  -0.1627 244 THR A C   
1700 O O   . THR A 244 ? 1.0516 1.4553 1.3319 -0.2387 0.1319  -0.1648 244 THR A O   
1701 C CB  . THR A 244 ? 1.0763 1.5427 1.3920 -0.2730 0.1059  -0.1484 244 THR A CB  
1702 O OG1 . THR A 244 ? 1.0679 1.5260 1.3764 -0.2608 0.1188  -0.1321 244 THR A OG1 
1703 C CG2 . THR A 244 ? 1.1188 1.6073 1.4202 -0.2921 0.0918  -0.1583 244 THR A CG2 
1704 N N   . GLY A 245 ? 0.7585 1.1666 1.0824 -0.2401 0.1287  -0.1500 245 GLY A N   
1705 C CA  . GLY A 245 ? 0.7642 1.1425 1.0847 -0.2219 0.1444  -0.1395 245 GLY A CA  
1706 C C   . GLY A 245 ? 0.7673 1.1446 1.1183 -0.2189 0.1478  -0.1224 245 GLY A C   
1707 O O   . GLY A 245 ? 0.7684 1.1660 1.1419 -0.2347 0.1341  -0.1208 245 GLY A O   
1708 N N   . HIS A 246 ? 0.7720 1.1223 1.1196 -0.2008 0.1656  -0.1082 246 HIS A N   
1709 C CA  . HIS A 246 ? 0.7808 1.1324 1.1594 -0.1966 0.1722  -0.0878 246 HIS A CA  
1710 C C   . HIS A 246 ? 0.7984 1.1227 1.1673 -0.1946 0.1697  -0.1055 246 HIS A C   
1711 O O   . HIS A 246 ? 0.8298 1.1199 1.1695 -0.1803 0.1802  -0.1124 246 HIS A O   
1712 C CB  . HIS A 246 ? 0.8213 1.1594 1.2015 -0.1739 0.1985  -0.0567 246 HIS A CB  
1713 C CG  . HIS A 246 ? 0.8356 1.1802 1.2510 -0.1674 0.2095  -0.0306 246 HIS A CG  
1714 N ND1 . HIS A 246 ? 0.8199 1.2081 1.2859 -0.1703 0.2120  0.0055  246 HIS A ND1 
1715 C CD2 . HIS A 246 ? 0.8697 1.1868 1.2799 -0.1594 0.2179  -0.0317 246 HIS A CD2 
1716 C CE1 . HIS A 246 ? 0.8408 1.2303 1.3331 -0.1649 0.2224  0.0262  246 HIS A CE1 
1717 N NE2 . HIS A 246 ? 0.8740 1.2178 1.3307 -0.1579 0.2267  0.0029  246 HIS A NE2 
1718 N N   . HIS A 247 ? 0.7893 1.1242 1.1781 -0.2104 0.1542  -0.1116 247 HIS A N   
1719 C CA  . HIS A 247 ? 0.7926 1.0993 1.1705 -0.2089 0.1501  -0.1297 247 HIS A CA  
1720 C C   . HIS A 247 ? 0.8096 1.0996 1.2028 -0.1994 0.1631  -0.1081 247 HIS A C   
1721 O O   . HIS A 247 ? 0.8161 1.1264 1.2440 -0.2085 0.1624  -0.0826 247 HIS A O   
1722 C CB  . HIS A 247 ? 0.8155 1.1257 1.1953 -0.2294 0.1290  -0.1467 247 HIS A CB  
1723 C CG  . HIS A 247 ? 0.8604 1.1401 1.2146 -0.2227 0.1256  -0.1751 247 HIS A CG  
1724 N ND1 . HIS A 247 ? 0.8930 1.1433 1.2448 -0.2108 0.1323  -0.1742 247 HIS A ND1 
1725 C CD2 . HIS A 247 ? 0.8903 1.1654 1.2211 -0.2234 0.1184  -0.2021 247 HIS A CD2 
1726 C CE1 . HIS A 247 ? 0.9362 1.1666 1.2669 -0.2040 0.1281  -0.1987 247 HIS A CE1 
1727 N NE2 . HIS A 247 ? 0.9371 1.1827 1.2553 -0.2099 0.1214  -0.2155 247 HIS A NE2 
1728 N N   . GLU A 248 ? 0.9675 1.2229 1.3353 -0.1827 0.1739  -0.1156 248 GLU A N   
1729 C CA  . GLU A 248 ? 1.0169 1.2509 1.3916 -0.1723 0.1880  -0.0966 248 GLU A CA  
1730 C C   . GLU A 248 ? 1.0459 1.2811 1.4453 -0.1878 0.1751  -0.0948 248 GLU A C   
1731 O O   . GLU A 248 ? 1.0712 1.3122 1.4975 -0.1891 0.1834  -0.0673 248 GLU A O   
1732 C CB  . GLU A 248 ? 1.0679 1.2595 1.4021 -0.1552 0.1970  -0.1077 248 GLU A CB  
1733 C CG  . GLU A 248 ? 1.1043 1.2769 1.4077 -0.1398 0.2158  -0.0963 248 GLU A CG  
1734 C CD  . GLU A 248 ? 1.1811 1.3073 1.4351 -0.1298 0.2181  -0.1076 248 GLU A CD  
1735 O OE1 . GLU A 248 ? 1.1910 1.3007 1.4427 -0.1292 0.2119  -0.1150 248 GLU A OE1 
1736 O OE2 . GLU A 248 ? 1.2052 1.3081 1.4191 -0.1244 0.2244  -0.1075 248 GLU A OE2 
1737 N N   . ALA A 249 ? 0.9643 1.1910 1.3516 -0.1991 0.1559  -0.1224 249 ALA A N   
1738 C CA  . ALA A 249 ? 0.8589 1.0727 1.2562 -0.2164 0.1412  -0.1241 249 ALA A CA  
1739 C C   . ALA A 249 ? 0.8600 1.1055 1.2961 -0.2385 0.1340  -0.0940 249 ALA A C   
1740 O O   . ALA A 249 ? 0.9075 1.1494 1.3657 -0.2469 0.1341  -0.0720 249 ALA A O   
1741 C CB  . ALA A 249 ? 0.9043 1.1030 1.2757 -0.2243 0.1243  -0.1572 249 ALA A CB  
1742 N N   . PHE A 250 ? 1.0286 1.3092 1.4755 -0.2492 0.1268  -0.0895 250 PHE A N   
1743 C CA  . PHE A 250 ? 1.0384 1.3562 1.5246 -0.2744 0.1140  -0.0588 250 PHE A CA  
1744 C C   . PHE A 250 ? 0.9713 1.3308 1.4976 -0.2604 0.1350  -0.0181 250 PHE A C   
1745 O O   . PHE A 250 ? 0.9745 1.3749 1.5459 -0.2776 0.1279  0.0180  250 PHE A O   
1746 C CB  . PHE A 250 ? 1.0611 1.3904 1.5332 -0.2979 0.0900  -0.0751 250 PHE A CB  
1747 C CG  . PHE A 250 ? 1.1511 1.4340 1.5744 -0.3030 0.0770  -0.1167 250 PHE A CG  
1748 C CD1 . PHE A 250 ? 1.1242 1.4004 1.5145 -0.2884 0.0820  -0.1471 250 PHE A CD1 
1749 C CD2 . PHE A 250 ? 1.2800 1.5239 1.6892 -0.3205 0.0620  -0.1229 250 PHE A CD2 
1750 C CE1 . PHE A 250 ? 1.2198 1.4565 1.5680 -0.2872 0.0754  -0.1812 250 PHE A CE1 
1751 C CE2 . PHE A 250 ? 1.3929 1.5868 1.7521 -0.3194 0.0548  -0.1599 250 PHE A CE2 
1752 C CZ  . PHE A 250 ? 1.3606 1.5531 1.6910 -0.3004 0.0633  -0.1883 250 PHE A CZ  
1753 N N   . ALA A 251 ? 0.8803 1.2270 1.3877 -0.2292 0.1609  -0.0214 251 ALA A N   
1754 C CA  . ALA A 251 ? 0.8533 1.2262 1.3849 -0.2091 0.1864  0.0144  251 ALA A CA  
1755 C C   . ALA A 251 ? 0.8128 1.2354 1.3741 -0.2241 0.1737  0.0318  251 ALA A C   
1756 O O   . ALA A 251 ? 0.8048 1.2708 1.4142 -0.2229 0.1821  0.0751  251 ALA A O   
1757 C CB  . ALA A 251 ? 0.8901 1.2735 1.4585 -0.2028 0.2033  0.0529  251 ALA A CB  
1758 N N   . GLN A 252 ? 1.1350 1.5531 1.6683 -0.2372 0.1542  0.0002  252 GLN A N   
1759 C CA  . GLN A 252 ? 1.1178 1.5770 1.6701 -0.2579 0.1350  0.0103  252 GLN A CA  
1760 C C   . GLN A 252 ? 1.1015 1.5438 1.6084 -0.2564 0.1290  -0.0269 252 GLN A C   
1761 O O   . GLN A 252 ? 1.1093 1.5139 1.5774 -0.2480 0.1315  -0.0608 252 GLN A O   
1762 C CB  . GLN A 252 ? 1.1747 1.6452 1.7438 -0.2962 0.1027  0.0133  252 GLN A CB  
1763 C CG  . GLN A 252 ? 1.1870 1.7024 1.7798 -0.3245 0.0778  0.0330  252 GLN A CG  
1764 C CD  . GLN A 252 ? 1.2919 1.8025 1.8854 -0.3675 0.0420  0.0333  252 GLN A CD  
1765 O OE1 . GLN A 252 ? 1.3568 1.8272 1.9320 -0.3741 0.0376  0.0172  252 GLN A OE1 
1766 N NE2 . GLN A 252 ? 1.3327 1.8791 1.9423 -0.3986 0.0147  0.0526  252 GLN A NE2 
1767 N N   . ASN A 253 ? 0.8354 1.3093 1.3498 -0.2644 0.1212  -0.0176 253 ASN A N   
1768 C CA  . ASN A 253 ? 0.8262 1.2888 1.3000 -0.2643 0.1164  -0.0489 253 ASN A CA  
1769 C C   . ASN A 253 ? 0.8777 1.3275 1.3239 -0.2888 0.0916  -0.0818 253 ASN A C   
1770 O O   . ASN A 253 ? 0.9387 1.3945 1.3965 -0.3143 0.0706  -0.0754 253 ASN A O   
1771 C CB  . ASN A 253 ? 0.8066 1.3024 1.2928 -0.2626 0.1184  -0.0270 253 ASN A CB  
1772 C CG  . ASN A 253 ? 0.7942 1.2711 1.2641 -0.2311 0.1473  -0.0195 253 ASN A CG  
1773 O OD1 . ASN A 253 ? 0.7959 1.2602 1.2317 -0.2275 0.1487  -0.0371 253 ASN A OD1 
1774 N ND2 . ASN A 253 ? 0.8062 1.2756 1.2945 -0.2089 0.1709  0.0071  253 ASN A ND2 
1775 N N   . VAL A 254 ? 0.9104 1.3399 1.3170 -0.2809 0.0948  -0.1150 254 VAL A N   
1776 C CA  . VAL A 254 ? 0.9812 1.3932 1.3542 -0.2953 0.0795  -0.1475 254 VAL A CA  
1777 C C   . VAL A 254 ? 0.9692 1.3930 1.3166 -0.2936 0.0808  -0.1631 254 VAL A C   
1778 O O   . VAL A 254 ? 0.9051 1.3389 1.2543 -0.2792 0.0942  -0.1556 254 VAL A O   
1779 C CB  . VAL A 254 ? 1.0045 1.3784 1.3574 -0.2811 0.0871  -0.1720 254 VAL A CB  
1780 C CG1 . VAL A 254 ? 1.0478 1.4044 1.4192 -0.2877 0.0823  -0.1595 254 VAL A CG1 
1781 C CG2 . VAL A 254 ? 0.9305 1.2992 1.2789 -0.2555 0.1069  -0.1743 254 VAL A CG2 
1782 N N   . HIS A 255 ? 1.4369 1.8535 1.7542 -0.3083 0.0680  -0.1851 255 HIS A N   
1783 C CA  . HIS A 255 ? 1.4411 1.8669 1.7326 -0.3032 0.0735  -0.2022 255 HIS A CA  
1784 C C   . HIS A 255 ? 1.5607 1.9620 1.8101 -0.3080 0.0690  -0.2335 255 HIS A C   
1785 O O   . HIS A 255 ? 1.6694 2.0382 1.9041 -0.3155 0.0607  -0.2431 255 HIS A O   
1786 C CB  . HIS A 255 ? 1.4434 1.9009 1.7460 -0.3167 0.0654  -0.1810 255 HIS A CB  
1787 C CG  . HIS A 255 ? 1.4773 1.9408 1.7827 -0.3448 0.0421  -0.1695 255 HIS A CG  
1788 N ND1 . HIS A 255 ? 1.4677 1.9649 1.7960 -0.3595 0.0303  -0.1400 255 HIS A ND1 
1789 C CD2 . HIS A 255 ? 1.5526 1.9875 1.8266 -0.3641 0.0257  -0.1871 255 HIS A CD2 
1790 C CE1 . HIS A 255 ? 1.5253 2.0199 1.8430 -0.3889 0.0053  -0.1369 255 HIS A CE1 
1791 N NE2 . HIS A 255 ? 1.5829 2.0354 1.8674 -0.3936 0.0014  -0.1639 255 HIS A NE2 
1792 N N   . ALA A 256 ? 1.1814 1.5947 1.4092 -0.3007 0.0775  -0.2480 256 ALA A N   
1793 C CA  . ALA A 256 ? 1.2987 1.6924 1.4871 -0.2950 0.0830  -0.2752 256 ALA A CA  
1794 C C   . ALA A 256 ? 1.2971 1.7211 1.4718 -0.2971 0.0878  -0.2772 256 ALA A C   
1795 O O   . ALA A 256 ? 1.1818 1.6358 1.3782 -0.2930 0.0930  -0.2635 256 ALA A O   
1796 C CB  . ALA A 256 ? 1.2653 1.6472 1.4585 -0.2688 0.0991  -0.2867 256 ALA A CB  
1797 N N   . ARG A 257 ? 1.2272 1.6369 1.3591 -0.3046 0.0863  -0.2938 257 ARG A N   
1798 C CA  . ARG A 257 ? 1.2322 1.6696 1.3469 -0.3053 0.0937  -0.2965 257 ARG A CA  
1799 C C   . ARG A 257 ? 1.3457 1.7669 1.4217 -0.2880 0.1119  -0.3199 257 ARG A C   
1800 O O   . ARG A 257 ? 1.4730 1.8491 1.5203 -0.2806 0.1148  -0.3365 257 ARG A O   
1801 C CB  . ARG A 257 ? 1.2610 1.7039 1.3583 -0.3331 0.0751  -0.2871 257 ARG A CB  
1802 C CG  . ARG A 257 ? 1.3215 1.7422 1.4220 -0.3554 0.0517  -0.2767 257 ARG A CG  
1803 C CD  . ARG A 257 ? 1.4625 1.8469 1.5051 -0.3702 0.0433  -0.2942 257 ARG A CD  
1804 N NE  . ARG A 257 ? 1.4954 1.8685 1.5125 -0.4033 0.0168  -0.2855 257 ARG A NE  
1805 C CZ  . ARG A 257 ? 1.6022 1.9290 1.5640 -0.4283 -0.0025 -0.2951 257 ARG A CZ  
1806 N NH1 . ARG A 257 ? 1.6175 1.9391 1.5290 -0.4411 -0.0062 -0.3023 257 ARG A NH1 
1807 N NH2 . ARG A 257 ? 1.6899 1.9928 1.6586 -0.4510 -0.0267 -0.2841 257 ARG A NH2 
1808 N N   . HIS A 258 ? 1.3254 1.7829 1.3999 -0.2806 0.1257  -0.3188 258 HIS A N   
1809 C CA  . HIS A 258 ? 1.4357 1.8904 1.4805 -0.2593 0.1489  -0.3349 258 HIS A CA  
1810 C C   . HIS A 258 ? 1.4033 1.8968 1.4364 -0.2666 0.1556  -0.3290 258 HIS A C   
1811 O O   . HIS A 258 ? 1.3033 1.8297 1.3616 -0.2834 0.1439  -0.3112 258 HIS A O   
1812 C CB  . HIS A 258 ? 1.3897 1.8647 1.4714 -0.2312 0.1654  -0.3320 258 HIS A CB  
1813 C CG  . HIS A 258 ? 1.5324 2.0015 1.5896 -0.2018 0.1925  -0.3454 258 HIS A CG  
1814 N ND1 . HIS A 258 ? 1.6953 2.1025 1.7076 -0.1878 0.2006  -0.3659 258 HIS A ND1 
1815 C CD2 . HIS A 258 ? 1.5231 2.0393 1.5941 -0.1823 0.2148  -0.3384 258 HIS A CD2 
1816 C CE1 . HIS A 258 ? 1.8030 2.2166 1.8002 -0.1563 0.2302  -0.3719 258 HIS A CE1 
1817 N NE2 . HIS A 258 ? 1.7094 2.1950 1.7466 -0.1521 0.2397  -0.3537 258 HIS A NE2 
1818 N N   . ALA A 259 ? 1.5432 2.0284 1.5339 -0.2528 0.1762  -0.3428 259 ALA A N   
1819 C CA  . ALA A 259 ? 1.5281 2.0516 1.5058 -0.2582 0.1860  -0.3360 259 ALA A CA  
1820 C C   . ALA A 259 ? 1.6177 2.1657 1.5927 -0.2260 0.2203  -0.3391 259 ALA A C   
1821 O O   . ALA A 259 ? 1.7298 2.2423 1.6823 -0.1998 0.2380  -0.3541 259 ALA A O   
1822 C CB  . ALA A 259 ? 1.5683 2.0550 1.4834 -0.2807 0.1748  -0.3459 259 ALA A CB  
1823 N N   . TYR A 260 ? 1.5917 2.2012 1.5909 -0.2275 0.2301  -0.3217 260 TYR A N   
1824 C CA  . TYR A 260 ? 1.6909 2.3400 1.6966 -0.1984 0.2638  -0.3164 260 TYR A CA  
1825 C C   . TYR A 260 ? 1.7196 2.3906 1.6901 -0.2065 0.2770  -0.3126 260 TYR A C   
1826 O O   . TYR A 260 ? 1.6286 2.3133 1.5982 -0.2373 0.2569  -0.3033 260 TYR A O   
1827 C CB  . TYR A 260 ? 1.6142 2.3311 1.6936 -0.1937 0.2635  -0.2908 260 TYR A CB  
1828 C CG  . TYR A 260 ? 1.5054 2.2064 1.6204 -0.1839 0.2527  -0.2912 260 TYR A CG  
1829 C CD1 . TYR A 260 ? 1.3260 2.0300 1.4736 -0.2069 0.2249  -0.2802 260 TYR A CD1 
1830 C CD2 . TYR A 260 ? 1.5912 2.2696 1.7024 -0.1498 0.2723  -0.3016 260 TYR A CD2 
1831 C CE1 . TYR A 260 ? 1.2324 1.9196 1.4073 -0.1981 0.2164  -0.2798 260 TYR A CE1 
1832 C CE2 . TYR A 260 ? 1.4879 2.1515 1.6303 -0.1417 0.2618  -0.3006 260 TYR A CE2 
1833 C CZ  . TYR A 260 ? 1.3067 1.9759 1.4807 -0.1670 0.2335  -0.2898 260 TYR A CZ  
1834 O OH  . TYR A 260 ? 1.2211 1.8729 1.4211 -0.1595 0.2239  -0.2882 260 TYR A OH  
1835 N N   . SER A 261 ? 1.8010 2.4740 1.7409 -0.1764 0.3132  -0.3180 261 SER A N   
1836 C CA  . SER A 261 ? 1.8441 2.5436 1.7517 -0.1799 0.3318  -0.3115 261 SER A CA  
1837 C C   . SER A 261 ? 1.8656 2.6598 1.8384 -0.1691 0.3508  -0.2799 261 SER A C   
1838 O O   . SER A 261 ? 1.8834 2.7151 1.9161 -0.1523 0.3544  -0.2661 261 SER A O   
1839 C CB  . SER A 261 ? 2.0064 2.6441 1.8286 -0.1535 0.3635  -0.3350 261 SER A CB  
1840 O OG  . SER A 261 ? 2.1324 2.7523 1.9598 -0.1111 0.3905  -0.3420 261 SER A OG  
1841 N N   . CYS A 262 ? 2.5229 3.3568 2.4841 -0.1817 0.3603  -0.2659 262 CYS A N   
1842 C CA  . CYS A 262 ? 2.5616 3.4899 2.5841 -0.1781 0.3758  -0.2313 262 CYS A CA  
1843 C C   . CYS A 262 ? 2.6944 3.6606 2.7560 -0.1333 0.4100  -0.2201 262 CYS A C   
1844 O O   . CYS A 262 ? 2.5574 3.5973 2.6945 -0.1339 0.4063  -0.1899 262 CYS A O   
1845 C CB  . CYS A 262 ? 2.6089 3.5637 2.5961 -0.1876 0.3936  -0.2215 262 CYS A CB  
1846 S SG  . CYS A 262 ? 2.6990 3.5636 2.5689 -0.1729 0.4166  -0.2567 262 CYS A SG  
1847 N N   . ASP A 263 ? 1.8786 2.7894 1.8850 -0.0953 0.4416  -0.2431 263 ASP A N   
1848 C CA  . ASP A 263 ? 2.0541 2.9954 2.0878 -0.0442 0.4825  -0.2315 263 ASP A CA  
1849 C C   . ASP A 263 ? 1.9399 2.8673 2.0169 -0.0286 0.4696  -0.2344 263 ASP A C   
1850 O O   . ASP A 263 ? 1.9962 2.9467 2.0993 0.0156  0.5014  -0.2233 263 ASP A O   
1851 C CB  . ASP A 263 ? 2.2248 3.0983 2.1679 -0.0053 0.5265  -0.2556 263 ASP A CB  
1852 C CG  . ASP A 263 ? 2.2021 2.9533 2.0640 -0.0102 0.5090  -0.2984 263 ASP A CG  
1853 O OD1 . ASP A 263 ? 2.0805 2.7864 1.8973 -0.0516 0.4763  -0.3151 263 ASP A OD1 
1854 O OD2 . ASP A 263 ? 2.3187 3.0201 2.1628 0.0261  0.5268  -0.3124 263 ASP A OD2 
1855 N N   . GLU A 264 ? 2.1230 3.0122 2.2066 -0.0621 0.4254  -0.2474 264 GLU A N   
1856 C CA  . GLU A 264 ? 1.9922 2.8688 2.1162 -0.0508 0.4113  -0.2484 264 GLU A CA  
1857 C C   . GLU A 264 ? 1.7217 2.6760 1.9290 -0.0760 0.3843  -0.2157 264 GLU A C   
1858 O O   . GLU A 264 ? 1.5846 2.5320 1.8272 -0.0779 0.3637  -0.2132 264 GLU A O   
1859 C CB  . GLU A 264 ? 2.0155 2.7958 2.0909 -0.0681 0.3833  -0.2819 264 GLU A CB  
1860 C CG  . GLU A 264 ? 2.1634 2.8671 2.1457 -0.0731 0.3903  -0.3111 264 GLU A CG  
1861 C CD  . GLU A 264 ? 2.2274 2.8315 2.1530 -0.0612 0.3873  -0.3423 264 GLU A CD  
1862 O OE1 . GLU A 264 ? 2.3414 2.9338 2.2811 -0.0248 0.4062  -0.3432 264 GLU A OE1 
1863 O OE2 . GLU A 264 ? 2.1793 2.7170 2.0460 -0.0894 0.3648  -0.3634 264 GLU A OE2 
1864 N N   . ILE A 265 ? 1.6949 2.7172 1.9262 -0.0976 0.3835  -0.1903 265 ILE A N   
1865 C CA  . ILE A 265 ? 1.4932 2.5901 1.7954 -0.1239 0.3596  -0.1550 265 ILE A CA  
1866 C C   . ILE A 265 ? 1.4994 2.6859 1.8628 -0.0937 0.3880  -0.1190 265 ILE A C   
1867 O O   . ILE A 265 ? 1.6145 2.8498 1.9780 -0.0778 0.4207  -0.1033 265 ILE A O   
1868 C CB  . ILE A 265 ? 1.4571 2.5793 1.7523 -0.1672 0.3413  -0.1424 265 ILE A CB  
1869 C CG1 . ILE A 265 ? 1.4581 2.4991 1.6980 -0.1945 0.3147  -0.1726 265 ILE A CG1 
1870 C CG2 . ILE A 265 ? 1.2932 2.4821 1.6515 -0.1976 0.3149  -0.1052 265 ILE A CG2 
1871 C CD1 . ILE A 265 ? 1.4465 2.5035 1.6734 -0.2336 0.2980  -0.1610 265 ILE A CD1 
1872 N N   . ILE A 266 ? 1.5059 2.7163 1.9225 -0.0852 0.3759  -0.1030 266 ILE A N   
1873 C CA  . ILE A 266 ? 1.4990 2.8023 1.9854 -0.0574 0.3979  -0.0623 266 ILE A CA  
1874 C C   . ILE A 266 ? 1.3537 2.7440 1.9021 -0.1008 0.3681  -0.0181 266 ILE A C   
1875 O O   . ILE A 266 ? 1.2221 2.6118 1.7982 -0.1277 0.3303  -0.0077 266 ILE A O   
1876 C CB  . ILE A 266 ? 1.4759 2.7588 1.9861 -0.0239 0.3998  -0.0653 266 ILE A CB  
1877 C CG1 . ILE A 266 ? 1.6852 2.9070 2.1442 0.0310  0.4437  -0.0944 266 ILE A CG1 
1878 C CG2 . ILE A 266 ? 1.3861 2.7753 1.9863 -0.0153 0.3996  -0.0132 266 ILE A CG2 
1879 C CD1 . ILE A 266 ? 1.6868 2.8593 2.1492 0.0600  0.4418  -0.1074 266 ILE A CD1 
1880 N N   . TRP A 267 ? 1.5587 3.0185 2.1226 -0.1098 0.3845  0.0084  267 TRP A N   
1881 C CA  . TRP A 267 ? 1.4530 2.9905 2.0678 -0.1575 0.3542  0.0516  267 TRP A CA  
1882 C C   . TRP A 267 ? 1.3734 2.9993 2.0736 -0.1510 0.3467  0.0988  267 TRP A C   
1883 O O   . TRP A 267 ? 1.4319 3.1146 2.1733 -0.1027 0.3848  0.1190  267 TRP A O   
1884 C CB  . TRP A 267 ? 1.5384 3.1327 2.1509 -0.1677 0.3761  0.0716  267 TRP A CB  
1885 C CG  . TRP A 267 ? 1.6234 3.1374 2.1536 -0.1804 0.3780  0.0312  267 TRP A CG  
1886 C CD1 . TRP A 267 ? 1.7700 3.2158 2.2355 -0.1448 0.4097  -0.0085 267 TRP A CD1 
1887 C CD2 . TRP A 267 ? 1.5920 3.0832 2.0927 -0.2334 0.3452  0.0290  267 TRP A CD2 
1888 N NE1 . TRP A 267 ? 1.8197 3.2085 2.2222 -0.1742 0.3963  -0.0333 267 TRP A NE1 
1889 C CE2 . TRP A 267 ? 1.7065 3.1233 2.1316 -0.2262 0.3586  -0.0107 267 TRP A CE2 
1890 C CE3 . TRP A 267 ? 1.5028 3.0233 2.0284 -0.2872 0.3049  0.0577  267 TRP A CE3 
1891 C CZ2 . TRP A 267 ? 1.7153 3.0947 2.0976 -0.2674 0.3344  -0.0201 267 TRP A CZ2 
1892 C CZ3 . TRP A 267 ? 1.5269 3.0014 2.0034 -0.3263 0.2834  0.0456  267 TRP A CZ3 
1893 C CH2 . TRP A 267 ? 1.6228 3.0316 2.0326 -0.3146 0.2989  0.0082  267 TRP A CH2 
1894 N N   . GLY A 268 ? 1.3784 3.0122 2.1013 -0.1997 0.2973  0.1180  268 GLY A N   
1895 C CA  . GLY A 268 ? 1.3127 3.0274 2.1126 -0.2051 0.2795  0.1658  268 GLY A CA  
1896 C C   . GLY A 268 ? 1.2787 2.9491 2.0833 -0.1741 0.2756  0.1492  268 GLY A C   
1897 O O   . GLY A 268 ? 1.2234 2.9424 2.0821 -0.1836 0.2516  0.1842  268 GLY A O   
1898 N N   . GLY A 269 ? 1.4452 3.0220 2.1909 -0.1399 0.2970  0.0975  269 GLY A N   
1899 C CA  . GLY A 269 ? 1.4324 2.9584 2.1757 -0.1085 0.2966  0.0786  269 GLY A CA  
1900 C C   . GLY A 269 ? 1.3359 2.8129 2.0684 -0.1500 0.2452  0.0739  269 GLY A C   
1901 O O   . GLY A 269 ? 1.2997 2.7486 2.0027 -0.1999 0.2128  0.0702  269 GLY A O   
1902 N N   . HIS A 270 ? 1.6958 3.1582 2.4479 -0.1272 0.2399  0.0751  270 HIS A N   
1903 C CA  . HIS A 270 ? 1.6354 3.0385 2.3676 -0.1588 0.1968  0.0667  270 HIS A CA  
1904 C C   . HIS A 270 ? 1.6586 2.9874 2.3657 -0.1185 0.2109  0.0324  270 HIS A C   
1905 O O   . HIS A 270 ? 1.7050 3.0623 2.4443 -0.0717 0.2385  0.0414  270 HIS A O   
1906 C CB  . HIS A 270 ? 1.5997 3.0789 2.3929 -0.1836 0.1645  0.1191  270 HIS A CB  
1907 C CG  . HIS A 270 ? 1.5930 3.1436 2.4108 -0.2319 0.1429  0.1581  270 HIS A CG  
1908 N ND1 . HIS A 270 ? 1.6021 3.2744 2.4936 -0.2237 0.1579  0.2085  270 HIS A ND1 
1909 C CD2 . HIS A 270 ? 1.5958 3.1105 2.3722 -0.2894 0.1077  0.1562  270 HIS A CD2 
1910 C CE1 . HIS A 270 ? 1.6048 3.3154 2.5008 -0.2782 0.1302  0.2362  270 HIS A CE1 
1911 N NE2 . HIS A 270 ? 1.6095 3.2213 2.4327 -0.3184 0.0994  0.2040  270 HIS A NE2 
1912 N N   . PHE A 271 ? 1.2795 2.5111 1.9285 -0.1353 0.1934  -0.0052 271 PHE A N   
1913 C CA  . PHE A 271 ? 1.3051 2.4660 1.9315 -0.1040 0.2016  -0.0339 271 PHE A CA  
1914 C C   . PHE A 271 ? 1.2865 2.4791 1.9583 -0.0959 0.1856  -0.0043 271 PHE A C   
1915 O O   . PHE A 271 ? 1.2430 2.4581 1.9300 -0.1344 0.1492  0.0221  271 PHE A O   
1916 C CB  . PHE A 271 ? 1.2818 2.3435 1.8460 -0.1284 0.1827  -0.0713 271 PHE A CB  
1917 C CG  . PHE A 271 ? 1.3246 2.3424 1.8425 -0.1237 0.2026  -0.1051 271 PHE A CG  
1918 C CD1 . PHE A 271 ? 1.2992 2.3088 1.7905 -0.1599 0.1897  -0.1094 271 PHE A CD1 
1919 C CD2 . PHE A 271 ? 1.4161 2.3973 1.9125 -0.0842 0.2331  -0.1311 271 PHE A CD2 
1920 C CE1 . PHE A 271 ? 1.3483 2.3203 1.7976 -0.1572 0.2051  -0.1375 271 PHE A CE1 
1921 C CE2 . PHE A 271 ? 1.4824 2.4200 1.9302 -0.0846 0.2470  -0.1605 271 PHE A CE2 
1922 C CZ  . PHE A 271 ? 1.4406 2.3776 1.8679 -0.1213 0.2323  -0.1628 271 PHE A CZ  
1923 N N   . VAL A 272 ? 1.0478 2.2396 1.7372 -0.0461 0.2123  -0.0069 272 VAL A N   
1924 C CA  . VAL A 272 ? 1.0429 2.2561 1.7722 -0.0334 0.1983  0.0190  272 VAL A CA  
1925 C C   . VAL A 272 ? 1.0118 2.1394 1.6973 -0.0615 0.1652  -0.0027 272 VAL A C   
1926 O O   . VAL A 272 ? 0.9988 2.0532 1.6284 -0.0807 0.1607  -0.0380 272 VAL A O   
1927 C CB  . VAL A 272 ? 1.1392 2.3504 1.8845 0.0306  0.2379  0.0153  272 VAL A CB  
1928 C CG1 . VAL A 272 ? 1.1465 2.3320 1.9051 0.0432  0.2212  0.0234  272 VAL A CG1 
1929 C CG2 . VAL A 272 ? 1.1789 2.4967 1.9865 0.0619  0.2681  0.0553  272 VAL A CG2 
1930 N N   . ASP A 273 ? 1.5792 2.7191 2.2910 -0.0638 0.1422  0.0219  273 ASP A N   
1931 C CA  . ASP A 273 ? 1.5756 2.6330 2.2435 -0.0858 0.1147  0.0038  273 ASP A CA  
1932 C C   . ASP A 273 ? 1.6271 2.6273 2.2832 -0.0439 0.1335  -0.0184 273 ASP A C   
1933 O O   . ASP A 273 ? 1.6789 2.7089 2.3685 -0.0009 0.1570  -0.0078 273 ASP A O   
1934 C CB  . ASP A 273 ? 1.5753 2.6646 2.2635 -0.1209 0.0730  0.0425  273 ASP A CB  
1935 C CG  . ASP A 273 ? 1.5985 2.5940 2.2247 -0.1520 0.0448  0.0227  273 ASP A CG  
1936 O OD1 . ASP A 273 ? 1.5928 2.5096 2.1703 -0.1458 0.0585  -0.0176 273 ASP A OD1 
1937 O OD2 . ASP A 273 ? 1.6389 2.6392 2.2632 -0.1828 0.0091  0.0496  273 ASP A OD2 
1938 N N   . VAL A 274 ? 1.2639 2.1758 1.8687 -0.0562 0.1233  -0.0483 274 VAL A N   
1939 C CA  . VAL A 274 ? 1.3209 2.1655 1.9046 -0.0252 0.1374  -0.0722 274 VAL A CA  
1940 C C   . VAL A 274 ? 1.3313 2.1387 1.9030 -0.0430 0.1076  -0.0626 274 VAL A C   
1941 O O   . VAL A 274 ? 1.3768 2.1188 1.9243 -0.0276 0.1120  -0.0811 274 VAL A O   
1942 C CB  . VAL A 274 ? 1.3254 2.0959 1.8557 -0.0288 0.1514  -0.1155 274 VAL A CB  
1943 C CG1 . VAL A 274 ? 1.3628 2.1602 1.8965 -0.0057 0.1831  -0.1261 274 VAL A CG1 
1944 C CG2 . VAL A 274 ? 1.2594 2.0067 1.7583 -0.0746 0.1284  -0.1214 274 VAL A CG2 
1945 N N   . PHE A 275 ? 0.7862 2.0599 1.8953 0.4083  -0.1387 0.4443  275 PHE A N   
1946 C CA  . PHE A 275 ? 1.0026 2.2591 2.0741 0.4283  -0.1710 0.3830  275 PHE A CA  
1947 C C   . PHE A 275 ? 1.1142 2.4474 2.1712 0.4663  -0.1755 0.4005  275 PHE A C   
1948 O O   . PHE A 275 ? 1.0751 2.4856 2.2195 0.4535  -0.2079 0.4414  275 PHE A O   
1949 C CB  . PHE A 275 ? 1.0614 2.3114 2.2365 0.3842  -0.2555 0.3346  275 PHE A CB  
1950 C CG  . PHE A 275 ? 0.9898 2.1431 2.1498 0.3474  -0.2524 0.2939  275 PHE A CG  
1951 C CD1 . PHE A 275 ? 0.8384 1.9891 2.1091 0.2847  -0.2886 0.3083  275 PHE A CD1 
1952 C CD2 . PHE A 275 ? 1.0707 2.1341 2.1055 0.3741  -0.2128 0.2433  275 PHE A CD2 
1953 C CE1 . PHE A 275 ? 0.7714 1.8184 2.0205 0.2473  -0.2842 0.2624  275 PHE A CE1 
1954 C CE2 . PHE A 275 ? 1.0037 1.9635 2.0147 0.3404  -0.2080 0.2012  275 PHE A CE2 
1955 C CZ  . PHE A 275 ? 0.8552 1.7998 1.9690 0.2760  -0.2424 0.2059  275 PHE A CZ  
1956 N N   . THR A 276 ? 1.4324 2.7408 2.3781 0.5125  -0.1429 0.3699  276 THR A N   
1957 C CA  . THR A 276 ? 1.5190 2.8811 2.4194 0.5509  -0.1290 0.3830  276 THR A CA  
1958 C C   . THR A 276 ? 1.7533 3.1118 2.6200 0.5829  -0.1523 0.3224  276 THR A C   
1959 O O   . THR A 276 ? 1.8381 3.1558 2.6899 0.5835  -0.1674 0.2742  276 THR A O   
1960 C CB  . THR A 276 ? 1.4438 2.7942 2.2388 0.5827  -0.0628 0.4125  276 THR A CB  
1961 O OG1 . THR A 276 ? 1.2295 2.6032 2.0629 0.5659  -0.0444 0.4677  276 THR A OG1 
1962 C CG2 . THR A 276 ? 1.5448 2.9449 2.2833 0.6173  -0.0535 0.4153  276 THR A CG2 
1963 N N   . THR A 277 ? 1.8415 3.2475 2.6970 0.6116  -0.1570 0.3221  277 THR A N   
1964 C CA  . THR A 277 ? 2.0654 3.4772 2.8694 0.6550  -0.1623 0.2697  277 THR A CA  
1965 C C   . THR A 277 ? 2.0777 3.4941 2.7689 0.6843  -0.1054 0.2874  277 THR A C   
1966 O O   . THR A 277 ? 2.0056 3.4510 2.6892 0.6828  -0.0928 0.3200  277 THR A O   
1967 C CB  . THR A 277 ? 2.2092 3.6661 3.1015 0.6723  -0.2214 0.2425  277 THR A CB  
1968 O OG1 . THR A 277 ? 2.1328 3.6011 3.1601 0.6364  -0.2852 0.2492  277 THR A OG1 
1969 C CG2 . THR A 277 ? 2.4508 3.9217 3.3175 0.7208  -0.2412 0.1761  277 THR A CG2 
1970 N N   . LEU A 278 ? 2.5077 3.9015 3.1161 0.7093  -0.0777 0.2670  278 LEU A N   
1971 C CA  . LEU A 278 ? 2.5096 3.9138 3.0252 0.7356  -0.0357 0.2850  278 LEU A CA  
1972 C C   . LEU A 278 ? 2.6666 4.1159 3.1694 0.7604  -0.0454 0.2612  278 LEU A C   
1973 O O   . LEU A 278 ? 2.7883 4.2553 3.3514 0.7690  -0.0822 0.2264  278 LEU A O   
1974 C CB  . LEU A 278 ? 2.5733 3.9504 3.0211 0.7579  -0.0129 0.2742  278 LEU A CB  
1975 C CG  . LEU A 278 ? 2.4161 3.7269 2.8613 0.7393  0.0055  0.2957  278 LEU A CG  
1976 C CD1 . LEU A 278 ? 2.4962 3.7745 2.8770 0.7638  0.0236  0.2847  278 LEU A CD1 
1977 C CD2 . LEU A 278 ? 2.2115 3.5177 2.6514 0.7348  0.0318  0.3488  278 LEU A CD2 
1978 N N   . PRO A 279 ? 2.0039 3.4703 2.4354 0.7741  -0.0182 0.2768  279 PRO A N   
1979 C CA  . PRO A 279 ? 2.1690 3.6664 2.5728 0.7987  -0.0218 0.2444  279 PRO A CA  
1980 C C   . PRO A 279 ? 2.3881 3.9025 2.7898 0.8336  -0.0312 0.1992  279 PRO A C   
1981 O O   . PRO A 279 ? 2.5272 4.0651 2.9574 0.8598  -0.0516 0.1574  279 PRO A O   
1982 C CB  . PRO A 279 ? 2.1039 3.6159 2.4292 0.8026  0.0034  0.2688  279 PRO A CB  
1983 C CG  . PRO A 279 ? 1.9454 3.4347 2.2607 0.7973  0.0185  0.3081  279 PRO A CG  
1984 C CD  . PRO A 279 ? 1.8344 3.2965 2.2176 0.7705  0.0085  0.3206  279 PRO A CD  
1985 N N   . ASP A 280 ? 2.4000 3.9063 2.7724 0.8394  -0.0191 0.2074  280 ASP A N   
1986 C CA  . ASP A 280 ? 2.4545 3.9957 2.8195 0.8748  -0.0301 0.1693  280 ASP A CA  
1987 C C   . ASP A 280 ? 2.5250 4.0789 2.9739 0.8836  -0.0791 0.1213  280 ASP A C   
1988 O O   . ASP A 280 ? 2.5926 4.2007 3.0533 0.9257  -0.1025 0.0765  280 ASP A O   
1989 C CB  . ASP A 280 ? 2.3791 3.9001 2.6981 0.8745  -0.0103 0.1938  280 ASP A CB  
1990 C CG  . ASP A 280 ? 2.4259 4.0006 2.7310 0.9125  -0.0237 0.1591  280 ASP A CG  
1991 O OD1 . ASP A 280 ? 2.5181 4.1586 2.8438 0.9473  -0.0438 0.1182  280 ASP A OD1 
1992 O OD2 . ASP A 280 ? 2.3735 3.9284 2.6479 0.9127  -0.0152 0.1719  280 ASP A OD2 
1993 N N   . GLY A 281 ? 2.4847 4.0025 3.0032 0.8478  -0.1026 0.1317  281 GLY A N   
1994 C CA  . GLY A 281 ? 2.5362 4.0692 3.1557 0.8516  -0.1651 0.0903  281 GLY A CA  
1995 C C   . GLY A 281 ? 2.4868 3.9947 3.1136 0.8304  -0.1826 0.0786  281 GLY A C   
1996 O O   . GLY A 281 ? 2.5259 4.0576 3.2287 0.8366  -0.2452 0.0324  281 GLY A O   
1997 N N   . ARG A 282 ? 2.2508 3.7085 2.8014 0.8079  -0.1326 0.1168  282 ARG A N   
1998 C CA  . ARG A 282 ? 2.1928 3.6010 2.7347 0.7837  -0.1382 0.1074  282 ARG A CA  
1999 C C   . ARG A 282 ? 1.9801 3.3234 2.5670 0.7293  -0.1335 0.1420  282 ARG A C   
2000 O O   . ARG A 282 ? 1.8351 3.1624 2.4040 0.7178  -0.0941 0.1939  282 ARG A O   
2001 C CB  . ARG A 282 ? 2.1420 3.5297 2.5790 0.8031  -0.0879 0.1279  282 ARG A CB  
2002 C CG  . ARG A 282 ? 2.1167 3.5135 2.4975 0.8175  -0.0387 0.1790  282 ARG A CG  
2003 C CD  . ARG A 282 ? 2.0641 3.4493 2.3649 0.8401  -0.0033 0.2050  282 ARG A CD  
2004 N NE  . ARG A 282 ? 2.0008 3.3705 2.2689 0.8417  0.0324  0.2613  282 ARG A NE  
2005 C CZ  . ARG A 282 ? 1.9199 3.2471 2.1472 0.8523  0.0590  0.3005  282 ARG A CZ  
2006 N NH1 . ARG A 282 ? 1.8930 3.1776 2.0956 0.8580  0.0624  0.2907  282 ARG A NH1 
2007 N NH2 . ARG A 282 ? 1.8234 3.1518 2.0396 0.8606  0.0752  0.3469  282 ARG A NH2 
2008 N N   . ARG A 283 ? 2.0007 3.3183 2.6519 0.6971  -0.1800 0.1109  283 ARG A N   
2009 C CA  . ARG A 283 ? 1.7832 3.0479 2.4899 0.6428  -0.1802 0.1417  283 ARG A CA  
2010 C C   . ARG A 283 ? 1.6230 2.8089 2.2464 0.6350  -0.1104 0.1808  283 ARG A C   
2011 O O   . ARG A 283 ? 1.6883 2.8460 2.2228 0.6634  -0.0780 0.1729  283 ARG A O   
2012 C CB  . ARG A 283 ? 1.7933 3.0473 2.5877 0.6072  -0.2538 0.0911  283 ARG A CB  
2013 C CG  . ARG A 283 ? 1.9214 3.2576 2.8364 0.6181  -0.3401 0.0583  283 ARG A CG  
2014 C CD  . ARG A 283 ? 1.7602 3.1060 2.8018 0.5704  -0.3777 0.0972  283 ARG A CD  
2015 N N   . ALA A 284 ? 1.0198 2.1786 1.6813 0.6030  -0.0909 0.2261  284 ALA A N   
2016 C CA  . ALA A 284 ? 0.8756 1.9690 1.4753 0.6098  -0.0283 0.2657  284 ALA A CA  
2017 C C   . ALA A 284 ? 0.8440 1.8987 1.5084 0.5674  -0.0237 0.2914  284 ALA A C   
2018 O O   . ALA A 284 ? 0.8208 1.9190 1.5834 0.5294  -0.0672 0.2961  284 ALA A O   
2019 C CB  . ALA A 284 ? 0.8665 2.0074 1.4194 0.6488  0.0084  0.3115  284 ALA A CB  
2020 N N   . LEU A 285 ? 1.2649 2.2413 1.8826 0.5784  0.0264  0.3104  285 LEU A N   
2021 C CA  . LEU A 285 ? 1.0538 1.9984 1.7285 0.5498  0.0418  0.3392  285 LEU A CA  
2022 C C   . LEU A 285 ? 0.9103 1.8705 1.5601 0.5953  0.0924  0.3963  285 LEU A C   
2023 O O   . LEU A 285 ? 0.8990 1.8060 1.4763 0.6426  0.1289  0.4003  285 LEU A O   
2024 C CB  . LEU A 285 ? 1.6532 2.4735 2.3129 0.5209  0.0470  0.2943  285 LEU A CB  
2025 C CG  . LEU A 285 ? 1.6068 2.3777 2.3211 0.4932  0.0694  0.3167  285 LEU A CG  
2026 C CD1 . LEU A 285 ? 1.5874 2.4500 2.4276 0.4386  0.0193  0.3386  285 LEU A CD1 
2027 C CD2 . LEU A 285 ? 1.5992 2.2222 2.2747 0.4689  0.0809  0.2613  285 LEU A CD2 
2028 N N   . ASP A 286 ? 1.4967 2.1171 2.0048 0.0404  0.1576  -0.1317 286 ASP A N   
2029 C CA  . ASP A 286 ? 1.5996 2.2208 2.1130 0.0838  0.1905  -0.1404 286 ASP A CA  
2030 C C   . ASP A 286 ? 1.5959 2.2151 2.0850 0.0767  0.2073  -0.1636 286 ASP A C   
2031 O O   . ASP A 286 ? 1.5368 2.2243 2.0515 0.0714  0.2114  -0.1484 286 ASP A O   
2032 C CB  . ASP A 286 ? 1.6169 2.3231 2.1892 0.1124  0.1982  -0.1021 286 ASP A CB  
2033 C CG  . ASP A 286 ? 1.7649 2.4630 2.3393 0.1673  0.2372  -0.1071 286 ASP A CG  
2034 O OD1 . ASP A 286 ? 1.8685 2.4888 2.3903 0.1785  0.2558  -0.1431 286 ASP A OD1 
2035 O OD2 . ASP A 286 ? 1.7970 2.5648 2.4233 0.1993  0.2492  -0.0728 286 ASP A OD2 
2036 N N   . LEU A 287 ? 1.1207 1.6637 1.5603 0.0727  0.2146  -0.1976 287 LEU A N   
2037 C CA  . LEU A 287 ? 1.1362 1.6689 1.5453 0.0615  0.2262  -0.2201 287 LEU A CA  
2038 C C   . LEU A 287 ? 1.2802 1.8225 1.6825 0.1005  0.2604  -0.2251 287 LEU A C   
2039 O O   . LEU A 287 ? 1.3512 1.8727 1.7175 0.0970  0.2737  -0.2458 287 LEU A O   
2040 C CB  . LEU A 287 ? 1.1730 1.6232 1.5332 0.0411  0.2187  -0.2497 287 LEU A CB  
2041 C CG  . LEU A 287 ? 1.0455 1.4817 1.4034 0.0024  0.1918  -0.2476 287 LEU A CG  
2042 C CD1 . LEU A 287 ? 1.0992 1.4643 1.4172 -0.0121 0.1892  -0.2716 287 LEU A CD1 
2043 C CD2 . LEU A 287 ? 0.9156 1.4053 1.2868 -0.0257 0.1809  -0.2368 287 LEU A CD2 
2044 N N   . GLY A 288 ? 1.0389 1.6077 1.4716 0.1402  0.2762  -0.2049 288 GLY A N   
2045 C CA  . GLY A 288 ? 1.1877 1.7745 1.6179 0.1831  0.3139  -0.2032 288 GLY A CA  
2046 C C   . GLY A 288 ? 1.0795 1.7628 1.5493 0.1727  0.3177  -0.1805 288 GLY A C   
2047 O O   . GLY A 288 ? 1.1740 1.8667 1.6248 0.1892  0.3458  -0.1881 288 GLY A O   
2048 N N   . LYS A 289 ? 2.1090 2.8596 2.6289 0.1427  0.2884  -0.1517 289 LYS A N   
2049 C CA  . LYS A 289 ? 2.0054 2.8496 2.5661 0.1252  0.2854  -0.1251 289 LYS A CA  
2050 C C   . LYS A 289 ? 1.9464 2.7720 2.4691 0.0857  0.2764  -0.1481 289 LYS A C   
2051 O O   . LYS A 289 ? 1.9027 2.7926 2.4453 0.0740  0.2808  -0.1328 289 LYS A O   
2052 C CB  . LYS A 289 ? 1.8730 2.7814 2.4883 0.1000  0.2514  -0.0866 289 LYS A CB  
2053 C CG  . LYS A 289 ? 1.9308 2.8474 2.5794 0.1339  0.2532  -0.0646 289 LYS A CG  
2054 C CD  . LYS A 289 ? 1.8293 2.8073 2.5264 0.1055  0.2159  -0.0242 289 LYS A CD  
2055 C CE  . LYS A 289 ? 1.8986 2.8816 2.6271 0.1405  0.2171  -0.0019 289 LYS A CE  
2056 N NZ  . LYS A 289 ? 2.0109 3.0363 2.7722 0.2000  0.2607  0.0133  289 LYS A NZ  
2057 N N   . PHE A 290 ? 1.2694 2.0101 1.7402 0.0659  0.2643  -0.1817 290 PHE A N   
2058 C CA  . PHE A 290 ? 1.2011 1.9241 1.6409 0.0255  0.2499  -0.1989 290 PHE A CA  
2059 C C   . PHE A 290 ? 1.2494 2.0039 1.6771 0.0273  0.2707  -0.2030 290 PHE A C   
2060 O O   . PHE A 290 ? 1.1577 1.9424 1.5878 -0.0063 0.2567  -0.1975 290 PHE A O   
2061 C CB  . PHE A 290 ? 1.2411 1.8713 1.6296 0.0128  0.2411  -0.2318 290 PHE A CB  
2062 C CG  . PHE A 290 ? 1.1575 1.7746 1.5229 -0.0280 0.2235  -0.2428 290 PHE A CG  
2063 C CD1 . PHE A 290 ? 1.0221 1.6591 1.4043 -0.0601 0.1977  -0.2274 290 PHE A CD1 
2064 C CD2 . PHE A 290 ? 1.2399 1.8203 1.5621 -0.0337 0.2328  -0.2670 290 PHE A CD2 
2065 C CE1 . PHE A 290 ? 0.9644 1.5867 1.3249 -0.0923 0.1849  -0.2351 290 PHE A CE1 
2066 C CE2 . PHE A 290 ? 1.1667 1.7398 1.4727 -0.0689 0.2164  -0.2728 290 PHE A CE2 
2067 C CZ  . PHE A 290 ? 1.0254 1.6204 1.3526 -0.0959 0.1942  -0.2564 290 PHE A CZ  
2068 N N   . HIS A 291 ? 0.9622 1.7023 1.3701 0.0671  0.3054  -0.2129 291 HIS A N   
2069 C CA  . HIS A 291 ? 1.0098 1.7700 1.3955 0.0719  0.3291  -0.2186 291 HIS A CA  
2070 C C   . HIS A 291 ? 1.0004 1.8601 1.4415 0.0946  0.3505  -0.1819 291 HIS A C   
2071 O O   . HIS A 291 ? 1.0796 1.9676 1.5087 0.1029  0.3747  -0.1806 291 HIS A O   
2072 C CB  . HIS A 291 ? 1.2497 1.9254 1.5654 0.1002  0.3569  -0.2519 291 HIS A CB  
2073 C CG  . HIS A 291 ? 1.2753 1.8628 1.5340 0.0692  0.3348  -0.2851 291 HIS A CG  
2074 N ND1 . HIS A 291 ? 1.2095 1.7952 1.4469 0.0290  0.3170  -0.2948 291 HIS A ND1 
2075 C CD2 . HIS A 291 ? 1.3633 1.8670 1.5861 0.0714  0.3268  -0.3063 291 HIS A CD2 
2076 C CE1 . HIS A 291 ? 1.2501 1.7596 1.4454 0.0088  0.2991  -0.3186 291 HIS A CE1 
2077 N NE2 . HIS A 291 ? 1.3434 1.8020 1.5284 0.0318  0.3040  -0.3262 291 HIS A NE2 
2078 N N   . GLU A 292 ? 2.3890 3.3054 2.8921 0.1032  0.3408  -0.1489 292 GLU A N   
2079 C CA  . GLU A 292 ? 2.3846 3.4054 2.9511 0.1261  0.3601  -0.1065 292 GLU A CA  
2080 C C   . GLU A 292 ? 2.2307 3.3353 2.8381 0.0815  0.3359  -0.0772 292 GLU A C   
2081 O O   . GLU A 292 ? 2.0965 3.2028 2.7167 0.0391  0.2949  -0.0691 292 GLU A O   
2082 C CB  . GLU A 292 ? 2.3907 3.4418 3.0090 0.1587  0.3619  -0.0781 292 GLU A CB  
2083 C CG  . GLU A 292 ? 2.6069 3.6127 3.1998 0.2217  0.4063  -0.0904 292 GLU A CG  
2084 C CD  . GLU A 292 ? 2.6230 3.6504 3.2644 0.2552  0.4067  -0.0629 292 GLU A CD  
2085 O OE1 . GLU A 292 ? 2.4730 3.5822 3.1832 0.2346  0.3784  -0.0227 292 GLU A OE1 
2086 O OE2 . GLU A 292 ? 2.8067 3.7656 3.4134 0.3010  0.4340  -0.0803 292 GLU A OE2 
2087 N N   . ILE A 293 ? 1.7690 2.9363 2.3907 0.0922  0.3630  -0.0609 293 ILE A N   
2088 C CA  . ILE A 293 ? 1.6497 2.8972 2.3078 0.0497  0.3426  -0.0309 293 ILE A CA  
2089 C C   . ILE A 293 ? 1.6458 3.0145 2.3845 0.0719  0.3605  0.0239  293 ILE A C   
2090 O O   . ILE A 293 ? 1.7699 3.1708 2.5151 0.1169  0.4070  0.0319  293 ILE A O   
2091 C CB  . ILE A 293 ? 1.6980 2.9227 2.3052 0.0319  0.3538  -0.0544 293 ILE A CB  
2092 C CG1 . ILE A 293 ? 1.7226 2.8325 2.2541 0.0152  0.3396  -0.1049 293 ILE A CG1 
2093 C CG2 . ILE A 293 ? 1.5829 2.8784 2.2213 -0.0180 0.3275  -0.0247 293 ILE A CG2 
2094 C CD1 . ILE A 293 ? 1.7537 2.8408 2.2374 -0.0113 0.3399  -0.1248 293 ILE A CD1 
2095 N N   . ALA A 294 ? 1.9575 3.3919 2.7551 0.0398  0.3234  0.0637  294 ALA A N   
2096 C CA  . ALA A 294 ? 1.9376 3.5007 2.8223 0.0494  0.3305  0.1249  294 ALA A CA  
2097 C C   . ALA A 294 ? 1.9499 3.5789 2.8451 0.0333  0.3462  0.1424  294 ALA A C   
2098 O O   . ALA A 294 ? 1.9282 3.5109 2.7712 -0.0055 0.3316  0.1151  294 ALA A O   
2099 C CB  . ALA A 294 ? 1.8251 3.4307 2.7562 0.0045  0.2772  0.1615  294 ALA A CB  
2100 N N   . GLN A 295 ? 1.3376 3.0776 2.3027 0.0645  0.3773  0.1912  295 GLN A N   
2101 C CA  . GLN A 295 ? 1.3654 3.1768 2.3458 0.0538  0.3975  0.2132  295 GLN A CA  
2102 C C   . GLN A 295 ? 1.3491 3.3139 2.4366 0.0652  0.4083  0.2887  295 GLN A C   
2103 O O   . GLN A 295 ? 1.3873 3.3986 2.5282 0.1163  0.4325  0.3168  295 GLN A O   
2104 C CB  . GLN A 295 ? 1.5298 3.2813 2.4441 0.1010  0.4536  0.1728  295 GLN A CB  
2105 C CG  . GLN A 295 ? 1.5747 3.3802 2.4865 0.0865  0.4740  0.1869  295 GLN A CG  
2106 C CD  . GLN A 295 ? 1.6945 3.3923 2.5036 0.0904  0.4938  0.1278  295 GLN A CD  
2107 O OE1 . GLN A 295 ? 1.8245 3.4296 2.5727 0.1316  0.5198  0.0859  295 GLN A OE1 
2108 N NE2 . GLN A 295 ? 1.6682 3.3751 2.4548 0.0446  0.4790  0.1258  295 GLN A NE2 
2109 N N   . PRO B 12  ? 2.2405 2.0913 1.6411 0.0379  0.1175  -0.0996 12  PRO B N   
2110 C CA  . PRO B 12  ? 2.2140 2.1032 1.6552 -0.0044 0.1122  -0.1035 12  PRO B CA  
2111 C C   . PRO B 12  ? 2.1416 2.0942 1.6185 -0.0444 0.1271  -0.0734 12  PRO B C   
2112 O O   . PRO B 12  ? 2.1311 2.1035 1.6118 -0.0833 0.1382  -0.0671 12  PRO B O   
2113 C CB  . PRO B 12  ? 2.2678 2.1202 1.6686 -0.0186 0.1195  -0.1169 12  PRO B CB  
2114 C CG  . PRO B 12  ? 2.2955 2.1125 1.6415 -0.0032 0.1407  -0.1033 12  PRO B CG  
2115 C CD  . PRO B 12  ? 2.2910 2.0966 1.6309 0.0394  0.1370  -0.0975 12  PRO B CD  
2116 N N   . ARG B 13  ? 2.3192 2.3031 1.8223 -0.0335 0.1256  -0.0567 13  ARG B N   
2117 C CA  . ARG B 13  ? 2.2552 2.2954 1.7870 -0.0653 0.1394  -0.0289 13  ARG B CA  
2118 C C   . ARG B 13  ? 2.2114 2.3008 1.7925 -0.1011 0.1306  -0.0259 13  ARG B C   
2119 O O   . ARG B 13  ? 2.2097 2.3032 1.8187 -0.0931 0.1113  -0.0386 13  ARG B O   
2120 C CB  . ARG B 13  ? 2.2228 2.2776 1.7622 -0.0396 0.1403  -0.0132 13  ARG B CB  
2121 C CG  . ARG B 13  ? 2.2237 2.2703 1.7826 -0.0031 0.1160  -0.0259 13  ARG B CG  
2122 C CD  . ARG B 13  ? 2.2104 2.2547 1.7602 0.0311  0.1182  -0.0141 13  ARG B CD  
2123 N NE  . ARG B 13  ? 2.1499 2.2467 1.7248 0.0087  0.1299  0.0119  13  ARG B NE  
2124 C CZ  . ARG B 13  ? 2.1292 2.2358 1.7023 0.0302  0.1344  0.0251  13  ARG B CZ  
2125 N NH1 . ARG B 13  ? 2.1635 2.2304 1.7092 0.0754  0.1285  0.0164  13  ARG B NH1 
2126 N NH2 . ARG B 13  ? 2.0764 2.2326 1.6753 0.0076  0.1438  0.0457  13  ARG B NH2 
2127 N N   . ILE B 14  ? 1.8889 2.0142 1.4802 -0.1400 0.1458  -0.0094 14  ILE B N   
2128 C CA  . ILE B 14  ? 1.8466 2.0190 1.4795 -0.1750 0.1400  -0.0036 14  ILE B CA  
2129 C C   . ILE B 14  ? 1.7971 2.0050 1.4662 -0.1666 0.1294  0.0091  14  ILE B C   
2130 O O   . ILE B 14  ? 1.7813 2.0080 1.4819 -0.1757 0.1153  0.0052  14  ILE B O   
2131 C CB  . ILE B 14  ? 1.8227 2.0274 1.4584 -0.2143 0.1586  0.0122  14  ILE B CB  
2132 C CG1 . ILE B 14  ? 1.8713 2.0393 1.4650 -0.2180 0.1744  0.0053  14  ILE B CG1 
2133 C CG2 . ILE B 14  ? 1.7947 2.0367 1.4644 -0.2492 0.1511  0.0127  14  ILE B CG2 
2134 C CD1 . ILE B 14  ? 1.9283 2.0475 1.4974 -0.2035 0.1628  -0.0207 14  ILE B CD1 
2135 N N   . LEU B 15  ? 1.8001 2.0161 1.4638 -0.1498 0.1370  0.0240  15  LEU B N   
2136 C CA  . LEU B 15  ? 1.7520 2.0026 1.4482 -0.1407 0.1268  0.0367  15  LEU B CA  
2137 C C   . LEU B 15  ? 1.7662 1.9900 1.4524 -0.0948 0.1171  0.0312  15  LEU B C   
2138 O O   . LEU B 15  ? 1.7979 1.9883 1.4482 -0.0723 0.1273  0.0287  15  LEU B O   
2139 C CB  . LEU B 15  ? 1.7079 2.0013 1.4152 -0.1616 0.1414  0.0586  15  LEU B CB  
2140 C CG  . LEU B 15  ? 1.6842 2.0140 1.4099 -0.2054 0.1477  0.0658  15  LEU B CG  
2141 C CD1 . LEU B 15  ? 1.6574 2.0199 1.3873 -0.2216 0.1655  0.0822  15  LEU B CD1 
2142 C CD2 . LEU B 15  ? 1.6536 2.0119 1.4145 -0.2169 0.1295  0.0676  15  LEU B CD2 
2143 N N   . ASN B 16  ? 1.7155 1.9528 1.4328 -0.0805 0.0975  0.0291  16  ASN B N   
2144 C CA  . ASN B 16  ? 1.7236 1.9420 1.4388 -0.0364 0.0854  0.0241  16  ASN B CA  
2145 C C   . ASN B 16  ? 1.6804 1.9286 1.4020 -0.0283 0.0909  0.0446  16  ASN B C   
2146 O O   . ASN B 16  ? 1.6413 1.9292 1.3769 -0.0578 0.1007  0.0613  16  ASN B O   
2147 C CB  . ASN B 16  ? 1.7232 1.9445 1.4732 -0.0244 0.0622  0.0122  16  ASN B CB  
2148 C CG  . ASN B 16  ? 1.7666 1.9634 1.5173 -0.0354 0.0567  -0.0101 16  ASN B CG  
2149 O OD1 . ASN B 16  ? 1.8124 1.9720 1.5302 -0.0303 0.0630  -0.0246 16  ASN B OD1 
2150 N ND2 . ASN B 16  ? 1.7564 1.9727 1.5438 -0.0504 0.0451  -0.0136 16  ASN B ND2 
2151 N N   . SER B 17  ? 1.3503 1.5799 1.0627 0.0127  0.0837  0.0416  17  SER B N   
2152 C CA  . SER B 17  ? 1.3129 1.5690 1.0316 0.0248  0.0873  0.0586  17  SER B CA  
2153 C C   . SER B 17  ? 1.2558 1.5641 1.0199 0.0070  0.0749  0.0713  17  SER B C   
2154 O O   . SER B 17  ? 1.2182 1.5625 0.9917 -0.0074 0.0835  0.0875  17  SER B O   
2155 C CB  . SER B 17  ? 1.3345 1.5605 1.0389 0.0752  0.0769  0.0504  17  SER B CB  
2156 O OG  . SER B 17  ? 1.3961 1.5667 1.0570 0.0949  0.0835  0.0347  17  SER B OG  
2157 N N   . ASP B 18  ? 1.8636 2.1742 1.6552 0.0082  0.0551  0.0627  18  ASP B N   
2158 C CA  . ASP B 18  ? 1.8175 2.1710 1.6485 -0.0068 0.0421  0.0741  18  ASP B CA  
2159 C C   . ASP B 18  ? 1.7935 2.1785 1.6316 -0.0527 0.0533  0.0856  18  ASP B C   
2160 O O   . ASP B 18  ? 1.7578 2.1776 1.6228 -0.0683 0.0444  0.0962  18  ASP B O   
2161 C CB  . ASP B 18  ? 1.8329 2.1756 1.6899 0.0049  0.0209  0.0611  18  ASP B CB  
2162 C CG  . ASP B 18  ? 1.8622 2.1916 1.7202 -0.0228 0.0239  0.0495  18  ASP B CG  
2163 O OD1 . ASP B 18  ? 1.9045 2.1996 1.7361 -0.0202 0.0323  0.0350  18  ASP B OD1 
2164 O OD2 . ASP B 18  ? 1.8458 2.1976 1.7296 -0.0465 0.0177  0.0543  18  ASP B OD2 
2165 N N   . GLY B 19  ? 0.9987 1.3698 0.8116 -0.0728 0.0720  0.0827  19  GLY B N   
2166 C CA  . GLY B 19  ? 0.9787 1.3789 0.7970 -0.1143 0.0837  0.0922  19  GLY B CA  
2167 C C   . GLY B 19  ? 0.9922 1.3895 0.8199 -0.1402 0.0789  0.0846  19  GLY B C   
2168 O O   . GLY B 19  ? 0.9815 1.3993 0.8113 -0.1741 0.0880  0.0904  19  GLY B O   
2169 N N   . SER B 20  ? 1.4703 1.8425 1.3050 -0.1237 0.0647  0.0702  20  SER B N   
2170 C CA  . SER B 20  ? 1.4911 1.8571 1.3356 -0.1462 0.0607  0.0602  20  SER B CA  
2171 C C   . SER B 20  ? 1.5320 1.8691 1.3491 -0.1570 0.0731  0.0466  20  SER B C   
2172 O O   . SER B 20  ? 1.5658 1.8677 1.3589 -0.1317 0.0755  0.0348  20  SER B O   
2173 C CB  . SER B 20  ? 1.5135 1.8611 1.3780 -0.1235 0.0426  0.0463  20  SER B CB  
2174 O OG  . SER B 20  ? 1.5504 1.8598 1.3984 -0.0880 0.0391  0.0296  20  SER B OG  
2175 N N   . SER B 21  ? 1.7895 2.1399 1.6085 -0.1931 0.0802  0.0477  21  SER B N   
2176 C CA  . SER B 21  ? 1.8286 2.1533 1.6232 -0.2052 0.0905  0.0342  21  SER B CA  
2177 C C   . SER B 21  ? 1.8796 2.1640 1.6712 -0.1851 0.0794  0.0090  21  SER B C   
2178 O O   . SER B 21  ? 1.8842 2.1686 1.7009 -0.1760 0.0654  0.0021  21  SER B O   
2179 C CB  . SER B 21  ? 1.8169 2.1667 1.6175 -0.2474 0.0983  0.0396  21  SER B CB  
2180 O OG  . SER B 21  ? 1.8295 2.1801 1.6497 -0.2603 0.0881  0.0307  21  SER B OG  
2181 N N   . ASN B 22  ? 1.6311 1.8801 1.3921 -0.1779 0.0857  -0.0059 22  ASN B N   
2182 C CA  . ASN B 22  ? 1.6855 1.8908 1.4379 -0.1508 0.0745  -0.0329 22  ASN B CA  
2183 C C   . ASN B 22  ? 1.7252 1.9144 1.4714 -0.1731 0.0754  -0.0525 22  ASN B C   
2184 O O   . ASN B 22  ? 1.7682 1.9215 1.4828 -0.1635 0.0784  -0.0680 22  ASN B O   
2185 C CB  . ASN B 22  ? 1.7107 1.8799 1.4260 -0.1160 0.0787  -0.0370 22  ASN B CB  
2186 C CG  . ASN B 22  ? 1.7642 1.8888 1.4725 -0.0779 0.0633  -0.0646 22  ASN B CG  
2187 O OD1 . ASN B 22  ? 1.7765 1.9021 1.5157 -0.0730 0.0485  -0.0794 22  ASN B OD1 
2188 N ND2 . ASN B 22  ? 1.8011 1.8846 1.4682 -0.0494 0.0671  -0.0728 22  ASN B ND2 
2189 N N   . ILE B 23  ? 1.6459 1.8604 1.4207 -0.2023 0.0725  -0.0520 23  ILE B N   
2190 C CA  . ILE B 23  ? 1.6792 1.8853 1.4513 -0.2278 0.0741  -0.0691 23  ILE B CA  
2191 C C   . ILE B 23  ? 1.7095 1.9098 1.5123 -0.2278 0.0615  -0.0893 23  ILE B C   
2192 O O   . ILE B 23  ? 1.6921 1.9070 1.5230 -0.2202 0.0546  -0.0826 23  ILE B O   
2193 C CB  . ILE B 23  ? 1.6427 1.8862 1.4174 -0.2701 0.0864  -0.0499 23  ILE B CB  
2194 C CG1 . ILE B 23  ? 1.6136 1.8676 1.3655 -0.2712 0.1003  -0.0296 23  ILE B CG1 
2195 C CG2 . ILE B 23  ? 1.6779 1.9122 1.4469 -0.2953 0.0881  -0.0678 23  ILE B CG2 
2196 C CD1 . ILE B 23  ? 1.6546 1.8700 1.3676 -0.2582 0.1073  -0.0417 23  ILE B CD1 
2197 N N   . THR B 24  ? 1.9503 2.1284 1.7483 -0.2363 0.0590  -0.1153 24  THR B N   
2198 C CA  . THR B 24  ? 1.9869 2.1603 1.8159 -0.2416 0.0501  -0.1375 24  THR B CA  
2199 C C   . THR B 24  ? 1.9646 2.1723 1.8110 -0.2853 0.0580  -0.1254 24  THR B C   
2200 O O   . THR B 24  ? 1.9609 2.1767 1.7911 -0.3117 0.0660  -0.1230 24  THR B O   
2201 C CB  . THR B 24  ? 2.0556 2.1891 1.8727 -0.2303 0.0428  -0.1749 24  THR B CB  
2202 O OG1 . THR B 24  ? 2.0777 2.1756 1.8657 -0.1909 0.0373  -0.1841 24  THR B OG1 
2203 C CG2 . THR B 24  ? 2.1012 2.2264 1.9557 -0.2268 0.0327  -0.2021 24  THR B CG2 
2204 N N   . ARG B 25  ? 2.3525 2.5788 2.2303 -0.2922 0.0557  -0.1177 25  ARG B N   
2205 C CA  . ARG B 25  ? 2.3360 2.5915 2.2267 -0.3312 0.0632  -0.1053 25  ARG B CA  
2206 C C   . ARG B 25  ? 2.3930 2.6353 2.3014 -0.3469 0.0620  -0.1336 25  ARG B C   
2207 O O   . ARG B 25  ? 2.4380 2.6587 2.3677 -0.3281 0.0542  -0.1567 25  ARG B O   
2208 C CB  . ARG B 25  ? 0.8934 1.1737 0.8040 -0.3325 0.0627  -0.0806 25  ARG B CB  
2209 N N   . LEU B 26  ? 2.5397 2.7959 2.4410 -0.3811 0.0697  -0.1330 26  LEU B N   
2210 C CA  . LEU B 26  ? 2.5952 2.8407 2.5111 -0.3990 0.0699  -0.1608 26  LEU B CA  
2211 C C   . LEU B 26  ? 2.5875 2.8588 2.5186 -0.4338 0.0787  -0.1474 26  LEU B C   
2212 O O   . LEU B 26  ? 2.5604 2.8541 2.4776 -0.4613 0.0858  -0.1326 26  LEU B O   
2213 C CB  . LEU B 26  ? 2.6157 2.8495 2.5082 -0.4079 0.0699  -0.1787 26  LEU B CB  
2214 C CG  . LEU B 26  ? 2.6271 2.8320 2.4931 -0.3763 0.0632  -0.1895 26  LEU B CG  
2215 C CD1 . LEU B 26  ? 2.6552 2.8474 2.4973 -0.3891 0.0634  -0.2074 26  LEU B CD1 
2216 C CD2 . LEU B 26  ? 2.6728 2.8457 2.5536 -0.3398 0.0514  -0.2153 26  LEU B CD2 
2217 N N   . GLY B 27  ? 2.0236 2.2898 1.9828 -0.4318 0.0785  -0.1533 27  GLY B N   
2218 C CA  . GLY B 27  ? 2.0074 2.2918 1.9779 -0.4621 0.0879  -0.1403 27  GLY B CA  
2219 C C   . GLY B 27  ? 2.0320 2.2991 2.0311 -0.4703 0.0909  -0.1688 27  GLY B C   
2220 O O   . GLY B 27  ? 2.0203 2.2908 2.0364 -0.4804 0.0974  -0.1599 27  GLY B O   
2221 N N   . TRP B 33  ? 1.9620 2.1687 2.1128 -0.4678 0.1332  -0.0846 33  TRP B N   
2222 C CA  . TRP B 33  ? 1.9052 2.0938 2.0934 -0.4473 0.1309  -0.0941 33  TRP B CA  
2223 C C   . TRP B 33  ? 1.8968 2.0878 2.0677 -0.4445 0.1283  -0.0577 33  TRP B C   
2224 O O   . TRP B 33  ? 1.8389 2.0333 2.0212 -0.4157 0.1130  -0.0497 33  TRP B O   
2225 C CB  . TRP B 33  ? 1.9220 2.0860 2.1429 -0.4655 0.1500  -0.1220 33  TRP B CB  
2226 N N   . LEU B 34  ? 2.4280 2.6165 2.5698 -0.4736 0.1426  -0.0365 34  LEU B N   
2227 C CA  . LEU B 34  ? 2.4375 2.6251 2.5561 -0.4728 0.1401  -0.0020 34  LEU B CA  
2228 C C   . LEU B 34  ? 2.4794 2.6913 2.5504 -0.4827 0.1341  0.0261  34  LEU B C   
2229 O O   . LEU B 34  ? 2.4963 2.7109 2.5410 -0.4821 0.1294  0.0552  34  LEU B O   
2230 C CB  . LEU B 34  ? 2.4878 2.6466 2.6081 -0.4956 0.1615  0.0008  34  LEU B CB  
2231 C CG  . LEU B 34  ? 2.4455 2.5795 2.6175 -0.4862 0.1690  -0.0269 34  LEU B CG  
2232 C CD1 . LEU B 34  ? 2.5119 2.6155 2.6830 -0.5131 0.1948  -0.0246 34  LEU B CD1 
2233 C CD2 . LEU B 34  ? 2.3672 2.5032 2.5617 -0.4510 0.1495  -0.0211 34  LEU B CD2 
2234 N N   . ASP B 35  ? 2.2711 2.5003 2.3328 -0.4907 0.1333  0.0155  35  ASP B N   
2235 C CA  . ASP B 35  ? 2.2912 2.5446 2.3128 -0.5028 0.1298  0.0371  35  ASP B CA  
2236 C C   . ASP B 35  ? 2.2482 2.5210 2.2527 -0.4822 0.1118  0.0637  35  ASP B C   
2237 O O   . ASP B 35  ? 2.2583 2.5385 2.2312 -0.4919 0.1109  0.0889  35  ASP B O   
2238 C CB  . ASP B 35  ? 2.2726 2.5412 2.2947 -0.5079 0.1289  0.0178  35  ASP B CB  
2239 C CG  . ASP B 35  ? 2.2806 2.5667 2.2675 -0.5337 0.1346  0.0314  35  ASP B CG  
2240 O OD1 . ASP B 35  ? 2.3075 2.5910 2.2697 -0.5487 0.1408  0.0531  35  ASP B OD1 
2241 O OD2 . ASP B 35  ? 2.2641 2.5653 2.2473 -0.5380 0.1325  0.0200  35  ASP B OD2 
2242 N N   . ASP B 36  ? 1.4440 1.7246 1.4691 -0.4529 0.0971  0.0564  36  ASP B N   
2243 C CA  . ASP B 36  ? 1.3996 1.7019 1.4117 -0.4325 0.0799  0.0779  36  ASP B CA  
2244 C C   . ASP B 36  ? 1.3706 1.6624 1.4018 -0.4082 0.0695  0.0844  36  ASP B C   
2245 O O   . ASP B 36  ? 1.3105 1.6123 1.3566 -0.3801 0.0548  0.0820  36  ASP B O   
2246 C CB  . ASP B 36  ? 1.3577 1.6784 1.3737 -0.4165 0.0710  0.0670  36  ASP B CB  
2247 C CG  . ASP B 36  ? 1.3203 1.6695 1.3142 -0.4078 0.0593  0.0893  36  ASP B CG  
2248 O OD1 . ASP B 36  ? 1.3192 1.6735 1.3009 -0.4062 0.0531  0.1111  36  ASP B OD1 
2249 O OD2 . ASP B 36  ? 1.2970 1.6621 1.2856 -0.4025 0.0565  0.0841  36  ASP B OD2 
2250 N N   . HIS B 37  ? 1.5007 1.7713 1.5301 -0.4190 0.0773  0.0930  37  HIS B N   
2251 C CA  . HIS B 37  ? 1.4492 1.7047 1.5019 -0.3981 0.0696  0.0954  37  HIS B CA  
2252 C C   . HIS B 37  ? 1.3983 1.6748 1.4462 -0.3710 0.0474  0.1133  37  HIS B C   
2253 O O   . HIS B 37  ? 1.3269 1.6040 1.4042 -0.3430 0.0353  0.1043  37  HIS B O   
2254 C CB  . HIS B 37  ? 1.5015 1.7285 1.5451 -0.4169 0.0836  0.1055  37  HIS B CB  
2255 C CG  . HIS B 37  ? 1.5531 1.7841 1.5546 -0.4236 0.0781  0.1369  37  HIS B CG  
2256 N ND1 . HIS B 37  ? 1.6078 1.8579 1.5719 -0.4389 0.0781  0.1501  37  HIS B ND1 
2257 C CD2 . HIS B 37  ? 1.5632 1.7801 1.5541 -0.4160 0.0717  0.1560  37  HIS B CD2 
2258 C CE1 . HIS B 37  ? 1.6429 1.8905 1.5749 -0.4392 0.0710  0.1749  37  HIS B CE1 
2259 N NE2 . HIS B 37  ? 1.6255 1.8521 1.5711 -0.4255 0.0668  0.1794  37  HIS B NE2 
2260 N N   . TYR B 38  ? 1.2020 1.4963 1.2141 -0.3782 0.0414  0.1369  38  TYR B N   
2261 C CA  . TYR B 38  ? 1.1608 1.4747 1.1675 -0.3550 0.0208  0.1539  38  TYR B CA  
2262 C C   . TYR B 38  ? 1.1020 1.4403 1.1244 -0.3319 0.0093  0.1442  38  TYR B C   
2263 O O   . TYR B 38  ? 1.0365 1.3804 1.0782 -0.3039 -0.0058 0.1443  38  TYR B O   
2264 C CB  . TYR B 38  ? 1.2080 1.5354 1.1737 -0.3684 0.0169  0.1777  38  TYR B CB  
2265 C CG  . TYR B 38  ? 1.1479 1.4973 1.1088 -0.3454 -0.0051 0.1929  38  TYR B CG  
2266 C CD1 . TYR B 38  ? 1.1159 1.4540 1.0904 -0.3255 -0.0175 0.1991  38  TYR B CD1 
2267 C CD2 . TYR B 38  ? 1.0936 1.4756 1.0384 -0.3437 -0.0133 0.1998  38  TYR B CD2 
2268 C CE1 . TYR B 38  ? 1.0599 1.4194 1.0310 -0.3043 -0.0389 0.2116  38  TYR B CE1 
2269 C CE2 . TYR B 38  ? 1.0433 1.4468 0.9862 -0.3232 -0.0330 0.2113  38  TYR B CE2 
2270 C CZ  . TYR B 38  ? 1.0373 1.4299 0.9927 -0.3034 -0.0464 0.2171  38  TYR B CZ  
2271 O OH  . TYR B 38  ? 0.9811 1.3965 0.9352 -0.2830 -0.0671 0.2272  38  TYR B OH  
2272 N N   . HIS B 39  ? 1.1512 1.5028 1.1635 -0.3435 0.0166  0.1361  39  HIS B N   
2273 C CA  . HIS B 39  ? 1.1135 1.4820 1.1362 -0.3237 0.0096  0.1255  39  HIS B CA  
2274 C C   . HIS B 39  ? 1.0527 1.4037 1.1109 -0.2992 0.0057  0.1045  39  HIS B C   
2275 O O   . HIS B 39  ? 0.9948 1.3544 1.0665 -0.2698 -0.0085 0.1044  39  HIS B O   
2276 C CB  . HIS B 39  ? 1.1286 1.5045 1.1369 -0.3435 0.0218  0.1160  39  HIS B CB  
2277 C CG  . HIS B 39  ? 1.1049 1.4845 1.1243 -0.3250 0.0194  0.0988  39  HIS B CG  
2278 N ND1 . HIS B 39  ? 1.1153 1.4730 1.1590 -0.3130 0.0216  0.0738  39  HIS B ND1 
2279 C CD2 . HIS B 39  ? 1.0788 1.4793 1.0865 -0.3163 0.0157  0.1021  39  HIS B CD2 
2280 C CE1 . HIS B 39  ? 1.0988 1.4615 1.1416 -0.2961 0.0181  0.0632  39  HIS B CE1 
2281 N NE2 . HIS B 39  ? 1.0778 1.4657 1.0985 -0.2985 0.0157  0.0808  39  HIS B NE2 
2282 N N   . ASP B 40  ? 1.1017 1.4283 1.1759 -0.3109 0.0183  0.0853  40  ASP B N   
2283 C CA  . ASP B 40  ? 1.0504 1.3586 1.1615 -0.2887 0.0154  0.0600  40  ASP B CA  
2284 C C   . ASP B 40  ? 0.9826 1.2877 1.1169 -0.2614 0.0008  0.0659  40  ASP B C   
2285 O O   . ASP B 40  ? 0.9266 1.2313 1.0847 -0.2306 -0.0108 0.0521  40  ASP B O   
2286 C CB  . ASP B 40  ? 1.0802 1.3627 1.2070 -0.3097 0.0324  0.0391  40  ASP B CB  
2287 C CG  . ASP B 40  ? 1.1406 1.4259 1.2498 -0.3330 0.0448  0.0278  40  ASP B CG  
2288 O OD1 . ASP B 40  ? 1.1565 1.4611 1.2448 -0.3296 0.0400  0.0334  40  ASP B OD1 
2289 O OD2 . ASP B 40  ? 1.1742 1.4422 1.2912 -0.3551 0.0598  0.0128  40  ASP B OD2 
2290 N N   . LEU B 41  ? 0.8587 1.1606 0.9844 -0.2715 0.0004  0.0862  41  LEU B N   
2291 C CA  . LEU B 41  ? 0.8874 1.1859 1.0341 -0.2473 -0.0142 0.0931  41  LEU B CA  
2292 C C   . LEU B 41  ? 0.8375 1.1631 0.9801 -0.2190 -0.0347 0.1042  41  LEU B C   
2293 O O   . LEU B 41  ? 0.8149 1.1406 0.9848 -0.1890 -0.0490 0.0986  41  LEU B O   
2294 C CB  . LEU B 41  ? 0.9245 1.2101 1.0564 -0.2653 -0.0099 0.1135  41  LEU B CB  
2295 C CG  . LEU B 41  ? 0.9566 1.2092 1.1055 -0.2845 0.0093  0.1000  41  LEU B CG  
2296 C CD1 . LEU B 41  ? 1.0256 1.2625 1.1456 -0.3074 0.0177  0.1227  41  LEU B CD1 
2297 C CD2 . LEU B 41  ? 0.8864 1.1238 1.0847 -0.2595 0.0038  0.0796  41  LEU B CD2 
2298 N N   . LEU B 42  ? 0.9938 1.3429 1.1042 -0.2285 -0.0357 0.1188  42  LEU B N   
2299 C CA  . LEU B 42  ? 0.9549 1.3310 1.0607 -0.2045 -0.0522 0.1281  42  LEU B CA  
2300 C C   . LEU B 42  ? 0.9359 1.3157 1.0520 -0.1850 -0.0526 0.1093  42  LEU B C   
2301 O O   . LEU B 42  ? 0.8949 1.2906 1.0148 -0.1584 -0.0658 0.1118  42  LEU B O   
2302 C CB  . LEU B 42  ? 1.0019 1.4023 1.0722 -0.2222 -0.0523 0.1490  42  LEU B CB  
2303 C CG  . LEU B 42  ? 1.0334 1.4322 1.0846 -0.2373 -0.0557 0.1696  42  LEU B CG  
2304 C CD1 . LEU B 42  ? 1.0485 1.4761 1.0699 -0.2463 -0.0604 0.1858  42  LEU B CD1 
2305 C CD2 . LEU B 42  ? 0.9762 1.3685 1.0466 -0.2143 -0.0722 0.1755  42  LEU B CD2 
2306 N N   . THR B 43  ? 0.8415 1.2047 0.9598 -0.1977 -0.0383 0.0900  43  THR B N   
2307 C CA  . THR B 43  ? 0.8235 1.1857 0.9421 -0.1827 -0.0371 0.0720  43  THR B CA  
2308 C C   . THR B 43  ? 0.8813 1.2229 1.0342 -0.1526 -0.0443 0.0472  43  THR B C   
2309 O O   . THR B 43  ? 0.7848 1.1255 0.9395 -0.1265 -0.0506 0.0349  43  THR B O   
2310 C CB  . THR B 43  ? 0.8420 1.1977 0.9422 -0.2119 -0.0196 0.0626  43  THR B CB  
2311 O OG1 . THR B 43  ? 0.8885 1.2662 0.9579 -0.2359 -0.0145 0.0841  43  THR B OG1 
2312 C CG2 . THR B 43  ? 0.8592 1.2074 0.9579 -0.1955 -0.0186 0.0418  43  THR B CG2 
2313 N N   . VAL B 44  ? 1.1747 1.2401 0.8489 -0.4771 -0.0282 -0.0939 44  VAL B N   
2314 C CA  . VAL B 44  ? 1.1513 1.2303 0.8267 -0.4867 -0.0301 -0.0713 44  VAL B CA  
2315 C C   . VAL B 44  ? 1.1663 1.2634 0.8520 -0.5224 -0.0255 -0.0891 44  VAL B C   
2316 O O   . VAL B 44  ? 1.1835 1.2950 0.8875 -0.5329 -0.0218 -0.1209 44  VAL B O   
2317 C CB  . VAL B 44  ? 1.1043 1.2037 0.8034 -0.4582 -0.0350 -0.0521 44  VAL B CB  
2318 C CG1 . VAL B 44  ? 1.0832 1.2029 0.7941 -0.4722 -0.0377 -0.0365 44  VAL B CG1 
2319 C CG2 . VAL B 44  ? 1.0813 1.1689 0.7653 -0.4264 -0.0391 -0.0272 44  VAL B CG2 
2320 N N   . SER B 45  ? 1.3565 1.4527 1.0305 -0.5397 -0.0269 -0.0702 45  SER B N   
2321 C CA  . SER B 45  ? 1.3695 1.4831 1.0518 -0.5715 -0.0235 -0.0841 45  SER B CA  
2322 C C   . SER B 45  ? 1.3358 1.4803 1.0553 -0.5601 -0.0294 -0.0885 45  SER B C   
2323 O O   . SER B 45  ? 1.2987 1.4484 1.0305 -0.5336 -0.0369 -0.0662 45  SER B O   
2324 C CB  . SER B 45  ? 1.3784 1.4751 1.0357 -0.5910 -0.0256 -0.0600 45  SER B CB  
2325 O OG  . SER B 45  ? 1.3073 1.4118 0.9781 -0.5722 -0.0333 -0.0302 45  SER B OG  
2326 N N   . TRP B 46  ? 1.5826 1.7489 1.3187 -0.5805 -0.0282 -0.1181 46  TRP B N   
2327 C CA  . TRP B 46  ? 1.5602 1.7522 1.3288 -0.5700 -0.0401 -0.1258 46  TRP B CA  
2328 C C   . TRP B 46  ? 1.5207 1.7143 1.2929 -0.5579 -0.0509 -0.0868 46  TRP B C   
2329 O O   . TRP B 46  ? 1.4955 1.6973 1.2846 -0.5350 -0.0622 -0.0760 46  TRP B O   
2330 C CB  . TRP B 46  ? 1.5886 1.8055 1.3716 -0.5949 -0.0403 -0.1624 46  TRP B CB  
2331 C CG  . TRP B 46  ? 1.6211 1.8489 1.4177 -0.5969 -0.0360 -0.2069 46  TRP B CG  
2332 C CD1 . TRP B 46  ? 1.6557 1.8886 1.4418 -0.6225 -0.0218 -0.2355 46  TRP B CD1 
2333 C CD2 . TRP B 46  ? 1.5843 1.8177 1.4067 -0.5734 -0.0471 -0.2282 46  TRP B CD2 
2334 N NE1 . TRP B 46  ? 1.6357 1.8799 1.4429 -0.6149 -0.0226 -0.2738 46  TRP B NE1 
2335 C CE2 . TRP B 46  ? 1.5933 1.8348 1.4225 -0.5842 -0.0387 -0.2707 46  TRP B CE2 
2336 C CE3 . TRP B 46  ? 1.5526 1.7834 1.3910 -0.5464 -0.0647 -0.2153 46  TRP B CE3 
2337 C CZ2 . TRP B 46  ? 1.5691 1.8126 1.4223 -0.5664 -0.0481 -0.3021 46  TRP B CZ2 
2338 C CZ3 . TRP B 46  ? 1.5364 1.7668 1.3947 -0.5310 -0.0748 -0.2458 46  TRP B CZ3 
2339 C CH2 . TRP B 46  ? 1.5433 1.7782 1.4097 -0.5398 -0.0668 -0.2893 46  TRP B CH2 
2340 N N   . PRO B 47  ? 1.3382 1.5224 1.0931 -0.5746 -0.0485 -0.0651 47  PRO B N   
2341 C CA  . PRO B 47  ? 1.3035 1.4873 1.0614 -0.5624 -0.0583 -0.0259 47  PRO B CA  
2342 C C   . PRO B 47  ? 1.2755 1.4589 1.0374 -0.5309 -0.0612 -0.0041 47  PRO B C   
2343 O O   . PRO B 47  ? 1.2519 1.4525 1.0333 -0.5154 -0.0730 0.0075  47  PRO B O   
2344 C CB  . PRO B 47  ? 1.3108 1.4692 1.0394 -0.5807 -0.0519 -0.0075 47  PRO B CB  
2345 C CG  . PRO B 47  ? 1.3625 1.5181 1.0783 -0.6122 -0.0425 -0.0392 47  PRO B CG  
2346 C CD  . PRO B 47  ? 1.3756 1.5466 1.1053 -0.6067 -0.0378 -0.0748 47  PRO B CD  
2347 N N   . VAL B 48  ? 1.1590 1.3227 0.9000 -0.5225 -0.0524 0.0009  48  VAL B N   
2348 C CA  . VAL B 48  ? 1.1097 1.2747 0.8517 -0.4915 -0.0538 0.0199  48  VAL B CA  
2349 C C   . VAL B 48  ? 1.1384 1.3186 0.9016 -0.4740 -0.0583 0.0048  48  VAL B C   
2350 O O   . VAL B 48  ? 1.1020 1.2974 0.8769 -0.4554 -0.0656 0.0247  48  VAL B O   
2351 C CB  . VAL B 48  ? 1.1039 1.2428 0.8183 -0.4844 -0.0471 0.0201  48  VAL B CB  
2352 C CG1 . VAL B 48  ? 1.0620 1.2064 0.7787 -0.4492 -0.0489 0.0356  48  VAL B CG1 
2353 C CG2 . VAL B 48  ? 1.0699 1.1871 0.7592 -0.5005 -0.0481 0.0367  48  VAL B CG2 
2354 N N   . PHE B 49  ? 1.0832 1.2585 0.8502 -0.4814 -0.0548 -0.0308 49  PHE B N   
2355 C CA  . PHE B 49  ? 1.0864 1.2683 0.8720 -0.4664 -0.0616 -0.0503 49  PHE B CA  
2356 C C   . PHE B 49  ? 1.0720 1.2743 0.8783 -0.4651 -0.0786 -0.0418 49  PHE B C   
2357 O O   . PHE B 49  ? 1.0625 1.2695 0.8756 -0.4466 -0.0875 -0.0307 49  PHE B O   
2358 C CB  . PHE B 49  ? 1.1225 1.2991 0.9132 -0.4798 -0.0573 -0.0940 49  PHE B CB  
2359 C CG  . PHE B 49  ? 1.1349 1.3147 0.9469 -0.4672 -0.0683 -0.1199 49  PHE B CG  
2360 C CD1 . PHE B 49  ? 1.1360 1.2997 0.9451 -0.4428 -0.0680 -0.1193 49  PHE B CD1 
2361 C CD2 . PHE B 49  ? 1.1514 1.3473 0.9846 -0.4794 -0.0815 -0.1467 49  PHE B CD2 
2362 C CE1 . PHE B 49  ? 1.1556 1.3148 0.9813 -0.4326 -0.0803 -0.1441 49  PHE B CE1 
2363 C CE2 . PHE B 49  ? 1.1505 1.3437 1.0011 -0.4681 -0.0963 -0.1734 49  PHE B CE2 
2364 C CZ  . PHE B 49  ? 1.1615 1.3340 1.0078 -0.4456 -0.0954 -0.1718 49  PHE B CZ  
2365 N N   . ILE B 50  ? 1.3501 1.5631 1.1635 -0.4858 -0.0851 -0.0462 50  ILE B N   
2366 C CA  . ILE B 50  ? 1.3419 1.5713 1.1720 -0.4863 -0.1063 -0.0373 50  ILE B CA  
2367 C C   . ILE B 50  ? 1.3117 1.5484 1.1384 -0.4735 -0.1112 0.0083  50  ILE B C   
2368 O O   . ILE B 50  ? 1.3092 1.5558 1.1451 -0.4643 -0.1280 0.0191  50  ILE B O   
2369 C CB  . ILE B 50  ? 1.3506 1.5888 1.1858 -0.5092 -0.1124 -0.0472 50  ILE B CB  
2370 C CG1 . ILE B 50  ? 1.3845 1.6233 1.2225 -0.5246 -0.1038 -0.0936 50  ILE B CG1 
2371 C CG2 . ILE B 50  ? 1.3497 1.6015 1.2012 -0.5079 -0.1402 -0.0425 50  ILE B CG2 
2372 C CD1 . ILE B 50  ? 1.3974 1.6476 1.2372 -0.5483 -0.1060 -0.1058 50  ILE B CD1 
2373 N N   . THR B 51  ? 0.9695 1.2012 0.7819 -0.4744 -0.0981 0.0337  51  THR B N   
2374 C CA  . THR B 51  ? 0.9115 1.1541 0.7219 -0.4612 -0.0999 0.0746  51  THR B CA  
2375 C C   . THR B 51  ? 0.8976 1.1482 0.7093 -0.4380 -0.0997 0.0805  51  THR B C   
2376 O O   . THR B 51  ? 0.8770 1.1462 0.6969 -0.4319 -0.1120 0.1013  51  THR B O   
2377 C CB  . THR B 51  ? 0.9115 1.1416 0.7042 -0.4617 -0.0860 0.0917  51  THR B CB  
2378 O OG1 . THR B 51  ? 0.9062 1.1248 0.6938 -0.4855 -0.0864 0.0885  51  THR B OG1 
2379 C CG2 . THR B 51  ? 0.8993 1.1462 0.6937 -0.4460 -0.0882 0.1301  51  THR B CG2 
2380 N N   . LEU B 52  ? 1.2730 1.5085 1.0742 -0.4264 -0.0866 0.0632  52  LEU B N   
2381 C CA  . LEU B 52  ? 1.2675 1.5058 1.0671 -0.4030 -0.0849 0.0651  52  LEU B CA  
2382 C C   . LEU B 52  ? 1.3101 1.5557 1.1226 -0.4029 -0.1019 0.0575  52  LEU B C   
2383 O O   . LEU B 52  ? 1.2825 1.5440 1.0957 -0.3920 -0.1081 0.0790  52  LEU B O   
2384 C CB  . LEU B 52  ? 1.3080 1.5213 1.0963 -0.3946 -0.0734 0.0380  52  LEU B CB  
2385 C CG  . LEU B 52  ? 1.2655 1.4670 1.0337 -0.3863 -0.0613 0.0484  52  LEU B CG  
2386 C CD1 . LEU B 52  ? 1.3148 1.4900 1.0710 -0.3770 -0.0546 0.0231  52  LEU B CD1 
2387 C CD2 . LEU B 52  ? 1.1899 1.4120 0.9557 -0.3643 -0.0608 0.0807  52  LEU B CD2 
2388 N N   . ILE B 53  ? 1.2187 1.4525 1.0398 -0.4161 -0.1108 0.0247  53  ILE B N   
2389 C CA  . ILE B 53  ? 1.2420 1.4761 1.0737 -0.4182 -0.1335 0.0116  53  ILE B CA  
2390 C C   . ILE B 53  ? 1.2324 1.4875 1.0680 -0.4252 -0.1520 0.0445  53  ILE B C   
2391 O O   . ILE B 53  ? 1.2413 1.5034 1.0745 -0.4187 -0.1643 0.0603  53  ILE B O   
2392 C CB  . ILE B 53  ? 1.2698 1.4930 1.1127 -0.4323 -0.1426 -0.0312 53  ILE B CB  
2393 C CG1 . ILE B 53  ? 1.2902 1.4924 1.1309 -0.4238 -0.1292 -0.0650 53  ILE B CG1 
2394 C CG2 . ILE B 53  ? 1.2964 1.5213 1.1499 -0.4378 -0.1747 -0.0416 53  ILE B CG2 
2395 C CD1 . ILE B 53  ? 1.3246 1.5209 1.1794 -0.4357 -0.1383 -0.1119 53  ILE B CD1 
2396 N N   . THR B 54  ? 0.9449 1.2089 0.7847 -0.4398 -0.1545 0.0558  54  THR B N   
2397 C CA  . THR B 54  ? 0.9350 1.2176 0.7781 -0.4469 -0.1721 0.0906  54  THR B CA  
2398 C C   . THR B 54  ? 0.8790 1.1809 0.7159 -0.4341 -0.1653 0.1279  54  THR B C   
2399 O O   . THR B 54  ? 0.8848 1.1985 0.7212 -0.4348 -0.1836 0.1442  54  THR B O   
2400 C CB  . THR B 54  ? 0.9164 1.2018 0.7613 -0.4601 -0.1680 0.1035  54  THR B CB  
2401 O OG1 . THR B 54  ? 0.9316 1.2036 0.7802 -0.4721 -0.1675 0.0665  54  THR B OG1 
2402 C CG2 . THR B 54  ? 0.9017 1.2016 0.7521 -0.4687 -0.1926 0.1346  54  THR B CG2 
2403 N N   . GLY B 55  ? 1.3268 1.6329 1.1573 -0.4233 -0.1410 0.1402  55  GLY B N   
2404 C CA  . GLY B 55  ? 1.2654 1.5957 1.0917 -0.4082 -0.1324 0.1703  55  GLY B CA  
2405 C C   . GLY B 55  ? 1.2950 1.6296 1.1175 -0.3994 -0.1401 0.1663  55  GLY B C   
2406 O O   . GLY B 55  ? 1.2811 1.6390 1.1038 -0.4030 -0.1528 0.1916  55  GLY B O   
2407 N N   . LEU B 56  ? 0.9901 1.3000 0.8075 -0.3898 -0.1335 0.1346  56  LEU B N   
2408 C CA  . LEU B 56  ? 1.0243 1.3281 0.8357 -0.3815 -0.1414 0.1261  56  LEU B CA  
2409 C C   . LEU B 56  ? 1.0670 1.3736 0.8804 -0.3990 -0.1723 0.1323  56  LEU B C   
2410 O O   . LEU B 56  ? 1.0609 1.3820 0.8662 -0.3988 -0.1817 0.1518  56  LEU B O   
2411 C CB  . LEU B 56  ? 1.0851 1.3529 0.8943 -0.3735 -0.1359 0.0852  56  LEU B CB  
2412 C CG  . LEU B 56  ? 1.1341 1.3840 0.9358 -0.3640 -0.1450 0.0709  56  LEU B CG  
2413 C CD1 . LEU B 56  ? 1.0824 1.3586 0.8735 -0.3531 -0.1406 0.1032  56  LEU B CD1 
2414 C CD2 . LEU B 56  ? 1.1663 1.3837 0.9649 -0.3491 -0.1316 0.0378  56  LEU B CD2 
2415 N N   . TYR B 57  ? 1.2829 1.5758 1.1051 -0.4148 -0.1898 0.1150  57  TYR B N   
2416 C CA  . TYR B 57  ? 1.3342 1.6242 1.1572 -0.4314 -0.2259 0.1167  57  TYR B CA  
2417 C C   . TYR B 57  ? 1.2847 1.6060 1.1036 -0.4402 -0.2370 0.1634  57  TYR B C   
2418 O O   . TYR B 57  ? 1.3047 1.6306 1.1124 -0.4454 -0.2555 0.1769  57  TYR B O   
2419 C CB  . TYR B 57  ? 1.3473 1.6255 1.1822 -0.4435 -0.2384 0.0929  57  TYR B CB  
2420 C CG  . TYR B 57  ? 1.3835 1.6564 1.2196 -0.4589 -0.2804 0.0910  57  TYR B CG  
2421 C CD1 . TYR B 57  ? 1.4363 1.6904 1.2638 -0.4613 -0.3104 0.0762  57  TYR B CD1 
2422 C CD2 . TYR B 57  ? 1.3706 1.6525 1.2142 -0.4707 -0.2936 0.1022  57  TYR B CD2 
2423 C CE1 . TYR B 57  ? 1.4774 1.7224 1.3027 -0.4752 -0.3552 0.0730  57  TYR B CE1 
2424 C CE2 . TYR B 57  ? 1.4065 1.6817 1.2496 -0.4828 -0.3366 0.1000  57  TYR B CE2 
2425 C CZ  . TYR B 57  ? 1.4606 1.7175 1.2941 -0.4850 -0.3688 0.0850  57  TYR B CZ  
2426 O OH  . TYR B 57  ? 1.5034 1.7498 1.3331 -0.4969 -0.4179 0.0819  57  TYR B OH  
2427 N N   . LEU B 58  ? 1.1243 1.4658 0.9509 -0.4435 -0.2264 0.1878  58  LEU B N   
2428 C CA  . LEU B 58  ? 1.0739 1.4481 0.8998 -0.4514 -0.2345 0.2330  58  LEU B CA  
2429 C C   . LEU B 58  ? 1.0376 1.4383 0.8544 -0.4415 -0.2207 0.2530  58  LEU B C   
2430 O O   . LEU B 58  ? 1.0556 1.4709 0.8631 -0.4525 -0.2407 0.2734  58  LEU B O   
2431 C CB  . LEU B 58  ? 1.0118 1.3987 0.8477 -0.4513 -0.2185 0.2520  58  LEU B CB  
2432 C CG  . LEU B 58  ? 1.0470 1.4087 0.8901 -0.4610 -0.2276 0.2309  58  LEU B CG  
2433 C CD1 . LEU B 58  ? 0.9930 1.3642 0.8426 -0.4654 -0.2200 0.2572  58  LEU B CD1 
2434 C CD2 . LEU B 58  ? 1.1217 1.4704 0.9639 -0.4752 -0.2673 0.2213  58  LEU B CD2 
2435 N N   . VAL B 59  ? 1.0857 1.4926 0.9031 -0.4213 -0.1885 0.2465  59  VAL B N   
2436 C CA  . VAL B 59  ? 1.0533 1.4873 0.8625 -0.4071 -0.1729 0.2601  59  VAL B CA  
2437 C C   . VAL B 59  ? 1.1091 1.5368 0.9036 -0.4154 -0.1928 0.2577  59  VAL B C   
2438 O O   . VAL B 59  ? 1.1006 1.5602 0.8883 -0.4265 -0.2029 0.2877  59  VAL B O   
2439 C CB  . VAL B 59  ? 1.0316 1.4542 0.8387 -0.3816 -0.1441 0.2381  59  VAL B CB  
2440 C CG1 . VAL B 59  ? 1.0086 1.4562 0.8054 -0.3648 -0.1316 0.2472  59  VAL B CG1 
2441 C CG2 . VAL B 59  ? 0.9765 1.4071 0.7923 -0.3745 -0.1267 0.2453  59  VAL B CG2 
2442 N N   . THR B 60  ? 1.4199 1.8053 1.2083 -0.4119 -0.2001 0.2218  60  THR B N   
2443 C CA  . THR B 60  ? 1.4778 1.8477 1.2487 -0.4185 -0.2199 0.2157  60  THR B CA  
2444 C C   . THR B 60  ? 1.5133 1.8907 1.2754 -0.4463 -0.2573 0.2387  60  THR B C   
2445 O O   . THR B 60  ? 1.5269 1.9162 1.2708 -0.4558 -0.2683 0.2560  60  THR B O   
2446 C CB  . THR B 60  ? 1.5541 1.8705 1.3224 -0.4121 -0.2278 0.1696  60  THR B CB  
2447 O OG1 . THR B 60  ? 1.6180 1.9095 1.3933 -0.4287 -0.2576 0.1509  60  THR B OG1 
2448 C CG2 . THR B 60  ? 1.5283 1.8339 1.3050 -0.3885 -0.1953 0.1476  60  THR B CG2 
2449 N N   . ASN B 61  ? 1.4120 1.7814 1.1842 -0.4602 -0.2786 0.2392  61  ASN B N   
2450 C CA  . ASN B 61  ? 1.4476 1.8226 1.2102 -0.4859 -0.3183 0.2637  61  ASN B CA  
2451 C C   . ASN B 61  ? 1.3871 1.8147 1.1460 -0.4944 -0.3106 0.3125  61  ASN B C   
2452 O O   . ASN B 61  ? 1.4185 1.8557 1.1584 -0.5145 -0.3364 0.3348  61  ASN B O   
2453 C CB  . ASN B 61  ? 1.4731 1.8332 1.2489 -0.4948 -0.3402 0.2568  61  ASN B CB  
2454 C CG  . ASN B 61  ? 1.5686 1.8810 1.3424 -0.4973 -0.3697 0.2122  61  ASN B CG  
2455 O OD1 . ASN B 61  ? 1.6407 1.9299 1.3964 -0.5098 -0.4065 0.2052  61  ASN B OD1 
2456 N ND2 . ASN B 61  ? 1.5759 1.8734 1.3671 -0.4866 -0.3555 0.1801  61  ASN B ND2 
2457 N N   . ALA B 62  ? 1.0590 1.5205 0.8351 -0.4807 -0.2773 0.3282  62  ALA B N   
2458 C CA  . ALA B 62  ? 0.9995 1.5172 0.7767 -0.4844 -0.2648 0.3699  62  ALA B CA  
2459 C C   . ALA B 62  ? 1.0057 1.5438 0.7645 -0.4827 -0.2561 0.3744  62  ALA B C   
2460 O O   . ALA B 62  ? 1.0172 1.5855 0.7623 -0.5033 -0.2717 0.4043  62  ALA B O   
2461 C CB  . ALA B 62  ? 0.9205 1.4632 0.7183 -0.4642 -0.2295 0.3753  62  ALA B CB  
2462 N N   . LEU B 63  ? 1.2268 1.7475 0.9835 -0.4594 -0.2322 0.3450  63  LEU B N   
2463 C CA  . LEU B 63  ? 1.2354 1.7681 0.9728 -0.4550 -0.2237 0.3449  63  LEU B CA  
2464 C C   . LEU B 63  ? 1.3131 1.8250 1.0245 -0.4845 -0.2626 0.3509  63  LEU B C   
2465 O O   . LEU B 63  ? 1.3147 1.8628 1.0093 -0.5003 -0.2668 0.3781  63  LEU B O   
2466 C CB  . LEU B 63  ? 1.2421 1.7386 0.9783 -0.4272 -0.2029 0.3068  63  LEU B CB  
2467 C CG  . LEU B 63  ? 1.1704 1.6891 0.9227 -0.3961 -0.1652 0.3019  63  LEU B CG  
2468 C CD1 . LEU B 63  ? 1.1945 1.6663 0.9431 -0.3724 -0.1528 0.2635  63  LEU B CD1 
2469 C CD2 . LEU B 63  ? 1.1153 1.6986 0.8656 -0.3871 -0.1446 0.3287  63  LEU B CD2 
2470 N N   . PHE B 64  ? 1.3290 1.7829 1.0359 -0.4929 -0.2929 0.3240  64  PHE B N   
2471 C CA  . PHE B 64  ? 1.4160 1.8393 1.0956 -0.5209 -0.3379 0.3250  64  PHE B CA  
2472 C C   . PHE B 64  ? 1.4161 1.8750 1.0866 -0.5517 -0.3645 0.3692  64  PHE B C   
2473 O O   . PHE B 64  ? 1.4494 1.9178 1.0917 -0.5750 -0.3840 0.3892  64  PHE B O   
2474 C CB  . PHE B 64  ? 1.4963 1.8539 1.1771 -0.5219 -0.3691 0.2846  64  PHE B CB  
2475 C CG  . PHE B 64  ? 1.5540 1.8624 1.2215 -0.5105 -0.3698 0.2459  64  PHE B CG  
2476 C CD1 . PHE B 64  ? 1.5334 1.8250 1.2184 -0.4809 -0.3370 0.2134  64  PHE B CD1 
2477 C CD2 . PHE B 64  ? 1.6333 1.9086 1.2683 -0.5306 -0.4055 0.2426  64  PHE B CD2 
2478 C CE1 . PHE B 64  ? 1.5903 1.8341 1.2639 -0.4696 -0.3386 0.1786  64  PHE B CE1 
2479 C CE2 . PHE B 64  ? 1.6907 1.9149 1.3130 -0.5196 -0.4076 0.2065  64  PHE B CE2 
2480 C CZ  . PHE B 64  ? 1.6682 1.8774 1.3115 -0.4880 -0.3734 0.1746  64  PHE B CZ  
2481 N N   . ALA B 65  ? 1.4908 1.9678 1.1829 -0.5531 -0.3663 0.3854  65  ALA B N   
2482 C CA  . ALA B 65  ? 1.4849 1.9985 1.1717 -0.5799 -0.3893 0.4306  65  ALA B CA  
2483 C C   . ALA B 65  ? 1.4490 2.0232 1.1241 -0.5888 -0.3692 0.4639  65  ALA B C   
2484 O O   . ALA B 65  ? 1.4964 2.0812 1.1445 -0.6200 -0.3991 0.4896  65  ALA B O   
2485 C CB  . ALA B 65  ? 1.4293 1.9616 1.1456 -0.5719 -0.3791 0.4445  65  ALA B CB  
2486 N N   . LEU B 66  ? 1.3964 2.0113 1.0903 -0.5621 -0.3205 0.4621  66  LEU B N   
2487 C CA  . LEU B 66  ? 1.3613 2.0412 1.0477 -0.5652 -0.2968 0.4874  66  LEU B CA  
2488 C C   . LEU B 66  ? 1.4258 2.0896 1.0747 -0.5839 -0.3139 0.4837  66  LEU B C   
2489 O O   . LEU B 66  ? 1.4418 2.1479 1.0708 -0.6115 -0.3237 0.5156  66  LEU B O   
2490 C CB  . LEU B 66  ? 1.2835 1.9952 0.9926 -0.5268 -0.2464 0.4730  66  LEU B CB  
2491 C CG  . LEU B 66  ? 1.2084 1.9706 0.9489 -0.5149 -0.2243 0.4934  66  LEU B CG  
2492 C CD1 . LEU B 66  ? 1.2185 1.9453 0.9727 -0.5238 -0.2477 0.4968  66  LEU B CD1 
2493 C CD2 . LEU B 66  ? 1.1454 1.9202 0.9041 -0.4747 -0.1830 0.4704  66  LEU B CD2 
2494 N N   . ALA B 67  ? 1.8820 2.4840 1.5203 -0.5704 -0.3177 0.4444  67  ALA B N   
2495 C CA  . ALA B 67  ? 1.9554 2.5261 1.5556 -0.5879 -0.3385 0.4362  67  ALA B CA  
2496 C C   . ALA B 67  ? 2.0287 2.5892 1.5994 -0.6333 -0.3908 0.4628  67  ALA B C   
2497 O O   . ALA B 67  ? 2.0625 2.6431 1.6007 -0.6603 -0.4018 0.4840  67  ALA B O   
2498 C CB  . ALA B 67  ? 2.0046 2.4978 1.6015 -0.5691 -0.3454 0.3881  67  ALA B CB  
2499 N N   . TYR B 68  ? 1.5361 2.0653 1.1160 -0.6424 -0.4248 0.4621  68  TYR B N   
2500 C CA  . TYR B 68  ? 1.6108 2.1252 1.1622 -0.6838 -0.4813 0.4876  68  TYR B CA  
2501 C C   . TYR B 68  ? 1.5759 2.1662 1.1222 -0.7095 -0.4766 0.5407  68  TYR B C   
2502 O O   . TYR B 68  ? 1.6221 2.2247 1.1313 -0.7434 -0.4982 0.5635  68  TYR B O   
2503 C CB  . TYR B 68  ? 1.6452 2.1145 1.2108 -0.6827 -0.5175 0.4744  68  TYR B CB  
2504 C CG  . TYR B 68  ? 1.7196 2.1099 1.2775 -0.6719 -0.5421 0.4233  68  TYR B CG  
2505 C CD1 . TYR B 68  ? 1.6964 2.0623 1.2872 -0.6399 -0.5229 0.3860  68  TYR B CD1 
2506 C CD2 . TYR B 68  ? 1.8177 2.1579 1.3342 -0.6950 -0.5847 0.4111  68  TYR B CD2 
2507 C CE1 . TYR B 68  ? 1.7699 2.0696 1.3565 -0.6303 -0.5443 0.3375  68  TYR B CE1 
2508 C CE2 . TYR B 68  ? 1.8919 2.1596 1.4033 -0.6840 -0.6086 0.3616  68  TYR B CE2 
2509 C CZ  . TYR B 68  ? 1.8676 2.1184 1.4160 -0.6510 -0.5873 0.3245  68  TYR B CZ  
2510 O OH  . TYR B 68  ? 1.9476 2.1316 1.4938 -0.6403 -0.6105 0.2732  68  TYR B OH  
2511 N N   . LEU B 69  ? 1.3444 1.9857 0.9273 -0.6943 -0.4482 0.5597  69  LEU B N   
2512 C CA  . LEU B 69  ? 1.3136 2.0341 0.8993 -0.7140 -0.4376 0.6074  69  LEU B CA  
2513 C C   . LEU B 69  ? 1.3118 2.0805 0.8762 -0.7229 -0.4126 0.6162  69  LEU B C   
2514 O O   . LEU B 69  ? 1.3461 2.1551 0.8850 -0.7603 -0.4300 0.6521  69  LEU B O   
2515 C CB  . LEU B 69  ? 1.2166 1.9836 0.8489 -0.6844 -0.3967 0.6142  69  LEU B CB  
2516 C CG  . LEU B 69  ? 1.2193 1.9469 0.8712 -0.6799 -0.4209 0.6128  69  LEU B CG  
2517 C CD1 . LEU B 69  ? 1.1334 1.9102 0.8251 -0.6598 -0.3866 0.6292  69  LEU B CD1 
2518 C CD2 . LEU B 69  ? 1.2947 2.0030 0.9190 -0.7205 -0.4808 0.6424  69  LEU B CD2 
2519 N N   . ALA B 70  ? 1.5377 2.3032 1.1115 -0.6888 -0.3724 0.5835  70  ALA B N   
2520 C CA  . ALA B 70  ? 1.5234 2.3351 1.0794 -0.6902 -0.3442 0.5871  70  ALA B CA  
2521 C C   . ALA B 70  ? 1.6152 2.4091 1.1188 -0.7375 -0.3850 0.6039  70  ALA B C   
2522 O O   . ALA B 70  ? 1.6170 2.4755 1.1026 -0.7612 -0.3749 0.6319  70  ALA B O   
2523 C CB  . ALA B 70  ? 1.4960 2.2761 1.0595 -0.6491 -0.3115 0.5442  70  ALA B CB  
2524 N N   . CYS B 71  ? 1.9832 2.6895 1.4612 -0.7521 -0.4327 0.5851  71  CYS B N   
2525 C CA  . CYS B 71  ? 2.0834 2.7584 1.5069 -0.8002 -0.4825 0.5999  71  CYS B CA  
2526 C C   . CYS B 71  ? 2.1042 2.8228 1.5174 -0.8421 -0.5141 0.6497  71  CYS B C   
2527 O O   . CYS B 71  ? 2.1564 2.9026 1.5297 -0.8850 -0.5331 0.6798  71  CYS B O   
2528 C CB  . CYS B 71  ? 2.1710 2.7382 1.5736 -0.8018 -0.5309 0.5633  71  CYS B CB  
2529 S SG  . CYS B 71  ? 2.1647 2.6733 1.5740 -0.7581 -0.5003 0.5055  71  CYS B SG  
2530 N N   . GLY B 72  ? 2.3824 1.8209 1.6311 -1.1014 -0.6957 0.3380  72  GLY B N   
2531 C CA  . GLY B 72  ? 2.3865 1.8351 1.6751 -1.0686 -0.6116 0.2477  72  GLY B CA  
2532 C C   . GLY B 72  ? 2.3096 1.7856 1.6036 -1.0396 -0.5555 0.3050  72  GLY B C   
2533 O O   . GLY B 72  ? 2.4366 1.8637 1.6475 -1.0706 -0.5241 0.3346  72  GLY B O   
2534 N N   . ASP B 73  ? 2.9022 2.4523 2.2906 -0.9801 -0.5443 0.3216  73  ASP B N   
2535 C CA  . ASP B 73  ? 2.8353 2.4127 2.2383 -0.9457 -0.4825 0.3598  73  ASP B CA  
2536 C C   . ASP B 73  ? 2.7977 2.3672 2.1448 -0.9640 -0.4962 0.4799  73  ASP B C   
2537 O O   . ASP B 73  ? 2.8294 2.3651 2.1232 -0.9728 -0.4373 0.4831  73  ASP B O   
2538 C CB  . ASP B 73  ? 2.9294 2.4599 2.3010 -0.9523 -0.3916 0.2516  73  ASP B CB  
2539 C CG  . ASP B 73  ? 2.9692 2.5136 2.4106 -0.9273 -0.3710 0.1319  73  ASP B CG  
2540 O OD1 . ASP B 73  ? 2.9156 2.5065 2.4293 -0.9004 -0.4263 0.1359  73  ASP B OD1 
2541 O OD2 . ASP B 73  ? 3.0605 2.5676 2.4851 -0.9354 -0.3004 0.0339  73  ASP B OD2 
2542 N N   . VAL B 74  ? 2.3557 1.9556 1.7169 -0.9699 -0.5751 0.5787  74  VAL B N   
2543 C CA  . VAL B 74  ? 2.3294 1.9235 1.6459 -0.9883 -0.5978 0.6959  74  VAL B CA  
2544 C C   . VAL B 74  ? 2.1958 1.8749 1.5956 -0.9370 -0.6097 0.8011  74  VAL B C   
2545 O O   . VAL B 74  ? 2.2439 1.9354 1.6325 -0.9467 -0.6456 0.9103  74  VAL B O   
2546 C CB  . VAL B 74  ? 2.3769 1.9327 1.6355 -1.0421 -0.6793 0.7421  74  VAL B CB  
2547 C CG1 . VAL B 74  ? 2.5134 1.9677 1.6474 -1.1020 -0.6548 0.7017  74  VAL B CG1 
2548 C CG2 . VAL B 74  ? 2.3816 1.9525 1.6818 -1.0435 -0.7334 0.6923  74  VAL B CG2 
2549 N N   . ILE B 75  ? 2.3069 2.0423 1.7908 -0.8828 -0.5798 0.7679  75  ILE B N   
2550 C CA  . ILE B 75  ? 2.1865 1.9994 1.7484 -0.8321 -0.5822 0.8610  75  ILE B CA  
2551 C C   . ILE B 75  ? 2.1580 1.9875 1.7463 -0.7864 -0.4970 0.8303  75  ILE B C   
2552 O O   . ILE B 75  ? 2.1747 2.0007 1.7867 -0.7647 -0.4558 0.7321  75  ILE B O   
2553 C CB  . ILE B 75  ? 2.1078 1.9814 1.7520 -0.8054 -0.6411 0.8813  75  ILE B CB  
2554 C CG1 . ILE B 75  ? 2.1216 1.9874 1.7439 -0.8483 -0.7303 0.9407  75  ILE B CG1 
2555 C CG2 . ILE B 75  ? 1.9963 1.9460 1.7205 -0.7497 -0.6282 0.9634  75  ILE B CG2 
2556 C CD1 . ILE B 75  ? 2.0752 1.9744 1.7545 -0.8369 -0.7893 0.9246  75  ILE B CD1 
2557 N N   . GLU B 76  ? 2.0041 1.8501 1.5892 -0.7722 -0.4731 0.9164  76  GLU B N   
2558 C CA  . GLU B 76  ? 1.9696 1.8344 1.5803 -0.7266 -0.3961 0.9059  76  GLU B CA  
2559 C C   . GLU B 76  ? 1.8983 1.8176 1.5949 -0.6731 -0.3850 0.8697  76  GLU B C   
2560 O O   . GLU B 76  ? 1.8375 1.8047 1.5916 -0.6584 -0.4413 0.9123  76  GLU B O   
2561 C CB  . GLU B 76  ? 2.0167 1.9125 1.6390 -0.7102 -0.3939 1.0286  76  GLU B CB  
2562 C CG  . GLU B 76  ? 1.9727 1.8607 1.5857 -0.6795 -0.3100 1.0180  76  GLU B CG  
2563 C CD  . GLU B 76  ? 2.0539 1.8584 1.5723 -0.7182 -0.2607 0.9348  76  GLU B CD  
2564 O OE1 . GLU B 76  ? 2.1259 1.8768 1.5683 -0.7708 -0.2901 0.9541  76  GLU B OE1 
2565 O OE2 . GLU B 76  ? 2.0460 1.8358 1.5641 -0.6976 -0.1926 0.8497  76  GLU B OE2 
2566 N N   . ASN B 77  ? 1.8514 1.7589 1.5532 -0.6456 -0.3132 0.7904  77  ASN B N   
2567 C CA  . ASN B 77  ? 1.7703 1.7228 1.5472 -0.5911 -0.2950 0.7601  77  ASN B CA  
2568 C C   . ASN B 77  ? 1.7503 1.7180 1.5691 -0.5904 -0.3525 0.7137  77  ASN B C   
2569 O O   . ASN B 77  ? 1.6844 1.6978 1.5679 -0.5484 -0.3657 0.7298  77  ASN B O   
2570 C CB  . ASN B 77  ? 1.7334 1.7462 1.5625 -0.5458 -0.2892 0.8695  77  ASN B CB  
2571 C CG  . ASN B 77  ? 1.7620 1.7624 1.5651 -0.5291 -0.2169 0.8919  77  ASN B CG  
2572 O OD1 . ASN B 77  ? 1.7317 1.7178 1.5356 -0.5032 -0.1529 0.8226  77  ASN B OD1 
2573 N ND2 . ASN B 77  ? 1.7928 1.7965 1.5731 -0.5442 -0.2287 0.9890  77  ASN B ND2 
2574 N N   . ALA B 78  ? 1.9218 1.8464 1.6999 -0.6375 -0.3864 0.6556  78  ALA B N   
2575 C CA  . ALA B 78  ? 1.9367 1.8671 1.7497 -0.6397 -0.4404 0.6008  78  ALA B CA  
2576 C C   . ALA B 78  ? 2.0251 1.9168 1.8358 -0.6400 -0.3982 0.4614  78  ALA B C   
2577 O O   . ALA B 78  ? 2.1136 1.9531 1.8668 -0.6735 -0.3575 0.4020  78  ALA B O   
2578 C CB  . ALA B 78  ? 1.9700 1.8805 1.7459 -0.6907 -0.5136 0.6325  78  ALA B CB  
2579 N N   . ARG B 79  ? 1.9561 1.8714 1.8298 -0.6032 -0.4072 0.4094  79  ARG B N   
2580 C CA  . ARG B 79  ? 1.9810 1.8632 1.8660 -0.6039 -0.3799 0.2752  79  ARG B CA  
2581 C C   . ARG B 79  ? 2.1072 1.9421 1.9460 -0.6601 -0.4116 0.2226  79  ARG B C   
2582 O O   . ARG B 79  ? 2.1281 1.9692 1.9640 -0.6808 -0.4836 0.2647  79  ARG B O   
2583 C CB  . ARG B 79  ? 1.8869 1.7984 1.8457 -0.5613 -0.4096 0.2378  79  ARG B CB  
2584 C CG  . ARG B 79  ? 1.7689 1.7198 1.7673 -0.5057 -0.3764 0.2859  79  ARG B CG  
2585 C CD  . ARG B 79  ? 1.6670 1.6292 1.7269 -0.4657 -0.3947 0.2251  79  ARG B CD  
2586 N NE  . ARG B 79  ? 1.6340 1.6241 1.7232 -0.4583 -0.4732 0.2809  79  ARG B NE  
2587 C CZ  . ARG B 79  ? 1.6931 1.6688 1.7915 -0.4809 -0.5374 0.2373  79  ARG B CZ  
2588 N NH1 . ARG B 79  ? 1.7640 1.6989 1.8481 -0.5115 -0.5307 0.1353  79  ARG B NH1 
2589 N NH2 . ARG B 79  ? 1.6494 1.6500 1.7715 -0.4733 -0.6071 0.2949  79  ARG B NH2 
2590 N N   . PRO B 80  ? 2.0151 1.8000 1.8142 -0.6866 -0.3556 0.1321  80  PRO B N   
2591 C CA  . PRO B 80  ? 2.1532 1.8836 1.8984 -0.7429 -0.3723 0.0750  80  PRO B CA  
2592 C C   . PRO B 80  ? 2.1635 1.8974 1.9482 -0.7479 -0.4435 0.0305  80  PRO B C   
2593 O O   . PRO B 80  ? 2.1022 1.8565 1.9561 -0.7129 -0.4488 -0.0330 80  PRO B O   
2594 C CB  . PRO B 80  ? 2.2181 1.9065 1.9470 -0.7520 -0.2901 -0.0381 80  PRO B CB  
2595 C CG  . PRO B 80  ? 2.1425 1.8522 1.8750 -0.7177 -0.2288 0.0042  80  PRO B CG  
2596 C CD  . PRO B 80  ? 1.9994 1.7735 1.7981 -0.6662 -0.2686 0.0813  80  PRO B CD  
2597 N N   . GLY B 81  ? 2.4320 2.1426 2.1700 -0.7915 -0.5002 0.0657  81  GLY B N   
2598 C CA  . GLY B 81  ? 2.4579 2.1645 2.2220 -0.8024 -0.5710 0.0280  81  GLY B CA  
2599 C C   . GLY B 81  ? 2.3315 2.0921 2.1792 -0.7536 -0.6189 0.0467  81  GLY B C   
2600 O O   . GLY B 81  ? 2.3033 2.0583 2.1958 -0.7445 -0.6463 -0.0354 81  GLY B O   
2601 N N   . SER B 82  ? 1.9228 1.9062 2.4063 -0.9593 -0.2569 0.6995  82  SER B N   
2602 C CA  . SER B 82  ? 1.9347 1.9126 2.3928 -0.9855 -0.2816 0.6996  82  SER B CA  
2603 C C   . SER B 82  ? 1.9349 1.8789 2.3327 -0.9851 -0.2702 0.6668  82  SER B C   
2604 O O   . SER B 82  ? 1.9035 1.8333 2.2596 -0.9897 -0.2630 0.6311  82  SER B O   
2605 C CB  . SER B 82  ? 1.9323 1.9250 2.3822 -1.0207 -0.3136 0.6941  82  SER B CB  
2606 O OG  . SER B 82  ? 1.9256 1.8964 2.3119 -1.0389 -0.3180 0.6558  82  SER B OG  
2607 N N   . PHE B 83  ? 1.8029 1.7347 2.1982 -0.9796 -0.2684 0.6802  83  PHE B N   
2608 C CA  . PHE B 83  ? 1.8077 1.7067 2.1526 -0.9777 -0.2563 0.6534  83  PHE B CA  
2609 C C   . PHE B 83  ? 1.7985 1.6879 2.0919 -1.0091 -0.2742 0.6240  83  PHE B C   
2610 O O   . PHE B 83  ? 1.7461 1.6141 1.9960 -1.0091 -0.2619 0.5896  83  PHE B O   
2611 C CB  . PHE B 83  ? 1.8331 1.7221 2.1892 -0.9684 -0.2536 0.6781  83  PHE B CB  
2612 C CG  . PHE B 83  ? 1.8379 1.6925 2.1448 -0.9696 -0.2433 0.6530  83  PHE B CG  
2613 C CD1 . PHE B 83  ? 1.7874 1.6172 2.0749 -0.9466 -0.2157 0.6309  83  PHE B CD1 
2614 C CD2 . PHE B 83  ? 1.8577 1.7044 2.1378 -0.9936 -0.2614 0.6515  83  PHE B CD2 
2615 C CE1 . PHE B 83  ? 1.7694 1.5678 2.0143 -0.9493 -0.2072 0.6075  83  PHE B CE1 
2616 C CE2 . PHE B 83  ? 1.8553 1.6707 2.0933 -0.9955 -0.2512 0.6294  83  PHE B CE2 
2617 C CZ  . PHE B 83  ? 1.8023 1.5937 2.0239 -0.9741 -0.2245 0.6071  83  PHE B CZ  
2618 N N   . THR B 84  ? 2.4654 2.3707 2.7637 -1.0350 -0.3033 0.6380  84  THR B N   
2619 C CA  . THR B 84  ? 2.4686 2.3649 2.7179 -1.0644 -0.3214 0.6134  84  THR B CA  
2620 C C   . THR B 84  ? 2.4347 2.3251 2.6539 -1.0664 -0.3116 0.5775  84  THR B C   
2621 O O   . THR B 84  ? 2.3911 2.2600 2.5650 -1.0691 -0.3013 0.5467  84  THR B O   
2622 C CB  . THR B 84  ? 2.4844 2.4025 2.7477 -1.0898 -0.3549 0.6330  84  THR B CB  
2623 O OG1 . THR B 84  ? 2.5078 2.4389 2.8112 -1.0841 -0.3639 0.6716  84  THR B OG1 
2624 C CG2 . THR B 84  ? 2.4998 2.4038 2.7084 -1.1177 -0.3728 0.6117  84  THR B CG2 
2625 N N   . ASP B 85  ? 1.9798 1.8903 2.2263 -1.0651 -0.3148 0.5826  85  ASP B N   
2626 C CA  . ASP B 85  ? 1.9183 1.8255 2.1403 -1.0653 -0.3051 0.5516  85  ASP B CA  
2627 C C   . ASP B 85  ? 1.8514 1.7369 2.0469 -1.0435 -0.2757 0.5250  85  ASP B C   
2628 O O   . ASP B 85  ? 1.8094 1.6806 1.9585 -1.0521 -0.2717 0.4918  85  ASP B O   
2629 C CB  . ASP B 85  ? 1.9171 1.8478 2.1836 -1.0576 -0.3047 0.5666  85  ASP B CB  
2630 C CG  . ASP B 85  ? 1.9581 1.9094 2.2457 -1.0833 -0.3364 0.5867  85  ASP B CG  
2631 O OD1 . ASP B 85  ? 1.9800 1.9325 2.2661 -1.0987 -0.3571 0.6024  85  ASP B OD1 
2632 O OD2 . ASP B 85  ? 1.9480 1.9135 2.2531 -1.0879 -0.3410 0.5866  85  ASP B OD2 
2633 N N   . ALA B 86  ? 1.7595 1.6422 1.9842 -1.0149 -0.2554 0.5400  86  ALA B N   
2634 C CA  . ALA B 86  ? 1.7057 1.5662 1.9069 -0.9923 -0.2284 0.5163  86  ALA B CA  
2635 C C   . ALA B 86  ? 1.6977 1.5339 1.8527 -1.0050 -0.2298 0.4947  86  ALA B C   
2636 O O   . ALA B 86  ? 1.6457 1.4671 1.7622 -1.0045 -0.2190 0.4610  86  ALA B O   
2637 C CB  . ALA B 86  ? 1.7192 1.5782 1.9587 -0.9598 -0.2087 0.5402  86  ALA B CB  
2638 N N   . PHE B 87  ? 1.6307 1.4638 1.7911 -1.0161 -0.2429 0.5150  87  PHE B N   
2639 C CA  . PHE B 87  ? 1.6327 1.4432 1.7534 -1.0294 -0.2448 0.4991  87  PHE B CA  
2640 C C   . PHE B 87  ? 1.6057 1.4134 1.6812 -1.0543 -0.2554 0.4684  87  PHE B C   
2641 O O   . PHE B 87  ? 1.5693 1.3595 1.6093 -1.0539 -0.2432 0.4381  87  PHE B O   
2642 C CB  . PHE B 87  ? 1.6096 1.4216 1.7450 -1.0400 -0.2608 0.5294  87  PHE B CB  
2643 C CG  . PHE B 87  ? 1.6201 1.4097 1.7156 -1.0557 -0.2640 0.5156  87  PHE B CG  
2644 C CD1 . PHE B 87  ? 1.7051 1.4693 1.7915 -1.0414 -0.2452 0.5102  87  PHE B CD1 
2645 C CD2 . PHE B 87  ? 1.6353 1.4273 1.7015 -1.0845 -0.2849 0.5081  87  PHE B CD2 
2646 C CE1 . PHE B 87  ? 1.6748 1.4181 1.7271 -1.0563 -0.2471 0.4982  87  PHE B CE1 
2647 C CE2 . PHE B 87  ? 1.6909 1.4623 1.7214 -1.0980 -0.2860 0.4968  87  PHE B CE2 
2648 C CZ  . PHE B 87  ? 1.6617 1.4094 1.6869 -1.0844 -0.2669 0.4922  87  PHE B CZ  
2649 N N   . PHE B 88  ? 1.8450 1.6697 1.9219 -1.0758 -0.2782 0.4767  88  PHE B N   
2650 C CA  . PHE B 88  ? 1.8277 1.6493 1.8609 -1.0990 -0.2887 0.4501  88  PHE B CA  
2651 C C   . PHE B 88  ? 1.7533 1.5729 1.7676 -1.0893 -0.2717 0.4186  88  PHE B C   
2652 O O   . PHE B 88  ? 1.7205 1.5283 1.6928 -1.0993 -0.2683 0.3899  88  PHE B O   
2653 C CB  . PHE B 88  ? 1.8815 1.7205 1.9208 -1.1213 -0.3162 0.4652  88  PHE B CB  
2654 C CG  . PHE B 88  ? 1.9574 1.7943 1.9940 -1.1380 -0.3366 0.4862  88  PHE B CG  
2655 C CD1 . PHE B 88  ? 2.0205 1.8747 2.0994 -1.1376 -0.3520 0.5219  88  PHE B CD1 
2656 C CD2 . PHE B 88  ? 1.9374 1.7557 1.9301 -1.1530 -0.3397 0.4714  88  PHE B CD2 
2657 C CE1 . PHE B 88  ? 2.0637 1.9164 2.1389 -1.1515 -0.3711 0.5417  88  PHE B CE1 
2658 C CE2 . PHE B 88  ? 1.9686 1.7839 1.9569 -1.1666 -0.3574 0.4914  88  PHE B CE2 
2659 C CZ  . PHE B 88  ? 2.0432 1.8756 2.0717 -1.1656 -0.3735 0.5263  88  PHE B CZ  
2660 N N   . PHE B 89  ? 1.6222 1.4538 1.6677 -1.0691 -0.2603 0.4249  89  PHE B N   
2661 C CA  . PHE B 89  ? 1.5537 1.3826 1.5823 -1.0553 -0.2415 0.3962  89  PHE B CA  
2662 C C   . PHE B 89  ? 1.5137 1.3209 1.5156 -1.0436 -0.2230 0.3730  89  PHE B C   
2663 O O   . PHE B 89  ? 1.5634 1.3632 1.5285 -1.0479 -0.2165 0.3415  89  PHE B O   
2664 C CB  . PHE B 89  ? 1.5414 1.3838 1.6107 -1.0302 -0.2284 0.4102  89  PHE B CB  
2665 C CG  . PHE B 89  ? 1.4776 1.3148 1.5295 -1.0106 -0.2062 0.3822  89  PHE B CG  
2666 C CD1 . PHE B 89  ? 1.5365 1.3772 1.5581 -1.0218 -0.2082 0.3569  89  PHE B CD1 
2667 C CD2 . PHE B 89  ? 1.5516 1.3789 1.6141 -0.9803 -0.1832 0.3806  89  PHE B CD2 
2668 C CE1 . PHE B 89  ? 1.4788 1.3159 1.4835 -1.0030 -0.1879 0.3314  89  PHE B CE1 
2669 C CE2 . PHE B 89  ? 1.4976 1.3199 1.5417 -0.9612 -0.1637 0.3543  89  PHE B CE2 
2670 C CZ  . PHE B 89  ? 1.4604 1.2888 1.4763 -0.9726 -0.1662 0.3299  89  PHE B CZ  
2671 N N   . SER B 90  ? 1.9222 1.7191 1.9440 -1.0286 -0.2147 0.3893  90  SER B N   
2672 C CA  . SER B 90  ? 1.8930 1.6667 1.8934 -1.0171 -0.1979 0.3698  90  SER B CA  
2673 C C   . SER B 90  ? 1.8860 1.6472 1.8442 -1.0413 -0.2055 0.3475  90  SER B C   
2674 O O   . SER B 90  ? 1.8402 1.5887 1.7707 -1.0376 -0.1934 0.3182  90  SER B O   
2675 C CB  . SER B 90  ? 1.9304 1.6930 1.9581 -1.0007 -0.1908 0.3951  90  SER B CB  
2676 O OG  . SER B 90  ? 1.9214 1.6584 1.9237 -1.0005 -0.1821 0.3786  90  SER B OG  
2677 N N   . VAL B 91  ? 1.7299 1.4949 1.6830 -1.0657 -0.2256 0.3615  91  VAL B N   
2678 C CA  . VAL B 91  ? 1.7254 1.4786 1.6379 -1.0879 -0.2315 0.3416  91  VAL B CA  
2679 C C   . VAL B 91  ? 1.6769 1.4374 1.5588 -1.0971 -0.2315 0.3126  91  VAL B C   
2680 O O   . VAL B 91  ? 1.6325 1.3827 1.4852 -1.0989 -0.2217 0.2847  91  VAL B O   
2681 C CB  . VAL B 91  ? 1.7538 1.5067 1.6631 -1.1107 -0.2523 0.3634  91  VAL B CB  
2682 C CG1 . VAL B 91  ? 1.8094 1.5629 1.7570 -1.0998 -0.2547 0.3983  91  VAL B CG1 
2683 C CG2 . VAL B 91  ? 1.7759 1.5452 1.6755 -1.1301 -0.2723 0.3661  91  VAL B CG2 
2684 N N   . GLN B 92  ? 1.9084 1.6868 1.7985 -1.1022 -0.2422 0.3195  92  GLN B N   
2685 C CA  . GLN B 92  ? 1.8682 1.6530 1.7293 -1.1099 -0.2419 0.2941  92  GLN B CA  
2686 C C   . GLN B 92  ? 1.7905 1.5713 1.6428 -1.0895 -0.2196 0.2674  92  GLN B C   
2687 O O   . GLN B 92  ? 1.7215 1.5012 1.5409 -1.0955 -0.2150 0.2399  92  GLN B O   
2688 C CB  . GLN B 92  ? 1.8840 1.6869 1.7632 -1.1123 -0.2526 0.3071  92  GLN B CB  
2689 C CG  . GLN B 92  ? 1.9551 1.7659 1.8633 -1.1220 -0.2723 0.3412  92  GLN B CG  
2690 C CD  . GLN B 92  ? 1.9847 1.8081 1.8903 -1.1392 -0.2913 0.3468  92  GLN B CD  
2691 O OE1 . GLN B 92  ? 1.9479 1.7784 1.8491 -1.1350 -0.2856 0.3332  92  GLN B OE1 
2692 N NE2 . GLN B 92  ? 2.0551 1.8801 1.9620 -1.1586 -0.3144 0.3668  92  GLN B NE2 
2693 N N   . THR B 93  ? 2.1629 1.9416 2.0441 -1.0643 -0.2057 0.2762  93  THR B N   
2694 C CA  . THR B 93  ? 2.0835 1.8570 1.9568 -1.0418 -0.1850 0.2522  93  THR B CA  
2695 C C   . THR B 93  ? 2.0453 1.7993 1.8949 -1.0435 -0.1772 0.2321  93  THR B C   
2696 O O   . THR B 93  ? 1.9685 1.7204 1.7905 -1.0432 -0.1692 0.2022  93  THR B O   
2697 C CB  . THR B 93  ? 2.1026 1.8788 2.0130 -1.0120 -0.1720 0.2692  93  THR B CB  
2698 O OG1 . THR B 93  ? 2.0292 1.8091 1.9310 -0.9918 -0.1557 0.2476  93  THR B OG1 
2699 C CG2 . THR B 93  ? 2.1244 1.8821 2.0464 -0.9988 -0.1634 0.2782  93  THR B CG2 
2700 N N   . MET B 94  ? 1.9206 1.6609 1.7816 -1.0462 -0.1798 0.2487  94  MET B N   
2701 C CA  . MET B 94  ? 1.8938 1.6132 1.7370 -1.0468 -0.1715 0.2315  94  MET B CA  
2702 C C   . MET B 94  ? 1.8635 1.5802 1.6730 -1.0737 -0.1796 0.2139  94  MET B C   
2703 O O   . MET B 94  ? 1.7959 1.5013 1.5856 -1.0748 -0.1711 0.1895  94  MET B O   
2704 C CB  . MET B 94  ? 1.9663 1.6692 1.8312 -1.0404 -0.1700 0.2552  94  MET B CB  
2705 C CG  . MET B 94  ? 1.9468 1.6254 1.7938 -1.0429 -0.1618 0.2379  94  MET B CG  
2706 S SD  . MET B 94  ? 1.9987 1.6563 1.8662 -1.0413 -0.1623 0.2678  94  MET B SD  
2707 C CE  . MET B 94  ? 2.0368 1.7135 1.9134 -1.0645 -0.1849 0.2978  94  MET B CE  
2708 N N   . ALA B 95  ? 1.6104 1.3370 1.4137 -1.0951 -0.1962 0.2267  95  ALA B N   
2709 C CA  . ALA B 95  ? 1.6079 1.3326 1.3776 -1.1196 -0.2034 0.2120  95  ALA B CA  
2710 C C   . ALA B 95  ? 1.5489 1.2874 1.2968 -1.1204 -0.2006 0.1880  95  ALA B C   
2711 O O   . ALA B 95  ? 1.5485 1.2881 1.2661 -1.1373 -0.2036 0.1718  95  ALA B O   
2712 C CB  . ALA B 95  ? 1.5933 1.3202 1.3619 -1.1401 -0.2223 0.2363  95  ALA B CB  
2713 N N   . THR B 96  ? 1.7092 1.4582 1.4738 -1.1006 -0.1937 0.1876  96  THR B N   
2714 C CA  . THR B 96  ? 1.6426 1.4049 1.3904 -1.0966 -0.1889 0.1670  96  THR B CA  
2715 C C   . THR B 96  ? 1.6627 1.4341 1.3902 -1.1185 -0.2037 0.1696  96  THR B C   
2716 O O   . THR B 96  ? 1.6021 1.3794 1.3025 -1.1229 -0.2001 0.1477  96  THR B O   
2717 C CB  . THR B 96  ? 1.5494 1.3075 1.2728 -1.0917 -0.1754 0.1337  96  THR B CB  
2718 O OG1 . THR B 96  ? 1.5354 1.2889 1.2317 -1.1154 -0.1818 0.1243  96  THR B OG1 
2719 C CG2 . THR B 96  ? 1.5440 1.2879 1.2823 -1.0730 -0.1632 0.1299  96  THR B CG2 
2720 N N   . ILE B 97  ? 1.8621 1.6344 1.6014 -1.1317 -0.2204 0.1959  97  ILE B N   
2721 C CA  . ILE B 97  ? 1.8813 1.6607 1.6013 -1.1504 -0.2353 0.1987  97  ILE B CA  
2722 C C   . ILE B 97  ? 1.8761 1.6690 1.6078 -1.1378 -0.2315 0.1966  97  ILE B C   
2723 O O   . ILE B 97  ? 1.8402 1.6381 1.5470 -1.1451 -0.2331 0.1828  97  ILE B O   
2724 C CB  . ILE B 97  ? 1.9626 1.7401 1.6936 -1.1665 -0.2561 0.2280  97  ILE B CB  
2725 C CG1 . ILE B 97  ? 1.9442 1.7075 1.6730 -1.1734 -0.2571 0.2354  97  ILE B CG1 
2726 C CG2 . ILE B 97  ? 1.9728 1.7526 1.6740 -1.1877 -0.2723 0.2265  97  ILE B CG2 
2727 C CD1 . ILE B 97  ? 2.0322 1.7945 1.7805 -1.1821 -0.2747 0.2675  97  ILE B CD1 
2728 N N   . GLY B 98  ? 1.8093 1.6071 1.5792 -1.1178 -0.2251 0.2114  98  GLY B N   
2729 C CA  . GLY B 98  ? 1.7955 1.6056 1.5826 -1.1026 -0.2186 0.2123  98  GLY B CA  
2730 C C   . GLY B 98  ? 1.8386 1.6563 1.6158 -1.1197 -0.2337 0.2171  98  GLY B C   
2731 O O   . GLY B 98  ? 1.7914 1.6133 1.5486 -1.1174 -0.2270 0.1987  98  GLY B O   
2732 N N   . TYR B 99  ? 2.1632 1.9819 1.9538 -1.1363 -0.2543 0.2417  99  TYR B N   
2733 C CA  . TYR B 99  ? 2.2102 2.0334 1.9910 -1.1546 -0.2720 0.2476  99  TYR B CA  
2734 C C   . TYR B 99  ? 2.1794 2.0133 1.9745 -1.1425 -0.2640 0.2443  99  TYR B C   
2735 O O   . TYR B 99  ? 2.1601 1.9927 1.9252 -1.1502 -0.2643 0.2275  99  TYR B O   
2736 C CB  . TYR B 99  ? 2.2878 2.1137 2.0935 -1.1686 -0.2950 0.2788  99  TYR B CB  
2737 C CG  . TYR B 99  ? 2.3376 2.1517 2.1157 -1.1890 -0.3097 0.2817  99  TYR B CG  
2738 C CD1 . TYR B 99  ? 2.3868 2.1996 2.1886 -1.1906 -0.3187 0.3058  99  TYR B CD1 
2739 C CD2 . TYR B 99  ? 2.3358 2.1397 2.0638 -1.2054 -0.3135 0.2615  99  TYR B