data_2WLS
# 
_entry.id   2WLS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WLS         
PDBE  EBI-40229    
WWPDB D_1290040229 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WLS 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-25 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pang, Y.P.'       1  
'Ekstrom, F.'      2  
'Polsinelli, G.A.' 3  
'Gao, Y.'          4  
'Rana, S.'         5  
'Hua, D.H.'        6  
'Andersson, B.'    7  
'Andersson, P.O.'  8  
'Peng, L.'         9  
'Singh, S.K.'      10 
'Mishra, R.K.'     11 
'Zhu, K.Y.'        12 
'Fallon, A.M.'     13 
'Ragsdale, D.W.'   14 
'Brimijoin, S.'    15 
# 
_citation.id                        primary 
_citation.title                     
'Selective and Irreversible Inhibitors of Mosquito Acetylcholinesterases for Controlling Malaria and Other Mosquito-Borne Diseases.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            4 
_citation.page_first                E6851 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19714254 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PONE.0006851 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pang, Y.P.'       1  ? 
primary 'Ekstrom, F.'      2  ? 
primary 'Polsinelli, G.A.' 3  ? 
primary 'Gao, Y.'          4  ? 
primary 'Rana, S.'         5  ? 
primary 'Hua, D.H.'        6  ? 
primary 'Andersson, B.'    7  ? 
primary 'Andersson, P.O.'  8  ? 
primary 'Peng, L.'         9  ? 
primary 'Singh, S.K.'      10 ? 
primary 'Mishra, R.K.'     11 ? 
primary 'Zhu, K.Y.'        12 ? 
primary 'Fallon, A.M.'     13 ? 
primary 'Ragsdale, D.W.'   14 ? 
primary 'Brimijoin, S.'    15 ? 
# 
_cell.entry_id           2WLS 
_cell.length_a           78.480 
_cell.length_b           110.305 
_cell.length_c           227.604 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WLS 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                              59764.488 2   3.1.1.7 ? 
'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                          221.208   2   ?       ? ? ? 
3 non-polymer syn 'N,N,N-trimethyl-13-[(methylsulfonyl)sulfanyl]tridecan-1-aminium' 352.619   2   ?       ? ? ? 
4 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                           106.120   1   ?       ? ? ? 
5 non-polymer syn 'HEXAETHYLENE GLYCOL'                                             282.331   1   ?       ? ? ? 
6 water       nat water                                                             18.015    349 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               MOUSE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCDNA3.1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2WLS A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2WLS B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking'          y ARGININE                                                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'            y GLYCINE                                                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer                  . WATER                                                             ? 'H2 O'              18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'          y LEUCINE                                                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'          y LYSINE                                                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking'          y METHIONINE                                                        ? 'C5 H11 N O2 S'     149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                          
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'       221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                                             'POLYETHYLENE GLYCOL PEG400' 
'C12 H26 O7'        282.331 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                                           ? 'C4 H10 O3'         106.120 
PHE 'L-peptide linking'          y PHENYLALANINE                                                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'          y PROLINE                                                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'          y SERINE                                                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking'          y THREONINE                                                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'          y TYROSINE                                                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'          y VALINE                                                            ? 'C5 H11 N O2'       117.146 
X13 non-polymer                  . 'N,N,N-trimethyl-13-[(methylsulfonyl)sulfanyl]tridecan-1-aminium' ? 'C17 H38 N O2 S2 1' 352.619 
# 
_exptl.entry_id          2WLS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.1 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-01-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.948 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             0.948 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WLS 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.00 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   61580 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.20 
_reflns.B_iso_Wilson_estimate        60.66 
_reflns.pdbx_redundancy              7.3 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.52 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.40 
_reflns_shell.pdbx_redundancy        7.3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WLS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     61249 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.037 
_refine.ls_d_res_high                            2.600 
_refine.ls_percent_reflns_obs                    99.45 
_refine.ls_R_factor_obs                          0.1859 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1851 
_refine.ls_R_factor_R_free                       0.2261 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1220 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.8455 
_refine.aniso_B[2][2]                            2.0636 
_refine.aniso_B[3][3]                            -2.9091 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.332 
_refine.solvent_model_param_bsol                 69.005 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'THE SO2CH3 GROUP OF AMTS13 IS UNDEFINED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.35 
_refine.pdbx_overall_phase_error                 22.53 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8321 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         90 
_refine_hist.number_atoms_solvent             349 
_refine_hist.number_atoms_total               8760 
_refine_hist.d_res_high                       2.600 
_refine_hist.d_res_low                        29.037 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 8703  'X-RAY DIFFRACTION' ? 
f_angle_d          1.133  ? ? 11873 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.461 ? ? 3116  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.075  ? ? 1281  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1557  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.6000 2.7041  6617 0.2509 100.00 0.3073 . . 146 . . 
'X-RAY DIFFRACTION' . 2.7041 2.8270  6573 0.2408 100.00 0.3194 . . 135 . . 
'X-RAY DIFFRACTION' . 2.8270 2.9759  6615 0.2297 100.00 0.3095 . . 130 . . 
'X-RAY DIFFRACTION' . 2.9759 3.1622  6608 0.2256 100.00 0.2956 . . 155 . . 
'X-RAY DIFFRACTION' . 3.1622 3.4060  6671 0.1955 100.00 0.2075 . . 116 . . 
'X-RAY DIFFRACTION' . 3.4060 3.7481  6641 0.1789 100.00 0.2185 . . 143 . . 
'X-RAY DIFFRACTION' . 3.7481 4.2890  6616 0.1591 99.00  0.2035 . . 125 . . 
'X-RAY DIFFRACTION' . 4.2890 5.3980  6736 0.1454 99.00  0.1799 . . 133 . . 
'X-RAY DIFFRACTION' . 5.3980 29.0386 6952 0.1723 99.00  0.1876 . . 137 . . 
# 
_struct.entry_id                  2WLS 
_struct.title                     'Crystal structure of Mus musculus Acetylcholinesterase in complex with AMTS13' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WLS 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE ESTERASE, ALTERNATIVE SPLICING, AMTS13, SYNAPSE, MEMBRANE, HYDROLASE, CELL MEMBRANE, CHOLINESTERASE, ACETYLCHOLINESTERASE, NEUROTRANSMITTER DEGRADATION, GPI-ANCHOR, LIPOPROTEIN, GLYCOPROTEIN, CELL JUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? LEU A 214 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 ALA A 241 ? GLY A 256 ? ALA A 241 GLY A 256 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 274 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? ALA A 420 ? VAL A 407 ALA A 420 1 ? 14 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? LEU A 540 ? ARG A 534 LEU A 540 1 ? 7  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P39 39 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P40 40 PRO B 277 ? GLU B 285 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P41 41 TRP B 286 ? VAL B 288 ? TRP B 286 VAL B 288 5 ? 3  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 GLY B 335 ? LEU B 339 ? GLY B 335 LEU B 339 5 ? 5  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? GLY B 456 ? GLU B 450 GLY B 456 1 ? 7  
HELX_P HELX_P50 50 LEU B 457 ? ASN B 464 ? LEU B 457 ASN B 464 5 ? 8  
HELX_P HELX_P51 51 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 52 ARG B 525 ? SER B 541 ? ARG B 525 SER B 541 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.062 ? ?               
disulf2 disulf ?   ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.064 ? ?               
disulf3 disulf ?   ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf4 disulf ?   ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf5 disulf ?   ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.064 ? ?               
disulf6 disulf ?   ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.062 ? ?               
covale1 covale one ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 601 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale2 covale one ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -0.49 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 9.64  
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -9.54 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
AD ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
BD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
AD 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
BD 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
AD 1  VAL A 239 ? SER A 240 ? VAL A 239 SER A 240 
AD 2  VAL A 302 ? VAL A 303 ? VAL A 302 VAL A 303 
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
BD 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
BD 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
AD 1  2  O VAL A 239 ? O VAL A 239 N VAL A 303 ? N VAL A 303 
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
BD 1  2  O VAL B 239 ? O VAL B 239 N VAL B 303 ? N VAL B 303 
# 
_database_PDB_matrix.entry_id          2WLS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WLS 
_atom_sites.fract_transf_matrix[1][1]   0.012742 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009066 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004394 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.041  14.749  55.280  1.00 93.93  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 29.589  14.876  55.205  1.00 87.30  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.015  15.362  56.529  1.00 82.69  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 29.735  15.911  57.367  1.00 84.41  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 28.940  13.548  54.776  1.00 81.94  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 29.801  12.298  55.029  1.00 70.77  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.158  10.995  54.529  1.00 80.23  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 27.976  10.733  54.876  1.00 70.64  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 29.843  10.231  53.799  1.00 67.35  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 27.717  15.162  56.713  1.00 73.49  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.066  15.576  57.936  1.00 59.09  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 25.840  16.380  57.613  1.00 64.61  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 24.717  15.911  57.819  1.00 67.99  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.062  17.582  57.081  1.00 78.47  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 24.979  18.514  56.757  1.00 73.77  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 24.646  18.556  55.263  1.00 71.60  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 23.845  19.379  54.829  1.00 75.18  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 25.313  19.918  57.269  1.00 60.42  ? 3    ARG A CB  1 
ATOM   19   N N   . GLU A 1 4   ? 25.255  17.660  54.489  1.00 73.70  ? 4    GLU A N   1 
ATOM   20   C CA  . GLU A 1 4   ? 25.003  17.559  53.052  1.00 66.61  ? 4    GLU A CA  1 
ATOM   21   C C   . GLU A 1 4   ? 23.758  16.753  52.744  1.00 69.49  ? 4    GLU A C   1 
ATOM   22   O O   . GLU A 1 4   ? 23.293  15.976  53.572  1.00 68.09  ? 4    GLU A O   1 
ATOM   23   C CB  . GLU A 1 4   ? 26.169  16.867  52.366  1.00 73.39  ? 4    GLU A CB  1 
ATOM   24   C CG  . GLU A 1 4   ? 27.345  17.759  52.090  1.00 81.42  ? 4    GLU A CG  1 
ATOM   25   C CD  . GLU A 1 4   ? 28.568  16.955  51.731  1.00 90.07  ? 4    GLU A CD  1 
ATOM   26   O OE1 . GLU A 1 4   ? 29.126  16.300  52.637  1.00 92.42  ? 4    GLU A OE1 1 
ATOM   27   O OE2 . GLU A 1 4   ? 28.963  16.968  50.546  1.00 87.02  ? 4    GLU A OE2 1 
ATOM   28   N N   . ASP A 1 5   ? 23.232  16.927  51.538  1.00 61.41  ? 5    ASP A N   1 
ATOM   29   C CA  . ASP A 1 5   ? 22.117  16.123  51.081  1.00 58.41  ? 5    ASP A CA  1 
ATOM   30   C C   . ASP A 1 5   ? 22.583  14.677  50.941  1.00 65.90  ? 5    ASP A C   1 
ATOM   31   O O   . ASP A 1 5   ? 23.464  14.386  50.137  1.00 68.64  ? 5    ASP A O   1 
ATOM   32   C CB  . ASP A 1 5   ? 21.599  16.659  49.752  1.00 52.49  ? 5    ASP A CB  1 
ATOM   33   C CG  . ASP A 1 5   ? 20.411  15.870  49.223  1.00 62.96  ? 5    ASP A CG  1 
ATOM   34   O OD1 . ASP A 1 5   ? 20.172  14.749  49.708  1.00 62.43  ? 5    ASP A OD1 1 
ATOM   35   O OD2 . ASP A 1 5   ? 19.713  16.371  48.313  1.00 61.55  ? 5    ASP A OD2 1 
ATOM   36   N N   . PRO A 1 6   ? 21.996  13.763  51.733  1.00 73.37  ? 6    PRO A N   1 
ATOM   37   C CA  . PRO A 1 6   ? 22.391  12.347  51.771  1.00 63.93  ? 6    PRO A CA  1 
ATOM   38   C C   . PRO A 1 6   ? 22.186  11.569  50.460  1.00 66.63  ? 6    PRO A C   1 
ATOM   39   O O   . PRO A 1 6   ? 22.841  10.541  50.276  1.00 66.24  ? 6    PRO A O   1 
ATOM   40   C CB  . PRO A 1 6   ? 21.489  11.770  52.876  1.00 62.57  ? 6    PRO A CB  1 
ATOM   41   C CG  . PRO A 1 6   ? 20.337  12.704  52.946  1.00 62.98  ? 6    PRO A CG  1 
ATOM   42   C CD  . PRO A 1 6   ? 20.983  14.049  52.763  1.00 68.24  ? 6    PRO A CD  1 
ATOM   43   N N   . GLN A 1 7   ? 21.308  12.031  49.571  1.00 63.19  ? 7    GLN A N   1 
ATOM   44   C CA  . GLN A 1 7   ? 21.040  11.293  48.328  1.00 60.88  ? 7    GLN A CA  1 
ATOM   45   C C   . GLN A 1 7   ? 21.907  11.744  47.151  1.00 60.68  ? 7    GLN A C   1 
ATOM   46   O O   . GLN A 1 7   ? 21.651  11.382  46.005  1.00 69.70  ? 7    GLN A O   1 
ATOM   47   C CB  . GLN A 1 7   ? 19.575  11.417  47.952  1.00 69.86  ? 7    GLN A CB  1 
ATOM   48   C CG  . GLN A 1 7   ? 18.751  12.037  49.063  1.00 75.39  ? 7    GLN A CG  1 
ATOM   49   C CD  . GLN A 1 7   ? 17.374  11.423  49.175  1.00 83.39  ? 7    GLN A CD  1 
ATOM   50   O OE1 . GLN A 1 7   ? 16.368  12.135  49.177  1.00 81.20  ? 7    GLN A OE1 1 
ATOM   51   N NE2 . GLN A 1 7   ? 17.318  10.089  49.266  1.00 81.76  ? 7    GLN A NE2 1 
ATOM   52   N N   . LEU A 1 8   ? 22.939  12.528  47.441  1.00 57.99  ? 8    LEU A N   1 
ATOM   53   C CA  . LEU A 1 8   ? 23.828  13.038  46.409  1.00 54.26  ? 8    LEU A CA  1 
ATOM   54   C C   . LEU A 1 8   ? 25.251  12.571  46.658  1.00 61.99  ? 8    LEU A C   1 
ATOM   55   O O   . LEU A 1 8   ? 26.191  13.020  46.002  1.00 58.39  ? 8    LEU A O   1 
ATOM   56   C CB  . LEU A 1 8   ? 23.769  14.557  46.373  1.00 51.70  ? 8    LEU A CB  1 
ATOM   57   C CG  . LEU A 1 8   ? 22.392  15.049  45.935  1.00 53.67  ? 8    LEU A CG  1 
ATOM   58   C CD1 . LEU A 1 8   ? 22.291  16.536  46.130  1.00 52.98  ? 8    LEU A CD1 1 
ATOM   59   C CD2 . LEU A 1 8   ? 22.122  14.658  44.481  1.00 48.16  ? 8    LEU A CD2 1 
ATOM   60   N N   . LEU A 1 9   ? 25.400  11.662  47.616  1.00 57.97  ? 9    LEU A N   1 
ATOM   61   C CA  . LEU A 1 9   ? 26.693  11.083  47.922  1.00 54.49  ? 9    LEU A CA  1 
ATOM   62   C C   . LEU A 1 9   ? 26.702  9.645   47.434  1.00 54.62  ? 9    LEU A C   1 
ATOM   63   O O   . LEU A 1 9   ? 25.855  8.847   47.832  1.00 56.60  ? 9    LEU A O   1 
ATOM   64   C CB  . LEU A 1 9   ? 26.966  11.157  49.422  1.00 50.45  ? 9    LEU A CB  1 
ATOM   65   C CG  . LEU A 1 9   ? 26.648  12.515  50.066  1.00 67.41  ? 9    LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 9   ? 26.933  12.528  51.587  1.00 60.00  ? 9    LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 9   ? 27.384  13.660  49.354  1.00 62.62  ? 9    LEU A CD2 1 
ATOM   68   N N   . VAL A 1 10  ? 27.645  9.335   46.547  1.00 50.13  ? 10   VAL A N   1 
ATOM   69   C CA  . VAL A 1 10  ? 27.736  8.020   45.922  1.00 42.70  ? 10   VAL A CA  1 
ATOM   70   C C   . VAL A 1 10  ? 29.209  7.618   45.772  1.00 58.63  ? 10   VAL A C   1 
ATOM   71   O O   . VAL A 1 10  ? 30.083  8.478   45.544  1.00 51.18  ? 10   VAL A O   1 
ATOM   72   C CB  . VAL A 1 10  ? 27.037  8.023   44.540  1.00 53.48  ? 10   VAL A CB  1 
ATOM   73   C CG1 . VAL A 1 10  ? 27.486  6.836   43.672  1.00 49.35  ? 10   VAL A CG1 1 
ATOM   74   C CG2 . VAL A 1 10  ? 25.525  8.019   44.717  1.00 51.44  ? 10   VAL A CG2 1 
ATOM   75   N N   . ARG A 1 11  ? 29.491  6.320   45.913  1.00 47.43  ? 11   ARG A N   1 
ATOM   76   C CA  . ARG A 1 11  ? 30.857  5.829   45.752  1.00 45.58  ? 11   ARG A CA  1 
ATOM   77   C C   . ARG A 1 11  ? 30.985  5.057   44.459  1.00 46.38  ? 11   ARG A C   1 
ATOM   78   O O   . ARG A 1 11  ? 30.101  4.278   44.120  1.00 49.63  ? 11   ARG A O   1 
ATOM   79   C CB  . ARG A 1 11  ? 31.272  4.924   46.908  1.00 43.01  ? 11   ARG A CB  1 
ATOM   80   C CG  . ARG A 1 11  ? 32.634  4.322   46.689  1.00 41.26  ? 11   ARG A CG  1 
ATOM   81   C CD  . ARG A 1 11  ? 33.112  3.538   47.889  1.00 47.88  ? 11   ARG A CD  1 
ATOM   82   N NE  . ARG A 1 11  ? 33.493  4.402   49.005  1.00 48.86  ? 11   ARG A NE  1 
ATOM   83   C CZ  . ARG A 1 11  ? 34.726  4.853   49.209  1.00 53.47  ? 11   ARG A CZ  1 
ATOM   84   N NH1 . ARG A 1 11  ? 34.993  5.640   50.253  1.00 48.15  ? 11   ARG A NH1 1 
ATOM   85   N NH2 . ARG A 1 11  ? 35.690  4.522   48.355  1.00 45.37  ? 11   ARG A NH2 1 
ATOM   86   N N   . VAL A 1 12  ? 32.082  5.287   43.743  1.00 46.02  ? 12   VAL A N   1 
ATOM   87   C CA  . VAL A 1 12  ? 32.419  4.532   42.538  1.00 47.67  ? 12   VAL A CA  1 
ATOM   88   C C   . VAL A 1 12  ? 33.852  4.003   42.653  1.00 48.66  ? 12   VAL A C   1 
ATOM   89   O O   . VAL A 1 12  ? 34.594  4.424   43.538  1.00 51.08  ? 12   VAL A O   1 
ATOM   90   C CB  . VAL A 1 12  ? 32.294  5.387   41.264  1.00 46.35  ? 12   VAL A CB  1 
ATOM   91   C CG1 . VAL A 1 12  ? 30.843  5.792   41.023  1.00 40.17  ? 12   VAL A CG1 1 
ATOM   92   C CG2 . VAL A 1 12  ? 33.189  6.607   41.365  1.00 43.17  ? 12   VAL A CG2 1 
ATOM   93   N N   . ARG A 1 13  ? 34.237  3.104   41.748  1.00 38.58  ? 13   ARG A N   1 
ATOM   94   C CA  . ARG A 1 13  ? 35.487  2.353   41.865  1.00 47.09  ? 13   ARG A CA  1 
ATOM   95   C C   . ARG A 1 13  ? 36.716  3.216   42.172  1.00 51.72  ? 13   ARG A C   1 
ATOM   96   O O   . ARG A 1 13  ? 37.679  2.750   42.776  1.00 56.74  ? 13   ARG A O   1 
ATOM   97   C CB  . ARG A 1 13  ? 35.712  1.514   40.608  1.00 48.93  ? 13   ARG A CB  1 
ATOM   98   C CG  . ARG A 1 13  ? 37.113  0.938   40.455  1.00 55.27  ? 13   ARG A CG  1 
ATOM   99   C CD  . ARG A 1 13  ? 37.381  -0.266  41.356  1.00 46.19  ? 13   ARG A CD  1 
ATOM   100  N NE  . ARG A 1 13  ? 38.379  0.103   42.346  1.00 63.78  ? 13   ARG A NE  1 
ATOM   101  C CZ  . ARG A 1 13  ? 39.602  -0.409  42.420  1.00 60.91  ? 13   ARG A CZ  1 
ATOM   102  N NH1 . ARG A 1 13  ? 39.992  -1.357  41.582  1.00 55.70  ? 13   ARG A NH1 1 
ATOM   103  N NH2 . ARG A 1 13  ? 40.430  0.018   43.357  1.00 62.59  ? 13   ARG A NH2 1 
ATOM   104  N N   . GLY A 1 14  ? 36.668  4.479   41.778  1.00 51.53  ? 14   GLY A N   1 
ATOM   105  C CA  . GLY A 1 14  ? 37.784  5.372   41.996  1.00 52.13  ? 14   GLY A CA  1 
ATOM   106  C C   . GLY A 1 14  ? 37.667  6.263   43.215  1.00 57.09  ? 14   GLY A C   1 
ATOM   107  O O   . GLY A 1 14  ? 38.634  6.936   43.580  1.00 60.92  ? 14   GLY A O   1 
ATOM   108  N N   . GLY A 1 15  ? 36.496  6.299   43.844  1.00 49.27  ? 15   GLY A N   1 
ATOM   109  C CA  . GLY A 1 15  ? 36.354  7.071   45.069  1.00 48.83  ? 15   GLY A CA  1 
ATOM   110  C C   . GLY A 1 15  ? 34.980  7.647   45.336  1.00 49.52  ? 15   GLY A C   1 
ATOM   111  O O   . GLY A 1 15  ? 34.021  7.329   44.641  1.00 53.58  ? 15   GLY A O   1 
ATOM   112  N N   . GLN A 1 16  ? 34.882  8.503   46.346  1.00 53.17  ? 16   GLN A N   1 
ATOM   113  C CA  . GLN A 1 16  ? 33.615  9.156   46.661  1.00 53.99  ? 16   GLN A CA  1 
ATOM   114  C C   . GLN A 1 16  ? 33.307  10.388  45.792  1.00 54.04  ? 16   GLN A C   1 
ATOM   115  O O   . GLN A 1 16  ? 34.213  11.151  45.424  1.00 51.69  ? 16   GLN A O   1 
ATOM   116  C CB  . GLN A 1 16  ? 33.546  9.491   48.149  1.00 48.40  ? 16   GLN A CB  1 
ATOM   117  C CG  . GLN A 1 16  ? 33.459  8.248   49.018  1.00 49.60  ? 16   GLN A CG  1 
ATOM   118  C CD  . GLN A 1 16  ? 33.045  8.560   50.444  1.00 64.92  ? 16   GLN A CD  1 
ATOM   119  O OE1 . GLN A 1 16  ? 33.668  9.378   51.123  1.00 56.94  ? 16   GLN A OE1 1 
ATOM   120  N NE2 . GLN A 1 16  ? 31.985  7.906   50.907  1.00 65.72  ? 16   GLN A NE2 1 
ATOM   121  N N   . LEU A 1 17  ? 32.022  10.555  45.462  1.00 44.44  ? 17   LEU A N   1 
ATOM   122  C CA  . LEU A 1 17  ? 31.545  11.677  44.649  1.00 45.75  ? 17   LEU A CA  1 
ATOM   123  C C   . LEU A 1 17  ? 30.396  12.378  45.331  1.00 47.39  ? 17   LEU A C   1 
ATOM   124  O O   . LEU A 1 17  ? 29.568  11.743  45.979  1.00 47.63  ? 17   LEU A O   1 
ATOM   125  C CB  . LEU A 1 17  ? 31.008  11.201  43.296  1.00 49.24  ? 17   LEU A CB  1 
ATOM   126  C CG  . LEU A 1 17  ? 31.861  10.315  42.397  1.00 50.07  ? 17   LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 17  ? 30.964  9.573   41.421  1.00 47.95  ? 17   LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 17  ? 32.899  11.144  41.682  1.00 51.55  ? 17   LEU A CD2 1 
ATOM   129  N N   . ARG A 1 18  ? 30.323  13.688  45.144  1.00 49.84  ? 18   ARG A N   1 
ATOM   130  C CA  . ARG A 1 18  ? 29.169  14.448  45.582  1.00 53.13  ? 18   ARG A CA  1 
ATOM   131  C C   . ARG A 1 18  ? 28.483  15.053  44.363  1.00 54.24  ? 18   ARG A C   1 
ATOM   132  O O   . ARG A 1 18  ? 29.072  15.869  43.651  1.00 54.32  ? 18   ARG A O   1 
ATOM   133  C CB  . ARG A 1 18  ? 29.581  15.538  46.574  1.00 54.00  ? 18   ARG A CB  1 
ATOM   134  C CG  . ARG A 1 18  ? 28.431  16.444  46.997  1.00 57.20  ? 18   ARG A CG  1 
ATOM   135  C CD  . ARG A 1 18  ? 28.901  17.571  47.913  1.00 66.23  ? 18   ARG A CD  1 
ATOM   136  N NE  . ARG A 1 18  ? 30.166  18.150  47.470  1.00 70.66  ? 18   ARG A NE  1 
ATOM   137  C CZ  . ARG A 1 18  ? 31.301  18.095  48.161  1.00 69.31  ? 18   ARG A CZ  1 
ATOM   138  N NH1 . ARG A 1 18  ? 31.333  17.504  49.348  1.00 60.49  ? 18   ARG A NH1 1 
ATOM   139  N NH2 . ARG A 1 18  ? 32.405  18.639  47.663  1.00 78.21  ? 18   ARG A NH2 1 
ATOM   140  N N   . GLY A 1 19  ? 27.244  14.639  44.120  1.00 48.90  ? 19   GLY A N   1 
ATOM   141  C CA  . GLY A 1 19  ? 26.473  15.131  42.990  1.00 50.15  ? 19   GLY A CA  1 
ATOM   142  C C   . GLY A 1 19  ? 25.666  16.379  43.312  1.00 57.94  ? 19   GLY A C   1 
ATOM   143  O O   . GLY A 1 19  ? 25.907  17.052  44.320  1.00 52.70  ? 19   GLY A O   1 
ATOM   144  N N   . ILE A 1 20  ? 24.700  16.689  42.455  1.00 54.70  ? 20   ILE A N   1 
ATOM   145  C CA  . ILE A 1 20  ? 23.901  17.890  42.631  1.00 48.00  ? 20   ILE A CA  1 
ATOM   146  C C   . ILE A 1 20  ? 22.427  17.665  42.282  1.00 53.10  ? 20   ILE A C   1 
ATOM   147  O O   . ILE A 1 20  ? 22.097  16.907  41.364  1.00 54.91  ? 20   ILE A O   1 
ATOM   148  C CB  . ILE A 1 20  ? 24.493  19.063  41.834  1.00 55.51  ? 20   ILE A CB  1 
ATOM   149  C CG1 . ILE A 1 20  ? 23.687  20.339  42.091  1.00 55.72  ? 20   ILE A CG1 1 
ATOM   150  C CG2 . ILE A 1 20  ? 24.595  18.720  40.329  1.00 51.00  ? 20   ILE A CG2 1 
ATOM   151  C CD1 . ILE A 1 20  ? 24.364  21.588  41.579  1.00 51.35  ? 20   ILE A CD1 1 
ATOM   152  N N   . ARG A 1 21  ? 21.544  18.304  43.040  1.00 48.56  ? 21   ARG A N   1 
ATOM   153  C CA  . ARG A 1 21  ? 20.106  18.181  42.814  1.00 55.31  ? 21   ARG A CA  1 
ATOM   154  C C   . ARG A 1 21  ? 19.678  19.264  41.843  1.00 54.05  ? 21   ARG A C   1 
ATOM   155  O O   . ARG A 1 21  ? 19.784  20.450  42.144  1.00 58.74  ? 21   ARG A O   1 
ATOM   156  C CB  . ARG A 1 21  ? 19.342  18.330  44.136  1.00 53.46  ? 21   ARG A CB  1 
ATOM   157  C CG  . ARG A 1 21  ? 17.877  17.882  44.104  1.00 62.30  ? 21   ARG A CG  1 
ATOM   158  C CD  . ARG A 1 21  ? 17.100  18.365  45.344  1.00 59.80  ? 21   ARG A CD  1 
ATOM   159  N NE  . ARG A 1 21  ? 16.375  19.595  45.043  1.00 83.27  ? 21   ARG A NE  1 
ATOM   160  C CZ  . ARG A 1 21  ? 15.060  19.748  45.169  1.00 83.24  ? 21   ARG A CZ  1 
ATOM   161  N NH1 . ARG A 1 21  ? 14.316  18.752  45.632  1.00 73.98  ? 21   ARG A NH1 1 
ATOM   162  N NH2 . ARG A 1 21  ? 14.491  20.906  44.843  1.00 86.04  ? 21   ARG A NH2 1 
ATOM   163  N N   . LEU A 1 22  ? 19.213  18.867  40.666  1.00 57.19  ? 22   LEU A N   1 
ATOM   164  C CA  . LEU A 1 22  ? 18.817  19.850  39.662  1.00 55.21  ? 22   LEU A CA  1 
ATOM   165  C C   . LEU A 1 22  ? 17.313  19.923  39.536  1.00 54.55  ? 22   LEU A C   1 
ATOM   166  O O   . LEU A 1 22  ? 16.617  18.926  39.720  1.00 56.44  ? 22   LEU A O   1 
ATOM   167  C CB  . LEU A 1 22  ? 19.393  19.504  38.291  1.00 51.67  ? 22   LEU A CB  1 
ATOM   168  C CG  . LEU A 1 22  ? 20.899  19.349  38.105  1.00 53.98  ? 22   LEU A CG  1 
ATOM   169  C CD1 . LEU A 1 22  ? 21.161  18.943  36.673  1.00 41.80  ? 22   LEU A CD1 1 
ATOM   170  C CD2 . LEU A 1 22  ? 21.647  20.618  38.449  1.00 46.61  ? 22   LEU A CD2 1 
ATOM   171  N N   . LYS A 1 23  ? 16.824  21.107  39.192  1.00 59.77  ? 23   LYS A N   1 
ATOM   172  C CA  . LYS A 1 23  ? 15.423  21.287  38.862  1.00 53.19  ? 23   LYS A CA  1 
ATOM   173  C C   . LYS A 1 23  ? 15.098  20.893  37.425  1.00 53.80  ? 23   LYS A C   1 
ATOM   174  O O   . LYS A 1 23  ? 15.787  21.261  36.479  1.00 52.60  ? 23   LYS A O   1 
ATOM   175  C CB  . LYS A 1 23  ? 14.985  22.727  39.129  1.00 58.25  ? 23   LYS A CB  1 
ATOM   176  C CG  . LYS A 1 23  ? 14.289  22.897  40.472  1.00 85.28  ? 23   LYS A CG  1 
ATOM   177  C CD  . LYS A 1 23  ? 13.094  21.937  40.586  1.00 90.39  ? 23   LYS A CD  1 
ATOM   178  C CE  . LYS A 1 23  ? 12.807  21.528  42.034  1.00 83.15  ? 23   LYS A CE  1 
ATOM   179  N NZ  . LYS A 1 23  ? 11.606  20.650  42.087  1.00 75.33  ? 23   LYS A NZ  1 
ATOM   180  N N   . ALA A 1 24  ? 14.038  20.116  37.282  1.00 61.78  ? 24   ALA A N   1 
ATOM   181  C CA  . ALA A 1 24  ? 13.437  19.841  35.990  1.00 56.50  ? 24   ALA A CA  1 
ATOM   182  C C   . ALA A 1 24  ? 11.951  20.176  36.140  1.00 68.09  ? 24   ALA A C   1 
ATOM   183  O O   . ALA A 1 24  ? 11.409  20.125  37.249  1.00 66.60  ? 24   ALA A O   1 
ATOM   184  C CB  . ALA A 1 24  ? 13.634  18.390  35.622  1.00 54.38  ? 24   ALA A CB  1 
ATOM   185  N N   . PRO A 1 25  ? 11.285  20.532  35.035  1.00 73.11  ? 25   PRO A N   1 
ATOM   186  C CA  . PRO A 1 25  ? 9.885   20.976  35.082  1.00 69.68  ? 25   PRO A CA  1 
ATOM   187  C C   . PRO A 1 25  ? 9.014   20.139  36.017  1.00 71.81  ? 25   PRO A C   1 
ATOM   188  O O   . PRO A 1 25  ? 8.230   20.685  36.797  1.00 68.08  ? 25   PRO A O   1 
ATOM   189  C CB  . PRO A 1 25  ? 9.427   20.796  33.639  1.00 74.01  ? 25   PRO A CB  1 
ATOM   190  C CG  . PRO A 1 25  ? 10.670  21.055  32.838  1.00 76.56  ? 25   PRO A CG  1 
ATOM   191  C CD  . PRO A 1 25  ? 11.812  20.503  33.658  1.00 78.01  ? 25   PRO A CD  1 
ATOM   192  N N   . GLY A 1 26  ? 9.154   18.823  35.943  1.00 74.65  ? 26   GLY A N   1 
ATOM   193  C CA  . GLY A 1 26  ? 8.330   17.942  36.752  1.00 70.86  ? 26   GLY A CA  1 
ATOM   194  C C   . GLY A 1 26  ? 8.934   17.504  38.079  1.00 74.84  ? 26   GLY A C   1 
ATOM   195  O O   . GLY A 1 26  ? 8.341   16.680  38.772  1.00 74.29  ? 26   GLY A O   1 
ATOM   196  N N   . GLY A 1 27  ? 10.105  18.035  38.436  1.00 65.76  ? 27   GLY A N   1 
ATOM   197  C CA  . GLY A 1 27  ? 10.743  17.683  39.697  1.00 61.15  ? 27   GLY A CA  1 
ATOM   198  C C   . GLY A 1 27  ? 12.255  17.553  39.631  1.00 66.34  ? 27   GLY A C   1 
ATOM   199  O O   . GLY A 1 27  ? 12.851  17.688  38.562  1.00 62.87  ? 27   GLY A O   1 
ATOM   200  N N   . PRO A 1 28  ? 12.886  17.250  40.774  1.00 65.66  ? 28   PRO A N   1 
ATOM   201  C CA  . PRO A 1 28  ? 14.348  17.269  40.884  1.00 60.45  ? 28   PRO A CA  1 
ATOM   202  C C   . PRO A 1 28  ? 14.988  16.080  40.183  1.00 59.47  ? 28   PRO A C   1 
ATOM   203  O O   . PRO A 1 28  ? 14.353  15.039  40.050  1.00 49.09  ? 28   PRO A O   1 
ATOM   204  C CB  . PRO A 1 28  ? 14.591  17.141  42.397  1.00 62.18  ? 28   PRO A CB  1 
ATOM   205  C CG  . PRO A 1 28  ? 13.227  17.103  43.046  1.00 57.64  ? 28   PRO A CG  1 
ATOM   206  C CD  . PRO A 1 28  ? 12.263  16.699  41.985  1.00 57.92  ? 28   PRO A CD  1 
ATOM   207  N N   . VAL A 1 29  ? 16.231  16.237  39.739  1.00 53.73  ? 29   VAL A N   1 
ATOM   208  C CA  . VAL A 1 29  ? 17.004  15.091  39.295  1.00 55.87  ? 29   VAL A CA  1 
ATOM   209  C C   . VAL A 1 29  ? 18.367  15.082  39.982  1.00 52.03  ? 29   VAL A C   1 
ATOM   210  O O   . VAL A 1 29  ? 18.855  16.122  40.428  1.00 51.52  ? 29   VAL A O   1 
ATOM   211  C CB  . VAL A 1 29  ? 17.165  15.047  37.756  1.00 52.20  ? 29   VAL A CB  1 
ATOM   212  C CG1 . VAL A 1 29  ? 15.826  15.187  37.089  1.00 44.30  ? 29   VAL A CG1 1 
ATOM   213  C CG2 . VAL A 1 29  ? 18.115  16.127  37.281  1.00 51.09  ? 29   VAL A CG2 1 
ATOM   214  N N   . SER A 1 30  ? 18.957  13.896  40.096  1.00 56.53  ? 30   SER A N   1 
ATOM   215  C CA  . SER A 1 30  ? 20.314  13.757  40.607  1.00 56.70  ? 30   SER A CA  1 
ATOM   216  C C   . SER A 1 30  ? 21.279  13.907  39.435  1.00 51.09  ? 30   SER A C   1 
ATOM   217  O O   . SER A 1 30  ? 21.097  13.288  38.390  1.00 50.99  ? 30   SER A O   1 
ATOM   218  C CB  . SER A 1 30  ? 20.506  12.387  41.253  1.00 53.05  ? 30   SER A CB  1 
ATOM   219  O OG  . SER A 1 30  ? 19.697  12.232  42.401  1.00 65.77  ? 30   SER A OG  1 
ATOM   220  N N   . ALA A 1 31  ? 22.301  14.730  39.593  1.00 47.52  ? 31   ALA A N   1 
ATOM   221  C CA  . ALA A 1 31  ? 23.286  14.865  38.529  1.00 48.35  ? 31   ALA A CA  1 
ATOM   222  C C   . ALA A 1 31  ? 24.691  14.740  39.083  1.00 48.72  ? 31   ALA A C   1 
ATOM   223  O O   . ALA A 1 31  ? 25.031  15.338  40.103  1.00 54.26  ? 31   ALA A O   1 
ATOM   224  C CB  . ALA A 1 31  ? 23.110  16.179  37.807  1.00 50.94  ? 31   ALA A CB  1 
ATOM   225  N N   . PHE A 1 32  ? 25.500  13.933  38.420  1.00 50.04  ? 32   PHE A N   1 
ATOM   226  C CA  . PHE A 1 32  ? 26.899  13.785  38.791  1.00 46.25  ? 32   PHE A CA  1 
ATOM   227  C C   . PHE A 1 32  ? 27.729  14.136  37.579  1.00 46.49  ? 32   PHE A C   1 
ATOM   228  O O   . PHE A 1 32  ? 27.796  13.376  36.617  1.00 46.31  ? 32   PHE A O   1 
ATOM   229  C CB  . PHE A 1 32  ? 27.168  12.362  39.257  1.00 42.18  ? 32   PHE A CB  1 
ATOM   230  C CG  . PHE A 1 32  ? 26.323  11.957  40.427  1.00 49.35  ? 32   PHE A CG  1 
ATOM   231  C CD1 . PHE A 1 32  ? 25.029  11.488  40.235  1.00 45.82  ? 32   PHE A CD1 1 
ATOM   232  C CD2 . PHE A 1 32  ? 26.807  12.075  41.726  1.00 47.40  ? 32   PHE A CD2 1 
ATOM   233  C CE1 . PHE A 1 32  ? 24.237  11.127  41.314  1.00 43.80  ? 32   PHE A CE1 1 
ATOM   234  C CE2 . PHE A 1 32  ? 26.022  11.713  42.811  1.00 46.17  ? 32   PHE A CE2 1 
ATOM   235  C CZ  . PHE A 1 32  ? 24.735  11.240  42.604  1.00 47.60  ? 32   PHE A CZ  1 
ATOM   236  N N   . LEU A 1 33  ? 28.335  15.315  37.619  1.00 54.16  ? 33   LEU A N   1 
ATOM   237  C CA  . LEU A 1 33  ? 29.003  15.869  36.451  1.00 49.56  ? 33   LEU A CA  1 
ATOM   238  C C   . LEU A 1 33  ? 30.518  15.940  36.636  1.00 51.76  ? 33   LEU A C   1 
ATOM   239  O O   . LEU A 1 33  ? 31.013  16.263  37.719  1.00 46.85  ? 33   LEU A O   1 
ATOM   240  C CB  . LEU A 1 33  ? 28.456  17.263  36.178  1.00 49.91  ? 33   LEU A CB  1 
ATOM   241  C CG  . LEU A 1 33  ? 26.938  17.414  36.196  1.00 48.66  ? 33   LEU A CG  1 
ATOM   242  C CD1 . LEU A 1 33  ? 26.572  18.890  36.080  1.00 47.51  ? 33   LEU A CD1 1 
ATOM   243  C CD2 . LEU A 1 33  ? 26.302  16.586  35.081  1.00 43.12  ? 33   LEU A CD2 1 
ATOM   244  N N   . GLY A 1 34  ? 31.250  15.642  35.571  1.00 43.74  ? 34   GLY A N   1 
ATOM   245  C CA  . GLY A 1 34  ? 32.691  15.732  35.617  1.00 45.13  ? 34   GLY A CA  1 
ATOM   246  C C   . GLY A 1 34  ? 33.365  14.600  36.373  1.00 47.66  ? 34   GLY A C   1 
ATOM   247  O O   . GLY A 1 34  ? 34.442  14.769  36.937  1.00 50.60  ? 34   GLY A O   1 
ATOM   248  N N   . ILE A 1 35  ? 32.740  13.435  36.390  1.00 47.74  ? 35   ILE A N   1 
ATOM   249  C CA  . ILE A 1 35  ? 33.412  12.256  36.905  1.00 44.12  ? 35   ILE A CA  1 
ATOM   250  C C   . ILE A 1 35  ? 34.548  11.819  35.971  1.00 49.95  ? 35   ILE A C   1 
ATOM   251  O O   . ILE A 1 35  ? 34.301  11.489  34.814  1.00 51.86  ? 35   ILE A O   1 
ATOM   252  C CB  . ILE A 1 35  ? 32.442  11.108  37.025  1.00 40.49  ? 35   ILE A CB  1 
ATOM   253  C CG1 . ILE A 1 35  ? 31.173  11.576  37.743  1.00 45.86  ? 35   ILE A CG1 1 
ATOM   254  C CG2 . ILE A 1 35  ? 33.112  9.974   37.737  1.00 45.74  ? 35   ILE A CG2 1 
ATOM   255  C CD1 . ILE A 1 35  ? 30.026  10.571  37.723  1.00 37.47  ? 35   ILE A CD1 1 
ATOM   256  N N   . PRO A 1 36  ? 35.796  11.801  36.473  1.00 51.12  ? 36   PRO A N   1 
ATOM   257  C CA  . PRO A 1 36  ? 36.951  11.391  35.664  1.00 51.08  ? 36   PRO A CA  1 
ATOM   258  C C   . PRO A 1 36  ? 36.870  9.907   35.425  1.00 53.18  ? 36   PRO A C   1 
ATOM   259  O O   . PRO A 1 36  ? 36.560  9.188   36.365  1.00 53.94  ? 36   PRO A O   1 
ATOM   260  C CB  . PRO A 1 36  ? 38.151  11.644  36.591  1.00 55.12  ? 36   PRO A CB  1 
ATOM   261  C CG  . PRO A 1 36  ? 37.609  12.283  37.829  1.00 50.68  ? 36   PRO A CG  1 
ATOM   262  C CD  . PRO A 1 36  ? 36.155  11.967  37.889  1.00 49.52  ? 36   PRO A CD  1 
ATOM   263  N N   . PHE A 1 37  ? 37.148  9.442   34.216  1.00 55.56  ? 37   PHE A N   1 
ATOM   264  C CA  . PHE A 1 37  ? 37.095  8.010   33.967  1.00 50.06  ? 37   PHE A CA  1 
ATOM   265  C C   . PHE A 1 37  ? 38.401  7.524   33.352  1.00 48.14  ? 37   PHE A C   1 
ATOM   266  O O   . PHE A 1 37  ? 38.525  6.363   32.956  1.00 58.47  ? 37   PHE A O   1 
ATOM   267  C CB  . PHE A 1 37  ? 35.885  7.642   33.093  1.00 48.51  ? 37   PHE A CB  1 
ATOM   268  C CG  . PHE A 1 37  ? 35.964  8.175   31.693  1.00 50.73  ? 37   PHE A CG  1 
ATOM   269  C CD1 . PHE A 1 37  ? 36.516  7.409   30.676  1.00 47.10  ? 37   PHE A CD1 1 
ATOM   270  C CD2 . PHE A 1 37  ? 35.489  9.442   31.395  1.00 44.15  ? 37   PHE A CD2 1 
ATOM   271  C CE1 . PHE A 1 37  ? 36.603  7.897   29.387  1.00 48.04  ? 37   PHE A CE1 1 
ATOM   272  C CE2 . PHE A 1 37  ? 35.565  9.930   30.110  1.00 45.78  ? 37   PHE A CE2 1 
ATOM   273  C CZ  . PHE A 1 37  ? 36.131  9.164   29.102  1.00 46.58  ? 37   PHE A CZ  1 
ATOM   274  N N   . ALA A 1 38  ? 39.376  8.421   33.290  1.00 49.18  ? 38   ALA A N   1 
ATOM   275  C CA  . ALA A 1 38  ? 40.677  8.121   32.702  1.00 52.47  ? 38   ALA A CA  1 
ATOM   276  C C   . ALA A 1 38  ? 41.759  9.073   33.227  1.00 59.33  ? 38   ALA A C   1 
ATOM   277  O O   . ALA A 1 38  ? 41.467  10.193  33.673  1.00 56.71  ? 38   ALA A O   1 
ATOM   278  C CB  . ALA A 1 38  ? 40.600  8.194   31.186  1.00 49.65  ? 38   ALA A CB  1 
ATOM   279  N N   . GLU A 1 39  ? 43.006  8.617   33.186  1.00 52.63  ? 39   GLU A N   1 
ATOM   280  C CA  . GLU A 1 39  ? 44.128  9.489   33.481  1.00 53.78  ? 39   GLU A CA  1 
ATOM   281  C C   . GLU A 1 39  ? 44.182  10.573  32.412  1.00 56.79  ? 39   GLU A C   1 
ATOM   282  O O   . GLU A 1 39  ? 44.041  10.282  31.222  1.00 57.49  ? 39   GLU A O   1 
ATOM   283  C CB  . GLU A 1 39  ? 45.423  8.686   33.496  1.00 49.62  ? 39   GLU A CB  1 
ATOM   284  C CG  . GLU A 1 39  ? 45.603  7.871   34.753  1.00 66.62  ? 39   GLU A CG  1 
ATOM   285  C CD  . GLU A 1 39  ? 45.627  8.740   36.001  1.00 69.80  ? 39   GLU A CD  1 
ATOM   286  O OE1 . GLU A 1 39  ? 46.418  9.708   36.040  1.00 70.72  ? 39   GLU A OE1 1 
ATOM   287  O OE2 . GLU A 1 39  ? 44.848  8.460   36.938  1.00 63.26  ? 39   GLU A OE2 1 
ATOM   288  N N   . PRO A 1 40  ? 44.372  11.829  32.829  1.00 51.41  ? 40   PRO A N   1 
ATOM   289  C CA  . PRO A 1 40  ? 44.481  12.938  31.873  1.00 52.23  ? 40   PRO A CA  1 
ATOM   290  C C   . PRO A 1 40  ? 45.432  12.573  30.741  1.00 51.13  ? 40   PRO A C   1 
ATOM   291  O O   . PRO A 1 40  ? 46.592  12.291  31.008  1.00 56.33  ? 40   PRO A O   1 
ATOM   292  C CB  . PRO A 1 40  ? 45.085  14.061  32.713  1.00 50.98  ? 40   PRO A CB  1 
ATOM   293  C CG  . PRO A 1 40  ? 44.664  13.753  34.107  1.00 51.17  ? 40   PRO A CG  1 
ATOM   294  C CD  . PRO A 1 40  ? 44.645  12.254  34.210  1.00 52.08  ? 40   PRO A CD  1 
ATOM   295  N N   . PRO A 1 41  ? 44.943  12.561  29.492  1.00 57.35  ? 41   PRO A N   1 
ATOM   296  C CA  . PRO A 1 41  ? 45.743  12.118  28.344  1.00 55.76  ? 41   PRO A CA  1 
ATOM   297  C C   . PRO A 1 41  ? 46.689  13.216  27.874  1.00 52.46  ? 41   PRO A C   1 
ATOM   298  O O   . PRO A 1 41  ? 46.732  13.560  26.696  1.00 50.63  ? 41   PRO A O   1 
ATOM   299  C CB  . PRO A 1 41  ? 44.671  11.851  27.293  1.00 45.71  ? 41   PRO A CB  1 
ATOM   300  C CG  . PRO A 1 41  ? 43.719  12.961  27.558  1.00 53.47  ? 41   PRO A CG  1 
ATOM   301  C CD  . PRO A 1 41  ? 43.578  12.920  29.068  1.00 48.90  ? 41   PRO A CD  1 
ATOM   302  N N   . VAL A 1 42  ? 47.458  13.752  28.808  1.00 50.94  ? 42   VAL A N   1 
ATOM   303  C CA  . VAL A 1 42  ? 48.312  14.896  28.530  1.00 55.30  ? 42   VAL A CA  1 
ATOM   304  C C   . VAL A 1 42  ? 49.792  14.504  28.503  1.00 61.87  ? 42   VAL A C   1 
ATOM   305  O O   . VAL A 1 42  ? 50.159  13.385  28.873  1.00 64.72  ? 42   VAL A O   1 
ATOM   306  C CB  . VAL A 1 42  ? 48.098  15.974  29.592  1.00 53.00  ? 42   VAL A CB  1 
ATOM   307  C CG1 . VAL A 1 42  ? 46.600  16.288  29.738  1.00 45.80  ? 42   VAL A CG1 1 
ATOM   308  C CG2 . VAL A 1 42  ? 48.652  15.494  30.905  1.00 45.61  ? 42   VAL A CG2 1 
ATOM   309  N N   . GLY A 1 43  ? 50.640  15.428  28.062  1.00 53.34  ? 43   GLY A N   1 
ATOM   310  C CA  . GLY A 1 43  ? 52.072  15.189  28.031  1.00 49.97  ? 43   GLY A CA  1 
ATOM   311  C C   . GLY A 1 43  ? 52.471  13.995  27.185  1.00 55.15  ? 43   GLY A C   1 
ATOM   312  O O   . GLY A 1 43  ? 52.112  13.908  26.009  1.00 61.75  ? 43   GLY A O   1 
ATOM   313  N N   . SER A 1 44  ? 53.220  13.075  27.785  1.00 60.23  ? 44   SER A N   1 
ATOM   314  C CA  . SER A 1 44  ? 53.678  11.879  27.085  1.00 62.25  ? 44   SER A CA  1 
ATOM   315  C C   . SER A 1 44  ? 52.518  10.951  26.753  1.00 55.39  ? 44   SER A C   1 
ATOM   316  O O   . SER A 1 44  ? 52.691  9.954   26.062  1.00 56.17  ? 44   SER A O   1 
ATOM   317  C CB  . SER A 1 44  ? 54.682  11.122  27.940  1.00 63.85  ? 44   SER A CB  1 
ATOM   318  O OG  . SER A 1 44  ? 54.033  10.535  29.053  1.00 74.17  ? 44   SER A OG  1 
ATOM   319  N N   . ARG A 1 45  ? 51.334  11.281  27.252  1.00 54.49  ? 45   ARG A N   1 
ATOM   320  C CA  . ARG A 1 45  ? 50.152  10.491  26.940  1.00 54.64  ? 45   ARG A CA  1 
ATOM   321  C C   . ARG A 1 45  ? 49.315  11.007  25.758  1.00 56.38  ? 45   ARG A C   1 
ATOM   322  O O   . ARG A 1 45  ? 48.357  10.352  25.350  1.00 51.66  ? 45   ARG A O   1 
ATOM   323  C CB  . ARG A 1 45  ? 49.299  10.270  28.188  1.00 58.06  ? 45   ARG A CB  1 
ATOM   324  C CG  . ARG A 1 45  ? 49.952  9.287   29.149  1.00 65.37  ? 45   ARG A CG  1 
ATOM   325  C CD  . ARG A 1 45  ? 48.950  8.295   29.733  1.00 84.92  ? 45   ARG A CD  1 
ATOM   326  N NE  . ARG A 1 45  ? 48.625  8.579   31.131  1.00 87.13  ? 45   ARG A NE  1 
ATOM   327  C CZ  . ARG A 1 45  ? 49.365  8.180   32.165  1.00 83.99  ? 45   ARG A CZ  1 
ATOM   328  N NH1 . ARG A 1 45  ? 50.479  7.486   31.956  1.00 92.06  ? 45   ARG A NH1 1 
ATOM   329  N NH2 . ARG A 1 45  ? 48.997  8.474   33.406  1.00 80.00  ? 45   ARG A NH2 1 
ATOM   330  N N   . ARG A 1 46  ? 49.681  12.159  25.197  1.00 55.63  ? 46   ARG A N   1 
ATOM   331  C CA  . ARG A 1 46  ? 49.011  12.650  23.992  1.00 53.62  ? 46   ARG A CA  1 
ATOM   332  C C   . ARG A 1 46  ? 49.127  11.600  22.876  1.00 47.87  ? 46   ARG A C   1 
ATOM   333  O O   . ARG A 1 46  ? 50.172  10.984  22.726  1.00 55.31  ? 46   ARG A O   1 
ATOM   334  C CB  . ARG A 1 46  ? 49.600  13.999  23.561  1.00 50.16  ? 46   ARG A CB  1 
ATOM   335  C CG  . ARG A 1 46  ? 49.067  14.518  22.245  1.00 49.66  ? 46   ARG A CG  1 
ATOM   336  C CD  . ARG A 1 46  ? 49.805  15.768  21.761  1.00 47.04  ? 46   ARG A CD  1 
ATOM   337  N NE  . ARG A 1 46  ? 49.516  16.937  22.586  1.00 43.91  ? 46   ARG A NE  1 
ATOM   338  C CZ  . ARG A 1 46  ? 50.052  18.139  22.393  1.00 47.44  ? 46   ARG A CZ  1 
ATOM   339  N NH1 . ARG A 1 46  ? 50.904  18.334  21.398  1.00 52.10  ? 46   ARG A NH1 1 
ATOM   340  N NH2 . ARG A 1 46  ? 49.749  19.148  23.198  1.00 43.14  ? 46   ARG A NH2 1 
ATOM   341  N N   . PHE A 1 47  ? 48.052  11.394  22.113  1.00 45.94  ? 47   PHE A N   1 
ATOM   342  C CA  . PHE A 1 47  ? 47.964  10.358  21.063  1.00 41.56  ? 47   PHE A CA  1 
ATOM   343  C C   . PHE A 1 47  ? 47.884  8.902   21.566  1.00 46.89  ? 47   PHE A C   1 
ATOM   344  O O   . PHE A 1 47  ? 47.606  7.991   20.789  1.00 43.58  ? 47   PHE A O   1 
ATOM   345  C CB  . PHE A 1 47  ? 49.094  10.460  20.027  1.00 45.75  ? 47   PHE A CB  1 
ATOM   346  C CG  . PHE A 1 47  ? 49.357  11.849  19.536  1.00 45.77  ? 47   PHE A CG  1 
ATOM   347  C CD1 . PHE A 1 47  ? 48.370  12.576  18.902  1.00 47.74  ? 47   PHE A CD1 1 
ATOM   348  C CD2 . PHE A 1 47  ? 50.600  12.422  19.696  1.00 43.46  ? 47   PHE A CD2 1 
ATOM   349  C CE1 . PHE A 1 47  ? 48.610  13.845  18.451  1.00 40.68  ? 47   PHE A CE1 1 
ATOM   350  C CE2 . PHE A 1 47  ? 50.843  13.695  19.243  1.00 49.98  ? 47   PHE A CE2 1 
ATOM   351  C CZ  . PHE A 1 47  ? 49.846  14.406  18.627  1.00 46.44  ? 47   PHE A CZ  1 
ATOM   352  N N   . MET A 1 48  ? 48.133  8.691   22.855  1.00 49.32  ? 48   MET A N   1 
ATOM   353  C CA  . MET A 1 48  ? 48.119  7.353   23.443  1.00 50.01  ? 48   MET A CA  1 
ATOM   354  C C   . MET A 1 48  ? 46.723  6.900   23.855  1.00 49.24  ? 48   MET A C   1 
ATOM   355  O O   . MET A 1 48  ? 45.866  7.722   24.166  1.00 50.08  ? 48   MET A O   1 
ATOM   356  C CB  . MET A 1 48  ? 49.029  7.319   24.670  1.00 49.53  ? 48   MET A CB  1 
ATOM   357  C CG  . MET A 1 48  ? 50.486  7.592   24.372  1.00 54.18  ? 48   MET A CG  1 
ATOM   358  S SD  . MET A 1 48  ? 51.344  6.063   23.967  1.00 78.16  ? 48   MET A SD  1 
ATOM   359  C CE  . MET A 1 48  ? 50.648  5.730   22.370  1.00 56.51  ? 48   MET A CE  1 
ATOM   360  N N   . PRO A 1 49  ? 46.492  5.580   23.857  1.00 53.57  ? 49   PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? 45.278  4.978   24.426  1.00 49.28  ? 49   PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? 45.071  5.413   25.878  1.00 51.73  ? 49   PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? 46.045  5.629   26.607  1.00 52.29  ? 49   PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? 45.579  3.479   24.372  1.00 40.40  ? 49   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? 46.496  3.329   23.221  1.00 40.64  ? 49   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? 47.343  4.581   23.187  1.00 47.44  ? 49   PRO A CD  1 
ATOM   367  N N   . PRO A 1 50  ? 43.806  5.536   26.301  1.00 51.96  ? 50   PRO A N   1 
ATOM   368  C CA  . PRO A 1 50  ? 43.494  6.003   27.653  1.00 51.74  ? 50   PRO A CA  1 
ATOM   369  C C   . PRO A 1 50  ? 43.864  4.956   28.693  1.00 60.09  ? 50   PRO A C   1 
ATOM   370  O O   . PRO A 1 50  ? 43.707  3.753   28.456  1.00 54.56  ? 50   PRO A O   1 
ATOM   371  C CB  . PRO A 1 50  ? 41.968  6.133   27.645  1.00 51.94  ? 50   PRO A CB  1 
ATOM   372  C CG  . PRO A 1 50  ? 41.496  5.607   26.342  1.00 43.79  ? 50   PRO A CG  1 
ATOM   373  C CD  . PRO A 1 50  ? 42.629  5.002   25.605  1.00 43.72  ? 50   PRO A CD  1 
ATOM   374  N N   . GLU A 1 51  ? 44.341  5.413   29.840  1.00 59.81  ? 51   GLU A N   1 
ATOM   375  C CA  . GLU A 1 51  ? 44.475  4.545   30.994  1.00 60.96  ? 51   GLU A CA  1 
ATOM   376  C C   . GLU A 1 51  ? 43.397  4.904   31.994  1.00 57.67  ? 51   GLU A C   1 
ATOM   377  O O   . GLU A 1 51  ? 43.141  6.084   32.236  1.00 58.73  ? 51   GLU A O   1 
ATOM   378  C CB  . GLU A 1 51  ? 45.849  4.702   31.630  1.00 63.23  ? 51   GLU A CB  1 
ATOM   379  C CG  . GLU A 1 51  ? 46.986  4.331   30.690  1.00 84.54  ? 51   GLU A CG  1 
ATOM   380  C CD  . GLU A 1 51  ? 48.328  4.834   31.191  1.00 97.13  ? 51   GLU A CD  1 
ATOM   381  O OE1 . GLU A 1 51  ? 48.328  5.651   32.138  1.00 85.56  ? 51   GLU A OE1 1 
ATOM   382  O OE2 . GLU A 1 51  ? 49.375  4.415   30.642  1.00 102.20 ? 51   GLU A OE2 1 
ATOM   383  N N   . PRO A 1 52  ? 42.764  3.883   32.581  1.00 58.48  ? 52   PRO A N   1 
ATOM   384  C CA  . PRO A 1 52  ? 41.758  4.029   33.640  1.00 53.87  ? 52   PRO A CA  1 
ATOM   385  C C   . PRO A 1 52  ? 42.197  5.019   34.720  1.00 54.19  ? 52   PRO A C   1 
ATOM   386  O O   . PRO A 1 52  ? 43.382  5.084   35.059  1.00 57.69  ? 52   PRO A O   1 
ATOM   387  C CB  . PRO A 1 52  ? 41.679  2.624   34.231  1.00 52.34  ? 52   PRO A CB  1 
ATOM   388  C CG  . PRO A 1 52  ? 42.060  1.724   33.106  1.00 58.06  ? 52   PRO A CG  1 
ATOM   389  C CD  . PRO A 1 52  ? 43.072  2.471   32.290  1.00 52.50  ? 52   PRO A CD  1 
ATOM   390  N N   . LYS A 1 53  ? 41.243  5.779   35.249  1.00 50.76  ? 53   LYS A N   1 
ATOM   391  C CA  . LYS A 1 53  ? 41.515  6.799   36.257  1.00 51.46  ? 53   LYS A CA  1 
ATOM   392  C C   . LYS A 1 53  ? 41.992  6.183   37.568  1.00 59.24  ? 53   LYS A C   1 
ATOM   393  O O   . LYS A 1 53  ? 41.364  5.263   38.102  1.00 64.58  ? 53   LYS A O   1 
ATOM   394  C CB  . LYS A 1 53  ? 40.258  7.635   36.508  1.00 52.42  ? 53   LYS A CB  1 
ATOM   395  C CG  . LYS A 1 53  ? 40.366  8.611   37.665  1.00 52.52  ? 53   LYS A CG  1 
ATOM   396  C CD  . LYS A 1 53  ? 41.428  9.662   37.423  1.00 52.10  ? 53   LYS A CD  1 
ATOM   397  C CE  . LYS A 1 53  ? 41.376  10.725  38.496  1.00 49.90  ? 53   LYS A CE  1 
ATOM   398  N NZ  . LYS A 1 53  ? 42.471  11.721  38.319  1.00 60.78  ? 53   LYS A NZ  1 
ATOM   399  N N   . ARG A 1 54  ? 43.109  6.691   38.078  1.00 59.74  ? 54   ARG A N   1 
ATOM   400  C CA  . ARG A 1 54  ? 43.659  6.221   39.344  1.00 64.63  ? 54   ARG A CA  1 
ATOM   401  C C   . ARG A 1 54  ? 42.815  6.758   40.495  1.00 57.29  ? 54   ARG A C   1 
ATOM   402  O O   . ARG A 1 54  ? 42.508  7.944   40.522  1.00 53.02  ? 54   ARG A O   1 
ATOM   403  C CB  . ARG A 1 54  ? 45.134  6.636   39.484  1.00 58.29  ? 54   ARG A CB  1 
ATOM   404  C CG  . ARG A 1 54  ? 46.085  5.620   38.866  1.00 68.16  ? 54   ARG A CG  1 
ATOM   405  C CD  . ARG A 1 54  ? 47.199  6.263   38.042  1.00 89.98  ? 54   ARG A CD  1 
ATOM   406  N NE  . ARG A 1 54  ? 48.364  6.620   38.846  1.00 101.57 ? 54   ARG A NE  1 
ATOM   407  C CZ  . ARG A 1 54  ? 48.676  7.861   39.215  1.00 111.86 ? 54   ARG A CZ  1 
ATOM   408  N NH1 . ARG A 1 54  ? 47.908  8.886   38.853  1.00 99.92  ? 54   ARG A NH1 1 
ATOM   409  N NH2 . ARG A 1 54  ? 49.760  8.080   39.951  1.00 119.57 ? 54   ARG A NH2 1 
ATOM   410  N N   . PRO A 1 55  ? 42.436  5.876   41.443  1.00 57.75  ? 55   PRO A N   1 
ATOM   411  C CA  . PRO A 1 55  ? 41.555  6.222   42.564  1.00 50.35  ? 55   PRO A CA  1 
ATOM   412  C C   . PRO A 1 55  ? 42.005  7.493   43.270  1.00 52.07  ? 55   PRO A C   1 
ATOM   413  O O   . PRO A 1 55  ? 43.197  7.769   43.372  1.00 54.32  ? 55   PRO A O   1 
ATOM   414  C CB  . PRO A 1 55  ? 41.693  5.024   43.499  1.00 46.95  ? 55   PRO A CB  1 
ATOM   415  C CG  . PRO A 1 55  ? 42.056  3.898   42.622  1.00 54.87  ? 55   PRO A CG  1 
ATOM   416  C CD  . PRO A 1 55  ? 42.891  4.476   41.513  1.00 49.28  ? 55   PRO A CD  1 
ATOM   417  N N   . TRP A 1 56  ? 41.046  8.280   43.731  1.00 55.90  ? 56   TRP A N   1 
ATOM   418  C CA  . TRP A 1 56  ? 41.359  9.523   44.411  1.00 55.44  ? 56   TRP A CA  1 
ATOM   419  C C   . TRP A 1 56  ? 40.922  9.399   45.850  1.00 60.96  ? 56   TRP A C   1 
ATOM   420  O O   . TRP A 1 56  ? 40.250  8.429   46.234  1.00 63.79  ? 56   TRP A O   1 
ATOM   421  C CB  . TRP A 1 56  ? 40.636  10.696  43.756  1.00 47.76  ? 56   TRP A CB  1 
ATOM   422  C CG  . TRP A 1 56  ? 39.156  10.535  43.761  1.00 60.39  ? 56   TRP A CG  1 
ATOM   423  C CD1 . TRP A 1 56  ? 38.293  10.876  44.768  1.00 61.27  ? 56   TRP A CD1 1 
ATOM   424  C CD2 . TRP A 1 56  ? 38.351  9.989   42.713  1.00 61.13  ? 56   TRP A CD2 1 
ATOM   425  N NE1 . TRP A 1 56  ? 37.001  10.576  44.406  1.00 54.50  ? 56   TRP A NE1 1 
ATOM   426  C CE2 . TRP A 1 56  ? 37.008  10.034  43.149  1.00 56.26  ? 56   TRP A CE2 1 
ATOM   427  C CE3 . TRP A 1 56  ? 38.633  9.475   41.442  1.00 59.26  ? 56   TRP A CE3 1 
ATOM   428  C CZ2 . TRP A 1 56  ? 35.950  9.580   42.361  1.00 57.06  ? 56   TRP A CZ2 1 
ATOM   429  C CZ3 . TRP A 1 56  ? 37.578  9.020   40.661  1.00 55.11  ? 56   TRP A CZ3 1 
ATOM   430  C CH2 . TRP A 1 56  ? 36.254  9.074   41.126  1.00 51.09  ? 56   TRP A CH2 1 
ATOM   431  N N   . SER A 1 57  ? 41.294  10.384  46.651  1.00 56.30  ? 57   SER A N   1 
ATOM   432  C CA  . SER A 1 57  ? 40.956  10.344  48.060  1.00 59.00  ? 57   SER A CA  1 
ATOM   433  C C   . SER A 1 57  ? 39.985  11.461  48.375  1.00 58.94  ? 57   SER A C   1 
ATOM   434  O O   . SER A 1 57  ? 40.022  12.532  47.766  1.00 59.51  ? 57   SER A O   1 
ATOM   435  C CB  . SER A 1 57  ? 42.217  10.456  48.921  1.00 71.78  ? 57   SER A CB  1 
ATOM   436  O OG  . SER A 1 57  ? 43.011  11.553  48.502  1.00 74.67  ? 57   SER A OG  1 
ATOM   437  N N   . GLY A 1 58  ? 39.103  11.204  49.326  1.00 60.10  ? 58   GLY A N   1 
ATOM   438  C CA  . GLY A 1 58  ? 38.124  12.193  49.697  1.00 53.84  ? 58   GLY A CA  1 
ATOM   439  C C   . GLY A 1 58  ? 36.986  12.212  48.709  1.00 61.46  ? 58   GLY A C   1 
ATOM   440  O O   . GLY A 1 58  ? 36.887  11.352  47.821  1.00 63.29  ? 58   GLY A O   1 
ATOM   441  N N   . VAL A 1 59  ? 36.117  13.198  48.879  1.00 59.28  ? 59   VAL A N   1 
ATOM   442  C CA  . VAL A 1 59  ? 34.931  13.320  48.052  1.00 57.89  ? 59   VAL A CA  1 
ATOM   443  C C   . VAL A 1 59  ? 35.199  14.265  46.888  1.00 61.46  ? 59   VAL A C   1 
ATOM   444  O O   . VAL A 1 59  ? 35.427  15.468  47.070  1.00 57.60  ? 59   VAL A O   1 
ATOM   445  C CB  . VAL A 1 59  ? 33.728  13.817  48.870  1.00 53.48  ? 59   VAL A CB  1 
ATOM   446  C CG1 . VAL A 1 59  ? 32.526  13.998  47.976  1.00 50.96  ? 59   VAL A CG1 1 
ATOM   447  C CG2 . VAL A 1 59  ? 33.420  12.841  50.001  1.00 48.31  ? 59   VAL A CG2 1 
ATOM   448  N N   . LEU A 1 60  ? 35.200  13.696  45.692  1.00 56.82  ? 60   LEU A N   1 
ATOM   449  C CA  . LEU A 1 60  ? 35.297  14.473  44.478  1.00 55.53  ? 60   LEU A CA  1 
ATOM   450  C C   . LEU A 1 60  ? 33.985  15.228  44.249  1.00 55.88  ? 60   LEU A C   1 
ATOM   451  O O   . LEU A 1 60  ? 32.908  14.634  44.253  1.00 55.27  ? 60   LEU A O   1 
ATOM   452  C CB  . LEU A 1 60  ? 35.606  13.543  43.309  1.00 58.04  ? 60   LEU A CB  1 
ATOM   453  C CG  . LEU A 1 60  ? 35.847  14.188  41.945  1.00 57.21  ? 60   LEU A CG  1 
ATOM   454  C CD1 . LEU A 1 60  ? 37.054  13.549  41.283  1.00 60.00  ? 60   LEU A CD1 1 
ATOM   455  C CD2 . LEU A 1 60  ? 34.612  14.060  41.068  1.00 53.31  ? 60   LEU A CD2 1 
ATOM   456  N N   . ASP A 1 61  ? 34.066  16.544  44.085  1.00 55.90  ? 61   ASP A N   1 
ATOM   457  C CA  . ASP A 1 61  ? 32.877  17.316  43.749  1.00 54.82  ? 61   ASP A CA  1 
ATOM   458  C C   . ASP A 1 61  ? 32.437  17.071  42.301  1.00 51.22  ? 61   ASP A C   1 
ATOM   459  O O   . ASP A 1 61  ? 33.207  17.271  41.364  1.00 64.86  ? 61   ASP A O   1 
ATOM   460  C CB  . ASP A 1 61  ? 33.112  18.801  43.973  1.00 53.03  ? 61   ASP A CB  1 
ATOM   461  C CG  . ASP A 1 61  ? 31.960  19.641  43.464  1.00 77.21  ? 61   ASP A CG  1 
ATOM   462  O OD1 . ASP A 1 61  ? 31.833  19.782  42.219  1.00 74.66  ? 61   ASP A OD1 1 
ATOM   463  O OD2 . ASP A 1 61  ? 31.172  20.145  44.307  1.00 78.66  ? 61   ASP A OD2 1 
ATOM   464  N N   . ALA A 1 62  ? 31.200  16.638  42.117  1.00 52.80  ? 62   ALA A N   1 
ATOM   465  C CA  . ALA A 1 62  ? 30.711  16.299  40.787  1.00 52.54  ? 62   ALA A CA  1 
ATOM   466  C C   . ALA A 1 62  ? 29.490  17.127  40.451  1.00 50.07  ? 62   ALA A C   1 
ATOM   467  O O   . ALA A 1 62  ? 28.502  16.600  39.945  1.00 48.23  ? 62   ALA A O   1 
ATOM   468  C CB  . ALA A 1 62  ? 30.383  14.825  40.701  1.00 48.07  ? 62   ALA A CB  1 
ATOM   469  N N   . THR A 1 63  ? 29.580  18.426  40.729  1.00 48.72  ? 63   THR A N   1 
ATOM   470  C CA  . THR A 1 63  ? 28.449  19.338  40.596  1.00 54.27  ? 63   THR A CA  1 
ATOM   471  C C   . THR A 1 63  ? 28.506  20.231  39.347  1.00 51.78  ? 63   THR A C   1 
ATOM   472  O O   . THR A 1 63  ? 27.560  20.957  39.052  1.00 55.77  ? 63   THR A O   1 
ATOM   473  C CB  . THR A 1 63  ? 28.330  20.221  41.841  1.00 56.86  ? 63   THR A CB  1 
ATOM   474  O OG1 . THR A 1 63  ? 29.505  21.031  41.955  1.00 55.44  ? 63   THR A OG1 1 
ATOM   475  C CG2 . THR A 1 63  ? 28.206  19.353  43.089  1.00 50.85  ? 63   THR A CG2 1 
ATOM   476  N N   . THR A 1 64  ? 29.607  20.174  38.611  1.00 52.55  ? 64   THR A N   1 
ATOM   477  C CA  . THR A 1 64  ? 29.723  20.962  37.393  1.00 55.40  ? 64   THR A CA  1 
ATOM   478  C C   . THR A 1 64  ? 30.394  20.206  36.253  1.00 51.18  ? 64   THR A C   1 
ATOM   479  O O   . THR A 1 64  ? 31.166  19.271  36.463  1.00 48.00  ? 64   THR A O   1 
ATOM   480  C CB  . THR A 1 64  ? 30.524  22.243  37.631  1.00 54.29  ? 64   THR A CB  1 
ATOM   481  O OG1 . THR A 1 64  ? 31.902  21.906  37.798  1.00 53.63  ? 64   THR A OG1 1 
ATOM   482  C CG2 . THR A 1 64  ? 30.032  22.960  38.873  1.00 60.11  ? 64   THR A CG2 1 
ATOM   483  N N   . PHE A 1 65  ? 30.101  20.635  35.036  1.00 53.14  ? 65   PHE A N   1 
ATOM   484  C CA  . PHE A 1 65  ? 30.739  20.054  33.874  1.00 54.00  ? 65   PHE A CA  1 
ATOM   485  C C   . PHE A 1 65  ? 32.225  20.360  33.893  1.00 53.96  ? 65   PHE A C   1 
ATOM   486  O O   . PHE A 1 65  ? 32.662  21.385  34.412  1.00 52.74  ? 65   PHE A O   1 
ATOM   487  C CB  . PHE A 1 65  ? 30.101  20.562  32.588  1.00 46.67  ? 65   PHE A CB  1 
ATOM   488  C CG  . PHE A 1 65  ? 28.732  20.006  32.337  1.00 53.75  ? 65   PHE A CG  1 
ATOM   489  C CD1 . PHE A 1 65  ? 28.558  18.641  32.101  1.00 48.88  ? 65   PHE A CD1 1 
ATOM   490  C CD2 . PHE A 1 65  ? 27.619  20.842  32.336  1.00 37.88  ? 65   PHE A CD2 1 
ATOM   491  C CE1 . PHE A 1 65  ? 27.294  18.114  31.867  1.00 50.47  ? 65   PHE A CE1 1 
ATOM   492  C CE2 . PHE A 1 65  ? 26.352  20.330  32.104  1.00 43.42  ? 65   PHE A CE2 1 
ATOM   493  C CZ  . PHE A 1 65  ? 26.183  18.965  31.870  1.00 52.18  ? 65   PHE A CZ  1 
ATOM   494  N N   . GLN A 1 66  ? 32.994  19.445  33.326  1.00 50.16  ? 66   GLN A N   1 
ATOM   495  C CA  . GLN A 1 66  ? 34.433  19.558  33.295  1.00 46.03  ? 66   GLN A CA  1 
ATOM   496  C C   . GLN A 1 66  ? 34.902  20.184  31.993  1.00 50.85  ? 66   GLN A C   1 
ATOM   497  O O   . GLN A 1 66  ? 34.082  20.583  31.163  1.00 48.51  ? 66   GLN A O   1 
ATOM   498  C CB  . GLN A 1 66  ? 35.039  18.173  33.450  1.00 45.79  ? 66   GLN A CB  1 
ATOM   499  C CG  . GLN A 1 66  ? 35.450  17.890  34.848  1.00 49.63  ? 66   GLN A CG  1 
ATOM   500  C CD  . GLN A 1 66  ? 36.620  18.763  35.259  1.00 56.03  ? 66   GLN A CD  1 
ATOM   501  O OE1 . GLN A 1 66  ? 37.465  19.115  34.432  1.00 57.09  ? 66   GLN A OE1 1 
ATOM   502  N NE2 . GLN A 1 66  ? 36.666  19.133  36.530  1.00 52.92  ? 66   GLN A NE2 1 
ATOM   503  N N   . ASN A 1 67  ? 36.220  20.267  31.821  1.00 45.07  ? 67   ASN A N   1 
ATOM   504  C CA  . ASN A 1 67  ? 36.806  20.737  30.569  1.00 42.65  ? 67   ASN A CA  1 
ATOM   505  C C   . ASN A 1 67  ? 36.262  20.045  29.333  1.00 44.47  ? 67   ASN A C   1 
ATOM   506  O O   . ASN A 1 67  ? 35.913  18.862  29.354  1.00 47.06  ? 67   ASN A O   1 
ATOM   507  C CB  . ASN A 1 67  ? 38.318  20.573  30.585  1.00 38.44  ? 67   ASN A CB  1 
ATOM   508  C CG  . ASN A 1 67  ? 38.972  21.405  31.655  1.00 53.46  ? 67   ASN A CG  1 
ATOM   509  O OD1 . ASN A 1 67  ? 38.595  22.564  31.900  1.00 44.85  ? 67   ASN A OD1 1 
ATOM   510  N ND2 . ASN A 1 67  ? 39.964  20.822  32.307  1.00 57.32  ? 67   ASN A ND2 1 
ATOM   511  N N   . VAL A 1 68  ? 36.195  20.806  28.252  1.00 44.97  ? 68   VAL A N   1 
ATOM   512  C CA  . VAL A 1 68  ? 35.919  20.262  26.936  1.00 38.28  ? 68   VAL A CA  1 
ATOM   513  C C   . VAL A 1 68  ? 37.235  19.919  26.232  1.00 43.04  ? 68   VAL A C   1 
ATOM   514  O O   . VAL A 1 68  ? 38.213  20.666  26.317  1.00 45.64  ? 68   VAL A O   1 
ATOM   515  C CB  . VAL A 1 68  ? 35.132  21.263  26.108  1.00 42.26  ? 68   VAL A CB  1 
ATOM   516  C CG1 . VAL A 1 68  ? 35.173  20.898  24.620  1.00 36.34  ? 68   VAL A CG1 1 
ATOM   517  C CG2 . VAL A 1 68  ? 33.715  21.353  26.641  1.00 35.03  ? 68   VAL A CG2 1 
ATOM   518  N N   . CYS A 1 69  ? 37.249  18.775  25.559  1.00 39.46  ? 69   CYS A N   1 
ATOM   519  C CA  . CYS A 1 69  ? 38.416  18.296  24.834  1.00 36.43  ? 69   CYS A CA  1 
ATOM   520  C C   . CYS A 1 69  ? 38.901  19.317  23.831  1.00 43.55  ? 69   CYS A C   1 
ATOM   521  O O   . CYS A 1 69  ? 38.104  19.902  23.108  1.00 39.29  ? 69   CYS A O   1 
ATOM   522  C CB  . CYS A 1 69  ? 38.104  16.969  24.147  1.00 36.38  ? 69   CYS A CB  1 
ATOM   523  S SG  . CYS A 1 69  ? 37.993  15.619  25.345  1.00 57.51  ? 69   CYS A SG  1 
ATOM   524  N N   . TYR A 1 70  ? 40.215  19.526  23.797  1.00 49.41  ? 70   TYR A N   1 
ATOM   525  C CA  . TYR A 1 70  ? 40.786  20.567  22.964  1.00 45.74  ? 70   TYR A CA  1 
ATOM   526  C C   . TYR A 1 70  ? 40.323  20.441  21.521  1.00 47.47  ? 70   TYR A C   1 
ATOM   527  O O   . TYR A 1 70  ? 40.394  19.363  20.936  1.00 45.81  ? 70   TYR A O   1 
ATOM   528  C CB  . TYR A 1 70  ? 42.317  20.577  23.032  1.00 53.45  ? 70   TYR A CB  1 
ATOM   529  C CG  . TYR A 1 70  ? 42.807  21.991  23.021  1.00 51.61  ? 70   TYR A CG  1 
ATOM   530  C CD1 . TYR A 1 70  ? 43.158  22.632  24.203  1.00 53.28  ? 70   TYR A CD1 1 
ATOM   531  C CD2 . TYR A 1 70  ? 42.831  22.719  21.838  1.00 49.87  ? 70   TYR A CD2 1 
ATOM   532  C CE1 . TYR A 1 70  ? 43.563  23.953  24.201  1.00 51.18  ? 70   TYR A CE1 1 
ATOM   533  C CE2 . TYR A 1 70  ? 43.226  24.030  21.819  1.00 51.74  ? 70   TYR A CE2 1 
ATOM   534  C CZ  . TYR A 1 70  ? 43.592  24.647  23.004  1.00 58.16  ? 70   TYR A CZ  1 
ATOM   535  O OH  . TYR A 1 70  ? 43.986  25.966  22.980  1.00 66.60  ? 70   TYR A OH  1 
ATOM   536  N N   . GLN A 1 71  ? 39.851  21.544  20.943  1.00 43.76  ? 71   GLN A N   1 
ATOM   537  C CA  . GLN A 1 71  ? 39.291  21.465  19.605  1.00 46.03  ? 71   GLN A CA  1 
ATOM   538  C C   . GLN A 1 71  ? 39.141  22.808  18.900  1.00 49.64  ? 71   GLN A C   1 
ATOM   539  O O   . GLN A 1 71  ? 39.196  23.877  19.514  1.00 48.79  ? 71   GLN A O   1 
ATOM   540  C CB  . GLN A 1 71  ? 37.918  20.787  19.660  1.00 38.58  ? 71   GLN A CB  1 
ATOM   541  C CG  . GLN A 1 71  ? 36.874  21.667  20.287  1.00 40.54  ? 71   GLN A CG  1 
ATOM   542  C CD  . GLN A 1 71  ? 35.630  20.933  20.666  1.00 44.94  ? 71   GLN A CD  1 
ATOM   543  O OE1 . GLN A 1 71  ? 34.556  21.198  20.119  1.00 46.02  ? 71   GLN A OE1 1 
ATOM   544  N NE2 . GLN A 1 71  ? 35.751  19.998  21.615  1.00 41.78  ? 71   GLN A NE2 1 
ATOM   545  N N   . TYR A 1 72  ? 38.927  22.712  17.594  1.00 46.04  ? 72   TYR A N   1 
ATOM   546  C CA  . TYR A 1 72  ? 38.597  23.838  16.746  1.00 49.86  ? 72   TYR A CA  1 
ATOM   547  C C   . TYR A 1 72  ? 37.275  24.501  17.157  1.00 56.74  ? 72   TYR A C   1 
ATOM   548  O O   . TYR A 1 72  ? 36.295  23.820  17.478  1.00 54.75  ? 72   TYR A O   1 
ATOM   549  C CB  . TYR A 1 72  ? 38.520  23.350  15.299  1.00 55.21  ? 72   TYR A CB  1 
ATOM   550  C CG  . TYR A 1 72  ? 38.040  24.401  14.346  1.00 63.44  ? 72   TYR A CG  1 
ATOM   551  C CD1 . TYR A 1 72  ? 36.683  24.550  14.080  1.00 63.26  ? 72   TYR A CD1 1 
ATOM   552  C CD2 . TYR A 1 72  ? 38.939  25.257  13.716  1.00 59.31  ? 72   TYR A CD2 1 
ATOM   553  C CE1 . TYR A 1 72  ? 36.232  25.522  13.213  1.00 69.63  ? 72   TYR A CE1 1 
ATOM   554  C CE2 . TYR A 1 72  ? 38.498  26.235  12.845  1.00 62.32  ? 72   TYR A CE2 1 
ATOM   555  C CZ  . TYR A 1 72  ? 37.142  26.365  12.596  1.00 73.82  ? 72   TYR A CZ  1 
ATOM   556  O OH  . TYR A 1 72  ? 36.687  27.337  11.728  1.00 81.99  ? 72   TYR A OH  1 
ATOM   557  N N   . VAL A 1 73  ? 37.250  25.831  17.147  1.00 61.62  ? 73   VAL A N   1 
ATOM   558  C CA  . VAL A 1 73  ? 36.046  26.584  17.506  1.00 57.66  ? 73   VAL A CA  1 
ATOM   559  C C   . VAL A 1 73  ? 35.490  27.312  16.294  1.00 60.98  ? 73   VAL A C   1 
ATOM   560  O O   . VAL A 1 73  ? 36.220  27.977  15.567  1.00 58.07  ? 73   VAL A O   1 
ATOM   561  C CB  . VAL A 1 73  ? 36.320  27.625  18.596  1.00 59.39  ? 73   VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 73  ? 35.035  28.341  18.965  1.00 59.53  ? 73   VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 73  ? 36.952  26.972  19.810  1.00 52.23  ? 73   VAL A CG2 1 
ATOM   564  N N   . ASP A 1 74  ? 34.186  27.187  16.084  1.00 70.66  ? 74   ASP A N   1 
ATOM   565  C CA  . ASP A 1 74  ? 33.573  27.724  14.881  1.00 65.13  ? 74   ASP A CA  1 
ATOM   566  C C   . ASP A 1 74  ? 33.558  29.248  14.858  1.00 67.07  ? 74   ASP A C   1 
ATOM   567  O O   . ASP A 1 74  ? 33.226  29.899  15.853  1.00 61.90  ? 74   ASP A O   1 
ATOM   568  C CB  . ASP A 1 74  ? 32.156  27.188  14.696  1.00 59.58  ? 74   ASP A CB  1 
ATOM   569  C CG  . ASP A 1 74  ? 31.649  27.395  13.291  1.00 71.66  ? 74   ASP A CG  1 
ATOM   570  O OD1 . ASP A 1 74  ? 31.979  26.551  12.424  1.00 72.58  ? 74   ASP A OD1 1 
ATOM   571  O OD2 . ASP A 1 74  ? 30.943  28.408  13.054  1.00 72.71  ? 74   ASP A OD2 1 
ATOM   572  N N   . THR A 1 75  ? 33.898  29.799  13.695  1.00 63.89  ? 75   THR A N   1 
ATOM   573  C CA  . THR A 1 75  ? 34.012  31.242  13.509  1.00 67.94  ? 75   THR A CA  1 
ATOM   574  C C   . THR A 1 75  ? 33.133  31.735  12.357  1.00 69.21  ? 75   THR A C   1 
ATOM   575  O O   . THR A 1 75  ? 33.048  32.932  12.104  1.00 70.14  ? 75   THR A O   1 
ATOM   576  C CB  . THR A 1 75  ? 35.473  31.644  13.218  1.00 72.19  ? 75   THR A CB  1 
ATOM   577  O OG1 . THR A 1 75  ? 35.962  30.905  12.087  1.00 73.02  ? 75   THR A OG1 1 
ATOM   578  C CG2 . THR A 1 75  ? 36.357  31.357  14.426  1.00 52.42  ? 75   THR A CG2 1 
ATOM   579  N N   . LEU A 1 76  ? 32.477  30.804  11.672  1.00 68.96  ? 76   LEU A N   1 
ATOM   580  C CA  . LEU A 1 76  ? 31.662  31.131  10.509  1.00 65.76  ? 76   LEU A CA  1 
ATOM   581  C C   . LEU A 1 76  ? 30.664  32.267  10.764  1.00 70.49  ? 76   LEU A C   1 
ATOM   582  O O   . LEU A 1 76  ? 30.545  33.176  9.951   1.00 71.57  ? 76   LEU A O   1 
ATOM   583  C CB  . LEU A 1 76  ? 30.927  29.888  10.001  1.00 62.81  ? 76   LEU A CB  1 
ATOM   584  C CG  . LEU A 1 76  ? 30.120  30.055  8.708   1.00 66.31  ? 76   LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 76  ? 31.033  30.318  7.533   1.00 59.39  ? 76   LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 76  ? 29.262  28.827  8.431   1.00 69.00  ? 76   LEU A CD2 1 
ATOM   587  N N   . TYR A 1 77  ? 29.947  32.214  11.883  1.00 66.83  ? 77   TYR A N   1 
ATOM   588  C CA  . TYR A 1 77  ? 28.927  33.218  12.172  1.00 61.49  ? 77   TYR A CA  1 
ATOM   589  C C   . TYR A 1 77  ? 28.935  33.634  13.637  1.00 66.81  ? 77   TYR A C   1 
ATOM   590  O O   . TYR A 1 77  ? 28.076  33.213  14.412  1.00 63.97  ? 77   TYR A O   1 
ATOM   591  C CB  . TYR A 1 77  ? 27.543  32.676  11.853  1.00 57.38  ? 77   TYR A CB  1 
ATOM   592  C CG  . TYR A 1 77  ? 27.257  32.432  10.402  1.00 59.06  ? 77   TYR A CG  1 
ATOM   593  C CD1 . TYR A 1 77  ? 27.085  33.485  9.525   1.00 59.34  ? 77   TYR A CD1 1 
ATOM   594  C CD2 . TYR A 1 77  ? 27.111  31.145  9.915   1.00 61.96  ? 77   TYR A CD2 1 
ATOM   595  C CE1 . TYR A 1 77  ? 26.801  33.267  8.196   1.00 58.22  ? 77   TYR A CE1 1 
ATOM   596  C CE2 . TYR A 1 77  ? 26.818  30.914  8.589   1.00 61.15  ? 77   TYR A CE2 1 
ATOM   597  C CZ  . TYR A 1 77  ? 26.667  31.979  7.733   1.00 62.58  ? 77   TYR A CZ  1 
ATOM   598  O OH  . TYR A 1 77  ? 26.374  31.753  6.408   1.00 66.03  ? 77   TYR A OH  1 
ATOM   599  N N   . PRO A 1 78  ? 29.902  34.470  14.021  1.00 70.91  ? 78   PRO A N   1 
ATOM   600  C CA  . PRO A 1 78  ? 30.065  34.959  15.396  1.00 67.12  ? 78   PRO A CA  1 
ATOM   601  C C   . PRO A 1 78  ? 28.756  35.355  16.077  1.00 62.11  ? 78   PRO A C   1 
ATOM   602  O O   . PRO A 1 78  ? 28.024  36.180  15.546  1.00 64.40  ? 78   PRO A O   1 
ATOM   603  C CB  . PRO A 1 78  ? 30.940  36.182  15.202  1.00 65.12  ? 78   PRO A CB  1 
ATOM   604  C CG  . PRO A 1 78  ? 31.823  35.779  14.050  1.00 71.85  ? 78   PRO A CG  1 
ATOM   605  C CD  . PRO A 1 78  ? 30.948  34.987  13.125  1.00 58.42  ? 78   PRO A CD  1 
ATOM   606  N N   . GLY A 1 79  ? 28.470  34.753  17.231  1.00 62.09  ? 79   GLY A N   1 
ATOM   607  C CA  . GLY A 1 79  ? 27.306  35.105  18.030  1.00 56.06  ? 79   GLY A CA  1 
ATOM   608  C C   . GLY A 1 79  ? 25.988  34.514  17.563  1.00 62.25  ? 79   GLY A C   1 
ATOM   609  O O   . GLY A 1 79  ? 24.968  34.624  18.243  1.00 59.10  ? 79   GLY A O   1 
ATOM   610  N N   . PHE A 1 80  ? 26.003  33.888  16.394  1.00 56.93  ? 80   PHE A N   1 
ATOM   611  C CA  . PHE A 1 80  ? 24.794  33.311  15.834  1.00 51.53  ? 80   PHE A CA  1 
ATOM   612  C C   . PHE A 1 80  ? 24.432  32.054  16.615  1.00 58.34  ? 80   PHE A C   1 
ATOM   613  O O   . PHE A 1 80  ? 25.232  31.127  16.727  1.00 59.84  ? 80   PHE A O   1 
ATOM   614  C CB  . PHE A 1 80  ? 24.999  33.017  14.343  1.00 51.12  ? 80   PHE A CB  1 
ATOM   615  C CG  . PHE A 1 80  ? 23.850  32.301  13.692  1.00 58.56  ? 80   PHE A CG  1 
ATOM   616  C CD1 . PHE A 1 80  ? 22.560  32.789  13.794  1.00 56.63  ? 80   PHE A CD1 1 
ATOM   617  C CD2 . PHE A 1 80  ? 24.069  31.149  12.950  1.00 56.32  ? 80   PHE A CD2 1 
ATOM   618  C CE1 . PHE A 1 80  ? 21.510  32.127  13.191  1.00 60.28  ? 80   PHE A CE1 1 
ATOM   619  C CE2 . PHE A 1 80  ? 23.025  30.488  12.340  1.00 54.09  ? 80   PHE A CE2 1 
ATOM   620  C CZ  . PHE A 1 80  ? 21.743  30.973  12.461  1.00 58.76  ? 80   PHE A CZ  1 
ATOM   621  N N   . GLU A 1 81  ? 23.229  32.038  17.172  1.00 56.61  ? 81   GLU A N   1 
ATOM   622  C CA  . GLU A 1 81  ? 22.784  30.930  18.007  1.00 61.00  ? 81   GLU A CA  1 
ATOM   623  C C   . GLU A 1 81  ? 22.961  29.590  17.298  1.00 59.88  ? 81   GLU A C   1 
ATOM   624  O O   . GLU A 1 81  ? 23.380  28.595  17.898  1.00 55.86  ? 81   GLU A O   1 
ATOM   625  C CB  . GLU A 1 81  ? 21.313  31.125  18.376  1.00 65.31  ? 81   GLU A CB  1 
ATOM   626  C CG  . GLU A 1 81  ? 20.734  30.041  19.266  1.00 72.95  ? 81   GLU A CG  1 
ATOM   627  C CD  . GLU A 1 81  ? 21.039  30.280  20.739  1.00 102.20 ? 81   GLU A CD  1 
ATOM   628  O OE1 . GLU A 1 81  ? 20.777  31.409  21.221  1.00 105.73 ? 81   GLU A OE1 1 
ATOM   629  O OE2 . GLU A 1 81  ? 21.538  29.344  21.413  1.00 96.97  ? 81   GLU A OE2 1 
ATOM   630  N N   . GLY A 1 82  ? 22.636  29.577  16.011  1.00 57.48  ? 82   GLY A N   1 
ATOM   631  C CA  . GLY A 1 82  ? 22.656  28.360  15.227  1.00 56.38  ? 82   GLY A CA  1 
ATOM   632  C C   . GLY A 1 82  ? 23.991  27.647  15.249  1.00 56.35  ? 82   GLY A C   1 
ATOM   633  O O   . GLY A 1 82  ? 24.020  26.422  15.216  1.00 55.24  ? 82   GLY A O   1 
ATOM   634  N N   . THR A 1 83  ? 25.087  28.403  15.286  1.00 47.56  ? 83   THR A N   1 
ATOM   635  C CA  . THR A 1 83  ? 26.412  27.804  15.385  1.00 54.41  ? 83   THR A CA  1 
ATOM   636  C C   . THR A 1 83  ? 26.906  27.741  16.837  1.00 58.76  ? 83   THR A C   1 
ATOM   637  O O   . THR A 1 83  ? 27.500  26.750  17.245  1.00 62.78  ? 83   THR A O   1 
ATOM   638  C CB  . THR A 1 83  ? 27.469  28.488  14.448  1.00 53.01  ? 83   THR A CB  1 
ATOM   639  O OG1 . THR A 1 83  ? 27.438  29.906  14.611  1.00 58.35  ? 83   THR A OG1 1 
ATOM   640  C CG2 . THR A 1 83  ? 27.183  28.177  13.003  1.00 53.37  ? 83   THR A CG2 1 
ATOM   641  N N   . GLU A 1 84  ? 26.630  28.778  17.620  1.00 56.35  ? 84   GLU A N   1 
ATOM   642  C CA  . GLU A 1 84  ? 27.124  28.854  18.991  1.00 50.68  ? 84   GLU A CA  1 
ATOM   643  C C   . GLU A 1 84  ? 26.621  27.737  19.896  1.00 51.75  ? 84   GLU A C   1 
ATOM   644  O O   . GLU A 1 84  ? 27.290  27.354  20.855  1.00 51.11  ? 84   GLU A O   1 
ATOM   645  C CB  . GLU A 1 84  ? 26.789  30.211  19.615  1.00 57.99  ? 84   GLU A CB  1 
ATOM   646  C CG  . GLU A 1 84  ? 27.438  31.411  18.919  1.00 68.27  ? 84   GLU A CG  1 
ATOM   647  C CD  . GLU A 1 84  ? 28.964  31.390  18.962  1.00 71.12  ? 84   GLU A CD  1 
ATOM   648  O OE1 . GLU A 1 84  ? 29.536  30.540  19.689  1.00 70.08  ? 84   GLU A OE1 1 
ATOM   649  O OE2 . GLU A 1 84  ? 29.591  32.229  18.267  1.00 70.08  ? 84   GLU A OE2 1 
ATOM   650  N N   . MET A 1 85  ? 25.438  27.218  19.606  1.00 56.71  ? 85   MET A N   1 
ATOM   651  C CA  . MET A 1 85  ? 24.881  26.148  20.425  1.00 56.65  ? 85   MET A CA  1 
ATOM   652  C C   . MET A 1 85  ? 25.750  24.887  20.344  1.00 53.28  ? 85   MET A C   1 
ATOM   653  O O   . MET A 1 85  ? 25.683  24.017  21.208  1.00 51.38  ? 85   MET A O   1 
ATOM   654  C CB  . MET A 1 85  ? 23.458  25.825  19.981  1.00 53.67  ? 85   MET A CB  1 
ATOM   655  C CG  . MET A 1 85  ? 23.407  25.187  18.607  1.00 53.67  ? 85   MET A CG  1 
ATOM   656  S SD  . MET A 1 85  ? 21.743  25.032  17.947  1.00 71.39  ? 85   MET A SD  1 
ATOM   657  C CE  . MET A 1 85  ? 21.037  23.825  19.065  1.00 52.20  ? 85   MET A CE  1 
ATOM   658  N N   . TRP A 1 86  ? 26.568  24.783  19.305  1.00 45.04  ? 86   TRP A N   1 
ATOM   659  C CA  . TRP A 1 86  ? 27.430  23.622  19.178  1.00 46.80  ? 86   TRP A CA  1 
ATOM   660  C C   . TRP A 1 86  ? 28.853  23.908  19.676  1.00 54.29  ? 86   TRP A C   1 
ATOM   661  O O   . TRP A 1 86  ? 29.656  22.995  19.842  1.00 41.64  ? 86   TRP A O   1 
ATOM   662  C CB  . TRP A 1 86  ? 27.451  23.135  17.737  1.00 41.52  ? 86   TRP A CB  1 
ATOM   663  C CG  . TRP A 1 86  ? 26.085  22.913  17.167  1.00 54.16  ? 86   TRP A CG  1 
ATOM   664  C CD1 . TRP A 1 86  ? 25.463  23.670  16.224  1.00 50.96  ? 86   TRP A CD1 1 
ATOM   665  C CD2 . TRP A 1 86  ? 25.166  21.862  17.507  1.00 49.19  ? 86   TRP A CD2 1 
ATOM   666  N NE1 . TRP A 1 86  ? 24.224  23.153  15.946  1.00 47.19  ? 86   TRP A NE1 1 
ATOM   667  C CE2 . TRP A 1 86  ? 24.019  22.041  16.719  1.00 47.22  ? 86   TRP A CE2 1 
ATOM   668  C CE3 . TRP A 1 86  ? 25.212  20.779  18.390  1.00 49.45  ? 86   TRP A CE3 1 
ATOM   669  C CZ2 . TRP A 1 86  ? 22.922  21.182  16.790  1.00 52.21  ? 86   TRP A CZ2 1 
ATOM   670  C CZ3 . TRP A 1 86  ? 24.121  19.926  18.460  1.00 47.17  ? 86   TRP A CZ3 1 
ATOM   671  C CH2 . TRP A 1 86  ? 22.993  20.135  17.671  1.00 46.47  ? 86   TRP A CH2 1 
ATOM   672  N N   . ASN A 1 87  ? 29.158  25.179  19.916  1.00 47.19  ? 87   ASN A N   1 
ATOM   673  C CA  . ASN A 1 87  ? 30.488  25.554  20.342  1.00 47.41  ? 87   ASN A CA  1 
ATOM   674  C C   . ASN A 1 87  ? 30.776  25.132  21.771  1.00 51.45  ? 87   ASN A C   1 
ATOM   675  O O   . ASN A 1 87  ? 29.859  24.995  22.572  1.00 47.94  ? 87   ASN A O   1 
ATOM   676  C CB  . ASN A 1 87  ? 30.689  27.055  20.175  1.00 51.15  ? 87   ASN A CB  1 
ATOM   677  C CG  . ASN A 1 87  ? 31.169  27.417  18.783  1.00 58.89  ? 87   ASN A CG  1 
ATOM   678  O OD1 . ASN A 1 87  ? 31.664  26.567  18.035  1.00 52.37  ? 87   ASN A OD1 1 
ATOM   679  N ND2 . ASN A 1 87  ? 31.028  28.682  18.429  1.00 57.21  ? 87   ASN A ND2 1 
ATOM   680  N N   . PRO A 1 88  ? 32.058  24.918  22.093  1.00 49.31  ? 88   PRO A N   1 
ATOM   681  C CA  . PRO A 1 88  ? 32.450  24.553  23.460  1.00 44.61  ? 88   PRO A CA  1 
ATOM   682  C C   . PRO A 1 88  ? 31.875  25.531  24.480  1.00 49.57  ? 88   PRO A C   1 
ATOM   683  O O   . PRO A 1 88  ? 31.792  26.730  24.207  1.00 50.32  ? 88   PRO A O   1 
ATOM   684  C CB  . PRO A 1 88  ? 33.981  24.642  23.422  1.00 42.57  ? 88   PRO A CB  1 
ATOM   685  C CG  . PRO A 1 88  ? 34.334  24.381  21.992  1.00 46.08  ? 88   PRO A CG  1 
ATOM   686  C CD  . PRO A 1 88  ? 33.208  24.965  21.171  1.00 45.79  ? 88   PRO A CD  1 
ATOM   687  N N   . ASN A 1 89  ? 31.466  25.020  25.639  1.00 53.52  ? 89   ASN A N   1 
ATOM   688  C CA  . ASN A 1 89  ? 30.826  25.852  26.655  1.00 41.97  ? 89   ASN A CA  1 
ATOM   689  C C   . ASN A 1 89  ? 31.552  25.738  27.985  1.00 48.92  ? 89   ASN A C   1 
ATOM   690  O O   . ASN A 1 89  ? 31.021  26.094  29.037  1.00 47.40  ? 89   ASN A O   1 
ATOM   691  C CB  . ASN A 1 89  ? 29.330  25.545  26.780  1.00 40.21  ? 89   ASN A CB  1 
ATOM   692  C CG  . ASN A 1 89  ? 29.043  24.160  27.342  1.00 50.43  ? 89   ASN A CG  1 
ATOM   693  O OD1 . ASN A 1 89  ? 29.879  23.259  27.286  1.00 44.05  ? 89   ASN A OD1 1 
ATOM   694  N ND2 . ASN A 1 89  ? 27.842  23.990  27.894  1.00 46.71  ? 89   ASN A ND2 1 
ATOM   695  N N   . ARG A 1 90  ? 32.772  25.212  27.907  1.00 47.17  ? 90   ARG A N   1 
ATOM   696  C CA  A ARG A 1 90  ? 33.683  25.134  29.044  0.50 48.31  ? 90   ARG A CA  1 
ATOM   697  C CA  B ARG A 1 90  ? 33.685  25.202  29.039  0.50 48.50  ? 90   ARG A CA  1 
ATOM   698  C C   . ARG A 1 90  ? 35.113  25.339  28.547  1.00 44.38  ? 90   ARG A C   1 
ATOM   699  O O   . ARG A 1 90  ? 35.366  25.316  27.353  1.00 47.73  ? 90   ARG A O   1 
ATOM   700  C CB  A ARG A 1 90  ? 33.557  23.782  29.760  0.50 48.53  ? 90   ARG A CB  1 
ATOM   701  C CB  B ARG A 1 90  ? 33.498  23.941  29.879  0.50 48.70  ? 90   ARG A CB  1 
ATOM   702  C CG  A ARG A 1 90  ? 32.225  23.555  30.482  0.50 45.93  ? 90   ARG A CG  1 
ATOM   703  C CG  B ARG A 1 90  ? 32.110  23.868  30.473  0.50 46.38  ? 90   ARG A CG  1 
ATOM   704  C CD  A ARG A 1 90  ? 32.041  24.498  31.674  0.50 46.38  ? 90   ARG A CD  1 
ATOM   705  C CD  B ARG A 1 90  ? 31.993  22.856  31.563  0.50 47.76  ? 90   ARG A CD  1 
ATOM   706  N NE  A ARG A 1 90  ? 30.758  24.283  32.337  0.50 52.04  ? 90   ARG A NE  1 
ATOM   707  N NE  B ARG A 1 90  ? 32.573  23.269  32.839  0.50 50.86  ? 90   ARG A NE  1 
ATOM   708  C CZ  A ARG A 1 90  ? 29.689  25.069  32.199  0.50 58.86  ? 90   ARG A CZ  1 
ATOM   709  C CZ  B ARG A 1 90  ? 32.278  24.386  33.493  0.50 46.77  ? 90   ARG A CZ  1 
ATOM   710  N NH1 A ARG A 1 90  ? 29.744  26.147  31.425  0.50 58.20  ? 90   ARG A NH1 1 
ATOM   711  N NH1 B ARG A 1 90  ? 31.436  25.268  32.978  0.50 47.24  ? 90   ARG A NH1 1 
ATOM   712  N NH2 A ARG A 1 90  ? 28.562  24.780  32.841  0.50 53.50  ? 90   ARG A NH2 1 
ATOM   713  N NH2 B ARG A 1 90  ? 32.856  24.629  34.659  0.50 45.75  ? 90   ARG A NH2 1 
ATOM   714  N N   . GLU A 1 91  ? 36.042  25.531  29.466  1.00 48.85  ? 91   GLU A N   1 
ATOM   715  C CA  . GLU A 1 91  ? 37.438  25.687  29.093  1.00 45.65  ? 91   GLU A CA  1 
ATOM   716  C C   . GLU A 1 91  ? 37.910  24.513  28.234  1.00 49.32  ? 91   GLU A C   1 
ATOM   717  O O   . GLU A 1 91  ? 37.598  23.347  28.525  1.00 44.55  ? 91   GLU A O   1 
ATOM   718  C CB  . GLU A 1 91  ? 38.296  25.760  30.354  1.00 49.79  ? 91   GLU A CB  1 
ATOM   719  C CG  . GLU A 1 91  ? 39.782  25.942  30.091  1.00 61.66  ? 91   GLU A CG  1 
ATOM   720  C CD  . GLU A 1 91  ? 40.633  25.739  31.344  1.00 71.23  ? 91   GLU A CD  1 
ATOM   721  O OE1 . GLU A 1 91  ? 40.083  25.828  32.471  1.00 64.30  ? 91   GLU A OE1 1 
ATOM   722  O OE2 . GLU A 1 91  ? 41.853  25.479  31.197  1.00 70.25  ? 91   GLU A OE2 1 
ATOM   723  N N   . LEU A 1 92  ? 38.660  24.821  27.179  1.00 42.86  ? 92   LEU A N   1 
ATOM   724  C CA  . LEU A 1 92  ? 39.300  23.785  26.372  1.00 46.99  ? 92   LEU A CA  1 
ATOM   725  C C   . LEU A 1 92  ? 40.525  23.205  27.092  1.00 43.54  ? 92   LEU A C   1 
ATOM   726  O O   . LEU A 1 92  ? 41.289  23.916  27.711  1.00 49.08  ? 92   LEU A O   1 
ATOM   727  C CB  . LEU A 1 92  ? 39.701  24.332  25.001  1.00 42.31  ? 92   LEU A CB  1 
ATOM   728  C CG  . LEU A 1 92  ? 38.604  24.810  24.047  1.00 40.30  ? 92   LEU A CG  1 
ATOM   729  C CD1 . LEU A 1 92  ? 39.206  25.277  22.733  1.00 45.50  ? 92   LEU A CD1 1 
ATOM   730  C CD2 . LEU A 1 92  ? 37.627  23.702  23.782  1.00 42.63  ? 92   LEU A CD2 1 
ATOM   731  N N   . SER A 1 93  ? 40.699  21.898  27.025  1.00 51.00  ? 93   SER A N   1 
ATOM   732  C CA  . SER A 1 93  ? 41.832  21.281  27.686  1.00 45.53  ? 93   SER A CA  1 
ATOM   733  C C   . SER A 1 93  ? 42.083  19.873  27.166  1.00 51.47  ? 93   SER A C   1 
ATOM   734  O O   . SER A 1 93  ? 41.163  19.180  26.731  1.00 49.33  ? 93   SER A O   1 
ATOM   735  C CB  . SER A 1 93  ? 41.632  21.267  29.204  1.00 48.63  ? 93   SER A CB  1 
ATOM   736  O OG  . SER A 1 93  ? 42.689  20.570  29.848  1.00 49.02  ? 93   SER A OG  1 
ATOM   737  N N   . GLU A 1 94  ? 43.340  19.457  27.195  1.00 52.58  ? 94   GLU A N   1 
ATOM   738  C CA  . GLU A 1 94  ? 43.668  18.104  26.808  1.00 45.99  ? 94   GLU A CA  1 
ATOM   739  C C   . GLU A 1 94  ? 43.269  17.171  27.934  1.00 50.95  ? 94   GLU A C   1 
ATOM   740  O O   . GLU A 1 94  ? 43.069  15.972  27.718  1.00 53.14  ? 94   GLU A O   1 
ATOM   741  C CB  . GLU A 1 94  ? 45.151  17.981  26.494  1.00 50.11  ? 94   GLU A CB  1 
ATOM   742  C CG  . GLU A 1 94  ? 45.494  18.292  25.060  1.00 49.87  ? 94   GLU A CG  1 
ATOM   743  C CD  . GLU A 1 94  ? 46.976  18.118  24.778  1.00 58.93  ? 94   GLU A CD  1 
ATOM   744  O OE1 . GLU A 1 94  ? 47.382  17.054  24.245  1.00 55.28  ? 94   GLU A OE1 1 
ATOM   745  O OE2 . GLU A 1 94  ? 47.739  19.046  25.110  1.00 66.48  ? 94   GLU A OE2 1 
ATOM   746  N N   . ASP A 1 95  ? 43.163  17.736  29.137  1.00 48.23  ? 95   ASP A N   1 
ATOM   747  C CA  . ASP A 1 95  ? 42.628  17.022  30.295  1.00 51.11  ? 95   ASP A CA  1 
ATOM   748  C C   . ASP A 1 95  ? 41.123  17.222  30.272  1.00 50.94  ? 95   ASP A C   1 
ATOM   749  O O   . ASP A 1 95  ? 40.622  18.250  30.726  1.00 49.63  ? 95   ASP A O   1 
ATOM   750  C CB  . ASP A 1 95  ? 43.229  17.575  31.597  1.00 46.75  ? 95   ASP A CB  1 
ATOM   751  C CG  . ASP A 1 95  ? 42.617  16.960  32.850  1.00 52.38  ? 95   ASP A CG  1 
ATOM   752  O OD1 . ASP A 1 95  ? 41.850  15.981  32.754  1.00 57.05  ? 95   ASP A OD1 1 
ATOM   753  O OD2 . ASP A 1 95  ? 42.914  17.460  33.951  1.00 57.42  ? 95   ASP A OD2 1 
ATOM   754  N N   . CYS A 1 96  ? 40.413  16.224  29.749  1.00 48.62  ? 96   CYS A N   1 
ATOM   755  C CA  . CYS A 1 96  ? 39.017  16.379  29.375  1.00 40.95  ? 96   CYS A CA  1 
ATOM   756  C C   . CYS A 1 96  ? 38.231  15.066  29.445  1.00 44.53  ? 96   CYS A C   1 
ATOM   757  O O   . CYS A 1 96  ? 37.054  15.033  29.114  1.00 44.84  ? 96   CYS A O   1 
ATOM   758  C CB  . CYS A 1 96  ? 38.943  16.927  27.946  1.00 46.18  ? 96   CYS A CB  1 
ATOM   759  S SG  . CYS A 1 96  ? 39.591  15.767  26.640  1.00 51.77  ? 96   CYS A SG  1 
ATOM   760  N N   . LEU A 1 97  ? 38.872  13.978  29.852  1.00 48.05  ? 97   LEU A N   1 
ATOM   761  C CA  . LEU A 1 97  ? 38.181  12.690  29.912  1.00 43.20  ? 97   LEU A CA  1 
ATOM   762  C C   . LEU A 1 97  ? 37.279  12.551  31.162  1.00 46.04  ? 97   LEU A C   1 
ATOM   763  O O   . LEU A 1 97  ? 37.661  11.980  32.183  1.00 52.31  ? 97   LEU A O   1 
ATOM   764  C CB  . LEU A 1 97  ? 39.178  11.530  29.779  1.00 44.82  ? 97   LEU A CB  1 
ATOM   765  C CG  . LEU A 1 97  ? 39.988  11.590  28.480  1.00 51.30  ? 97   LEU A CG  1 
ATOM   766  C CD1 . LEU A 1 97  ? 40.919  10.378  28.278  1.00 43.47  ? 97   LEU A CD1 1 
ATOM   767  C CD2 . LEU A 1 97  ? 39.036  11.748  27.305  1.00 45.47  ? 97   LEU A CD2 1 
ATOM   768  N N   . TYR A 1 98  ? 36.074  13.090  31.076  1.00 38.67  ? 98   TYR A N   1 
ATOM   769  C CA  . TYR A 1 98  ? 35.161  13.042  32.199  1.00 40.84  ? 98   TYR A CA  1 
ATOM   770  C C   . TYR A 1 98  ? 33.837  12.611  31.635  1.00 37.47  ? 98   TYR A C   1 
ATOM   771  O O   . TYR A 1 98  ? 33.586  12.822  30.464  1.00 39.18  ? 98   TYR A O   1 
ATOM   772  C CB  . TYR A 1 98  ? 35.059  14.418  32.901  1.00 47.01  ? 98   TYR A CB  1 
ATOM   773  C CG  . TYR A 1 98  ? 36.400  14.933  33.421  1.00 53.28  ? 98   TYR A CG  1 
ATOM   774  C CD1 . TYR A 1 98  ? 36.778  14.756  34.759  1.00 50.36  ? 98   TYR A CD1 1 
ATOM   775  C CD2 . TYR A 1 98  ? 37.297  15.565  32.569  1.00 46.22  ? 98   TYR A CD2 1 
ATOM   776  C CE1 . TYR A 1 98  ? 38.004  15.206  35.219  1.00 46.34  ? 98   TYR A CE1 1 
ATOM   777  C CE2 . TYR A 1 98  ? 38.523  16.017  33.025  1.00 50.95  ? 98   TYR A CE2 1 
ATOM   778  C CZ  . TYR A 1 98  ? 38.874  15.836  34.342  1.00 49.11  ? 98   TYR A CZ  1 
ATOM   779  O OH  . TYR A 1 98  ? 40.104  16.286  34.770  1.00 49.45  ? 98   TYR A OH  1 
ATOM   780  N N   . LEU A 1 99  ? 33.007  11.969  32.446  1.00 43.11  ? 99   LEU A N   1 
ATOM   781  C CA  . LEU A 1 99  ? 31.653  11.659  32.020  1.00 46.89  ? 99   LEU A CA  1 
ATOM   782  C C   . LEU A 1 99  ? 30.634  12.244  32.996  1.00 47.76  ? 99   LEU A C   1 
ATOM   783  O O   . LEU A 1 99  ? 30.989  12.699  34.088  1.00 45.15  ? 99   LEU A O   1 
ATOM   784  C CB  . LEU A 1 99  ? 31.462  10.142  31.823  1.00 42.19  ? 99   LEU A CB  1 
ATOM   785  C CG  . LEU A 1 99  ? 31.904  9.190   32.935  1.00 44.45  ? 99   LEU A CG  1 
ATOM   786  C CD1 . LEU A 1 99  ? 30.807  9.075   33.973  1.00 41.28  ? 99   LEU A CD1 1 
ATOM   787  C CD2 . LEU A 1 99  ? 32.253  7.819   32.381  1.00 36.12  ? 99   LEU A CD2 1 
ATOM   788  N N   . ASN A 1 100 ? 29.369  12.227  32.591  1.00 39.57  ? 100  ASN A N   1 
ATOM   789  C CA  . ASN A 1 100 ? 28.293  12.778  33.397  1.00 42.53  ? 100  ASN A CA  1 
ATOM   790  C C   . ASN A 1 100 ? 27.180  11.764  33.552  1.00 42.64  ? 100  ASN A C   1 
ATOM   791  O O   . ASN A 1 100 ? 26.908  10.990  32.634  1.00 45.42  ? 100  ASN A O   1 
ATOM   792  C CB  . ASN A 1 100 ? 27.735  14.040  32.740  1.00 45.19  ? 100  ASN A CB  1 
ATOM   793  C CG  . ASN A 1 100 ? 28.827  14.955  32.215  1.00 44.38  ? 100  ASN A CG  1 
ATOM   794  O OD1 . ASN A 1 100 ? 29.549  15.582  32.984  1.00 41.30  ? 100  ASN A OD1 1 
ATOM   795  N ND2 . ASN A 1 100 ? 28.947  15.035  30.898  1.00 41.43  ? 100  ASN A ND2 1 
ATOM   796  N N   . VAL A 1 101 ? 26.527  11.781  34.709  1.00 39.02  ? 101  VAL A N   1 
ATOM   797  C CA  . VAL A 1 101 ? 25.410  10.888  34.973  1.00 41.25  ? 101  VAL A CA  1 
ATOM   798  C C   . VAL A 1 101 ? 24.182  11.664  35.431  1.00 42.49  ? 101  VAL A C   1 
ATOM   799  O O   . VAL A 1 101 ? 24.269  12.513  36.319  1.00 41.80  ? 101  VAL A O   1 
ATOM   800  C CB  . VAL A 1 101 ? 25.771  9.867   36.060  1.00 42.76  ? 101  VAL A CB  1 
ATOM   801  C CG1 . VAL A 1 101 ? 24.572  8.996   36.377  1.00 40.34  ? 101  VAL A CG1 1 
ATOM   802  C CG2 . VAL A 1 101 ? 26.959  9.035   35.621  1.00 37.51  ? 101  VAL A CG2 1 
ATOM   803  N N   . TRP A 1 102 ? 23.039  11.381  34.822  1.00 41.08  ? 102  TRP A N   1 
ATOM   804  C CA  . TRP A 1 102 ? 21.777  11.919  35.317  1.00 44.27  ? 102  TRP A CA  1 
ATOM   805  C C   . TRP A 1 102 ? 20.892  10.758  35.719  1.00 48.26  ? 102  TRP A C   1 
ATOM   806  O O   . TRP A 1 102 ? 20.753  9.793   34.967  1.00 46.68  ? 102  TRP A O   1 
ATOM   807  C CB  . TRP A 1 102 ? 21.043  12.717  34.242  1.00 47.64  ? 102  TRP A CB  1 
ATOM   808  C CG  . TRP A 1 102 ? 21.614  14.055  33.908  1.00 50.45  ? 102  TRP A CG  1 
ATOM   809  C CD1 . TRP A 1 102 ? 21.281  15.259  34.471  1.00 52.70  ? 102  TRP A CD1 1 
ATOM   810  C CD2 . TRP A 1 102 ? 22.591  14.341  32.901  1.00 49.00  ? 102  TRP A CD2 1 
ATOM   811  N NE1 . TRP A 1 102 ? 22.003  16.272  33.885  1.00 54.22  ? 102  TRP A NE1 1 
ATOM   812  C CE2 . TRP A 1 102 ? 22.819  15.732  32.922  1.00 56.31  ? 102  TRP A CE2 1 
ATOM   813  C CE3 . TRP A 1 102 ? 23.306  13.556  31.995  1.00 47.62  ? 102  TRP A CE3 1 
ATOM   814  C CZ2 . TRP A 1 102 ? 23.724  16.351  32.059  1.00 52.10  ? 102  TRP A CZ2 1 
ATOM   815  C CZ3 . TRP A 1 102 ? 24.207  14.176  31.144  1.00 44.90  ? 102  TRP A CZ3 1 
ATOM   816  C CH2 . TRP A 1 102 ? 24.405  15.557  31.183  1.00 43.02  ? 102  TRP A CH2 1 
ATOM   817  N N   . THR A 1 103 ? 20.276  10.862  36.891  1.00 46.57  ? 103  THR A N   1 
ATOM   818  C CA  . THR A 1 103 ? 19.349  9.841   37.375  1.00 53.00  ? 103  THR A CA  1 
ATOM   819  C C   . THR A 1 103 ? 18.170  10.527  38.030  1.00 55.03  ? 103  THR A C   1 
ATOM   820  O O   . THR A 1 103 ? 18.255  11.703  38.395  1.00 53.13  ? 103  THR A O   1 
ATOM   821  C CB  . THR A 1 103 ? 19.995  8.929   38.445  1.00 55.63  ? 103  THR A CB  1 
ATOM   822  O OG1 . THR A 1 103 ? 20.226  9.686   39.641  1.00 58.98  ? 103  THR A OG1 1 
ATOM   823  C CG2 . THR A 1 103 ? 21.318  8.368   37.957  1.00 53.16  ? 103  THR A CG2 1 
ATOM   824  N N   . PRO A 1 104 ? 17.065  9.796   38.192  1.00 49.79  ? 104  PRO A N   1 
ATOM   825  C CA  . PRO A 1 104 ? 15.932  10.322  38.956  1.00 57.73  ? 104  PRO A CA  1 
ATOM   826  C C   . PRO A 1 104 ? 16.369  10.718  40.357  1.00 57.74  ? 104  PRO A C   1 
ATOM   827  O O   . PRO A 1 104 ? 17.474  10.359  40.772  1.00 58.67  ? 104  PRO A O   1 
ATOM   828  C CB  . PRO A 1 104 ? 14.978  9.140   39.015  1.00 51.92  ? 104  PRO A CB  1 
ATOM   829  C CG  . PRO A 1 104 ? 15.285  8.375   37.763  1.00 55.14  ? 104  PRO A CG  1 
ATOM   830  C CD  . PRO A 1 104 ? 16.766  8.493   37.582  1.00 51.06  ? 104  PRO A CD  1 
ATOM   831  N N   . TYR A 1 105 ? 15.527  11.474  41.056  1.00 59.01  ? 105  TYR A N   1 
ATOM   832  C CA  . TYR A 1 105 ? 15.818  11.904  42.422  1.00 59.90  ? 105  TYR A CA  1 
ATOM   833  C C   . TYR A 1 105 ? 14.612  11.688  43.328  1.00 64.43  ? 105  TYR A C   1 
ATOM   834  O O   . TYR A 1 105 ? 13.539  12.239  43.086  1.00 70.06  ? 105  TYR A O   1 
ATOM   835  C CB  . TYR A 1 105 ? 16.213  13.374  42.444  1.00 54.39  ? 105  TYR A CB  1 
ATOM   836  C CG  . TYR A 1 105 ? 16.604  13.899  43.814  1.00 57.95  ? 105  TYR A CG  1 
ATOM   837  C CD1 . TYR A 1 105 ? 17.930  14.181  44.119  1.00 52.34  ? 105  TYR A CD1 1 
ATOM   838  C CD2 . TYR A 1 105 ? 15.647  14.129  44.793  1.00 54.62  ? 105  TYR A CD2 1 
ATOM   839  C CE1 . TYR A 1 105 ? 18.290  14.669  45.351  1.00 55.50  ? 105  TYR A CE1 1 
ATOM   840  C CE2 . TYR A 1 105 ? 16.000  14.622  46.029  1.00 51.94  ? 105  TYR A CE2 1 
ATOM   841  C CZ  . TYR A 1 105 ? 17.320  14.892  46.305  1.00 56.92  ? 105  TYR A CZ  1 
ATOM   842  O OH  . TYR A 1 105 ? 17.678  15.375  47.543  1.00 50.00  ? 105  TYR A OH  1 
ATOM   843  N N   . PRO A 1 106 ? 14.787  10.890  44.385  1.00 65.99  ? 106  PRO A N   1 
ATOM   844  C CA  . PRO A 1 106 ? 16.055  10.225  44.692  1.00 69.49  ? 106  PRO A CA  1 
ATOM   845  C C   . PRO A 1 106 ? 16.275  9.096   43.708  1.00 64.90  ? 106  PRO A C   1 
ATOM   846  O O   . PRO A 1 106 ? 15.349  8.738   42.969  1.00 60.12  ? 106  PRO A O   1 
ATOM   847  C CB  . PRO A 1 106 ? 15.791  9.629   46.074  1.00 75.11  ? 106  PRO A CB  1 
ATOM   848  C CG  . PRO A 1 106 ? 14.306  9.339   46.025  1.00 58.08  ? 106  PRO A CG  1 
ATOM   849  C CD  . PRO A 1 106 ? 13.760  10.579  45.395  1.00 57.11  ? 106  PRO A CD  1 
ATOM   850  N N   . ARG A 1 107 ? 17.479  8.535   43.715  1.00 66.65  ? 107  ARG A N   1 
ATOM   851  C CA  . ARG A 1 107 ? 17.853  7.502   42.759  1.00 62.12  ? 107  ARG A CA  1 
ATOM   852  C C   . ARG A 1 107 ? 16.876  6.337   42.787  1.00 59.54  ? 107  ARG A C   1 
ATOM   853  O O   . ARG A 1 107 ? 16.313  6.025   43.825  1.00 77.41  ? 107  ARG A O   1 
ATOM   854  C CB  . ARG A 1 107 ? 19.284  7.051   43.025  1.00 60.01  ? 107  ARG A CB  1 
ATOM   855  C CG  . ARG A 1 107 ? 20.241  8.240   43.125  1.00 65.07  ? 107  ARG A CG  1 
ATOM   856  C CD  . ARG A 1 107 ? 21.684  7.795   43.157  1.00 63.77  ? 107  ARG A CD  1 
ATOM   857  N NE  . ARG A 1 107 ? 21.997  6.968   44.322  1.00 59.65  ? 107  ARG A NE  1 
ATOM   858  C CZ  . ARG A 1 107 ? 22.450  7.453   45.472  1.00 53.17  ? 107  ARG A CZ  1 
ATOM   859  N NH1 . ARG A 1 107 ? 22.632  8.755   45.614  1.00 62.27  ? 107  ARG A NH1 1 
ATOM   860  N NH2 . ARG A 1 107 ? 22.720  6.642   46.479  1.00 67.69  ? 107  ARG A NH2 1 
ATOM   861  N N   . PRO A 1 108 ? 16.661  5.704   41.628  1.00 69.74  ? 108  PRO A N   1 
ATOM   862  C CA  . PRO A 1 108 ? 15.674  4.638   41.394  1.00 75.22  ? 108  PRO A CA  1 
ATOM   863  C C   . PRO A 1 108 ? 15.777  3.409   42.313  1.00 77.21  ? 108  PRO A C   1 
ATOM   864  O O   . PRO A 1 108 ? 16.863  3.040   42.765  1.00 70.68  ? 108  PRO A O   1 
ATOM   865  C CB  . PRO A 1 108 ? 15.939  4.241   39.931  1.00 64.99  ? 108  PRO A CB  1 
ATOM   866  C CG  . PRO A 1 108 ? 17.309  4.788   39.627  1.00 65.73  ? 108  PRO A CG  1 
ATOM   867  C CD  . PRO A 1 108 ? 17.336  6.076   40.375  1.00 64.25  ? 108  PRO A CD  1 
ATOM   868  N N   . ALA A 1 109 ? 14.625  2.785   42.561  1.00 83.47  ? 109  ALA A N   1 
ATOM   869  C CA  . ALA A 1 109 ? 14.503  1.630   43.452  1.00 85.48  ? 109  ALA A CA  1 
ATOM   870  C C   . ALA A 1 109 ? 15.124  0.370   42.858  1.00 79.45  ? 109  ALA A C   1 
ATOM   871  O O   . ALA A 1 109 ? 16.080  -0.182  43.401  1.00 74.77  ? 109  ALA A O   1 
ATOM   872  C CB  . ALA A 1 109 ? 13.033  1.382   43.775  1.00 84.36  ? 109  ALA A CB  1 
ATOM   873  N N   . SER A 1 110 ? 14.559  -0.088  41.748  1.00 75.63  ? 110  SER A N   1 
ATOM   874  C CA  . SER A 1 110 ? 15.100  -1.232  41.032  1.00 78.82  ? 110  SER A CA  1 
ATOM   875  C C   . SER A 1 110 ? 16.066  -0.732  39.968  1.00 80.01  ? 110  SER A C   1 
ATOM   876  O O   . SER A 1 110 ? 16.071  0.458   39.654  1.00 77.77  ? 110  SER A O   1 
ATOM   877  C CB  . SER A 1 110 ? 13.967  -2.022  40.382  1.00 78.35  ? 110  SER A CB  1 
ATOM   878  O OG  . SER A 1 110 ? 13.103  -1.151  39.675  1.00 87.46  ? 110  SER A OG  1 
ATOM   879  N N   . PRO A 1 111 ? 16.885  -1.636  39.405  1.00 76.57  ? 111  PRO A N   1 
ATOM   880  C CA  . PRO A 1 111 ? 17.875  -1.272  38.382  1.00 72.92  ? 111  PRO A CA  1 
ATOM   881  C C   . PRO A 1 111 ? 17.237  -0.734  37.099  1.00 71.96  ? 111  PRO A C   1 
ATOM   882  O O   . PRO A 1 111 ? 16.472  -1.435  36.431  1.00 69.34  ? 111  PRO A O   1 
ATOM   883  C CB  . PRO A 1 111 ? 18.595  -2.596  38.105  1.00 69.55  ? 111  PRO A CB  1 
ATOM   884  C CG  . PRO A 1 111 ? 18.351  -3.419  39.314  1.00 64.46  ? 111  PRO A CG  1 
ATOM   885  C CD  . PRO A 1 111 ? 16.968  -3.062  39.750  1.00 68.33  ? 111  PRO A CD  1 
ATOM   886  N N   . THR A 1 112 ? 17.572  0.508   36.761  1.00 61.73  ? 112  THR A N   1 
ATOM   887  C CA  . THR A 1 112 ? 16.983  1.191   35.619  1.00 57.55  ? 112  THR A CA  1 
ATOM   888  C C   . THR A 1 112 ? 17.842  1.026   34.374  1.00 51.13  ? 112  THR A C   1 
ATOM   889  O O   . THR A 1 112 ? 19.063  1.081   34.457  1.00 52.93  ? 112  THR A O   1 
ATOM   890  C CB  . THR A 1 112 ? 16.853  2.685   35.927  1.00 64.07  ? 112  THR A CB  1 
ATOM   891  O OG1 . THR A 1 112 ? 16.316  2.835   37.244  1.00 70.38  ? 112  THR A OG1 1 
ATOM   892  C CG2 . THR A 1 112 ? 15.958  3.398   34.903  1.00 55.89  ? 112  THR A CG2 1 
ATOM   893  N N   . PRO A 1 113 ? 17.201  0.825   33.214  1.00 52.40  ? 113  PRO A N   1 
ATOM   894  C CA  . PRO A 1 113 ? 17.908  0.781   31.927  1.00 55.47  ? 113  PRO A CA  1 
ATOM   895  C C   . PRO A 1 113 ? 18.718  2.063   31.710  1.00 58.99  ? 113  PRO A C   1 
ATOM   896  O O   . PRO A 1 113 ? 18.263  3.165   32.060  1.00 49.19  ? 113  PRO A O   1 
ATOM   897  C CB  . PRO A 1 113 ? 16.773  0.705   30.903  1.00 56.61  ? 113  PRO A CB  1 
ATOM   898  C CG  . PRO A 1 113 ? 15.616  0.156   31.652  1.00 58.98  ? 113  PRO A CG  1 
ATOM   899  C CD  . PRO A 1 113 ? 15.749  0.655   33.057  1.00 53.97  ? 113  PRO A CD  1 
ATOM   900  N N   . VAL A 1 114 ? 19.905  1.910   31.129  1.00 50.92  ? 114  VAL A N   1 
ATOM   901  C CA  . VAL A 1 114 ? 20.851  3.008   30.996  1.00 47.01  ? 114  VAL A CA  1 
ATOM   902  C C   . VAL A 1 114 ? 20.988  3.501   29.556  1.00 47.43  ? 114  VAL A C   1 
ATOM   903  O O   . VAL A 1 114 ? 21.187  2.709   28.643  1.00 53.47  ? 114  VAL A O   1 
ATOM   904  C CB  . VAL A 1 114 ? 22.226  2.560   31.484  1.00 52.08  ? 114  VAL A CB  1 
ATOM   905  C CG1 . VAL A 1 114 ? 23.226  3.704   31.419  1.00 46.36  ? 114  VAL A CG1 1 
ATOM   906  C CG2 . VAL A 1 114 ? 22.116  1.995   32.896  1.00 50.99  ? 114  VAL A CG2 1 
ATOM   907  N N   . LEU A 1 115 ? 20.884  4.807   29.348  1.00 48.99  ? 115  LEU A N   1 
ATOM   908  C CA  . LEU A 1 115 ? 21.143  5.377   28.027  1.00 49.64  ? 115  LEU A CA  1 
ATOM   909  C C   . LEU A 1 115 ? 22.525  5.983   28.023  1.00 44.24  ? 115  LEU A C   1 
ATOM   910  O O   . LEU A 1 115 ? 22.902  6.649   28.982  1.00 50.01  ? 115  LEU A O   1 
ATOM   911  C CB  . LEU A 1 115 ? 20.125  6.457   27.686  1.00 41.85  ? 115  LEU A CB  1 
ATOM   912  C CG  . LEU A 1 115 ? 18.739  5.904   27.384  1.00 57.87  ? 115  LEU A CG  1 
ATOM   913  C CD1 . LEU A 1 115 ? 17.690  7.003   27.383  1.00 52.16  ? 115  LEU A CD1 1 
ATOM   914  C CD2 . LEU A 1 115 ? 18.797  5.213   26.047  1.00 65.39  ? 115  LEU A CD2 1 
ATOM   915  N N   . ILE A 1 116 ? 23.278  5.759   26.954  1.00 42.89  ? 116  ILE A N   1 
ATOM   916  C CA  . ILE A 1 116 ? 24.591  6.391   26.830  1.00 53.19  ? 116  ILE A CA  1 
ATOM   917  C C   . ILE A 1 116 ? 24.734  7.257   25.591  1.00 45.08  ? 116  ILE A C   1 
ATOM   918  O O   . ILE A 1 116 ? 24.765  6.747   24.470  1.00 41.62  ? 116  ILE A O   1 
ATOM   919  C CB  . ILE A 1 116 ? 25.714  5.363   26.828  1.00 47.04  ? 116  ILE A CB  1 
ATOM   920  C CG1 . ILE A 1 116 ? 25.666  4.562   28.128  1.00 46.61  ? 116  ILE A CG1 1 
ATOM   921  C CG2 . ILE A 1 116 ? 27.046  6.070   26.650  1.00 41.05  ? 116  ILE A CG2 1 
ATOM   922  C CD1 . ILE A 1 116 ? 26.755  3.540   28.241  1.00 47.62  ? 116  ILE A CD1 1 
ATOM   923  N N   . TRP A 1 117 ? 24.834  8.565   25.802  1.00 40.02  ? 117  TRP A N   1 
ATOM   924  C CA  . TRP A 1 117 ? 24.962  9.502   24.695  1.00 39.93  ? 117  TRP A CA  1 
ATOM   925  C C   . TRP A 1 117 ? 26.391  9.660   24.207  1.00 45.77  ? 117  TRP A C   1 
ATOM   926  O O   . TRP A 1 117 ? 27.320  9.778   25.001  1.00 50.43  ? 117  TRP A O   1 
ATOM   927  C CB  . TRP A 1 117 ? 24.431  10.868  25.094  1.00 48.68  ? 117  TRP A CB  1 
ATOM   928  C CG  . TRP A 1 117 ? 24.537  11.915  24.011  1.00 47.70  ? 117  TRP A CG  1 
ATOM   929  C CD1 . TRP A 1 117 ? 25.274  13.062  24.054  1.00 43.78  ? 117  TRP A CD1 1 
ATOM   930  C CD2 . TRP A 1 117 ? 23.870  11.915  22.741  1.00 42.24  ? 117  TRP A CD2 1 
ATOM   931  N NE1 . TRP A 1 117 ? 25.110  13.771  22.891  1.00 45.73  ? 117  TRP A NE1 1 
ATOM   932  C CE2 . TRP A 1 117 ? 24.254  13.088  22.068  1.00 43.49  ? 117  TRP A CE2 1 
ATOM   933  C CE3 . TRP A 1 117 ? 22.989  11.034  22.109  1.00 46.17  ? 117  TRP A CE3 1 
ATOM   934  C CZ2 . TRP A 1 117 ? 23.778  13.413  20.801  1.00 43.51  ? 117  TRP A CZ2 1 
ATOM   935  C CZ3 . TRP A 1 117 ? 22.524  11.353  20.836  1.00 47.75  ? 117  TRP A CZ3 1 
ATOM   936  C CH2 . TRP A 1 117 ? 22.915  12.535  20.202  1.00 45.29  ? 117  TRP A CH2 1 
ATOM   937  N N   . ILE A 1 118 ? 26.560  9.664   22.892  1.00 44.93  ? 118  ILE A N   1 
ATOM   938  C CA  . ILE A 1 118 ? 27.843  9.982   22.295  1.00 44.56  ? 118  ILE A CA  1 
ATOM   939  C C   . ILE A 1 118 ? 27.671  11.129  21.310  1.00 47.69  ? 118  ILE A C   1 
ATOM   940  O O   . ILE A 1 118 ? 27.089  10.952  20.230  1.00 45.70  ? 118  ILE A O   1 
ATOM   941  C CB  . ILE A 1 118 ? 28.423  8.804   21.540  1.00 40.80  ? 118  ILE A CB  1 
ATOM   942  C CG1 . ILE A 1 118 ? 28.515  7.584   22.444  1.00 39.90  ? 118  ILE A CG1 1 
ATOM   943  C CG2 . ILE A 1 118 ? 29.795  9.157   21.037  1.00 36.36  ? 118  ILE A CG2 1 
ATOM   944  C CD1 . ILE A 1 118 ? 29.095  6.404   21.729  1.00 38.37  ? 118  ILE A CD1 1 
ATOM   945  N N   . TYR A 1 119 ? 28.177  12.305  21.677  1.00 41.53  ? 119  TYR A N   1 
ATOM   946  C CA  . TYR A 1 119 ? 28.008  13.482  20.833  1.00 41.20  ? 119  TYR A CA  1 
ATOM   947  C C   . TYR A 1 119 ? 28.720  13.340  19.501  1.00 44.24  ? 119  TYR A C   1 
ATOM   948  O O   . TYR A 1 119 ? 29.699  12.599  19.384  1.00 39.28  ? 119  TYR A O   1 
ATOM   949  C CB  . TYR A 1 119 ? 28.487  14.736  21.541  1.00 39.07  ? 119  TYR A CB  1 
ATOM   950  C CG  . TYR A 1 119 ? 29.942  14.727  21.951  1.00 42.29  ? 119  TYR A CG  1 
ATOM   951  C CD1 . TYR A 1 119 ? 30.961  14.811  20.998  1.00 33.63  ? 119  TYR A CD1 1 
ATOM   952  C CD2 . TYR A 1 119 ? 30.295  14.675  23.297  1.00 33.65  ? 119  TYR A CD2 1 
ATOM   953  C CE1 . TYR A 1 119 ? 32.283  14.828  21.372  1.00 32.46  ? 119  TYR A CE1 1 
ATOM   954  C CE2 . TYR A 1 119 ? 31.605  14.690  23.681  1.00 35.67  ? 119  TYR A CE2 1 
ATOM   955  C CZ  . TYR A 1 119 ? 32.603  14.766  22.723  1.00 39.99  ? 119  TYR A CZ  1 
ATOM   956  O OH  . TYR A 1 119 ? 33.920  14.774  23.138  1.00 39.64  ? 119  TYR A OH  1 
ATOM   957  N N   . GLY A 1 120 ? 28.207  14.045  18.499  1.00 40.54  ? 120  GLY A N   1 
ATOM   958  C CA  . GLY A 1 120 ? 28.832  14.086  17.192  1.00 43.01  ? 120  GLY A CA  1 
ATOM   959  C C   . GLY A 1 120 ? 29.544  15.405  16.987  1.00 52.96  ? 120  GLY A C   1 
ATOM   960  O O   . GLY A 1 120 ? 29.777  16.144  17.948  1.00 56.50  ? 120  GLY A O   1 
ATOM   961  N N   . GLY A 1 121 ? 29.881  15.718  15.740  1.00 53.69  ? 121  GLY A N   1 
ATOM   962  C CA  . GLY A 1 121 ? 30.694  16.886  15.457  1.00 38.83  ? 121  GLY A CA  1 
ATOM   963  C C   . GLY A 1 121 ? 31.917  16.515  14.635  1.00 47.82  ? 121  GLY A C   1 
ATOM   964  O O   . GLY A 1 121 ? 33.026  17.016  14.882  1.00 42.54  ? 121  GLY A O   1 
ATOM   965  N N   . GLY A 1 122 ? 31.718  15.622  13.666  1.00 37.37  ? 122  GLY A N   1 
ATOM   966  C CA  . GLY A 1 122 ? 32.747  15.309  12.683  1.00 40.64  ? 122  GLY A CA  1 
ATOM   967  C C   . GLY A 1 122 ? 34.049  14.715  13.202  1.00 47.91  ? 122  GLY A C   1 
ATOM   968  O O   . GLY A 1 122 ? 35.050  14.700  12.482  1.00 44.92  ? 122  GLY A O   1 
ATOM   969  N N   . PHE A 1 123 ? 34.039  14.218  14.439  1.00 40.92  ? 123  PHE A N   1 
ATOM   970  C CA  . PHE A 1 123 ? 35.266  13.757  15.091  1.00 40.13  ? 123  PHE A CA  1 
ATOM   971  C C   . PHE A 1 123 ? 36.298  14.880  15.347  1.00 46.35  ? 123  PHE A C   1 
ATOM   972  O O   . PHE A 1 123 ? 37.418  14.608  15.769  1.00 46.71  ? 123  PHE A O   1 
ATOM   973  C CB  . PHE A 1 123 ? 35.913  12.622  14.291  1.00 38.39  ? 123  PHE A CB  1 
ATOM   974  C CG  . PHE A 1 123 ? 35.075  11.378  14.212  1.00 40.25  ? 123  PHE A CG  1 
ATOM   975  C CD1 . PHE A 1 123 ? 34.893  10.574  15.324  1.00 35.88  ? 123  PHE A CD1 1 
ATOM   976  C CD2 . PHE A 1 123 ? 34.474  11.006  13.022  1.00 40.40  ? 123  PHE A CD2 1 
ATOM   977  C CE1 . PHE A 1 123 ? 34.118  9.438   15.247  1.00 37.46  ? 123  PHE A CE1 1 
ATOM   978  C CE2 . PHE A 1 123 ? 33.707  9.864   12.940  1.00 32.51  ? 123  PHE A CE2 1 
ATOM   979  C CZ  . PHE A 1 123 ? 33.525  9.083   14.047  1.00 37.81  ? 123  PHE A CZ  1 
ATOM   980  N N   . TYR A 1 124 ? 35.929  16.133  15.092  1.00 43.01  ? 124  TYR A N   1 
ATOM   981  C CA  . TYR A 1 124 ? 36.837  17.249  15.346  1.00 44.90  ? 124  TYR A CA  1 
ATOM   982  C C   . TYR A 1 124 ? 36.276  18.177  16.419  1.00 41.66  ? 124  TYR A C   1 
ATOM   983  O O   . TYR A 1 124 ? 36.923  19.120  16.844  1.00 45.25  ? 124  TYR A O   1 
ATOM   984  C CB  . TYR A 1 124 ? 37.120  18.044  14.060  1.00 42.59  ? 124  TYR A CB  1 
ATOM   985  C CG  . TYR A 1 124 ? 35.964  18.915  13.639  1.00 44.37  ? 124  TYR A CG  1 
ATOM   986  C CD1 . TYR A 1 124 ? 35.802  20.192  14.164  1.00 43.13  ? 124  TYR A CD1 1 
ATOM   987  C CD2 . TYR A 1 124 ? 35.026  18.461  12.729  1.00 45.77  ? 124  TYR A CD2 1 
ATOM   988  C CE1 . TYR A 1 124 ? 34.739  20.985  13.792  1.00 45.88  ? 124  TYR A CE1 1 
ATOM   989  C CE2 . TYR A 1 124 ? 33.952  19.248  12.359  1.00 49.29  ? 124  TYR A CE2 1 
ATOM   990  C CZ  . TYR A 1 124 ? 33.818  20.507  12.897  1.00 45.36  ? 124  TYR A CZ  1 
ATOM   991  O OH  . TYR A 1 124 ? 32.760  21.291  12.528  1.00 54.24  ? 124  TYR A OH  1 
ATOM   992  N N   . SER A 1 125 ? 35.060  17.916  16.855  1.00 43.01  ? 125  SER A N   1 
ATOM   993  C CA  . SER A 1 125 ? 34.440  18.807  17.821  1.00 44.57  ? 125  SER A CA  1 
ATOM   994  C C   . SER A 1 125 ? 33.415  18.042  18.631  1.00 41.46  ? 125  SER A C   1 
ATOM   995  O O   . SER A 1 125 ? 33.170  16.862  18.371  1.00 36.88  ? 125  SER A O   1 
ATOM   996  C CB  . SER A 1 125 ? 33.790  20.013  17.121  1.00 44.49  ? 125  SER A CB  1 
ATOM   997  O OG  . SER A 1 125 ? 32.791  19.616  16.189  1.00 43.38  ? 125  SER A OG  1 
ATOM   998  N N   . GLY A 1 126 ? 32.822  18.717  19.612  1.00 35.99  ? 126  GLY A N   1 
ATOM   999  C CA  . GLY A 1 126 ? 31.804  18.100  20.442  1.00 37.77  ? 126  GLY A CA  1 
ATOM   1000 C C   . GLY A 1 126 ? 32.138  18.178  21.916  1.00 39.87  ? 126  GLY A C   1 
ATOM   1001 O O   . GLY A 1 126 ? 33.284  18.406  22.305  1.00 44.50  ? 126  GLY A O   1 
ATOM   1002 N N   . ALA A 1 127 ? 31.121  17.984  22.737  1.00 35.90  ? 127  ALA A N   1 
ATOM   1003 C CA  . ALA A 1 127 ? 31.238  18.124  24.181  1.00 40.05  ? 127  ALA A CA  1 
ATOM   1004 C C   . ALA A 1 127 ? 29.939  17.575  24.765  1.00 47.39  ? 127  ALA A C   1 
ATOM   1005 O O   . ALA A 1 127 ? 28.870  17.735  24.166  1.00 44.80  ? 127  ALA A O   1 
ATOM   1006 C CB  . ALA A 1 127 ? 31.412  19.593  24.557  1.00 40.43  ? 127  ALA A CB  1 
ATOM   1007 N N   . ALA A 1 128 ? 30.018  16.916  25.915  1.00 40.65  ? 128  ALA A N   1 
ATOM   1008 C CA  . ALA A 1 128 ? 28.820  16.307  26.485  1.00 47.04  ? 128  ALA A CA  1 
ATOM   1009 C C   . ALA A 1 128 ? 28.140  17.291  27.426  1.00 44.40  ? 128  ALA A C   1 
ATOM   1010 O O   . ALA A 1 128 ? 27.112  16.978  28.034  1.00 53.35  ? 128  ALA A O   1 
ATOM   1011 C CB  . ALA A 1 128 ? 29.149  14.967  27.202  1.00 39.36  ? 128  ALA A CB  1 
ATOM   1012 N N   . SER A 1 129 ? 28.715  18.487  27.520  1.00 41.24  ? 129  SER A N   1 
ATOM   1013 C CA  . SER A 1 129 ? 28.204  19.544  28.400  1.00 42.59  ? 129  SER A CA  1 
ATOM   1014 C C   . SER A 1 129 ? 27.322  20.570  27.683  1.00 43.05  ? 129  SER A C   1 
ATOM   1015 O O   . SER A 1 129 ? 26.819  21.495  28.311  1.00 51.80  ? 129  SER A O   1 
ATOM   1016 C CB  . SER A 1 129 ? 29.366  20.263  29.087  1.00 40.77  ? 129  SER A CB  1 
ATOM   1017 O OG  . SER A 1 129 ? 30.316  20.704  28.129  1.00 37.32  ? 129  SER A OG  1 
ATOM   1018 N N   . LEU A 1 130 ? 27.148  20.419  26.374  1.00 41.96  ? 130  LEU A N   1 
ATOM   1019 C CA  . LEU A 1 130 ? 26.257  21.289  25.613  1.00 43.54  ? 130  LEU A CA  1 
ATOM   1020 C C   . LEU A 1 130 ? 24.838  21.207  26.159  1.00 46.31  ? 130  LEU A C   1 
ATOM   1021 O O   . LEU A 1 130 ? 24.414  20.184  26.701  1.00 45.01  ? 130  LEU A O   1 
ATOM   1022 C CB  . LEU A 1 130 ? 26.252  20.908  24.124  1.00 45.27  ? 130  LEU A CB  1 
ATOM   1023 C CG  . LEU A 1 130 ? 27.599  20.980  23.406  1.00 42.67  ? 130  LEU A CG  1 
ATOM   1024 C CD1 . LEU A 1 130 ? 27.432  20.731  21.933  1.00 43.12  ? 130  LEU A CD1 1 
ATOM   1025 C CD2 . LEU A 1 130 ? 28.234  22.329  23.643  1.00 42.43  ? 130  LEU A CD2 1 
ATOM   1026 N N   . ASP A 1 131 ? 24.096  22.288  25.989  1.00 50.77  ? 131  ASP A N   1 
ATOM   1027 C CA  . ASP A 1 131 ? 22.732  22.355  26.490  1.00 47.09  ? 131  ASP A CA  1 
ATOM   1028 C C   . ASP A 1 131 ? 21.783  21.347  25.856  1.00 51.49  ? 131  ASP A C   1 
ATOM   1029 O O   . ASP A 1 131 ? 20.936  20.786  26.545  1.00 54.38  ? 131  ASP A O   1 
ATOM   1030 C CB  . ASP A 1 131 ? 22.193  23.764  26.323  1.00 48.76  ? 131  ASP A CB  1 
ATOM   1031 C CG  . ASP A 1 131 ? 22.783  24.727  27.336  1.00 65.62  ? 131  ASP A CG  1 
ATOM   1032 O OD1 . ASP A 1 131 ? 23.612  24.289  28.168  1.00 68.09  ? 131  ASP A OD1 1 
ATOM   1033 O OD2 . ASP A 1 131 ? 22.410  25.918  27.308  1.00 76.91  ? 131  ASP A OD2 1 
ATOM   1034 N N   . VAL A 1 132 ? 21.925  21.114  24.555  1.00 42.63  ? 132  VAL A N   1 
ATOM   1035 C CA  . VAL A 1 132 ? 21.068  20.165  23.857  1.00 51.29  ? 132  VAL A CA  1 
ATOM   1036 C C   . VAL A 1 132 ? 21.289  18.718  24.301  1.00 45.70  ? 132  VAL A C   1 
ATOM   1037 O O   . VAL A 1 132 ? 20.533  17.820  23.930  1.00 45.94  ? 132  VAL A O   1 
ATOM   1038 C CB  . VAL A 1 132 ? 21.253  20.245  22.324  1.00 48.73  ? 132  VAL A CB  1 
ATOM   1039 C CG1 . VAL A 1 132 ? 20.653  21.517  21.800  1.00 56.79  ? 132  VAL A CG1 1 
ATOM   1040 C CG2 . VAL A 1 132 ? 22.727  20.145  21.958  1.00 50.44  ? 132  VAL A CG2 1 
ATOM   1041 N N   . TYR A 1 133 ? 22.331  18.485  25.082  1.00 47.05  ? 133  TYR A N   1 
ATOM   1042 C CA  . TYR A 1 133 ? 22.605  17.127  25.536  1.00 49.24  ? 133  TYR A CA  1 
ATOM   1043 C C   . TYR A 1 133 ? 22.269  16.981  27.024  1.00 46.36  ? 133  TYR A C   1 
ATOM   1044 O O   . TYR A 1 133 ? 22.826  16.130  27.710  1.00 53.61  ? 133  TYR A O   1 
ATOM   1045 C CB  . TYR A 1 133 ? 24.071  16.732  25.274  1.00 45.21  ? 133  TYR A CB  1 
ATOM   1046 C CG  . TYR A 1 133 ? 24.562  16.886  23.848  1.00 42.26  ? 133  TYR A CG  1 
ATOM   1047 C CD1 . TYR A 1 133 ? 23.718  16.682  22.762  1.00 46.03  ? 133  TYR A CD1 1 
ATOM   1048 C CD2 . TYR A 1 133 ? 25.885  17.216  23.589  1.00 45.65  ? 133  TYR A CD2 1 
ATOM   1049 C CE1 . TYR A 1 133 ? 24.183  16.814  21.454  1.00 43.54  ? 133  TYR A CE1 1 
ATOM   1050 C CE2 . TYR A 1 133 ? 26.358  17.356  22.293  1.00 41.87  ? 133  TYR A CE2 1 
ATOM   1051 C CZ  . TYR A 1 133 ? 25.504  17.153  21.230  1.00 46.55  ? 133  TYR A CZ  1 
ATOM   1052 O OH  . TYR A 1 133 ? 25.980  17.290  19.950  1.00 39.86  ? 133  TYR A OH  1 
ATOM   1053 N N   . ASP A 1 134 ? 21.366  17.822  27.519  1.00 46.93  ? 134  ASP A N   1 
ATOM   1054 C CA  . ASP A 1 134 ? 20.984  17.812  28.927  1.00 48.14  ? 134  ASP A CA  1 
ATOM   1055 C C   . ASP A 1 134 ? 20.079  16.629  29.264  1.00 51.62  ? 134  ASP A C   1 
ATOM   1056 O O   . ASP A 1 134 ? 18.922  16.583  28.847  1.00 46.59  ? 134  ASP A O   1 
ATOM   1057 C CB  . ASP A 1 134 ? 20.288  19.114  29.283  1.00 45.43  ? 134  ASP A CB  1 
ATOM   1058 C CG  . ASP A 1 134 ? 20.113  19.293  30.776  1.00 56.16  ? 134  ASP A CG  1 
ATOM   1059 O OD1 . ASP A 1 134 ? 20.065  18.285  31.501  1.00 57.67  ? 134  ASP A OD1 1 
ATOM   1060 O OD2 . ASP A 1 134 ? 20.016  20.452  31.229  1.00 63.96  ? 134  ASP A OD2 1 
ATOM   1061 N N   . GLY A 1 135 ? 20.617  15.680  30.027  1.00 47.87  ? 135  GLY A N   1 
ATOM   1062 C CA  . GLY A 1 135 ? 19.892  14.471  30.361  1.00 51.45  ? 135  GLY A CA  1 
ATOM   1063 C C   . GLY A 1 135 ? 18.856  14.626  31.460  1.00 50.64  ? 135  GLY A C   1 
ATOM   1064 O O   . GLY A 1 135 ? 18.223  13.651  31.839  1.00 49.99  ? 135  GLY A O   1 
ATOM   1065 N N   . ARG A 1 136 ? 18.660  15.843  31.960  1.00 49.69  ? 136  ARG A N   1 
ATOM   1066 C CA  . ARG A 1 136 ? 17.777  16.038  33.109  1.00 49.95  ? 136  ARG A CA  1 
ATOM   1067 C C   . ARG A 1 136 ? 16.319  15.711  32.788  1.00 58.64  ? 136  ARG A C   1 
ATOM   1068 O O   . ARG A 1 136 ? 15.575  15.262  33.662  1.00 52.35  ? 136  ARG A O   1 
ATOM   1069 C CB  . ARG A 1 136 ? 17.924  17.440  33.737  1.00 45.76  ? 136  ARG A CB  1 
ATOM   1070 C CG  . ARG A 1 136 ? 17.136  18.570  33.087  1.00 47.54  ? 136  ARG A CG  1 
ATOM   1071 C CD  . ARG A 1 136 ? 17.310  19.902  33.857  1.00 54.41  ? 136  ARG A CD  1 
ATOM   1072 N NE  . ARG A 1 136 ? 18.664  20.454  33.750  1.00 49.11  ? 136  ARG A NE  1 
ATOM   1073 C CZ  . ARG A 1 136 ? 19.162  21.427  34.518  1.00 55.76  ? 136  ARG A CZ  1 
ATOM   1074 N NH1 . ARG A 1 136 ? 20.408  21.848  34.327  1.00 60.65  ? 136  ARG A NH1 1 
ATOM   1075 N NH2 . ARG A 1 136 ? 18.437  21.980  35.483  1.00 59.37  ? 136  ARG A NH2 1 
ATOM   1076 N N   . PHE A 1 137 ? 15.918  15.913  31.535  1.00 53.48  ? 137  PHE A N   1 
ATOM   1077 C CA  . PHE A 1 137 ? 14.534  15.685  31.146  1.00 45.97  ? 137  PHE A CA  1 
ATOM   1078 C C   . PHE A 1 137 ? 14.234  14.199  30.960  1.00 53.73  ? 137  PHE A C   1 
ATOM   1079 O O   . PHE A 1 137 ? 13.201  13.716  31.405  1.00 58.38  ? 137  PHE A O   1 
ATOM   1080 C CB  . PHE A 1 137 ? 14.182  16.469  29.883  1.00 49.72  ? 137  PHE A CB  1 
ATOM   1081 C CG  . PHE A 1 137 ? 14.455  17.932  29.992  1.00 60.02  ? 137  PHE A CG  1 
ATOM   1082 C CD1 . PHE A 1 137 ? 13.545  18.777  30.622  1.00 62.77  ? 137  PHE A CD1 1 
ATOM   1083 C CD2 . PHE A 1 137 ? 15.631  18.474  29.474  1.00 56.54  ? 137  PHE A CD2 1 
ATOM   1084 C CE1 . PHE A 1 137 ? 13.798  20.141  30.737  1.00 59.40  ? 137  PHE A CE1 1 
ATOM   1085 C CE2 . PHE A 1 137 ? 15.895  19.837  29.585  1.00 48.40  ? 137  PHE A CE2 1 
ATOM   1086 C CZ  . PHE A 1 137 ? 14.976  20.673  30.220  1.00 53.50  ? 137  PHE A CZ  1 
ATOM   1087 N N   . LEU A 1 138 ? 15.125  13.474  30.295  1.00 55.70  ? 138  LEU A N   1 
ATOM   1088 C CA  . LEU A 1 138 ? 14.937  12.039  30.150  1.00 55.21  ? 138  LEU A CA  1 
ATOM   1089 C C   . LEU A 1 138 ? 14.962  11.373  31.530  1.00 56.37  ? 138  LEU A C   1 
ATOM   1090 O O   . LEU A 1 138 ? 14.162  10.489  31.814  1.00 55.37  ? 138  LEU A O   1 
ATOM   1091 C CB  . LEU A 1 138 ? 15.997  11.434  29.220  1.00 51.92  ? 138  LEU A CB  1 
ATOM   1092 C CG  . LEU A 1 138 ? 15.776  11.668  27.723  1.00 57.51  ? 138  LEU A CG  1 
ATOM   1093 C CD1 . LEU A 1 138 ? 17.056  11.480  26.931  1.00 46.96  ? 138  LEU A CD1 1 
ATOM   1094 C CD2 . LEU A 1 138 ? 14.679  10.757  27.181  1.00 53.70  ? 138  LEU A CD2 1 
ATOM   1095 N N   . ALA A 1 139 ? 15.876  11.810  32.390  1.00 53.65  ? 139  ALA A N   1 
ATOM   1096 C CA  . ALA A 1 139 ? 15.977  11.255  33.738  1.00 58.36  ? 139  ALA A CA  1 
ATOM   1097 C C   . ALA A 1 139 ? 14.695  11.505  34.551  1.00 62.05  ? 139  ALA A C   1 
ATOM   1098 O O   . ALA A 1 139 ? 14.128  10.593  35.145  1.00 59.88  ? 139  ALA A O   1 
ATOM   1099 C CB  . ALA A 1 139 ? 17.205  11.827  34.467  1.00 49.48  ? 139  ALA A CB  1 
ATOM   1100 N N   . GLN A 1 140 ? 14.238  12.749  34.568  1.00 64.20  ? 140  GLN A N   1 
ATOM   1101 C CA  . GLN A 1 140 ? 13.059  13.117  35.340  1.00 58.90  ? 140  GLN A CA  1 
ATOM   1102 C C   . GLN A 1 140 ? 11.780  12.520  34.746  1.00 63.38  ? 140  GLN A C   1 
ATOM   1103 O O   . GLN A 1 140 ? 11.052  11.788  35.413  1.00 69.63  ? 140  GLN A O   1 
ATOM   1104 C CB  . GLN A 1 140 ? 12.952  14.640  35.415  1.00 61.55  ? 140  GLN A CB  1 
ATOM   1105 C CG  . GLN A 1 140 ? 12.100  15.168  36.548  1.00 60.91  ? 140  GLN A CG  1 
ATOM   1106 C CD  . GLN A 1 140 ? 10.619  14.961  36.302  1.00 71.38  ? 140  GLN A CD  1 
ATOM   1107 O OE1 . GLN A 1 140 ? 10.098  15.286  35.227  1.00 73.79  ? 140  GLN A OE1 1 
ATOM   1108 N NE2 . GLN A 1 140 ? 9.929   14.417  37.299  1.00 59.94  ? 140  GLN A NE2 1 
ATOM   1109 N N   . VAL A 1 141 ? 11.513  12.825  33.485  1.00 56.75  ? 141  VAL A N   1 
ATOM   1110 C CA  . VAL A 1 141 ? 10.244  12.447  32.884  1.00 54.15  ? 141  VAL A CA  1 
ATOM   1111 C C   . VAL A 1 141 ? 10.150  10.967  32.567  1.00 59.92  ? 141  VAL A C   1 
ATOM   1112 O O   . VAL A 1 141 ? 9.071   10.382  32.629  1.00 70.80  ? 141  VAL A O   1 
ATOM   1113 C CB  . VAL A 1 141 ? 9.975   13.223  31.589  1.00 54.81  ? 141  VAL A CB  1 
ATOM   1114 C CG1 . VAL A 1 141 ? 8.668   12.762  30.976  1.00 55.70  ? 141  VAL A CG1 1 
ATOM   1115 C CG2 . VAL A 1 141 ? 9.937   14.710  31.861  1.00 51.97  ? 141  VAL A CG2 1 
ATOM   1116 N N   . GLU A 1 142 ? 11.271  10.357  32.217  1.00 58.32  ? 142  GLU A N   1 
ATOM   1117 C CA  . GLU A 1 142 ? 11.251  8.960   31.815  1.00 50.82  ? 142  GLU A CA  1 
ATOM   1118 C C   . GLU A 1 142 ? 11.897  8.062   32.860  1.00 55.13  ? 142  GLU A C   1 
ATOM   1119 O O   . GLU A 1 142 ? 11.900  6.841   32.718  1.00 54.98  ? 142  GLU A O   1 
ATOM   1120 C CB  . GLU A 1 142 ? 11.928  8.783   30.454  1.00 53.95  ? 142  GLU A CB  1 
ATOM   1121 C CG  . GLU A 1 142 ? 11.052  9.202   29.274  1.00 61.37  ? 142  GLU A CG  1 
ATOM   1122 C CD  . GLU A 1 142 ? 9.804   8.321   29.114  1.00 74.18  ? 142  GLU A CD  1 
ATOM   1123 O OE1 . GLU A 1 142 ? 9.823   7.150   29.580  1.00 76.86  ? 142  GLU A OE1 1 
ATOM   1124 O OE2 . GLU A 1 142 ? 8.809   8.798   28.514  1.00 65.12  ? 142  GLU A OE2 1 
ATOM   1125 N N   . GLY A 1 143 ? 12.439  8.669   33.912  1.00 55.02  ? 143  GLY A N   1 
ATOM   1126 C CA  . GLY A 1 143 ? 13.133  7.925   34.950  1.00 52.20  ? 143  GLY A CA  1 
ATOM   1127 C C   . GLY A 1 143 ? 14.390  7.214   34.474  1.00 56.12  ? 143  GLY A C   1 
ATOM   1128 O O   . GLY A 1 143 ? 14.865  6.282   35.122  1.00 63.34  ? 143  GLY A O   1 
ATOM   1129 N N   . ALA A 1 144 ? 14.937  7.650   33.343  1.00 53.67  ? 144  ALA A N   1 
ATOM   1130 C CA  . ALA A 1 144 ? 16.110  6.994   32.762  1.00 60.09  ? 144  ALA A CA  1 
ATOM   1131 C C   . ALA A 1 144 ? 17.421  7.308   33.503  1.00 52.30  ? 144  ALA A C   1 
ATOM   1132 O O   . ALA A 1 144 ? 17.565  8.358   34.132  1.00 46.55  ? 144  ALA A O   1 
ATOM   1133 C CB  . ALA A 1 144 ? 16.236  7.368   31.298  1.00 53.31  ? 144  ALA A CB  1 
ATOM   1134 N N   . VAL A 1 145 ? 18.378  6.394   33.432  1.00 43.99  ? 145  VAL A N   1 
ATOM   1135 C CA  . VAL A 1 145 ? 19.724  6.732   33.859  1.00 44.60  ? 145  VAL A CA  1 
ATOM   1136 C C   . VAL A 1 145 ? 20.481  7.099   32.596  1.00 49.19  ? 145  VAL A C   1 
ATOM   1137 O O   . VAL A 1 145 ? 20.583  6.292   31.666  1.00 49.02  ? 145  VAL A O   1 
ATOM   1138 C CB  . VAL A 1 145 ? 20.415  5.592   34.629  1.00 51.50  ? 145  VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 145 ? 21.864  5.971   34.953  1.00 48.77  ? 145  VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 145 ? 19.646  5.283   35.908  1.00 44.78  ? 145  VAL A CG2 1 
ATOM   1141 N N   . LEU A 1 146 ? 20.966  8.335   32.543  1.00 42.75  ? 146  LEU A N   1 
ATOM   1142 C CA  . LEU A 1 146 ? 21.582  8.846   31.326  1.00 43.15  ? 146  LEU A CA  1 
ATOM   1143 C C   . LEU A 1 146 ? 23.033  9.224   31.556  1.00 47.55  ? 146  LEU A C   1 
ATOM   1144 O O   . LEU A 1 146 ? 23.371  9.913   32.528  1.00 47.22  ? 146  LEU A O   1 
ATOM   1145 C CB  . LEU A 1 146 ? 20.804  10.042  30.781  1.00 49.19  ? 146  LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 146 ? 20.990  10.251  29.274  1.00 56.51  ? 146  LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 146 ? 19.796  10.970  28.699  1.00 53.29  ? 146  LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 146 ? 22.287  10.993  28.965  1.00 54.23  ? 146  LEU A CD2 1 
ATOM   1149 N N   . VAL A 1 147 ? 23.885  8.766   30.650  1.00 41.83  ? 147  VAL A N   1 
ATOM   1150 C CA  . VAL A 1 147 ? 25.316  8.959   30.776  1.00 40.93  ? 147  VAL A CA  1 
ATOM   1151 C C   . VAL A 1 147 ? 25.864  9.499   29.489  1.00 45.01  ? 147  VAL A C   1 
ATOM   1152 O O   . VAL A 1 147 ? 25.621  8.935   28.421  1.00 48.14  ? 147  VAL A O   1 
ATOM   1153 C CB  . VAL A 1 147 ? 26.041  7.618   31.022  1.00 50.14  ? 147  VAL A CB  1 
ATOM   1154 C CG1 . VAL A 1 147 ? 27.540  7.775   30.816  1.00 48.11  ? 147  VAL A CG1 1 
ATOM   1155 C CG2 . VAL A 1 147 ? 25.751  7.093   32.405  1.00 48.04  ? 147  VAL A CG2 1 
ATOM   1156 N N   . SER A 1 148 ? 26.634  10.573  29.589  1.00 44.03  ? 148  SER A N   1 
ATOM   1157 C CA  . SER A 1 148 ? 27.396  11.061  28.442  1.00 45.75  ? 148  SER A CA  1 
ATOM   1158 C C   . SER A 1 148 ? 28.874  11.241  28.788  1.00 42.24  ? 148  SER A C   1 
ATOM   1159 O O   . SER A 1 148 ? 29.228  11.617  29.902  1.00 45.35  ? 148  SER A O   1 
ATOM   1160 C CB  . SER A 1 148 ? 26.815  12.378  27.929  1.00 42.51  ? 148  SER A CB  1 
ATOM   1161 O OG  . SER A 1 148 ? 26.806  13.351  28.957  1.00 43.55  ? 148  SER A OG  1 
ATOM   1162 N N   . MET A 1 149 ? 29.746  10.991  27.830  1.00 42.17  ? 149  MET A N   1 
ATOM   1163 C CA  . MET A 1 149 ? 31.163  11.146  28.104  1.00 44.71  ? 149  MET A CA  1 
ATOM   1164 C C   . MET A 1 149 ? 31.840  12.099  27.138  1.00 41.69  ? 149  MET A C   1 
ATOM   1165 O O   . MET A 1 149 ? 31.394  12.291  26.005  1.00 39.61  ? 149  MET A O   1 
ATOM   1166 C CB  . MET A 1 149 ? 31.867  9.794   28.026  1.00 40.75  ? 149  MET A CB  1 
ATOM   1167 C CG  . MET A 1 149 ? 32.314  9.419   26.625  1.00 42.81  ? 149  MET A CG  1 
ATOM   1168 S SD  . MET A 1 149 ? 30.993  8.852   25.532  1.00 50.25  ? 149  MET A SD  1 
ATOM   1169 C CE  . MET A 1 149 ? 30.694  7.184   26.141  1.00 40.24  ? 149  MET A CE  1 
ATOM   1170 N N   . ASN A 1 150 ? 32.936  12.687  27.590  1.00 42.11  ? 150  ASN A N   1 
ATOM   1171 C CA  . ASN A 1 150 ? 33.856  13.328  26.663  1.00 45.47  ? 150  ASN A CA  1 
ATOM   1172 C C   . ASN A 1 150 ? 34.796  12.296  26.066  1.00 44.49  ? 150  ASN A C   1 
ATOM   1173 O O   . ASN A 1 150 ? 35.124  11.296  26.698  1.00 43.97  ? 150  ASN A O   1 
ATOM   1174 C CB  . ASN A 1 150 ? 34.647  14.435  27.342  1.00 41.69  ? 150  ASN A CB  1 
ATOM   1175 C CG  . ASN A 1 150 ? 33.820  15.674  27.573  1.00 45.74  ? 150  ASN A CG  1 
ATOM   1176 O OD1 . ASN A 1 150 ? 32.654  15.737  27.182  1.00 42.03  ? 150  ASN A OD1 1 
ATOM   1177 N ND2 . ASN A 1 150 ? 34.423  16.678  28.204  1.00 43.63  ? 150  ASN A ND2 1 
ATOM   1178 N N   . TYR A 1 151 ? 35.193  12.525  24.826  1.00 41.02  ? 151  TYR A N   1 
ATOM   1179 C CA  . TYR A 1 151 ? 36.197  11.700  24.199  1.00 38.49  ? 151  TYR A CA  1 
ATOM   1180 C C   . TYR A 1 151 ? 37.060  12.624  23.343  1.00 46.61  ? 151  TYR A C   1 
ATOM   1181 O O   . TYR A 1 151 ? 36.594  13.689  22.914  1.00 41.52  ? 151  TYR A O   1 
ATOM   1182 C CB  . TYR A 1 151 ? 35.542  10.571  23.394  1.00 36.59  ? 151  TYR A CB  1 
ATOM   1183 C CG  . TYR A 1 151 ? 34.691  11.007  22.213  1.00 43.65  ? 151  TYR A CG  1 
ATOM   1184 C CD1 . TYR A 1 151 ? 33.334  11.313  22.370  1.00 40.19  ? 151  TYR A CD1 1 
ATOM   1185 C CD2 . TYR A 1 151 ? 35.238  11.094  20.934  1.00 36.72  ? 151  TYR A CD2 1 
ATOM   1186 C CE1 . TYR A 1 151 ? 32.555  11.704  21.288  1.00 35.21  ? 151  TYR A CE1 1 
ATOM   1187 C CE2 . TYR A 1 151 ? 34.469  11.484  19.852  1.00 41.19  ? 151  TYR A CE2 1 
ATOM   1188 C CZ  . TYR A 1 151 ? 33.129  11.789  20.027  1.00 41.80  ? 151  TYR A CZ  1 
ATOM   1189 O OH  . TYR A 1 151 ? 32.380  12.165  18.925  1.00 36.23  ? 151  TYR A OH  1 
ATOM   1190 N N   . ARG A 1 152 ? 38.320  12.253  23.131  1.00 38.06  ? 152  ARG A N   1 
ATOM   1191 C CA  . ARG A 1 152 ? 39.226  13.114  22.379  1.00 39.02  ? 152  ARG A CA  1 
ATOM   1192 C C   . ARG A 1 152 ? 38.836  13.188  20.917  1.00 40.31  ? 152  ARG A C   1 
ATOM   1193 O O   . ARG A 1 152 ? 38.551  12.167  20.278  1.00 39.05  ? 152  ARG A O   1 
ATOM   1194 C CB  . ARG A 1 152 ? 40.683  12.677  22.529  1.00 44.72  ? 152  ARG A CB  1 
ATOM   1195 C CG  . ARG A 1 152 ? 41.284  13.058  23.863  1.00 45.74  ? 152  ARG A CG  1 
ATOM   1196 C CD  . ARG A 1 152 ? 42.584  12.322  24.102  1.00 44.48  ? 152  ARG A CD  1 
ATOM   1197 N NE  . ARG A 1 152 ? 42.359  10.898  24.321  1.00 44.72  ? 152  ARG A NE  1 
ATOM   1198 C CZ  . ARG A 1 152 ? 43.332  9.991   24.381  1.00 50.90  ? 152  ARG A CZ  1 
ATOM   1199 N NH1 . ARG A 1 152 ? 44.601  10.366  24.217  1.00 43.11  ? 152  ARG A NH1 1 
ATOM   1200 N NH2 . ARG A 1 152 ? 43.036  8.707   24.591  1.00 39.50  ? 152  ARG A NH2 1 
ATOM   1201 N N   . VAL A 1 153 ? 38.817  14.414  20.403  1.00 42.04  ? 153  VAL A N   1 
ATOM   1202 C CA  . VAL A 1 153 ? 38.490  14.676  19.010  1.00 40.25  ? 153  VAL A CA  1 
ATOM   1203 C C   . VAL A 1 153 ? 39.722  15.181  18.276  1.00 44.72  ? 153  VAL A C   1 
ATOM   1204 O O   . VAL A 1 153 ? 40.793  15.337  18.875  1.00 43.78  ? 153  VAL A O   1 
ATOM   1205 C CB  . VAL A 1 153 ? 37.365  15.727  18.874  1.00 44.19  ? 153  VAL A CB  1 
ATOM   1206 C CG1 . VAL A 1 153 ? 36.051  15.156  19.354  1.00 40.04  ? 153  VAL A CG1 1 
ATOM   1207 C CG2 . VAL A 1 153 ? 37.720  17.009  19.637  1.00 35.61  ? 153  VAL A CG2 1 
ATOM   1208 N N   . GLY A 1 154 ? 39.561  15.423  16.977  1.00 43.25  ? 154  GLY A N   1 
ATOM   1209 C CA  . GLY A 1 154 ? 40.622  15.961  16.150  1.00 42.72  ? 154  GLY A CA  1 
ATOM   1210 C C   . GLY A 1 154 ? 41.902  15.160  16.232  1.00 48.30  ? 154  GLY A C   1 
ATOM   1211 O O   . GLY A 1 154 ? 41.875  13.931  16.348  1.00 48.17  ? 154  GLY A O   1 
ATOM   1212 N N   . THR A 1 155 ? 43.032  15.857  16.156  1.00 47.30  ? 155  THR A N   1 
ATOM   1213 C CA  . THR A 1 155 ? 44.327  15.194  16.216  1.00 49.24  ? 155  THR A CA  1 
ATOM   1214 C C   . THR A 1 155 ? 44.462  14.379  17.493  1.00 47.73  ? 155  THR A C   1 
ATOM   1215 O O   . THR A 1 155 ? 44.932  13.245  17.468  1.00 53.85  ? 155  THR A O   1 
ATOM   1216 C CB  . THR A 1 155 ? 45.510  16.192  16.164  1.00 48.84  ? 155  THR A CB  1 
ATOM   1217 O OG1 . THR A 1 155 ? 45.320  17.218  17.145  1.00 47.28  ? 155  THR A OG1 1 
ATOM   1218 C CG2 . THR A 1 155 ? 45.650  16.809  14.780  1.00 46.90  ? 155  THR A CG2 1 
ATOM   1219 N N   . PHE A 1 156 ? 44.056  14.961  18.613  1.00 41.87  ? 156  PHE A N   1 
ATOM   1220 C CA  . PHE A 1 156 ? 44.292  14.326  19.903  1.00 47.79  ? 156  PHE A CA  1 
ATOM   1221 C C   . PHE A 1 156 ? 43.543  13.013  19.989  1.00 47.56  ? 156  PHE A C   1 
ATOM   1222 O O   . PHE A 1 156 ? 43.980  12.088  20.662  1.00 46.54  ? 156  PHE A O   1 
ATOM   1223 C CB  . PHE A 1 156 ? 43.889  15.265  21.037  1.00 39.73  ? 156  PHE A CB  1 
ATOM   1224 C CG  . PHE A 1 156 ? 44.402  16.662  20.856  1.00 53.56  ? 156  PHE A CG  1 
ATOM   1225 C CD1 . PHE A 1 156 ? 45.683  17.003  21.265  1.00 51.07  ? 156  PHE A CD1 1 
ATOM   1226 C CD2 . PHE A 1 156 ? 43.616  17.627  20.242  1.00 45.67  ? 156  PHE A CD2 1 
ATOM   1227 C CE1 . PHE A 1 156 ? 46.161  18.285  21.080  1.00 50.69  ? 156  PHE A CE1 1 
ATOM   1228 C CE2 . PHE A 1 156 ? 44.082  18.906  20.060  1.00 50.14  ? 156  PHE A CE2 1 
ATOM   1229 C CZ  . PHE A 1 156 ? 45.362  19.238  20.477  1.00 59.11  ? 156  PHE A CZ  1 
ATOM   1230 N N   . GLY A 1 157 ? 42.423  12.933  19.279  1.00 40.42  ? 157  GLY A N   1 
ATOM   1231 C CA  . GLY A 1 157 ? 41.606  11.743  19.318  1.00 39.73  ? 157  GLY A CA  1 
ATOM   1232 C C   . GLY A 1 157 ? 41.865  10.750  18.205  1.00 41.13  ? 157  GLY A C   1 
ATOM   1233 O O   . GLY A 1 157 ? 41.581  9.563   18.371  1.00 38.83  ? 157  GLY A O   1 
ATOM   1234 N N   . PHE A 1 158 ? 42.408  11.215  17.078  1.00 41.76  ? 158  PHE A N   1 
ATOM   1235 C CA  . PHE A 1 158 ? 42.428  10.378  15.884  1.00 39.08  ? 158  PHE A CA  1 
ATOM   1236 C C   . PHE A 1 158 ? 43.653  10.447  14.985  1.00 42.17  ? 158  PHE A C   1 
ATOM   1237 O O   . PHE A 1 158 ? 43.757  9.687   14.019  1.00 40.81  ? 158  PHE A O   1 
ATOM   1238 C CB  . PHE A 1 158 ? 41.131  10.577  15.088  1.00 37.22  ? 158  PHE A CB  1 
ATOM   1239 C CG  . PHE A 1 158 ? 39.926  10.188  15.863  1.00 39.05  ? 158  PHE A CG  1 
ATOM   1240 C CD1 . PHE A 1 158 ? 39.557  8.844   15.958  1.00 39.34  ? 158  PHE A CD1 1 
ATOM   1241 C CD2 . PHE A 1 158 ? 39.207  11.144  16.574  1.00 32.01  ? 158  PHE A CD2 1 
ATOM   1242 C CE1 . PHE A 1 158 ? 38.461  8.469   16.721  1.00 44.87  ? 158  PHE A CE1 1 
ATOM   1243 C CE2 . PHE A 1 158 ? 38.120  10.784  17.349  1.00 34.96  ? 158  PHE A CE2 1 
ATOM   1244 C CZ  . PHE A 1 158 ? 37.737  9.449   17.424  1.00 44.36  ? 158  PHE A CZ  1 
ATOM   1245 N N   . LEU A 1 159 ? 44.593  11.328  15.294  1.00 43.89  ? 159  LEU A N   1 
ATOM   1246 C CA  . LEU A 1 159 ? 45.827  11.339  14.518  1.00 44.18  ? 159  LEU A CA  1 
ATOM   1247 C C   . LEU A 1 159 ? 46.552  10.006  14.683  1.00 45.01  ? 159  LEU A C   1 
ATOM   1248 O O   . LEU A 1 159 ? 46.859  9.593   15.793  1.00 47.06  ? 159  LEU A O   1 
ATOM   1249 C CB  . LEU A 1 159 ? 46.731  12.499  14.926  1.00 46.02  ? 159  LEU A CB  1 
ATOM   1250 C CG  . LEU A 1 159 ? 48.091  12.570  14.218  1.00 48.14  ? 159  LEU A CG  1 
ATOM   1251 C CD1 . LEU A 1 159 ? 48.553  14.010  14.085  1.00 46.02  ? 159  LEU A CD1 1 
ATOM   1252 C CD2 . LEU A 1 159 ? 49.133  11.734  14.955  1.00 42.04  ? 159  LEU A CD2 1 
ATOM   1253 N N   . ALA A 1 160 ? 46.830  9.334   13.577  1.00 43.88  ? 160  ALA A N   1 
ATOM   1254 C CA  . ALA A 1 160 ? 47.418  8.004   13.656  1.00 48.17  ? 160  ALA A CA  1 
ATOM   1255 C C   . ALA A 1 160 ? 48.646  7.788   12.771  1.00 50.69  ? 160  ALA A C   1 
ATOM   1256 O O   . ALA A 1 160 ? 48.683  8.171   11.597  1.00 48.71  ? 160  ALA A O   1 
ATOM   1257 C CB  . ALA A 1 160 ? 46.362  6.938   13.359  1.00 46.63  ? 160  ALA A CB  1 
ATOM   1258 N N   . LEU A 1 161 ? 49.660  7.163   13.347  1.00 53.05  ? 161  LEU A N   1 
ATOM   1259 C CA  . LEU A 1 161 ? 50.701  6.572   12.530  1.00 54.94  ? 161  LEU A CA  1 
ATOM   1260 C C   . LEU A 1 161 ? 50.496  5.077   12.639  1.00 54.76  ? 161  LEU A C   1 
ATOM   1261 O O   . LEU A 1 161 ? 51.098  4.416   13.478  1.00 56.57  ? 161  LEU A O   1 
ATOM   1262 C CB  . LEU A 1 161 ? 52.077  7.028   12.986  1.00 48.10  ? 161  LEU A CB  1 
ATOM   1263 C CG  . LEU A 1 161 ? 52.236  8.486   12.535  1.00 53.24  ? 161  LEU A CG  1 
ATOM   1264 C CD1 . LEU A 1 161 ? 53.210  9.285   13.393  1.00 59.56  ? 161  LEU A CD1 1 
ATOM   1265 C CD2 . LEU A 1 161 ? 52.619  8.529   11.073  1.00 46.79  ? 161  LEU A CD2 1 
ATOM   1266 N N   . PRO A 1 162 ? 49.599  4.545   11.801  1.00 47.61  ? 162  PRO A N   1 
ATOM   1267 C CA  . PRO A 1 162 ? 49.148  3.159   11.962  1.00 63.80  ? 162  PRO A CA  1 
ATOM   1268 C C   . PRO A 1 162 ? 50.340  2.210   12.053  1.00 59.32  ? 162  PRO A C   1 
ATOM   1269 O O   . PRO A 1 162 ? 51.305  2.345   11.303  1.00 54.20  ? 162  PRO A O   1 
ATOM   1270 C CB  . PRO A 1 162 ? 48.330  2.896   10.686  1.00 53.01  ? 162  PRO A CB  1 
ATOM   1271 C CG  . PRO A 1 162 ? 47.997  4.248   10.150  1.00 53.41  ? 162  PRO A CG  1 
ATOM   1272 C CD  . PRO A 1 162 ? 49.132  5.138   10.541  1.00 47.26  ? 162  PRO A CD  1 
ATOM   1273 N N   . GLY A 1 163 ? 50.277  1.263   12.978  1.00 65.94  ? 163  GLY A N   1 
ATOM   1274 C CA  . GLY A 1 163 ? 51.386  0.357   13.179  1.00 51.99  ? 163  GLY A CA  1 
ATOM   1275 C C   . GLY A 1 163 ? 52.235  0.805   14.344  1.00 54.68  ? 163  GLY A C   1 
ATOM   1276 O O   . GLY A 1 163 ? 52.740  -0.014  15.091  1.00 65.47  ? 163  GLY A O   1 
ATOM   1277 N N   . SER A 1 164 ? 52.388  2.110   14.516  1.00 53.11  ? 164  SER A N   1 
ATOM   1278 C CA  . SER A 1 164 ? 53.270  2.615   15.555  1.00 55.85  ? 164  SER A CA  1 
ATOM   1279 C C   . SER A 1 164 ? 52.748  2.336   16.965  1.00 60.71  ? 164  SER A C   1 
ATOM   1280 O O   . SER A 1 164 ? 51.600  1.920   17.159  1.00 53.27  ? 164  SER A O   1 
ATOM   1281 C CB  . SER A 1 164 ? 53.498  4.105   15.380  1.00 55.69  ? 164  SER A CB  1 
ATOM   1282 O OG  . SER A 1 164 ? 52.408  4.812   15.922  1.00 61.50  ? 164  SER A OG  1 
ATOM   1283 N N   . ARG A 1 165 ? 53.610  2.567   17.948  1.00 59.70  ? 165  ARG A N   1 
ATOM   1284 C CA  . ARG A 1 165 ? 53.272  2.318   19.337  1.00 66.63  ? 165  ARG A CA  1 
ATOM   1285 C C   . ARG A 1 165 ? 52.769  3.598   19.999  1.00 69.99  ? 165  ARG A C   1 
ATOM   1286 O O   . ARG A 1 165 ? 51.944  3.550   20.918  1.00 64.30  ? 165  ARG A O   1 
ATOM   1287 C CB  . ARG A 1 165 ? 54.504  1.812   20.087  1.00 70.84  ? 165  ARG A CB  1 
ATOM   1288 C CG  . ARG A 1 165 ? 54.197  1.025   21.349  1.00 82.61  ? 165  ARG A CG  1 
ATOM   1289 C CD  . ARG A 1 165 ? 55.346  1.121   22.357  1.00 95.74  ? 165  ARG A CD  1 
ATOM   1290 N NE  . ARG A 1 165 ? 55.049  2.031   23.467  1.00 104.74 ? 165  ARG A NE  1 
ATOM   1291 C CZ  . ARG A 1 165 ? 55.380  3.322   23.506  1.00 96.96  ? 165  ARG A CZ  1 
ATOM   1292 N NH1 . ARG A 1 165 ? 56.031  3.877   22.491  1.00 97.11  ? 165  ARG A NH1 1 
ATOM   1293 N NH2 . ARG A 1 165 ? 55.060  4.061   24.565  1.00 79.44  ? 165  ARG A NH2 1 
ATOM   1294 N N   . GLU A 1 166 ? 53.266  4.738   19.522  1.00 56.98  ? 166  GLU A N   1 
ATOM   1295 C CA  . GLU A 1 166 ? 53.019  6.020   20.176  1.00 60.89  ? 166  GLU A CA  1 
ATOM   1296 C C   . GLU A 1 166 ? 51.842  6.786   19.574  1.00 60.63  ? 166  GLU A C   1 
ATOM   1297 O O   . GLU A 1 166 ? 51.467  7.845   20.068  1.00 58.43  ? 166  GLU A O   1 
ATOM   1298 C CB  . GLU A 1 166 ? 54.277  6.893   20.161  1.00 65.15  ? 166  GLU A CB  1 
ATOM   1299 C CG  . GLU A 1 166 ? 55.562  6.143   20.489  1.00 72.40  ? 166  GLU A CG  1 
ATOM   1300 C CD  . GLU A 1 166 ? 56.231  5.520   19.256  1.00 88.53  ? 166  GLU A CD  1 
ATOM   1301 O OE1 . GLU A 1 166 ? 55.537  4.937   18.377  1.00 81.36  ? 166  GLU A OE1 1 
ATOM   1302 O OE2 . GLU A 1 166 ? 57.474  5.615   19.176  1.00 86.90  ? 166  GLU A OE2 1 
ATOM   1303 N N   . ALA A 1 167 ? 51.257  6.239   18.516  1.00 56.45  ? 167  ALA A N   1 
ATOM   1304 C CA  . ALA A 1 167 ? 50.119  6.856   17.861  1.00 51.80  ? 167  ALA A CA  1 
ATOM   1305 C C   . ALA A 1 167 ? 49.402  5.814   17.010  1.00 51.93  ? 167  ALA A C   1 
ATOM   1306 O O   . ALA A 1 167 ? 49.419  5.876   15.777  1.00 51.84  ? 167  ALA A O   1 
ATOM   1307 C CB  . ALA A 1 167 ? 50.568  8.029   17.018  1.00 47.35  ? 167  ALA A CB  1 
ATOM   1308 N N   . PRO A 1 168 ? 48.758  4.857   17.684  1.00 50.54  ? 168  PRO A N   1 
ATOM   1309 C CA  . PRO A 1 168 ? 48.079  3.692   17.112  1.00 41.06  ? 168  PRO A CA  1 
ATOM   1310 C C   . PRO A 1 168 ? 46.791  4.060   16.378  1.00 52.05  ? 168  PRO A C   1 
ATOM   1311 O O   . PRO A 1 168 ? 46.299  3.257   15.572  1.00 59.57  ? 168  PRO A O   1 
ATOM   1312 C CB  . PRO A 1 168 ? 47.703  2.863   18.344  1.00 38.29  ? 168  PRO A CB  1 
ATOM   1313 C CG  . PRO A 1 168 ? 48.090  3.668   19.557  1.00 43.69  ? 168  PRO A CG  1 
ATOM   1314 C CD  . PRO A 1 168 ? 48.472  5.027   19.118  1.00 49.91  ? 168  PRO A CD  1 
ATOM   1315 N N   . GLY A 1 169 ? 46.232  5.231   16.678  1.00 45.52  ? 169  GLY A N   1 
ATOM   1316 C CA  . GLY A 1 169 ? 44.975  5.650   16.079  1.00 48.46  ? 169  GLY A CA  1 
ATOM   1317 C C   . GLY A 1 169 ? 43.738  5.180   16.831  1.00 47.41  ? 169  GLY A C   1 
ATOM   1318 O O   . GLY A 1 169 ? 43.805  4.298   17.684  1.00 48.67  ? 169  GLY A O   1 
ATOM   1319 N N   . ASN A 1 170 ? 42.600  5.790   16.522  1.00 47.35  ? 170  ASN A N   1 
ATOM   1320 C CA  . ASN A 1 170 ? 41.337  5.438   17.160  1.00 40.26  ? 170  ASN A CA  1 
ATOM   1321 C C   . ASN A 1 170 ? 41.285  5.619   18.685  1.00 42.08  ? 170  ASN A C   1 
ATOM   1322 O O   . ASN A 1 170 ? 40.427  5.033   19.342  1.00 47.51  ? 170  ASN A O   1 
ATOM   1323 C CB  . ASN A 1 170 ? 40.953  4.005   16.807  1.00 38.93  ? 170  ASN A CB  1 
ATOM   1324 C CG  . ASN A 1 170 ? 40.748  3.802   15.316  1.00 51.73  ? 170  ASN A CG  1 
ATOM   1325 O OD1 . ASN A 1 170 ? 40.401  4.734   14.587  1.00 47.93  ? 170  ASN A OD1 1 
ATOM   1326 N ND2 . ASN A 1 170 ? 40.953  2.571   14.854  1.00 48.70  ? 170  ASN A ND2 1 
ATOM   1327 N N   . VAL A 1 171 ? 42.175  6.417   19.267  1.00 40.26  ? 171  VAL A N   1 
ATOM   1328 C CA  . VAL A 1 171 ? 42.150  6.535   20.722  1.00 38.48  ? 171  VAL A CA  1 
ATOM   1329 C C   . VAL A 1 171 ? 40.893  7.251   21.206  1.00 43.34  ? 171  VAL A C   1 
ATOM   1330 O O   . VAL A 1 171 ? 40.440  7.030   22.324  1.00 44.35  ? 171  VAL A O   1 
ATOM   1331 C CB  . VAL A 1 171 ? 43.420  7.189   21.315  1.00 41.79  ? 171  VAL A CB  1 
ATOM   1332 C CG1 . VAL A 1 171 ? 44.674  6.474   20.809  1.00 36.60  ? 171  VAL A CG1 1 
ATOM   1333 C CG2 . VAL A 1 171 ? 43.452  8.690   21.023  1.00 39.81  ? 171  VAL A CG2 1 
ATOM   1334 N N   . GLY A 1 172 ? 40.313  8.094   20.362  1.00 41.56  ? 172  GLY A N   1 
ATOM   1335 C CA  . GLY A 1 172 ? 39.046  8.714   20.706  1.00 39.96  ? 172  GLY A CA  1 
ATOM   1336 C C   . GLY A 1 172 ? 37.976  7.665   20.918  1.00 39.74  ? 172  GLY A C   1 
ATOM   1337 O O   . GLY A 1 172 ? 37.172  7.764   21.838  1.00 37.80  ? 172  GLY A O   1 
ATOM   1338 N N   . LEU A 1 173 ? 37.964  6.655   20.052  1.00 39.49  ? 173  LEU A N   1 
ATOM   1339 C CA  . LEU A 1 173 ? 37.048  5.533   20.204  1.00 44.53  ? 173  LEU A CA  1 
ATOM   1340 C C   . LEU A 1 173 ? 37.340  4.754   21.481  1.00 47.18  ? 173  LEU A C   1 
ATOM   1341 O O   . LEU A 1 173 ? 36.427  4.279   22.157  1.00 42.49  ? 173  LEU A O   1 
ATOM   1342 C CB  . LEU A 1 173 ? 37.139  4.605   19.001  1.00 41.71  ? 173  LEU A CB  1 
ATOM   1343 C CG  . LEU A 1 173 ? 36.587  5.227   17.722  1.00 46.93  ? 173  LEU A CG  1 
ATOM   1344 C CD1 . LEU A 1 173 ? 36.740  4.255   16.596  1.00 41.67  ? 173  LEU A CD1 1 
ATOM   1345 C CD2 . LEU A 1 173 ? 35.127  5.631   17.891  1.00 38.51  ? 173  LEU A CD2 1 
ATOM   1346 N N   . LEU A 1 174 ? 38.623  4.637   21.806  1.00 44.48  ? 174  LEU A N   1 
ATOM   1347 C CA  . LEU A 1 174 ? 39.042  3.957   23.019  1.00 42.07  ? 174  LEU A CA  1 
ATOM   1348 C C   . LEU A 1 174 ? 38.636  4.722   24.273  1.00 47.58  ? 174  LEU A C   1 
ATOM   1349 O O   . LEU A 1 174 ? 38.331  4.100   25.288  1.00 48.55  ? 174  LEU A O   1 
ATOM   1350 C CB  . LEU A 1 174 ? 40.553  3.708   23.011  1.00 42.92  ? 174  LEU A CB  1 
ATOM   1351 C CG  . LEU A 1 174 ? 41.006  2.679   21.975  1.00 46.75  ? 174  LEU A CG  1 
ATOM   1352 C CD1 . LEU A 1 174 ? 42.468  2.391   22.123  1.00 37.91  ? 174  LEU A CD1 1 
ATOM   1353 C CD2 . LEU A 1 174 ? 40.211  1.409   22.108  1.00 41.70  ? 174  LEU A CD2 1 
ATOM   1354 N N   . ASP A 1 175 ? 38.640  6.058   24.211  1.00 43.87  ? 175  ASP A N   1 
ATOM   1355 C CA  . ASP A 1 175 ? 38.120  6.868   25.314  1.00 40.96  ? 175  ASP A CA  1 
ATOM   1356 C C   . ASP A 1 175 ? 36.669  6.450   25.535  1.00 48.40  ? 175  ASP A C   1 
ATOM   1357 O O   . ASP A 1 175 ? 36.230  6.201   26.665  1.00 47.14  ? 175  ASP A O   1 
ATOM   1358 C CB  . ASP A 1 175 ? 38.160  8.370   24.996  1.00 41.38  ? 175  ASP A CB  1 
ATOM   1359 C CG  . ASP A 1 175 ? 39.578  8.907   24.777  1.00 49.11  ? 175  ASP A CG  1 
ATOM   1360 O OD1 . ASP A 1 175 ? 40.551  8.272   25.225  1.00 47.73  ? 175  ASP A OD1 1 
ATOM   1361 O OD2 . ASP A 1 175 ? 39.727  9.980   24.151  1.00 47.79  ? 175  ASP A OD2 1 
ATOM   1362 N N   . GLN A 1 176 ? 35.927  6.372   24.435  1.00 46.81  ? 176  GLN A N   1 
ATOM   1363 C CA  . GLN A 1 176 ? 34.516  6.023   24.490  1.00 46.72  ? 176  GLN A CA  1 
ATOM   1364 C C   . GLN A 1 176 ? 34.345  4.645   25.113  1.00 46.62  ? 176  GLN A C   1 
ATOM   1365 O O   . GLN A 1 176 ? 33.485  4.456   25.974  1.00 46.42  ? 176  GLN A O   1 
ATOM   1366 C CB  . GLN A 1 176 ? 33.879  6.073   23.090  1.00 46.03  ? 176  GLN A CB  1 
ATOM   1367 C CG  . GLN A 1 176 ? 33.879  7.462   22.427  1.00 40.17  ? 176  GLN A CG  1 
ATOM   1368 C CD  . GLN A 1 176 ? 33.288  7.445   21.017  1.00 49.79  ? 176  GLN A CD  1 
ATOM   1369 O OE1 . GLN A 1 176 ? 32.694  6.443   20.584  1.00 43.96  ? 176  GLN A OE1 1 
ATOM   1370 N NE2 . GLN A 1 176 ? 33.452  8.559   20.288  1.00 38.61  ? 176  GLN A NE2 1 
ATOM   1371 N N   . ARG A 1 177 ? 35.161  3.686   24.682  1.00 45.88  ? 177  ARG A N   1 
ATOM   1372 C CA  . ARG A 1 177 ? 35.030  2.317   25.173  1.00 48.82  ? 177  ARG A CA  1 
ATOM   1373 C C   . ARG A 1 177 ? 35.319  2.219   26.675  1.00 50.73  ? 177  ARG A C   1 
ATOM   1374 O O   . ARG A 1 177 ? 34.637  1.495   27.402  1.00 48.09  ? 177  ARG A O   1 
ATOM   1375 C CB  . ARG A 1 177 ? 35.937  1.365   24.401  1.00 50.20  ? 177  ARG A CB  1 
ATOM   1376 C CG  . ARG A 1 177 ? 35.922  -0.074  24.939  1.00 49.93  ? 177  ARG A CG  1 
ATOM   1377 C CD  . ARG A 1 177 ? 36.888  -0.961  24.160  1.00 46.40  ? 177  ARG A CD  1 
ATOM   1378 N NE  . ARG A 1 177 ? 36.304  -1.391  22.895  1.00 50.10  ? 177  ARG A NE  1 
ATOM   1379 C CZ  . ARG A 1 177 ? 37.004  -1.822  21.850  1.00 52.27  ? 177  ARG A CZ  1 
ATOM   1380 N NH1 . ARG A 1 177 ? 38.333  -1.883  21.909  1.00 40.66  ? 177  ARG A NH1 1 
ATOM   1381 N NH2 . ARG A 1 177 ? 36.370  -2.185  20.740  1.00 44.39  ? 177  ARG A NH2 1 
ATOM   1382 N N   . LEU A 1 178 ? 36.320  2.963   27.133  1.00 41.53  ? 178  LEU A N   1 
ATOM   1383 C CA  . LEU A 1 178 ? 36.660  2.988   28.546  1.00 44.43  ? 178  LEU A CA  1 
ATOM   1384 C C   . LEU A 1 178 ? 35.488  3.504   29.367  1.00 49.94  ? 178  LEU A C   1 
ATOM   1385 O O   . LEU A 1 178 ? 35.219  3.000   30.457  1.00 53.27  ? 178  LEU A O   1 
ATOM   1386 C CB  . LEU A 1 178 ? 37.917  3.825   28.804  1.00 46.08  ? 178  LEU A CB  1 
ATOM   1387 C CG  . LEU A 1 178 ? 38.449  3.892   30.237  1.00 50.84  ? 178  LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1 178 ? 38.691  2.507   30.767  1.00 54.17  ? 178  LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1 178 ? 39.724  4.704   30.310  1.00 50.59  ? 178  LEU A CD2 1 
ATOM   1390 N N   . ALA A 1 179 ? 34.776  4.496   28.844  1.00 44.17  ? 179  ALA A N   1 
ATOM   1391 C CA  . ALA A 1 179 ? 33.607  4.995   29.556  1.00 39.69  ? 179  ALA A CA  1 
ATOM   1392 C C   . ALA A 1 179 ? 32.504  3.952   29.562  1.00 42.28  ? 179  ALA A C   1 
ATOM   1393 O O   . ALA A 1 179 ? 31.746  3.875   30.520  1.00 46.81  ? 179  ALA A O   1 
ATOM   1394 C CB  . ALA A 1 179 ? 33.111  6.349   28.988  1.00 37.03  ? 179  ALA A CB  1 
ATOM   1395 N N   . LEU A 1 180 ? 32.416  3.136   28.511  1.00 43.53  ? 180  LEU A N   1 
ATOM   1396 C CA  . LEU A 1 180 ? 31.445  2.036   28.513  1.00 45.96  ? 180  LEU A CA  1 
ATOM   1397 C C   . LEU A 1 180 ? 31.763  1.018   29.610  1.00 51.21  ? 180  LEU A C   1 
ATOM   1398 O O   . LEU A 1 180 ? 30.870  0.586   30.343  1.00 45.81  ? 180  LEU A O   1 
ATOM   1399 C CB  . LEU A 1 180 ? 31.368  1.341   27.160  1.00 44.19  ? 180  LEU A CB  1 
ATOM   1400 C CG  . LEU A 1 180 ? 30.972  2.243   25.994  1.00 47.90  ? 180  LEU A CG  1 
ATOM   1401 C CD1 . LEU A 1 180 ? 30.615  1.411   24.791  1.00 42.18  ? 180  LEU A CD1 1 
ATOM   1402 C CD2 . LEU A 1 180 ? 29.815  3.139   26.379  1.00 48.13  ? 180  LEU A CD2 1 
ATOM   1403 N N   . GLN A 1 181 ? 33.036  0.650   29.722  1.00 45.01  ? 181  GLN A N   1 
ATOM   1404 C CA  . GLN A 1 181 ? 33.476  -0.239  30.785  1.00 52.07  ? 181  GLN A CA  1 
ATOM   1405 C C   . GLN A 1 181 ? 33.161  0.387   32.140  1.00 53.26  ? 181  GLN A C   1 
ATOM   1406 O O   . GLN A 1 181 ? 32.553  -0.248  33.007  1.00 49.88  ? 181  GLN A O   1 
ATOM   1407 C CB  . GLN A 1 181 ? 34.973  -0.522  30.664  1.00 45.53  ? 181  GLN A CB  1 
ATOM   1408 C CG  . GLN A 1 181 ? 35.317  -1.370  29.457  1.00 54.27  ? 181  GLN A CG  1 
ATOM   1409 C CD  . GLN A 1 181 ? 36.786  -1.270  29.067  1.00 61.72  ? 181  GLN A CD  1 
ATOM   1410 O OE1 . GLN A 1 181 ? 37.449  -0.282  29.363  1.00 67.29  ? 181  GLN A OE1 1 
ATOM   1411 N NE2 . GLN A 1 181 ? 37.295  -2.291  28.389  1.00 64.43  ? 181  GLN A NE2 1 
ATOM   1412 N N   . TRP A 1 182 ? 33.571  1.641   32.304  1.00 49.97  ? 182  TRP A N   1 
ATOM   1413 C CA  . TRP A 1 182 ? 33.283  2.400   33.512  1.00 48.15  ? 182  TRP A CA  1 
ATOM   1414 C C   . TRP A 1 182 ? 31.814  2.283   33.901  1.00 47.78  ? 182  TRP A C   1 
ATOM   1415 O O   . TRP A 1 182 ? 31.494  2.146   35.078  1.00 48.17  ? 182  TRP A O   1 
ATOM   1416 C CB  . TRP A 1 182 ? 33.645  3.879   33.338  1.00 45.27  ? 182  TRP A CB  1 
ATOM   1417 C CG  . TRP A 1 182 ? 33.463  4.665   34.608  1.00 47.67  ? 182  TRP A CG  1 
ATOM   1418 C CD1 . TRP A 1 182 ? 34.429  4.980   35.528  1.00 50.32  ? 182  TRP A CD1 1 
ATOM   1419 C CD2 . TRP A 1 182 ? 32.240  5.222   35.109  1.00 42.35  ? 182  TRP A CD2 1 
ATOM   1420 N NE1 . TRP A 1 182 ? 33.881  5.705   36.569  1.00 49.47  ? 182  TRP A NE1 1 
ATOM   1421 C CE2 . TRP A 1 182 ? 32.541  5.864   36.339  1.00 42.72  ? 182  TRP A CE2 1 
ATOM   1422 C CE3 . TRP A 1 182 ? 30.921  5.237   34.646  1.00 44.09  ? 182  TRP A CE3 1 
ATOM   1423 C CZ2 . TRP A 1 182 ? 31.569  6.515   37.104  1.00 46.13  ? 182  TRP A CZ2 1 
ATOM   1424 C CZ3 . TRP A 1 182 ? 29.952  5.888   35.411  1.00 46.05  ? 182  TRP A CZ3 1 
ATOM   1425 C CH2 . TRP A 1 182 ? 30.283  6.519   36.626  1.00 45.10  ? 182  TRP A CH2 1 
ATOM   1426 N N   . VAL A 1 183 ? 30.923  2.348   32.917  1.00 44.73  ? 183  VAL A N   1 
ATOM   1427 C CA  . VAL A 1 183 ? 29.501  2.202   33.194  1.00 42.06  ? 183  VAL A CA  1 
ATOM   1428 C C   . VAL A 1 183 ? 29.188  0.777   33.675  1.00 47.55  ? 183  VAL A C   1 
ATOM   1429 O O   . VAL A 1 183 ? 28.483  0.600   34.658  1.00 45.82  ? 183  VAL A O   1 
ATOM   1430 C CB  . VAL A 1 183 ? 28.637  2.553   31.978  1.00 42.07  ? 183  VAL A CB  1 
ATOM   1431 C CG1 . VAL A 1 183 ? 27.247  1.931   32.103  1.00 38.52  ? 183  VAL A CG1 1 
ATOM   1432 C CG2 . VAL A 1 183 ? 28.528  4.044   31.832  1.00 42.17  ? 183  VAL A CG2 1 
ATOM   1433 N N   . GLN A 1 184 ? 29.720  -0.230  32.986  1.00 47.70  ? 184  GLN A N   1 
ATOM   1434 C CA  . GLN A 1 184 ? 29.563  -1.621  33.415  1.00 48.39  ? 184  GLN A CA  1 
ATOM   1435 C C   . GLN A 1 184 ? 29.958  -1.790  34.875  1.00 52.00  ? 184  GLN A C   1 
ATOM   1436 O O   . GLN A 1 184 ? 29.189  -2.325  35.667  1.00 45.98  ? 184  GLN A O   1 
ATOM   1437 C CB  . GLN A 1 184 ? 30.389  -2.572  32.544  1.00 41.45  ? 184  GLN A CB  1 
ATOM   1438 C CG  . GLN A 1 184 ? 29.795  -2.797  31.183  1.00 43.65  ? 184  GLN A CG  1 
ATOM   1439 C CD  . GLN A 1 184 ? 28.393  -3.363  31.266  1.00 55.40  ? 184  GLN A CD  1 
ATOM   1440 O OE1 . GLN A 1 184 ? 28.165  -4.400  31.885  1.00 61.50  ? 184  GLN A OE1 1 
ATOM   1441 N NE2 . GLN A 1 184 ? 27.442  -2.680  30.649  1.00 54.37  ? 184  GLN A NE2 1 
ATOM   1442 N N   . GLU A 1 185 ? 31.145  -1.319  35.241  1.00 48.59  ? 185  GLU A N   1 
ATOM   1443 C CA  . GLU A 1 185 ? 31.600  -1.504  36.611  1.00 50.55  ? 185  GLU A CA  1 
ATOM   1444 C C   . GLU A 1 185 ? 30.858  -0.684  37.668  1.00 50.21  ? 185  GLU A C   1 
ATOM   1445 O O   . GLU A 1 185 ? 30.764  -1.118  38.815  1.00 54.22  ? 185  GLU A O   1 
ATOM   1446 C CB  . GLU A 1 185 ? 33.105  -1.276  36.753  1.00 49.89  ? 185  GLU A CB  1 
ATOM   1447 C CG  . GLU A 1 185 ? 33.537  -1.224  38.221  1.00 61.16  ? 185  GLU A CG  1 
ATOM   1448 C CD  . GLU A 1 185 ? 35.023  -1.469  38.432  1.00 73.55  ? 185  GLU A CD  1 
ATOM   1449 O OE1 . GLU A 1 185 ? 35.383  -2.170  39.415  1.00 68.55  ? 185  GLU A OE1 1 
ATOM   1450 O OE2 . GLU A 1 185 ? 35.825  -0.958  37.618  1.00 69.65  ? 185  GLU A OE2 1 
ATOM   1451 N N   . ASN A 1 186 ? 30.321  0.477   37.299  1.00 53.24  ? 186  ASN A N   1 
ATOM   1452 C CA  . ASN A 1 186 ? 29.895  1.461   38.310  1.00 44.66  ? 186  ASN A CA  1 
ATOM   1453 C C   . ASN A 1 186 ? 28.448  1.918   38.300  1.00 45.65  ? 186  ASN A C   1 
ATOM   1454 O O   . ASN A 1 186 ? 27.986  2.528   39.262  1.00 49.51  ? 186  ASN A O   1 
ATOM   1455 C CB  . ASN A 1 186 ? 30.757  2.712   38.213  1.00 38.55  ? 186  ASN A CB  1 
ATOM   1456 C CG  . ASN A 1 186 ? 32.204  2.439   38.493  1.00 45.23  ? 186  ASN A CG  1 
ATOM   1457 O OD1 . ASN A 1 186 ? 32.612  2.357   39.649  1.00 51.13  ? 186  ASN A OD1 1 
ATOM   1458 N ND2 . ASN A 1 186 ? 33.003  2.322   37.436  1.00 42.59  ? 186  ASN A ND2 1 
ATOM   1459 N N   . ILE A 1 187 ? 27.733  1.674   37.214  1.00 43.60  ? 187  ILE A N   1 
ATOM   1460 C CA  . ILE A 1 187 ? 26.447  2.330   37.060  1.00 47.06  ? 187  ILE A CA  1 
ATOM   1461 C C   . ILE A 1 187 ? 25.411  1.840   38.082  1.00 50.43  ? 187  ILE A C   1 
ATOM   1462 O O   . ILE A 1 187 ? 24.447  2.547   38.391  1.00 48.26  ? 187  ILE A O   1 
ATOM   1463 C CB  . ILE A 1 187 ? 25.907  2.207   35.624  1.00 48.02  ? 187  ILE A CB  1 
ATOM   1464 C CG1 . ILE A 1 187 ? 24.902  3.335   35.354  1.00 45.07  ? 187  ILE A CG1 1 
ATOM   1465 C CG2 . ILE A 1 187 ? 25.326  0.810   35.375  1.00 42.40  ? 187  ILE A CG2 1 
ATOM   1466 C CD1 . ILE A 1 187 ? 25.522  4.707   35.473  1.00 42.82  ? 187  ILE A CD1 1 
ATOM   1467 N N   . ALA A 1 188 ? 25.611  0.636   38.605  1.00 45.58  ? 188  ALA A N   1 
ATOM   1468 C CA  . ALA A 1 188 ? 24.716  0.112   39.635  1.00 51.28  ? 188  ALA A CA  1 
ATOM   1469 C C   . ALA A 1 188 ? 24.680  0.997   40.894  1.00 49.98  ? 188  ALA A C   1 
ATOM   1470 O O   . ALA A 1 188 ? 23.657  1.064   41.580  1.00 50.72  ? 188  ALA A O   1 
ATOM   1471 C CB  . ALA A 1 188 ? 25.079  -1.319  39.986  1.00 40.76  ? 188  ALA A CB  1 
ATOM   1472 N N   . ALA A 1 189 ? 25.783  1.684   41.184  1.00 42.02  ? 189  ALA A N   1 
ATOM   1473 C CA  . ALA A 1 189 ? 25.844  2.609   42.320  1.00 39.22  ? 189  ALA A CA  1 
ATOM   1474 C C   . ALA A 1 189 ? 24.878  3.783   42.198  1.00 50.51  ? 189  ALA A C   1 
ATOM   1475 O O   . ALA A 1 189 ? 24.692  4.539   43.154  1.00 58.78  ? 189  ALA A O   1 
ATOM   1476 C CB  . ALA A 1 189 ? 27.272  3.132   42.509  1.00 42.32  ? 189  ALA A CB  1 
ATOM   1477 N N   . PHE A 1 190 ? 24.286  3.946   41.017  1.00 48.51  ? 190  PHE A N   1 
ATOM   1478 C CA  . PHE A 1 190 ? 23.398  5.066   40.724  1.00 48.08  ? 190  PHE A CA  1 
ATOM   1479 C C   . PHE A 1 190 ? 21.989  4.546   40.512  1.00 58.41  ? 190  PHE A C   1 
ATOM   1480 O O   . PHE A 1 190 ? 21.035  5.322   40.357  1.00 56.14  ? 190  PHE A O   1 
ATOM   1481 C CB  . PHE A 1 190 ? 23.864  5.796   39.455  1.00 47.19  ? 190  PHE A CB  1 
ATOM   1482 C CG  . PHE A 1 190 ? 25.186  6.487   39.607  1.00 43.40  ? 190  PHE A CG  1 
ATOM   1483 C CD1 . PHE A 1 190 ? 26.363  5.832   39.306  1.00 47.98  ? 190  PHE A CD1 1 
ATOM   1484 C CD2 . PHE A 1 190 ? 25.250  7.790   40.073  1.00 46.33  ? 190  PHE A CD2 1 
ATOM   1485 C CE1 . PHE A 1 190 ? 27.579  6.471   39.450  1.00 48.73  ? 190  PHE A CE1 1 
ATOM   1486 C CE2 . PHE A 1 190 ? 26.461  8.435   40.227  1.00 41.03  ? 190  PHE A CE2 1 
ATOM   1487 C CZ  . PHE A 1 190 ? 27.626  7.777   39.914  1.00 44.49  ? 190  PHE A CZ  1 
ATOM   1488 N N   . GLY A 1 191 ? 21.867  3.221   40.484  1.00 44.71  ? 191  GLY A N   1 
ATOM   1489 C CA  . GLY A 1 191 ? 20.581  2.593   40.281  1.00 44.42  ? 191  GLY A CA  1 
ATOM   1490 C C   . GLY A 1 191 ? 20.425  2.171   38.847  1.00 52.25  ? 191  GLY A C   1 
ATOM   1491 O O   . GLY A 1 191 ? 19.339  1.796   38.419  1.00 58.38  ? 191  GLY A O   1 
ATOM   1492 N N   . GLY A 1 192 ? 21.522  2.236   38.099  1.00 53.75  ? 192  GLY A N   1 
ATOM   1493 C CA  . GLY A 1 192 ? 21.520  1.824   36.707  1.00 50.23  ? 192  GLY A CA  1 
ATOM   1494 C C   . GLY A 1 192 ? 21.737  0.331   36.522  1.00 53.12  ? 192  GLY A C   1 
ATOM   1495 O O   . GLY A 1 192 ? 22.355  -0.330  37.354  1.00 53.48  ? 192  GLY A O   1 
ATOM   1496 N N   . ASP A 1 193 ? 21.236  -0.193  35.411  1.00 52.27  ? 193  ASP A N   1 
ATOM   1497 C CA  . ASP A 1 193 ? 21.304  -1.609  35.118  1.00 48.19  ? 193  ASP A CA  1 
ATOM   1498 C C   . ASP A 1 193 ? 22.343  -1.888  34.048  1.00 47.95  ? 193  ASP A C   1 
ATOM   1499 O O   . ASP A 1 193 ? 22.073  -1.705  32.872  1.00 52.96  ? 193  ASP A O   1 
ATOM   1500 C CB  . ASP A 1 193 ? 19.926  -2.090  34.643  1.00 57.95  ? 193  ASP A CB  1 
ATOM   1501 C CG  . ASP A 1 193 ? 19.863  -3.604  34.417  1.00 66.98  ? 193  ASP A CG  1 
ATOM   1502 O OD1 . ASP A 1 193 ? 20.891  -4.305  34.597  1.00 55.64  ? 193  ASP A OD1 1 
ATOM   1503 O OD2 . ASP A 1 193 ? 18.770  -4.089  34.050  1.00 68.06  ? 193  ASP A OD2 1 
ATOM   1504 N N   . PRO A 1 194 ? 23.518  -2.385  34.446  1.00 48.71  ? 194  PRO A N   1 
ATOM   1505 C CA  . PRO A 1 194 ? 24.589  -2.673  33.486  1.00 46.79  ? 194  PRO A CA  1 
ATOM   1506 C C   . PRO A 1 194 ? 24.178  -3.761  32.500  1.00 56.20  ? 194  PRO A C   1 
ATOM   1507 O O   . PRO A 1 194 ? 24.869  -3.995  31.506  1.00 56.39  ? 194  PRO A O   1 
ATOM   1508 C CB  . PRO A 1 194 ? 25.733  -3.193  34.364  1.00 47.13  ? 194  PRO A CB  1 
ATOM   1509 C CG  . PRO A 1 194 ? 25.300  -3.009  35.772  1.00 46.15  ? 194  PRO A CG  1 
ATOM   1510 C CD  . PRO A 1 194 ? 23.816  -2.920  35.782  1.00 44.81  ? 194  PRO A CD  1 
ATOM   1511 N N   . MET A 1 195 ? 23.068  -4.431  32.787  1.00 60.05  ? 195  MET A N   1 
ATOM   1512 C CA  . MET A 1 195 ? 22.554  -5.472  31.908  1.00 60.31  ? 195  MET A CA  1 
ATOM   1513 C C   . MET A 1 195 ? 21.651  -4.884  30.831  1.00 62.44  ? 195  MET A C   1 
ATOM   1514 O O   . MET A 1 195 ? 21.306  -5.567  29.867  1.00 58.17  ? 195  MET A O   1 
ATOM   1515 C CB  . MET A 1 195 ? 21.791  -6.515  32.715  1.00 63.13  ? 195  MET A CB  1 
ATOM   1516 C CG  . MET A 1 195 ? 22.644  -7.203  33.763  1.00 77.60  ? 195  MET A CG  1 
ATOM   1517 S SD  . MET A 1 195 ? 23.288  -8.800  33.236  1.00 97.92  ? 195  MET A SD  1 
ATOM   1518 C CE  . MET A 1 195 ? 23.972  -8.402  31.617  1.00 82.78  ? 195  MET A CE  1 
ATOM   1519 N N   . SER A 1 196 ? 21.274  -3.618  30.996  1.00 49.21  ? 196  SER A N   1 
ATOM   1520 C CA  . SER A 1 196 ? 20.476  -2.919  29.991  1.00 52.65  ? 196  SER A CA  1 
ATOM   1521 C C   . SER A 1 196 ? 21.097  -1.565  29.598  1.00 60.20  ? 196  SER A C   1 
ATOM   1522 O O   . SER A 1 196 ? 20.737  -0.498  30.137  1.00 52.24  ? 196  SER A O   1 
ATOM   1523 C CB  . SER A 1 196 ? 19.051  -2.722  30.502  1.00 56.92  ? 196  SER A CB  1 
ATOM   1524 O OG  . SER A 1 196 ? 18.209  -2.250  29.473  1.00 60.91  ? 196  SER A OG  1 
ATOM   1525 N N   . VAL A 1 197 ? 22.042  -1.615  28.665  1.00 51.46  ? 197  VAL A N   1 
ATOM   1526 C CA  . VAL A 1 197 ? 22.745  -0.417  28.216  1.00 47.90  ? 197  VAL A CA  1 
ATOM   1527 C C   . VAL A 1 197 ? 22.516  -0.186  26.725  1.00 48.25  ? 197  VAL A C   1 
ATOM   1528 O O   . VAL A 1 197 ? 22.865  -1.024  25.884  1.00 50.30  ? 197  VAL A O   1 
ATOM   1529 C CB  . VAL A 1 197 ? 24.269  -0.495  28.514  1.00 54.18  ? 197  VAL A CB  1 
ATOM   1530 C CG1 . VAL A 1 197 ? 25.002  0.679   27.891  1.00 44.89  ? 197  VAL A CG1 1 
ATOM   1531 C CG2 . VAL A 1 197 ? 24.525  -0.558  30.015  1.00 41.99  ? 197  VAL A CG2 1 
ATOM   1532 N N   . THR A 1 198 ? 21.900  0.949   26.409  1.00 54.09  ? 198  THR A N   1 
ATOM   1533 C CA  . THR A 1 198 ? 21.667  1.363   25.028  1.00 46.87  ? 198  THR A CA  1 
ATOM   1534 C C   . THR A 1 198 ? 22.612  2.509   24.667  1.00 45.89  ? 198  THR A C   1 
ATOM   1535 O O   . THR A 1 198 ? 22.721  3.489   25.414  1.00 46.94  ? 198  THR A O   1 
ATOM   1536 C CB  . THR A 1 198 ? 20.212  1.823   24.817  1.00 44.27  ? 198  THR A CB  1 
ATOM   1537 O OG1 . THR A 1 198 ? 19.324  0.734   25.059  1.00 52.87  ? 198  THR A OG1 1 
ATOM   1538 C CG2 . THR A 1 198 ? 19.998  2.298   23.409  1.00 47.91  ? 198  THR A CG2 1 
ATOM   1539 N N   . LEU A 1 199 ? 23.303  2.375   23.534  1.00 39.38  ? 199  LEU A N   1 
ATOM   1540 C CA  . LEU A 1 199 ? 24.091  3.471   22.977  1.00 45.15  ? 199  LEU A CA  1 
ATOM   1541 C C   . LEU A 1 199 ? 23.249  4.317   22.040  1.00 45.98  ? 199  LEU A C   1 
ATOM   1542 O O   . LEU A 1 199 ? 22.506  3.780   21.223  1.00 53.43  ? 199  LEU A O   1 
ATOM   1543 C CB  . LEU A 1 199 ? 25.264  2.925   22.186  1.00 42.49  ? 199  LEU A CB  1 
ATOM   1544 C CG  . LEU A 1 199 ? 26.201  2.052   22.991  1.00 43.46  ? 199  LEU A CG  1 
ATOM   1545 C CD1 . LEU A 1 199 ? 27.388  1.661   22.142  1.00 40.01  ? 199  LEU A CD1 1 
ATOM   1546 C CD2 . LEU A 1 199 ? 26.630  2.826   24.217  1.00 52.99  ? 199  LEU A CD2 1 
ATOM   1547 N N   . PHE A 1 200 ? 23.358  5.634   22.147  1.00 41.54  ? 200  PHE A N   1 
ATOM   1548 C CA  . PHE A 1 200 ? 22.764  6.506   21.136  1.00 44.80  ? 200  PHE A CA  1 
ATOM   1549 C C   . PHE A 1 200 ? 23.621  7.737   20.904  1.00 45.02  ? 200  PHE A C   1 
ATOM   1550 O O   . PHE A 1 200 ? 24.273  8.238   21.821  1.00 44.75  ? 200  PHE A O   1 
ATOM   1551 C CB  . PHE A 1 200 ? 21.294  6.859   21.446  1.00 38.98  ? 200  PHE A CB  1 
ATOM   1552 C CG  . PHE A 1 200 ? 21.111  7.854   22.558  1.00 42.95  ? 200  PHE A CG  1 
ATOM   1553 C CD1 . PHE A 1 200 ? 21.721  7.672   23.791  1.00 47.22  ? 200  PHE A CD1 1 
ATOM   1554 C CD2 . PHE A 1 200 ? 20.289  8.966   22.381  1.00 45.89  ? 200  PHE A CD2 1 
ATOM   1555 C CE1 . PHE A 1 200 ? 21.541  8.594   24.831  1.00 46.42  ? 200  PHE A CE1 1 
ATOM   1556 C CE2 . PHE A 1 200 ? 20.098  9.896   23.413  1.00 50.76  ? 200  PHE A CE2 1 
ATOM   1557 C CZ  . PHE A 1 200 ? 20.727  9.708   24.645  1.00 50.35  ? 200  PHE A CZ  1 
ATOM   1558 N N   . GLY A 1 201 ? 23.631  8.202   19.662  1.00 42.48  ? 201  GLY A N   1 
ATOM   1559 C CA  . GLY A 1 201 ? 24.530  9.256   19.246  1.00 42.72  ? 201  GLY A CA  1 
ATOM   1560 C C   . GLY A 1 201 ? 24.132  9.780   17.886  1.00 48.09  ? 201  GLY A C   1 
ATOM   1561 O O   . GLY A 1 201 ? 23.330  9.165   17.181  1.00 46.87  ? 201  GLY A O   1 
ATOM   1562 N N   . GLU A 1 202 ? 24.696  10.925  17.520  1.00 40.59  ? 202  GLU A N   1 
ATOM   1563 C CA  . GLU A 1 202 ? 24.279  11.623  16.325  1.00 43.22  ? 202  GLU A CA  1 
ATOM   1564 C C   . GLU A 1 202 ? 25.505  12.029  15.525  1.00 43.48  ? 202  GLU A C   1 
ATOM   1565 O O   . GLU A 1 202 ? 26.547  12.308  16.111  1.00 46.48  ? 202  GLU A O   1 
ATOM   1566 C CB  . GLU A 1 202 ? 23.447  12.846  16.735  1.00 43.50  ? 202  GLU A CB  1 
ATOM   1567 C CG  . GLU A 1 202 ? 22.839  13.621  15.579  1.00 44.11  ? 202  GLU A CG  1 
ATOM   1568 C CD  . GLU A 1 202 ? 23.753  14.731  15.089  1.00 56.92  ? 202  GLU A CD  1 
ATOM   1569 O OE1 . GLU A 1 202 ? 24.745  15.036  15.796  1.00 54.69  ? 202  GLU A OE1 1 
ATOM   1570 O OE2 . GLU A 1 202 ? 23.481  15.301  14.006  1.00 53.15  ? 202  GLU A OE2 1 
ATOM   1571 N N   . SER A 1 203 ? 25.395  12.064  14.194  1.00 46.14  ? 203  SER A N   1 
ATOM   1572 C CA  . SER A 1 203 ? 26.531  12.472  13.346  1.00 50.50  ? 203  SER A CA  1 
ATOM   1573 C C   . SER A 1 203 ? 27.737  11.528  13.599  1.00 46.57  ? 203  SER A C   1 
ATOM   1574 O O   . SER A 1 203 ? 27.596  10.305  13.494  1.00 40.55  ? 203  SER A O   1 
ATOM   1575 C CB  . SER A 1 203 ? 26.874  13.958  13.599  1.00 54.01  ? 203  SER A CB  1 
ATOM   1576 O OG  . SER A 1 203 ? 28.081  14.369  12.970  1.00 69.44  ? 203  SER A OG  1 
ATOM   1577 N N   . ALA A 1 204 ? 28.902  12.071  13.956  1.00 39.91  ? 204  ALA A N   1 
ATOM   1578 C CA  . ALA A 1 204 ? 30.056  11.218  14.254  1.00 44.03  ? 204  ALA A CA  1 
ATOM   1579 C C   . ALA A 1 204 ? 29.805  10.392  15.519  1.00 53.72  ? 204  ALA A C   1 
ATOM   1580 O O   . ALA A 1 204 ? 30.466  9.369   15.746  1.00 42.25  ? 204  ALA A O   1 
ATOM   1581 C CB  . ALA A 1 204 ? 31.326  12.036  14.402  1.00 37.77  ? 204  ALA A CB  1 
ATOM   1582 N N   . GLY A 1 205 ? 28.858  10.856  16.342  1.00 47.79  ? 205  GLY A N   1 
ATOM   1583 C CA  . GLY A 1 205 ? 28.393  10.096  17.487  1.00 40.23  ? 205  GLY A CA  1 
ATOM   1584 C C   . GLY A 1 205 ? 27.761  8.796   17.008  1.00 47.51  ? 205  GLY A C   1 
ATOM   1585 O O   . GLY A 1 205 ? 28.057  7.718   17.522  1.00 44.14  ? 205  GLY A O   1 
ATOM   1586 N N   . ALA A 1 206 ? 26.900  8.903   16.001  1.00 44.81  ? 206  ALA A N   1 
ATOM   1587 C CA  . ALA A 1 206 ? 26.258  7.733   15.420  1.00 49.23  ? 206  ALA A CA  1 
ATOM   1588 C C   . ALA A 1 206 ? 27.264  6.784   14.760  1.00 47.00  ? 206  ALA A C   1 
ATOM   1589 O O   . ALA A 1 206 ? 27.196  5.577   14.967  1.00 46.24  ? 206  ALA A O   1 
ATOM   1590 C CB  . ALA A 1 206 ? 25.163  8.140   14.436  1.00 42.68  ? 206  ALA A CB  1 
ATOM   1591 N N   . ALA A 1 207 ? 28.195  7.315   13.975  1.00 42.46  ? 207  ALA A N   1 
ATOM   1592 C CA  . ALA A 1 207 ? 29.218  6.466   13.371  1.00 41.74  ? 207  ALA A CA  1 
ATOM   1593 C C   . ALA A 1 207 ? 30.032  5.751   14.459  1.00 45.89  ? 207  ALA A C   1 
ATOM   1594 O O   . ALA A 1 207 ? 30.437  4.593   14.304  1.00 46.74  ? 207  ALA A O   1 
ATOM   1595 C CB  . ALA A 1 207 ? 30.119  7.279   12.496  1.00 42.98  ? 207  ALA A CB  1 
ATOM   1596 N N   . SER A 1 208 ? 30.257  6.452   15.566  1.00 44.05  ? 208  SER A N   1 
ATOM   1597 C CA  . SER A 1 208 ? 30.954  5.890   16.715  1.00 42.62  ? 208  SER A CA  1 
ATOM   1598 C C   . SER A 1 208 ? 30.195  4.695   17.266  1.00 49.86  ? 208  SER A C   1 
ATOM   1599 O O   . SER A 1 208 ? 30.785  3.640   17.505  1.00 47.09  ? 208  SER A O   1 
ATOM   1600 C CB  . SER A 1 208 ? 31.128  6.945   17.812  1.00 43.98  ? 208  SER A CB  1 
ATOM   1601 O OG  . SER A 1 208 ? 32.184  7.827   17.495  1.00 43.35  ? 208  SER A OG  1 
ATOM   1602 N N   . VAL A 1 209 ? 28.888  4.868   17.476  1.00 44.83  ? 209  VAL A N   1 
ATOM   1603 C CA  . VAL A 1 209 ? 28.051  3.786   17.966  1.00 38.68  ? 209  VAL A CA  1 
ATOM   1604 C C   . VAL A 1 209 ? 28.185  2.621   16.994  1.00 46.81  ? 209  VAL A C   1 
ATOM   1605 O O   . VAL A 1 209 ? 28.343  1.465   17.399  1.00 46.33  ? 209  VAL A O   1 
ATOM   1606 C CB  . VAL A 1 209 ? 26.580  4.213   18.075  1.00 46.68  ? 209  VAL A CB  1 
ATOM   1607 C CG1 . VAL A 1 209 ? 25.664  2.991   18.121  1.00 37.92  ? 209  VAL A CG1 1 
ATOM   1608 C CG2 . VAL A 1 209 ? 26.371  5.113   19.291  1.00 40.74  ? 209  VAL A CG2 1 
ATOM   1609 N N   . GLY A 1 210 ? 28.158  2.938   15.706  1.00 44.79  ? 210  GLY A N   1 
ATOM   1610 C CA  . GLY A 1 210 ? 28.309  1.932   14.676  1.00 44.87  ? 210  GLY A CA  1 
ATOM   1611 C C   . GLY A 1 210 ? 29.616  1.180   14.813  1.00 50.08  ? 210  GLY A C   1 
ATOM   1612 O O   . GLY A 1 210 ? 29.664  -0.029  14.608  1.00 50.40  ? 210  GLY A O   1 
ATOM   1613 N N   . MET A 1 211 ? 30.689  1.876   15.161  1.00 44.58  ? 211  MET A N   1 
ATOM   1614 C CA  . MET A 1 211 ? 31.976  1.193   15.269  1.00 45.11  ? 211  MET A CA  1 
ATOM   1615 C C   . MET A 1 211 ? 32.072  0.313   16.479  1.00 46.15  ? 211  MET A C   1 
ATOM   1616 O O   . MET A 1 211 ? 32.807  -0.675  16.474  1.00 49.16  ? 211  MET A O   1 
ATOM   1617 C CB  . MET A 1 211 ? 33.135  2.171   15.236  1.00 49.14  ? 211  MET A CB  1 
ATOM   1618 C CG  . MET A 1 211 ? 33.563  2.446   13.820  1.00 56.12  ? 211  MET A CG  1 
ATOM   1619 S SD  . MET A 1 211 ? 33.989  4.155   13.600  1.00 62.90  ? 211  MET A SD  1 
ATOM   1620 C CE  . MET A 1 211 ? 33.632  4.346   11.861  1.00 53.14  ? 211  MET A CE  1 
ATOM   1621 N N   . HIS A 1 212 ? 31.323  0.653   17.519  1.00 40.37  ? 212  HIS A N   1 
ATOM   1622 C CA  . HIS A 1 212 ? 31.303  -0.206  18.686  1.00 44.39  ? 212  HIS A CA  1 
ATOM   1623 C C   . HIS A 1 212 ? 30.555  -1.500  18.382  1.00 47.56  ? 212  HIS A C   1 
ATOM   1624 O O   . HIS A 1 212 ? 30.853  -2.551  18.932  1.00 54.33  ? 212  HIS A O   1 
ATOM   1625 C CB  . HIS A 1 212 ? 30.702  0.520   19.880  1.00 44.24  ? 212  HIS A CB  1 
ATOM   1626 C CG  . HIS A 1 212 ? 31.570  1.614   20.403  1.00 45.13  ? 212  HIS A CG  1 
ATOM   1627 N ND1 . HIS A 1 212 ? 32.874  1.402   20.793  1.00 44.83  ? 212  HIS A ND1 1 
ATOM   1628 C CD2 . HIS A 1 212 ? 31.333  2.935   20.587  1.00 51.90  ? 212  HIS A CD2 1 
ATOM   1629 C CE1 . HIS A 1 212 ? 33.403  2.543   21.199  1.00 46.70  ? 212  HIS A CE1 1 
ATOM   1630 N NE2 . HIS A 1 212 ? 32.489  3.489   21.084  1.00 49.91  ? 212  HIS A NE2 1 
ATOM   1631 N N   . ILE A 1 213 ? 29.583  -1.415  17.492  1.00 43.57  ? 213  ILE A N   1 
ATOM   1632 C CA  . ILE A 1 213 ? 28.860  -2.586  17.069  1.00 47.15  ? 213  ILE A CA  1 
ATOM   1633 C C   . ILE A 1 213 ? 29.781  -3.484  16.258  1.00 52.81  ? 213  ILE A C   1 
ATOM   1634 O O   . ILE A 1 213 ? 29.660  -4.706  16.285  1.00 56.69  ? 213  ILE A O   1 
ATOM   1635 C CB  . ILE A 1 213 ? 27.670  -2.189  16.205  1.00 48.90  ? 213  ILE A CB  1 
ATOM   1636 C CG1 . ILE A 1 213 ? 26.696  -1.356  17.028  1.00 43.19  ? 213  ILE A CG1 1 
ATOM   1637 C CG2 . ILE A 1 213 ? 27.002  -3.421  15.603  1.00 56.70  ? 213  ILE A CG2 1 
ATOM   1638 C CD1 . ILE A 1 213 ? 25.354  -1.176  16.385  1.00 41.08  ? 213  ILE A CD1 1 
ATOM   1639 N N   . LEU A 1 214 ? 30.709  -2.871  15.537  1.00 52.08  ? 214  LEU A N   1 
ATOM   1640 C CA  . LEU A 1 214 ? 31.600  -3.622  14.664  1.00 50.71  ? 214  LEU A CA  1 
ATOM   1641 C C   . LEU A 1 214 ? 32.910  -4.015  15.344  1.00 49.88  ? 214  LEU A C   1 
ATOM   1642 O O   . LEU A 1 214 ? 33.793  -4.590  14.719  1.00 48.36  ? 214  LEU A O   1 
ATOM   1643 C CB  . LEU A 1 214 ? 31.879  -2.832  13.389  1.00 49.28  ? 214  LEU A CB  1 
ATOM   1644 C CG  . LEU A 1 214 ? 30.602  -2.523  12.618  1.00 54.99  ? 214  LEU A CG  1 
ATOM   1645 C CD1 . LEU A 1 214 ? 30.891  -1.680  11.391  1.00 54.89  ? 214  LEU A CD1 1 
ATOM   1646 C CD2 . LEU A 1 214 ? 29.932  -3.827  12.239  1.00 50.36  ? 214  LEU A CD2 1 
ATOM   1647 N N   . SER A 1 215 ? 33.038  -3.709  16.626  1.00 49.44  ? 215  SER A N   1 
ATOM   1648 C CA  . SER A 1 215 ? 34.280  -4.009  17.317  1.00 52.37  ? 215  SER A CA  1 
ATOM   1649 C C   . SER A 1 215 ? 34.028  -4.942  18.485  1.00 58.40  ? 215  SER A C   1 
ATOM   1650 O O   . SER A 1 215 ? 33.436  -4.542  19.487  1.00 55.59  ? 215  SER A O   1 
ATOM   1651 C CB  . SER A 1 215 ? 34.950  -2.722  17.797  1.00 53.81  ? 215  SER A CB  1 
ATOM   1652 O OG  . SER A 1 215 ? 36.347  -2.903  17.936  1.00 52.88  ? 215  SER A OG  1 
ATOM   1653 N N   . LEU A 1 216 ? 34.477  -6.188  18.339  1.00 66.75  ? 216  LEU A N   1 
ATOM   1654 C CA  . LEU A 1 216 ? 34.290  -7.236  19.349  1.00 65.84  ? 216  LEU A CA  1 
ATOM   1655 C C   . LEU A 1 216 ? 34.419  -6.770  20.805  1.00 61.43  ? 216  LEU A C   1 
ATOM   1656 O O   . LEU A 1 216 ? 33.484  -6.924  21.600  1.00 55.51  ? 216  LEU A O   1 
ATOM   1657 C CB  . LEU A 1 216 ? 35.258  -8.402  19.091  1.00 72.57  ? 216  LEU A CB  1 
ATOM   1658 C CG  . LEU A 1 216 ? 34.623  -9.708  18.607  1.00 75.08  ? 216  LEU A CG  1 
ATOM   1659 C CD1 . LEU A 1 216 ? 33.478  -10.092 19.552  1.00 64.46  ? 216  LEU A CD1 1 
ATOM   1660 C CD2 . LEU A 1 216 ? 34.137  -9.601  17.161  1.00 59.23  ? 216  LEU A CD2 1 
ATOM   1661 N N   . PRO A 1 217 ? 35.581  -6.205  21.166  1.00 51.69  ? 217  PRO A N   1 
ATOM   1662 C CA  . PRO A 1 217 ? 35.737  -5.823  22.572  1.00 52.02  ? 217  PRO A CA  1 
ATOM   1663 C C   . PRO A 1 217 ? 34.646  -4.867  23.072  1.00 55.01  ? 217  PRO A C   1 
ATOM   1664 O O   . PRO A 1 217 ? 34.384  -4.848  24.268  1.00 62.03  ? 217  PRO A O   1 
ATOM   1665 C CB  . PRO A 1 217 ? 37.127  -5.171  22.611  1.00 47.85  ? 217  PRO A CB  1 
ATOM   1666 C CG  . PRO A 1 217 ? 37.853  -5.759  21.458  1.00 48.43  ? 217  PRO A CG  1 
ATOM   1667 C CD  . PRO A 1 217 ? 36.807  -5.967  20.385  1.00 52.00  ? 217  PRO A CD  1 
ATOM   1668 N N   . SER A 1 218 ? 34.009  -4.106  22.186  1.00 53.12  ? 218  SER A N   1 
ATOM   1669 C CA  . SER A 1 218 ? 32.951  -3.186  22.611  1.00 55.02  ? 218  SER A CA  1 
ATOM   1670 C C   . SER A 1 218 ? 31.618  -3.891  22.720  1.00 53.52  ? 218  SER A C   1 
ATOM   1671 O O   . SER A 1 218 ? 30.727  -3.453  23.445  1.00 48.90  ? 218  SER A O   1 
ATOM   1672 C CB  . SER A 1 218 ? 32.815  -2.005  21.640  1.00 53.43  ? 218  SER A CB  1 
ATOM   1673 O OG  . SER A 1 218 ? 33.825  -1.028  21.853  1.00 49.78  ? 218  SER A OG  1 
ATOM   1674 N N   . ARG A 1 219 ? 31.495  -4.985  21.983  1.00 59.16  ? 219  ARG A N   1 
ATOM   1675 C CA  . ARG A 1 219 ? 30.222  -5.675  21.812  1.00 57.86  ? 219  ARG A CA  1 
ATOM   1676 C C   . ARG A 1 219 ? 29.558  -6.053  23.127  1.00 59.43  ? 219  ARG A C   1 
ATOM   1677 O O   . ARG A 1 219 ? 28.338  -5.951  23.277  1.00 67.84  ? 219  ARG A O   1 
ATOM   1678 C CB  . ARG A 1 219 ? 30.419  -6.926  20.958  1.00 59.35  ? 219  ARG A CB  1 
ATOM   1679 C CG  . ARG A 1 219 ? 30.371  -6.656  19.472  1.00 63.92  ? 219  ARG A CG  1 
ATOM   1680 C CD  . ARG A 1 219 ? 29.307  -5.613  19.166  1.00 65.47  ? 219  ARG A CD  1 
ATOM   1681 N NE  . ARG A 1 219 ? 27.952  -6.009  19.561  1.00 68.12  ? 219  ARG A NE  1 
ATOM   1682 C CZ  . ARG A 1 219 ? 27.108  -6.686  18.779  1.00 81.38  ? 219  ARG A CZ  1 
ATOM   1683 N NH1 . ARG A 1 219 ? 27.484  -7.069  17.558  1.00 68.48  ? 219  ARG A NH1 1 
ATOM   1684 N NH2 . ARG A 1 219 ? 25.886  -6.988  19.220  1.00 78.61  ? 219  ARG A NH2 1 
ATOM   1685 N N   . SER A 1 220 ? 30.372  -6.495  24.072  1.00 49.51  ? 220  SER A N   1 
ATOM   1686 C CA  . SER A 1 220 ? 29.891  -6.957  25.358  1.00 51.20  ? 220  SER A CA  1 
ATOM   1687 C C   . SER A 1 220 ? 29.644  -5.836  26.353  1.00 55.67  ? 220  SER A C   1 
ATOM   1688 O O   . SER A 1 220 ? 29.516  -6.108  27.533  1.00 52.61  ? 220  SER A O   1 
ATOM   1689 C CB  . SER A 1 220 ? 30.947  -7.860  25.975  1.00 62.28  ? 220  SER A CB  1 
ATOM   1690 O OG  . SER A 1 220 ? 32.150  -7.129  26.147  1.00 57.48  ? 220  SER A OG  1 
ATOM   1691 N N   . LEU A 1 221 ? 29.611  -4.585  25.903  1.00 58.39  ? 221  LEU A N   1 
ATOM   1692 C CA  . LEU A 1 221 ? 29.515  -3.464  26.831  1.00 48.04  ? 221  LEU A CA  1 
ATOM   1693 C C   . LEU A 1 221 ? 28.193  -2.762  26.692  1.00 49.03  ? 221  LEU A C   1 
ATOM   1694 O O   . LEU A 1 221 ? 27.901  -1.822  27.442  1.00 47.17  ? 221  LEU A O   1 
ATOM   1695 C CB  . LEU A 1 221 ? 30.653  -2.470  26.621  1.00 49.23  ? 221  LEU A CB  1 
ATOM   1696 C CG  . LEU A 1 221 ? 32.026  -3.053  26.932  1.00 54.96  ? 221  LEU A CG  1 
ATOM   1697 C CD1 . LEU A 1 221 ? 33.119  -2.054  26.583  1.00 54.25  ? 221  LEU A CD1 1 
ATOM   1698 C CD2 . LEU A 1 221 ? 32.081  -3.441  28.395  1.00 47.47  ? 221  LEU A CD2 1 
ATOM   1699 N N   . PHE A 1 222 ? 27.393  -3.227  25.737  1.00 45.37  ? 222  PHE A N   1 
ATOM   1700 C CA  . PHE A 1 222 ? 26.068  -2.661  25.503  1.00 50.14  ? 222  PHE A CA  1 
ATOM   1701 C C   . PHE A 1 222 ? 25.179  -3.681  24.813  1.00 48.45  ? 222  PHE A C   1 
ATOM   1702 O O   . PHE A 1 222 ? 25.666  -4.652  24.231  1.00 49.46  ? 222  PHE A O   1 
ATOM   1703 C CB  . PHE A 1 222 ? 26.163  -1.386  24.649  1.00 43.92  ? 222  PHE A CB  1 
ATOM   1704 C CG  . PHE A 1 222 ? 26.613  -1.632  23.234  1.00 39.31  ? 222  PHE A CG  1 
ATOM   1705 C CD1 . PHE A 1 222 ? 27.963  -1.781  22.934  1.00 41.80  ? 222  PHE A CD1 1 
ATOM   1706 C CD2 . PHE A 1 222 ? 25.687  -1.721  22.204  1.00 45.69  ? 222  PHE A CD2 1 
ATOM   1707 C CE1 . PHE A 1 222 ? 28.390  -2.005  21.632  1.00 42.89  ? 222  PHE A CE1 1 
ATOM   1708 C CE2 . PHE A 1 222 ? 26.106  -1.956  20.893  1.00 51.38  ? 222  PHE A CE2 1 
ATOM   1709 C CZ  . PHE A 1 222 ? 27.467  -2.087  20.609  1.00 45.18  ? 222  PHE A CZ  1 
ATOM   1710 N N   . HIS A 1 223 ? 23.878  -3.423  24.829  1.00 43.20  ? 223  HIS A N   1 
ATOM   1711 C CA  . HIS A 1 223 ? 22.915  -4.388  24.340  1.00 51.72  ? 223  HIS A CA  1 
ATOM   1712 C C   . HIS A 1 223 ? 22.103  -3.917  23.125  1.00 55.15  ? 223  HIS A C   1 
ATOM   1713 O O   . HIS A 1 223 ? 21.706  -4.725  22.285  1.00 61.05  ? 223  HIS A O   1 
ATOM   1714 C CB  . HIS A 1 223 ? 22.026  -4.789  25.519  1.00 56.10  ? 223  HIS A CB  1 
ATOM   1715 C CG  . HIS A 1 223 ? 22.805  -4.998  26.781  1.00 62.36  ? 223  HIS A CG  1 
ATOM   1716 N ND1 . HIS A 1 223 ? 23.326  -6.226  27.142  1.00 68.55  ? 223  HIS A ND1 1 
ATOM   1717 C CD2 . HIS A 1 223 ? 23.214  -4.125  27.732  1.00 56.18  ? 223  HIS A CD2 1 
ATOM   1718 C CE1 . HIS A 1 223 ? 23.997  -6.103  28.273  1.00 61.14  ? 223  HIS A CE1 1 
ATOM   1719 N NE2 . HIS A 1 223 ? 23.942  -4.838  28.653  1.00 63.76  ? 223  HIS A NE2 1 
ATOM   1720 N N   . ARG A 1 224 ? 21.875  -2.613  23.029  1.00 56.47  ? 224  ARG A N   1 
ATOM   1721 C CA  . ARG A 1 224 ? 21.085  -2.047  21.939  1.00 53.43  ? 224  ARG A CA  1 
ATOM   1722 C C   . ARG A 1 224 ? 21.682  -0.730  21.475  1.00 54.95  ? 224  ARG A C   1 
ATOM   1723 O O   . ARG A 1 224 ? 22.463  -0.109  22.198  1.00 52.72  ? 224  ARG A O   1 
ATOM   1724 C CB  . ARG A 1 224 ? 19.655  -1.811  22.400  1.00 54.44  ? 224  ARG A CB  1 
ATOM   1725 C CG  . ARG A 1 224 ? 18.773  -3.010  22.255  1.00 61.90  ? 224  ARG A CG  1 
ATOM   1726 C CD  . ARG A 1 224 ? 17.410  -2.733  22.846  1.00 62.02  ? 224  ARG A CD  1 
ATOM   1727 N NE  . ARG A 1 224 ? 17.506  -2.533  24.281  1.00 71.04  ? 224  ARG A NE  1 
ATOM   1728 C CZ  . ARG A 1 224 ? 17.799  -3.505  25.138  1.00 73.04  ? 224  ARG A CZ  1 
ATOM   1729 N NH1 . ARG A 1 224 ? 18.018  -4.736  24.691  1.00 72.13  ? 224  ARG A NH1 1 
ATOM   1730 N NH2 . ARG A 1 224 ? 17.879  -3.248  26.440  1.00 63.69  ? 224  ARG A NH2 1 
ATOM   1731 N N   . ALA A 1 225 ? 21.310  -0.288  20.280  1.00 53.43  ? 225  ALA A N   1 
ATOM   1732 C CA  . ALA A 1 225 ? 21.916  0.923   19.740  1.00 47.92  ? 225  ALA A CA  1 
ATOM   1733 C C   . ALA A 1 225 ? 20.977  1.769   18.902  1.00 50.70  ? 225  ALA A C   1 
ATOM   1734 O O   . ALA A 1 225 ? 20.149  1.240   18.163  1.00 49.25  ? 225  ALA A O   1 
ATOM   1735 C CB  . ALA A 1 225 ? 23.164  0.582   18.946  1.00 45.27  ? 225  ALA A CB  1 
ATOM   1736 N N   . VAL A 1 226 ? 21.123  3.090   19.037  1.00 45.86  ? 226  VAL A N   1 
ATOM   1737 C CA  . VAL A 1 226 ? 20.487  4.050   18.143  1.00 46.65  ? 226  VAL A CA  1 
ATOM   1738 C C   . VAL A 1 226 ? 21.536  4.866   17.385  1.00 48.19  ? 226  VAL A C   1 
ATOM   1739 O O   . VAL A 1 226 ? 22.438  5.440   17.986  1.00 47.84  ? 226  VAL A O   1 
ATOM   1740 C CB  . VAL A 1 226 ? 19.614  5.048   18.904  1.00 48.62  ? 226  VAL A CB  1 
ATOM   1741 C CG1 . VAL A 1 226 ? 18.765  5.837   17.920  1.00 47.63  ? 226  VAL A CG1 1 
ATOM   1742 C CG2 . VAL A 1 226 ? 18.746  4.338   19.916  1.00 43.98  ? 226  VAL A CG2 1 
ATOM   1743 N N   . LEU A 1 227 ? 21.410  4.919   16.066  1.00 47.99  ? 227  LEU A N   1 
ATOM   1744 C CA  . LEU A 1 227 ? 22.264  5.771   15.251  1.00 44.17  ? 227  LEU A CA  1 
ATOM   1745 C C   . LEU A 1 227 ? 21.420  6.858   14.608  1.00 45.32  ? 227  LEU A C   1 
ATOM   1746 O O   . LEU A 1 227 ? 20.589  6.574   13.745  1.00 44.53  ? 227  LEU A O   1 
ATOM   1747 C CB  . LEU A 1 227 ? 22.958  4.958   14.154  1.00 43.72  ? 227  LEU A CB  1 
ATOM   1748 C CG  . LEU A 1 227 ? 23.924  3.849   14.588  1.00 50.74  ? 227  LEU A CG  1 
ATOM   1749 C CD1 . LEU A 1 227 ? 23.158  2.679   15.185  1.00 51.81  ? 227  LEU A CD1 1 
ATOM   1750 C CD2 . LEU A 1 227 ? 24.798  3.372   13.431  1.00 44.82  ? 227  LEU A CD2 1 
ATOM   1751 N N   . GLN A 1 228 ? 21.628  8.104   15.017  1.00 45.00  ? 228  GLN A N   1 
ATOM   1752 C CA  . GLN A 1 228 ? 20.907  9.216   14.397  1.00 43.22  ? 228  GLN A CA  1 
ATOM   1753 C C   . GLN A 1 228 ? 21.797  9.970   13.412  1.00 45.36  ? 228  GLN A C   1 
ATOM   1754 O O   . GLN A 1 228 ? 22.836  10.509  13.794  1.00 47.97  ? 228  GLN A O   1 
ATOM   1755 C CB  . GLN A 1 228 ? 20.372  10.162  15.467  1.00 42.99  ? 228  GLN A CB  1 
ATOM   1756 C CG  . GLN A 1 228 ? 19.687  9.449   16.614  1.00 41.53  ? 228  GLN A CG  1 
ATOM   1757 C CD  . GLN A 1 228 ? 19.475  10.351  17.789  1.00 43.83  ? 228  GLN A CD  1 
ATOM   1758 O OE1 . GLN A 1 228 ? 19.206  9.900   18.902  1.00 41.92  ? 228  GLN A OE1 1 
ATOM   1759 N NE2 . GLN A 1 228 ? 19.607  11.649  17.556  1.00 55.56  ? 228  GLN A NE2 1 
ATOM   1760 N N   . SER A 1 229 ? 21.391  9.987   12.142  1.00 47.41  ? 229  SER A N   1 
ATOM   1761 C CA  . SER A 1 229 ? 22.092  10.726  11.084  1.00 44.92  ? 229  SER A CA  1 
ATOM   1762 C C   . SER A 1 229 ? 23.592  10.425  10.991  1.00 52.54  ? 229  SER A C   1 
ATOM   1763 O O   . SER A 1 229 ? 24.419  11.338  10.870  1.00 49.56  ? 229  SER A O   1 
ATOM   1764 C CB  . SER A 1 229 ? 21.879  12.232  11.239  1.00 45.01  ? 229  SER A CB  1 
ATOM   1765 O OG  . SER A 1 229 ? 20.504  12.548  11.263  1.00 52.16  ? 229  SER A OG  1 
ATOM   1766 N N   . GLY A 1 230 ? 23.950  9.149   11.020  1.00 43.43  ? 230  GLY A N   1 
ATOM   1767 C CA  . GLY A 1 230 ? 25.345  8.803   10.887  1.00 44.19  ? 230  GLY A CA  1 
ATOM   1768 C C   . GLY A 1 230 ? 25.585  7.314   10.880  1.00 47.61  ? 230  GLY A C   1 
ATOM   1769 O O   . GLY A 1 230 ? 24.828  6.531   11.455  1.00 43.53  ? 230  GLY A O   1 
ATOM   1770 N N   . THR A 1 231 ? 26.669  6.922   10.235  1.00 43.20  ? 231  THR A N   1 
ATOM   1771 C CA  . THR A 1 231 ? 26.971  5.521   10.080  1.00 47.32  ? 231  THR A CA  1 
ATOM   1772 C C   . THR A 1 231 ? 28.465  5.328   10.059  1.00 45.32  ? 231  THR A C   1 
ATOM   1773 O O   . THR A 1 231 ? 29.201  6.227   9.669   1.00 45.60  ? 231  THR A O   1 
ATOM   1774 C CB  . THR A 1 231 ? 26.388  4.966   8.762   1.00 52.76  ? 231  THR A CB  1 
ATOM   1775 O OG1 . THR A 1 231 ? 26.870  5.739   7.652   1.00 51.22  ? 231  THR A OG1 1 
ATOM   1776 C CG2 . THR A 1 231 ? 24.876  5.012   8.782   1.00 45.24  ? 231  THR A CG2 1 
ATOM   1777 N N   . PRO A 1 232 ? 28.915  4.138   10.473  1.00 53.06  ? 232  PRO A N   1 
ATOM   1778 C CA  . PRO A 1 232 ? 30.327  3.757   10.423  1.00 46.75  ? 232  PRO A CA  1 
ATOM   1779 C C   . PRO A 1 232 ? 30.788  3.587   8.966   1.00 47.19  ? 232  PRO A C   1 
ATOM   1780 O O   . PRO A 1 232 ? 31.944  3.864   8.665   1.00 49.55  ? 232  PRO A O   1 
ATOM   1781 C CB  . PRO A 1 232 ? 30.337  2.423   11.177  1.00 45.39  ? 232  PRO A CB  1 
ATOM   1782 C CG  . PRO A 1 232 ? 28.965  1.892   10.979  1.00 43.44  ? 232  PRO A CG  1 
ATOM   1783 C CD  . PRO A 1 232 ? 28.100  3.095   11.118  1.00 51.23  ? 232  PRO A CD  1 
ATOM   1784 N N   . ASN A 1 233 ? 29.895  3.145   8.082   1.00 43.80  ? 233  ASN A N   1 
ATOM   1785 C CA  . ASN A 1 233 ? 30.173  3.094   6.640   1.00 49.32  ? 233  ASN A CA  1 
ATOM   1786 C C   . ASN A 1 233 ? 29.962  4.479   6.014   1.00 49.29  ? 233  ASN A C   1 
ATOM   1787 O O   . ASN A 1 233 ? 29.628  5.438   6.706   1.00 51.24  ? 233  ASN A O   1 
ATOM   1788 C CB  . ASN A 1 233 ? 29.283  2.060   5.941   1.00 41.43  ? 233  ASN A CB  1 
ATOM   1789 C CG  . ASN A 1 233 ? 27.788  2.320   6.175   1.00 49.61  ? 233  ASN A CG  1 
ATOM   1790 O OD1 . ASN A 1 233 ? 27.314  2.340   7.319   1.00 49.84  ? 233  ASN A OD1 1 
ATOM   1791 N ND2 . ASN A 1 233 ? 27.047  2.527   5.094   1.00 39.55  ? 233  ASN A ND2 1 
ATOM   1792 N N   . GLY A 1 234 ? 30.148  4.596   4.709   1.00 47.29  ? 234  GLY A N   1 
ATOM   1793 C CA  . GLY A 1 234 ? 30.075  5.908   4.091   1.00 51.12  ? 234  GLY A CA  1 
ATOM   1794 C C   . GLY A 1 234 ? 31.431  6.588   3.928   1.00 54.93  ? 234  GLY A C   1 
ATOM   1795 O O   . GLY A 1 234 ? 32.463  6.081   4.378   1.00 54.40  ? 234  GLY A O   1 
ATOM   1796 N N   . PRO A 1 235 ? 31.432  7.774   3.310   1.00 54.64  ? 235  PRO A N   1 
ATOM   1797 C CA  . PRO A 1 235 ? 32.652  8.373   2.761   1.00 45.61  ? 235  PRO A CA  1 
ATOM   1798 C C   . PRO A 1 235 ? 33.504  9.186   3.743   1.00 47.23  ? 235  PRO A C   1 
ATOM   1799 O O   . PRO A 1 235 ? 34.647  9.482   3.405   1.00 48.31  ? 235  PRO A O   1 
ATOM   1800 C CB  . PRO A 1 235 ? 32.111  9.302   1.673   1.00 42.66  ? 235  PRO A CB  1 
ATOM   1801 C CG  . PRO A 1 235 ? 30.577  9.242   1.782   1.00 48.43  ? 235  PRO A CG  1 
ATOM   1802 C CD  . PRO A 1 235 ? 30.264  8.636   3.094   1.00 46.84  ? 235  PRO A CD  1 
ATOM   1803 N N   . TRP A 1 236 ? 32.978  9.539   4.915   1.00 43.84  ? 236  TRP A N   1 
ATOM   1804 C CA  . TRP A 1 236 ? 33.675  10.483  5.794   1.00 45.81  ? 236  TRP A CA  1 
ATOM   1805 C C   . TRP A 1 236 ? 34.073  9.905   7.156   1.00 43.72  ? 236  TRP A C   1 
ATOM   1806 O O   . TRP A 1 236 ? 34.903  10.484  7.848   1.00 42.04  ? 236  TRP A O   1 
ATOM   1807 C CB  . TRP A 1 236 ? 32.818  11.733  6.019   1.00 33.70  ? 236  TRP A CB  1 
ATOM   1808 C CG  . TRP A 1 236 ? 31.486  11.388  6.595   1.00 42.60  ? 236  TRP A CG  1 
ATOM   1809 C CD1 . TRP A 1 236 ? 30.337  11.113  5.900   1.00 41.83  ? 236  TRP A CD1 1 
ATOM   1810 C CD2 . TRP A 1 236 ? 31.160  11.234  7.984   1.00 41.34  ? 236  TRP A CD2 1 
ATOM   1811 N NE1 . TRP A 1 236 ? 29.320  10.819  6.772   1.00 39.53  ? 236  TRP A NE1 1 
ATOM   1812 C CE2 . TRP A 1 236 ? 29.795  10.878  8.055   1.00 39.19  ? 236  TRP A CE2 1 
ATOM   1813 C CE3 . TRP A 1 236 ? 31.887  11.371  9.175   1.00 40.84  ? 236  TRP A CE3 1 
ATOM   1814 C CZ2 . TRP A 1 236 ? 29.136  10.654  9.271   1.00 39.98  ? 236  TRP A CZ2 1 
ATOM   1815 C CZ3 . TRP A 1 236 ? 31.230  11.150  10.390  1.00 45.93  ? 236  TRP A CZ3 1 
ATOM   1816 C CH2 . TRP A 1 236 ? 29.864  10.793  10.425  1.00 41.28  ? 236  TRP A CH2 1 
ATOM   1817 N N   . ALA A 1 237 ? 33.487  8.781   7.554   1.00 41.60  ? 237  ALA A N   1 
ATOM   1818 C CA  . ALA A 1 237 ? 33.650  8.328   8.941   1.00 41.88  ? 237  ALA A CA  1 
ATOM   1819 C C   . ALA A 1 237 ? 34.952  7.569   9.229   1.00 46.54  ? 237  ALA A C   1 
ATOM   1820 O O   . ALA A 1 237 ? 35.369  7.473   10.388  1.00 48.17  ? 237  ALA A O   1 
ATOM   1821 C CB  . ALA A 1 237 ? 32.432  7.538   9.412   1.00 39.75  ? 237  ALA A CB  1 
ATOM   1822 N N   . THR A 1 238 ? 35.597  7.045   8.189   1.00 35.69  ? 238  THR A N   1 
ATOM   1823 C CA  . THR A 1 238 ? 36.872  6.354   8.365   1.00 45.62  ? 238  THR A CA  1 
ATOM   1824 C C   . THR A 1 238 ? 37.893  6.715   7.299   1.00 44.83  ? 238  THR A C   1 
ATOM   1825 O O   . THR A 1 238 ? 37.553  7.246   6.258   1.00 49.75  ? 238  THR A O   1 
ATOM   1826 C CB  . THR A 1 238 ? 36.705  4.805   8.352   1.00 48.26  ? 238  THR A CB  1 
ATOM   1827 O OG1 . THR A 1 238 ? 36.191  4.384   7.087   1.00 50.12  ? 238  THR A OG1 1 
ATOM   1828 C CG2 . THR A 1 238 ? 35.760  4.363   9.433   1.00 44.66  ? 238  THR A CG2 1 
ATOM   1829 N N   . VAL A 1 239 ? 39.157  6.422   7.565   1.00 49.46  ? 239  VAL A N   1 
ATOM   1830 C CA  . VAL A 1 239 ? 40.176  6.524   6.530   1.00 45.49  ? 239  VAL A CA  1 
ATOM   1831 C C   . VAL A 1 239 ? 41.016  5.261   6.540   1.00 46.30  ? 239  VAL A C   1 
ATOM   1832 O O   . VAL A 1 239 ? 41.100  4.571   7.552   1.00 51.39  ? 239  VAL A O   1 
ATOM   1833 C CB  . VAL A 1 239 ? 41.077  7.750   6.719   1.00 44.71  ? 239  VAL A CB  1 
ATOM   1834 C CG1 . VAL A 1 239 ? 40.337  9.007   6.289   1.00 42.07  ? 239  VAL A CG1 1 
ATOM   1835 C CG2 . VAL A 1 239 ? 41.568  7.844   8.176   1.00 36.70  ? 239  VAL A CG2 1 
ATOM   1836 N N   . SER A 1 240 ? 41.619  4.952   5.403   1.00 48.05  ? 240  SER A N   1 
ATOM   1837 C CA  . SER A 1 240 ? 42.553  3.838   5.313   1.00 48.43  ? 240  SER A CA  1 
ATOM   1838 C C   . SER A 1 240 ? 43.803  4.148   6.128   1.00 45.70  ? 240  SER A C   1 
ATOM   1839 O O   . SER A 1 240 ? 44.109  5.310   6.395   1.00 55.12  ? 240  SER A O   1 
ATOM   1840 C CB  . SER A 1 240 ? 42.947  3.627   3.865   1.00 38.20  ? 240  SER A CB  1 
ATOM   1841 O OG  . SER A 1 240 ? 43.771  4.699   3.448   1.00 54.78  ? 240  SER A OG  1 
ATOM   1842 N N   . ALA A 1 241 ? 44.537  3.114   6.519   1.00 52.07  ? 241  ALA A N   1 
ATOM   1843 C CA  . ALA A 1 241 ? 45.794  3.330   7.229   1.00 51.54  ? 241  ALA A CA  1 
ATOM   1844 C C   . ALA A 1 241 ? 46.700  4.238   6.422   1.00 48.53  ? 241  ALA A C   1 
ATOM   1845 O O   . ALA A 1 241 ? 47.341  5.127   6.972   1.00 52.20  ? 241  ALA A O   1 
ATOM   1846 C CB  . ALA A 1 241 ? 46.494  2.019   7.508   1.00 41.98  ? 241  ALA A CB  1 
ATOM   1847 N N   . GLY A 1 242 ? 46.750  4.005   5.115   1.00 50.99  ? 242  GLY A N   1 
ATOM   1848 C CA  . GLY A 1 242 ? 47.639  4.758   4.254   1.00 43.53  ? 242  GLY A CA  1 
ATOM   1849 C C   . GLY A 1 242 ? 47.330  6.231   4.328   1.00 52.69  ? 242  GLY A C   1 
ATOM   1850 O O   . GLY A 1 242 ? 48.222  7.059   4.514   1.00 52.17  ? 242  GLY A O   1 
ATOM   1851 N N   . GLU A 1 243 ? 46.052  6.561   4.198   1.00 49.09  ? 243  GLU A N   1 
ATOM   1852 C CA  . GLU A 1 243 ? 45.664  7.952   4.157   1.00 45.77  ? 243  GLU A CA  1 
ATOM   1853 C C   . GLU A 1 243 ? 45.879  8.628   5.508   1.00 48.43  ? 243  GLU A C   1 
ATOM   1854 O O   . GLU A 1 243 ? 46.238  9.804   5.560   1.00 44.68  ? 243  GLU A O   1 
ATOM   1855 C CB  . GLU A 1 243 ? 44.215  8.100   3.692   1.00 54.94  ? 243  GLU A CB  1 
ATOM   1856 C CG  . GLU A 1 243 ? 43.673  9.516   3.819   1.00 47.26  ? 243  GLU A CG  1 
ATOM   1857 C CD  . GLU A 1 243 ? 44.260  10.490  2.794   1.00 58.17  ? 243  GLU A CD  1 
ATOM   1858 O OE1 . GLU A 1 243 ? 43.805  11.662  2.769   1.00 51.63  ? 243  GLU A OE1 1 
ATOM   1859 O OE2 . GLU A 1 243 ? 45.156  10.088  2.008   1.00 60.22  ? 243  GLU A OE2 1 
ATOM   1860 N N   . ALA A 1 244 ? 45.657  7.898   6.599   1.00 44.07  ? 244  ALA A N   1 
ATOM   1861 C CA  . ALA A 1 244 ? 45.856  8.485   7.926   1.00 48.03  ? 244  ALA A CA  1 
ATOM   1862 C C   . ALA A 1 244 ? 47.333  8.737   8.196   1.00 53.08  ? 244  ALA A C   1 
ATOM   1863 O O   . ALA A 1 244 ? 47.697  9.727   8.828   1.00 50.77  ? 244  ALA A O   1 
ATOM   1864 C CB  . ALA A 1 244 ? 45.268  7.616   9.001   1.00 43.19  ? 244  ALA A CB  1 
ATOM   1865 N N   . ARG A 1 245 ? 48.184  7.839   7.712   1.00 46.62  ? 245  ARG A N   1 
ATOM   1866 C CA  . ARG A 1 245 ? 49.609  8.042   7.841   1.00 53.16  ? 245  ARG A CA  1 
ATOM   1867 C C   . ARG A 1 245 ? 49.964  9.308   7.071   1.00 54.01  ? 245  ARG A C   1 
ATOM   1868 O O   . ARG A 1 245 ? 50.667  10.187  7.571   1.00 50.58  ? 245  ARG A O   1 
ATOM   1869 C CB  . ARG A 1 245 ? 50.383  6.837   7.300   1.00 51.87  ? 245  ARG A CB  1 
ATOM   1870 C CG  . ARG A 1 245 ? 51.898  7.031   7.269   1.00 50.12  ? 245  ARG A CG  1 
ATOM   1871 C CD  . ARG A 1 245 ? 52.647  5.714   7.042   1.00 46.44  ? 245  ARG A CD  1 
ATOM   1872 N NE  . ARG A 1 245 ? 52.589  4.843   8.211   1.00 48.89  ? 245  ARG A NE  1 
ATOM   1873 C CZ  . ARG A 1 245 ? 53.334  5.011   9.301   1.00 56.80  ? 245  ARG A CZ  1 
ATOM   1874 N NH1 . ARG A 1 245 ? 54.203  6.019   9.376   1.00 47.32  ? 245  ARG A NH1 1 
ATOM   1875 N NH2 . ARG A 1 245 ? 53.210  4.173   10.325  1.00 57.08  ? 245  ARG A NH2 1 
ATOM   1876 N N   . ARG A 1 246 ? 49.459  9.401   5.849   1.00 47.74  ? 246  ARG A N   1 
ATOM   1877 C CA  . ARG A 1 246 ? 49.737  10.559  5.025   1.00 45.82  ? 246  ARG A CA  1 
ATOM   1878 C C   . ARG A 1 246 ? 49.328  11.874  5.707   1.00 51.96  ? 246  ARG A C   1 
ATOM   1879 O O   . ARG A 1 246 ? 50.097  12.831  5.743   1.00 50.45  ? 246  ARG A O   1 
ATOM   1880 C CB  . ARG A 1 246 ? 49.050  10.421  3.681   1.00 48.25  ? 246  ARG A CB  1 
ATOM   1881 C CG  . ARG A 1 246 ? 49.336  11.574  2.768   1.00 51.22  ? 246  ARG A CG  1 
ATOM   1882 C CD  . ARG A 1 246 ? 48.160  11.845  1.844   1.00 45.75  ? 246  ARG A CD  1 
ATOM   1883 N NE  . ARG A 1 246 ? 48.022  13.290  1.714   1.00 56.28  ? 246  ARG A NE  1 
ATOM   1884 C CZ  . ARG A 1 246 ? 46.933  13.987  2.024   1.00 58.04  ? 246  ARG A CZ  1 
ATOM   1885 N NH1 . ARG A 1 246 ? 45.835  13.378  2.446   1.00 52.83  ? 246  ARG A NH1 1 
ATOM   1886 N NH2 . ARG A 1 246 ? 46.938  15.304  1.878   1.00 64.71  ? 246  ARG A NH2 1 
ATOM   1887 N N   . ARG A 1 247 ? 48.125  11.917  6.268   1.00 49.89  ? 247  ARG A N   1 
ATOM   1888 C CA  . ARG A 1 247 ? 47.651  13.140  6.905   1.00 46.13  ? 247  ARG A CA  1 
ATOM   1889 C C   . ARG A 1 247 ? 48.405  13.455  8.183   1.00 45.23  ? 247  ARG A C   1 
ATOM   1890 O O   . ARG A 1 247 ? 48.659  14.624  8.498   1.00 44.31  ? 247  ARG A O   1 
ATOM   1891 C CB  . ARG A 1 247 ? 46.168  13.047  7.209   1.00 39.45  ? 247  ARG A CB  1 
ATOM   1892 C CG  . ARG A 1 247 ? 45.310  13.076  5.998   1.00 38.23  ? 247  ARG A CG  1 
ATOM   1893 C CD  . ARG A 1 247 ? 43.922  12.655  6.409   1.00 43.19  ? 247  ARG A CD  1 
ATOM   1894 N NE  . ARG A 1 247 ? 43.043  12.494  5.268   1.00 43.41  ? 247  ARG A NE  1 
ATOM   1895 C CZ  . ARG A 1 247 ? 41.721  12.494  5.357   1.00 48.87  ? 247  ARG A CZ  1 
ATOM   1896 N NH1 . ARG A 1 247 ? 41.140  12.665  6.539   1.00 45.88  ? 247  ARG A NH1 1 
ATOM   1897 N NH2 . ARG A 1 247 ? 40.985  12.342  4.267   1.00 41.04  ? 247  ARG A NH2 1 
ATOM   1898 N N   . ALA A 1 248 ? 48.741  12.408  8.928   1.00 45.26  ? 248  ALA A N   1 
ATOM   1899 C CA  . ALA A 1 248 ? 49.558  12.548  10.123  1.00 46.46  ? 248  ALA A CA  1 
ATOM   1900 C C   . ALA A 1 248 ? 50.906  13.194  9.790   1.00 50.53  ? 248  ALA A C   1 
ATOM   1901 O O   . ALA A 1 248 ? 51.316  14.145  10.456  1.00 49.37  ? 248  ALA A O   1 
ATOM   1902 C CB  . ALA A 1 248 ? 49.760  11.192  10.797  1.00 46.33  ? 248  ALA A CB  1 
ATOM   1903 N N   . THR A 1 249 ? 51.592  12.702  8.757   1.00 47.50  ? 249  THR A N   1 
ATOM   1904 C CA  . THR A 1 249 ? 52.935  13.213  8.477   1.00 53.57  ? 249  THR A CA  1 
ATOM   1905 C C   . THR A 1 249 ? 52.881  14.620  7.887   1.00 51.95  ? 249  THR A C   1 
ATOM   1906 O O   . THR A 1 249 ? 53.721  15.476  8.201   1.00 54.53  ? 249  THR A O   1 
ATOM   1907 C CB  . THR A 1 249 ? 53.795  12.250  7.608   1.00 51.32  ? 249  THR A CB  1 
ATOM   1908 O OG1 . THR A 1 249 ? 53.681  12.596  6.224   1.00 72.18  ? 249  THR A OG1 1 
ATOM   1909 C CG2 . THR A 1 249 ? 53.368  10.796  7.818   1.00 45.72  ? 249  THR A CG2 1 
ATOM   1910 N N   . LEU A 1 250 ? 51.872  14.870  7.060   1.00 47.71  ? 250  LEU A N   1 
ATOM   1911 C CA  . LEU A 1 250 ? 51.677  16.206  6.509   1.00 46.43  ? 250  LEU A CA  1 
ATOM   1912 C C   . LEU A 1 250 ? 51.427  17.233  7.622   1.00 53.26  ? 250  LEU A C   1 
ATOM   1913 O O   . LEU A 1 250 ? 51.937  18.353  7.586   1.00 55.01  ? 250  LEU A O   1 
ATOM   1914 C CB  . LEU A 1 250 ? 50.540  16.220  5.494   1.00 46.90  ? 250  LEU A CB  1 
ATOM   1915 C CG  . LEU A 1 250 ? 50.222  17.615  4.970   1.00 51.16  ? 250  LEU A CG  1 
ATOM   1916 C CD1 . LEU A 1 250 ? 51.500  18.280  4.493   1.00 50.81  ? 250  LEU A CD1 1 
ATOM   1917 C CD2 . LEU A 1 250 ? 49.207  17.570  3.859   1.00 44.90  ? 250  LEU A CD2 1 
ATOM   1918 N N   . LEU A 1 251 ? 50.661  16.849  8.630   1.00 53.13  ? 251  LEU A N   1 
ATOM   1919 C CA  . LEU A 1 251 ? 50.419  17.765  9.729   1.00 51.81  ? 251  LEU A CA  1 
ATOM   1920 C C   . LEU A 1 251 ? 51.705  18.037  10.514  1.00 50.56  ? 251  LEU A C   1 
ATOM   1921 O O   . LEU A 1 251 ? 51.987  19.184  10.875  1.00 51.03  ? 251  LEU A O   1 
ATOM   1922 C CB  . LEU A 1 251 ? 49.331  17.233  10.659  1.00 47.39  ? 251  LEU A CB  1 
ATOM   1923 C CG  . LEU A 1 251 ? 49.168  18.145  11.870  1.00 48.88  ? 251  LEU A CG  1 
ATOM   1924 C CD1 . LEU A 1 251 ? 48.119  19.211  11.597  1.00 52.25  ? 251  LEU A CD1 1 
ATOM   1925 C CD2 . LEU A 1 251 ? 48.818  17.339  13.083  1.00 50.21  ? 251  LEU A CD2 1 
ATOM   1926 N N   . ALA A 1 252 ? 52.473  16.986  10.792  1.00 52.65  ? 252  ALA A N   1 
ATOM   1927 C CA  . ALA A 1 252 ? 53.776  17.148  11.445  1.00 55.75  ? 252  ALA A CA  1 
ATOM   1928 C C   . ALA A 1 252 ? 54.651  18.134  10.679  1.00 50.26  ? 252  ALA A C   1 
ATOM   1929 O O   . ALA A 1 252 ? 55.173  19.076  11.263  1.00 45.36  ? 252  ALA A O   1 
ATOM   1930 C CB  . ALA A 1 252 ? 54.472  15.829  11.578  1.00 53.94  ? 252  ALA A CB  1 
ATOM   1931 N N   . ARG A 1 253 ? 54.788  17.941  9.369   1.00 47.54  ? 253  ARG A N   1 
ATOM   1932 C CA  . ARG A 1 253 ? 55.462  18.945  8.543   1.00 51.74  ? 253  ARG A CA  1 
ATOM   1933 C C   . ARG A 1 253 ? 54.941  20.376  8.808   1.00 50.65  ? 253  ARG A C   1 
ATOM   1934 O O   . ARG A 1 253 ? 55.708  21.274  9.158   1.00 49.17  ? 253  ARG A O   1 
ATOM   1935 C CB  . ARG A 1 253 ? 55.342  18.611  7.055   1.00 47.66  ? 253  ARG A CB  1 
ATOM   1936 C CG  . ARG A 1 253 ? 56.206  17.457  6.573   1.00 56.62  ? 253  ARG A CG  1 
ATOM   1937 C CD  . ARG A 1 253 ? 56.771  17.742  5.160   1.00 71.45  ? 253  ARG A CD  1 
ATOM   1938 N NE  . ARG A 1 253 ? 55.728  18.098  4.190   1.00 86.73  ? 253  ARG A NE  1 
ATOM   1939 C CZ  . ARG A 1 253 ? 55.913  18.801  3.064   1.00 98.18  ? 253  ARG A CZ  1 
ATOM   1940 N NH1 . ARG A 1 253 ? 54.870  19.051  2.272   1.00 87.61  ? 253  ARG A NH1 1 
ATOM   1941 N NH2 . ARG A 1 253 ? 57.120  19.264  2.719   1.00 81.61  ? 253  ARG A NH2 1 
ATOM   1942 N N   . LEU A 1 254 ? 53.634  20.575  8.648   1.00 51.29  ? 254  LEU A N   1 
ATOM   1943 C CA  . LEU A 1 254 ? 53.011  21.890  8.831   1.00 45.36  ? 254  LEU A CA  1 
ATOM   1944 C C   . LEU A 1 254 ? 53.276  22.574  10.163  1.00 50.07  ? 254  LEU A C   1 
ATOM   1945 O O   . LEU A 1 254 ? 53.192  23.794  10.244  1.00 56.86  ? 254  LEU A O   1 
ATOM   1946 C CB  . LEU A 1 254 ? 51.502  21.825  8.622   1.00 47.16  ? 254  LEU A CB  1 
ATOM   1947 C CG  . LEU A 1 254 ? 51.003  21.351  7.265   1.00 54.05  ? 254  LEU A CG  1 
ATOM   1948 C CD1 . LEU A 1 254 ? 49.489  21.414  7.220   1.00 54.80  ? 254  LEU A CD1 1 
ATOM   1949 C CD2 . LEU A 1 254 ? 51.602  22.197  6.185   1.00 52.41  ? 254  LEU A CD2 1 
ATOM   1950 N N   . VAL A 1 255 ? 53.562  21.809  11.209  1.00 50.25  ? 255  VAL A N   1 
ATOM   1951 C CA  . VAL A 1 255 ? 53.873  22.414  12.504  1.00 56.58  ? 255  VAL A CA  1 
ATOM   1952 C C   . VAL A 1 255 ? 55.362  22.381  12.851  1.00 59.05  ? 255  VAL A C   1 
ATOM   1953 O O   . VAL A 1 255 ? 55.766  22.880  13.901  1.00 68.74  ? 255  VAL A O   1 
ATOM   1954 C CB  . VAL A 1 255 ? 53.065  21.781  13.668  1.00 59.73  ? 255  VAL A CB  1 
ATOM   1955 C CG1 . VAL A 1 255 ? 51.589  22.126  13.540  1.00 56.17  ? 255  VAL A CG1 1 
ATOM   1956 C CG2 . VAL A 1 255 ? 53.277  20.279  13.723  1.00 53.38  ? 255  VAL A CG2 1 
ATOM   1957 N N   . GLY A 1 256 ? 56.168  21.781  11.979  1.00 58.55  ? 256  GLY A N   1 
ATOM   1958 C CA  . GLY A 1 256 ? 57.612  21.791  12.137  1.00 61.84  ? 256  GLY A CA  1 
ATOM   1959 C C   . GLY A 1 256 ? 58.266  20.502  12.612  1.00 61.06  ? 256  GLY A C   1 
ATOM   1960 O O   . GLY A 1 256 ? 59.080  20.542  13.522  1.00 73.38  ? 256  GLY A O   1 
ATOM   1961 N N   . CYS A 1 257 ? 57.938  19.378  11.976  1.00 56.87  ? 257  CYS A N   1 
ATOM   1962 C CA  . CYS A 1 257 ? 58.441  18.064  12.365  1.00 56.24  ? 257  CYS A CA  1 
ATOM   1963 C C   . CYS A 1 257 ? 58.703  17.191  11.137  1.00 64.17  ? 257  CYS A C   1 
ATOM   1964 O O   . CYS A 1 257 ? 59.580  16.314  11.148  1.00 74.61  ? 257  CYS A O   1 
ATOM   1965 C CB  . CYS A 1 257 ? 57.438  17.361  13.288  1.00 64.25  ? 257  CYS A CB  1 
ATOM   1966 S SG  . CYS A 1 257 ? 56.886  18.318  14.774  1.00 74.32  ? 257  CYS A SG  1 
ATOM   1967 N N   . ASN A 1 265 ? 61.218  7.091   10.811  1.00 88.61  ? 265  ASN A N   1 
ATOM   1968 C CA  . ASN A 1 265 ? 60.938  6.653   12.179  1.00 89.10  ? 265  ASN A CA  1 
ATOM   1969 C C   . ASN A 1 265 ? 59.805  7.459   12.842  1.00 80.47  ? 265  ASN A C   1 
ATOM   1970 O O   . ASN A 1 265 ? 59.887  8.686   12.990  1.00 74.31  ? 265  ASN A O   1 
ATOM   1971 C CB  . ASN A 1 265 ? 62.229  6.672   13.017  1.00 89.64  ? 265  ASN A CB  1 
ATOM   1972 C CG  . ASN A 1 265 ? 62.014  6.218   14.457  1.00 88.33  ? 265  ASN A CG  1 
ATOM   1973 O OD1 . ASN A 1 265 ? 61.494  6.974   15.278  1.00 80.21  ? 265  ASN A OD1 1 
ATOM   1974 N ND2 . ASN A 1 265 ? 62.443  4.990   14.776  1.00 82.80  ? 265  ASN A ND2 1 
ATOM   1975 N N   . ASP A 1 266 ? 58.744  6.756   13.228  1.00 73.08  ? 266  ASP A N   1 
ATOM   1976 C CA  . ASP A 1 266 ? 57.558  7.389   13.799  1.00 67.56  ? 266  ASP A CA  1 
ATOM   1977 C C   . ASP A 1 266 ? 57.798  7.936   15.197  1.00 67.79  ? 266  ASP A C   1 
ATOM   1978 O O   . ASP A 1 266 ? 57.271  8.981   15.564  1.00 69.80  ? 266  ASP A O   1 
ATOM   1979 C CB  . ASP A 1 266 ? 56.394  6.400   13.835  1.00 56.40  ? 266  ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 266 ? 55.943  5.987   12.450  1.00 69.18  ? 266  ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 266 ? 56.268  6.712   11.483  1.00 79.19  ? 266  ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 266 ? 55.262  4.943   12.324  1.00 69.99  ? 266  ASP A OD2 1 
ATOM   1983 N N   . THR A 1 267 ? 58.591  7.216   15.975  1.00 68.86  ? 267  THR A N   1 
ATOM   1984 C CA  . THR A 1 267 ? 58.862  7.579   17.356  1.00 64.01  ? 267  THR A CA  1 
ATOM   1985 C C   . THR A 1 267 ? 59.320  9.018   17.503  1.00 59.09  ? 267  THR A C   1 
ATOM   1986 O O   . THR A 1 267 ? 58.826  9.756   18.348  1.00 63.91  ? 267  THR A O   1 
ATOM   1987 C CB  . THR A 1 267 ? 59.955  6.677   17.941  1.00 65.05  ? 267  THR A CB  1 
ATOM   1988 O OG1 . THR A 1 267 ? 59.575  5.302   17.786  1.00 67.12  ? 267  THR A OG1 1 
ATOM   1989 C CG2 . THR A 1 267 ? 60.161  6.983   19.402  1.00 49.09  ? 267  THR A CG2 1 
ATOM   1990 N N   . GLU A 1 268 ? 60.276  9.405   16.675  1.00 63.74  ? 268  GLU A N   1 
ATOM   1991 C CA  . GLU A 1 268 ? 60.886  10.719  16.761  1.00 67.91  ? 268  GLU A CA  1 
ATOM   1992 C C   . GLU A 1 268 ? 59.908  11.768  16.260  1.00 63.49  ? 268  GLU A C   1 
ATOM   1993 O O   . GLU A 1 268 ? 59.863  12.895  16.751  1.00 59.64  ? 268  GLU A O   1 
ATOM   1994 C CB  . GLU A 1 268 ? 62.160  10.730  15.917  1.00 72.53  ? 268  GLU A CB  1 
ATOM   1995 C CG  . GLU A 1 268 ? 63.020  9.492   16.138  1.00 86.72  ? 268  GLU A CG  1 
ATOM   1996 C CD  . GLU A 1 268 ? 63.827  9.101   14.909  1.00 107.11 ? 268  GLU A CD  1 
ATOM   1997 O OE1 . GLU A 1 268 ? 63.946  9.938   13.985  1.00 109.60 ? 268  GLU A OE1 1 
ATOM   1998 O OE2 . GLU A 1 268 ? 64.343  7.957   14.869  1.00 108.53 ? 268  GLU A OE2 1 
ATOM   1999 N N   . LEU A 1 269 ? 59.121  11.373  15.272  1.00 62.98  ? 269  LEU A N   1 
ATOM   2000 C CA  . LEU A 1 269 ? 58.112  12.232  14.688  1.00 54.25  ? 269  LEU A CA  1 
ATOM   2001 C C   . LEU A 1 269 ? 57.047  12.573  15.729  1.00 56.59  ? 269  LEU A C   1 
ATOM   2002 O O   . LEU A 1 269 ? 56.726  13.744  15.957  1.00 55.37  ? 269  LEU A O   1 
ATOM   2003 C CB  . LEU A 1 269 ? 57.483  11.490  13.518  1.00 51.98  ? 269  LEU A CB  1 
ATOM   2004 C CG  . LEU A 1 269 ? 56.785  12.283  12.425  1.00 53.55  ? 269  LEU A CG  1 
ATOM   2005 C CD1 . LEU A 1 269 ? 56.173  11.317  11.419  1.00 52.14  ? 269  LEU A CD1 1 
ATOM   2006 C CD2 . LEU A 1 269 ? 55.717  13.145  13.031  1.00 65.50  ? 269  LEU A CD2 1 
ATOM   2007 N N   . ILE A 1 270 ? 56.501  11.530  16.347  1.00 53.61  ? 270  ILE A N   1 
ATOM   2008 C CA  . ILE A 1 270 ? 55.446  11.667  17.326  1.00 51.71  ? 270  ILE A CA  1 
ATOM   2009 C C   . ILE A 1 270 ? 55.974  12.441  18.500  1.00 58.04  ? 270  ILE A C   1 
ATOM   2010 O O   . ILE A 1 270 ? 55.314  13.351  19.006  1.00 56.75  ? 270  ILE A O   1 
ATOM   2011 C CB  . ILE A 1 270 ? 54.994  10.304  17.826  1.00 52.88  ? 270  ILE A CB  1 
ATOM   2012 C CG1 . ILE A 1 270 ? 54.341  9.517   16.699  1.00 60.22  ? 270  ILE A CG1 1 
ATOM   2013 C CG2 . ILE A 1 270 ? 54.030  10.450  18.984  1.00 49.61  ? 270  ILE A CG2 1 
ATOM   2014 C CD1 . ILE A 1 270 ? 54.325  8.022   16.959  1.00 66.85  ? 270  ILE A CD1 1 
ATOM   2015 N N   . ALA A 1 271 ? 57.176  12.069  18.930  1.00 56.41  ? 271  ALA A N   1 
ATOM   2016 C CA  . ALA A 1 271 ? 57.840  12.747  20.034  1.00 54.84  ? 271  ALA A CA  1 
ATOM   2017 C C   . ALA A 1 271 ? 57.883  14.246  19.785  1.00 51.78  ? 271  ALA A C   1 
ATOM   2018 O O   . ALA A 1 271 ? 57.704  15.040  20.704  1.00 59.61  ? 271  ALA A O   1 
ATOM   2019 C CB  . ALA A 1 271 ? 59.241  12.204  20.228  1.00 46.23  ? 271  ALA A CB  1 
ATOM   2020 N N   . CYS A 1 272 ? 58.124  14.643  18.544  1.00 49.06  ? 272  CYS A N   1 
ATOM   2021 C CA  . CYS A 1 272 ? 58.172  16.065  18.243  1.00 56.25  ? 272  CYS A CA  1 
ATOM   2022 C C   . CYS A 1 272 ? 56.765  16.643  18.370  1.00 56.71  ? 272  CYS A C   1 
ATOM   2023 O O   . CYS A 1 272 ? 56.563  17.637  19.072  1.00 55.14  ? 272  CYS A O   1 
ATOM   2024 C CB  . CYS A 1 272 ? 58.797  16.337  16.864  1.00 54.59  ? 272  CYS A CB  1 
ATOM   2025 S SG  . CYS A 1 272 ? 58.392  17.973  16.143  1.00 100.98 ? 272  CYS A SG  1 
ATOM   2026 N N   . LEU A 1 273 ? 55.790  16.010  17.720  1.00 46.48  ? 273  LEU A N   1 
ATOM   2027 C CA  . LEU A 1 273 ? 54.401  16.448  17.855  1.00 52.64  ? 273  LEU A CA  1 
ATOM   2028 C C   . LEU A 1 273 ? 53.983  16.655  19.314  1.00 53.76  ? 273  LEU A C   1 
ATOM   2029 O O   . LEU A 1 273 ? 53.254  17.595  19.627  1.00 53.38  ? 273  LEU A O   1 
ATOM   2030 C CB  . LEU A 1 273 ? 53.446  15.462  17.187  1.00 51.37  ? 273  LEU A CB  1 
ATOM   2031 C CG  . LEU A 1 273 ? 53.354  15.611  15.674  1.00 56.58  ? 273  LEU A CG  1 
ATOM   2032 C CD1 . LEU A 1 273 ? 52.421  14.573  15.047  1.00 49.45  ? 273  LEU A CD1 1 
ATOM   2033 C CD2 . LEU A 1 273 ? 52.913  17.027  15.337  1.00 58.83  ? 273  LEU A CD2 1 
ATOM   2034 N N   . ARG A 1 274 ? 54.441  15.781  20.204  1.00 48.65  ? 274  ARG A N   1 
ATOM   2035 C CA  . ARG A 1 274 ? 54.021  15.857  21.591  1.00 49.21  ? 274  ARG A CA  1 
ATOM   2036 C C   . ARG A 1 274 ? 54.543  17.098  22.287  1.00 54.65  ? 274  ARG A C   1 
ATOM   2037 O O   . ARG A 1 274 ? 54.108  17.419  23.391  1.00 62.14  ? 274  ARG A O   1 
ATOM   2038 C CB  . ARG A 1 274 ? 54.392  14.595  22.361  1.00 39.61  ? 274  ARG A CB  1 
ATOM   2039 C CG  . ARG A 1 274 ? 53.400  13.472  22.138  1.00 48.26  ? 274  ARG A CG  1 
ATOM   2040 C CD  . ARG A 1 274 ? 53.541  12.455  23.229  1.00 59.24  ? 274  ARG A CD  1 
ATOM   2041 N NE  . ARG A 1 274 ? 54.948  12.140  23.357  1.00 67.89  ? 274  ARG A NE  1 
ATOM   2042 C CZ  . ARG A 1 274 ? 55.499  11.049  22.851  1.00 71.79  ? 274  ARG A CZ  1 
ATOM   2043 N NH1 . ARG A 1 274 ? 54.725  10.161  22.236  1.00 64.48  ? 274  ARG A NH1 1 
ATOM   2044 N NH2 . ARG A 1 274 ? 56.809  10.842  22.983  1.00 62.92  ? 274  ARG A NH2 1 
ATOM   2045 N N   . THR A 1 275 ? 55.446  17.814  21.628  1.00 51.74  ? 275  THR A N   1 
ATOM   2046 C CA  . THR A 1 275 ? 55.998  19.037  22.202  1.00 53.89  ? 275  THR A CA  1 
ATOM   2047 C C   . THR A 1 275 ? 55.273  20.279  21.727  1.00 47.53  ? 275  THR A C   1 
ATOM   2048 O O   . THR A 1 275 ? 55.451  21.344  22.292  1.00 60.08  ? 275  THR A O   1 
ATOM   2049 C CB  . THR A 1 275 ? 57.471  19.235  21.833  1.00 52.50  ? 275  THR A CB  1 
ATOM   2050 O OG1 . THR A 1 275 ? 57.577  19.398  20.416  1.00 61.17  ? 275  THR A OG1 1 
ATOM   2051 C CG2 . THR A 1 275 ? 58.296  18.060  22.263  1.00 42.09  ? 275  THR A CG2 1 
ATOM   2052 N N   . ARG A 1 276 ? 54.478  20.161  20.675  1.00 52.15  ? 276  ARG A N   1 
ATOM   2053 C CA  A ARG A 1 276 ? 53.756  21.308  20.137  0.50 53.65  ? 276  ARG A CA  1 
ATOM   2054 C CA  B ARG A 1 276 ? 53.772  21.322  20.150  0.50 53.85  ? 276  ARG A CA  1 
ATOM   2055 C C   . ARG A 1 276 ? 52.569  21.652  21.028  1.00 55.91  ? 276  ARG A C   1 
ATOM   2056 O O   . ARG A 1 276 ? 51.930  20.765  21.588  1.00 56.40  ? 276  ARG A O   1 
ATOM   2057 C CB  A ARG A 1 276 ? 53.289  21.021  18.709  0.50 52.13  ? 276  ARG A CB  1 
ATOM   2058 C CB  B ARG A 1 276 ? 53.353  21.096  18.698  0.50 51.93  ? 276  ARG A CB  1 
ATOM   2059 C CG  A ARG A 1 276 ? 54.432  20.779  17.736  0.50 54.68  ? 276  ARG A CG  1 
ATOM   2060 C CG  B ARG A 1 276 ? 54.503  20.683  17.785  0.50 54.64  ? 276  ARG A CG  1 
ATOM   2061 C CD  A ARG A 1 276 ? 55.180  22.074  17.463  0.50 60.73  ? 276  ARG A CD  1 
ATOM   2062 C CD  B ARG A 1 276 ? 55.226  21.877  17.153  0.50 60.84  ? 276  ARG A CD  1 
ATOM   2063 N NE  A ARG A 1 276 ? 56.498  21.851  16.876  0.50 65.90  ? 276  ARG A NE  1 
ATOM   2064 N NE  B ARG A 1 276 ? 55.853  22.776  18.124  0.50 61.09  ? 276  ARG A NE  1 
ATOM   2065 C CZ  A ARG A 1 276 ? 57.614  21.708  17.582  0.50 61.69  ? 276  ARG A CZ  1 
ATOM   2066 C CZ  B ARG A 1 276 ? 55.679  24.095  18.138  0.50 61.02  ? 276  ARG A CZ  1 
ATOM   2067 N NH1 A ARG A 1 276 ? 57.570  21.758  18.907  0.50 53.41  ? 276  ARG A NH1 1 
ATOM   2068 N NH1 B ARG A 1 276 ? 54.905  24.668  17.229  0.50 60.77  ? 276  ARG A NH1 1 
ATOM   2069 N NH2 A ARG A 1 276 ? 58.773  21.515  16.964  0.50 59.58  ? 276  ARG A NH2 1 
ATOM   2070 N NH2 B ARG A 1 276 ? 56.285  24.843  19.051  0.50 57.78  ? 276  ARG A NH2 1 
ATOM   2071 N N   . PRO A 1 277 ? 52.274  22.943  21.175  1.00 54.37  ? 277  PRO A N   1 
ATOM   2072 C CA  . PRO A 1 277 ? 51.129  23.317  21.999  1.00 56.39  ? 277  PRO A CA  1 
ATOM   2073 C C   . PRO A 1 277 ? 49.837  22.854  21.324  1.00 58.50  ? 277  PRO A C   1 
ATOM   2074 O O   . PRO A 1 277 ? 49.744  22.870  20.095  1.00 58.85  ? 277  PRO A O   1 
ATOM   2075 C CB  . PRO A 1 277 ? 51.198  24.850  22.017  1.00 58.79  ? 277  PRO A CB  1 
ATOM   2076 C CG  . PRO A 1 277 ? 52.552  25.198  21.490  1.00 51.67  ? 277  PRO A CG  1 
ATOM   2077 C CD  . PRO A 1 277 ? 52.921  24.110  20.560  1.00 53.14  ? 277  PRO A CD  1 
ATOM   2078 N N   . ALA A 1 278 ? 48.854  22.446  22.113  1.00 53.86  ? 278  ALA A N   1 
ATOM   2079 C CA  . ALA A 1 278 ? 47.601  21.957  21.556  1.00 52.90  ? 278  ALA A CA  1 
ATOM   2080 C C   . ALA A 1 278 ? 47.040  22.902  20.495  1.00 50.36  ? 278  ALA A C   1 
ATOM   2081 O O   . ALA A 1 278 ? 46.559  22.451  19.457  1.00 44.94  ? 278  ALA A O   1 
ATOM   2082 C CB  . ALA A 1 278 ? 46.574  21.702  22.661  1.00 51.59  ? 278  ALA A CB  1 
ATOM   2083 N N   . GLN A 1 279 ? 47.119  24.208  20.735  1.00 53.33  ? 279  GLN A N   1 
ATOM   2084 C CA  . GLN A 1 279 ? 46.556  25.151  19.770  1.00 47.73  ? 279  GLN A CA  1 
ATOM   2085 C C   . GLN A 1 279 ? 47.207  25.111  18.384  1.00 52.02  ? 279  GLN A C   1 
ATOM   2086 O O   . GLN A 1 279 ? 46.529  25.314  17.386  1.00 53.70  ? 279  GLN A O   1 
ATOM   2087 C CB  . GLN A 1 279 ? 46.551  26.578  20.304  1.00 45.17  ? 279  GLN A CB  1 
ATOM   2088 C CG  . GLN A 1 279 ? 45.688  27.520  19.463  1.00 50.02  ? 279  GLN A CG  1 
ATOM   2089 C CD  . GLN A 1 279 ? 44.200  27.137  19.452  1.00 53.09  ? 279  GLN A CD  1 
ATOM   2090 O OE1 . GLN A 1 279 ? 43.603  26.840  20.499  1.00 43.01  ? 279  GLN A OE1 1 
ATOM   2091 N NE2 . GLN A 1 279 ? 43.596  27.162  18.267  1.00 41.41  ? 279  GLN A NE2 1 
ATOM   2092 N N   . ASP A 1 280 ? 48.510  24.855  18.315  1.00 52.29  ? 280  ASP A N   1 
ATOM   2093 C CA  . ASP A 1 280 ? 49.178  24.702  17.024  1.00 52.13  ? 280  ASP A CA  1 
ATOM   2094 C C   . ASP A 1 280 ? 48.602  23.548  16.225  1.00 51.20  ? 280  ASP A C   1 
ATOM   2095 O O   . ASP A 1 280 ? 48.444  23.654  15.012  1.00 53.47  ? 280  ASP A O   1 
ATOM   2096 C CB  . ASP A 1 280 ? 50.673  24.453  17.199  1.00 61.38  ? 280  ASP A CB  1 
ATOM   2097 C CG  . ASP A 1 280 ? 51.473  25.729  17.278  1.00 80.25  ? 280  ASP A CG  1 
ATOM   2098 O OD1 . ASP A 1 280 ? 50.921  26.765  17.731  1.00 79.34  ? 280  ASP A OD1 1 
ATOM   2099 O OD2 . ASP A 1 280 ? 52.663  25.685  16.889  1.00 85.35  ? 280  ASP A OD2 1 
ATOM   2100 N N   . LEU A 1 281 ? 48.320  22.435  16.898  1.00 44.27  ? 281  LEU A N   1 
ATOM   2101 C CA  . LEU A 1 281 ? 47.751  21.279  16.219  1.00 50.46  ? 281  LEU A CA  1 
ATOM   2102 C C   . LEU A 1 281 ? 46.383  21.636  15.648  1.00 48.61  ? 281  LEU A C   1 
ATOM   2103 O O   . LEU A 1 281 ? 46.104  21.380  14.477  1.00 52.15  ? 281  LEU A O   1 
ATOM   2104 C CB  . LEU A 1 281 ? 47.662  20.072  17.158  1.00 51.77  ? 281  LEU A CB  1 
ATOM   2105 C CG  . LEU A 1 281 ? 48.994  19.615  17.772  1.00 52.70  ? 281  LEU A CG  1 
ATOM   2106 C CD1 . LEU A 1 281 ? 48.810  18.332  18.515  1.00 53.39  ? 281  LEU A CD1 1 
ATOM   2107 C CD2 . LEU A 1 281 ? 50.075  19.440  16.726  1.00 48.62  ? 281  LEU A CD2 1 
ATOM   2108 N N   . VAL A 1 282 ? 45.545  22.257  16.468  1.00 40.78  ? 282  VAL A N   1 
ATOM   2109 C CA  . VAL A 1 282 ? 44.226  22.680  16.028  1.00 47.69  ? 282  VAL A CA  1 
ATOM   2110 C C   . VAL A 1 282 ? 44.299  23.669  14.862  1.00 47.56  ? 282  VAL A C   1 
ATOM   2111 O O   . VAL A 1 282 ? 43.552  23.552  13.898  1.00 47.67  ? 282  VAL A O   1 
ATOM   2112 C CB  . VAL A 1 282 ? 43.442  23.311  17.177  1.00 49.58  ? 282  VAL A CB  1 
ATOM   2113 C CG1 . VAL A 1 282 ? 42.159  23.951  16.656  1.00 42.73  ? 282  VAL A CG1 1 
ATOM   2114 C CG2 . VAL A 1 282 ? 43.143  22.260  18.221  1.00 46.20  ? 282  VAL A CG2 1 
ATOM   2115 N N   . ASP A 1 283 ? 45.214  24.628  14.951  1.00 49.23  ? 283  ASP A N   1 
ATOM   2116 C CA  . ASP A 1 283 ? 45.370  25.662  13.926  1.00 46.06  ? 283  ASP A CA  1 
ATOM   2117 C C   . ASP A 1 283 ? 45.758  25.138  12.548  1.00 49.52  ? 283  ASP A C   1 
ATOM   2118 O O   . ASP A 1 283 ? 45.627  25.856  11.560  1.00 51.56  ? 283  ASP A O   1 
ATOM   2119 C CB  . ASP A 1 283 ? 46.377  26.726  14.377  1.00 47.06  ? 283  ASP A CB  1 
ATOM   2120 C CG  . ASP A 1 283 ? 45.810  27.656  15.460  1.00 63.59  ? 283  ASP A CG  1 
ATOM   2121 O OD1 . ASP A 1 283 ? 44.578  27.641  15.691  1.00 58.72  ? 283  ASP A OD1 1 
ATOM   2122 O OD2 . ASP A 1 283 ? 46.597  28.402  16.089  1.00 68.52  ? 283  ASP A OD2 1 
ATOM   2123 N N   . HIS A 1 284 ? 46.224  23.894  12.469  1.00 49.38  ? 284  HIS A N   1 
ATOM   2124 C CA  . HIS A 1 284 ? 46.639  23.340  11.183  1.00 44.91  ? 284  HIS A CA  1 
ATOM   2125 C C   . HIS A 1 284 ? 45.867  22.118  10.734  1.00 47.59  ? 284  HIS A C   1 
ATOM   2126 O O   . HIS A 1 284 ? 46.094  21.628  9.635   1.00 46.96  ? 284  HIS A O   1 
ATOM   2127 C CB  . HIS A 1 284 ? 48.138  23.024  11.186  1.00 55.65  ? 284  HIS A CB  1 
ATOM   2128 C CG  . HIS A 1 284 ? 48.994  24.245  11.219  1.00 54.94  ? 284  HIS A CG  1 
ATOM   2129 N ND1 . HIS A 1 284 ? 49.478  24.782  12.393  1.00 57.25  ? 284  HIS A ND1 1 
ATOM   2130 C CD2 . HIS A 1 284 ? 49.400  25.073  10.229  1.00 52.69  ? 284  HIS A CD2 1 
ATOM   2131 C CE1 . HIS A 1 284 ? 50.165  25.876  12.122  1.00 62.08  ? 284  HIS A CE1 1 
ATOM   2132 N NE2 . HIS A 1 284 ? 50.132  26.076  10.816  1.00 63.18  ? 284  HIS A NE2 1 
ATOM   2133 N N   . GLU A 1 285 ? 44.949  21.628  11.559  1.00 49.06  ? 285  GLU A N   1 
ATOM   2134 C CA  . GLU A 1 285 ? 44.316  20.354  11.244  1.00 52.53  ? 285  GLU A CA  1 
ATOM   2135 C C   . GLU A 1 285 ? 43.472  20.358  9.953   1.00 50.00  ? 285  GLU A C   1 
ATOM   2136 O O   . GLU A 1 285 ? 43.360  19.338  9.286   1.00 48.18  ? 285  GLU A O   1 
ATOM   2137 C CB  . GLU A 1 285 ? 43.533  19.808  12.435  1.00 42.57  ? 285  GLU A CB  1 
ATOM   2138 C CG  . GLU A 1 285 ? 42.095  20.241  12.480  1.00 59.52  ? 285  GLU A CG  1 
ATOM   2139 C CD  . GLU A 1 285 ? 41.315  19.504  13.560  1.00 69.85  ? 285  GLU A CD  1 
ATOM   2140 O OE1 . GLU A 1 285 ? 41.150  20.082  14.658  1.00 59.07  ? 285  GLU A OE1 1 
ATOM   2141 O OE2 . GLU A 1 285 ? 40.879  18.348  13.314  1.00 72.48  ? 285  GLU A OE2 1 
ATOM   2142 N N   . TRP A 1 286 ? 42.916  21.496  9.564   1.00 47.53  ? 286  TRP A N   1 
ATOM   2143 C CA  . TRP A 1 286 ? 42.092  21.503  8.353   1.00 50.16  ? 286  TRP A CA  1 
ATOM   2144 C C   . TRP A 1 286 ? 42.900  21.507  7.063   1.00 51.65  ? 286  TRP A C   1 
ATOM   2145 O O   . TRP A 1 286 ? 42.354  21.334  5.975   1.00 52.73  ? 286  TRP A O   1 
ATOM   2146 C CB  . TRP A 1 286 ? 41.113  22.676  8.360   1.00 53.26  ? 286  TRP A CB  1 
ATOM   2147 C CG  . TRP A 1 286 ? 40.012  22.494  9.352   1.00 62.02  ? 286  TRP A CG  1 
ATOM   2148 C CD1 . TRP A 1 286 ? 39.931  23.044  10.600  1.00 59.23  ? 286  TRP A CD1 1 
ATOM   2149 C CD2 . TRP A 1 286 ? 38.842  21.680  9.195   1.00 59.41  ? 286  TRP A CD2 1 
ATOM   2150 N NE1 . TRP A 1 286 ? 38.779  22.634  11.222  1.00 64.42  ? 286  TRP A NE1 1 
ATOM   2151 C CE2 . TRP A 1 286 ? 38.091  21.798  10.381  1.00 60.56  ? 286  TRP A CE2 1 
ATOM   2152 C CE3 . TRP A 1 286 ? 38.353  20.872  8.164   1.00 58.94  ? 286  TRP A CE3 1 
ATOM   2153 C CZ2 . TRP A 1 286 ? 36.874  21.140  10.563  1.00 60.97  ? 286  TRP A CZ2 1 
ATOM   2154 C CZ3 . TRP A 1 286 ? 37.144  20.221  8.342   1.00 58.98  ? 286  TRP A CZ3 1 
ATOM   2155 C CH2 . TRP A 1 286 ? 36.418  20.356  9.535   1.00 60.42  ? 286  TRP A CH2 1 
ATOM   2156 N N   . HIS A 1 287 ? 44.206  21.682  7.179   1.00 53.33  ? 287  HIS A N   1 
ATOM   2157 C CA  . HIS A 1 287 ? 45.030  21.851  5.994   1.00 51.73  ? 287  HIS A CA  1 
ATOM   2158 C C   . HIS A 1 287 ? 45.542  20.557  5.379   1.00 43.59  ? 287  HIS A C   1 
ATOM   2159 O O   . HIS A 1 287 ? 46.210  20.589  4.358   1.00 61.86  ? 287  HIS A O   1 
ATOM   2160 C CB  . HIS A 1 287 ? 46.198  22.791  6.283   1.00 57.56  ? 287  HIS A CB  1 
ATOM   2161 C CG  . HIS A 1 287 ? 45.782  24.102  6.871   1.00 63.51  ? 287  HIS A CG  1 
ATOM   2162 N ND1 . HIS A 1 287 ? 44.470  24.530  6.883   1.00 72.66  ? 287  HIS A ND1 1 
ATOM   2163 C CD2 . HIS A 1 287 ? 46.504  25.091  7.448   1.00 57.94  ? 287  HIS A CD2 1 
ATOM   2164 C CE1 . HIS A 1 287 ? 44.400  25.718  7.451   1.00 68.45  ? 287  HIS A CE1 1 
ATOM   2165 N NE2 . HIS A 1 287 ? 45.622  26.081  7.803   1.00 78.22  ? 287  HIS A NE2 1 
ATOM   2166 N N   . VAL A 1 288 ? 45.218  19.422  5.975   1.00 47.88  ? 288  VAL A N   1 
ATOM   2167 C CA  . VAL A 1 288 ? 45.766  18.161  5.494   1.00 44.04  ? 288  VAL A CA  1 
ATOM   2168 C C   . VAL A 1 288 ? 44.799  17.353  4.635   1.00 46.40  ? 288  VAL A C   1 
ATOM   2169 O O   . VAL A 1 288 ? 45.103  16.218  4.275   1.00 53.29  ? 288  VAL A O   1 
ATOM   2170 C CB  . VAL A 1 288 ? 46.264  17.279  6.661   1.00 49.61  ? 288  VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 288 ? 47.137  18.092  7.592   1.00 40.09  ? 288  VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 288 ? 45.082  16.650  7.414   1.00 39.06  ? 288  VAL A CG2 1 
ATOM   2173 N N   . LEU A 1 289 ? 43.641  17.925  4.309   1.00 52.06  ? 289  LEU A N   1 
ATOM   2174 C CA  . LEU A 1 289 ? 42.667  17.241  3.449   1.00 52.14  ? 289  LEU A CA  1 
ATOM   2175 C C   . LEU A 1 289 ? 43.112  17.199  1.989   1.00 51.04  ? 289  LEU A C   1 
ATOM   2176 O O   . LEU A 1 289 ? 43.619  18.183  1.462   1.00 51.62  ? 289  LEU A O   1 
ATOM   2177 C CB  . LEU A 1 289 ? 41.293  17.901  3.532   1.00 47.36  ? 289  LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 289 ? 40.490  17.757  4.820   1.00 53.73  ? 289  LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 289 ? 39.295  18.698  4.765   1.00 50.37  ? 289  LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 289 ? 40.045  16.316  5.031   1.00 49.04  ? 289  LEU A CD2 1 
ATOM   2181 N N   . PRO A 1 290 ? 42.880  16.059  1.323   1.00 57.69  ? 290  PRO A N   1 
ATOM   2182 C CA  . PRO A 1 290 ? 43.346  15.810  -0.045  1.00 55.80  ? 290  PRO A CA  1 
ATOM   2183 C C   . PRO A 1 290 ? 42.717  16.749  -1.070  1.00 59.75  ? 290  PRO A C   1 
ATOM   2184 O O   . PRO A 1 290 ? 43.390  17.127  -2.026  1.00 66.32  ? 290  PRO A O   1 
ATOM   2185 C CB  . PRO A 1 290 ? 42.895  14.364  -0.324  1.00 54.09  ? 290  PRO A CB  1 
ATOM   2186 C CG  . PRO A 1 290 ? 42.408  13.819  0.985   1.00 51.74  ? 290  PRO A CG  1 
ATOM   2187 C CD  . PRO A 1 290 ? 41.998  14.983  1.807   1.00 52.92  ? 290  PRO A CD  1 
ATOM   2188 N N   . GLN A 1 291 ? 41.444  17.096  -0.902  1.00 59.58  ? 291  GLN A N   1 
ATOM   2189 C CA  . GLN A 1 291 ? 40.791  17.999  -1.840  1.00 54.21  ? 291  GLN A CA  1 
ATOM   2190 C C   . GLN A 1 291 ? 39.945  18.999  -1.096  1.00 56.76  ? 291  GLN A C   1 
ATOM   2191 O O   . GLN A 1 291 ? 39.616  18.803  0.067   1.00 64.37  ? 291  GLN A O   1 
ATOM   2192 C CB  . GLN A 1 291 ? 39.904  17.233  -2.816  1.00 55.25  ? 291  GLN A CB  1 
ATOM   2193 C CG  . GLN A 1 291 ? 40.565  16.033  -3.468  1.00 60.29  ? 291  GLN A CG  1 
ATOM   2194 C CD  . GLN A 1 291 ? 40.333  14.745  -2.699  1.00 70.01  ? 291  GLN A CD  1 
ATOM   2195 O OE1 . GLN A 1 291 ? 40.900  13.698  -3.035  1.00 73.79  ? 291  GLN A OE1 1 
ATOM   2196 N NE2 . GLN A 1 291 ? 39.491  14.811  -1.661  1.00 63.79  ? 291  GLN A NE2 1 
ATOM   2197 N N   . GLU A 1 292 ? 39.606  20.085  -1.773  1.00 62.44  ? 292  GLU A N   1 
ATOM   2198 C CA  . GLU A 1 292 ? 38.593  20.999  -1.280  1.00 66.00  ? 292  GLU A CA  1 
ATOM   2199 C C   . GLU A 1 292 ? 37.297  20.194  -1.171  1.00 61.14  ? 292  GLU A C   1 
ATOM   2200 O O   . GLU A 1 292 ? 36.867  19.565  -2.134  1.00 55.94  ? 292  GLU A O   1 
ATOM   2201 C CB  . GLU A 1 292 ? 38.441  22.171  -2.252  1.00 68.98  ? 292  GLU A CB  1 
ATOM   2202 C CG  . GLU A 1 292 ? 37.648  23.360  -1.720  1.00 91.49  ? 292  GLU A CG  1 
ATOM   2203 C CD  . GLU A 1 292 ? 37.524  24.484  -2.747  1.00 102.48 ? 292  GLU A CD  1 
ATOM   2204 O OE1 . GLU A 1 292 ? 38.224  24.426  -3.785  1.00 96.66  ? 292  GLU A OE1 1 
ATOM   2205 O OE2 . GLU A 1 292 ? 36.728  25.424  -2.514  1.00 105.59 ? 292  GLU A OE2 1 
ATOM   2206 N N   . SER A 1 293 ? 36.681  20.181  0.004   1.00 59.69  ? 293  SER A N   1 
ATOM   2207 C CA  . SER A 1 293 ? 35.537  19.304  0.185   1.00 55.28  ? 293  SER A CA  1 
ATOM   2208 C C   . SER A 1 293 ? 34.626  19.752  1.309   1.00 52.70  ? 293  SER A C   1 
ATOM   2209 O O   . SER A 1 293 ? 35.028  20.517  2.175   1.00 50.10  ? 293  SER A O   1 
ATOM   2210 C CB  . SER A 1 293 ? 36.013  17.867  0.416   1.00 51.38  ? 293  SER A CB  1 
ATOM   2211 O OG  . SER A 1 293 ? 37.129  17.836  1.281   1.00 52.33  ? 293  SER A OG  1 
ATOM   2212 N N   . ILE A 1 294 ? 33.378  19.306  1.264   1.00 57.62  ? 294  ILE A N   1 
ATOM   2213 C CA  . ILE A 1 294 ? 32.509  19.428  2.426   1.00 61.49  ? 294  ILE A CA  1 
ATOM   2214 C C   . ILE A 1 294 ? 32.213  18.045  2.984   1.00 51.47  ? 294  ILE A C   1 
ATOM   2215 O O   . ILE A 1 294 ? 32.294  17.050  2.267   1.00 44.42  ? 294  ILE A O   1 
ATOM   2216 C CB  . ILE A 1 294 ? 31.189  20.154  2.121   1.00 55.80  ? 294  ILE A CB  1 
ATOM   2217 C CG1 . ILE A 1 294 ? 30.690  19.779  0.734   1.00 55.51  ? 294  ILE A CG1 1 
ATOM   2218 C CG2 . ILE A 1 294 ? 31.372  21.666  2.260   1.00 62.49  ? 294  ILE A CG2 1 
ATOM   2219 C CD1 . ILE A 1 294 ? 29.496  20.571  0.302   1.00 60.83  ? 294  ILE A CD1 1 
ATOM   2220 N N   . PHE A 1 295 ? 31.894  17.998  4.273   1.00 52.97  ? 295  PHE A N   1 
ATOM   2221 C CA  . PHE A 1 295 ? 31.558  16.758  4.940   1.00 42.00  ? 295  PHE A CA  1 
ATOM   2222 C C   . PHE A 1 295 ? 32.742  15.805  4.857   1.00 45.89  ? 295  PHE A C   1 
ATOM   2223 O O   . PHE A 1 295 ? 32.593  14.611  4.585   1.00 39.22  ? 295  PHE A O   1 
ATOM   2224 C CB  . PHE A 1 295 ? 30.315  16.137  4.307   1.00 42.38  ? 295  PHE A CB  1 
ATOM   2225 C CG  . PHE A 1 295 ? 29.393  15.526  5.305   1.00 52.50  ? 295  PHE A CG  1 
ATOM   2226 C CD1 . PHE A 1 295 ? 29.880  14.621  6.250   1.00 47.88  ? 295  PHE A CD1 1 
ATOM   2227 C CD2 . PHE A 1 295 ? 28.047  15.868  5.330   1.00 43.90  ? 295  PHE A CD2 1 
ATOM   2228 C CE1 . PHE A 1 295 ? 29.037  14.059  7.190   1.00 44.61  ? 295  PHE A CE1 1 
ATOM   2229 C CE2 . PHE A 1 295 ? 27.200  15.311  6.265   1.00 43.43  ? 295  PHE A CE2 1 
ATOM   2230 C CZ  . PHE A 1 295 ? 27.688  14.405  7.197   1.00 46.34  ? 295  PHE A CZ  1 
ATOM   2231 N N   . ARG A 1 296 ? 33.928  16.364  5.058   1.00 46.88  ? 296  ARG A N   1 
ATOM   2232 C CA  . ARG A 1 296 ? 35.151  15.584  5.115   1.00 40.89  ? 296  ARG A CA  1 
ATOM   2233 C C   . ARG A 1 296 ? 35.976  16.172  6.231   1.00 47.56  ? 296  ARG A C   1 
ATOM   2234 O O   . ARG A 1 296 ? 36.151  17.392  6.313   1.00 44.15  ? 296  ARG A O   1 
ATOM   2235 C CB  . ARG A 1 296 ? 35.924  15.658  3.810   1.00 35.10  ? 296  ARG A CB  1 
ATOM   2236 C CG  . ARG A 1 296 ? 35.273  14.949  2.657   1.00 37.17  ? 296  ARG A CG  1 
ATOM   2237 C CD  . ARG A 1 296 ? 35.264  13.440  2.829   1.00 44.15  ? 296  ARG A CD  1 
ATOM   2238 N NE  . ARG A 1 296 ? 34.693  12.821  1.636   1.00 48.90  ? 296  ARG A NE  1 
ATOM   2239 C CZ  . ARG A 1 296 ? 33.389  12.731  1.391   1.00 47.76  ? 296  ARG A CZ  1 
ATOM   2240 N NH1 . ARG A 1 296 ? 32.506  13.201  2.274   1.00 43.83  ? 296  ARG A NH1 1 
ATOM   2241 N NH2 . ARG A 1 296 ? 32.974  12.177  0.261   1.00 38.37  ? 296  ARG A NH2 1 
ATOM   2242 N N   . PHE A 1 297 ? 36.472  15.294  7.094   1.00 43.66  ? 297  PHE A N   1 
ATOM   2243 C CA  . PHE A 1 297 ? 37.216  15.713  8.269   1.00 42.69  ? 297  PHE A CA  1 
ATOM   2244 C C   . PHE A 1 297 ? 38.604  15.099  8.281   1.00 46.12  ? 297  PHE A C   1 
ATOM   2245 O O   . PHE A 1 297 ? 38.820  13.978  7.814   1.00 46.01  ? 297  PHE A O   1 
ATOM   2246 C CB  . PHE A 1 297 ? 36.417  15.366  9.508   1.00 41.18  ? 297  PHE A CB  1 
ATOM   2247 C CG  . PHE A 1 297 ? 34.959  15.620  9.337   1.00 47.16  ? 297  PHE A CG  1 
ATOM   2248 C CD1 . PHE A 1 297 ? 34.465  16.917  9.367   1.00 43.77  ? 297  PHE A CD1 1 
ATOM   2249 C CD2 . PHE A 1 297 ? 34.087  14.580  9.079   1.00 43.12  ? 297  PHE A CD2 1 
ATOM   2250 C CE1 . PHE A 1 297 ? 33.116  17.172  9.181   1.00 43.06  ? 297  PHE A CE1 1 
ATOM   2251 C CE2 . PHE A 1 297 ? 32.738  14.830  8.893   1.00 42.06  ? 297  PHE A CE2 1 
ATOM   2252 C CZ  . PHE A 1 297 ? 32.252  16.132  8.948   1.00 40.51  ? 297  PHE A CZ  1 
ATOM   2253 N N   . SER A 1 298 ? 39.551  15.859  8.798   1.00 47.81  ? 298  SER A N   1 
ATOM   2254 C CA  . SER A 1 298 ? 40.942  15.489  8.675   1.00 44.87  ? 298  SER A CA  1 
ATOM   2255 C C   . SER A 1 298 ? 41.314  14.249  9.475   1.00 48.63  ? 298  SER A C   1 
ATOM   2256 O O   . SER A 1 298 ? 42.014  13.371  8.969   1.00 48.16  ? 298  SER A O   1 
ATOM   2257 C CB  . SER A 1 298 ? 41.811  16.668  9.054   1.00 36.09  ? 298  SER A CB  1 
ATOM   2258 O OG  . SER A 1 298 ? 41.727  17.609  8.011   1.00 49.64  ? 298  SER A OG  1 
ATOM   2259 N N   . PHE A 1 299 ? 40.828  14.175  10.710  1.00 45.76  ? 299  PHE A N   1 
ATOM   2260 C CA  . PHE A 1 299 ? 41.223  13.112  11.631  1.00 46.71  ? 299  PHE A CA  1 
ATOM   2261 C C   . PHE A 1 299 ? 40.042  12.322  12.172  1.00 42.71  ? 299  PHE A C   1 
ATOM   2262 O O   . PHE A 1 299 ? 39.289  12.798  13.022  1.00 46.09  ? 299  PHE A O   1 
ATOM   2263 C CB  . PHE A 1 299 ? 42.109  13.677  12.743  1.00 39.83  ? 299  PHE A CB  1 
ATOM   2264 C CG  . PHE A 1 299 ? 43.418  14.190  12.227  1.00 45.67  ? 299  PHE A CG  1 
ATOM   2265 C CD1 . PHE A 1 299 ? 44.460  13.318  11.971  1.00 39.55  ? 299  PHE A CD1 1 
ATOM   2266 C CD2 . PHE A 1 299 ? 43.581  15.534  11.923  1.00 46.30  ? 299  PHE A CD2 1 
ATOM   2267 C CE1 . PHE A 1 299 ? 45.649  13.782  11.459  1.00 43.58  ? 299  PHE A CE1 1 
ATOM   2268 C CE2 . PHE A 1 299 ? 44.767  16.004  11.407  1.00 45.16  ? 299  PHE A CE2 1 
ATOM   2269 C CZ  . PHE A 1 299 ? 45.806  15.131  11.176  1.00 41.50  ? 299  PHE A CZ  1 
ATOM   2270 N N   . VAL A 1 300 ? 39.885  11.112  11.647  1.00 36.54  ? 300  VAL A N   1 
ATOM   2271 C CA  . VAL A 1 300 ? 38.730  10.280  11.945  1.00 37.35  ? 300  VAL A CA  1 
ATOM   2272 C C   . VAL A 1 300 ? 39.192  8.838   12.205  1.00 41.54  ? 300  VAL A C   1 
ATOM   2273 O O   . VAL A 1 300 ? 40.372  8.528   12.038  1.00 38.83  ? 300  VAL A O   1 
ATOM   2274 C CB  . VAL A 1 300 ? 37.688  10.351  10.801  1.00 36.60  ? 300  VAL A CB  1 
ATOM   2275 C CG1 . VAL A 1 300 ? 37.311  11.791  10.523  1.00 38.66  ? 300  VAL A CG1 1 
ATOM   2276 C CG2 . VAL A 1 300 ? 38.231  9.712   9.531   1.00 40.20  ? 300  VAL A CG2 1 
ATOM   2277 N N   . PRO A 1 301 ? 38.274  7.962   12.655  1.00 44.93  ? 301  PRO A N   1 
ATOM   2278 C CA  . PRO A 1 301 ? 38.658  6.562   12.844  1.00 34.96  ? 301  PRO A CA  1 
ATOM   2279 C C   . PRO A 1 301 ? 39.422  5.989   11.663  1.00 42.85  ? 301  PRO A C   1 
ATOM   2280 O O   . PRO A 1 301 ? 39.043  6.145   10.492  1.00 39.61  ? 301  PRO A O   1 
ATOM   2281 C CB  . PRO A 1 301 ? 37.315  5.868   13.023  1.00 39.64  ? 301  PRO A CB  1 
ATOM   2282 C CG  . PRO A 1 301 ? 36.494  6.901   13.766  1.00 40.37  ? 301  PRO A CG  1 
ATOM   2283 C CD  . PRO A 1 301 ? 36.912  8.228   13.168  1.00 43.14  ? 301  PRO A CD  1 
ATOM   2284 N N   . VAL A 1 302 ? 40.531  5.338   11.985  1.00 39.64  ? 302  VAL A N   1 
ATOM   2285 C CA  . VAL A 1 302 ? 41.338  4.687   10.968  1.00 50.46  ? 302  VAL A CA  1 
ATOM   2286 C C   . VAL A 1 302 ? 41.049  3.172   10.954  1.00 51.09  ? 302  VAL A C   1 
ATOM   2287 O O   . VAL A 1 302 ? 40.797  2.565   11.999  1.00 47.10  ? 302  VAL A O   1 
ATOM   2288 C CB  . VAL A 1 302 ? 42.857  4.987   11.169  1.00 44.02  ? 302  VAL A CB  1 
ATOM   2289 C CG1 . VAL A 1 302 ? 43.360  4.368   12.453  1.00 45.94  ? 302  VAL A CG1 1 
ATOM   2290 C CG2 . VAL A 1 302 ? 43.674  4.481   9.989   1.00 46.77  ? 302  VAL A CG2 1 
ATOM   2291 N N   . VAL A 1 303 ? 41.051  2.583   9.762   1.00 51.10  ? 303  VAL A N   1 
ATOM   2292 C CA  . VAL A 1 303 ? 40.926  1.134   9.610   1.00 56.42  ? 303  VAL A CA  1 
ATOM   2293 C C   . VAL A 1 303 ? 42.276  0.460   9.901   1.00 51.26  ? 303  VAL A C   1 
ATOM   2294 O O   . VAL A 1 303 ? 43.123  0.333   9.025   1.00 54.01  ? 303  VAL A O   1 
ATOM   2295 C CB  . VAL A 1 303 ? 40.456  0.744   8.194   1.00 46.72  ? 303  VAL A CB  1 
ATOM   2296 C CG1 . VAL A 1 303 ? 40.313  -0.756  8.101   1.00 56.80  ? 303  VAL A CG1 1 
ATOM   2297 C CG2 . VAL A 1 303 ? 39.138  1.401   7.868   1.00 50.56  ? 303  VAL A CG2 1 
ATOM   2298 N N   . ASP A 1 304 ? 42.464  0.027   11.138  1.00 54.67  ? 304  ASP A N   1 
ATOM   2299 C CA  . ASP A 1 304 ? 43.772  -0.399  11.612  1.00 56.00  ? 304  ASP A CA  1 
ATOM   2300 C C   . ASP A 1 304 ? 43.975  -1.917  11.688  1.00 56.11  ? 304  ASP A C   1 
ATOM   2301 O O   . ASP A 1 304 ? 45.031  -2.369  12.103  1.00 65.20  ? 304  ASP A O   1 
ATOM   2302 C CB  . ASP A 1 304 ? 44.086  0.254   12.981  1.00 46.54  ? 304  ASP A CB  1 
ATOM   2303 C CG  . ASP A 1 304 ? 43.018  -0.039  14.057  1.00 58.28  ? 304  ASP A CG  1 
ATOM   2304 O OD1 . ASP A 1 304 ? 41.906  -0.531  13.719  1.00 51.08  ? 304  ASP A OD1 1 
ATOM   2305 O OD2 . ASP A 1 304 ? 43.294  0.255   15.253  1.00 58.41  ? 304  ASP A OD2 1 
ATOM   2306 N N   . GLY A 1 305 ? 42.979  -2.700  11.290  1.00 54.70  ? 305  GLY A N   1 
ATOM   2307 C CA  . GLY A 1 305 ? 43.025  -4.130  11.527  1.00 59.31  ? 305  GLY A CA  1 
ATOM   2308 C C   . GLY A 1 305 ? 43.143  -4.453  13.015  1.00 72.99  ? 305  GLY A C   1 
ATOM   2309 O O   . GLY A 1 305 ? 43.761  -5.453  13.403  1.00 74.94  ? 305  GLY A O   1 
ATOM   2310 N N   . ASP A 1 306 ? 42.545  -3.600  13.848  1.00 68.49  ? 306  ASP A N   1 
ATOM   2311 C CA  . ASP A 1 306 ? 42.562  -3.759  15.305  1.00 58.21  ? 306  ASP A CA  1 
ATOM   2312 C C   . ASP A 1 306 ? 41.195  -3.388  15.890  1.00 60.91  ? 306  ASP A C   1 
ATOM   2313 O O   . ASP A 1 306 ? 40.321  -4.254  16.024  1.00 67.94  ? 306  ASP A O   1 
ATOM   2314 C CB  . ASP A 1 306 ? 43.668  -2.905  15.922  1.00 53.62  ? 306  ASP A CB  1 
ATOM   2315 C CG  . ASP A 1 306 ? 43.937  -3.247  17.382  1.00 70.61  ? 306  ASP A CG  1 
ATOM   2316 O OD1 . ASP A 1 306 ? 43.283  -4.181  17.906  1.00 65.03  ? 306  ASP A OD1 1 
ATOM   2317 O OD2 . ASP A 1 306 ? 44.810  -2.580  17.999  1.00 69.80  ? 306  ASP A OD2 1 
ATOM   2318 N N   . PHE A 1 307 ? 41.003  -2.114  16.238  1.00 56.30  ? 307  PHE A N   1 
ATOM   2319 C CA  . PHE A 1 307 ? 39.672  -1.654  16.629  1.00 52.54  ? 307  PHE A CA  1 
ATOM   2320 C C   . PHE A 1 307 ? 38.700  -2.020  15.511  1.00 54.19  ? 307  PHE A C   1 
ATOM   2321 O O   . PHE A 1 307 ? 37.680  -2.677  15.733  1.00 54.89  ? 307  PHE A O   1 
ATOM   2322 C CB  . PHE A 1 307 ? 39.627  -0.141  16.892  1.00 51.34  ? 307  PHE A CB  1 
ATOM   2323 C CG  . PHE A 1 307 ? 38.384  0.291   17.619  1.00 50.64  ? 307  PHE A CG  1 
ATOM   2324 C CD1 . PHE A 1 307 ? 37.176  0.398   16.944  1.00 47.33  ? 307  PHE A CD1 1 
ATOM   2325 C CD2 . PHE A 1 307 ? 38.409  0.529   18.993  1.00 51.72  ? 307  PHE A CD2 1 
ATOM   2326 C CE1 . PHE A 1 307 ? 36.020  0.742   17.611  1.00 41.81  ? 307  PHE A CE1 1 
ATOM   2327 C CE2 . PHE A 1 307 ? 37.256  0.885   19.671  1.00 47.67  ? 307  PHE A CE2 1 
ATOM   2328 C CZ  . PHE A 1 307 ? 36.056  0.991   18.975  1.00 47.59  ? 307  PHE A CZ  1 
ATOM   2329 N N   . LEU A 1 308 ? 39.038  -1.579  14.306  1.00 50.64  ? 308  LEU A N   1 
ATOM   2330 C CA  . LEU A 1 308 ? 38.328  -1.975  13.113  1.00 55.36  ? 308  LEU A CA  1 
ATOM   2331 C C   . LEU A 1 308 ? 39.196  -2.983  12.387  1.00 64.98  ? 308  LEU A C   1 
ATOM   2332 O O   . LEU A 1 308 ? 40.283  -2.642  11.917  1.00 64.70  ? 308  LEU A O   1 
ATOM   2333 C CB  . LEU A 1 308 ? 38.068  -0.763  12.228  1.00 53.15  ? 308  LEU A CB  1 
ATOM   2334 C CG  . LEU A 1 308 ? 37.006  0.193   12.762  1.00 59.40  ? 308  LEU A CG  1 
ATOM   2335 C CD1 . LEU A 1 308 ? 36.740  1.305   11.758  1.00 54.58  ? 308  LEU A CD1 1 
ATOM   2336 C CD2 . LEU A 1 308 ? 35.721  -0.573  13.083  1.00 54.49  ? 308  LEU A CD2 1 
ATOM   2337 N N   . SER A 1 309 ? 38.724  -4.223  12.305  1.00 61.13  ? 309  SER A N   1 
ATOM   2338 C CA  . SER A 1 309 ? 39.527  -5.302  11.741  1.00 63.76  ? 309  SER A CA  1 
ATOM   2339 C C   . SER A 1 309 ? 39.526  -5.251  10.213  1.00 64.86  ? 309  SER A C   1 
ATOM   2340 O O   . SER A 1 309 ? 40.476  -5.685  9.570   1.00 61.62  ? 309  SER A O   1 
ATOM   2341 C CB  . SER A 1 309 ? 39.019  -6.656  12.227  1.00 58.61  ? 309  SER A CB  1 
ATOM   2342 O OG  . SER A 1 309 ? 37.772  -6.960  11.628  1.00 65.47  ? 309  SER A OG  1 
ATOM   2343 N N   . ASP A 1 310 ? 38.455  -4.713  9.642   1.00 63.50  ? 310  ASP A N   1 
ATOM   2344 C CA  . ASP A 1 310 ? 38.361  -4.503  8.203   1.00 57.60  ? 310  ASP A CA  1 
ATOM   2345 C C   . ASP A 1 310 ? 37.535  -3.226  7.976   1.00 58.20  ? 310  ASP A C   1 
ATOM   2346 O O   . ASP A 1 310 ? 37.214  -2.538  8.937   1.00 56.47  ? 310  ASP A O   1 
ATOM   2347 C CB  . ASP A 1 310 ? 37.699  -5.712  7.551   1.00 57.57  ? 310  ASP A CB  1 
ATOM   2348 C CG  . ASP A 1 310 ? 38.023  -5.831  6.068   1.00 78.77  ? 310  ASP A CG  1 
ATOM   2349 O OD1 . ASP A 1 310 ? 38.518  -4.842  5.474   1.00 74.87  ? 310  ASP A OD1 1 
ATOM   2350 O OD2 . ASP A 1 310 ? 37.780  -6.918  5.493   1.00 82.93  ? 310  ASP A OD2 1 
ATOM   2351 N N   . THR A 1 311 ? 37.183  -2.895  6.735   1.00 53.20  ? 311  THR A N   1 
ATOM   2352 C CA  . THR A 1 311 ? 36.335  -1.726  6.531   1.00 53.61  ? 311  THR A CA  1 
ATOM   2353 C C   . THR A 1 311 ? 34.955  -2.002  7.071   1.00 57.97  ? 311  THR A C   1 
ATOM   2354 O O   . THR A 1 311 ? 34.489  -3.143  7.055   1.00 56.97  ? 311  THR A O   1 
ATOM   2355 C CB  . THR A 1 311 ? 36.161  -1.315  5.054   1.00 57.98  ? 311  THR A CB  1 
ATOM   2356 O OG1 . THR A 1 311 ? 35.354  -2.287  4.375   1.00 59.90  ? 311  THR A OG1 1 
ATOM   2357 C CG2 . THR A 1 311 ? 37.512  -1.120  4.349   1.00 38.09  ? 311  THR A CG2 1 
ATOM   2358 N N   . PRO A 1 312 ? 34.287  -0.949  7.549   1.00 60.37  ? 312  PRO A N   1 
ATOM   2359 C CA  . PRO A 1 312 ? 32.892  -1.058  7.977   1.00 59.16  ? 312  PRO A CA  1 
ATOM   2360 C C   . PRO A 1 312 ? 32.043  -1.637  6.850   1.00 57.95  ? 312  PRO A C   1 
ATOM   2361 O O   . PRO A 1 312 ? 31.152  -2.441  7.108   1.00 61.46  ? 312  PRO A O   1 
ATOM   2362 C CB  . PRO A 1 312 ? 32.497  0.397   8.249   1.00 45.60  ? 312  PRO A CB  1 
ATOM   2363 C CG  . PRO A 1 312 ? 33.763  1.072   8.536   1.00 59.15  ? 312  PRO A CG  1 
ATOM   2364 C CD  . PRO A 1 312 ? 34.804  0.419   7.690   1.00 51.87  ? 312  PRO A CD  1 
ATOM   2365 N N   . GLU A 1 313 ? 32.319  -1.227  5.615   1.00 60.88  ? 313  GLU A N   1 
ATOM   2366 C CA  . GLU A 1 313 ? 31.581  -1.739  4.464   1.00 66.51  ? 313  GLU A CA  1 
ATOM   2367 C C   . GLU A 1 313 ? 31.685  -3.265  4.452   1.00 67.04  ? 313  GLU A C   1 
ATOM   2368 O O   . GLU A 1 313 ? 30.685  -3.959  4.286   1.00 64.82  ? 313  GLU A O   1 
ATOM   2369 C CB  . GLU A 1 313 ? 32.110  -1.126  3.155   1.00 66.22  ? 313  GLU A CB  1 
ATOM   2370 C CG  . GLU A 1 313 ? 31.397  -1.598  1.873   1.00 84.18  ? 313  GLU A CG  1 
ATOM   2371 C CD  . GLU A 1 313 ? 32.194  -1.305  0.579   1.00 100.89 ? 313  GLU A CD  1 
ATOM   2372 O OE1 . GLU A 1 313 ? 33.423  -1.060  0.668   1.00 98.76  ? 313  GLU A OE1 1 
ATOM   2373 O OE2 . GLU A 1 313 ? 31.594  -1.325  -0.529  1.00 85.32  ? 313  GLU A OE2 1 
ATOM   2374 N N   . ALA A 1 314 ? 32.896  -3.777  4.661   1.00 59.72  ? 314  ALA A N   1 
ATOM   2375 C CA  . ALA A 1 314 ? 33.136  -5.216  4.684   1.00 58.72  ? 314  ALA A CA  1 
ATOM   2376 C C   . ALA A 1 314 ? 32.431  -5.873  5.858   1.00 62.53  ? 314  ALA A C   1 
ATOM   2377 O O   . ALA A 1 314 ? 31.668  -6.817  5.675   1.00 65.13  ? 314  ALA A O   1 
ATOM   2378 C CB  . ALA A 1 314 ? 34.630  -5.511  4.740   1.00 51.39  ? 314  ALA A CB  1 
ATOM   2379 N N   . LEU A 1 315 ? 32.691  -5.366  7.061   1.00 55.27  ? 315  LEU A N   1 
ATOM   2380 C CA  . LEU A 1 315 ? 32.144  -5.945  8.285   1.00 55.93  ? 315  LEU A CA  1 
ATOM   2381 C C   . LEU A 1 315 ? 30.605  -6.027  8.314   1.00 68.71  ? 315  LEU A C   1 
ATOM   2382 O O   . LEU A 1 315 ? 30.042  -7.019  8.782   1.00 71.82  ? 315  LEU A O   1 
ATOM   2383 C CB  . LEU A 1 315 ? 32.676  -5.210  9.517   1.00 53.17  ? 315  LEU A CB  1 
ATOM   2384 C CG  . LEU A 1 315 ? 34.201  -5.182  9.632   1.00 61.79  ? 315  LEU A CG  1 
ATOM   2385 C CD1 . LEU A 1 315 ? 34.667  -4.177  10.667  1.00 52.13  ? 315  LEU A CD1 1 
ATOM   2386 C CD2 . LEU A 1 315 ? 34.726  -6.555  9.962   1.00 53.01  ? 315  LEU A CD2 1 
ATOM   2387 N N   . ILE A 1 316 ? 29.915  -5.004  7.821   1.00 63.83  ? 316  ILE A N   1 
ATOM   2388 C CA  . ILE A 1 316 ? 28.457  -5.073  7.794   1.00 67.15  ? 316  ILE A CA  1 
ATOM   2389 C C   . ILE A 1 316 ? 27.967  -6.051  6.725   1.00 69.79  ? 316  ILE A C   1 
ATOM   2390 O O   . ILE A 1 316 ? 26.840  -6.532  6.792   1.00 76.12  ? 316  ILE A O   1 
ATOM   2391 C CB  . ILE A 1 316 ? 27.773  -3.685  7.584   1.00 61.73  ? 316  ILE A CB  1 
ATOM   2392 C CG1 . ILE A 1 316 ? 28.071  -3.127  6.191   1.00 67.39  ? 316  ILE A CG1 1 
ATOM   2393 C CG2 . ILE A 1 316 ? 28.179  -2.709  8.663   1.00 52.42  ? 316  ILE A CG2 1 
ATOM   2394 C CD1 . ILE A 1 316 ? 27.094  -2.042  5.733   1.00 66.96  ? 316  ILE A CD1 1 
ATOM   2395 N N   . ASN A 1 317 ? 28.812  -6.333  5.736   1.00 75.61  ? 317  ASN A N   1 
ATOM   2396 C CA  . ASN A 1 317 ? 28.425  -7.205  4.627   1.00 78.83  ? 317  ASN A CA  1 
ATOM   2397 C C   . ASN A 1 317 ? 28.560  -8.664  4.993   1.00 73.06  ? 317  ASN A C   1 
ATOM   2398 O O   . ASN A 1 317 ? 28.098  -9.530  4.265   1.00 79.75  ? 317  ASN A O   1 
ATOM   2399 C CB  . ASN A 1 317 ? 29.261  -6.928  3.372   1.00 72.52  ? 317  ASN A CB  1 
ATOM   2400 C CG  . ASN A 1 317 ? 28.772  -5.711  2.590   1.00 90.18  ? 317  ASN A CG  1 
ATOM   2401 O OD1 . ASN A 1 317 ? 27.830  -5.024  3.000   1.00 95.98  ? 317  ASN A OD1 1 
ATOM   2402 N ND2 . ASN A 1 317 ? 29.421  -5.436  1.458   1.00 93.54  ? 317  ASN A ND2 1 
ATOM   2403 N N   . THR A 1 318 ? 29.190  -8.937  6.126   1.00 69.79  ? 318  THR A N   1 
ATOM   2404 C CA  . THR A 1 318 ? 29.533  -10.309 6.454   1.00 72.62  ? 318  THR A CA  1 
ATOM   2405 C C   . THR A 1 318 ? 29.283  -10.711 7.910   1.00 78.09  ? 318  THR A C   1 
ATOM   2406 O O   . THR A 1 318 ? 29.325  -11.893 8.233   1.00 89.65  ? 318  THR A O   1 
ATOM   2407 C CB  . THR A 1 318 ? 31.007  -10.596 6.115   1.00 75.17  ? 318  THR A CB  1 
ATOM   2408 O OG1 . THR A 1 318 ? 31.857  -9.982  7.096   1.00 68.32  ? 318  THR A OG1 1 
ATOM   2409 C CG2 . THR A 1 318 ? 31.344  -10.063 4.735   1.00 73.16  ? 318  THR A CG2 1 
ATOM   2410 N N   . GLY A 1 319 ? 29.026  -9.750  8.789   1.00 73.47  ? 319  GLY A N   1 
ATOM   2411 C CA  . GLY A 1 319 ? 28.848  -10.068 10.198  1.00 76.22  ? 319  GLY A CA  1 
ATOM   2412 C C   . GLY A 1 319 ? 27.478  -10.640 10.524  1.00 76.49  ? 319  GLY A C   1 
ATOM   2413 O O   . GLY A 1 319 ? 26.507  -10.412 9.799   1.00 78.43  ? 319  GLY A O   1 
ATOM   2414 N N   . ASP A 1 320 ? 27.390  -11.391 11.616  1.00 78.75  ? 320  ASP A N   1 
ATOM   2415 C CA  . ASP A 1 320 ? 26.106  -11.923 12.055  1.00 74.24  ? 320  ASP A CA  1 
ATOM   2416 C C   . ASP A 1 320 ? 25.489  -10.999 13.092  1.00 77.13  ? 320  ASP A C   1 
ATOM   2417 O O   . ASP A 1 320 ? 26.111  -10.722 14.120  1.00 77.96  ? 320  ASP A O   1 
ATOM   2418 C CB  . ASP A 1 320 ? 26.267  -13.319 12.652  1.00 79.04  ? 320  ASP A CB  1 
ATOM   2419 C CG  . ASP A 1 320 ? 24.967  -13.854 13.231  1.00 90.45  ? 320  ASP A CG  1 
ATOM   2420 O OD1 . ASP A 1 320 ? 23.980  -13.991 12.469  1.00 93.90  ? 320  ASP A OD1 1 
ATOM   2421 O OD2 . ASP A 1 320 ? 24.934  -14.136 14.448  1.00 88.11  ? 320  ASP A OD2 1 
ATOM   2422 N N   . PHE A 1 321 ? 24.265  -10.538 12.833  1.00 73.33  ? 321  PHE A N   1 
ATOM   2423 C CA  . PHE A 1 321 ? 23.610  -9.580  13.727  1.00 75.50  ? 321  PHE A CA  1 
ATOM   2424 C C   . PHE A 1 321 ? 22.303  -10.101 14.321  1.00 79.80  ? 321  PHE A C   1 
ATOM   2425 O O   . PHE A 1 321 ? 21.353  -9.345  14.550  1.00 76.81  ? 321  PHE A O   1 
ATOM   2426 C CB  . PHE A 1 321 ? 23.431  -8.225  13.025  1.00 74.45  ? 321  PHE A CB  1 
ATOM   2427 C CG  . PHE A 1 321 ? 24.719  -7.667  12.482  1.00 70.29  ? 321  PHE A CG  1 
ATOM   2428 C CD1 . PHE A 1 321 ? 25.710  -7.218  13.344  1.00 67.02  ? 321  PHE A CD1 1 
ATOM   2429 C CD2 . PHE A 1 321 ? 24.958  -7.631  11.121  1.00 67.43  ? 321  PHE A CD2 1 
ATOM   2430 C CE1 . PHE A 1 321 ? 26.904  -6.733  12.857  1.00 66.41  ? 321  PHE A CE1 1 
ATOM   2431 C CE2 . PHE A 1 321 ? 26.148  -7.147  10.630  1.00 66.98  ? 321  PHE A CE2 1 
ATOM   2432 C CZ  . PHE A 1 321 ? 27.123  -6.699  11.497  1.00 65.39  ? 321  PHE A CZ  1 
ATOM   2433 N N   . GLN A 1 322 ? 22.283  -11.403 14.588  1.00 80.83  ? 322  GLN A N   1 
ATOM   2434 C CA  . GLN A 1 322 ? 21.145  -12.052 15.212  1.00 80.88  ? 322  GLN A CA  1 
ATOM   2435 C C   . GLN A 1 322 ? 20.740  -11.316 16.491  1.00 81.59  ? 322  GLN A C   1 
ATOM   2436 O O   . GLN A 1 322 ? 19.585  -10.913 16.662  1.00 80.03  ? 322  GLN A O   1 
ATOM   2437 C CB  . GLN A 1 322 ? 21.512  -13.496 15.557  1.00 92.28  ? 322  GLN A CB  1 
ATOM   2438 C CG  . GLN A 1 322 ? 20.544  -14.543 15.024  1.00 102.27 ? 322  GLN A CG  1 
ATOM   2439 C CD  . GLN A 1 322 ? 20.929  -15.039 13.635  1.00 107.92 ? 322  GLN A CD  1 
ATOM   2440 O OE1 . GLN A 1 322 ? 20.260  -14.729 12.645  1.00 98.66  ? 322  GLN A OE1 1 
ATOM   2441 N NE2 . GLN A 1 322 ? 22.021  -15.806 13.557  1.00 93.16  ? 322  GLN A NE2 1 
ATOM   2442 N N   . ASP A 1 323 ? 21.706  -11.129 17.382  1.00 72.86  ? 323  ASP A N   1 
ATOM   2443 C CA  . ASP A 1 323 ? 21.409  -10.661 18.733  1.00 86.96  ? 323  ASP A CA  1 
ATOM   2444 C C   . ASP A 1 323 ? 21.208  -9.149  18.872  1.00 84.44  ? 323  ASP A C   1 
ATOM   2445 O O   . ASP A 1 323 ? 21.319  -8.609  19.973  1.00 85.79  ? 323  ASP A O   1 
ATOM   2446 C CB  . ASP A 1 323 ? 22.512  -11.118 19.694  1.00 84.79  ? 323  ASP A CB  1 
ATOM   2447 N N   . LEU A 1 324 ? 20.890  -8.463  17.779  1.00 84.84  ? 324  LEU A N   1 
ATOM   2448 C CA  . LEU A 1 324 ? 20.990  -7.006  17.792  1.00 75.72  ? 324  LEU A CA  1 
ATOM   2449 C C   . LEU A 1 324 ? 19.718  -6.246  17.466  1.00 67.08  ? 324  LEU A C   1 
ATOM   2450 O O   . LEU A 1 324 ? 19.094  -6.488  16.434  1.00 67.68  ? 324  LEU A O   1 
ATOM   2451 C CB  . LEU A 1 324 ? 22.088  -6.551  16.830  1.00 77.81  ? 324  LEU A CB  1 
ATOM   2452 C CG  . LEU A 1 324 ? 22.476  -5.081  16.975  1.00 70.14  ? 324  LEU A CG  1 
ATOM   2453 C CD1 . LEU A 1 324 ? 23.159  -4.828  18.324  1.00 64.02  ? 324  LEU A CD1 1 
ATOM   2454 C CD2 . LEU A 1 324 ? 23.359  -4.668  15.821  1.00 65.00  ? 324  LEU A CD2 1 
ATOM   2455 N N   . GLN A 1 325 ? 19.363  -5.307  18.343  1.00 59.60  ? 325  GLN A N   1 
ATOM   2456 C CA  . GLN A 1 325 ? 18.318  -4.332  18.048  1.00 61.87  ? 325  GLN A CA  1 
ATOM   2457 C C   . GLN A 1 325 ? 18.882  -2.922  17.820  1.00 61.29  ? 325  GLN A C   1 
ATOM   2458 O O   . GLN A 1 325 ? 19.725  -2.427  18.576  1.00 51.82  ? 325  GLN A O   1 
ATOM   2459 C CB  . GLN A 1 325 ? 17.263  -4.284  19.150  1.00 63.69  ? 325  GLN A CB  1 
ATOM   2460 C CG  . GLN A 1 325 ? 16.525  -5.584  19.389  1.00 68.59  ? 325  GLN A CG  1 
ATOM   2461 C CD  . GLN A 1 325 ? 17.045  -6.312  20.601  1.00 74.26  ? 325  GLN A CD  1 
ATOM   2462 O OE1 . GLN A 1 325 ? 17.036  -5.778  21.716  1.00 67.81  ? 325  GLN A OE1 1 
ATOM   2463 N NE2 . GLN A 1 325 ? 17.514  -7.538  20.394  1.00 88.23  ? 325  GLN A NE2 1 
ATOM   2464 N N   . VAL A 1 326 ? 18.380  -2.271  16.781  1.00 56.31  ? 326  VAL A N   1 
ATOM   2465 C CA  . VAL A 1 326 ? 18.901  -0.983  16.365  1.00 54.67  ? 326  VAL A CA  1 
ATOM   2466 C C   . VAL A 1 326 ? 17.801  -0.059  15.863  1.00 55.39  ? 326  VAL A C   1 
ATOM   2467 O O   . VAL A 1 326 ? 16.932  -0.457  15.081  1.00 53.41  ? 326  VAL A O   1 
ATOM   2468 C CB  . VAL A 1 326 ? 19.939  -1.140  15.236  1.00 54.09  ? 326  VAL A CB  1 
ATOM   2469 C CG1 . VAL A 1 326 ? 20.380  0.208   14.764  1.00 61.85  ? 326  VAL A CG1 1 
ATOM   2470 C CG2 . VAL A 1 326 ? 21.139  -1.920  15.719  1.00 61.03  ? 326  VAL A CG2 1 
ATOM   2471 N N   . LEU A 1 327 ? 17.848  1.184   16.318  1.00 50.51  ? 327  LEU A N   1 
ATOM   2472 C CA  . LEU A 1 327 ? 17.003  2.228   15.779  1.00 46.56  ? 327  LEU A CA  1 
ATOM   2473 C C   . LEU A 1 327 ? 17.914  3.153   14.969  1.00 51.19  ? 327  LEU A C   1 
ATOM   2474 O O   . LEU A 1 327 ? 18.974  3.554   15.450  1.00 50.97  ? 327  LEU A O   1 
ATOM   2475 C CB  . LEU A 1 327 ? 16.306  2.964   16.923  1.00 47.20  ? 327  LEU A CB  1 
ATOM   2476 C CG  . LEU A 1 327 ? 15.397  4.129   16.544  1.00 58.68  ? 327  LEU A CG  1 
ATOM   2477 C CD1 . LEU A 1 327 ? 14.817  3.916   15.160  1.00 61.32  ? 327  LEU A CD1 1 
ATOM   2478 C CD2 . LEU A 1 327 ? 14.293  4.265   17.557  1.00 57.11  ? 327  LEU A CD2 1 
ATOM   2479 N N   . VAL A 1 328 ? 17.534  3.447   13.727  1.00 49.25  ? 328  VAL A N   1 
ATOM   2480 C CA  . VAL A 1 328 ? 18.328  4.327   12.862  1.00 49.08  ? 328  VAL A CA  1 
ATOM   2481 C C   . VAL A 1 328 ? 17.442  5.324   12.139  1.00 49.21  ? 328  VAL A C   1 
ATOM   2482 O O   . VAL A 1 328 ? 16.309  5.013   11.795  1.00 56.70  ? 328  VAL A O   1 
ATOM   2483 C CB  . VAL A 1 328 ? 19.132  3.549   11.792  1.00 48.63  ? 328  VAL A CB  1 
ATOM   2484 C CG1 . VAL A 1 328 ? 19.957  2.456   12.427  1.00 53.06  ? 328  VAL A CG1 1 
ATOM   2485 C CG2 . VAL A 1 328 ? 18.206  2.960   10.757  1.00 46.16  ? 328  VAL A CG2 1 
ATOM   2486 N N   . GLY A 1 329 ? 17.954  6.525   11.891  1.00 52.18  ? 329  GLY A N   1 
ATOM   2487 C CA  . GLY A 1 329 ? 17.174  7.503   11.161  1.00 42.81  ? 329  GLY A CA  1 
ATOM   2488 C C   . GLY A 1 329 ? 17.954  8.673   10.615  1.00 51.24  ? 329  GLY A C   1 
ATOM   2489 O O   . GLY A 1 329 ? 19.175  8.736   10.738  1.00 56.73  ? 329  GLY A O   1 
ATOM   2490 N N   . VAL A 1 330 ? 17.228  9.612   10.018  1.00 48.53  ? 330  VAL A N   1 
ATOM   2491 C CA  . VAL A 1 330 ? 17.814  10.767  9.367   1.00 47.88  ? 330  VAL A CA  1 
ATOM   2492 C C   . VAL A 1 330 ? 16.835  11.919  9.478   1.00 49.07  ? 330  VAL A C   1 
ATOM   2493 O O   . VAL A 1 330 ? 15.653  11.708  9.723   1.00 46.29  ? 330  VAL A O   1 
ATOM   2494 C CB  . VAL A 1 330 ? 18.049  10.499  7.869   1.00 49.64  ? 330  VAL A CB  1 
ATOM   2495 C CG1 . VAL A 1 330 ? 18.984  9.298   7.663   1.00 39.03  ? 330  VAL A CG1 1 
ATOM   2496 C CG2 . VAL A 1 330 ? 16.712  10.303  7.159   1.00 37.89  ? 330  VAL A CG2 1 
ATOM   2497 N N   . VAL A 1 331 ? 17.324  13.140  9.303   1.00 47.82  ? 331  VAL A N   1 
ATOM   2498 C CA  . VAL A 1 331 ? 16.445  14.301  9.273   1.00 46.72  ? 331  VAL A CA  1 
ATOM   2499 C C   . VAL A 1 331 ? 16.136  14.637  7.817   1.00 53.73  ? 331  VAL A C   1 
ATOM   2500 O O   . VAL A 1 331 ? 16.789  14.123  6.905   1.00 52.75  ? 331  VAL A O   1 
ATOM   2501 C CB  . VAL A 1 331 ? 17.068  15.501  9.991   1.00 47.24  ? 331  VAL A CB  1 
ATOM   2502 C CG1 . VAL A 1 331 ? 17.458  15.105  11.410  1.00 45.50  ? 331  VAL A CG1 1 
ATOM   2503 C CG2 . VAL A 1 331 ? 18.272  16.021  9.219   1.00 46.92  ? 331  VAL A CG2 1 
ATOM   2504 N N   . LYS A 1 332 ? 15.130  15.471  7.591   1.00 52.35  ? 332  LYS A N   1 
ATOM   2505 C CA  . LYS A 1 332 ? 14.680  15.725  6.228   1.00 55.37  ? 332  LYS A CA  1 
ATOM   2506 C C   . LYS A 1 332 ? 15.771  16.376  5.384   1.00 57.17  ? 332  LYS A C   1 
ATOM   2507 O O   . LYS A 1 332 ? 15.902  16.083  4.199   1.00 53.76  ? 332  LYS A O   1 
ATOM   2508 C CB  . LYS A 1 332 ? 13.412  16.583  6.204   1.00 57.27  ? 332  LYS A CB  1 
ATOM   2509 C CG  . LYS A 1 332 ? 12.665  16.521  4.877   1.00 54.98  ? 332  LYS A CG  1 
ATOM   2510 C CD  . LYS A 1 332 ? 11.277  17.153  4.985   1.00 70.71  ? 332  LYS A CD  1 
ATOM   2511 C CE  . LYS A 1 332 ? 11.216  18.573  4.387   1.00 79.11  ? 332  LYS A CE  1 
ATOM   2512 N NZ  . LYS A 1 332 ? 11.688  19.676  5.291   1.00 68.01  ? 332  LYS A NZ  1 
ATOM   2513 N N   . ASP A 1 333 ? 16.568  17.246  5.993   1.00 52.94  ? 333  ASP A N   1 
ATOM   2514 C CA  . ASP A 1 333 ? 17.557  17.994  5.216   1.00 52.51  ? 333  ASP A CA  1 
ATOM   2515 C C   . ASP A 1 333 ? 18.990  17.837  5.715   1.00 53.37  ? 333  ASP A C   1 
ATOM   2516 O O   . ASP A 1 333 ? 19.613  18.792  6.194   1.00 52.68  ? 333  ASP A O   1 
ATOM   2517 C CB  . ASP A 1 333 ? 17.150  19.460  5.141   1.00 49.34  ? 333  ASP A CB  1 
ATOM   2518 C CG  . ASP A 1 333 ? 15.809  19.638  4.467   1.00 57.20  ? 333  ASP A CG  1 
ATOM   2519 O OD1 . ASP A 1 333 ? 14.786  19.788  5.179   1.00 60.34  ? 333  ASP A OD1 1 
ATOM   2520 O OD2 . ASP A 1 333 ? 15.780  19.587  3.219   1.00 60.82  ? 333  ASP A OD2 1 
ATOM   2521 N N   . GLU A 1 334 ? 19.500  16.619  5.578   1.00 48.43  ? 334  GLU A N   1 
ATOM   2522 C CA  . GLU A 1 334 ? 20.832  16.259  6.048   1.00 52.24  ? 334  GLU A CA  1 
ATOM   2523 C C   . GLU A 1 334 ? 21.956  17.163  5.536   1.00 50.36  ? 334  GLU A C   1 
ATOM   2524 O O   . GLU A 1 334 ? 22.911  17.439  6.259   1.00 49.23  ? 334  GLU A O   1 
ATOM   2525 C CB  . GLU A 1 334 ? 21.132  14.806  5.671   1.00 49.65  ? 334  GLU A CB  1 
ATOM   2526 C CG  . GLU A 1 334 ? 20.327  13.782  6.455   1.00 49.12  ? 334  GLU A CG  1 
ATOM   2527 C CD  . GLU A 1 334 ? 20.655  13.806  7.936   1.00 57.93  ? 334  GLU A CD  1 
ATOM   2528 O OE1 . GLU A 1 334 ? 21.661  14.459  8.300   1.00 50.57  ? 334  GLU A OE1 1 
ATOM   2529 O OE2 . GLU A 1 334 ? 19.908  13.178  8.732   1.00 57.08  ? 334  GLU A OE2 1 
ATOM   2530 N N   . GLY A 1 335 ? 21.845  17.623  4.295   1.00 49.13  ? 335  GLY A N   1 
ATOM   2531 C CA  . GLY A 1 335 ? 22.944  18.326  3.664   1.00 49.66  ? 335  GLY A CA  1 
ATOM   2532 C C   . GLY A 1 335 ? 23.026  19.834  3.845   1.00 51.44  ? 335  GLY A C   1 
ATOM   2533 O O   . GLY A 1 335 ? 24.115  20.397  3.776   1.00 51.36  ? 335  GLY A O   1 
ATOM   2534 N N   . SER A 1 336 ? 21.892  20.494  4.063   1.00 48.54  ? 336  SER A N   1 
ATOM   2535 C CA  . SER A 1 336 ? 21.848  21.960  3.983   1.00 52.50  ? 336  SER A CA  1 
ATOM   2536 C C   . SER A 1 336 ? 22.892  22.670  4.861   1.00 51.26  ? 336  SER A C   1 
ATOM   2537 O O   . SER A 1 336 ? 23.553  23.601  4.411   1.00 52.26  ? 336  SER A O   1 
ATOM   2538 C CB  . SER A 1 336 ? 20.439  22.476  4.295   1.00 52.72  ? 336  SER A CB  1 
ATOM   2539 O OG  . SER A 1 336 ? 20.112  22.283  5.657   1.00 56.78  ? 336  SER A OG  1 
ATOM   2540 N N   . TYR A 1 337 ? 23.029  22.212  6.103   1.00 50.61  ? 337  TYR A N   1 
ATOM   2541 C CA  . TYR A 1 337 ? 23.992  22.744  7.073   1.00 54.67  ? 337  TYR A CA  1 
ATOM   2542 C C   . TYR A 1 337 ? 25.400  22.924  6.496   1.00 52.13  ? 337  TYR A C   1 
ATOM   2543 O O   . TYR A 1 337 ? 26.079  23.914  6.764   1.00 55.70  ? 337  TYR A O   1 
ATOM   2544 C CB  . TYR A 1 337 ? 24.056  21.812  8.289   1.00 54.17  ? 337  TYR A CB  1 
ATOM   2545 C CG  . TYR A 1 337 ? 24.715  22.406  9.499   1.00 47.86  ? 337  TYR A CG  1 
ATOM   2546 C CD1 . TYR A 1 337 ? 23.956  22.899  10.546  1.00 48.96  ? 337  TYR A CD1 1 
ATOM   2547 C CD2 . TYR A 1 337 ? 26.094  22.462  9.604   1.00 52.57  ? 337  TYR A CD2 1 
ATOM   2548 C CE1 . TYR A 1 337 ? 24.554  23.448  11.664  1.00 54.10  ? 337  TYR A CE1 1 
ATOM   2549 C CE2 . TYR A 1 337 ? 26.709  23.015  10.716  1.00 56.22  ? 337  TYR A CE2 1 
ATOM   2550 C CZ  . TYR A 1 337 ? 25.934  23.513  11.745  1.00 60.30  ? 337  TYR A CZ  1 
ATOM   2551 O OH  . TYR A 1 337 ? 26.535  24.062  12.866  1.00 54.71  ? 337  TYR A OH  1 
ATOM   2552 N N   . PHE A 1 338 ? 25.832  21.964  5.692   1.00 51.49  ? 338  PHE A N   1 
ATOM   2553 C CA  . PHE A 1 338 ? 27.198  21.957  5.181   1.00 55.57  ? 338  PHE A CA  1 
ATOM   2554 C C   . PHE A 1 338 ? 27.447  22.963  4.061   1.00 58.65  ? 338  PHE A C   1 
ATOM   2555 O O   . PHE A 1 338 ? 28.556  23.490  3.921   1.00 55.89  ? 338  PHE A O   1 
ATOM   2556 C CB  . PHE A 1 338 ? 27.576  20.536  4.760   1.00 48.73  ? 338  PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 338 ? 27.480  19.556  5.886   1.00 53.46  ? 338  PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 338 ? 26.257  19.001  6.234   1.00 57.79  ? 338  PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 338 ? 28.595  19.245  6.646   1.00 49.37  ? 338  PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 338 ? 26.155  18.124  7.304   1.00 57.14  ? 338  PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 338 ? 28.503  18.375  7.710   1.00 50.89  ? 338  PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 338 ? 27.284  17.813  8.042   1.00 56.55  ? 338  PHE A CZ  1 
ATOM   2563 N N   . LEU A 1 339 ? 26.411  23.241  3.277   1.00 48.74  ? 339  LEU A N   1 
ATOM   2564 C CA  . LEU A 1 339 ? 26.566  24.108  2.125   1.00 49.28  ? 339  LEU A CA  1 
ATOM   2565 C C   . LEU A 1 339 ? 27.100  25.499  2.487   1.00 56.61  ? 339  LEU A C   1 
ATOM   2566 O O   . LEU A 1 339 ? 27.855  26.086  1.715   1.00 57.61  ? 339  LEU A O   1 
ATOM   2567 C CB  . LEU A 1 339 ? 25.249  24.213  1.367   1.00 50.71  ? 339  LEU A CB  1 
ATOM   2568 C CG  . LEU A 1 339 ? 24.647  22.858  1.023   1.00 50.97  ? 339  LEU A CG  1 
ATOM   2569 C CD1 . LEU A 1 339 ? 23.442  23.027  0.125   1.00 46.76  ? 339  LEU A CD1 1 
ATOM   2570 C CD2 . LEU A 1 339 ? 25.702  21.980  0.358   1.00 54.04  ? 339  LEU A CD2 1 
ATOM   2571 N N   . VAL A 1 340 ? 26.724  26.019  3.654   1.00 49.17  ? 340  VAL A N   1 
ATOM   2572 C CA  . VAL A 1 340 ? 27.108  27.380  4.027   1.00 51.95  ? 340  VAL A CA  1 
ATOM   2573 C C   . VAL A 1 340 ? 28.548  27.447  4.505   1.00 54.83  ? 340  VAL A C   1 
ATOM   2574 O O   . VAL A 1 340 ? 29.093  28.526  4.712   1.00 53.70  ? 340  VAL A O   1 
ATOM   2575 C CB  . VAL A 1 340 ? 26.190  27.973  5.116   1.00 50.87  ? 340  VAL A CB  1 
ATOM   2576 C CG1 . VAL A 1 340 ? 24.757  28.032  4.627   1.00 48.39  ? 340  VAL A CG1 1 
ATOM   2577 C CG2 . VAL A 1 340 ? 26.292  27.158  6.394   1.00 53.32  ? 340  VAL A CG2 1 
ATOM   2578 N N   . TYR A 1 341 ? 29.166  26.288  4.686   1.00 55.44  ? 341  TYR A N   1 
ATOM   2579 C CA  . TYR A 1 341 ? 30.576  26.251  5.034   1.00 58.52  ? 341  TYR A CA  1 
ATOM   2580 C C   . TYR A 1 341 ? 31.443  26.086  3.803   1.00 62.05  ? 341  TYR A C   1 
ATOM   2581 O O   . TYR A 1 341 ? 32.210  25.137  3.704   1.00 77.06  ? 341  TYR A O   1 
ATOM   2582 C CB  . TYR A 1 341 ? 30.873  25.114  6.000   1.00 55.96  ? 341  TYR A CB  1 
ATOM   2583 C CG  . TYR A 1 341 ? 30.461  25.392  7.412   1.00 59.86  ? 341  TYR A CG  1 
ATOM   2584 C CD1 . TYR A 1 341 ? 29.197  25.033  7.865   1.00 51.40  ? 341  TYR A CD1 1 
ATOM   2585 C CD2 . TYR A 1 341 ? 31.336  26.009  8.299   1.00 56.63  ? 341  TYR A CD2 1 
ATOM   2586 C CE1 . TYR A 1 341 ? 28.814  25.279  9.161   1.00 54.21  ? 341  TYR A CE1 1 
ATOM   2587 C CE2 . TYR A 1 341 ? 30.963  26.259  9.601   1.00 58.76  ? 341  TYR A CE2 1 
ATOM   2588 C CZ  . TYR A 1 341 ? 29.698  25.893  10.031  1.00 65.11  ? 341  TYR A CZ  1 
ATOM   2589 O OH  . TYR A 1 341 ? 29.308  26.138  11.334  1.00 63.38  ? 341  TYR A OH  1 
ATOM   2590 N N   . GLY A 1 342 ? 31.304  26.997  2.852   1.00 72.85  ? 342  GLY A N   1 
ATOM   2591 C CA  . GLY A 1 342 ? 32.243  27.066  1.753   1.00 73.31  ? 342  GLY A CA  1 
ATOM   2592 C C   . GLY A 1 342 ? 31.841  26.372  0.473   1.00 73.92  ? 342  GLY A C   1 
ATOM   2593 O O   . GLY A 1 342 ? 32.701  25.900  -0.270  1.00 87.00  ? 342  GLY A O   1 
ATOM   2594 N N   . VAL A 1 343 ? 30.545  26.280  0.210   1.00 68.33  ? 343  VAL A N   1 
ATOM   2595 C CA  . VAL A 1 343 ? 30.115  26.035  -1.159  1.00 64.27  ? 343  VAL A CA  1 
ATOM   2596 C C   . VAL A 1 343 ? 29.754  27.402  -1.722  1.00 59.85  ? 343  VAL A C   1 
ATOM   2597 O O   . VAL A 1 343 ? 28.885  28.092  -1.194  1.00 60.31  ? 343  VAL A O   1 
ATOM   2598 C CB  . VAL A 1 343 ? 28.947  25.051  -1.257  1.00 61.09  ? 343  VAL A CB  1 
ATOM   2599 C CG1 . VAL A 1 343 ? 28.619  24.772  -2.717  1.00 51.48  ? 343  VAL A CG1 1 
ATOM   2600 C CG2 . VAL A 1 343 ? 29.298  23.759  -0.539  1.00 59.49  ? 343  VAL A CG2 1 
ATOM   2601 N N   . PRO A 1 344 ? 30.462  27.830  -2.769  1.00 67.89  ? 344  PRO A N   1 
ATOM   2602 C CA  . PRO A 1 344 ? 30.225  29.213  -3.195  1.00 71.74  ? 344  PRO A CA  1 
ATOM   2603 C C   . PRO A 1 344 ? 28.807  29.353  -3.737  1.00 63.79  ? 344  PRO A C   1 
ATOM   2604 O O   . PRO A 1 344 ? 28.401  28.540  -4.572  1.00 55.80  ? 344  PRO A O   1 
ATOM   2605 C CB  . PRO A 1 344 ? 31.277  29.429  -4.295  1.00 55.93  ? 344  PRO A CB  1 
ATOM   2606 C CG  . PRO A 1 344 ? 32.283  28.313  -4.104  1.00 49.67  ? 344  PRO A CG  1 
ATOM   2607 C CD  . PRO A 1 344 ? 31.471  27.158  -3.602  1.00 62.29  ? 344  PRO A CD  1 
ATOM   2608 N N   . GLY A 1 345 ? 28.071  30.349  -3.244  1.00 57.49  ? 345  GLY A N   1 
ATOM   2609 C CA  . GLY A 1 345 ? 26.692  30.568  -3.641  1.00 55.93  ? 345  GLY A CA  1 
ATOM   2610 C C   . GLY A 1 345 ? 25.752  30.524  -2.456  1.00 59.13  ? 345  GLY A C   1 
ATOM   2611 O O   . GLY A 1 345 ? 24.670  31.105  -2.494  1.00 62.50  ? 345  GLY A O   1 
ATOM   2612 N N   . PHE A 1 346 ? 26.188  29.849  -1.393  1.00 59.95  ? 346  PHE A N   1 
ATOM   2613 C CA  . PHE A 1 346 ? 25.362  29.608  -0.212  1.00 56.56  ? 346  PHE A CA  1 
ATOM   2614 C C   . PHE A 1 346 ? 25.684  30.492  0.986   1.00 55.61  ? 346  PHE A C   1 
ATOM   2615 O O   . PHE A 1 346 ? 26.845  30.807  1.262   1.00 60.97  ? 346  PHE A O   1 
ATOM   2616 C CB  . PHE A 1 346 ? 25.462  28.145  0.203   1.00 49.42  ? 346  PHE A CB  1 
ATOM   2617 C CG  . PHE A 1 346 ? 24.899  27.204  -0.806  1.00 54.53  ? 346  PHE A CG  1 
ATOM   2618 C CD1 . PHE A 1 346 ? 25.672  26.773  -1.872  1.00 55.13  ? 346  PHE A CD1 1 
ATOM   2619 C CD2 . PHE A 1 346 ? 23.590  26.757  -0.700  1.00 52.53  ? 346  PHE A CD2 1 
ATOM   2620 C CE1 . PHE A 1 346 ? 25.153  25.912  -2.816  1.00 49.01  ? 346  PHE A CE1 1 
ATOM   2621 C CE2 . PHE A 1 346 ? 23.062  25.895  -1.636  1.00 49.12  ? 346  PHE A CE2 1 
ATOM   2622 C CZ  . PHE A 1 346 ? 23.840  25.470  -2.698  1.00 54.72  ? 346  PHE A CZ  1 
ATOM   2623 N N   . SER A 1 347 ? 24.631  30.873  1.699   1.00 49.91  ? 347  SER A N   1 
ATOM   2624 C CA  . SER A 1 347 ? 24.744  31.652  2.926   1.00 56.67  ? 347  SER A CA  1 
ATOM   2625 C C   . SER A 1 347 ? 23.476  31.513  3.748   1.00 59.83  ? 347  SER A C   1 
ATOM   2626 O O   . SER A 1 347 ? 22.408  31.201  3.210   1.00 66.22  ? 347  SER A O   1 
ATOM   2627 C CB  . SER A 1 347 ? 24.980  33.130  2.622   1.00 64.63  ? 347  SER A CB  1 
ATOM   2628 O OG  . SER A 1 347 ? 24.878  33.897  3.809   1.00 67.62  ? 347  SER A OG  1 
ATOM   2629 N N   . LYS A 1 348 ? 23.593  31.748  5.050   1.00 54.33  ? 348  LYS A N   1 
ATOM   2630 C CA  . LYS A 1 348 ? 22.429  31.745  5.922   1.00 57.94  ? 348  LYS A CA  1 
ATOM   2631 C C   . LYS A 1 348 ? 21.653  33.064  5.817   1.00 62.23  ? 348  LYS A C   1 
ATOM   2632 O O   . LYS A 1 348 ? 20.525  33.169  6.302   1.00 65.19  ? 348  LYS A O   1 
ATOM   2633 C CB  . LYS A 1 348 ? 22.837  31.502  7.377   1.00 57.53  ? 348  LYS A CB  1 
ATOM   2634 C CG  . LYS A 1 348 ? 23.299  32.748  8.118   1.00 57.63  ? 348  LYS A CG  1 
ATOM   2635 C CD  . LYS A 1 348 ? 23.422  32.482  9.603   1.00 58.87  ? 348  LYS A CD  1 
ATOM   2636 C CE  . LYS A 1 348 ? 23.872  33.724  10.352  1.00 63.65  ? 348  LYS A CE  1 
ATOM   2637 N NZ  . LYS A 1 348 ? 22.761  34.682  10.612  1.00 64.95  ? 348  LYS A NZ  1 
ATOM   2638 N N   . ASP A 1 349 ? 22.257  34.065  5.184   1.00 60.77  ? 349  ASP A N   1 
ATOM   2639 C CA  . ASP A 1 349 ? 21.661  35.402  5.135   1.00 60.93  ? 349  ASP A CA  1 
ATOM   2640 C C   . ASP A 1 349 ? 20.863  35.703  3.860   1.00 66.78  ? 349  ASP A C   1 
ATOM   2641 O O   . ASP A 1 349 ? 20.158  36.707  3.796   1.00 74.54  ? 349  ASP A O   1 
ATOM   2642 C CB  . ASP A 1 349 ? 22.728  36.468  5.368   1.00 53.91  ? 349  ASP A CB  1 
ATOM   2643 C CG  . ASP A 1 349 ? 23.408  36.318  6.716   1.00 72.66  ? 349  ASP A CG  1 
ATOM   2644 O OD1 . ASP A 1 349 ? 22.679  36.131  7.730   1.00 58.88  ? 349  ASP A OD1 1 
ATOM   2645 O OD2 . ASP A 1 349 ? 24.666  36.381  6.755   1.00 65.47  ? 349  ASP A OD2 1 
ATOM   2646 N N   . ASN A 1 350 ? 20.977  34.851  2.845   1.00 62.49  ? 350  ASN A N   1 
ATOM   2647 C CA  . ASN A 1 350 ? 20.087  34.963  1.700   1.00 57.94  ? 350  ASN A CA  1 
ATOM   2648 C C   . ASN A 1 350 ? 19.459  33.623  1.358   1.00 63.11  ? 350  ASN A C   1 
ATOM   2649 O O   . ASN A 1 350 ? 19.610  32.660  2.101   1.00 64.96  ? 350  ASN A O   1 
ATOM   2650 C CB  . ASN A 1 350 ? 20.761  35.632  0.492   1.00 55.41  ? 350  ASN A CB  1 
ATOM   2651 C CG  . ASN A 1 350 ? 21.967  34.866  -0.031  1.00 68.24  ? 350  ASN A CG  1 
ATOM   2652 O OD1 . ASN A 1 350 ? 21.895  33.660  -0.293  1.00 66.82  ? 350  ASN A OD1 1 
ATOM   2653 N ND2 . ASN A 1 350 ? 23.077  35.592  -0.237  1.00 68.68  ? 350  ASN A ND2 1 
ATOM   2654 N N   . GLU A 1 351 ? 18.740  33.570  0.245   1.00 64.34  ? 351  GLU A N   1 
ATOM   2655 C CA  . GLU A 1 351 ? 18.052  32.354  -0.162  1.00 63.51  ? 351  GLU A CA  1 
ATOM   2656 C C   . GLU A 1 351 ? 18.992  31.337  -0.800  1.00 55.80  ? 351  GLU A C   1 
ATOM   2657 O O   . GLU A 1 351 ? 18.574  30.224  -1.131  1.00 51.69  ? 351  GLU A O   1 
ATOM   2658 C CB  . GLU A 1 351 ? 16.941  32.696  -1.152  1.00 75.23  ? 351  GLU A CB  1 
ATOM   2659 C CG  . GLU A 1 351 ? 15.975  33.724  -0.634  1.00 75.49  ? 351  GLU A CG  1 
ATOM   2660 C CD  . GLU A 1 351 ? 15.267  33.256  0.615   1.00 88.49  ? 351  GLU A CD  1 
ATOM   2661 O OE1 . GLU A 1 351 ? 14.632  32.178  0.567   1.00 91.13  ? 351  GLU A OE1 1 
ATOM   2662 O OE2 . GLU A 1 351 ? 15.345  33.968  1.642   1.00 98.72  ? 351  GLU A OE2 1 
ATOM   2663 N N   . SER A 1 352 ? 20.249  31.733  -0.987  1.00 50.74  ? 352  SER A N   1 
ATOM   2664 C CA  . SER A 1 352 ? 21.243  30.870  -1.616  1.00 53.22  ? 352  SER A CA  1 
ATOM   2665 C C   . SER A 1 352 ? 20.724  30.260  -2.916  1.00 55.10  ? 352  SER A C   1 
ATOM   2666 O O   . SER A 1 352 ? 21.013  29.107  -3.226  1.00 56.53  ? 352  SER A O   1 
ATOM   2667 C CB  . SER A 1 352 ? 21.681  29.756  -0.659  1.00 51.37  ? 352  SER A CB  1 
ATOM   2668 O OG  . SER A 1 352 ? 21.975  30.283  0.620   1.00 55.45  ? 352  SER A OG  1 
ATOM   2669 N N   . LEU A 1 353 ? 19.945  31.025  -3.672  1.00 52.55  ? 353  LEU A N   1 
ATOM   2670 C CA  . LEU A 1 353 ? 19.582  30.601  -5.018  1.00 58.57  ? 353  LEU A CA  1 
ATOM   2671 C C   . LEU A 1 353 ? 20.849  30.585  -5.871  1.00 61.72  ? 353  LEU A C   1 
ATOM   2672 O O   . LEU A 1 353 ? 21.514  31.606  -6.019  1.00 63.58  ? 353  LEU A O   1 
ATOM   2673 C CB  . LEU A 1 353 ? 18.538  31.534  -5.621  1.00 49.27  ? 353  LEU A CB  1 
ATOM   2674 C CG  . LEU A 1 353 ? 17.259  31.688  -4.796  1.00 56.26  ? 353  LEU A CG  1 
ATOM   2675 C CD1 . LEU A 1 353 ? 16.370  32.760  -5.380  1.00 62.54  ? 353  LEU A CD1 1 
ATOM   2676 C CD2 . LEU A 1 353 ? 16.514  30.383  -4.723  1.00 55.81  ? 353  LEU A CD2 1 
ATOM   2677 N N   . ILE A 1 354 ? 21.204  29.425  -6.407  1.00 52.08  ? 354  ILE A N   1 
ATOM   2678 C CA  . ILE A 1 354 ? 22.454  29.321  -7.139  1.00 51.13  ? 354  ILE A CA  1 
ATOM   2679 C C   . ILE A 1 354 ? 22.251  29.043  -8.615  1.00 50.06  ? 354  ILE A C   1 
ATOM   2680 O O   . ILE A 1 354 ? 21.172  28.642  -9.052  1.00 51.37  ? 354  ILE A O   1 
ATOM   2681 C CB  . ILE A 1 354 ? 23.346  28.216  -6.578  1.00 49.59  ? 354  ILE A CB  1 
ATOM   2682 C CG1 . ILE A 1 354 ? 22.545  26.919  -6.450  1.00 44.52  ? 354  ILE A CG1 1 
ATOM   2683 C CG2 . ILE A 1 354 ? 23.916  28.645  -5.253  1.00 53.92  ? 354  ILE A CG2 1 
ATOM   2684 C CD1 . ILE A 1 354 ? 23.315  25.673  -6.752  1.00 43.08  ? 354  ILE A CD1 1 
ATOM   2685 N N   . SER A 1 355 ? 23.322  29.243  -9.370  1.00 45.07  ? 355  SER A N   1 
ATOM   2686 C CA  . SER A 1 355 ? 23.338  28.967  -10.797 1.00 43.95  ? 355  SER A CA  1 
ATOM   2687 C C   . SER A 1 355 ? 23.699  27.511  -11.099 1.00 45.89  ? 355  SER A C   1 
ATOM   2688 O O   . SER A 1 355 ? 24.174  26.762  -10.245 1.00 45.22  ? 355  SER A O   1 
ATOM   2689 C CB  . SER A 1 355 ? 24.357  29.878  -11.476 1.00 43.37  ? 355  SER A CB  1 
ATOM   2690 O OG  . SER A 1 355 ? 25.686  29.419  -11.243 1.00 49.71  ? 355  SER A OG  1 
ATOM   2691 N N   . ARG A 1 356 ? 23.503  27.124  -12.342 1.00 41.75  ? 356  ARG A N   1 
ATOM   2692 C CA  . ARG A 1 356 ? 23.863  25.795  -12.744 1.00 50.30  ? 356  ARG A CA  1 
ATOM   2693 C C   . ARG A 1 356 ? 25.378  25.593  -12.626 1.00 55.33  ? 356  ARG A C   1 
ATOM   2694 O O   . ARG A 1 356 ? 25.845  24.494  -12.295 1.00 52.85  ? 356  ARG A O   1 
ATOM   2695 C CB  . ARG A 1 356 ? 23.375  25.537  -14.161 1.00 46.83  ? 356  ARG A CB  1 
ATOM   2696 C CG  . ARG A 1 356 ? 23.688  24.148  -14.636 1.00 60.32  ? 356  ARG A CG  1 
ATOM   2697 C CD  . ARG A 1 356 ? 22.606  23.604  -15.537 1.00 51.76  ? 356  ARG A CD  1 
ATOM   2698 N NE  . ARG A 1 356 ? 22.893  22.207  -15.846 1.00 67.58  ? 356  ARG A NE  1 
ATOM   2699 C CZ  . ARG A 1 356 ? 22.422  21.167  -15.158 1.00 64.60  ? 356  ARG A CZ  1 
ATOM   2700 N NH1 . ARG A 1 356 ? 21.610  21.350  -14.118 1.00 54.96  ? 356  ARG A NH1 1 
ATOM   2701 N NH2 . ARG A 1 356 ? 22.754  19.935  -15.523 1.00 65.22  ? 356  ARG A NH2 1 
ATOM   2702 N N   . ALA A 1 357 ? 26.141  26.654  -12.882 1.00 46.94  ? 357  ALA A N   1 
ATOM   2703 C CA  . ALA A 1 357 ? 27.598  26.560  -12.815 1.00 49.55  ? 357  ALA A CA  1 
ATOM   2704 C C   . ALA A 1 357 ? 28.004  26.336  -11.385 1.00 50.54  ? 357  ALA A C   1 
ATOM   2705 O O   . ALA A 1 357 ? 28.881  25.520  -11.107 1.00 53.32  ? 357  ALA A O   1 
ATOM   2706 C CB  . ALA A 1 357 ? 28.277  27.817  -13.359 1.00 35.84  ? 357  ALA A CB  1 
ATOM   2707 N N   . GLN A 1 358 ? 27.364  27.067  -10.480 1.00 39.23  ? 358  GLN A N   1 
ATOM   2708 C CA  . GLN A 1 358 ? 27.639  26.898  -9.068  1.00 47.84  ? 358  GLN A CA  1 
ATOM   2709 C C   . GLN A 1 358 ? 27.209  25.511  -8.597  1.00 50.11  ? 358  GLN A C   1 
ATOM   2710 O O   . GLN A 1 358 ? 27.764  24.973  -7.648  1.00 50.05  ? 358  GLN A O   1 
ATOM   2711 C CB  . GLN A 1 358 ? 26.940  27.979  -8.252  1.00 41.74  ? 358  GLN A CB  1 
ATOM   2712 C CG  . GLN A 1 358 ? 27.388  29.368  -8.618  1.00 42.59  ? 358  GLN A CG  1 
ATOM   2713 C CD  . GLN A 1 358 ? 26.629  30.425  -7.865  1.00 55.12  ? 358  GLN A CD  1 
ATOM   2714 O OE1 . GLN A 1 358 ? 25.405  30.520  -7.979  1.00 60.73  ? 358  GLN A OE1 1 
ATOM   2715 N NE2 . GLN A 1 358 ? 27.343  31.223  -7.077  1.00 47.78  ? 358  GLN A NE2 1 
ATOM   2716 N N   . PHE A 1 359 ? 26.221  24.928  -9.265  1.00 50.66  ? 359  PHE A N   1 
ATOM   2717 C CA  . PHE A 1 359 ? 25.776  23.596  -8.897  1.00 47.41  ? 359  PHE A CA  1 
ATOM   2718 C C   . PHE A 1 359 ? 26.846  22.571  -9.280  1.00 44.45  ? 359  PHE A C   1 
ATOM   2719 O O   . PHE A 1 359 ? 27.230  21.744  -8.469  1.00 44.19  ? 359  PHE A O   1 
ATOM   2720 C CB  . PHE A 1 359 ? 24.405  23.274  -9.516  1.00 40.86  ? 359  PHE A CB  1 
ATOM   2721 C CG  . PHE A 1 359 ? 23.974  21.848  -9.327  1.00 41.12  ? 359  PHE A CG  1 
ATOM   2722 C CD1 . PHE A 1 359 ? 23.825  21.003  -10.417 1.00 43.05  ? 359  PHE A CD1 1 
ATOM   2723 C CD2 . PHE A 1 359 ? 23.741  21.341  -8.061  1.00 45.62  ? 359  PHE A CD2 1 
ATOM   2724 C CE1 . PHE A 1 359 ? 23.437  19.680  -10.251 1.00 45.17  ? 359  PHE A CE1 1 
ATOM   2725 C CE2 . PHE A 1 359 ? 23.358  20.019  -7.886  1.00 46.36  ? 359  PHE A CE2 1 
ATOM   2726 C CZ  . PHE A 1 359 ? 23.202  19.188  -8.985  1.00 44.08  ? 359  PHE A CZ  1 
ATOM   2727 N N   . LEU A 1 360 ? 27.345  22.651  -10.507 1.00 45.84  ? 360  LEU A N   1 
ATOM   2728 C CA  . LEU A 1 360 ? 28.405  21.753  -10.951 1.00 43.73  ? 360  LEU A CA  1 
ATOM   2729 C C   . LEU A 1 360 ? 29.693  21.933  -10.126 1.00 52.11  ? 360  LEU A C   1 
ATOM   2730 O O   . LEU A 1 360 ? 30.392  20.968  -9.848  1.00 49.94  ? 360  LEU A O   1 
ATOM   2731 C CB  . LEU A 1 360 ? 28.673  21.924  -12.453 1.00 45.51  ? 360  LEU A CB  1 
ATOM   2732 C CG  . LEU A 1 360 ? 27.429  21.957  -13.368 1.00 62.93  ? 360  LEU A CG  1 
ATOM   2733 C CD1 . LEU A 1 360 ? 27.764  22.237  -14.836 1.00 56.20  ? 360  LEU A CD1 1 
ATOM   2734 C CD2 . LEU A 1 360 ? 26.615  20.675  -13.282 1.00 56.78  ? 360  LEU A CD2 1 
ATOM   2735 N N   . ALA A 1 361 ? 30.000  23.164  -9.727  1.00 47.64  ? 361  ALA A N   1 
ATOM   2736 C CA  . ALA A 1 361 ? 31.163  23.417  -8.875  1.00 48.07  ? 361  ALA A CA  1 
ATOM   2737 C C   . ALA A 1 361 ? 30.964  22.808  -7.498  1.00 56.07  ? 361  ALA A C   1 
ATOM   2738 O O   . ALA A 1 361 ? 31.888  22.225  -6.921  1.00 55.38  ? 361  ALA A O   1 
ATOM   2739 C CB  . ALA A 1 361 ? 31.405  24.896  -8.735  1.00 39.19  ? 361  ALA A CB  1 
ATOM   2740 N N   . GLY A 1 362 ? 29.752  22.968  -6.970  1.00 48.14  ? 362  GLY A N   1 
ATOM   2741 C CA  . GLY A 1 362 ? 29.401  22.421  -5.680  1.00 43.32  ? 362  GLY A CA  1 
ATOM   2742 C C   . GLY A 1 362 ? 29.493  20.905  -5.658  1.00 53.84  ? 362  GLY A C   1 
ATOM   2743 O O   . GLY A 1 362 ? 29.871  20.323  -4.655  1.00 54.54  ? 362  GLY A O   1 
ATOM   2744 N N   . VAL A 1 363 ? 29.148  20.262  -6.767  1.00 48.63  ? 363  VAL A N   1 
ATOM   2745 C CA  . VAL A 1 363 ? 29.165  18.808  -6.817  1.00 51.08  ? 363  VAL A CA  1 
ATOM   2746 C C   . VAL A 1 363 ? 30.590  18.254  -6.774  1.00 55.57  ? 363  VAL A C   1 
ATOM   2747 O O   . VAL A 1 363 ? 30.817  17.211  -6.169  1.00 57.90  ? 363  VAL A O   1 
ATOM   2748 C CB  . VAL A 1 363 ? 28.427  18.276  -8.058  1.00 48.92  ? 363  VAL A CB  1 
ATOM   2749 C CG1 . VAL A 1 363 ? 28.645  16.786  -8.218  1.00 43.55  ? 363  VAL A CG1 1 
ATOM   2750 C CG2 . VAL A 1 363 ? 26.947  18.590  -7.959  1.00 49.16  ? 363  VAL A CG2 1 
ATOM   2751 N N   . ARG A 1 364 ? 31.539  18.949  -7.408  1.00 52.00  ? 364  ARG A N   1 
ATOM   2752 C CA  . ARG A 1 364 ? 32.955  18.573  -7.332  1.00 53.24  ? 364  ARG A CA  1 
ATOM   2753 C C   . ARG A 1 364 ? 33.464  18.641  -5.899  1.00 53.99  ? 364  ARG A C   1 
ATOM   2754 O O   . ARG A 1 364 ? 34.362  17.904  -5.517  1.00 53.57  ? 364  ARG A O   1 
ATOM   2755 C CB  . ARG A 1 364 ? 33.834  19.492  -8.183  1.00 54.14  ? 364  ARG A CB  1 
ATOM   2756 C CG  . ARG A 1 364 ? 33.465  19.578  -9.644  1.00 57.14  ? 364  ARG A CG  1 
ATOM   2757 C CD  . ARG A 1 364 ? 33.160  18.213  -10.226 1.00 70.22  ? 364  ARG A CD  1 
ATOM   2758 N NE  . ARG A 1 364 ? 34.207  17.230  -9.946  1.00 82.64  ? 364  ARG A NE  1 
ATOM   2759 C CZ  . ARG A 1 364 ? 35.097  16.804  -10.837 1.00 82.80  ? 364  ARG A CZ  1 
ATOM   2760 N NH1 . ARG A 1 364 ? 35.073  17.283  -12.080 1.00 79.45  ? 364  ARG A NH1 1 
ATOM   2761 N NH2 . ARG A 1 364 ? 36.008  15.899  -10.484 1.00 73.24  ? 364  ARG A NH2 1 
ATOM   2762 N N   . ILE A 1 365 ? 32.894  19.549  -5.119  1.00 51.37  ? 365  ILE A N   1 
ATOM   2763 C CA  . ILE A 1 365 ? 33.330  19.779  -3.755  1.00 49.59  ? 365  ILE A CA  1 
ATOM   2764 C C   . ILE A 1 365 ? 32.684  18.772  -2.791  1.00 53.41  ? 365  ILE A C   1 
ATOM   2765 O O   . ILE A 1 365 ? 33.328  18.269  -1.865  1.00 53.55  ? 365  ILE A O   1 
ATOM   2766 C CB  . ILE A 1 365 ? 33.000  21.232  -3.340  1.00 52.15  ? 365  ILE A CB  1 
ATOM   2767 C CG1 . ILE A 1 365 ? 33.914  22.200  -4.070  1.00 58.97  ? 365  ILE A CG1 1 
ATOM   2768 C CG2 . ILE A 1 365 ? 33.173  21.449  -1.856  1.00 57.29  ? 365  ILE A CG2 1 
ATOM   2769 C CD1 . ILE A 1 365 ? 33.823  23.597  -3.526  1.00 74.26  ? 365  ILE A CD1 1 
ATOM   2770 N N   . GLY A 1 366 ? 31.405  18.489  -3.014  1.00 49.06  ? 366  GLY A N   1 
ATOM   2771 C CA  . GLY A 1 366 ? 30.660  17.556  -2.193  1.00 48.61  ? 366  GLY A CA  1 
ATOM   2772 C C   . GLY A 1 366 ? 30.993  16.101  -2.486  1.00 57.81  ? 366  GLY A C   1 
ATOM   2773 O O   . GLY A 1 366 ? 30.767  15.224  -1.655  1.00 58.52  ? 366  GLY A O   1 
ATOM   2774 N N   . VAL A 1 367 ? 31.527  15.831  -3.670  1.00 48.95  ? 367  VAL A N   1 
ATOM   2775 C CA  . VAL A 1 367 ? 31.942  14.482  -3.995  1.00 50.33  ? 367  VAL A CA  1 
ATOM   2776 C C   . VAL A 1 367 ? 33.406  14.505  -4.402  1.00 55.87  ? 367  VAL A C   1 
ATOM   2777 O O   . VAL A 1 367 ? 33.747  14.219  -5.545  1.00 59.52  ? 367  VAL A O   1 
ATOM   2778 C CB  . VAL A 1 367 ? 31.067  13.878  -5.108  1.00 58.08  ? 367  VAL A CB  1 
ATOM   2779 C CG1 . VAL A 1 367 ? 31.244  12.377  -5.154  1.00 51.51  ? 367  VAL A CG1 1 
ATOM   2780 C CG2 . VAL A 1 367 ? 29.603  14.219  -4.866  1.00 48.79  ? 367  VAL A CG2 1 
ATOM   2781 N N   . PRO A 1 368 ? 34.284  14.863  -3.459  1.00 56.19  ? 368  PRO A N   1 
ATOM   2782 C CA  . PRO A 1 368 ? 35.680  15.129  -3.805  1.00 51.74  ? 368  PRO A CA  1 
ATOM   2783 C C   . PRO A 1 368 ? 36.405  13.951  -4.446  1.00 56.87  ? 368  PRO A C   1 
ATOM   2784 O O   . PRO A 1 368 ? 37.329  14.171  -5.231  1.00 65.49  ? 368  PRO A O   1 
ATOM   2785 C CB  . PRO A 1 368 ? 36.298  15.505  -2.455  1.00 57.92  ? 368  PRO A CB  1 
ATOM   2786 C CG  . PRO A 1 368 ? 35.312  15.021  -1.431  1.00 54.17  ? 368  PRO A CG  1 
ATOM   2787 C CD  . PRO A 1 368 ? 34.002  15.247  -2.070  1.00 49.18  ? 368  PRO A CD  1 
ATOM   2788 N N   . GLN A 1 369 ? 35.996  12.726  -4.133  1.00 63.68  ? 369  GLN A N   1 
ATOM   2789 C CA  . GLN A 1 369 ? 36.660  11.541  -4.679  1.00 60.33  ? 369  GLN A CA  1 
ATOM   2790 C C   . GLN A 1 369 ? 36.306  11.292  -6.142  1.00 68.05  ? 369  GLN A C   1 
ATOM   2791 O O   . GLN A 1 369 ? 36.978  10.522  -6.820  1.00 79.12  ? 369  GLN A O   1 
ATOM   2792 C CB  . GLN A 1 369 ? 36.267  10.291  -3.893  1.00 64.55  ? 369  GLN A CB  1 
ATOM   2793 C CG  . GLN A 1 369 ? 35.537  10.554  -2.601  1.00 72.34  ? 369  GLN A CG  1 
ATOM   2794 C CD  . GLN A 1 369 ? 34.028  10.645  -2.772  1.00 68.60  ? 369  GLN A CD  1 
ATOM   2795 O OE1 . GLN A 1 369 ? 33.390  9.744   -3.321  1.00 70.03  ? 369  GLN A OE1 1 
ATOM   2796 N NE2 . GLN A 1 369 ? 33.451  11.729  -2.276  1.00 62.69  ? 369  GLN A NE2 1 
ATOM   2797 N N   . ALA A 1 370 ? 35.245  11.939  -6.617  1.00 64.26  ? 370  ALA A N   1 
ATOM   2798 C CA  . ALA A 1 370 ? 34.655  11.644  -7.924  1.00 64.82  ? 370  ALA A CA  1 
ATOM   2799 C C   . ALA A 1 370 ? 35.461  12.086  -9.143  1.00 67.80  ? 370  ALA A C   1 
ATOM   2800 O O   . ALA A 1 370 ? 35.813  13.262  -9.282  1.00 69.34  ? 370  ALA A O   1 
ATOM   2801 C CB  . ALA A 1 370 ? 33.256  12.235  -8.009  1.00 60.55  ? 370  ALA A CB  1 
ATOM   2802 N N   . SER A 1 371 ? 35.716  11.132  -10.036 1.00 61.97  ? 371  SER A N   1 
ATOM   2803 C CA  . SER A 1 371 ? 36.226  11.424  -11.373 1.00 65.93  ? 371  SER A CA  1 
ATOM   2804 C C   . SER A 1 371 ? 35.296  12.387  -12.118 1.00 70.23  ? 371  SER A C   1 
ATOM   2805 O O   . SER A 1 371 ? 34.213  12.726  -11.639 1.00 69.94  ? 371  SER A O   1 
ATOM   2806 C CB  . SER A 1 371 ? 36.349  10.128  -12.176 1.00 75.47  ? 371  SER A CB  1 
ATOM   2807 O OG  . SER A 1 371 ? 35.071  9.618   -12.541 1.00 77.43  ? 371  SER A OG  1 
ATOM   2808 N N   . ASP A 1 372 ? 35.711  12.824  -13.298 1.00 70.02  ? 372  ASP A N   1 
ATOM   2809 C CA  . ASP A 1 372 ? 34.862  13.699  -14.087 1.00 69.42  ? 372  ASP A CA  1 
ATOM   2810 C C   . ASP A 1 372 ? 33.570  12.999  -14.493 1.00 68.68  ? 372  ASP A C   1 
ATOM   2811 O O   . ASP A 1 372 ? 32.498  13.607  -14.457 1.00 60.71  ? 372  ASP A O   1 
ATOM   2812 C CB  . ASP A 1 372 ? 35.599  14.229  -15.318 1.00 74.41  ? 372  ASP A CB  1 
ATOM   2813 C CG  . ASP A 1 372 ? 36.360  15.514  -15.037 1.00 83.00  ? 372  ASP A CG  1 
ATOM   2814 O OD1 . ASP A 1 372 ? 37.005  15.618  -13.971 1.00 86.93  ? 372  ASP A OD1 1 
ATOM   2815 O OD2 . ASP A 1 372 ? 36.315  16.424  -15.890 1.00 93.17  ? 372  ASP A OD2 1 
ATOM   2816 N N   . LEU A 1 373 ? 33.665  11.724  -14.870 1.00 61.52  ? 373  LEU A N   1 
ATOM   2817 C CA  . LEU A 1 373 ? 32.479  10.993  -15.300 1.00 59.87  ? 373  LEU A CA  1 
ATOM   2818 C C   . LEU A 1 373 ? 31.490  10.798  -14.150 1.00 69.70  ? 373  LEU A C   1 
ATOM   2819 O O   . LEU A 1 373 ? 30.289  11.038  -14.292 1.00 66.28  ? 373  LEU A O   1 
ATOM   2820 C CB  . LEU A 1 373 ? 32.838  9.641   -15.914 1.00 63.81  ? 373  LEU A CB  1 
ATOM   2821 C CG  . LEU A 1 373 ? 31.606  8.944   -16.503 1.00 72.55  ? 373  LEU A CG  1 
ATOM   2822 C CD1 . LEU A 1 373 ? 30.879  9.881   -17.474 1.00 66.52  ? 373  LEU A CD1 1 
ATOM   2823 C CD2 . LEU A 1 373 ? 31.954  7.627   -17.174 1.00 68.66  ? 373  LEU A CD2 1 
ATOM   2824 N N   . ALA A 1 374 ? 32.001  10.363  -13.006 1.00 69.84  ? 374  ALA A N   1 
ATOM   2825 C CA  . ALA A 1 374 ? 31.162  10.190  -11.833 1.00 59.13  ? 374  ALA A CA  1 
ATOM   2826 C C   . ALA A 1 374 ? 30.436  11.481  -11.459 1.00 58.79  ? 374  ALA A C   1 
ATOM   2827 O O   . ALA A 1 374 ? 29.278  11.449  -11.048 1.00 57.31  ? 374  ALA A O   1 
ATOM   2828 C CB  . ALA A 1 374 ? 31.987  9.685   -10.669 1.00 61.88  ? 374  ALA A CB  1 
ATOM   2829 N N   . ALA A 1 375 ? 31.112  12.617  -11.600 1.00 56.76  ? 375  ALA A N   1 
ATOM   2830 C CA  . ALA A 1 375 ? 30.518  13.883  -11.188 1.00 57.24  ? 375  ALA A CA  1 
ATOM   2831 C C   . ALA A 1 375 ? 29.441  14.285  -12.175 1.00 63.81  ? 375  ALA A C   1 
ATOM   2832 O O   . ALA A 1 375 ? 28.450  14.919  -11.805 1.00 65.49  ? 375  ALA A O   1 
ATOM   2833 C CB  . ALA A 1 375 ? 31.570  14.973  -11.070 1.00 47.50  ? 375  ALA A CB  1 
ATOM   2834 N N   . GLU A 1 376 ? 29.637  13.916  -13.436 1.00 61.03  ? 376  GLU A N   1 
ATOM   2835 C CA  . GLU A 1 376 ? 28.621  14.159  -14.447 1.00 64.21  ? 376  GLU A CA  1 
ATOM   2836 C C   . GLU A 1 376 ? 27.405  13.288  -14.134 1.00 59.00  ? 376  GLU A C   1 
ATOM   2837 O O   . GLU A 1 376 ? 26.276  13.776  -14.130 1.00 53.19  ? 376  GLU A O   1 
ATOM   2838 C CB  . GLU A 1 376 ? 29.165  13.888  -15.859 1.00 74.98  ? 376  GLU A CB  1 
ATOM   2839 C CG  . GLU A 1 376 ? 28.114  13.889  -16.994 1.00 89.27  ? 376  GLU A CG  1 
ATOM   2840 C CD  . GLU A 1 376 ? 27.480  15.268  -17.279 1.00 97.79  ? 376  GLU A CD  1 
ATOM   2841 O OE1 . GLU A 1 376 ? 27.822  16.257  -16.582 1.00 94.26  ? 376  GLU A OE1 1 
ATOM   2842 O OE2 . GLU A 1 376 ? 26.632  15.353  -18.208 1.00 88.06  ? 376  GLU A OE2 1 
ATOM   2843 N N   . ALA A 1 377 ? 27.642  12.011  -13.846 1.00 49.98  ? 377  ALA A N   1 
ATOM   2844 C CA  . ALA A 1 377 ? 26.560  11.119  -13.441 1.00 54.58  ? 377  ALA A CA  1 
ATOM   2845 C C   . ALA A 1 377 ? 25.734  11.745  -12.325 1.00 54.53  ? 377  ALA A C   1 
ATOM   2846 O O   . ALA A 1 377 ? 24.508  11.808  -12.410 1.00 54.02  ? 377  ALA A O   1 
ATOM   2847 C CB  . ALA A 1 377 ? 27.098  9.762   -13.013 1.00 45.97  ? 377  ALA A CB  1 
ATOM   2848 N N   . VAL A 1 378 ? 26.415  12.223  -11.290 1.00 56.13  ? 378  VAL A N   1 
ATOM   2849 C CA  . VAL A 1 378 ? 25.737  12.826  -10.152 1.00 51.52  ? 378  VAL A CA  1 
ATOM   2850 C C   . VAL A 1 378 ? 24.871  13.987  -10.605 1.00 50.78  ? 378  VAL A C   1 
ATOM   2851 O O   . VAL A 1 378 ? 23.703  14.086  -10.225 1.00 52.89  ? 378  VAL A O   1 
ATOM   2852 C CB  . VAL A 1 378 ? 26.730  13.299  -9.065  1.00 49.84  ? 378  VAL A CB  1 
ATOM   2853 C CG1 . VAL A 1 378 ? 26.037  14.205  -8.068  1.00 43.83  ? 378  VAL A CG1 1 
ATOM   2854 C CG2 . VAL A 1 378 ? 27.328  12.112  -8.348  1.00 47.40  ? 378  VAL A CG2 1 
ATOM   2855 N N   . VAL A 1 379 ? 25.445  14.857  -11.428 1.00 49.61  ? 379  VAL A N   1 
ATOM   2856 C CA  . VAL A 1 379 ? 24.733  16.035  -11.919 1.00 53.39  ? 379  VAL A CA  1 
ATOM   2857 C C   . VAL A 1 379 ? 23.550  15.679  -12.817 1.00 56.98  ? 379  VAL A C   1 
ATOM   2858 O O   . VAL A 1 379 ? 22.505  16.327  -12.774 1.00 55.41  ? 379  VAL A O   1 
ATOM   2859 C CB  . VAL A 1 379 ? 25.665  16.963  -12.692 1.00 50.15  ? 379  VAL A CB  1 
ATOM   2860 C CG1 . VAL A 1 379 ? 24.863  17.874  -13.581 1.00 58.35  ? 379  VAL A CG1 1 
ATOM   2861 C CG2 . VAL A 1 379 ? 26.514  17.768  -11.729 1.00 54.29  ? 379  VAL A CG2 1 
ATOM   2862 N N   . LEU A 1 380 ? 23.719  14.645  -13.630 1.00 49.76  ? 380  LEU A N   1 
ATOM   2863 C CA  . LEU A 1 380 ? 22.647  14.191  -14.495 1.00 54.90  ? 380  LEU A CA  1 
ATOM   2864 C C   . LEU A 1 380 ? 21.501  13.635  -13.670 1.00 57.13  ? 380  LEU A C   1 
ATOM   2865 O O   . LEU A 1 380 ? 20.330  13.957  -13.903 1.00 56.68  ? 380  LEU A O   1 
ATOM   2866 C CB  . LEU A 1 380 ? 23.167  13.159  -15.503 1.00 64.11  ? 380  LEU A CB  1 
ATOM   2867 C CG  . LEU A 1 380 ? 24.162  13.820  -16.473 1.00 70.78  ? 380  LEU A CG  1 
ATOM   2868 C CD1 . LEU A 1 380 ? 24.638  12.879  -17.572 1.00 71.53  ? 380  LEU A CD1 1 
ATOM   2869 C CD2 . LEU A 1 380 ? 23.562  15.102  -17.070 1.00 68.86  ? 380  LEU A CD2 1 
ATOM   2870 N N   . HIS A 1 381 ? 21.848  12.821  -12.683 1.00 54.90  ? 381  HIS A N   1 
ATOM   2871 C CA  . HIS A 1 381 ? 20.851  12.231  -11.811 1.00 51.11  ? 381  HIS A CA  1 
ATOM   2872 C C   . HIS A 1 381 ? 20.084  13.285  -11.027 1.00 49.60  ? 381  HIS A C   1 
ATOM   2873 O O   . HIS A 1 381 ? 18.884  13.145  -10.787 1.00 48.59  ? 381  HIS A O   1 
ATOM   2874 C CB  . HIS A 1 381 ? 21.507  11.255  -10.848 1.00 57.76  ? 381  HIS A CB  1 
ATOM   2875 C CG  . HIS A 1 381 ? 20.531  10.524  -9.990  1.00 50.04  ? 381  HIS A CG  1 
ATOM   2876 N ND1 . HIS A 1 381 ? 19.998  9.307   -10.348 1.00 60.19  ? 381  HIS A ND1 1 
ATOM   2877 C CD2 . HIS A 1 381 ? 19.974  10.846  -8.803  1.00 51.12  ? 381  HIS A CD2 1 
ATOM   2878 C CE1 . HIS A 1 381 ? 19.159  8.905   -9.411  1.00 61.28  ? 381  HIS A CE1 1 
ATOM   2879 N NE2 . HIS A 1 381 ? 19.123  9.823   -8.463  1.00 54.55  ? 381  HIS A NE2 1 
ATOM   2880 N N   . TYR A 1 382 ? 20.769  14.352  -10.640 1.00 46.96  ? 382  TYR A N   1 
ATOM   2881 C CA  . TYR A 1 382 ? 20.150  15.316  -9.743  1.00 48.45  ? 382  TYR A CA  1 
ATOM   2882 C C   . TYR A 1 382 ? 19.534  16.516  -10.428 1.00 51.02  ? 382  TYR A C   1 
ATOM   2883 O O   . TYR A 1 382 ? 18.749  17.225  -9.813  1.00 58.97  ? 382  TYR A O   1 
ATOM   2884 C CB  . TYR A 1 382 ? 21.123  15.760  -8.652  1.00 51.00  ? 382  TYR A CB  1 
ATOM   2885 C CG  . TYR A 1 382 ? 21.175  14.790  -7.493  1.00 50.75  ? 382  TYR A CG  1 
ATOM   2886 C CD1 . TYR A 1 382 ? 22.067  13.727  -7.489  1.00 45.54  ? 382  TYR A CD1 1 
ATOM   2887 C CD2 . TYR A 1 382 ? 20.318  14.928  -6.416  1.00 45.86  ? 382  TYR A CD2 1 
ATOM   2888 C CE1 . TYR A 1 382 ? 22.105  12.838  -6.445  1.00 47.76  ? 382  TYR A CE1 1 
ATOM   2889 C CE2 . TYR A 1 382 ? 20.352  14.049  -5.364  1.00 49.82  ? 382  TYR A CE2 1 
ATOM   2890 C CZ  . TYR A 1 382 ? 21.246  13.006  -5.378  1.00 52.44  ? 382  TYR A CZ  1 
ATOM   2891 O OH  . TYR A 1 382 ? 21.281  12.125  -4.319  1.00 56.47  ? 382  TYR A OH  1 
ATOM   2892 N N   . THR A 1 383 ? 19.884  16.743  -11.692 1.00 49.21  ? 383  THR A N   1 
ATOM   2893 C CA  . THR A 1 383 ? 19.242  17.792  -12.475 1.00 43.36  ? 383  THR A CA  1 
ATOM   2894 C C   . THR A 1 383 ? 17.770  17.463  -12.676 1.00 53.33  ? 383  THR A C   1 
ATOM   2895 O O   . THR A 1 383 ? 17.421  16.328  -13.005 1.00 58.46  ? 383  THR A O   1 
ATOM   2896 C CB  . THR A 1 383 ? 19.881  17.941  -13.864 1.00 50.30  ? 383  THR A CB  1 
ATOM   2897 O OG1 . THR A 1 383 ? 21.209  18.441  -13.726 1.00 51.23  ? 383  THR A OG1 1 
ATOM   2898 C CG2 . THR A 1 383 ? 19.072  18.890  -14.744 1.00 44.46  ? 383  THR A CG2 1 
ATOM   2899 N N   . ASP A 1 384 ? 16.922  18.460  -12.455 1.00 48.82  ? 384  ASP A N   1 
ATOM   2900 C CA  . ASP A 1 384 ? 15.513  18.424  -12.825 1.00 53.78  ? 384  ASP A CA  1 
ATOM   2901 C C   . ASP A 1 384 ? 15.379  18.839  -14.299 1.00 59.95  ? 384  ASP A C   1 
ATOM   2902 O O   . ASP A 1 384 ? 15.437  20.028  -14.634 1.00 55.51  ? 384  ASP A O   1 
ATOM   2903 C CB  . ASP A 1 384 ? 14.749  19.395  -11.926 1.00 61.56  ? 384  ASP A CB  1 
ATOM   2904 C CG  . ASP A 1 384 ? 13.338  19.660  -12.402 1.00 68.06  ? 384  ASP A CG  1 
ATOM   2905 O OD1 . ASP A 1 384 ? 12.847  18.912  -13.276 1.00 68.16  ? 384  ASP A OD1 1 
ATOM   2906 O OD2 . ASP A 1 384 ? 12.722  20.626  -11.890 1.00 74.22  ? 384  ASP A OD2 1 
ATOM   2907 N N   . TRP A 1 385 ? 15.208  17.864  -15.184 1.00 56.75  ? 385  TRP A N   1 
ATOM   2908 C CA  . TRP A 1 385 ? 15.359  18.139  -16.610 1.00 58.63  ? 385  TRP A CA  1 
ATOM   2909 C C   . TRP A 1 385 ? 14.231  18.942  -17.230 1.00 57.15  ? 385  TRP A C   1 
ATOM   2910 O O   . TRP A 1 385 ? 14.362  19.432  -18.348 1.00 60.39  ? 385  TRP A O   1 
ATOM   2911 C CB  . TRP A 1 385 ? 15.679  16.867  -17.382 1.00 50.30  ? 385  TRP A CB  1 
ATOM   2912 C CG  . TRP A 1 385 ? 17.046  16.432  -17.049 1.00 51.46  ? 385  TRP A CG  1 
ATOM   2913 C CD1 . TRP A 1 385 ? 17.404  15.460  -16.171 1.00 51.36  ? 385  TRP A CD1 1 
ATOM   2914 C CD2 . TRP A 1 385 ? 18.260  17.000  -17.541 1.00 47.97  ? 385  TRP A CD2 1 
ATOM   2915 N NE1 . TRP A 1 385 ? 18.773  15.366  -16.101 1.00 51.37  ? 385  TRP A NE1 1 
ATOM   2916 C CE2 . TRP A 1 385 ? 19.324  16.301  -16.933 1.00 44.16  ? 385  TRP A CE2 1 
ATOM   2917 C CE3 . TRP A 1 385 ? 18.553  18.028  -18.442 1.00 56.47  ? 385  TRP A CE3 1 
ATOM   2918 C CZ2 . TRP A 1 385 ? 20.660  16.595  -17.192 1.00 52.34  ? 385  TRP A CZ2 1 
ATOM   2919 C CZ3 . TRP A 1 385 ? 19.894  18.325  -18.702 1.00 56.47  ? 385  TRP A CZ3 1 
ATOM   2920 C CH2 . TRP A 1 385 ? 20.926  17.607  -18.079 1.00 56.77  ? 385  TRP A CH2 1 
ATOM   2921 N N   . LEU A 1 386 ? 13.150  19.105  -16.474 1.00 61.40  ? 386  LEU A N   1 
ATOM   2922 C CA  . LEU A 1 386 ? 12.096  20.059  -16.812 1.00 63.19  ? 386  LEU A CA  1 
ATOM   2923 C C   . LEU A 1 386 ? 12.511  21.513  -16.581 1.00 63.43  ? 386  LEU A C   1 
ATOM   2924 O O   . LEU A 1 386 ? 12.184  22.383  -17.382 1.00 74.62  ? 386  LEU A O   1 
ATOM   2925 C CB  . LEU A 1 386 ? 10.825  19.767  -16.015 1.00 56.61  ? 386  LEU A CB  1 
ATOM   2926 C CG  . LEU A 1 386 ? 9.706   19.127  -16.824 1.00 62.08  ? 386  LEU A CG  1 
ATOM   2927 C CD1 . LEU A 1 386 ? 8.389   19.307  -16.099 1.00 60.19  ? 386  LEU A CD1 1 
ATOM   2928 C CD2 . LEU A 1 386 ? 9.648   19.749  -18.230 1.00 62.15  ? 386  LEU A CD2 1 
ATOM   2929 N N   . HIS A 1 387 ? 13.205  21.769  -15.472 1.00 70.32  ? 387  HIS A N   1 
ATOM   2930 C CA  . HIS A 1 387 ? 13.698  23.110  -15.134 1.00 67.40  ? 387  HIS A CA  1 
ATOM   2931 C C   . HIS A 1 387 ? 15.187  23.101  -14.765 1.00 63.35  ? 387  HIS A C   1 
ATOM   2932 O O   . HIS A 1 387 ? 15.537  23.517  -13.659 1.00 62.74  ? 387  HIS A O   1 
ATOM   2933 C CB  . HIS A 1 387 ? 12.939  23.683  -13.930 1.00 59.94  ? 387  HIS A CB  1 
ATOM   2934 C CG  . HIS A 1 387 ? 11.448  23.589  -14.030 1.00 76.19  ? 387  HIS A CG  1 
ATOM   2935 N ND1 . HIS A 1 387 ? 10.751  22.436  -13.733 1.00 75.58  ? 387  HIS A ND1 1 
ATOM   2936 C CD2 . HIS A 1 387 ? 10.516  24.518  -14.351 1.00 75.23  ? 387  HIS A CD2 1 
ATOM   2937 C CE1 . HIS A 1 387 ? 9.457   22.654  -13.887 1.00 73.75  ? 387  HIS A CE1 1 
ATOM   2938 N NE2 . HIS A 1 387 ? 9.288   23.910  -14.261 1.00 72.12  ? 387  HIS A NE2 1 
ATOM   2939 N N   . PRO A 1 388 ? 16.064  22.650  -15.683 1.00 59.07  ? 388  PRO A N   1 
ATOM   2940 C CA  . PRO A 1 388 ? 17.496  22.434  -15.399 1.00 57.05  ? 388  PRO A CA  1 
ATOM   2941 C C   . PRO A 1 388 ? 18.270  23.684  -14.959 1.00 54.63  ? 388  PRO A C   1 
ATOM   2942 O O   . PRO A 1 388 ? 19.441  23.568  -14.605 1.00 59.79  ? 388  PRO A O   1 
ATOM   2943 C CB  . PRO A 1 388 ? 18.043  21.936  -16.741 1.00 56.30  ? 388  PRO A CB  1 
ATOM   2944 C CG  . PRO A 1 388 ? 17.062  22.474  -17.749 1.00 57.41  ? 388  PRO A CG  1 
ATOM   2945 C CD  . PRO A 1 388 ? 15.743  22.324  -17.080 1.00 57.41  ? 388  PRO A CD  1 
ATOM   2946 N N   . GLU A 1 389 ? 17.628  24.849  -14.970 1.00 60.18  ? 389  GLU A N   1 
ATOM   2947 C CA  . GLU A 1 389 ? 18.305  26.110  -14.678 1.00 54.82  ? 389  GLU A CA  1 
ATOM   2948 C C   . GLU A 1 389 ? 17.645  26.784  -13.518 1.00 56.16  ? 389  GLU A C   1 
ATOM   2949 O O   . GLU A 1 389 ? 18.059  27.862  -13.110 1.00 56.69  ? 389  GLU A O   1 
ATOM   2950 C CB  . GLU A 1 389 ? 18.162  27.077  -15.845 1.00 64.74  ? 389  GLU A CB  1 
ATOM   2951 C CG  . GLU A 1 389 ? 18.514  26.510  -17.190 1.00 78.81  ? 389  GLU A CG  1 
ATOM   2952 C CD  . GLU A 1 389 ? 19.925  26.842  -17.584 1.00 86.82  ? 389  GLU A CD  1 
ATOM   2953 O OE1 . GLU A 1 389 ? 20.853  26.490  -16.820 1.00 80.42  ? 389  GLU A OE1 1 
ATOM   2954 O OE2 . GLU A 1 389 ? 20.098  27.467  -18.655 1.00 104.45 ? 389  GLU A OE2 1 
ATOM   2955 N N   . ASP A 1 390 ? 16.575  26.183  -13.019 1.00 55.87  ? 390  ASP A N   1 
ATOM   2956 C CA  . ASP A 1 390 ? 15.846  26.792  -11.927 1.00 51.44  ? 390  ASP A CA  1 
ATOM   2957 C C   . ASP A 1 390 ? 16.699  26.851  -10.651 1.00 52.40  ? 390  ASP A C   1 
ATOM   2958 O O   . ASP A 1 390 ? 17.077  25.820  -10.092 1.00 51.32  ? 390  ASP A O   1 
ATOM   2959 C CB  . ASP A 1 390 ? 14.551  26.044  -11.667 1.00 50.43  ? 390  ASP A CB  1 
ATOM   2960 C CG  . ASP A 1 390 ? 13.738  26.696  -10.591 1.00 57.03  ? 390  ASP A CG  1 
ATOM   2961 O OD1 . ASP A 1 390 ? 13.426  27.891  -10.749 1.00 61.80  ? 390  ASP A OD1 1 
ATOM   2962 O OD2 . ASP A 1 390 ? 13.433  26.034  -9.583  1.00 61.36  ? 390  ASP A OD2 1 
ATOM   2963 N N   . PRO A 1 391 ? 17.000  28.068  -10.189 1.00 47.21  ? 391  PRO A N   1 
ATOM   2964 C CA  . PRO A 1 391 ? 17.913  28.300  -9.066  1.00 50.26  ? 391  PRO A CA  1 
ATOM   2965 C C   . PRO A 1 391 ? 17.409  27.656  -7.792  1.00 55.93  ? 391  PRO A C   1 
ATOM   2966 O O   . PRO A 1 391 ? 18.188  27.400  -6.881  1.00 60.17  ? 391  PRO A O   1 
ATOM   2967 C CB  . PRO A 1 391 ? 17.894  29.825  -8.900  1.00 52.93  ? 391  PRO A CB  1 
ATOM   2968 C CG  . PRO A 1 391 ? 17.397  30.361  -10.190 1.00 58.53  ? 391  PRO A CG  1 
ATOM   2969 C CD  . PRO A 1 391 ? 16.462  29.321  -10.737 1.00 58.27  ? 391  PRO A CD  1 
ATOM   2970 N N   . THR A 1 392 ? 16.111  27.408  -7.720  1.00 53.32  ? 392  THR A N   1 
ATOM   2971 C CA  . THR A 1 392 ? 15.546  26.851  -6.509  1.00 49.35  ? 392  THR A CA  1 
ATOM   2972 C C   . THR A 1 392 ? 15.706  25.336  -6.491  1.00 53.06  ? 392  THR A C   1 
ATOM   2973 O O   . THR A 1 392 ? 16.053  24.767  -5.451  1.00 48.13  ? 392  THR A O   1 
ATOM   2974 C CB  . THR A 1 392 ? 14.085  27.276  -6.305  1.00 48.83  ? 392  THR A CB  1 
ATOM   2975 O OG1 . THR A 1 392 ? 14.057  28.638  -5.868  1.00 49.24  ? 392  THR A OG1 1 
ATOM   2976 C CG2 . THR A 1 392 ? 13.431  26.422  -5.245  1.00 45.98  ? 392  THR A CG2 1 
ATOM   2977 N N   . HIS A 1 393 ? 15.470  24.670  -7.620  1.00 42.55  ? 393  HIS A N   1 
ATOM   2978 C CA  A HIS A 1 393 ? 15.762  23.250  -7.649  0.50 50.51  ? 393  HIS A CA  1 
ATOM   2979 C CA  B HIS A 1 393 ? 15.754  23.246  -7.720  0.50 50.84  ? 393  HIS A CA  1 
ATOM   2980 C C   . HIS A 1 393 ? 17.252  22.989  -7.481  1.00 53.37  ? 393  HIS A C   1 
ATOM   2981 O O   . HIS A 1 393 ? 17.635  22.038  -6.805  1.00 54.90  ? 393  HIS A O   1 
ATOM   2982 C CB  A HIS A 1 393 ? 15.298  22.551  -8.912  0.50 53.54  ? 393  HIS A CB  1 
ATOM   2983 C CB  B HIS A 1 393 ? 15.342  22.704  -9.095  0.50 53.57  ? 393  HIS A CB  1 
ATOM   2984 C CG  A HIS A 1 393 ? 15.828  21.156  -9.020  0.50 54.83  ? 393  HIS A CG  1 
ATOM   2985 C CG  B HIS A 1 393 ? 13.858  22.594  -9.294  0.50 60.16  ? 393  HIS A CG  1 
ATOM   2986 N ND1 A HIS A 1 393 ? 15.277  20.097  -8.330  0.50 55.98  ? 393  HIS A ND1 1 
ATOM   2987 N ND1 B HIS A 1 393 ? 13.128  21.501  -8.875  0.50 59.43  ? 393  HIS A ND1 1 
ATOM   2988 C CD2 A HIS A 1 393 ? 16.900  20.658  -9.682  0.50 54.74  ? 393  HIS A CD2 1 
ATOM   2989 C CD2 B HIS A 1 393 ? 12.973  23.427  -9.892  0.50 57.36  ? 393  HIS A CD2 1 
ATOM   2990 C CE1 A HIS A 1 393 ? 15.962  18.999  -8.593  0.50 57.72  ? 393  HIS A CE1 1 
ATOM   2991 C CE1 B HIS A 1 393 ? 11.858  21.671  -9.196  0.50 53.16  ? 393  HIS A CE1 1 
ATOM   2992 N NE2 A HIS A 1 393 ? 16.954  19.313  -9.408  0.50 55.08  ? 393  HIS A NE2 1 
ATOM   2993 N NE2 B HIS A 1 393 ? 11.736  22.834  -9.810  0.50 56.37  ? 393  HIS A NE2 1 
ATOM   2994 N N   . LEU A 1 394 ? 18.094  23.838  -8.071  1.00 46.36  ? 394  LEU A N   1 
ATOM   2995 C CA  . LEU A 1 394 ? 19.538  23.637  -7.992  1.00 52.36  ? 394  LEU A CA  1 
ATOM   2996 C C   . LEU A 1 394 ? 20.038  23.752  -6.551  1.00 53.62  ? 394  LEU A C   1 
ATOM   2997 O O   . LEU A 1 394 ? 20.809  22.924  -6.087  1.00 46.11  ? 394  LEU A O   1 
ATOM   2998 C CB  . LEU A 1 394 ? 20.297  24.592  -8.921  1.00 41.34  ? 394  LEU A CB  1 
ATOM   2999 C CG  . LEU A 1 394 ? 20.122  24.360  -10.425 1.00 43.59  ? 394  LEU A CG  1 
ATOM   3000 C CD1 . LEU A 1 394 ? 20.480  25.615  -11.216 1.00 42.05  ? 394  LEU A CD1 1 
ATOM   3001 C CD2 . LEU A 1 394 ? 20.903  23.143  -10.922 1.00 37.82  ? 394  LEU A CD2 1 
ATOM   3002 N N   . ARG A 1 395 ? 19.586  24.776  -5.844  1.00 45.99  ? 395  ARG A N   1 
ATOM   3003 C CA  . ARG A 1 395 ? 19.902  24.897  -4.439  1.00 45.10  ? 395  ARG A CA  1 
ATOM   3004 C C   . ARG A 1 395 ? 19.500  23.635  -3.648  1.00 47.97  ? 395  ARG A C   1 
ATOM   3005 O O   . ARG A 1 395 ? 20.303  23.078  -2.911  1.00 53.15  ? 395  ARG A O   1 
ATOM   3006 C CB  . ARG A 1 395 ? 19.240  26.145  -3.874  1.00 43.59  ? 395  ARG A CB  1 
ATOM   3007 C CG  . ARG A 1 395 ? 19.495  26.369  -2.414  1.00 45.01  ? 395  ARG A CG  1 
ATOM   3008 C CD  . ARG A 1 395 ? 18.224  26.229  -1.664  1.00 49.42  ? 395  ARG A CD  1 
ATOM   3009 N NE  . ARG A 1 395 ? 17.540  27.505  -1.544  1.00 49.07  ? 395  ARG A NE  1 
ATOM   3010 C CZ  . ARG A 1 395 ? 16.220  27.639  -1.469  1.00 50.61  ? 395  ARG A CZ  1 
ATOM   3011 N NH1 . ARG A 1 395 ? 15.435  26.573  -1.520  1.00 42.78  ? 395  ARG A NH1 1 
ATOM   3012 N NH2 . ARG A 1 395 ? 15.685  28.847  -1.352  1.00 63.50  ? 395  ARG A NH2 1 
ATOM   3013 N N   . ASP A 1 396 ? 18.274  23.162  -3.813  1.00 49.35  ? 396  ASP A N   1 
ATOM   3014 C CA  . ASP A 1 396 ? 17.831  21.991  -3.060  1.00 46.68  ? 396  ASP A CA  1 
ATOM   3015 C C   . ASP A 1 396 ? 18.510  20.704  -3.533  1.00 48.45  ? 396  ASP A C   1 
ATOM   3016 O O   . ASP A 1 396 ? 18.745  19.800  -2.740  1.00 51.45  ? 396  ASP A O   1 
ATOM   3017 C CB  . ASP A 1 396 ? 16.305  21.834  -3.106  1.00 45.86  ? 396  ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 396 ? 15.561  23.090  -2.647  1.00 56.80  ? 396  ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 396 ? 16.189  24.000  -2.052  1.00 56.87  ? 396  ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 396 ? 14.334  23.168  -2.885  1.00 57.88  ? 396  ASP A OD2 1 
ATOM   3021 N N   . ALA A 1 397 ? 18.822  20.621  -4.821  1.00 46.28  ? 397  ALA A N   1 
ATOM   3022 C CA  . ALA A 1 397 ? 19.525  19.459  -5.361  1.00 48.69  ? 397  ALA A CA  1 
ATOM   3023 C C   . ALA A 1 397 ? 20.918  19.347  -4.760  1.00 54.18  ? 397  ALA A C   1 
ATOM   3024 O O   . ALA A 1 397 ? 21.380  18.255  -4.405  1.00 50.59  ? 397  ALA A O   1 
ATOM   3025 C CB  . ALA A 1 397 ? 19.623  19.554  -6.869  1.00 51.05  ? 397  ALA A CB  1 
ATOM   3026 N N   . MET A 1 398 ? 21.586  20.492  -4.668  1.00 45.32  ? 398  MET A N   1 
ATOM   3027 C CA  . MET A 1 398 ? 22.889  20.582  -4.060  1.00 41.58  ? 398  MET A CA  1 
ATOM   3028 C C   . MET A 1 398 ? 22.851  20.070  -2.618  1.00 49.65  ? 398  MET A C   1 
ATOM   3029 O O   . MET A 1 398 ? 23.744  19.349  -2.173  1.00 45.62  ? 398  MET A O   1 
ATOM   3030 C CB  . MET A 1 398 ? 23.347  22.033  -4.062  1.00 45.46  ? 398  MET A CB  1 
ATOM   3031 C CG  . MET A 1 398 ? 24.753  22.227  -3.542  1.00 50.97  ? 398  MET A CG  1 
ATOM   3032 S SD  . MET A 1 398 ? 25.961  21.466  -4.644  1.00 49.97  ? 398  MET A SD  1 
ATOM   3033 C CE  . MET A 1 398 ? 26.340  19.933  -3.818  1.00 47.68  ? 398  MET A CE  1 
ATOM   3034 N N   . SER A 1 399 ? 21.824  20.464  -1.878  1.00 46.27  ? 399  SER A N   1 
ATOM   3035 C CA  . SER A 1 399 ? 21.691  20.024  -0.499  1.00 45.75  ? 399  SER A CA  1 
ATOM   3036 C C   . SER A 1 399 ? 21.431  18.511  -0.437  1.00 44.31  ? 399  SER A C   1 
ATOM   3037 O O   . SER A 1 399 ? 21.961  17.816  0.425   1.00 47.65  ? 399  SER A O   1 
ATOM   3038 C CB  . SER A 1 399 ? 20.582  20.817  0.184   1.00 47.15  ? 399  SER A CB  1 
ATOM   3039 O OG  . SER A 1 399 ? 20.250  20.292  1.448   1.00 54.28  ? 399  SER A OG  1 
ATOM   3040 N N   . ALA A 1 400 ? 20.638  18.012  -1.379  1.00 44.93  ? 400  ALA A N   1 
ATOM   3041 C CA  . ALA A 1 400 ? 20.303  16.591  -1.465  1.00 42.48  ? 400  ALA A CA  1 
ATOM   3042 C C   . ALA A 1 400 ? 21.510  15.732  -1.824  1.00 47.66  ? 400  ALA A C   1 
ATOM   3043 O O   . ALA A 1 400 ? 21.686  14.642  -1.284  1.00 45.99  ? 400  ALA A O   1 
ATOM   3044 C CB  . ALA A 1 400 ? 19.186  16.366  -2.471  1.00 37.39  ? 400  ALA A CB  1 
ATOM   3045 N N   . VAL A 1 401 ? 22.330  16.221  -2.749  1.00 46.29  ? 401  VAL A N   1 
ATOM   3046 C CA  . VAL A 1 401 ? 23.576  15.547  -3.101  1.00 47.42  ? 401  VAL A CA  1 
ATOM   3047 C C   . VAL A 1 401 ? 24.443  15.306  -1.862  1.00 45.34  ? 401  VAL A C   1 
ATOM   3048 O O   . VAL A 1 401 ? 24.896  14.185  -1.608  1.00 44.04  ? 401  VAL A O   1 
ATOM   3049 C CB  . VAL A 1 401 ? 24.376  16.375  -4.112  1.00 49.63  ? 401  VAL A CB  1 
ATOM   3050 C CG1 . VAL A 1 401 ? 25.802  15.846  -4.224  1.00 33.58  ? 401  VAL A CG1 1 
ATOM   3051 C CG2 . VAL A 1 401 ? 23.653  16.406  -5.468  1.00 38.66  ? 401  VAL A CG2 1 
ATOM   3052 N N   . VAL A 1 402 ? 24.653  16.360  -1.084  1.00 40.35  ? 402  VAL A N   1 
ATOM   3053 C CA  . VAL A 1 402 ? 25.463  16.255  0.117   1.00 45.94  ? 402  VAL A CA  1 
ATOM   3054 C C   . VAL A 1 402 ? 24.829  15.330  1.150   1.00 52.49  ? 402  VAL A C   1 
ATOM   3055 O O   . VAL A 1 402 ? 25.498  14.441  1.686   1.00 49.30  ? 402  VAL A O   1 
ATOM   3056 C CB  . VAL A 1 402 ? 25.686  17.621  0.751   1.00 42.31  ? 402  VAL A CB  1 
ATOM   3057 C CG1 . VAL A 1 402 ? 26.403  17.465  2.062   1.00 41.76  ? 402  VAL A CG1 1 
ATOM   3058 C CG2 . VAL A 1 402 ? 26.468  18.495  -0.189  1.00 40.31  ? 402  VAL A CG2 1 
ATOM   3059 N N   . GLY A 1 403 ? 23.541  15.546  1.421   1.00 48.67  ? 403  GLY A N   1 
ATOM   3060 C CA  . GLY A 1 403 ? 22.808  14.746  2.383   1.00 40.38  ? 403  GLY A CA  1 
ATOM   3061 C C   . GLY A 1 403 ? 22.761  13.271  2.030   1.00 46.48  ? 403  GLY A C   1 
ATOM   3062 O O   . GLY A 1 403 ? 23.000  12.420  2.878   1.00 49.66  ? 403  GLY A O   1 
ATOM   3063 N N   . ASP A 1 404 ? 22.457  12.971  0.772   1.00 41.32  ? 404  ASP A N   1 
ATOM   3064 C CA  . ASP A 1 404 ? 22.266  11.601  0.322   1.00 39.23  ? 404  ASP A CA  1 
ATOM   3065 C C   . ASP A 1 404 ? 23.550  10.792  0.325   1.00 46.72  ? 404  ASP A C   1 
ATOM   3066 O O   . ASP A 1 404 ? 23.566  9.636   0.724   1.00 46.48  ? 404  ASP A O   1 
ATOM   3067 C CB  . ASP A 1 404 ? 21.681  11.591  -1.091  1.00 40.95  ? 404  ASP A CB  1 
ATOM   3068 C CG  . ASP A 1 404 ? 20.235  12.054  -1.132  1.00 53.22  ? 404  ASP A CG  1 
ATOM   3069 O OD1 . ASP A 1 404 ? 19.605  12.190  -0.056  1.00 53.24  ? 404  ASP A OD1 1 
ATOM   3070 O OD2 . ASP A 1 404 ? 19.723  12.278  -2.250  1.00 59.41  ? 404  ASP A OD2 1 
ATOM   3071 N N   . HIS A 1 405 ? 24.619  11.411  -0.156  1.00 46.42  ? 405  HIS A N   1 
ATOM   3072 C CA  . HIS A 1 405 ? 25.917  10.772  -0.276  1.00 46.46  ? 405  HIS A CA  1 
ATOM   3073 C C   . HIS A 1 405 ? 26.557  10.494  1.093   1.00 45.34  ? 405  HIS A C   1 
ATOM   3074 O O   . HIS A 1 405 ? 27.198  9.469   1.304   1.00 48.38  ? 405  HIS A O   1 
ATOM   3075 C CB  . HIS A 1 405 ? 26.808  11.688  -1.125  1.00 44.58  ? 405  HIS A CB  1 
ATOM   3076 C CG  . HIS A 1 405 ? 28.237  11.256  -1.222  1.00 47.54  ? 405  HIS A CG  1 
ATOM   3077 N ND1 . HIS A 1 405 ? 28.609  9.973   -1.567  1.00 44.22  ? 405  HIS A ND1 1 
ATOM   3078 C CD2 . HIS A 1 405 ? 29.388  11.954  -1.060  1.00 47.33  ? 405  HIS A CD2 1 
ATOM   3079 C CE1 . HIS A 1 405 ? 29.929  9.898   -1.602  1.00 55.34  ? 405  HIS A CE1 1 
ATOM   3080 N NE2 . HIS A 1 405 ? 30.426  11.086  -1.301  1.00 44.45  ? 405  HIS A NE2 1 
ATOM   3081 N N   . ASN A 1 406 ? 26.372  11.408  2.030   1.00 46.18  ? 406  ASN A N   1 
ATOM   3082 C CA  . ASN A 1 406 ? 27.063  11.312  3.310   1.00 45.56  ? 406  ASN A CA  1 
ATOM   3083 C C   . ASN A 1 406 ? 26.288  10.631  4.429   1.00 45.26  ? 406  ASN A C   1 
ATOM   3084 O O   . ASN A 1 406 ? 26.888  10.035  5.315   1.00 45.97  ? 406  ASN A O   1 
ATOM   3085 C CB  . ASN A 1 406 ? 27.526  12.694  3.764   1.00 43.82  ? 406  ASN A CB  1 
ATOM   3086 C CG  . ASN A 1 406 ? 28.651  13.224  2.914   1.00 47.24  ? 406  ASN A CG  1 
ATOM   3087 O OD1 . ASN A 1 406 ? 29.713  12.610  2.832   1.00 44.95  ? 406  ASN A OD1 1 
ATOM   3088 N ND2 . ASN A 1 406 ? 28.424  14.369  2.262   1.00 46.88  ? 406  ASN A ND2 1 
ATOM   3089 N N   . VAL A 1 407 ? 24.963  10.709  4.391   1.00 42.41  ? 407  VAL A N   1 
ATOM   3090 C CA  . VAL A 1 407 ? 24.162  10.198  5.491   1.00 45.17  ? 407  VAL A CA  1 
ATOM   3091 C C   . VAL A 1 407 ? 23.083  9.253   5.015   1.00 42.23  ? 407  VAL A C   1 
ATOM   3092 O O   . VAL A 1 407 ? 23.124  8.068   5.307   1.00 48.85  ? 407  VAL A O   1 
ATOM   3093 C CB  . VAL A 1 407 ? 23.479  11.332  6.277   1.00 48.47  ? 407  VAL A CB  1 
ATOM   3094 C CG1 . VAL A 1 407 ? 22.681  10.759  7.443   1.00 46.17  ? 407  VAL A CG1 1 
ATOM   3095 C CG2 . VAL A 1 407 ? 24.501  12.330  6.767   1.00 46.85  ? 407  VAL A CG2 1 
ATOM   3096 N N   . VAL A 1 408 ? 22.121  9.788   4.272   1.00 43.07  ? 408  VAL A N   1 
ATOM   3097 C CA  . VAL A 1 408 ? 20.931  9.033   3.899   1.00 45.81  ? 408  VAL A CA  1 
ATOM   3098 C C   . VAL A 1 408 ? 21.236  7.712   3.199   1.00 50.46  ? 408  VAL A C   1 
ATOM   3099 O O   . VAL A 1 408 ? 20.632  6.682   3.494   1.00 44.40  ? 408  VAL A O   1 
ATOM   3100 C CB  . VAL A 1 408 ? 19.977  9.852   3.021   1.00 49.16  ? 408  VAL A CB  1 
ATOM   3101 C CG1 . VAL A 1 408 ? 18.779  8.982   2.626   1.00 42.68  ? 408  VAL A CG1 1 
ATOM   3102 C CG2 . VAL A 1 408 ? 19.533  11.125  3.753   1.00 39.67  ? 408  VAL A CG2 1 
ATOM   3103 N N   . CYS A 1 409 ? 22.175  7.727   2.272   1.00 42.23  ? 409  CYS A N   1 
ATOM   3104 C CA  . CYS A 1 409 ? 22.445  6.495   1.561   1.00 45.69  ? 409  CYS A CA  1 
ATOM   3105 C C   . CYS A 1 409 ? 23.336  5.541   2.347   1.00 51.40  ? 409  CYS A C   1 
ATOM   3106 O O   . CYS A 1 409 ? 23.139  4.332   2.292   1.00 50.10  ? 409  CYS A O   1 
ATOM   3107 C CB  . CYS A 1 409 ? 22.916  6.778   0.135   1.00 46.11  ? 409  CYS A CB  1 
ATOM   3108 S SG  . CYS A 1 409 ? 21.499  7.398   -0.860  1.00 60.72  ? 409  CYS A SG  1 
ATOM   3109 N N   . PRO A 1 410 ? 24.304  6.080   3.103   1.00 51.26  ? 410  PRO A N   1 
ATOM   3110 C CA  . PRO A 1 410 ? 25.006  5.183   4.028   1.00 50.12  ? 410  PRO A CA  1 
ATOM   3111 C C   . PRO A 1 410 ? 24.045  4.571   5.047   1.00 47.76  ? 410  PRO A C   1 
ATOM   3112 O O   . PRO A 1 410 ? 24.139  3.391   5.363   1.00 48.42  ? 410  PRO A O   1 
ATOM   3113 C CB  . PRO A 1 410 ? 26.010  6.114   4.712   1.00 44.75  ? 410  PRO A CB  1 
ATOM   3114 C CG  . PRO A 1 410 ? 26.306  7.140   3.653   1.00 48.23  ? 410  PRO A CG  1 
ATOM   3115 C CD  . PRO A 1 410 ? 25.002  7.369   2.941   1.00 41.73  ? 410  PRO A CD  1 
ATOM   3116 N N   . VAL A 1 411 ? 23.126  5.374   5.559   1.00 47.09  ? 411  VAL A N   1 
ATOM   3117 C CA  . VAL A 1 411 ? 22.138  4.871   6.497   1.00 49.40  ? 411  VAL A CA  1 
ATOM   3118 C C   . VAL A 1 411 ? 21.203  3.832   5.847   1.00 51.48  ? 411  VAL A C   1 
ATOM   3119 O O   . VAL A 1 411 ? 20.926  2.785   6.431   1.00 49.39  ? 411  VAL A O   1 
ATOM   3120 C CB  . VAL A 1 411 ? 21.344  6.024   7.126   1.00 47.36  ? 411  VAL A CB  1 
ATOM   3121 C CG1 . VAL A 1 411 ? 20.088  5.512   7.822   1.00 40.10  ? 411  VAL A CG1 1 
ATOM   3122 C CG2 . VAL A 1 411 ? 22.229  6.783   8.095   1.00 42.21  ? 411  VAL A CG2 1 
ATOM   3123 N N   . ALA A 1 412 ? 20.735  4.115   4.635   1.00 51.29  ? 412  ALA A N   1 
ATOM   3124 C CA  . ALA A 1 412 ? 19.902  3.168   3.894   1.00 49.84  ? 412  ALA A CA  1 
ATOM   3125 C C   . ALA A 1 412 ? 20.636  1.853   3.739   1.00 50.92  ? 412  ALA A C   1 
ATOM   3126 O O   . ALA A 1 412 ? 20.116  0.785   4.059   1.00 54.52  ? 412  ALA A O   1 
ATOM   3127 C CB  . ALA A 1 412 ? 19.547  3.726   2.532   1.00 51.86  ? 412  ALA A CB  1 
ATOM   3128 N N   . GLN A 1 413 ? 21.856  1.952   3.238   1.00 48.79  ? 413  GLN A N   1 
ATOM   3129 C CA  . GLN A 1 413 ? 22.734  0.811   3.082   1.00 43.30  ? 413  GLN A CA  1 
ATOM   3130 C C   . GLN A 1 413 ? 22.907  0.055   4.407   1.00 55.01  ? 413  GLN A C   1 
ATOM   3131 O O   . GLN A 1 413 ? 22.869  -1.173  4.445   1.00 54.28  ? 413  GLN A O   1 
ATOM   3132 C CB  . GLN A 1 413 ? 24.078  1.312   2.579   1.00 45.26  ? 413  GLN A CB  1 
ATOM   3133 C CG  . GLN A 1 413 ? 25.228  0.384   2.834   1.00 59.16  ? 413  GLN A CG  1 
ATOM   3134 C CD  . GLN A 1 413 ? 25.750  -0.216  1.565   1.00 68.32  ? 413  GLN A CD  1 
ATOM   3135 O OE1 . GLN A 1 413 ? 25.075  -1.033  0.927   1.00 81.14  ? 413  GLN A OE1 1 
ATOM   3136 N NE2 . GLN A 1 413 ? 26.962  0.186   1.175   1.00 65.22  ? 413  GLN A NE2 1 
ATOM   3137 N N   . LEU A 1 414 ? 23.096  0.789   5.497   1.00 54.54  ? 414  LEU A N   1 
ATOM   3138 C CA  . LEU A 1 414 ? 23.314  0.163   6.795   1.00 50.19  ? 414  LEU A CA  1 
ATOM   3139 C C   . LEU A 1 414 ? 22.073  -0.620  7.246   1.00 53.35  ? 414  LEU A C   1 
ATOM   3140 O O   . LEU A 1 414 ? 22.175  -1.776  7.651   1.00 51.38  ? 414  LEU A O   1 
ATOM   3141 C CB  . LEU A 1 414 ? 23.704  1.212   7.852   1.00 44.39  ? 414  LEU A CB  1 
ATOM   3142 C CG  . LEU A 1 414 ? 24.060  0.670   9.248   1.00 44.63  ? 414  LEU A CG  1 
ATOM   3143 C CD1 . LEU A 1 414 ? 25.398  -0.051  9.234   1.00 46.48  ? 414  LEU A CD1 1 
ATOM   3144 C CD2 . LEU A 1 414 ? 24.099  1.760   10.272  1.00 42.31  ? 414  LEU A CD2 1 
ATOM   3145 N N   . ALA A 1 415 ? 20.907  0.018   7.179   1.00 47.13  ? 415  ALA A N   1 
ATOM   3146 C CA  . ALA A 1 415 ? 19.669  -0.609  7.630   1.00 53.30  ? 415  ALA A CA  1 
ATOM   3147 C C   . ALA A 1 415 ? 19.394  -1.883  6.840   1.00 58.36  ? 415  ALA A C   1 
ATOM   3148 O O   . ALA A 1 415 ? 19.031  -2.916  7.413   1.00 52.18  ? 415  ALA A O   1 
ATOM   3149 C CB  . ALA A 1 415 ? 18.501  0.361   7.517   1.00 48.34  ? 415  ALA A CB  1 
ATOM   3150 N N   . GLY A 1 416 ? 19.588  -1.799  5.526   1.00 55.87  ? 416  GLY A N   1 
ATOM   3151 C CA  . GLY A 1 416 ? 19.456  -2.946  4.648   1.00 52.42  ? 416  GLY A CA  1 
ATOM   3152 C C   . GLY A 1 416 ? 20.322  -4.118  5.068   1.00 59.28  ? 416  GLY A C   1 
ATOM   3153 O O   . GLY A 1 416 ? 19.808  -5.181  5.408   1.00 63.27  ? 416  GLY A O   1 
ATOM   3154 N N   . ARG A 1 417 ? 21.637  -3.925  5.056   1.00 56.04  ? 417  ARG A N   1 
ATOM   3155 C CA  . ARG A 1 417 ? 22.568  -4.991  5.414   1.00 55.42  ? 417  ARG A CA  1 
ATOM   3156 C C   . ARG A 1 417 ? 22.317  -5.588  6.808   1.00 60.58  ? 417  ARG A C   1 
ATOM   3157 O O   . ARG A 1 417 ? 22.419  -6.797  6.993   1.00 63.61  ? 417  ARG A O   1 
ATOM   3158 C CB  . ARG A 1 417 ? 24.017  -4.507  5.310   1.00 58.34  ? 417  ARG A CB  1 
ATOM   3159 C CG  . ARG A 1 417 ? 24.427  -3.907  3.964   1.00 63.47  ? 417  ARG A CG  1 
ATOM   3160 C CD  . ARG A 1 417 ? 24.375  -4.898  2.806   1.00 78.15  ? 417  ARG A CD  1 
ATOM   3161 N NE  . ARG A 1 417 ? 24.793  -6.249  3.179   1.00 86.65  ? 417  ARG A NE  1 
ATOM   3162 C CZ  . ARG A 1 417 ? 25.217  -7.165  2.310   1.00 96.63  ? 417  ARG A CZ  1 
ATOM   3163 N NH1 . ARG A 1 417 ? 25.297  -6.867  1.013   1.00 89.26  ? 417  ARG A NH1 1 
ATOM   3164 N NH2 . ARG A 1 417 ? 25.575  -8.375  2.739   1.00 86.67  ? 417  ARG A NH2 1 
ATOM   3165 N N   . LEU A 1 418 ? 22.007  -4.747  7.789   1.00 55.59  ? 418  LEU A N   1 
ATOM   3166 C CA  . LEU A 1 418 ? 21.782  -5.233  9.148   1.00 57.25  ? 418  LEU A CA  1 
ATOM   3167 C C   . LEU A 1 418 ? 20.523  -6.096  9.222   1.00 64.47  ? 418  LEU A C   1 
ATOM   3168 O O   . LEU A 1 418 ? 20.529  -7.159  9.831   1.00 62.96  ? 418  LEU A O   1 
ATOM   3169 C CB  . LEU A 1 418 ? 21.683  -4.071  10.148  1.00 56.64  ? 418  LEU A CB  1 
ATOM   3170 C CG  . LEU A 1 418 ? 22.925  -3.667  10.955  1.00 61.02  ? 418  LEU A CG  1 
ATOM   3171 C CD1 . LEU A 1 418 ? 24.203  -3.904  10.179  1.00 61.94  ? 418  LEU A CD1 1 
ATOM   3172 C CD2 . LEU A 1 418 ? 22.842  -2.216  11.397  1.00 46.16  ? 418  LEU A CD2 1 
ATOM   3173 N N   . ALA A 1 419 ? 19.440  -5.632  8.608   1.00 59.15  ? 419  ALA A N   1 
ATOM   3174 C CA  . ALA A 1 419 ? 18.194  -6.382  8.626   1.00 55.67  ? 419  ALA A CA  1 
ATOM   3175 C C   . ALA A 1 419 ? 18.387  -7.724  7.914   1.00 67.74  ? 419  ALA A C   1 
ATOM   3176 O O   . ALA A 1 419 ? 17.934  -8.777  8.375   1.00 69.60  ? 419  ALA A O   1 
ATOM   3177 C CB  . ALA A 1 419 ? 17.078  -5.576  7.969   1.00 53.16  ? 419  ALA A CB  1 
ATOM   3178 N N   . ALA A 1 420 ? 19.084  -7.675  6.791   1.00 64.68  ? 420  ALA A N   1 
ATOM   3179 C CA  . ALA A 1 420 ? 19.351  -8.868  6.012   1.00 67.90  ? 420  ALA A CA  1 
ATOM   3180 C C   . ALA A 1 420 ? 20.249  -9.861  6.751   1.00 73.65  ? 420  ALA A C   1 
ATOM   3181 O O   . ALA A 1 420 ? 20.550  -10.935 6.234   1.00 80.41  ? 420  ALA A O   1 
ATOM   3182 C CB  . ALA A 1 420 ? 19.974  -8.483  4.679   1.00 54.97  ? 420  ALA A CB  1 
ATOM   3183 N N   . GLN A 1 421 ? 20.687  -9.520  7.955   1.00 65.55  ? 421  GLN A N   1 
ATOM   3184 C CA  . GLN A 1 421 ? 21.660  -10.376 8.616   1.00 63.81  ? 421  GLN A CA  1 
ATOM   3185 C C   . GLN A 1 421 ? 21.428  -10.527 10.101  1.00 70.60  ? 421  GLN A C   1 
ATOM   3186 O O   . GLN A 1 421 ? 22.376  -10.699 10.870  1.00 73.07  ? 421  GLN A O   1 
ATOM   3187 C CB  . GLN A 1 421 ? 23.069  -9.891  8.325   1.00 63.83  ? 421  GLN A CB  1 
ATOM   3188 C CG  . GLN A 1 421 ? 23.296  -9.741  6.836   1.00 73.66  ? 421  GLN A CG  1 
ATOM   3189 C CD  . GLN A 1 421 ? 24.751  -9.604  6.489   1.00 90.14  ? 421  GLN A CD  1 
ATOM   3190 O OE1 . GLN A 1 421 ? 25.106  -9.160  5.391   1.00 90.26  ? 421  GLN A OE1 1 
ATOM   3191 N NE2 . GLN A 1 421 ? 25.613  -9.983  7.427   1.00 84.43  ? 421  GLN A NE2 1 
ATOM   3192 N N   . GLY A 1 422 ? 20.157  -10.470 10.491  1.00 55.85  ? 422  GLY A N   1 
ATOM   3193 C CA  . GLY A 1 422 ? 19.772  -10.804 11.844  1.00 62.19  ? 422  GLY A CA  1 
ATOM   3194 C C   . GLY A 1 422 ? 19.052  -9.703  12.580  1.00 72.37  ? 422  GLY A C   1 
ATOM   3195 O O   . GLY A 1 422 ? 18.004  -9.928  13.191  1.00 77.09  ? 422  GLY A O   1 
ATOM   3196 N N   . ALA A 1 423 ? 19.616  -8.505  12.515  1.00 72.46  ? 423  ALA A N   1 
ATOM   3197 C CA  . ALA A 1 423 ? 19.203  -7.415  13.384  1.00 61.59  ? 423  ALA A CA  1 
ATOM   3198 C C   . ALA A 1 423 ? 17.727  -7.080  13.259  1.00 52.72  ? 423  ALA A C   1 
ATOM   3199 O O   . ALA A 1 423 ? 17.137  -7.211  12.189  1.00 50.14  ? 423  ALA A O   1 
ATOM   3200 C CB  . ALA A 1 423 ? 20.046  -6.190  13.112  1.00 66.52  ? 423  ALA A CB  1 
ATOM   3201 N N   . ARG A 1 424 ? 17.136  -6.679  14.379  1.00 48.43  ? 424  ARG A N   1 
ATOM   3202 C CA  . ARG A 1 424 ? 15.838  -6.033  14.362  1.00 60.90  ? 424  ARG A CA  1 
ATOM   3203 C C   . ARG A 1 424 ? 16.108  -4.537  14.177  1.00 58.01  ? 424  ARG A C   1 
ATOM   3204 O O   . ARG A 1 424 ? 16.752  -3.910  15.013  1.00 57.22  ? 424  ARG A O   1 
ATOM   3205 C CB  . ARG A 1 424 ? 15.062  -6.319  15.661  1.00 64.37  ? 424  ARG A CB  1 
ATOM   3206 C CG  . ARG A 1 424 ? 13.598  -5.841  15.645  1.00 64.57  ? 424  ARG A CG  1 
ATOM   3207 C CD  . ARG A 1 424 ? 12.683  -6.715  16.519  1.00 84.17  ? 424  ARG A CD  1 
ATOM   3208 N NE  . ARG A 1 424 ? 12.759  -6.389  17.948  1.00 95.34  ? 424  ARG A NE  1 
ATOM   3209 C CZ  . ARG A 1 424 ? 13.346  -7.153  18.871  1.00 93.55  ? 424  ARG A CZ  1 
ATOM   3210 N NH1 . ARG A 1 424 ? 13.917  -8.304  18.523  1.00 93.06  ? 424  ARG A NH1 1 
ATOM   3211 N NH2 . ARG A 1 424 ? 13.364  -6.767  20.143  1.00 82.31  ? 424  ARG A NH2 1 
ATOM   3212 N N   . VAL A 1 425 ? 15.647  -3.980  13.063  1.00 55.98  ? 425  VAL A N   1 
ATOM   3213 C CA  . VAL A 1 425 ? 15.943  -2.596  12.716  1.00 51.74  ? 425  VAL A CA  1 
ATOM   3214 C C   . VAL A 1 425 ? 14.671  -1.768  12.691  1.00 49.64  ? 425  VAL A C   1 
ATOM   3215 O O   . VAL A 1 425 ? 13.662  -2.195  12.145  1.00 55.47  ? 425  VAL A O   1 
ATOM   3216 C CB  . VAL A 1 425 ? 16.606  -2.503  11.320  1.00 54.56  ? 425  VAL A CB  1 
ATOM   3217 C CG1 . VAL A 1 425 ? 17.009  -1.073  11.022  1.00 49.27  ? 425  VAL A CG1 1 
ATOM   3218 C CG2 . VAL A 1 425 ? 17.807  -3.448  11.217  1.00 44.53  ? 425  VAL A CG2 1 
ATOM   3219 N N   . TYR A 1 426 ? 14.714  -0.588  13.292  1.00 53.38  ? 426  TYR A N   1 
ATOM   3220 C CA  . TYR A 1 426 ? 13.607  0.361   13.194  1.00 51.13  ? 426  TYR A CA  1 
ATOM   3221 C C   . TYR A 1 426 ? 14.148  1.599   12.522  1.00 49.52  ? 426  TYR A C   1 
ATOM   3222 O O   . TYR A 1 426 ? 15.282  1.977   12.752  1.00 52.03  ? 426  TYR A O   1 
ATOM   3223 C CB  . TYR A 1 426 ? 13.029  0.695   14.570  1.00 50.57  ? 426  TYR A CB  1 
ATOM   3224 C CG  . TYR A 1 426 ? 12.283  -0.458  15.202  1.00 60.60  ? 426  TYR A CG  1 
ATOM   3225 C CD1 . TYR A 1 426 ? 12.915  -1.306  16.106  1.00 60.95  ? 426  TYR A CD1 1 
ATOM   3226 C CD2 . TYR A 1 426 ? 10.947  -0.714  14.881  1.00 62.34  ? 426  TYR A CD2 1 
ATOM   3227 C CE1 . TYR A 1 426 ? 12.242  -2.371  16.679  1.00 69.67  ? 426  TYR A CE1 1 
ATOM   3228 C CE2 . TYR A 1 426 ? 10.265  -1.779  15.443  1.00 60.39  ? 426  TYR A CE2 1 
ATOM   3229 C CZ  . TYR A 1 426 ? 10.919  -2.603  16.343  1.00 69.47  ? 426  TYR A CZ  1 
ATOM   3230 O OH  . TYR A 1 426 ? 10.260  -3.661  16.915  1.00 65.64  ? 426  TYR A OH  1 
ATOM   3231 N N   . ALA A 1 427 ? 13.350  2.224   11.671  1.00 59.01  ? 427  ALA A N   1 
ATOM   3232 C CA  . ALA A 1 427 ? 13.867  3.305   10.846  1.00 47.51  ? 427  ALA A CA  1 
ATOM   3233 C C   . ALA A 1 427 ? 12.900  4.467   10.820  1.00 52.82  ? 427  ALA A C   1 
ATOM   3234 O O   . ALA A 1 427 ? 11.693  4.271   10.782  1.00 60.95  ? 427  ALA A O   1 
ATOM   3235 C CB  . ALA A 1 427 ? 14.123  2.803   9.437   1.00 46.81  ? 427  ALA A CB  1 
ATOM   3236 N N   . TYR A 1 428 ? 13.423  5.685   10.832  1.00 52.41  ? 428  TYR A N   1 
ATOM   3237 C CA  . TYR A 1 428 ? 12.558  6.851   10.784  1.00 52.60  ? 428  TYR A CA  1 
ATOM   3238 C C   . TYR A 1 428 ? 13.182  7.941   9.928   1.00 53.79  ? 428  TYR A C   1 
ATOM   3239 O O   . TYR A 1 428 ? 14.365  7.906   9.625   1.00 49.14  ? 428  TYR A O   1 
ATOM   3240 C CB  . TYR A 1 428 ? 12.352  7.399   12.191  1.00 47.53  ? 428  TYR A CB  1 
ATOM   3241 C CG  . TYR A 1 428 ? 13.632  7.945   12.749  1.00 54.97  ? 428  TYR A CG  1 
ATOM   3242 C CD1 . TYR A 1 428 ? 14.013  9.270   12.514  1.00 50.90  ? 428  TYR A CD1 1 
ATOM   3243 C CD2 . TYR A 1 428 ? 14.488  7.128   13.477  1.00 45.27  ? 428  TYR A CD2 1 
ATOM   3244 C CE1 . TYR A 1 428 ? 15.210  9.764   13.016  1.00 48.46  ? 428  TYR A CE1 1 
ATOM   3245 C CE2 . TYR A 1 428 ? 15.674  7.607   13.981  1.00 50.43  ? 428  TYR A CE2 1 
ATOM   3246 C CZ  . TYR A 1 428 ? 16.037  8.920   13.753  1.00 53.89  ? 428  TYR A CZ  1 
ATOM   3247 O OH  . TYR A 1 428 ? 17.235  9.370   14.267  1.00 56.90  ? 428  TYR A OH  1 
ATOM   3248 N N   . ILE A 1 429 ? 12.371  8.909   9.535   1.00 54.70  ? 429  ILE A N   1 
ATOM   3249 C CA  . ILE A 1 429 ? 12.892  10.167  9.049   1.00 50.24  ? 429  ILE A CA  1 
ATOM   3250 C C   . ILE A 1 429 ? 12.258  11.234  9.917   1.00 52.26  ? 429  ILE A C   1 
ATOM   3251 O O   . ILE A 1 429 ? 11.052  11.218  10.143  1.00 54.89  ? 429  ILE A O   1 
ATOM   3252 C CB  . ILE A 1 429 ? 12.533  10.413  7.586   1.00 54.61  ? 429  ILE A CB  1 
ATOM   3253 C CG1 . ILE A 1 429 ? 13.087  11.758  7.129   1.00 50.20  ? 429  ILE A CG1 1 
ATOM   3254 C CG2 . ILE A 1 429 ? 11.034  10.386  7.398   1.00 58.50  ? 429  ILE A CG2 1 
ATOM   3255 C CD1 . ILE A 1 429 ? 12.765  12.077  5.701   1.00 51.69  ? 429  ILE A CD1 1 
ATOM   3256 N N   . PHE A 1 430 ? 13.074  12.144  10.428  1.00 48.39  ? 430  PHE A N   1 
ATOM   3257 C CA  . PHE A 1 430 ? 12.586  13.194  11.305  1.00 45.48  ? 430  PHE A CA  1 
ATOM   3258 C C   . PHE A 1 430 ? 12.311  14.428  10.470  1.00 46.44  ? 430  PHE A C   1 
ATOM   3259 O O   . PHE A 1 430 ? 13.205  14.944  9.810   1.00 53.00  ? 430  PHE A O   1 
ATOM   3260 C CB  . PHE A 1 430 ? 13.631  13.493  12.365  1.00 46.67  ? 430  PHE A CB  1 
ATOM   3261 C CG  . PHE A 1 430 ? 13.228  14.546  13.331  1.00 42.62  ? 430  PHE A CG  1 
ATOM   3262 C CD1 . PHE A 1 430 ? 13.423  15.879  13.038  1.00 46.70  ? 430  PHE A CD1 1 
ATOM   3263 C CD2 . PHE A 1 430 ? 12.681  14.201  14.557  1.00 48.51  ? 430  PHE A CD2 1 
ATOM   3264 C CE1 . PHE A 1 430 ? 13.054  16.862  13.945  1.00 51.59  ? 430  PHE A CE1 1 
ATOM   3265 C CE2 . PHE A 1 430 ? 12.316  15.174  15.469  1.00 48.93  ? 430  PHE A CE2 1 
ATOM   3266 C CZ  . PHE A 1 430 ? 12.495  16.507  15.160  1.00 49.99  ? 430  PHE A CZ  1 
ATOM   3267 N N   . GLU A 1 431 ? 11.075  14.907  10.494  1.00 51.57  ? 431  GLU A N   1 
ATOM   3268 C CA  . GLU A 1 431 ? 10.673  15.935  9.546   1.00 55.20  ? 431  GLU A CA  1 
ATOM   3269 C C   . GLU A 1 431 ? 10.138  17.218  10.160  1.00 52.84  ? 431  GLU A C   1 
ATOM   3270 O O   . GLU A 1 431 ? 9.573   18.047  9.459   1.00 54.46  ? 431  GLU A O   1 
ATOM   3271 C CB  . GLU A 1 431 ? 9.620   15.372  8.601   1.00 56.56  ? 431  GLU A CB  1 
ATOM   3272 C CG  . GLU A 1 431 ? 10.124  14.266  7.717   1.00 64.52  ? 431  GLU A CG  1 
ATOM   3273 C CD  . GLU A 1 431 ? 9.098   13.880  6.673   1.00 76.63  ? 431  GLU A CD  1 
ATOM   3274 O OE1 . GLU A 1 431 ? 7.920   13.693  7.061   1.00 75.64  ? 431  GLU A OE1 1 
ATOM   3275 O OE2 . GLU A 1 431 ? 9.468   13.777  5.476   1.00 74.85  ? 431  GLU A OE2 1 
ATOM   3276 N N   . HIS A 1 432 ? 10.292  17.400  11.458  1.00 50.41  ? 432  HIS A N   1 
ATOM   3277 C CA  . HIS A 1 432 ? 9.755   18.612  12.040  1.00 50.37  ? 432  HIS A CA  1 
ATOM   3278 C C   . HIS A 1 432 ? 10.806  19.690  12.269  1.00 56.87  ? 432  HIS A C   1 
ATOM   3279 O O   . HIS A 1 432 ? 11.756  19.509  13.029  1.00 58.39  ? 432  HIS A O   1 
ATOM   3280 C CB  . HIS A 1 432 ? 8.981   18.330  13.326  1.00 59.60  ? 432  HIS A CB  1 
ATOM   3281 C CG  . HIS A 1 432 ? 8.484   19.571  13.995  1.00 61.12  ? 432  HIS A CG  1 
ATOM   3282 N ND1 . HIS A 1 432 ? 7.607   20.441  13.384  1.00 60.99  ? 432  HIS A ND1 1 
ATOM   3283 C CD2 . HIS A 1 432 ? 8.770   20.109  15.204  1.00 59.61  ? 432  HIS A CD2 1 
ATOM   3284 C CE1 . HIS A 1 432 ? 7.365   21.456  14.195  1.00 65.17  ? 432  HIS A CE1 1 
ATOM   3285 N NE2 . HIS A 1 432 ? 8.057   21.276  15.307  1.00 61.02  ? 432  HIS A NE2 1 
ATOM   3286 N N   . ARG A 1 433 ? 10.619  20.821  11.604  1.00 52.46  ? 433  ARG A N   1 
ATOM   3287 C CA  . ARG A 1 433 ? 11.448  21.988  11.841  1.00 54.17  ? 433  ARG A CA  1 
ATOM   3288 C C   . ARG A 1 433 ? 11.027  22.703  13.124  1.00 59.42  ? 433  ARG A C   1 
ATOM   3289 O O   . ARG A 1 433 ? 9.881   23.126  13.268  1.00 64.84  ? 433  ARG A O   1 
ATOM   3290 C CB  . ARG A 1 433 ? 11.364  22.936  10.650  1.00 55.59  ? 433  ARG A CB  1 
ATOM   3291 C CG  . ARG A 1 433 ? 11.778  24.353  10.959  1.00 63.58  ? 433  ARG A CG  1 
ATOM   3292 C CD  . ARG A 1 433 ? 11.762  25.195  9.698   1.00 64.10  ? 433  ARG A CD  1 
ATOM   3293 N NE  . ARG A 1 433 ? 13.106  25.445  9.218   1.00 64.23  ? 433  ARG A NE  1 
ATOM   3294 C CZ  . ARG A 1 433 ? 13.774  26.565  9.453   1.00 66.32  ? 433  ARG A CZ  1 
ATOM   3295 N NH1 . ARG A 1 433 ? 13.202  27.540  10.149  1.00 55.83  ? 433  ARG A NH1 1 
ATOM   3296 N NH2 . ARG A 1 433 ? 15.014  26.703  8.992   1.00 66.51  ? 433  ARG A NH2 1 
ATOM   3297 N N   . ALA A 1 434 ? 11.959  22.826  14.061  1.00 58.98  ? 434  ALA A N   1 
ATOM   3298 C CA  . ALA A 1 434 ? 11.674  23.481  15.324  1.00 55.62  ? 434  ALA A CA  1 
ATOM   3299 C C   . ALA A 1 434 ? 11.219  24.910  15.065  1.00 64.45  ? 434  ALA A C   1 
ATOM   3300 O O   . ALA A 1 434 ? 11.860  25.656  14.313  1.00 57.52  ? 434  ALA A O   1 
ATOM   3301 C CB  . ALA A 1 434 ? 12.902  23.461  16.222  1.00 60.60  ? 434  ALA A CB  1 
ATOM   3302 N N   . SER A 1 435 ? 10.099  25.278  15.680  1.00 58.99  ? 435  SER A N   1 
ATOM   3303 C CA  . SER A 1 435 ? 9.570   26.632  15.578  1.00 59.73  ? 435  SER A CA  1 
ATOM   3304 C C   . SER A 1 435 ? 10.632  27.642  16.001  1.00 61.09  ? 435  SER A C   1 
ATOM   3305 O O   . SER A 1 435 ? 10.669  28.769  15.511  1.00 59.41  ? 435  SER A O   1 
ATOM   3306 C CB  . SER A 1 435 ? 8.331   26.774  16.462  1.00 57.96  ? 435  SER A CB  1 
ATOM   3307 O OG  . SER A 1 435 ? 8.679   26.752  17.834  1.00 62.28  ? 435  SER A OG  1 
ATOM   3308 N N   . THR A 1 436 ? 11.507  27.206  16.901  1.00 60.73  ? 436  THR A N   1 
ATOM   3309 C CA  . THR A 1 436 ? 12.546  28.045  17.486  1.00 59.70  ? 436  THR A CA  1 
ATOM   3310 C C   . THR A 1 436 ? 13.838  28.115  16.660  1.00 57.06  ? 436  THR A C   1 
ATOM   3311 O O   . THR A 1 436 ? 14.832  28.669  17.117  1.00 60.24  ? 436  THR A O   1 
ATOM   3312 C CB  . THR A 1 436 ? 12.915  27.517  18.889  1.00 64.76  ? 436  THR A CB  1 
ATOM   3313 O OG1 . THR A 1 436 ? 13.829  26.417  18.769  1.00 72.21  ? 436  THR A OG1 1 
ATOM   3314 C CG2 . THR A 1 436 ? 11.674  27.030  19.604  1.00 66.24  ? 436  THR A CG2 1 
ATOM   3315 N N   . LEU A 1 437 ? 13.834  27.555  15.455  1.00 57.55  ? 437  LEU A N   1 
ATOM   3316 C CA  . LEU A 1 437 ? 15.065  27.427  14.669  1.00 59.98  ? 437  LEU A CA  1 
ATOM   3317 C C   . LEU A 1 437 ? 15.596  28.769  14.162  1.00 59.45  ? 437  LEU A C   1 
ATOM   3318 O O   . LEU A 1 437 ? 14.836  29.573  13.620  1.00 63.51  ? 437  LEU A O   1 
ATOM   3319 C CB  . LEU A 1 437 ? 14.832  26.479  13.491  1.00 59.77  ? 437  LEU A CB  1 
ATOM   3320 C CG  . LEU A 1 437 ? 16.080  25.808  12.932  1.00 63.02  ? 437  LEU A CG  1 
ATOM   3321 C CD1 . LEU A 1 437 ? 16.897  25.255  14.080  1.00 50.66  ? 437  LEU A CD1 1 
ATOM   3322 C CD2 . LEU A 1 437 ? 15.714  24.714  11.927  1.00 54.72  ? 437  LEU A CD2 1 
ATOM   3323 N N   . THR A 1 438 ? 16.897  29.011  14.328  1.00 56.35  ? 438  THR A N   1 
ATOM   3324 C CA  . THR A 1 438 ? 17.487  30.273  13.872  1.00 59.36  ? 438  THR A CA  1 
ATOM   3325 C C   . THR A 1 438 ? 18.050  30.226  12.448  1.00 63.25  ? 438  THR A C   1 
ATOM   3326 O O   . THR A 1 438 ? 18.440  31.256  11.897  1.00 64.57  ? 438  THR A O   1 
ATOM   3327 C CB  . THR A 1 438 ? 18.588  30.772  14.812  1.00 60.88  ? 438  THR A CB  1 
ATOM   3328 O OG1 . THR A 1 438 ? 19.606  29.772  14.920  1.00 66.59  ? 438  THR A OG1 1 
ATOM   3329 C CG2 . THR A 1 438 ? 18.017  31.054  16.178  1.00 52.33  ? 438  THR A CG2 1 
ATOM   3330 N N   . TRP A 1 439 ? 18.096  29.039  11.853  1.00 56.29  ? 439  TRP A N   1 
ATOM   3331 C CA  . TRP A 1 439 ? 18.540  28.915  10.476  1.00 51.35  ? 439  TRP A CA  1 
ATOM   3332 C C   . TRP A 1 439 ? 17.387  29.265  9.533   1.00 60.37  ? 439  TRP A C   1 
ATOM   3333 O O   . TRP A 1 439 ? 16.212  29.139  9.902   1.00 51.40  ? 439  TRP A O   1 
ATOM   3334 C CB  . TRP A 1 439 ? 19.045  27.495  10.191  1.00 53.96  ? 439  TRP A CB  1 
ATOM   3335 C CG  . TRP A 1 439 ? 20.291  27.113  10.935  1.00 53.69  ? 439  TRP A CG  1 
ATOM   3336 C CD1 . TRP A 1 439 ? 20.360  26.383  12.079  1.00 54.07  ? 439  TRP A CD1 1 
ATOM   3337 C CD2 . TRP A 1 439 ? 21.649  27.433  10.582  1.00 53.30  ? 439  TRP A CD2 1 
ATOM   3338 N NE1 . TRP A 1 439 ? 21.670  26.237  12.473  1.00 51.05  ? 439  TRP A NE1 1 
ATOM   3339 C CE2 . TRP A 1 439 ? 22.481  26.865  11.569  1.00 50.80  ? 439  TRP A CE2 1 
ATOM   3340 C CE3 . TRP A 1 439 ? 22.239  28.140  9.531   1.00 45.20  ? 439  TRP A CE3 1 
ATOM   3341 C CZ2 . TRP A 1 439 ? 23.872  26.984  11.539  1.00 49.66  ? 439  TRP A CZ2 1 
ATOM   3342 C CZ3 . TRP A 1 439 ? 23.621  28.256  9.499   1.00 50.25  ? 439  TRP A CZ3 1 
ATOM   3343 C CH2 . TRP A 1 439 ? 24.421  27.680  10.499  1.00 54.81  ? 439  TRP A CH2 1 
ATOM   3344 N N   . PRO A 1 440 ? 17.725  29.696  8.305   1.00 53.04  ? 440  PRO A N   1 
ATOM   3345 C CA  . PRO A 1 440 ? 16.766  30.091  7.271   1.00 44.89  ? 440  PRO A CA  1 
ATOM   3346 C C   . PRO A 1 440 ? 15.839  28.944  6.935   1.00 58.68  ? 440  PRO A C   1 
ATOM   3347 O O   . PRO A 1 440 ? 16.226  27.787  7.117   1.00 64.42  ? 440  PRO A O   1 
ATOM   3348 C CB  . PRO A 1 440 ? 17.651  30.352  6.045   1.00 51.32  ? 440  PRO A CB  1 
ATOM   3349 C CG  . PRO A 1 440 ? 19.014  30.518  6.550   1.00 55.38  ? 440  PRO A CG  1 
ATOM   3350 C CD  . PRO A 1 440 ? 19.112  29.725  7.813   1.00 57.23  ? 440  PRO A CD  1 
ATOM   3351 N N   . LEU A 1 441 ? 14.658  29.252  6.413   1.00 47.43  ? 441  LEU A N   1 
ATOM   3352 C CA  . LEU A 1 441 ? 13.724  28.221  6.004   1.00 54.50  ? 441  LEU A CA  1 
ATOM   3353 C C   . LEU A 1 441 ? 14.264  27.351  4.892   1.00 58.06  ? 441  LEU A C   1 
ATOM   3354 O O   . LEU A 1 441 ? 13.879  26.188  4.775   1.00 61.34  ? 441  LEU A O   1 
ATOM   3355 C CB  . LEU A 1 441 ? 12.419  28.849  5.537   1.00 63.90  ? 441  LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 441 ? 11.677  29.438  6.722   1.00 71.27  ? 441  LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 441 ? 10.908  30.667  6.291   1.00 69.20  ? 441  LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 441 ? 10.780  28.369  7.339   1.00 69.03  ? 441  LEU A CD2 1 
ATOM   3359 N N   . TRP A 1 442 ? 15.137  27.912  4.059   1.00 56.87  ? 442  TRP A N   1 
ATOM   3360 C CA  . TRP A 1 442 ? 15.616  27.164  2.909   1.00 54.69  ? 442  TRP A CA  1 
ATOM   3361 C C   . TRP A 1 442 ? 16.383  25.923  3.356   1.00 55.71  ? 442  TRP A C   1 
ATOM   3362 O O   . TRP A 1 442 ? 16.459  24.936  2.622   1.00 52.67  ? 442  TRP A O   1 
ATOM   3363 C CB  . TRP A 1 442 ? 16.405  28.040  1.917   1.00 43.36  ? 442  TRP A CB  1 
ATOM   3364 C CG  . TRP A 1 442 ? 17.792  28.448  2.324   1.00 52.66  ? 442  TRP A CG  1 
ATOM   3365 C CD1 . TRP A 1 442 ? 18.181  29.673  2.785   1.00 54.73  ? 442  TRP A CD1 1 
ATOM   3366 C CD2 . TRP A 1 442 ? 18.987  27.649  2.256   1.00 51.80  ? 442  TRP A CD2 1 
ATOM   3367 N NE1 . TRP A 1 442 ? 19.536  29.685  3.029   1.00 55.25  ? 442  TRP A NE1 1 
ATOM   3368 C CE2 . TRP A 1 442 ? 20.057  28.457  2.716   1.00 51.50  ? 442  TRP A CE2 1 
ATOM   3369 C CE3 . TRP A 1 442 ? 19.254  26.327  1.870   1.00 44.72  ? 442  TRP A CE3 1 
ATOM   3370 C CZ2 . TRP A 1 442 ? 21.371  27.987  2.807   1.00 44.98  ? 442  TRP A CZ2 1 
ATOM   3371 C CZ3 . TRP A 1 442 ? 20.565  25.860  1.954   1.00 45.67  ? 442  TRP A CZ3 1 
ATOM   3372 C CH2 . TRP A 1 442 ? 21.606  26.692  2.423   1.00 52.12  ? 442  TRP A CH2 1 
ATOM   3373 N N   . MET A 1 443 ? 16.911  25.963  4.579   1.00 54.36  ? 443  MET A N   1 
ATOM   3374 C CA  . MET A 1 443 ? 17.666  24.837  5.115   1.00 45.56  ? 443  MET A CA  1 
ATOM   3375 C C   . MET A 1 443 ? 16.789  23.711  5.632   1.00 52.99  ? 443  MET A C   1 
ATOM   3376 O O   . MET A 1 443 ? 17.279  22.610  5.884   1.00 52.89  ? 443  MET A O   1 
ATOM   3377 C CB  . MET A 1 443 ? 18.619  25.294  6.193   1.00 45.53  ? 443  MET A CB  1 
ATOM   3378 C CG  . MET A 1 443 ? 19.662  26.238  5.668   1.00 52.35  ? 443  MET A CG  1 
ATOM   3379 S SD  . MET A 1 443 ? 21.079  26.331  6.750   1.00 56.12  ? 443  MET A SD  1 
ATOM   3380 C CE  . MET A 1 443 ? 21.710  27.932  6.312   1.00 62.46  ? 443  MET A CE  1 
ATOM   3381 N N   . GLY A 1 444 ? 15.494  23.982  5.773   1.00 52.58  ? 444  GLY A N   1 
ATOM   3382 C CA  . GLY A 1 444 ? 14.531  22.968  6.171   1.00 47.38  ? 444  GLY A CA  1 
ATOM   3383 C C   . GLY A 1 444 ? 14.798  22.436  7.563   1.00 49.65  ? 444  GLY A C   1 
ATOM   3384 O O   . GLY A 1 444 ? 14.972  23.214  8.509   1.00 46.38  ? 444  GLY A O   1 
ATOM   3385 N N   . VAL A 1 445 ? 14.826  21.109  7.684   1.00 47.12  ? 445  VAL A N   1 
ATOM   3386 C CA  . VAL A 1 445 ? 15.192  20.446  8.937   1.00 52.70  ? 445  VAL A CA  1 
ATOM   3387 C C   . VAL A 1 445 ? 16.655  20.000  8.870   1.00 53.46  ? 445  VAL A C   1 
ATOM   3388 O O   . VAL A 1 445 ? 16.956  18.925  8.353   1.00 52.40  ? 445  VAL A O   1 
ATOM   3389 C CB  . VAL A 1 445 ? 14.305  19.215  9.203   1.00 53.32  ? 445  VAL A CB  1 
ATOM   3390 C CG1 . VAL A 1 445 ? 14.660  18.588  10.545  1.00 55.72  ? 445  VAL A CG1 1 
ATOM   3391 C CG2 . VAL A 1 445 ? 12.831  19.599  9.163   1.00 55.58  ? 445  VAL A CG2 1 
ATOM   3392 N N   . PRO A 1 446 ? 17.573  20.832  9.376   1.00 46.92  ? 446  PRO A N   1 
ATOM   3393 C CA  . PRO A 1 446 ? 18.999  20.563  9.181   1.00 48.43  ? 446  PRO A CA  1 
ATOM   3394 C C   . PRO A 1 446 ? 19.570  19.487  10.092  1.00 51.57  ? 446  PRO A C   1 
ATOM   3395 O O   . PRO A 1 446 ? 19.031  19.134  11.142  1.00 48.15  ? 446  PRO A O   1 
ATOM   3396 C CB  . PRO A 1 446 ? 19.664  21.904  9.526   1.00 46.26  ? 446  PRO A CB  1 
ATOM   3397 C CG  . PRO A 1 446 ? 18.542  22.892  9.687   1.00 46.70  ? 446  PRO A CG  1 
ATOM   3398 C CD  . PRO A 1 446 ? 17.352  22.102  10.079  1.00 42.62  ? 446  PRO A CD  1 
ATOM   3399 N N   . HIS A 1 447 ? 20.709  18.983  9.651   1.00 54.52  ? 447  HIS A N   1 
ATOM   3400 C CA  . HIS A 1 447 ? 21.521  18.035  10.387  1.00 49.67  ? 447  HIS A CA  1 
ATOM   3401 C C   . HIS A 1 447 ? 21.741  18.482  11.836  1.00 52.05  ? 447  HIS A C   1 
ATOM   3402 O O   . HIS A 1 447 ? 22.320  19.541  12.098  1.00 51.38  ? 447  HIS A O   1 
ATOM   3403 C CB  . HIS A 1 447 ? 22.848  17.933  9.651   1.00 49.18  ? 447  HIS A CB  1 
ATOM   3404 C CG  . HIS A 1 447 ? 23.746  16.848  10.143  1.00 52.85  ? 447  HIS A CG  1 
ATOM   3405 N ND1 . HIS A 1 447 ? 23.505  15.515  9.895   1.00 53.30  ? 447  HIS A ND1 1 
ATOM   3406 C CD2 . HIS A 1 447 ? 24.913  16.902  10.823  1.00 51.98  ? 447  HIS A CD2 1 
ATOM   3407 C CE1 . HIS A 1 447 ? 24.475  14.790  10.419  1.00 50.20  ? 447  HIS A CE1 1 
ATOM   3408 N NE2 . HIS A 1 447 ? 25.343  15.607  10.989  1.00 59.93  ? 447  HIS A NE2 1 
ATOM   3409 N N   . GLY A 1 448 ? 21.269  17.670  12.773  1.00 49.29  ? 448  GLY A N   1 
ATOM   3410 C CA  . GLY A 1 448 ? 21.456  17.940  14.183  1.00 45.30  ? 448  GLY A CA  1 
ATOM   3411 C C   . GLY A 1 448 ? 20.242  18.485  14.913  1.00 47.12  ? 448  GLY A C   1 
ATOM   3412 O O   . GLY A 1 448 ? 20.270  18.658  16.133  1.00 46.62  ? 448  GLY A O   1 
ATOM   3413 N N   . TYR A 1 449 ? 19.162  18.753  14.191  1.00 48.76  ? 449  TYR A N   1 
ATOM   3414 C CA  . TYR A 1 449 ? 18.047  19.459  14.826  1.00 50.84  ? 449  TYR A CA  1 
ATOM   3415 C C   . TYR A 1 449 ? 16.873  18.598  15.261  1.00 50.24  ? 449  TYR A C   1 
ATOM   3416 O O   . TYR A 1 449 ? 15.789  19.106  15.504  1.00 58.28  ? 449  TYR A O   1 
ATOM   3417 C CB  . TYR A 1 449 ? 17.638  20.710  14.039  1.00 43.97  ? 449  TYR A CB  1 
ATOM   3418 C CG  . TYR A 1 449 ? 18.706  21.765  14.193  1.00 49.28  ? 449  TYR A CG  1 
ATOM   3419 C CD1 . TYR A 1 449 ? 19.823  21.770  13.355  1.00 48.34  ? 449  TYR A CD1 1 
ATOM   3420 C CD2 . TYR A 1 449 ? 18.644  22.712  15.216  1.00 42.18  ? 449  TYR A CD2 1 
ATOM   3421 C CE1 . TYR A 1 449 ? 20.838  22.704  13.506  1.00 39.98  ? 449  TYR A CE1 1 
ATOM   3422 C CE2 . TYR A 1 449 ? 19.662  23.665  15.374  1.00 49.51  ? 449  TYR A CE2 1 
ATOM   3423 C CZ  . TYR A 1 449 ? 20.756  23.649  14.511  1.00 48.34  ? 449  TYR A CZ  1 
ATOM   3424 O OH  . TYR A 1 449 ? 21.775  24.569  14.641  1.00 48.33  ? 449  TYR A OH  1 
ATOM   3425 N N   . GLU A 1 450 ? 17.115  17.298  15.395  1.00 53.15  ? 450  GLU A N   1 
ATOM   3426 C CA  . GLU A 1 450 ? 16.177  16.414  16.074  1.00 49.16  ? 450  GLU A CA  1 
ATOM   3427 C C   . GLU A 1 450 ? 16.602  16.274  17.523  1.00 47.14  ? 450  GLU A C   1 
ATOM   3428 O O   . GLU A 1 450 ? 15.778  16.050  18.393  1.00 50.01  ? 450  GLU A O   1 
ATOM   3429 C CB  . GLU A 1 450 ? 16.149  15.033  15.427  1.00 49.08  ? 450  GLU A CB  1 
ATOM   3430 C CG  . GLU A 1 450 ? 17.273  14.117  15.876  1.00 53.81  ? 450  GLU A CG  1 
ATOM   3431 C CD  . GLU A 1 450 ? 18.603  14.387  15.169  1.00 57.53  ? 450  GLU A CD  1 
ATOM   3432 O OE1 . GLU A 1 450 ? 18.910  15.559  14.843  1.00 58.49  ? 450  GLU A OE1 1 
ATOM   3433 O OE2 . GLU A 1 450 ? 19.350  13.411  14.943  1.00 60.32  ? 450  GLU A OE2 1 
ATOM   3434 N N   . ILE A 1 451 ? 17.896  16.424  17.778  1.00 50.32  ? 451  ILE A N   1 
ATOM   3435 C CA  . ILE A 1 451 ? 18.450  16.186  19.112  1.00 50.24  ? 451  ILE A CA  1 
ATOM   3436 C C   . ILE A 1 451 ? 17.680  16.882  20.243  1.00 48.01  ? 451  ILE A C   1 
ATOM   3437 O O   . ILE A 1 451 ? 17.401  16.271  21.271  1.00 53.43  ? 451  ILE A O   1 
ATOM   3438 C CB  . ILE A 1 451 ? 19.947  16.581  19.183  1.00 41.57  ? 451  ILE A CB  1 
ATOM   3439 C CG1 . ILE A 1 451 ? 20.751  15.829  18.124  1.00 44.61  ? 451  ILE A CG1 1 
ATOM   3440 C CG2 . ILE A 1 451 ? 20.503  16.298  20.558  1.00 39.33  ? 451  ILE A CG2 1 
ATOM   3441 C CD1 . ILE A 1 451 ? 22.233  16.172  18.102  1.00 45.25  ? 451  ILE A CD1 1 
ATOM   3442 N N   . GLU A 1 452 ? 17.355  18.159  20.059  1.00 52.56  ? 452  GLU A N   1 
ATOM   3443 C CA  . GLU A 1 452 ? 16.678  18.932  21.103  1.00 52.64  ? 452  GLU A CA  1 
ATOM   3444 C C   . GLU A 1 452 ? 15.332  18.321  21.496  1.00 55.99  ? 452  GLU A C   1 
ATOM   3445 O O   . GLU A 1 452 ? 14.885  18.478  22.632  1.00 60.57  ? 452  GLU A O   1 
ATOM   3446 C CB  . GLU A 1 452 ? 16.524  20.412  20.706  1.00 51.58  ? 452  GLU A CB  1 
ATOM   3447 C CG  . GLU A 1 452 ? 15.919  20.653  19.319  1.00 58.15  ? 452  GLU A CG  1 
ATOM   3448 C CD  . GLU A 1 452 ? 16.168  22.067  18.778  1.00 58.14  ? 452  GLU A CD  1 
ATOM   3449 O OE1 . GLU A 1 452 ? 15.213  22.866  18.723  1.00 69.40  ? 452  GLU A OE1 1 
ATOM   3450 O OE2 . GLU A 1 452 ? 17.314  22.388  18.398  1.00 61.91  ? 452  GLU A OE2 1 
ATOM   3451 N N   . PHE A 1 453 ? 14.700  17.605  20.572  1.00 48.27  ? 453  PHE A N   1 
ATOM   3452 C CA  . PHE A 1 453 ? 13.417  16.974  20.860  1.00 47.17  ? 453  PHE A CA  1 
ATOM   3453 C C   . PHE A 1 453 ? 13.558  15.662  21.612  1.00 49.47  ? 453  PHE A C   1 
ATOM   3454 O O   . PHE A 1 453 ? 12.820  15.401  22.559  1.00 55.73  ? 453  PHE A O   1 
ATOM   3455 C CB  . PHE A 1 453 ? 12.593  16.800  19.583  1.00 50.58  ? 453  PHE A CB  1 
ATOM   3456 C CG  . PHE A 1 453 ? 12.131  18.096  19.007  1.00 49.22  ? 453  PHE A CG  1 
ATOM   3457 C CD1 . PHE A 1 453 ? 11.018  18.731  19.516  1.00 52.48  ? 453  PHE A CD1 1 
ATOM   3458 C CD2 . PHE A 1 453 ? 12.835  18.706  17.995  1.00 46.27  ? 453  PHE A CD2 1 
ATOM   3459 C CE1 . PHE A 1 453 ? 10.597  19.942  19.009  1.00 54.84  ? 453  PHE A CE1 1 
ATOM   3460 C CE2 . PHE A 1 453 ? 12.421  19.920  17.487  1.00 65.23  ? 453  PHE A CE2 1 
ATOM   3461 C CZ  . PHE A 1 453 ? 11.296  20.541  17.998  1.00 56.32  ? 453  PHE A CZ  1 
ATOM   3462 N N   . ILE A 1 454 ? 14.510  14.845  21.187  1.00 52.29  ? 454  ILE A N   1 
ATOM   3463 C CA  . ILE A 1 454 ? 14.809  13.579  21.843  1.00 48.35  ? 454  ILE A CA  1 
ATOM   3464 C C   . ILE A 1 454 ? 15.183  13.775  23.306  1.00 49.43  ? 454  ILE A C   1 
ATOM   3465 O O   . ILE A 1 454 ? 14.765  13.008  24.163  1.00 54.70  ? 454  ILE A O   1 
ATOM   3466 C CB  . ILE A 1 454 ? 15.997  12.912  21.170  1.00 50.96  ? 454  ILE A CB  1 
ATOM   3467 C CG1 . ILE A 1 454 ? 15.862  12.998  19.641  1.00 50.77  ? 454  ILE A CG1 1 
ATOM   3468 C CG2 . ILE A 1 454 ? 16.177  11.493  21.695  1.00 43.73  ? 454  ILE A CG2 1 
ATOM   3469 C CD1 . ILE A 1 454 ? 15.186  11.830  19.009  1.00 50.92  ? 454  ILE A CD1 1 
ATOM   3470 N N   . PHE A 1 455 ? 15.987  14.795  23.585  1.00 46.78  ? 455  PHE A N   1 
ATOM   3471 C CA  . PHE A 1 455 ? 16.417  15.075  24.950  1.00 50.76  ? 455  PHE A CA  1 
ATOM   3472 C C   . PHE A 1 455 ? 15.339  15.799  25.765  1.00 56.73  ? 455  PHE A C   1 
ATOM   3473 O O   . PHE A 1 455 ? 15.485  15.980  26.979  1.00 55.00  ? 455  PHE A O   1 
ATOM   3474 C CB  . PHE A 1 455 ? 17.717  15.883  24.953  1.00 49.55  ? 455  PHE A CB  1 
ATOM   3475 C CG  . PHE A 1 455 ? 18.954  15.044  24.895  1.00 40.98  ? 455  PHE A CG  1 
ATOM   3476 C CD1 . PHE A 1 455 ? 19.431  14.576  23.690  1.00 42.36  ? 455  PHE A CD1 1 
ATOM   3477 C CD2 . PHE A 1 455 ? 19.649  14.736  26.049  1.00 48.06  ? 455  PHE A CD2 1 
ATOM   3478 C CE1 . PHE A 1 455 ? 20.583  13.800  23.632  1.00 46.63  ? 455  PHE A CE1 1 
ATOM   3479 C CE2 . PHE A 1 455 ? 20.799  13.969  26.006  1.00 47.79  ? 455  PHE A CE2 1 
ATOM   3480 C CZ  . PHE A 1 455 ? 21.265  13.497  24.789  1.00 51.25  ? 455  PHE A CZ  1 
ATOM   3481 N N   . GLY A 1 456 ? 14.270  16.224  25.092  1.00 51.67  ? 456  GLY A N   1 
ATOM   3482 C CA  . GLY A 1 456 ? 13.122  16.811  25.765  1.00 54.66  ? 456  GLY A CA  1 
ATOM   3483 C C   . GLY A 1 456 ? 13.240  18.279  26.139  1.00 58.32  ? 456  GLY A C   1 
ATOM   3484 O O   . GLY A 1 456 ? 12.594  18.743  27.069  1.00 56.83  ? 456  GLY A O   1 
ATOM   3485 N N   . LEU A 1 457 ? 14.058  19.024  25.411  1.00 63.14  ? 457  LEU A N   1 
ATOM   3486 C CA  . LEU A 1 457 ? 14.219  20.443  25.709  1.00 60.60  ? 457  LEU A CA  1 
ATOM   3487 C C   . LEU A 1 457 ? 12.920  21.244  25.612  1.00 54.24  ? 457  LEU A C   1 
ATOM   3488 O O   . LEU A 1 457 ? 12.709  22.168  26.381  1.00 60.48  ? 457  LEU A O   1 
ATOM   3489 C CB  . LEU A 1 457 ? 15.325  21.074  24.851  1.00 49.97  ? 457  LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 457 ? 16.738  20.991  25.450  1.00 56.77  ? 457  LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 457 ? 17.222  19.544  25.585  1.00 56.24  ? 457  LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 457 ? 17.734  21.805  24.644  1.00 51.67  ? 457  LEU A CD2 1 
ATOM   3493 N N   . PRO A 1 458 ? 12.044  20.902  24.666  1.00 55.53  ? 458  PRO A N   1 
ATOM   3494 C CA  . PRO A 1 458 ? 10.812  21.699  24.589  1.00 63.07  ? 458  PRO A CA  1 
ATOM   3495 C C   . PRO A 1 458 ? 9.978   21.700  25.879  1.00 64.77  ? 458  PRO A C   1 
ATOM   3496 O O   . PRO A 1 458 ? 9.074   22.525  25.995  1.00 68.31  ? 458  PRO A O   1 
ATOM   3497 C CB  . PRO A 1 458 ? 10.045  21.041  23.439  1.00 57.83  ? 458  PRO A CB  1 
ATOM   3498 C CG  . PRO A 1 458 ? 11.128  20.495  22.559  1.00 59.97  ? 458  PRO A CG  1 
ATOM   3499 C CD  . PRO A 1 458 ? 12.187  19.996  23.515  1.00 57.93  ? 458  PRO A CD  1 
ATOM   3500 N N   . LEU A 1 459 ? 10.291  20.816  26.827  1.00 66.03  ? 459  LEU A N   1 
ATOM   3501 C CA  . LEU A 1 459 ? 9.564   20.732  28.100  1.00 60.87  ? 459  LEU A CA  1 
ATOM   3502 C C   . LEU A 1 459 ? 9.953   21.831  29.079  1.00 62.64  ? 459  LEU A C   1 
ATOM   3503 O O   . LEU A 1 459 ? 9.275   22.042  30.082  1.00 70.90  ? 459  LEU A O   1 
ATOM   3504 C CB  . LEU A 1 459 ? 9.794   19.381  28.774  1.00 51.73  ? 459  LEU A CB  1 
ATOM   3505 C CG  . LEU A 1 459 ? 8.969   18.180  28.318  1.00 60.42  ? 459  LEU A CG  1 
ATOM   3506 C CD1 . LEU A 1 459 ? 8.667   18.228  26.834  1.00 66.30  ? 459  LEU A CD1 1 
ATOM   3507 C CD2 . LEU A 1 459 ? 9.689   16.902  28.687  1.00 53.06  ? 459  LEU A CD2 1 
ATOM   3508 N N   . ASP A 1 460 ? 11.057  22.513  28.807  1.00 59.27  ? 460  ASP A N   1 
ATOM   3509 C CA  . ASP A 1 460 ? 11.472  23.617  29.652  1.00 66.20  ? 460  ASP A CA  1 
ATOM   3510 C C   . ASP A 1 460 ? 10.703  24.866  29.245  1.00 73.98  ? 460  ASP A C   1 
ATOM   3511 O O   . ASP A 1 460 ? 10.920  25.427  28.171  1.00 70.00  ? 460  ASP A O   1 
ATOM   3512 C CB  . ASP A 1 460 ? 12.979  23.845  29.556  1.00 67.57  ? 460  ASP A CB  1 
ATOM   3513 C CG  . ASP A 1 460 ? 13.436  25.040  30.364  1.00 78.43  ? 460  ASP A CG  1 
ATOM   3514 O OD1 . ASP A 1 460 ? 12.573  25.817  30.840  1.00 83.18  ? 460  ASP A OD1 1 
ATOM   3515 O OD2 . ASP A 1 460 ? 14.664  25.204  30.521  1.00 80.14  ? 460  ASP A OD2 1 
ATOM   3516 N N   . PRO A 1 461 ? 9.799   25.310  30.120  1.00 86.78  ? 461  PRO A N   1 
ATOM   3517 C CA  . PRO A 1 461 ? 8.862   26.402  29.835  1.00 82.91  ? 461  PRO A CA  1 
ATOM   3518 C C   . PRO A 1 461 ? 9.572   27.648  29.312  1.00 77.82  ? 461  PRO A C   1 
ATOM   3519 O O   . PRO A 1 461 ? 9.086   28.294  28.383  1.00 84.65  ? 461  PRO A O   1 
ATOM   3520 C CB  . PRO A 1 461 ? 8.235   26.683  31.201  1.00 90.37  ? 461  PRO A CB  1 
ATOM   3521 C CG  . PRO A 1 461 ? 8.405   25.397  31.968  1.00 93.33  ? 461  PRO A CG  1 
ATOM   3522 C CD  . PRO A 1 461 ? 9.716   24.845  31.515  1.00 82.45  ? 461  PRO A CD  1 
ATOM   3523 N N   . SER A 1 462 ? 10.720  27.972  29.888  1.00 65.66  ? 462  SER A N   1 
ATOM   3524 C CA  . SER A 1 462 ? 11.425  29.186  29.505  1.00 76.27  ? 462  SER A CA  1 
ATOM   3525 C C   . SER A 1 462 ? 11.993  29.134  28.086  1.00 79.35  ? 462  SER A C   1 
ATOM   3526 O O   . SER A 1 462 ? 12.737  30.028  27.683  1.00 76.24  ? 462  SER A O   1 
ATOM   3527 C CB  . SER A 1 462 ? 12.569  29.459  30.479  1.00 80.23  ? 462  SER A CB  1 
ATOM   3528 O OG  . SER A 1 462 ? 13.786  28.925  29.985  1.00 72.16  ? 462  SER A OG  1 
ATOM   3529 N N   . LEU A 1 463 ? 11.656  28.096  27.327  1.00 78.61  ? 463  LEU A N   1 
ATOM   3530 C CA  . LEU A 1 463 ? 12.308  27.886  26.037  1.00 69.82  ? 463  LEU A CA  1 
ATOM   3531 C C   . LEU A 1 463 ? 11.544  28.392  24.826  1.00 79.70  ? 463  LEU A C   1 
ATOM   3532 O O   . LEU A 1 463 ? 12.144  28.635  23.777  1.00 80.07  ? 463  LEU A O   1 
ATOM   3533 C CB  . LEU A 1 463 ? 12.675  26.422  25.843  1.00 68.03  ? 463  LEU A CB  1 
ATOM   3534 C CG  . LEU A 1 463 ? 14.012  26.094  26.491  1.00 72.32  ? 463  LEU A CG  1 
ATOM   3535 C CD1 . LEU A 1 463 ? 14.575  24.817  25.887  1.00 62.55  ? 463  LEU A CD1 1 
ATOM   3536 C CD2 . LEU A 1 463 ? 14.983  27.270  26.329  1.00 60.26  ? 463  LEU A CD2 1 
ATOM   3537 N N   . ASN A 1 464 ? 10.228  28.532  24.964  1.00 77.79  ? 464  ASN A N   1 
ATOM   3538 C CA  . ASN A 1 464 ? 9.404   29.154  23.923  1.00 74.53  ? 464  ASN A CA  1 
ATOM   3539 C C   . ASN A 1 464 ? 8.999   28.192  22.800  1.00 64.88  ? 464  ASN A C   1 
ATOM   3540 O O   . ASN A 1 464 ? 8.556   28.624  21.742  1.00 69.30  ? 464  ASN A O   1 
ATOM   3541 C CB  . ASN A 1 464 ? 10.074  30.427  23.340  1.00 72.95  ? 464  ASN A CB  1 
ATOM   3542 C CG  . ASN A 1 464 ? 10.215  31.570  24.370  1.00 85.63  ? 464  ASN A CG  1 
ATOM   3543 O OD1 . ASN A 1 464 ? 9.507   31.605  25.382  1.00 82.49  ? 464  ASN A OD1 1 
ATOM   3544 N ND2 . ASN A 1 464 ? 11.131  32.514  24.096  1.00 85.90  ? 464  ASN A ND2 1 
ATOM   3545 N N   . TYR A 1 465 ? 9.150   26.890  23.016  1.00 63.67  ? 465  TYR A N   1 
ATOM   3546 C CA  . TYR A 1 465 ? 8.607   25.927  22.061  1.00 60.79  ? 465  TYR A CA  1 
ATOM   3547 C C   . TYR A 1 465 ? 7.077   25.993  22.104  1.00 59.11  ? 465  TYR A C   1 
ATOM   3548 O O   . TYR A 1 465 ? 6.516   26.450  23.085  1.00 59.55  ? 465  TYR A O   1 
ATOM   3549 C CB  . TYR A 1 465 ? 9.088   24.506  22.374  1.00 59.64  ? 465  TYR A CB  1 
ATOM   3550 C CG  . TYR A 1 465 ? 10.555  24.273  22.094  1.00 60.34  ? 465  TYR A CG  1 
ATOM   3551 C CD1 . TYR A 1 465 ? 10.977  23.734  20.885  1.00 60.32  ? 465  TYR A CD1 1 
ATOM   3552 C CD2 . TYR A 1 465 ? 11.518  24.596  23.039  1.00 64.79  ? 465  TYR A CD2 1 
ATOM   3553 C CE1 . TYR A 1 465 ? 12.322  23.523  20.627  1.00 58.12  ? 465  TYR A CE1 1 
ATOM   3554 C CE2 . TYR A 1 465 ? 12.858  24.399  22.792  1.00 62.36  ? 465  TYR A CE2 1 
ATOM   3555 C CZ  . TYR A 1 465 ? 13.258  23.861  21.586  1.00 65.93  ? 465  TYR A CZ  1 
ATOM   3556 O OH  . TYR A 1 465 ? 14.600  23.663  21.351  1.00 59.68  ? 465  TYR A OH  1 
ATOM   3557 N N   . THR A 1 466 ? 6.404   25.544  21.048  1.00 66.96  ? 466  THR A N   1 
ATOM   3558 C CA  . THR A 1 466 ? 4.943   25.479  21.048  1.00 63.05  ? 466  THR A CA  1 
ATOM   3559 C C   . THR A 1 466 ? 4.469   24.301  21.884  1.00 69.47  ? 466  THR A C   1 
ATOM   3560 O O   . THR A 1 466 ? 5.235   23.377  22.156  1.00 66.14  ? 466  THR A O   1 
ATOM   3561 C CB  . THR A 1 466 ? 4.353   25.296  19.630  1.00 61.39  ? 466  THR A CB  1 
ATOM   3562 O OG1 . THR A 1 466 ? 4.631   23.970  19.152  1.00 61.01  ? 466  THR A OG1 1 
ATOM   3563 C CG2 . THR A 1 466 ? 4.915   26.313  18.674  1.00 58.00  ? 466  THR A CG2 1 
ATOM   3564 N N   . THR A 1 467 ? 3.193   24.322  22.261  1.00 68.65  ? 467  THR A N   1 
ATOM   3565 C CA  . THR A 1 467 ? 2.621   23.260  23.075  1.00 65.60  ? 467  THR A CA  1 
ATOM   3566 C C   . THR A 1 467 ? 2.608   21.914  22.349  1.00 65.39  ? 467  THR A C   1 
ATOM   3567 O O   . THR A 1 467 ? 2.831   20.858  22.954  1.00 62.40  ? 467  THR A O   1 
ATOM   3568 C CB  . THR A 1 467 ? 1.210   23.642  23.564  1.00 74.25  ? 467  THR A CB  1 
ATOM   3569 O OG1 . THR A 1 467 ? 1.330   24.627  24.599  1.00 74.02  ? 467  THR A OG1 1 
ATOM   3570 C CG2 . THR A 1 467 ? 0.467   22.422  24.119  1.00 70.64  ? 467  THR A CG2 1 
ATOM   3571 N N   . GLU A 1 468 ? 2.358   21.960  21.048  1.00 59.26  ? 468  GLU A N   1 
ATOM   3572 C CA  . GLU A 1 468 ? 2.352   20.752  20.238  1.00 68.11  ? 468  GLU A CA  1 
ATOM   3573 C C   . GLU A 1 468 ? 3.754   20.158  20.195  1.00 70.43  ? 468  GLU A C   1 
ATOM   3574 O O   . GLU A 1 468 ? 3.921   18.936  20.205  1.00 66.31  ? 468  GLU A O   1 
ATOM   3575 C CB  . GLU A 1 468 ? 1.853   21.060  18.826  1.00 65.15  ? 468  GLU A CB  1 
ATOM   3576 C CG  . GLU A 1 468 ? 0.805   22.179  18.788  1.00 80.87  ? 468  GLU A CG  1 
ATOM   3577 C CD  . GLU A 1 468 ? 1.420   23.586  18.823  1.00 95.29  ? 468  GLU A CD  1 
ATOM   3578 O OE1 . GLU A 1 468 ? 1.262   24.298  19.850  1.00 90.00  ? 468  GLU A OE1 1 
ATOM   3579 O OE2 . GLU A 1 468 ? 2.068   23.975  17.819  1.00 98.07  ? 468  GLU A OE2 1 
ATOM   3580 N N   . GLU A 1 469 ? 4.756   21.035  20.155  1.00 63.17  ? 469  GLU A N   1 
ATOM   3581 C CA  . GLU A 1 469 ? 6.152   20.610  20.189  1.00 64.56  ? 469  GLU A CA  1 
ATOM   3582 C C   . GLU A 1 469 ? 6.492   19.946  21.517  1.00 64.70  ? 469  GLU A C   1 
ATOM   3583 O O   . GLU A 1 469 ? 7.167   18.918  21.558  1.00 62.19  ? 469  GLU A O   1 
ATOM   3584 C CB  . GLU A 1 469 ? 7.080   21.796  19.924  1.00 57.93  ? 469  GLU A CB  1 
ATOM   3585 C CG  . GLU A 1 469 ? 7.375   21.979  18.452  1.00 59.31  ? 469  GLU A CG  1 
ATOM   3586 C CD  . GLU A 1 469 ? 7.955   23.336  18.128  1.00 64.79  ? 469  GLU A CD  1 
ATOM   3587 O OE1 . GLU A 1 469 ? 7.776   24.276  18.934  1.00 56.68  ? 469  GLU A OE1 1 
ATOM   3588 O OE2 . GLU A 1 469 ? 8.582   23.460  17.054  1.00 66.50  ? 469  GLU A OE2 1 
ATOM   3589 N N   . ARG A 1 470 ? 6.014   20.548  22.599  1.00 60.99  ? 470  ARG A N   1 
ATOM   3590 C CA  . ARG A 1 470 ? 6.141   19.981  23.930  1.00 62.03  ? 470  ARG A CA  1 
ATOM   3591 C C   . ARG A 1 470 ? 5.590   18.538  23.973  1.00 67.84  ? 470  ARG A C   1 
ATOM   3592 O O   . ARG A 1 470 ? 6.141   17.673  24.648  1.00 71.17  ? 470  ARG A O   1 
ATOM   3593 C CB  . ARG A 1 470 ? 5.415   20.895  24.917  1.00 66.88  ? 470  ARG A CB  1 
ATOM   3594 C CG  . ARG A 1 470 ? 6.033   20.990  26.302  1.00 79.69  ? 470  ARG A CG  1 
ATOM   3595 C CD  . ARG A 1 470 ? 5.197   20.248  27.368  1.00 100.00 ? 470  ARG A CD  1 
ATOM   3596 N NE  . ARG A 1 470 ? 3.813   20.730  27.445  1.00 100.10 ? 470  ARG A NE  1 
ATOM   3597 C CZ  . ARG A 1 470 ? 2.734   19.959  27.318  1.00 93.83  ? 470  ARG A CZ  1 
ATOM   3598 N NH1 . ARG A 1 470 ? 2.861   18.650  27.127  1.00 88.22  ? 470  ARG A NH1 1 
ATOM   3599 N NH2 . ARG A 1 470 ? 1.523   20.498  27.390  1.00 95.25  ? 470  ARG A NH2 1 
ATOM   3600 N N   . ILE A 1 471 ? 4.526   18.272  23.220  1.00 64.06  ? 471  ILE A N   1 
ATOM   3601 C CA  . ILE A 1 471 ? 3.880   16.961  23.223  1.00 61.37  ? 471  ILE A CA  1 
ATOM   3602 C C   . ILE A 1 471 ? 4.584   15.998  22.283  1.00 60.53  ? 471  ILE A C   1 
ATOM   3603 O O   . ILE A 1 471 ? 4.727   14.802  22.570  1.00 63.76  ? 471  ILE A O   1 
ATOM   3604 C CB  . ILE A 1 471 ? 2.392   17.101  22.825  1.00 70.06  ? 471  ILE A CB  1 
ATOM   3605 C CG1 . ILE A 1 471 ? 1.584   17.570  24.032  1.00 61.61  ? 471  ILE A CG1 1 
ATOM   3606 C CG2 . ILE A 1 471 ? 1.828   15.788  22.260  1.00 54.48  ? 471  ILE A CG2 1 
ATOM   3607 C CD1 . ILE A 1 471 ? 0.532   18.593  23.688  1.00 70.11  ? 471  ILE A CD1 1 
ATOM   3608 N N   . PHE A 1 472 ? 5.010   16.536  21.148  1.00 61.57  ? 472  PHE A N   1 
ATOM   3609 C CA  . PHE A 1 472 ? 5.864   15.825  20.202  1.00 57.61  ? 472  PHE A CA  1 
ATOM   3610 C C   . PHE A 1 472 ? 7.132   15.322  20.892  1.00 58.00  ? 472  PHE A C   1 
ATOM   3611 O O   . PHE A 1 472 ? 7.538   14.170  20.706  1.00 57.49  ? 472  PHE A O   1 
ATOM   3612 C CB  . PHE A 1 472 ? 6.219   16.767  19.059  1.00 55.80  ? 472  PHE A CB  1 
ATOM   3613 C CG  . PHE A 1 472 ? 7.106   16.164  18.018  1.00 56.19  ? 472  PHE A CG  1 
ATOM   3614 C CD1 . PHE A 1 472 ? 6.859   14.891  17.526  1.00 59.27  ? 472  PHE A CD1 1 
ATOM   3615 C CD2 . PHE A 1 472 ? 8.179   16.888  17.502  1.00 57.02  ? 472  PHE A CD2 1 
ATOM   3616 C CE1 . PHE A 1 472 ? 7.683   14.332  16.544  1.00 63.10  ? 472  PHE A CE1 1 
ATOM   3617 C CE2 . PHE A 1 472 ? 9.001   16.343  16.522  1.00 58.35  ? 472  PHE A CE2 1 
ATOM   3618 C CZ  . PHE A 1 472 ? 8.753   15.060  16.040  1.00 58.33  ? 472  PHE A CZ  1 
ATOM   3619 N N   . ALA A 1 473 ? 7.740   16.179  21.709  1.00 53.05  ? 473  ALA A N   1 
ATOM   3620 C CA  . ALA A 1 473 ? 8.967   15.821  22.409  1.00 54.96  ? 473  ALA A CA  1 
ATOM   3621 C C   . ALA A 1 473 ? 8.729   14.626  23.311  1.00 57.99  ? 473  ALA A C   1 
ATOM   3622 O O   . ALA A 1 473 ? 9.567   13.733  23.416  1.00 57.37  ? 473  ALA A O   1 
ATOM   3623 C CB  . ALA A 1 473 ? 9.487   16.991  23.202  1.00 49.69  ? 473  ALA A CB  1 
ATOM   3624 N N   . GLN A 1 474 ? 7.568   14.603  23.950  1.00 60.81  ? 474  GLN A N   1 
ATOM   3625 C CA  . GLN A 1 474 ? 7.235   13.508  24.847  1.00 60.62  ? 474  GLN A CA  1 
ATOM   3626 C C   . GLN A 1 474 ? 7.059   12.211  24.072  1.00 60.54  ? 474  GLN A C   1 
ATOM   3627 O O   . GLN A 1 474 ? 7.466   11.144  24.533  1.00 61.96  ? 474  GLN A O   1 
ATOM   3628 C CB  . GLN A 1 474 ? 5.981   13.838  25.655  1.00 67.67  ? 474  GLN A CB  1 
ATOM   3629 C CG  . GLN A 1 474 ? 6.225   14.824  26.788  1.00 67.85  ? 474  GLN A CG  1 
ATOM   3630 C CD  . GLN A 1 474 ? 5.010   15.678  27.109  1.00 76.31  ? 474  GLN A CD  1 
ATOM   3631 O OE1 . GLN A 1 474 ? 3.864   15.261  26.917  1.00 82.71  ? 474  GLN A OE1 1 
ATOM   3632 N NE2 . GLN A 1 474 ? 5.258   16.888  27.600  1.00 79.89  ? 474  GLN A NE2 1 
ATOM   3633 N N   . ARG A 1 475 ? 6.458   12.294  22.892  1.00 53.35  ? 475  ARG A N   1 
ATOM   3634 C CA  . ARG A 1 475 ? 6.336   11.104  22.066  1.00 59.65  ? 475  ARG A CA  1 
ATOM   3635 C C   . ARG A 1 475 ? 7.699   10.523  21.761  1.00 62.78  ? 475  ARG A C   1 
ATOM   3636 O O   . ARG A 1 475 ? 7.924   9.306   21.889  1.00 53.63  ? 475  ARG A O   1 
ATOM   3637 C CB  . ARG A 1 475 ? 5.660   11.434  20.756  1.00 59.02  ? 475  ARG A CB  1 
ATOM   3638 C CG  . ARG A 1 475 ? 4.184   11.291  20.794  1.00 60.81  ? 475  ARG A CG  1 
ATOM   3639 C CD  . ARG A 1 475 ? 3.627   11.727  19.477  1.00 59.14  ? 475  ARG A CD  1 
ATOM   3640 N NE  . ARG A 1 475 ? 4.020   10.808  18.424  1.00 57.09  ? 475  ARG A NE  1 
ATOM   3641 C CZ  . ARG A 1 475 ? 4.187   11.167  17.158  1.00 59.31  ? 475  ARG A CZ  1 
ATOM   3642 N NH1 . ARG A 1 475 ? 4.007   12.441  16.803  1.00 51.96  ? 475  ARG A NH1 1 
ATOM   3643 N NH2 . ARG A 1 475 ? 4.539   10.254  16.256  1.00 51.46  ? 475  ARG A NH2 1 
ATOM   3644 N N   . LEU A 1 476 ? 8.602   11.407  21.339  1.00 61.15  ? 476  LEU A N   1 
ATOM   3645 C CA  . LEU A 1 476 ? 9.941   10.996  20.945  1.00 56.61  ? 476  LEU A CA  1 
ATOM   3646 C C   . LEU A 1 476 ? 10.667  10.357  22.118  1.00 54.99  ? 476  LEU A C   1 
ATOM   3647 O O   . LEU A 1 476 ? 11.148  9.228   22.005  1.00 49.57  ? 476  LEU A O   1 
ATOM   3648 C CB  . LEU A 1 476 ? 10.726  12.176  20.379  1.00 56.74  ? 476  LEU A CB  1 
ATOM   3649 C CG  . LEU A 1 476 ? 10.140  12.707  19.072  1.00 60.57  ? 476  LEU A CG  1 
ATOM   3650 C CD1 . LEU A 1 476 ? 11.168  13.536  18.317  1.00 59.77  ? 476  LEU A CD1 1 
ATOM   3651 C CD2 . LEU A 1 476 ? 9.670   11.544  18.225  1.00 51.01  ? 476  LEU A CD2 1 
ATOM   3652 N N   . MET A 1 477 ? 10.723  11.069  23.245  1.00 52.09  ? 477  MET A N   1 
ATOM   3653 C CA  . MET A 1 477 ? 11.346  10.534  24.452  1.00 51.15  ? 477  MET A CA  1 
ATOM   3654 C C   . MET A 1 477 ? 10.758  9.175   24.796  1.00 57.41  ? 477  MET A C   1 
ATOM   3655 O O   . MET A 1 477 ? 11.445  8.307   25.330  1.00 54.87  ? 477  MET A O   1 
ATOM   3656 C CB  . MET A 1 477 ? 11.148  11.474  25.630  1.00 54.11  ? 477  MET A CB  1 
ATOM   3657 C CG  . MET A 1 477 ? 11.757  12.829  25.435  1.00 55.00  ? 477  MET A CG  1 
ATOM   3658 S SD  . MET A 1 477 ? 11.324  13.923  26.791  1.00 69.90  ? 477  MET A SD  1 
ATOM   3659 C CE  . MET A 1 477 ? 12.380  13.306  28.092  1.00 62.09  ? 477  MET A CE  1 
ATOM   3660 N N   . LYS A 1 478 ? 9.477   9.003   24.486  1.00 60.76  ? 478  LYS A N   1 
ATOM   3661 C CA  . LYS A 1 478 ? 8.805   7.737   24.711  1.00 56.53  ? 478  LYS A CA  1 
ATOM   3662 C C   . LYS A 1 478 ? 9.319   6.647   23.781  1.00 50.71  ? 478  LYS A C   1 
ATOM   3663 O O   . LYS A 1 478 ? 9.670   5.566   24.251  1.00 55.62  ? 478  LYS A O   1 
ATOM   3664 C CB  . LYS A 1 478 ? 7.283   7.893   24.614  1.00 63.48  ? 478  LYS A CB  1 
ATOM   3665 C CG  . LYS A 1 478 ? 6.592   8.015   25.962  1.00 65.47  ? 478  LYS A CG  1 
ATOM   3666 C CD  . LYS A 1 478 ? 6.539   6.651   26.652  1.00 81.50  ? 478  LYS A CD  1 
ATOM   3667 C CE  . LYS A 1 478 ? 5.825   6.711   28.004  1.00 84.67  ? 478  LYS A CE  1 
ATOM   3668 N NZ  . LYS A 1 478 ? 6.754   6.603   29.172  1.00 69.78  ? 478  LYS A NZ  1 
ATOM   3669 N N   . TYR A 1 479 ? 9.379   6.918   22.475  1.00 52.85  ? 479  TYR A N   1 
ATOM   3670 C CA  . TYR A 1 479 ? 9.880   5.908   21.526  1.00 55.45  ? 479  TYR A CA  1 
ATOM   3671 C C   . TYR A 1 479 ? 11.286  5.482   21.887  1.00 58.04  ? 479  TYR A C   1 
ATOM   3672 O O   . TYR A 1 479 ? 11.615  4.292   21.899  1.00 52.89  ? 479  TYR A O   1 
ATOM   3673 C CB  . TYR A 1 479 ? 9.950   6.451   20.110  1.00 52.17  ? 479  TYR A CB  1 
ATOM   3674 C CG  . TYR A 1 479 ? 8.626   6.782   19.504  1.00 63.00  ? 479  TYR A CG  1 
ATOM   3675 C CD1 . TYR A 1 479 ? 7.628   5.819   19.400  1.00 57.21  ? 479  TYR A CD1 1 
ATOM   3676 C CD2 . TYR A 1 479 ? 8.379   8.054   19.004  1.00 55.26  ? 479  TYR A CD2 1 
ATOM   3677 C CE1 . TYR A 1 479 ? 6.415   6.124   18.828  1.00 56.35  ? 479  TYR A CE1 1 
ATOM   3678 C CE2 . TYR A 1 479 ? 7.175   8.369   18.437  1.00 58.48  ? 479  TYR A CE2 1 
ATOM   3679 C CZ  . TYR A 1 479 ? 6.190   7.404   18.349  1.00 63.36  ? 479  TYR A CZ  1 
ATOM   3680 O OH  . TYR A 1 479 ? 4.979   7.727   17.778  1.00 64.86  ? 479  TYR A OH  1 
ATOM   3681 N N   . TRP A 1 480 ? 12.117  6.486   22.154  1.00 52.83  ? 480  TRP A N   1 
ATOM   3682 C CA  . TRP A 1 480 ? 13.521  6.272   22.439  1.00 56.87  ? 480  TRP A CA  1 
ATOM   3683 C C   . TRP A 1 480 ? 13.707  5.451   23.714  1.00 53.56  ? 480  TRP A C   1 
ATOM   3684 O O   . TRP A 1 480 ? 14.440  4.459   23.713  1.00 53.92  ? 480  TRP A O   1 
ATOM   3685 C CB  . TRP A 1 480 ? 14.262  7.613   22.508  1.00 52.94  ? 480  TRP A CB  1 
ATOM   3686 C CG  . TRP A 1 480 ? 15.092  7.951   21.276  1.00 53.47  ? 480  TRP A CG  1 
ATOM   3687 C CD1 . TRP A 1 480 ? 16.461  8.131   21.219  1.00 51.68  ? 480  TRP A CD1 1 
ATOM   3688 C CD2 . TRP A 1 480 ? 14.614  8.153   19.943  1.00 53.53  ? 480  TRP A CD2 1 
ATOM   3689 N NE1 . TRP A 1 480 ? 16.851  8.434   19.933  1.00 39.07  ? 480  TRP A NE1 1 
ATOM   3690 C CE2 . TRP A 1 480 ? 15.738  8.450   19.131  1.00 56.33  ? 480  TRP A CE2 1 
ATOM   3691 C CE3 . TRP A 1 480 ? 13.350  8.110   19.352  1.00 51.12  ? 480  TRP A CE3 1 
ATOM   3692 C CZ2 . TRP A 1 480 ? 15.625  8.694   17.766  1.00 55.71  ? 480  TRP A CZ2 1 
ATOM   3693 C CZ3 . TRP A 1 480 ? 13.241  8.358   18.007  1.00 48.90  ? 480  TRP A CZ3 1 
ATOM   3694 C CH2 . TRP A 1 480 ? 14.368  8.646   17.224  1.00 56.04  ? 480  TRP A CH2 1 
ATOM   3695 N N   . THR A 1 481 ? 13.041  5.845   24.798  1.00 55.17  ? 481  THR A N   1 
ATOM   3696 C CA  . THR A 1 481 ? 13.137  5.077   26.044  1.00 55.29  ? 481  THR A CA  1 
ATOM   3697 C C   . THR A 1 481 ? 12.462  3.709   25.952  1.00 57.10  ? 481  THR A C   1 
ATOM   3698 O O   . THR A 1 481 ? 12.942  2.747   26.540  1.00 60.84  ? 481  THR A O   1 
ATOM   3699 C CB  . THR A 1 481 ? 12.589  5.835   27.245  1.00 50.56  ? 481  THR A CB  1 
ATOM   3700 O OG1 . THR A 1 481 ? 11.232  6.213   26.994  1.00 60.18  ? 481  THR A OG1 1 
ATOM   3701 C CG2 . THR A 1 481 ? 13.418  7.067   27.496  1.00 52.65  ? 481  THR A CG2 1 
ATOM   3702 N N   . ASN A 1 482 ? 11.362  3.609   25.213  1.00 52.50  ? 482  ASN A N   1 
ATOM   3703 C CA  . ASN A 1 482 ? 10.752  2.301   25.005  1.00 58.51  ? 482  ASN A CA  1 
ATOM   3704 C C   . ASN A 1 482 ? 11.714  1.356   24.321  1.00 55.88  ? 482  ASN A C   1 
ATOM   3705 O O   . ASN A 1 482 ? 11.792  0.182   24.671  1.00 62.58  ? 482  ASN A O   1 
ATOM   3706 C CB  . ASN A 1 482 ? 9.451   2.398   24.211  1.00 61.16  ? 482  ASN A CB  1 
ATOM   3707 C CG  . ASN A 1 482 ? 8.281   2.775   25.079  1.00 63.40  ? 482  ASN A CG  1 
ATOM   3708 O OD1 . ASN A 1 482 ? 8.294   2.535   26.285  1.00 61.56  ? 482  ASN A OD1 1 
ATOM   3709 N ND2 . ASN A 1 482 ? 7.268   3.380   24.479  1.00 64.17  ? 482  ASN A ND2 1 
ATOM   3710 N N   . PHE A 1 483 ? 12.454  1.872   23.347  1.00 53.89  ? 483  PHE A N   1 
ATOM   3711 C CA  . PHE A 1 483 ? 13.426  1.058   22.632  1.00 56.92  ? 483  PHE A CA  1 
ATOM   3712 C C   . PHE A 1 483 ? 14.581  0.647   23.558  1.00 59.34  ? 483  PHE A C   1 
ATOM   3713 O O   . PHE A 1 483 ? 15.121  -0.463  23.471  1.00 54.67  ? 483  PHE A O   1 
ATOM   3714 C CB  . PHE A 1 483 ? 13.956  1.798   21.401  1.00 49.99  ? 483  PHE A CB  1 
ATOM   3715 C CG  . PHE A 1 483 ? 15.068  1.073   20.705  1.00 53.63  ? 483  PHE A CG  1 
ATOM   3716 C CD1 . PHE A 1 483 ? 14.795  0.040   19.826  1.00 45.79  ? 483  PHE A CD1 1 
ATOM   3717 C CD2 . PHE A 1 483 ? 16.393  1.401   20.953  1.00 47.73  ? 483  PHE A CD2 1 
ATOM   3718 C CE1 . PHE A 1 483 ? 15.824  -0.652  19.192  1.00 49.84  ? 483  PHE A CE1 1 
ATOM   3719 C CE2 . PHE A 1 483 ? 17.427  0.716   20.321  1.00 50.16  ? 483  PHE A CE2 1 
ATOM   3720 C CZ  . PHE A 1 483 ? 17.137  -0.308  19.430  1.00 53.07  ? 483  PHE A CZ  1 
ATOM   3721 N N   . ALA A 1 484 ? 14.964  1.552   24.447  1.00 58.52  ? 484  ALA A N   1 
ATOM   3722 C CA  . ALA A 1 484 ? 16.045  1.261   25.372  1.00 59.80  ? 484  ALA A CA  1 
ATOM   3723 C C   . ALA A 1 484 ? 15.603  0.129   26.274  1.00 62.82  ? 484  ALA A C   1 
ATOM   3724 O O   . ALA A 1 484 ? 16.329  -0.844  26.463  1.00 53.09  ? 484  ALA A O   1 
ATOM   3725 C CB  . ALA A 1 484 ? 16.382  2.491   26.194  1.00 51.08  ? 484  ALA A CB  1 
ATOM   3726 N N   . ARG A 1 485 ? 14.395  0.268   26.819  1.00 60.06  ? 485  ARG A N   1 
ATOM   3727 C CA  . ARG A 1 485 ? 13.841  -0.713  27.741  1.00 59.50  ? 485  ARG A CA  1 
ATOM   3728 C C   . ARG A 1 485 ? 13.621  -2.081  27.097  1.00 58.25  ? 485  ARG A C   1 
ATOM   3729 O O   . ARG A 1 485 ? 13.906  -3.090  27.714  1.00 49.62  ? 485  ARG A O   1 
ATOM   3730 C CB  . ARG A 1 485 ? 12.523  -0.218  28.352  1.00 62.84  ? 485  ARG A CB  1 
ATOM   3731 C CG  . ARG A 1 485 ? 12.669  0.830   29.458  1.00 69.66  ? 485  ARG A CG  1 
ATOM   3732 C CD  . ARG A 1 485 ? 11.305  1.249   30.041  1.00 70.85  ? 485  ARG A CD  1 
ATOM   3733 N NE  . ARG A 1 485 ? 10.520  2.102   29.144  1.00 69.42  ? 485  ARG A NE  1 
ATOM   3734 C CZ  . ARG A 1 485 ? 10.401  3.425   29.279  1.00 77.53  ? 485  ARG A CZ  1 
ATOM   3735 N NH1 . ARG A 1 485 ? 11.014  4.041   30.284  1.00 70.57  ? 485  ARG A NH1 1 
ATOM   3736 N NH2 . ARG A 1 485 ? 9.667   4.137   28.416  1.00 73.34  ? 485  ARG A NH2 1 
ATOM   3737 N N   . THR A 1 486 ? 13.134  -2.118  25.859  1.00 57.10  ? 486  THR A N   1 
ATOM   3738 C CA  . THR A 1 486 ? 12.601  -3.368  25.308  1.00 59.05  ? 486  THR A CA  1 
ATOM   3739 C C   . THR A 1 486 ? 13.195  -3.800  23.968  1.00 69.58  ? 486  THR A C   1 
ATOM   3740 O O   . THR A 1 486 ? 13.055  -4.959  23.558  1.00 65.90  ? 486  THR A O   1 
ATOM   3741 C CB  . THR A 1 486 ? 11.077  -3.269  25.116  1.00 59.62  ? 486  THR A CB  1 
ATOM   3742 O OG1 . THR A 1 486 ? 10.791  -2.446  23.974  1.00 58.46  ? 486  THR A OG1 1 
ATOM   3743 C CG2 . THR A 1 486 ? 10.413  -2.671  26.368  1.00 43.56  ? 486  THR A CG2 1 
ATOM   3744 N N   . GLY A 1 487 ? 13.846  -2.872  23.280  1.00 66.57  ? 487  GLY A N   1 
ATOM   3745 C CA  . GLY A 1 487 ? 14.322  -3.146  21.941  1.00 59.08  ? 487  GLY A CA  1 
ATOM   3746 C C   . GLY A 1 487 ? 13.195  -2.904  20.970  1.00 62.46  ? 487  GLY A C   1 
ATOM   3747 O O   . GLY A 1 487 ? 13.236  -3.368  19.834  1.00 63.99  ? 487  GLY A O   1 
ATOM   3748 N N   . ASP A 1 488 ? 12.185  -2.169  21.429  1.00 58.49  ? 488  ASP A N   1 
ATOM   3749 C CA  . ASP A 1 488 ? 11.021  -1.864  20.611  1.00 56.96  ? 488  ASP A CA  1 
ATOM   3750 C C   . ASP A 1 488 ? 10.424  -0.506  21.000  1.00 56.26  ? 488  ASP A C   1 
ATOM   3751 O O   . ASP A 1 488 ? 10.000  -0.302  22.136  1.00 59.90  ? 488  ASP A O   1 
ATOM   3752 C CB  . ASP A 1 488 ? 9.990   -2.990  20.744  1.00 64.88  ? 488  ASP A CB  1 
ATOM   3753 C CG  . ASP A 1 488 ? 8.696   -2.709  19.986  1.00 69.73  ? 488  ASP A CG  1 
ATOM   3754 O OD1 . ASP A 1 488 ? 8.499   -1.575  19.501  1.00 71.39  ? 488  ASP A OD1 1 
ATOM   3755 O OD2 . ASP A 1 488 ? 7.861   -3.632  19.882  1.00 72.78  ? 488  ASP A OD2 1 
ATOM   3756 N N   . PRO A 1 489 ? 10.388  0.430   20.043  1.00 62.56  ? 489  PRO A N   1 
ATOM   3757 C CA  . PRO A 1 489 ? 9.978   1.816   20.310  1.00 63.78  ? 489  PRO A CA  1 
ATOM   3758 C C   . PRO A 1 489 ? 8.508   1.929   20.698  1.00 63.74  ? 489  PRO A C   1 
ATOM   3759 O O   . PRO A 1 489 ? 8.110   2.899   21.355  1.00 64.05  ? 489  PRO A O   1 
ATOM   3760 C CB  . PRO A 1 489 ? 10.222  2.515   18.964  1.00 55.06  ? 489  PRO A CB  1 
ATOM   3761 C CG  . PRO A 1 489 ? 10.150  1.391   17.951  1.00 58.91  ? 489  PRO A CG  1 
ATOM   3762 C CD  . PRO A 1 489 ? 10.833  0.253   18.648  1.00 60.52  ? 489  PRO A CD  1 
ATOM   3763 N N   . ASN A 1 490 ? 7.718   0.943   20.289  1.00 65.73  ? 490  ASN A N   1 
ATOM   3764 C CA  . ASN A 1 490 ? 6.272   0.960   20.507  1.00 68.52  ? 490  ASN A CA  1 
ATOM   3765 C C   . ASN A 1 490 ? 5.863   0.805   21.966  1.00 78.33  ? 490  ASN A C   1 
ATOM   3766 O O   . ASN A 1 490 ? 6.416   -0.021  22.704  1.00 72.71  ? 490  ASN A O   1 
ATOM   3767 C CB  . ASN A 1 490 ? 5.596   -0.131  19.678  1.00 68.54  ? 490  ASN A CB  1 
ATOM   3768 C CG  . ASN A 1 490 ? 5.716   0.110   18.187  1.00 67.07  ? 490  ASN A CG  1 
ATOM   3769 O OD1 . ASN A 1 490 ? 5.084   1.014   17.640  1.00 66.99  ? 490  ASN A OD1 1 
ATOM   3770 N ND2 . ASN A 1 490 ? 6.516   -0.711  17.519  1.00 59.75  ? 490  ASN A ND2 1 
ATOM   3771 N N   . ASP A 1 491 ? 4.886   1.610   22.374  1.00 89.80  ? 491  ASP A N   1 
ATOM   3772 C CA  . ASP A 1 491 ? 4.287   1.480   23.692  1.00 94.96  ? 491  ASP A CA  1 
ATOM   3773 C C   . ASP A 1 491 ? 3.510   0.169   23.718  1.00 103.79 ? 491  ASP A C   1 
ATOM   3774 O O   . ASP A 1 491 ? 2.641   -0.056  22.871  1.00 99.25  ? 491  ASP A O   1 
ATOM   3775 C CB  . ASP A 1 491 ? 3.357   2.666   23.974  1.00 102.83 ? 491  ASP A CB  1 
ATOM   3776 C CG  . ASP A 1 491 ? 3.179   2.937   25.464  1.00 109.21 ? 491  ASP A CG  1 
ATOM   3777 O OD1 . ASP A 1 491 ? 3.410   4.094   25.888  1.00 104.50 ? 491  ASP A OD1 1 
ATOM   3778 O OD2 . ASP A 1 491 ? 2.814   2.000   26.210  1.00 105.63 ? 491  ASP A OD2 1 
ATOM   3779 N N   . PRO A 1 492 ? 3.844   -0.717  24.672  1.00 107.67 ? 492  PRO A N   1 
ATOM   3780 C CA  . PRO A 1 492 ? 3.128   -1.989  24.827  1.00 112.65 ? 492  PRO A CA  1 
ATOM   3781 C C   . PRO A 1 492 ? 1.666   -1.757  25.220  1.00 117.12 ? 492  PRO A C   1 
ATOM   3782 O O   . PRO A 1 492 ? 0.792   -2.539  24.834  1.00 110.04 ? 492  PRO A O   1 
ATOM   3783 C CB  . PRO A 1 492 ? 3.888   -2.687  25.964  1.00 110.78 ? 492  PRO A CB  1 
ATOM   3784 C CG  . PRO A 1 492 ? 5.220   -2.005  26.023  1.00 107.35 ? 492  PRO A CG  1 
ATOM   3785 C CD  . PRO A 1 492 ? 4.955   -0.589  25.631  1.00 101.76 ? 492  PRO A CD  1 
ATOM   3786 N N   . ARG A 1 493 ? 1.414   -0.687  25.974  1.00 117.06 ? 493  ARG A N   1 
ATOM   3787 C CA  . ARG A 1 493 ? 0.059   -0.307  26.369  1.00 120.83 ? 493  ARG A CA  1 
ATOM   3788 C C   . ARG A 1 493 ? -0.693  0.279   25.181  1.00 125.34 ? 493  ARG A C   1 
ATOM   3789 O O   . ARG A 1 493 ? -1.748  -0.222  24.780  1.00 125.16 ? 493  ARG A O   1 
ATOM   3790 C CB  . ARG A 1 493 ? 0.095   0.718   27.510  1.00 110.14 ? 493  ARG A CB  1 
ATOM   3791 N N   . ASP A 1 494 ? -0.128  1.342   24.619  1.00 121.37 ? 494  ASP A N   1 
ATOM   3792 C CA  . ASP A 1 494 ? -0.743  2.062   23.512  1.00 122.01 ? 494  ASP A CA  1 
ATOM   3793 C C   . ASP A 1 494 ? -0.774  1.242   22.215  1.00 125.53 ? 494  ASP A C   1 
ATOM   3794 O O   . ASP A 1 494 ? 0.241   1.110   21.521  1.00 121.30 ? 494  ASP A O   1 
ATOM   3795 C CB  . ASP A 1 494 ? -0.006  3.386   23.287  1.00 120.86 ? 494  ASP A CB  1 
ATOM   3796 C CG  . ASP A 1 494 ? -0.887  4.446   22.662  1.00 120.81 ? 494  ASP A CG  1 
ATOM   3797 O OD1 . ASP A 1 494 ? -1.775  4.086   21.864  1.00 118.50 ? 494  ASP A OD1 1 
ATOM   3798 O OD2 . ASP A 1 494 ? -0.692  5.642   22.971  1.00 124.59 ? 494  ASP A OD2 1 
ATOM   3799 N N   . SER A 1 495 ? -1.944  0.689   21.900  1.00 125.15 ? 495  SER A N   1 
ATOM   3800 C CA  . SER A 1 495 ? -2.169  0.025   20.617  1.00 126.07 ? 495  SER A CA  1 
ATOM   3801 C C   . SER A 1 495 ? -3.162  0.822   19.767  1.00 125.23 ? 495  SER A C   1 
ATOM   3802 O O   . SER A 1 495 ? -3.324  0.562   18.570  1.00 117.50 ? 495  SER A O   1 
ATOM   3803 C CB  . SER A 1 495 ? -2.647  -1.414  20.818  1.00 124.62 ? 495  SER A CB  1 
ATOM   3804 O OG  . SER A 1 495 ? -3.515  -1.510  21.933  1.00 133.49 ? 495  SER A OG  1 
ATOM   3805 N N   . LYS A 1 496 ? -3.821  1.790   20.402  1.00 125.77 ? 496  LYS A N   1 
ATOM   3806 C CA  . LYS A 1 496 ? -4.649  2.768   19.700  1.00 127.70 ? 496  LYS A CA  1 
ATOM   3807 C C   . LYS A 1 496 ? -3.779  3.576   18.736  1.00 126.95 ? 496  LYS A C   1 
ATOM   3808 O O   . LYS A 1 496 ? -4.108  3.725   17.554  1.00 119.68 ? 496  LYS A O   1 
ATOM   3809 C CB  . LYS A 1 496 ? -5.340  3.704   20.698  1.00 116.43 ? 496  LYS A CB  1 
ATOM   3810 N N   . SER A 1 497 ? -2.667  4.095   19.255  1.00 125.69 ? 497  SER A N   1 
ATOM   3811 C CA  . SER A 1 497 ? -1.657  4.750   18.430  1.00 116.57 ? 497  SER A CA  1 
ATOM   3812 C C   . SER A 1 497 ? -1.138  3.780   17.377  1.00 112.91 ? 497  SER A C   1 
ATOM   3813 O O   . SER A 1 497 ? -0.992  2.581   17.637  1.00 109.64 ? 497  SER A O   1 
ATOM   3814 C CB  . SER A 1 497 ? -0.491  5.255   19.286  1.00 112.68 ? 497  SER A CB  1 
ATOM   3815 O OG  . SER A 1 497 ? -0.865  6.382   20.060  1.00 124.52 ? 497  SER A OG  1 
ATOM   3816 N N   . PRO A 1 498 ? -0.863  4.300   16.177  1.00 101.75 ? 498  PRO A N   1 
ATOM   3817 C CA  . PRO A 1 498 ? -0.369  3.503   15.051  1.00 89.78  ? 498  PRO A CA  1 
ATOM   3818 C C   . PRO A 1 498 ? 0.981   2.873   15.392  1.00 89.81  ? 498  PRO A C   1 
ATOM   3819 O O   . PRO A 1 498 ? 1.766   3.478   16.125  1.00 87.16  ? 498  PRO A O   1 
ATOM   3820 C CB  . PRO A 1 498 ? -0.217  4.546   13.941  1.00 86.43  ? 498  PRO A CB  1 
ATOM   3821 C CG  . PRO A 1 498 ? -0.101  5.863   14.687  1.00 86.77  ? 498  PRO A CG  1 
ATOM   3822 C CD  . PRO A 1 498 ? -1.056  5.710   15.805  1.00 89.97  ? 498  PRO A CD  1 
ATOM   3823 N N   . GLN A 1 499 ? 1.243   1.677   14.872  1.00 85.30  ? 499  GLN A N   1 
ATOM   3824 C CA  . GLN A 1 499 ? 2.461   0.941   15.209  1.00 78.92  ? 499  GLN A CA  1 
ATOM   3825 C C   . GLN A 1 499 ? 3.640   1.274   14.297  1.00 75.83  ? 499  GLN A C   1 
ATOM   3826 O O   . GLN A 1 499 ? 3.455   1.628   13.135  1.00 77.13  ? 499  GLN A O   1 
ATOM   3827 C CB  . GLN A 1 499 ? 2.195   -0.567  15.190  1.00 76.30  ? 499  GLN A CB  1 
ATOM   3828 C CG  . GLN A 1 499 ? 1.170   -1.001  16.221  1.00 87.15  ? 499  GLN A CG  1 
ATOM   3829 C CD  . GLN A 1 499 ? 1.558   -0.597  17.637  1.00 89.65  ? 499  GLN A CD  1 
ATOM   3830 O OE1 . GLN A 1 499 ? 2.438   -1.210  18.251  1.00 87.69  ? 499  GLN A OE1 1 
ATOM   3831 N NE2 . GLN A 1 499 ? 0.894   0.431   18.168  1.00 81.97  ? 499  GLN A NE2 1 
ATOM   3832 N N   . TRP A 1 500 ? 4.848   1.153   14.841  1.00 69.86  ? 500  TRP A N   1 
ATOM   3833 C CA  . TRP A 1 500 ? 6.087   1.381   14.100  1.00 56.20  ? 500  TRP A CA  1 
ATOM   3834 C C   . TRP A 1 500 ? 6.661   0.010   13.766  1.00 58.54  ? 500  TRP A C   1 
ATOM   3835 O O   . TRP A 1 500 ? 7.150   -0.703  14.647  1.00 60.13  ? 500  TRP A O   1 
ATOM   3836 C CB  . TRP A 1 500 ? 7.064   2.207   14.961  1.00 60.33  ? 500  TRP A CB  1 
ATOM   3837 C CG  . TRP A 1 500 ? 8.439   2.535   14.367  1.00 62.96  ? 500  TRP A CG  1 
ATOM   3838 C CD1 . TRP A 1 500 ? 9.044   1.955   13.275  1.00 60.84  ? 500  TRP A CD1 1 
ATOM   3839 C CD2 . TRP A 1 500 ? 9.384   3.487   14.882  1.00 61.37  ? 500  TRP A CD2 1 
ATOM   3840 N NE1 . TRP A 1 500 ? 10.290  2.505   13.075  1.00 55.06  ? 500  TRP A NE1 1 
ATOM   3841 C CE2 . TRP A 1 500 ? 10.520  3.447   14.046  1.00 59.61  ? 500  TRP A CE2 1 
ATOM   3842 C CE3 . TRP A 1 500 ? 9.373   4.378   15.965  1.00 52.31  ? 500  TRP A CE3 1 
ATOM   3843 C CZ2 . TRP A 1 500 ? 11.631  4.263   14.261  1.00 58.71  ? 500  TRP A CZ2 1 
ATOM   3844 C CZ3 . TRP A 1 500 ? 10.469  5.184   16.174  1.00 48.43  ? 500  TRP A CZ3 1 
ATOM   3845 C CH2 . TRP A 1 500 ? 11.584  5.124   15.330  1.00 57.70  ? 500  TRP A CH2 1 
ATOM   3846 N N   . PRO A 1 501 ? 6.581   -0.381  12.490  1.00 54.66  ? 501  PRO A N   1 
ATOM   3847 C CA  . PRO A 1 501 ? 7.034   -1.717  12.091  1.00 50.87  ? 501  PRO A CA  1 
ATOM   3848 C C   . PRO A 1 501 ? 8.538   -1.762  11.911  1.00 56.37  ? 501  PRO A C   1 
ATOM   3849 O O   . PRO A 1 501 ? 9.119   -0.759  11.510  1.00 56.28  ? 501  PRO A O   1 
ATOM   3850 C CB  . PRO A 1 501 ? 6.359   -1.915  10.730  1.00 49.63  ? 501  PRO A CB  1 
ATOM   3851 C CG  . PRO A 1 501 ? 6.140   -0.523  10.192  1.00 47.61  ? 501  PRO A CG  1 
ATOM   3852 C CD  . PRO A 1 501 ? 6.020   0.398   11.369  1.00 50.09  ? 501  PRO A CD  1 
ATOM   3853 N N   . PRO A 1 502 ? 9.164   -2.915  12.183  1.00 59.56  ? 502  PRO A N   1 
ATOM   3854 C CA  . PRO A 1 502 ? 10.585  -3.075  11.865  1.00 59.92  ? 502  PRO A CA  1 
ATOM   3855 C C   . PRO A 1 502 ? 10.837  -2.756  10.404  1.00 67.51  ? 502  PRO A C   1 
ATOM   3856 O O   . PRO A 1 502 ? 9.896   -2.757  9.611   1.00 68.23  ? 502  PRO A O   1 
ATOM   3857 C CB  . PRO A 1 502 ? 10.837  -4.565  12.108  1.00 49.87  ? 502  PRO A CB  1 
ATOM   3858 C CG  . PRO A 1 502 ? 9.852   -4.936  13.138  1.00 63.14  ? 502  PRO A CG  1 
ATOM   3859 C CD  . PRO A 1 502 ? 8.618   -4.091  12.875  1.00 59.15  ? 502  PRO A CD  1 
ATOM   3860 N N   . TYR A 1 503 ? 12.092  -2.484  10.062  1.00 62.10  ? 503  TYR A N   1 
ATOM   3861 C CA  . TYR A 1 503 ? 12.485  -2.275  8.683   1.00 54.65  ? 503  TYR A CA  1 
ATOM   3862 C C   . TYR A 1 503 ? 13.046  -3.588  8.158   1.00 53.65  ? 503  TYR A C   1 
ATOM   3863 O O   . TYR A 1 503 ? 13.783  -4.279  8.857   1.00 56.72  ? 503  TYR A O   1 
ATOM   3864 C CB  . TYR A 1 503 ? 13.519  -1.146  8.593   1.00 54.30  ? 503  TYR A CB  1 
ATOM   3865 C CG  . TYR A 1 503 ? 14.149  -0.961  7.228   1.00 55.41  ? 503  TYR A CG  1 
ATOM   3866 C CD1 . TYR A 1 503 ? 15.261  -1.714  6.848   1.00 58.90  ? 503  TYR A CD1 1 
ATOM   3867 C CD2 . TYR A 1 503 ? 13.646  -0.031  6.324   1.00 49.47  ? 503  TYR A CD2 1 
ATOM   3868 C CE1 . TYR A 1 503 ? 15.850  -1.551  5.607   1.00 54.36  ? 503  TYR A CE1 1 
ATOM   3869 C CE2 . TYR A 1 503 ? 14.230  0.144   5.076   1.00 51.75  ? 503  TYR A CE2 1 
ATOM   3870 C CZ  . TYR A 1 503 ? 15.333  -0.623  4.722   1.00 63.61  ? 503  TYR A CZ  1 
ATOM   3871 O OH  . TYR A 1 503 ? 15.930  -0.471  3.483   1.00 62.93  ? 503  TYR A OH  1 
ATOM   3872 N N   . THR A 1 504 ? 12.691  -3.927  6.924   1.00 59.71  ? 504  THR A N   1 
ATOM   3873 C CA  . THR A 1 504 ? 13.048  -5.213  6.331   1.00 58.69  ? 504  THR A CA  1 
ATOM   3874 C C   . THR A 1 504 ? 13.476  -5.008  4.889   1.00 58.49  ? 504  THR A C   1 
ATOM   3875 O O   . THR A 1 504 ? 13.007  -4.081  4.227   1.00 59.95  ? 504  THR A O   1 
ATOM   3876 C CB  . THR A 1 504 ? 11.830  -6.169  6.331   1.00 60.38  ? 504  THR A CB  1 
ATOM   3877 O OG1 . THR A 1 504 ? 10.725  -5.532  5.664   1.00 67.51  ? 504  THR A OG1 1 
ATOM   3878 C CG2 . THR A 1 504 ? 11.408  -6.509  7.760   1.00 47.35  ? 504  THR A CG2 1 
ATOM   3879 N N   . THR A 1 505 ? 14.351  -5.872  4.389   1.00 54.23  ? 505  THR A N   1 
ATOM   3880 C CA  . THR A 1 505 ? 14.693  -5.827  2.969   1.00 66.24  ? 505  THR A CA  1 
ATOM   3881 C C   . THR A 1 505 ? 13.433  -5.968  2.100   1.00 63.66  ? 505  THR A C   1 
ATOM   3882 O O   . THR A 1 505 ? 13.289  -5.297  1.081   1.00 65.85  ? 505  THR A O   1 
ATOM   3883 C CB  . THR A 1 505 ? 15.710  -6.921  2.582   1.00 67.12  ? 505  THR A CB  1 
ATOM   3884 O OG1 . THR A 1 505 ? 15.073  -8.201  2.622   1.00 75.72  ? 505  THR A OG1 1 
ATOM   3885 C CG2 . THR A 1 505 ? 16.910  -6.916  3.538   1.00 66.73  ? 505  THR A CG2 1 
ATOM   3886 N N   . ALA A 1 506 ? 12.518  -6.834  2.520   1.00 67.71  ? 506  ALA A N   1 
ATOM   3887 C CA  . ALA A 1 506 ? 11.280  -7.069  1.778   1.00 69.51  ? 506  ALA A CA  1 
ATOM   3888 C C   . ALA A 1 506 ? 10.439  -5.811  1.643   1.00 69.30  ? 506  ALA A C   1 
ATOM   3889 O O   . ALA A 1 506 ? 10.181  -5.342  0.534   1.00 75.13  ? 506  ALA A O   1 
ATOM   3890 C CB  . ALA A 1 506 ? 10.457  -8.168  2.449   1.00 74.76  ? 506  ALA A CB  1 
ATOM   3891 N N   . ALA A 1 507 ? 10.008  -5.270  2.779   1.00 64.77  ? 507  ALA A N   1 
ATOM   3892 C CA  . ALA A 1 507 ? 9.066   -4.158  2.772   1.00 63.79  ? 507  ALA A CA  1 
ATOM   3893 C C   . ALA A 1 507 ? 9.724   -2.777  2.885   1.00 63.87  ? 507  ALA A C   1 
ATOM   3894 O O   . ALA A 1 507 ? 9.132   -1.782  2.472   1.00 59.15  ? 507  ALA A O   1 
ATOM   3895 C CB  . ALA A 1 507 ? 8.027   -4.351  3.856   1.00 65.73  ? 507  ALA A CB  1 
ATOM   3896 N N   . GLN A 1 508 ? 10.933  -2.723  3.446   1.00 63.08  ? 508  GLN A N   1 
ATOM   3897 C CA  . GLN A 1 508 ? 11.690  -1.471  3.585   1.00 60.59  ? 508  GLN A CA  1 
ATOM   3898 C C   . GLN A 1 508 ? 10.878  -0.358  4.233   1.00 58.00  ? 508  GLN A C   1 
ATOM   3899 O O   . GLN A 1 508 ? 10.873  0.780   3.758   1.00 59.68  ? 508  GLN A O   1 
ATOM   3900 C CB  . GLN A 1 508 ? 12.199  -0.993  2.226   1.00 52.33  ? 508  GLN A CB  1 
ATOM   3901 C CG  . GLN A 1 508 ? 12.706  -2.111  1.345   1.00 59.07  ? 508  GLN A CG  1 
ATOM   3902 C CD  . GLN A 1 508 ? 13.030  -1.640  -0.060  1.00 70.66  ? 508  GLN A CD  1 
ATOM   3903 O OE1 . GLN A 1 508 ? 13.666  -0.602  -0.245  1.00 69.90  ? 508  GLN A OE1 1 
ATOM   3904 N NE2 . GLN A 1 508 ? 12.594  -2.404  -1.060  1.00 71.23  ? 508  GLN A NE2 1 
ATOM   3905 N N   . GLN A 1 509 ? 10.196  -0.686  5.321   1.00 57.40  ? 509  GLN A N   1 
ATOM   3906 C CA  . GLN A 1 509 ? 9.312   0.269   5.971   1.00 63.22  ? 509  GLN A CA  1 
ATOM   3907 C C   . GLN A 1 509 ? 10.025  1.105   7.026   1.00 61.07  ? 509  GLN A C   1 
ATOM   3908 O O   . GLN A 1 509 ? 10.907  0.614   7.732   1.00 61.22  ? 509  GLN A O   1 
ATOM   3909 C CB  . GLN A 1 509 ? 8.119   -0.444  6.605   1.00 63.37  ? 509  GLN A CB  1 
ATOM   3910 C CG  . GLN A 1 509 ? 7.098   -0.945  5.609   1.00 70.83  ? 509  GLN A CG  1 
ATOM   3911 C CD  . GLN A 1 509 ? 5.844   -1.469  6.284   1.00 76.09  ? 509  GLN A CD  1 
ATOM   3912 O OE1 . GLN A 1 509 ? 5.914   -2.341  7.154   1.00 63.54  ? 509  GLN A OE1 1 
ATOM   3913 N NE2 . GLN A 1 509 ? 4.683   -0.940  5.882   1.00 76.25  ? 509  GLN A NE2 1 
ATOM   3914 N N   . TYR A 1 510 ? 9.614   2.367   7.120   1.00 55.90  ? 510  TYR A N   1 
ATOM   3915 C CA  . TYR A 1 510 ? 10.127  3.307   8.102   1.00 55.16  ? 510  TYR A CA  1 
ATOM   3916 C C   . TYR A 1 510 ? 9.030   4.318   8.407   1.00 59.74  ? 510  TYR A C   1 
ATOM   3917 O O   . TYR A 1 510 ? 8.121   4.495   7.596   1.00 65.49  ? 510  TYR A O   1 
ATOM   3918 C CB  . TYR A 1 510 ? 11.351  4.029   7.548   1.00 55.09  ? 510  TYR A CB  1 
ATOM   3919 C CG  . TYR A 1 510 ? 11.045  4.917   6.368   1.00 55.79  ? 510  TYR A CG  1 
ATOM   3920 C CD1 . TYR A 1 510 ? 11.019  4.403   5.073   1.00 56.06  ? 510  TYR A CD1 1 
ATOM   3921 C CD2 . TYR A 1 510 ? 10.784  6.274   6.546   1.00 50.20  ? 510  TYR A CD2 1 
ATOM   3922 C CE1 . TYR A 1 510 ? 10.735  5.216   3.993   1.00 51.46  ? 510  TYR A CE1 1 
ATOM   3923 C CE2 . TYR A 1 510 ? 10.503  7.090   5.476   1.00 52.25  ? 510  TYR A CE2 1 
ATOM   3924 C CZ  . TYR A 1 510 ? 10.483  6.557   4.201   1.00 53.76  ? 510  TYR A CZ  1 
ATOM   3925 O OH  . TYR A 1 510 ? 10.207  7.371   3.130   1.00 59.48  ? 510  TYR A OH  1 
ATOM   3926 N N   . VAL A 1 511 ? 9.099   4.977   9.563   1.00 54.64  ? 511  VAL A N   1 
ATOM   3927 C CA  . VAL A 1 511 ? 8.064   5.933   9.938   1.00 53.87  ? 511  VAL A CA  1 
ATOM   3928 C C   . VAL A 1 511 ? 8.530   7.355   9.743   1.00 50.89  ? 511  VAL A C   1 
ATOM   3929 O O   . VAL A 1 511 ? 9.722   7.633   9.728   1.00 57.58  ? 511  VAL A O   1 
ATOM   3930 C CB  . VAL A 1 511 ? 7.621   5.773   11.413  1.00 61.42  ? 511  VAL A CB  1 
ATOM   3931 C CG1 . VAL A 1 511 ? 6.758   4.531   11.583  1.00 58.92  ? 511  VAL A CG1 1 
ATOM   3932 C CG2 . VAL A 1 511 ? 8.825   5.738   12.339  1.00 51.01  ? 511  VAL A CG2 1 
ATOM   3933 N N   . SER A 1 512 ? 7.582   8.263   9.595   1.00 51.81  ? 512  SER A N   1 
ATOM   3934 C CA  . SER A 1 512 ? 7.908   9.675   9.602   1.00 56.38  ? 512  SER A CA  1 
ATOM   3935 C C   . SER A 1 512 ? 7.699   10.200  11.012  1.00 59.29  ? 512  SER A C   1 
ATOM   3936 O O   . SER A 1 512 ? 6.777   9.781   11.709  1.00 63.10  ? 512  SER A O   1 
ATOM   3937 C CB  . SER A 1 512 ? 7.014   10.435  8.630   1.00 59.48  ? 512  SER A CB  1 
ATOM   3938 O OG  . SER A 1 512 ? 5.682   10.501  9.113   1.00 72.09  ? 512  SER A OG  1 
ATOM   3939 N N   . LEU A 1 513 ? 8.558   11.114  11.438  1.00 54.50  ? 513  LEU A N   1 
ATOM   3940 C CA  . LEU A 1 513 ? 8.399   11.735  12.739  1.00 54.00  ? 513  LEU A CA  1 
ATOM   3941 C C   . LEU A 1 513 ? 8.130   13.239  12.610  1.00 58.16  ? 513  LEU A C   1 
ATOM   3942 O O   . LEU A 1 513 ? 9.040   14.033  12.358  1.00 59.25  ? 513  LEU A O   1 
ATOM   3943 C CB  . LEU A 1 513 ? 9.629   11.469  13.612  1.00 55.91  ? 513  LEU A CB  1 
ATOM   3944 C CG  . LEU A 1 513 ? 9.999   10.011  13.894  1.00 50.65  ? 513  LEU A CG  1 
ATOM   3945 C CD1 . LEU A 1 513 ? 11.279  9.930   14.706  1.00 48.86  ? 513  LEU A CD1 1 
ATOM   3946 C CD2 . LEU A 1 513 ? 8.888   9.333   14.637  1.00 54.40  ? 513  LEU A CD2 1 
ATOM   3947 N N   . ASN A 1 514 ? 6.866   13.614  12.774  1.00 59.25  ? 514  ASN A N   1 
ATOM   3948 C CA  . ASN A 1 514 ? 6.442   15.015  12.743  1.00 64.29  ? 514  ASN A CA  1 
ATOM   3949 C C   . ASN A 1 514 ? 5.317   15.228  13.735  1.00 65.96  ? 514  ASN A C   1 
ATOM   3950 O O   . ASN A 1 514 ? 5.044   14.358  14.568  1.00 64.88  ? 514  ASN A O   1 
ATOM   3951 C CB  . ASN A 1 514 ? 5.986   15.438  11.338  1.00 67.74  ? 514  ASN A CB  1 
ATOM   3952 C CG  . ASN A 1 514 ? 5.189   14.347  10.623  1.00 73.55  ? 514  ASN A CG  1 
ATOM   3953 O OD1 . ASN A 1 514 ? 4.253   13.768  11.185  1.00 75.41  ? 514  ASN A OD1 1 
ATOM   3954 N ND2 . ASN A 1 514 ? 5.570   14.054  9.379   1.00 69.89  ? 514  ASN A ND2 1 
ATOM   3955 N N   . LEU A 1 515 ? 4.655   16.377  13.646  1.00 72.82  ? 515  LEU A N   1 
ATOM   3956 C CA  . LEU A 1 515 ? 3.603   16.701  14.606  1.00 66.10  ? 515  LEU A CA  1 
ATOM   3957 C C   . LEU A 1 515 ? 2.405   15.769  14.443  1.00 67.43  ? 515  LEU A C   1 
ATOM   3958 O O   . LEU A 1 515 ? 1.708   15.481  15.406  1.00 66.39  ? 515  LEU A O   1 
ATOM   3959 C CB  . LEU A 1 515 ? 3.193   18.163  14.477  1.00 61.98  ? 515  LEU A CB  1 
ATOM   3960 C CG  . LEU A 1 515 ? 4.358   19.098  14.776  1.00 67.07  ? 515  LEU A CG  1 
ATOM   3961 C CD1 . LEU A 1 515 ? 3.948   20.550  14.655  1.00 54.67  ? 515  LEU A CD1 1 
ATOM   3962 C CD2 . LEU A 1 515 ? 4.905   18.798  16.170  1.00 62.48  ? 515  LEU A CD2 1 
ATOM   3963 N N   . LYS A 1 516 ? 2.178   15.293  13.223  1.00 68.07  ? 516  LYS A N   1 
ATOM   3964 C CA  . LYS A 1 516 ? 1.146   14.293  12.981  1.00 70.10  ? 516  LYS A CA  1 
ATOM   3965 C C   . LYS A 1 516 ? 1.553   12.937  13.548  1.00 69.08  ? 516  LYS A C   1 
ATOM   3966 O O   . LYS A 1 516 ? 2.720   12.708  13.856  1.00 71.25  ? 516  LYS A O   1 
ATOM   3967 C CB  . LYS A 1 516 ? 0.843   14.157  11.483  1.00 69.09  ? 516  LYS A CB  1 
ATOM   3968 C CG  . LYS A 1 516 ? -0.009  15.285  10.899  1.00 73.17  ? 516  LYS A CG  1 
ATOM   3969 C CD  . LYS A 1 516 ? 0.813   16.237  10.032  1.00 94.53  ? 516  LYS A CD  1 
ATOM   3970 C CE  . LYS A 1 516 ? 1.129   15.629  8.651   1.00 100.36 ? 516  LYS A CE  1 
ATOM   3971 N NZ  . LYS A 1 516 ? 0.024   15.779  7.644   1.00 95.61  ? 516  LYS A NZ  1 
ATOM   3972 N N   . PRO A 1 517 ? 0.576   12.041  13.713  1.00 75.40  ? 517  PRO A N   1 
ATOM   3973 C CA  . PRO A 1 517 ? 0.798   10.652  14.123  1.00 69.62  ? 517  PRO A CA  1 
ATOM   3974 C C   . PRO A 1 517 ? 1.723   9.886   13.184  1.00 68.54  ? 517  PRO A C   1 
ATOM   3975 O O   . PRO A 1 517 ? 1.838   10.223  11.997  1.00 69.48  ? 517  PRO A O   1 
ATOM   3976 C CB  . PRO A 1 517 ? -0.608  10.052  14.068  1.00 58.28  ? 517  PRO A CB  1 
ATOM   3977 C CG  . PRO A 1 517 ? -1.484  11.181  14.390  1.00 60.96  ? 517  PRO A CG  1 
ATOM   3978 C CD  . PRO A 1 517 ? -0.846  12.412  13.800  1.00 66.46  ? 517  PRO A CD  1 
ATOM   3979 N N   . LEU A 1 518 ? 2.366   8.855   13.730  1.00 69.41  ? 518  LEU A N   1 
ATOM   3980 C CA  . LEU A 1 518 ? 3.245   7.983   12.958  1.00 70.83  ? 518  LEU A CA  1 
ATOM   3981 C C   . LEU A 1 518 ? 2.626   7.621   11.626  1.00 71.35  ? 518  LEU A C   1 
ATOM   3982 O O   . LEU A 1 518 ? 1.490   7.154   11.559  1.00 66.25  ? 518  LEU A O   1 
ATOM   3983 C CB  . LEU A 1 518 ? 3.546   6.686   13.712  1.00 63.19  ? 518  LEU A CB  1 
ATOM   3984 C CG  . LEU A 1 518 ? 4.733   6.616   14.665  1.00 61.04  ? 518  LEU A CG  1 
ATOM   3985 C CD1 . LEU A 1 518 ? 5.213   5.166   14.771  1.00 67.70  ? 518  LEU A CD1 1 
ATOM   3986 C CD2 . LEU A 1 518 ? 5.852   7.516   14.190  1.00 59.87  ? 518  LEU A CD2 1 
ATOM   3987 N N   . GLU A 1 519 ? 3.391   7.825   10.566  1.00 70.38  ? 519  GLU A N   1 
ATOM   3988 C CA  . GLU A 1 519 ? 2.967   7.417   9.246   1.00 65.07  ? 519  GLU A CA  1 
ATOM   3989 C C   . GLU A 1 519 ? 4.032   6.524   8.630   1.00 65.32  ? 519  GLU A C   1 
ATOM   3990 O O   . GLU A 1 519 ? 5.185   6.921   8.512   1.00 75.96  ? 519  GLU A O   1 
ATOM   3991 C CB  . GLU A 1 519 ? 2.740   8.646   8.391   1.00 60.90  ? 519  GLU A CB  1 
ATOM   3992 C CG  . GLU A 1 519 ? 2.603   8.344   6.930   1.00 76.36  ? 519  GLU A CG  1 
ATOM   3993 C CD  . GLU A 1 519 ? 2.693   9.603   6.094   1.00 96.68  ? 519  GLU A CD  1 
ATOM   3994 O OE1 . GLU A 1 519 ? 2.434   10.700  6.653   1.00 99.17  ? 519  GLU A OE1 1 
ATOM   3995 O OE2 . GLU A 1 519 ? 3.032   9.496   4.890   1.00 87.32  ? 519  GLU A OE2 1 
ATOM   3996 N N   . VAL A 1 520 ? 3.653   5.310   8.261   1.00 60.71  ? 520  VAL A N   1 
ATOM   3997 C CA  . VAL A 1 520 ? 4.596   4.355   7.700   1.00 56.67  ? 520  VAL A CA  1 
ATOM   3998 C C   . VAL A 1 520 ? 4.799   4.590   6.214   1.00 63.61  ? 520  VAL A C   1 
ATOM   3999 O O   . VAL A 1 520 ? 3.837   4.626   5.449   1.00 65.04  ? 520  VAL A O   1 
ATOM   4000 C CB  . VAL A 1 520 ? 4.102   2.916   7.880   1.00 57.89  ? 520  VAL A CB  1 
ATOM   4001 C CG1 . VAL A 1 520 ? 4.826   1.988   6.922   1.00 51.92  ? 520  VAL A CG1 1 
ATOM   4002 C CG2 . VAL A 1 520 ? 4.286   2.473   9.324   1.00 62.93  ? 520  VAL A CG2 1 
ATOM   4003 N N   . ARG A 1 521 ? 6.057   4.739   5.807   1.00 63.04  ? 521  ARG A N   1 
ATOM   4004 C CA  . ARG A 1 521 ? 6.392   4.888   4.398   1.00 56.44  ? 521  ARG A CA  1 
ATOM   4005 C C   . ARG A 1 521 ? 7.234   3.717   3.962   1.00 52.79  ? 521  ARG A C   1 
ATOM   4006 O O   . ARG A 1 521 ? 7.688   2.932   4.790   1.00 59.13  ? 521  ARG A O   1 
ATOM   4007 C CB  . ARG A 1 521 ? 7.120   6.204   4.158   1.00 54.82  ? 521  ARG A CB  1 
ATOM   4008 C CG  . ARG A 1 521 ? 6.315   7.382   4.639   1.00 55.17  ? 521  ARG A CG  1 
ATOM   4009 C CD  . ARG A 1 521 ? 7.016   8.691   4.418   1.00 56.66  ? 521  ARG A CD  1 
ATOM   4010 N NE  . ARG A 1 521 ? 6.237   9.777   5.003   1.00 62.60  ? 521  ARG A NE  1 
ATOM   4011 C CZ  . ARG A 1 521 ? 6.712   10.992  5.261   1.00 71.71  ? 521  ARG A CZ  1 
ATOM   4012 N NH1 . ARG A 1 521 ? 7.980   11.288  4.991   1.00 71.62  ? 521  ARG A NH1 1 
ATOM   4013 N NH2 . ARG A 1 521 ? 5.921   11.912  5.802   1.00 69.74  ? 521  ARG A NH2 1 
ATOM   4014 N N   . ARG A 1 522 ? 7.430   3.586   2.660   1.00 51.02  ? 522  ARG A N   1 
ATOM   4015 C CA  . ARG A 1 522 ? 8.130   2.424   2.131   1.00 63.63  ? 522  ARG A CA  1 
ATOM   4016 C C   . ARG A 1 522 ? 9.271   2.837   1.207   1.00 63.52  ? 522  ARG A C   1 
ATOM   4017 O O   . ARG A 1 522 ? 9.094   3.672   0.315   1.00 63.30  ? 522  ARG A O   1 
ATOM   4018 C CB  . ARG A 1 522 ? 7.164   1.503   1.374   1.00 74.17  ? 522  ARG A CB  1 
ATOM   4019 C CG  . ARG A 1 522 ? 6.192   0.684   2.227   1.00 70.18  ? 522  ARG A CG  1 
ATOM   4020 C CD  . ARG A 1 522 ? 5.647   -0.490  1.403   1.00 81.23  ? 522  ARG A CD  1 
ATOM   4021 N NE  . ARG A 1 522 ? 6.729   -1.377  0.952   1.00 97.27  ? 522  ARG A NE  1 
ATOM   4022 C CZ  . ARG A 1 522 ? 6.782   -1.975  -0.242  1.00 99.51  ? 522  ARG A CZ  1 
ATOM   4023 N NH1 . ARG A 1 522 ? 5.814   -1.778  -1.129  1.00 100.67 ? 522  ARG A NH1 1 
ATOM   4024 N NH2 . ARG A 1 522 ? 7.812   -2.761  -0.558  1.00 87.26  ? 522  ARG A NH2 1 
ATOM   4025 N N   . GLY A 1 523 ? 10.440  2.240   1.414   1.00 65.94  ? 523  GLY A N   1 
ATOM   4026 C CA  . GLY A 1 523 ? 11.601  2.555   0.602   1.00 63.68  ? 523  GLY A CA  1 
ATOM   4027 C C   . GLY A 1 523 ? 12.266  3.846   1.035   1.00 59.70  ? 523  GLY A C   1 
ATOM   4028 O O   . GLY A 1 523 ? 11.706  4.944   0.927   1.00 63.32  ? 523  GLY A O   1 
ATOM   4029 N N   . LEU A 1 524 ? 13.478  3.707   1.538   1.00 54.54  ? 524  LEU A N   1 
ATOM   4030 C CA  . LEU A 1 524 ? 14.240  4.845   2.007   1.00 55.73  ? 524  LEU A CA  1 
ATOM   4031 C C   . LEU A 1 524 ? 15.096  5.403   0.867   1.00 58.01  ? 524  LEU A C   1 
ATOM   4032 O O   . LEU A 1 524 ? 16.193  4.908   0.604   1.00 55.37  ? 524  LEU A O   1 
ATOM   4033 C CB  . LEU A 1 524 ? 15.111  4.385   3.164   1.00 60.28  ? 524  LEU A CB  1 
ATOM   4034 C CG  . LEU A 1 524 ? 15.273  5.386   4.298   1.00 76.01  ? 524  LEU A CG  1 
ATOM   4035 C CD1 . LEU A 1 524 ? 14.361  6.608   4.110   1.00 69.86  ? 524  LEU A CD1 1 
ATOM   4036 C CD2 . LEU A 1 524 ? 15.004  4.667   5.617   1.00 74.50  ? 524  LEU A CD2 1 
ATOM   4037 N N   . ARG A 1 525 ? 14.577  6.417   0.179   1.00 58.62  ? 525  ARG A N   1 
ATOM   4038 C CA  . ARG A 1 525 ? 15.199  6.914   -1.046  1.00 58.78  ? 525  ARG A CA  1 
ATOM   4039 C C   . ARG A 1 525 ? 15.684  5.784   -1.935  1.00 62.69  ? 525  ARG A C   1 
ATOM   4040 O O   . ARG A 1 525 ? 16.828  5.824   -2.395  1.00 63.44  ? 525  ARG A O   1 
ATOM   4041 C CB  . ARG A 1 525 ? 16.413  7.769   -0.716  1.00 59.39  ? 525  ARG A CB  1 
ATOM   4042 C CG  . ARG A 1 525 ? 16.094  9.112   -0.152  1.00 67.68  ? 525  ARG A CG  1 
ATOM   4043 C CD  . ARG A 1 525 ? 16.001  10.161  -1.222  1.00 63.03  ? 525  ARG A CD  1 
ATOM   4044 N NE  . ARG A 1 525 ? 16.625  11.387  -0.748  1.00 72.75  ? 525  ARG A NE  1 
ATOM   4045 C CZ  . ARG A 1 525 ? 16.213  12.069  0.316   1.00 71.87  ? 525  ARG A CZ  1 
ATOM   4046 N NH1 . ARG A 1 525 ? 15.171  11.639  1.015   1.00 79.56  ? 525  ARG A NH1 1 
ATOM   4047 N NH2 . ARG A 1 525 ? 16.845  13.181  0.684   1.00 75.68  ? 525  ARG A NH2 1 
ATOM   4048 N N   . ALA A 1 526 ? 14.843  4.786   -2.192  1.00 54.28  ? 526  ALA A N   1 
ATOM   4049 C CA  . ALA A 1 526 ? 15.328  3.593   -2.886  1.00 53.39  ? 526  ALA A CA  1 
ATOM   4050 C C   . ALA A 1 526 ? 16.049  3.846   -4.231  1.00 54.41  ? 526  ALA A C   1 
ATOM   4051 O O   . ALA A 1 526 ? 17.193  3.429   -4.394  1.00 59.88  ? 526  ALA A O   1 
ATOM   4052 C CB  . ALA A 1 526 ? 14.227  2.561   -3.029  1.00 54.42  ? 526  ALA A CB  1 
ATOM   4053 N N   . GLN A 1 527 ? 15.409  4.528   -5.178  1.00 50.60  ? 527  GLN A N   1 
ATOM   4054 C CA  . GLN A 1 527 ? 16.008  4.691   -6.508  1.00 58.58  ? 527  GLN A CA  1 
ATOM   4055 C C   . GLN A 1 527 ? 17.341  5.397   -6.419  1.00 56.19  ? 527  GLN A C   1 
ATOM   4056 O O   . GLN A 1 527 ? 18.344  4.910   -6.937  1.00 57.53  ? 527  GLN A O   1 
ATOM   4057 C CB  . GLN A 1 527 ? 15.094  5.450   -7.480  1.00 54.74  ? 527  GLN A CB  1 
ATOM   4058 C CG  . GLN A 1 527 ? 13.919  4.647   -8.025  1.00 60.40  ? 527  GLN A CG  1 
ATOM   4059 C CD  . GLN A 1 527 ? 14.330  3.350   -8.730  1.00 71.21  ? 527  GLN A CD  1 
ATOM   4060 O OE1 . GLN A 1 527 ? 13.988  2.253   -8.277  1.00 68.72  ? 527  GLN A OE1 1 
ATOM   4061 N NE2 . GLN A 1 527 ? 15.056  3.474   -9.844  1.00 67.51  ? 527  GLN A NE2 1 
ATOM   4062 N N   . THR A 1 528 ? 17.344  6.553   -5.767  1.00 54.86  ? 528  THR A N   1 
ATOM   4063 C CA  . THR A 1 528 ? 18.564  7.328   -5.596  1.00 53.09  ? 528  THR A CA  1 
ATOM   4064 C C   . THR A 1 528 ? 19.656  6.563   -4.846  1.00 57.45  ? 528  THR A C   1 
ATOM   4065 O O   . THR A 1 528 ? 20.841  6.651   -5.193  1.00 54.89  ? 528  THR A O   1 
ATOM   4066 C CB  . THR A 1 528 ? 18.286  8.619   -4.849  1.00 54.22  ? 528  THR A CB  1 
ATOM   4067 O OG1 . THR A 1 528 ? 17.757  9.576   -5.767  1.00 56.53  ? 528  THR A OG1 1 
ATOM   4068 C CG2 . THR A 1 528 ? 19.572  9.167   -4.224  1.00 47.45  ? 528  THR A CG2 1 
ATOM   4069 N N   . CYS A 1 529 ? 19.275  5.817   -3.815  1.00 47.38  ? 529  CYS A N   1 
ATOM   4070 C CA  . CYS A 1 529 ? 20.293  5.101   -3.052  1.00 51.85  ? 529  CYS A CA  1 
ATOM   4071 C C   . CYS A 1 529 ? 20.905  3.964   -3.857  1.00 48.90  ? 529  CYS A C   1 
ATOM   4072 O O   . CYS A 1 529 ? 22.045  3.572   -3.624  1.00 49.74  ? 529  CYS A O   1 
ATOM   4073 C CB  . CYS A 1 529 ? 19.816  4.709   -1.640  1.00 49.09  ? 529  CYS A CB  1 
ATOM   4074 S SG  . CYS A 1 529 ? 19.885  6.180   -0.484  1.00 69.39  ? 529  CYS A SG  1 
ATOM   4075 N N   . ALA A 1 530 ? 20.177  3.492   -4.860  1.00 49.64  ? 530  ALA A N   1 
ATOM   4076 C CA  . ALA A 1 530 ? 20.741  2.533   -5.795  1.00 52.94  ? 530  ALA A CA  1 
ATOM   4077 C C   . ALA A 1 530 ? 21.878  3.188   -6.568  1.00 57.42  ? 530  ALA A C   1 
ATOM   4078 O O   . ALA A 1 530 ? 22.918  2.571   -6.824  1.00 59.22  ? 530  ALA A O   1 
ATOM   4079 C CB  . ALA A 1 530 ? 19.680  2.027   -6.742  1.00 57.72  ? 530  ALA A CB  1 
ATOM   4080 N N   . PHE A 1 531 ? 21.677  4.446   -6.934  1.00 46.28  ? 531  PHE A N   1 
ATOM   4081 C CA  . PHE A 1 531 ? 22.702  5.204   -7.625  1.00 50.47  ? 531  PHE A CA  1 
ATOM   4082 C C   . PHE A 1 531 ? 23.981  5.245   -6.800  1.00 56.09  ? 531  PHE A C   1 
ATOM   4083 O O   . PHE A 1 531 ? 25.054  4.829   -7.266  1.00 50.67  ? 531  PHE A O   1 
ATOM   4084 C CB  . PHE A 1 531 ? 22.199  6.624   -7.893  1.00 58.81  ? 531  PHE A CB  1 
ATOM   4085 C CG  . PHE A 1 531 ? 23.240  7.549   -8.452  1.00 50.30  ? 531  PHE A CG  1 
ATOM   4086 C CD1 . PHE A 1 531 ? 23.774  7.338   -9.712  1.00 56.89  ? 531  PHE A CD1 1 
ATOM   4087 C CD2 . PHE A 1 531 ? 23.668  8.641   -7.726  1.00 53.74  ? 531  PHE A CD2 1 
ATOM   4088 C CE1 . PHE A 1 531 ? 24.727  8.193   -10.240 1.00 57.33  ? 531  PHE A CE1 1 
ATOM   4089 C CE2 . PHE A 1 531 ? 24.627  9.507   -8.245  1.00 62.16  ? 531  PHE A CE2 1 
ATOM   4090 C CZ  . PHE A 1 531 ? 25.153  9.281   -9.507  1.00 62.86  ? 531  PHE A CZ  1 
ATOM   4091 N N   . TRP A 1 532 ? 23.856  5.736   -5.567  1.00 50.10  ? 532  TRP A N   1 
ATOM   4092 C CA  . TRP A 1 532 ? 25.013  5.920   -4.695  1.00 53.42  ? 532  TRP A CA  1 
ATOM   4093 C C   . TRP A 1 532 ? 25.625  4.603   -4.255  1.00 56.59  ? 532  TRP A C   1 
ATOM   4094 O O   . TRP A 1 532 ? 26.843  4.443   -4.290  1.00 56.51  ? 532  TRP A O   1 
ATOM   4095 C CB  . TRP A 1 532 ? 24.669  6.773   -3.469  1.00 46.53  ? 532  TRP A CB  1 
ATOM   4096 C CG  . TRP A 1 532 ? 24.391  8.207   -3.814  1.00 46.81  ? 532  TRP A CG  1 
ATOM   4097 C CD1 . TRP A 1 532 ? 23.166  8.821   -3.873  1.00 44.94  ? 532  TRP A CD1 1 
ATOM   4098 C CD2 . TRP A 1 532 ? 25.358  9.206   -4.171  1.00 46.16  ? 532  TRP A CD2 1 
ATOM   4099 N NE1 . TRP A 1 532 ? 23.316  10.143  -4.237  1.00 45.58  ? 532  TRP A NE1 1 
ATOM   4100 C CE2 . TRP A 1 532 ? 24.650  10.403  -4.426  1.00 44.41  ? 532  TRP A CE2 1 
ATOM   4101 C CE3 . TRP A 1 532 ? 26.755  9.204   -4.303  1.00 48.83  ? 532  TRP A CE3 1 
ATOM   4102 C CZ2 . TRP A 1 532 ? 25.290  11.579  -4.805  1.00 41.84  ? 532  TRP A CZ2 1 
ATOM   4103 C CZ3 . TRP A 1 532 ? 27.390  10.380  -4.669  1.00 44.13  ? 532  TRP A CZ3 1 
ATOM   4104 C CH2 . TRP A 1 532 ? 26.656  11.549  -4.918  1.00 46.79  ? 532  TRP A CH2 1 
ATOM   4105 N N   . ASN A 1 533 ? 24.783  3.654   -3.865  1.00 51.38  ? 533  ASN A N   1 
ATOM   4106 C CA  . ASN A 1 533 ? 25.289  2.430   -3.256  1.00 51.24  ? 533  ASN A CA  1 
ATOM   4107 C C   . ASN A 1 533 ? 25.599  1.286   -4.211  1.00 53.35  ? 533  ASN A C   1 
ATOM   4108 O O   . ASN A 1 533 ? 26.338  0.377   -3.860  1.00 54.69  ? 533  ASN A O   1 
ATOM   4109 C CB  . ASN A 1 533 ? 24.347  1.955   -2.149  1.00 52.07  ? 533  ASN A CB  1 
ATOM   4110 C CG  . ASN A 1 533 ? 24.210  2.969   -1.035  1.00 52.57  ? 533  ASN A CG  1 
ATOM   4111 O OD1 . ASN A 1 533 ? 25.109  3.776   -0.810  1.00 64.31  ? 533  ASN A OD1 1 
ATOM   4112 N ND2 . ASN A 1 533 ? 23.085  2.939   -0.336  1.00 54.17  ? 533  ASN A ND2 1 
ATOM   4113 N N   . ARG A 1 534 ? 25.046  1.324   -5.416  1.00 56.98  ? 534  ARG A N   1 
ATOM   4114 C CA  . ARG A 1 534 ? 25.217  0.198   -6.328  1.00 58.81  ? 534  ARG A CA  1 
ATOM   4115 C C   . ARG A 1 534 ? 25.967  0.589   -7.563  1.00 66.64  ? 534  ARG A C   1 
ATOM   4116 O O   . ARG A 1 534 ? 26.866  -0.118  -8.005  1.00 74.94  ? 534  ARG A O   1 
ATOM   4117 C CB  . ARG A 1 534 ? 23.869  -0.379  -6.737  1.00 59.40  ? 534  ARG A CB  1 
ATOM   4118 C CG  . ARG A 1 534 ? 23.280  -1.302  -5.706  1.00 57.09  ? 534  ARG A CG  1 
ATOM   4119 C CD  . ARG A 1 534 ? 21.789  -1.397  -5.892  1.00 64.88  ? 534  ARG A CD  1 
ATOM   4120 N NE  . ARG A 1 534 ? 21.121  -1.965  -4.725  1.00 70.98  ? 534  ARG A NE  1 
ATOM   4121 C CZ  . ARG A 1 534 ? 21.052  -3.267  -4.461  1.00 76.73  ? 534  ARG A CZ  1 
ATOM   4122 N NH1 . ARG A 1 534 ? 21.626  -4.149  -5.279  1.00 76.41  ? 534  ARG A NH1 1 
ATOM   4123 N NH2 . ARG A 1 534 ? 20.408  -3.685  -3.379  1.00 73.07  ? 534  ARG A NH2 1 
ATOM   4124 N N   . PHE A 1 535 ? 25.586  1.720   -8.132  1.00 68.76  ? 535  PHE A N   1 
ATOM   4125 C CA  . PHE A 1 535 ? 26.173  2.127   -9.383  1.00 59.32  ? 535  PHE A CA  1 
ATOM   4126 C C   . PHE A 1 535 ? 27.497  2.856   -9.203  1.00 59.22  ? 535  PHE A C   1 
ATOM   4127 O O   . PHE A 1 535 ? 28.503  2.437   -9.756  1.00 63.38  ? 535  PHE A O   1 
ATOM   4128 C CB  . PHE A 1 535 ? 25.207  2.980   -10.193 1.00 57.42  ? 535  PHE A CB  1 
ATOM   4129 C CG  . PHE A 1 535 ? 25.800  3.469   -11.470 1.00 61.68  ? 535  PHE A CG  1 
ATOM   4130 C CD1 . PHE A 1 535 ? 26.162  2.565   -12.464 1.00 56.63  ? 535  PHE A CD1 1 
ATOM   4131 C CD2 . PHE A 1 535 ? 26.039  4.817   -11.668 1.00 59.29  ? 535  PHE A CD2 1 
ATOM   4132 C CE1 . PHE A 1 535 ? 26.728  3.000   -13.640 1.00 56.82  ? 535  PHE A CE1 1 
ATOM   4133 C CE2 . PHE A 1 535 ? 26.607  5.263   -12.847 1.00 63.29  ? 535  PHE A CE2 1 
ATOM   4134 C CZ  . PHE A 1 535 ? 26.951  4.356   -13.832 1.00 61.54  ? 535  PHE A CZ  1 
ATOM   4135 N N   . LEU A 1 536 ? 27.493  3.949   -8.445  1.00 60.94  ? 536  LEU A N   1 
ATOM   4136 C CA  . LEU A 1 536 ? 28.700  4.764   -8.237  1.00 54.56  ? 536  LEU A CA  1 
ATOM   4137 C C   . LEU A 1 536 ? 29.983  3.998   -7.902  1.00 63.08  ? 536  LEU A C   1 
ATOM   4138 O O   . LEU A 1 536 ? 31.021  4.244   -8.507  1.00 66.26  ? 536  LEU A O   1 
ATOM   4139 C CB  . LEU A 1 536 ? 28.446  5.810   -7.159  1.00 60.46  ? 536  LEU A CB  1 
ATOM   4140 C CG  . LEU A 1 536 ? 28.448  7.251   -7.652  1.00 71.58  ? 536  LEU A CG  1 
ATOM   4141 C CD1 . LEU A 1 536 ? 29.764  7.934   -7.280  1.00 68.09  ? 536  LEU A CD1 1 
ATOM   4142 C CD2 . LEU A 1 536 ? 28.186  7.292   -9.158  1.00 68.13  ? 536  LEU A CD2 1 
ATOM   4143 N N   . PRO A 1 537 ? 29.923  3.074   -6.926  1.00 67.68  ? 537  PRO A N   1 
ATOM   4144 C CA  . PRO A 1 537 ? 31.140  2.337   -6.574  1.00 66.78  ? 537  PRO A CA  1 
ATOM   4145 C C   . PRO A 1 537 ? 31.733  1.636   -7.790  1.00 74.73  ? 537  PRO A C   1 
ATOM   4146 O O   . PRO A 1 537 ? 32.954  1.628   -7.960  1.00 76.39  ? 537  PRO A O   1 
ATOM   4147 C CB  . PRO A 1 537 ? 30.640  1.300   -5.561  1.00 59.66  ? 537  PRO A CB  1 
ATOM   4148 C CG  . PRO A 1 537 ? 29.399  1.888   -4.999  1.00 58.81  ? 537  PRO A CG  1 
ATOM   4149 C CD  . PRO A 1 537 ? 28.764  2.634   -6.129  1.00 57.56  ? 537  PRO A CD  1 
ATOM   4150 N N   . LYS A 1 538 ? 30.871  1.054   -8.621  1.00 71.90  ? 538  LYS A N   1 
ATOM   4151 C CA  . LYS A 1 538 ? 31.306  0.373   -9.839  1.00 73.72  ? 538  LYS A CA  1 
ATOM   4152 C C   . LYS A 1 538 ? 31.839  1.368   -10.865 1.00 69.79  ? 538  LYS A C   1 
ATOM   4153 O O   . LYS A 1 538 ? 32.759  1.069   -11.613 1.00 79.69  ? 538  LYS A O   1 
ATOM   4154 C CB  . LYS A 1 538 ? 30.162  -0.456  -10.437 1.00 67.72  ? 538  LYS A CB  1 
ATOM   4155 C CG  . LYS A 1 538 ? 29.670  -1.571  -9.519  1.00 79.95  ? 538  LYS A CG  1 
ATOM   4156 C CD  . LYS A 1 538 ? 28.656  -2.464  -10.204 1.00 78.85  ? 538  LYS A CD  1 
ATOM   4157 C CE  . LYS A 1 538 ? 28.467  -3.758  -9.424  1.00 96.03  ? 538  LYS A CE  1 
ATOM   4158 N NZ  . LYS A 1 538 ? 27.823  -4.826  -10.255 1.00 102.62 ? 538  LYS A NZ  1 
ATOM   4159 N N   . LEU A 1 539 ? 31.266  2.561   -10.882 1.00 71.94  ? 539  LEU A N   1 
ATOM   4160 C CA  . LEU A 1 539 ? 31.665  3.569   -11.847 1.00 71.36  ? 539  LEU A CA  1 
ATOM   4161 C C   . LEU A 1 539 ? 33.101  3.992   -11.630 1.00 80.19  ? 539  LEU A C   1 
ATOM   4162 O O   . LEU A 1 539 ? 33.925  3.880   -12.534 1.00 90.99  ? 539  LEU A O   1 
ATOM   4163 C CB  . LEU A 1 539 ? 30.751  4.792   -11.774 1.00 75.50  ? 539  LEU A CB  1 
ATOM   4164 C CG  . LEU A 1 539 ? 31.136  5.966   -12.681 1.00 70.44  ? 539  LEU A CG  1 
ATOM   4165 C CD1 . LEU A 1 539 ? 31.415  5.466   -14.073 1.00 59.85  ? 539  LEU A CD1 1 
ATOM   4166 C CD2 . LEU A 1 539 ? 30.039  7.022   -12.698 1.00 67.60  ? 539  LEU A CD2 1 
ATOM   4167 N N   . LEU A 1 540 ? 33.410  4.480   -10.434 1.00 85.48  ? 540  LEU A N   1 
ATOM   4168 C CA  . LEU A 1 540 ? 34.751  5.013   -10.189 1.00 94.83  ? 540  LEU A CA  1 
ATOM   4169 C C   . LEU A 1 540 ? 35.838  3.930   -9.987  1.00 98.69  ? 540  LEU A C   1 
ATOM   4170 O O   . LEU A 1 540 ? 36.995  4.244   -9.707  1.00 105.93 ? 540  LEU A O   1 
ATOM   4171 C CB  . LEU A 1 540 ? 34.745  6.108   -9.103  1.00 86.57  ? 540  LEU A CB  1 
ATOM   4172 C CG  . LEU A 1 540 ? 34.436  5.794   -7.640  1.00 88.79  ? 540  LEU A CG  1 
ATOM   4173 C CD1 . LEU A 1 540 ? 33.505  6.869   -7.031  1.00 85.17  ? 540  LEU A CD1 1 
ATOM   4174 C CD2 . LEU A 1 540 ? 33.878  4.380   -7.478  1.00 65.94  ? 540  LEU A CD2 1 
ATOM   4175 N N   . SER A 1 541 ? 35.458  2.661   -10.151 1.00 96.24  ? 541  SER A N   1 
ATOM   4176 C CA  . SER A 1 541 ? 36.423  1.607   -10.473 1.00 90.81  ? 541  SER A CA  1 
ATOM   4177 C C   . SER A 1 541 ? 36.658  1.673   -11.984 1.00 103.33 ? 541  SER A C   1 
ATOM   4178 O O   . SER A 1 541 ? 36.380  0.715   -12.714 1.00 105.70 ? 541  SER A O   1 
ATOM   4179 C CB  . SER A 1 541 ? 35.888  0.221   -10.108 1.00 83.99  ? 541  SER A CB  1 
ATOM   4180 O OG  . SER A 1 541 ? 35.348  0.191   -8.801  1.00 92.15  ? 541  SER A OG  1 
ATOM   4181 N N   . ALA A 1 542 ? 37.143  2.823   -12.445 1.00 101.97 ? 542  ALA A N   1 
ATOM   4182 C CA  . ALA A 1 542 ? 37.328  3.086   -13.867 1.00 92.13  ? 542  ALA A CA  1 
ATOM   4183 C C   . ALA A 1 542 ? 37.860  4.500   -14.042 1.00 94.90  ? 542  ALA A C   1 
ATOM   4184 O O   . ALA A 1 542 ? 38.536  5.028   -13.156 1.00 96.43  ? 542  ALA A O   1 
ATOM   4185 C CB  . ALA A 1 542 ? 36.017  2.908   -14.624 1.00 83.46  ? 542  ALA A CB  1 
ATOM   4186 N N   . GLU B 1 4   ? -17.318 4.954   -69.788 1.00 107.88 ? 4    GLU B N   1 
ATOM   4187 C CA  . GLU B 1 4   ? -16.028 5.553   -69.453 1.00 102.86 ? 4    GLU B CA  1 
ATOM   4188 C C   . GLU B 1 4   ? -16.157 6.815   -68.591 1.00 104.85 ? 4    GLU B C   1 
ATOM   4189 O O   . GLU B 1 4   ? -16.290 7.929   -69.110 1.00 104.23 ? 4    GLU B O   1 
ATOM   4190 C CB  . GLU B 1 4   ? -15.233 5.867   -70.721 1.00 96.06  ? 4    GLU B CB  1 
ATOM   4191 C CG  . GLU B 1 4   ? -13.893 6.542   -70.443 1.00 104.50 ? 4    GLU B CG  1 
ATOM   4192 C CD  . GLU B 1 4   ? -12.940 5.664   -69.634 1.00 114.73 ? 4    GLU B CD  1 
ATOM   4193 O OE1 . GLU B 1 4   ? -12.730 5.951   -68.428 1.00 108.45 ? 4    GLU B OE1 1 
ATOM   4194 O OE2 . GLU B 1 4   ? -12.405 4.685   -70.206 1.00 103.93 ? 4    GLU B OE2 1 
ATOM   4195 N N   . ASP B 1 5   ? -16.102 6.628   -67.275 1.00 95.67  ? 5    ASP B N   1 
ATOM   4196 C CA  . ASP B 1 5   ? -16.197 7.722   -66.308 1.00 87.94  ? 5    ASP B CA  1 
ATOM   4197 C C   . ASP B 1 5   ? -14.999 8.670   -66.394 1.00 86.95  ? 5    ASP B C   1 
ATOM   4198 O O   . ASP B 1 5   ? -13.869 8.265   -66.128 1.00 90.48  ? 5    ASP B O   1 
ATOM   4199 C CB  . ASP B 1 5   ? -16.283 7.131   -64.903 1.00 88.25  ? 5    ASP B CB  1 
ATOM   4200 C CG  . ASP B 1 5   ? -16.605 8.164   -63.853 1.00 84.87  ? 5    ASP B CG  1 
ATOM   4201 O OD1 . ASP B 1 5   ? -16.972 7.746   -62.734 1.00 69.71  ? 5    ASP B OD1 1 
ATOM   4202 O OD2 . ASP B 1 5   ? -16.496 9.379   -64.143 1.00 82.73  ? 5    ASP B OD2 1 
ATOM   4203 N N   . PRO B 1 6   ? -15.245 9.941   -66.754 1.00 91.08  ? 6    PRO B N   1 
ATOM   4204 C CA  . PRO B 1 6   ? -14.173 10.915  -66.998 1.00 78.48  ? 6    PRO B CA  1 
ATOM   4205 C C   . PRO B 1 6   ? -13.428 11.268  -65.721 1.00 82.01  ? 6    PRO B C   1 
ATOM   4206 O O   . PRO B 1 6   ? -12.267 11.668  -65.772 1.00 81.53  ? 6    PRO B O   1 
ATOM   4207 C CB  . PRO B 1 6   ? -14.923 12.152  -67.504 1.00 75.95  ? 6    PRO B CB  1 
ATOM   4208 C CG  . PRO B 1 6   ? -16.299 11.691  -67.833 1.00 80.76  ? 6    PRO B CG  1 
ATOM   4209 C CD  . PRO B 1 6   ? -16.577 10.542  -66.922 1.00 93.31  ? 6    PRO B CD  1 
ATOM   4210 N N   . GLN B 1 7   ? -14.102 11.136  -64.586 1.00 81.45  ? 7    GLN B N   1 
ATOM   4211 C CA  . GLN B 1 7   ? -13.487 11.439  -63.303 1.00 82.07  ? 7    GLN B CA  1 
ATOM   4212 C C   . GLN B 1 7   ? -12.335 10.496  -63.039 1.00 78.37  ? 7    GLN B C   1 
ATOM   4213 O O   . GLN B 1 7   ? -11.387 10.849  -62.341 1.00 78.58  ? 7    GLN B O   1 
ATOM   4214 C CB  . GLN B 1 7   ? -14.509 11.319  -62.171 1.00 87.99  ? 7    GLN B CB  1 
ATOM   4215 C CG  . GLN B 1 7   ? -15.282 12.592  -61.920 1.00 87.17  ? 7    GLN B CG  1 
ATOM   4216 C CD  . GLN B 1 7   ? -14.365 13.737  -61.567 1.00 89.62  ? 7    GLN B CD  1 
ATOM   4217 O OE1 . GLN B 1 7   ? -13.664 13.695  -60.553 1.00 93.31  ? 7    GLN B OE1 1 
ATOM   4218 N NE2 . GLN B 1 7   ? -14.353 14.766  -62.406 1.00 89.81  ? 7    GLN B NE2 1 
ATOM   4219 N N   . LEU B 1 8   ? -12.433 9.293   -63.595 1.00 71.05  ? 8    LEU B N   1 
ATOM   4220 C CA  . LEU B 1 8   ? -11.433 8.261   -63.374 1.00 66.93  ? 8    LEU B CA  1 
ATOM   4221 C C   . LEU B 1 8   ? -10.441 8.197   -64.516 1.00 66.77  ? 8    LEU B C   1 
ATOM   4222 O O   . LEU B 1 8   ? -9.825  7.163   -64.755 1.00 74.82  ? 8    LEU B O   1 
ATOM   4223 C CB  . LEU B 1 8   ? -12.098 6.910   -63.185 1.00 64.53  ? 8    LEU B CB  1 
ATOM   4224 C CG  . LEU B 1 8   ? -13.127 6.979   -62.065 1.00 74.17  ? 8    LEU B CG  1 
ATOM   4225 C CD1 . LEU B 1 8   ? -13.854 5.654   -61.934 1.00 70.56  ? 8    LEU B CD1 1 
ATOM   4226 C CD2 . LEU B 1 8   ? -12.449 7.374   -60.760 1.00 65.26  ? 8    LEU B CD2 1 
ATOM   4227 N N   . LEU B 1 9   ? -10.285 9.315   -65.211 1.00 60.16  ? 9    LEU B N   1 
ATOM   4228 C CA  . LEU B 1 9   ? -9.320  9.427   -66.290 1.00 64.05  ? 9    LEU B CA  1 
ATOM   4229 C C   . LEU B 1 9   ? -8.393  10.599  -66.047 1.00 70.23  ? 9    LEU B C   1 
ATOM   4230 O O   . LEU B 1 9   ? -8.858  11.721  -65.830 1.00 77.96  ? 9    LEU B O   1 
ATOM   4231 C CB  . LEU B 1 9   ? -10.037 9.640   -67.614 1.00 70.94  ? 9    LEU B CB  1 
ATOM   4232 C CG  . LEU B 1 9   ? -10.072 8.463   -68.576 1.00 80.08  ? 9    LEU B CG  1 
ATOM   4233 C CD1 . LEU B 1 9   ? -11.046 8.782   -69.698 1.00 87.94  ? 9    LEU B CD1 1 
ATOM   4234 C CD2 . LEU B 1 9   ? -8.669  8.185   -69.110 1.00 67.39  ? 9    LEU B CD2 1 
ATOM   4235 N N   . VAL B 1 10  ? -7.088  10.350  -66.098 1.00 56.34  ? 10   VAL B N   1 
ATOM   4236 C CA  . VAL B 1 10  ? -6.108  11.400  -65.846 1.00 57.90  ? 10   VAL B CA  1 
ATOM   4237 C C   . VAL B 1 10  ? -4.927  11.313  -66.806 1.00 61.54  ? 10   VAL B C   1 
ATOM   4238 O O   . VAL B 1 10  ? -4.523  10.226  -67.230 1.00 62.43  ? 10   VAL B O   1 
ATOM   4239 C CB  . VAL B 1 10  ? -5.575  11.352  -64.388 1.00 56.96  ? 10   VAL B CB  1 
ATOM   4240 C CG1 . VAL B 1 10  ? -4.667  12.529  -64.110 1.00 49.33  ? 10   VAL B CG1 1 
ATOM   4241 C CG2 . VAL B 1 10  ? -6.721  11.346  -63.408 1.00 61.43  ? 10   VAL B CG2 1 
ATOM   4242 N N   . ARG B 1 11  ? -4.372  12.469  -67.140 1.00 57.92  ? 11   ARG B N   1 
ATOM   4243 C CA  . ARG B 1 11  ? -3.190  12.523  -67.977 1.00 62.89  ? 11   ARG B CA  1 
ATOM   4244 C C   . ARG B 1 11  ? -1.992  13.058  -67.209 1.00 66.48  ? 11   ARG B C   1 
ATOM   4245 O O   . ARG B 1 11  ? -1.928  14.241  -66.855 1.00 69.44  ? 11   ARG B O   1 
ATOM   4246 C CB  . ARG B 1 11  ? -3.431  13.373  -69.225 1.00 69.10  ? 11   ARG B CB  1 
ATOM   4247 C CG  . ARG B 1 11  ? -2.160  13.641  -69.997 1.00 68.71  ? 11   ARG B CG  1 
ATOM   4248 C CD  . ARG B 1 11  ? -2.439  14.028  -71.428 1.00 79.29  ? 11   ARG B CD  1 
ATOM   4249 N NE  . ARG B 1 11  ? -1.486  13.365  -72.310 1.00 99.01  ? 11   ARG B NE  1 
ATOM   4250 C CZ  . ARG B 1 11  ? -1.772  12.297  -73.049 1.00 95.46  ? 11   ARG B CZ  1 
ATOM   4251 N NH1 . ARG B 1 11  ? -2.999  11.783  -73.033 1.00 90.49  ? 11   ARG B NH1 1 
ATOM   4252 N NH2 . ARG B 1 11  ? -0.834  11.750  -73.815 1.00 76.69  ? 11   ARG B NH2 1 
ATOM   4253 N N   . VAL B 1 12  ? -1.036  12.176  -66.959 1.00 63.83  ? 12   VAL B N   1 
ATOM   4254 C CA  . VAL B 1 12  ? 0.210   12.583  -66.344 1.00 64.11  ? 12   VAL B CA  1 
ATOM   4255 C C   . VAL B 1 12  ? 1.264   12.640  -67.441 1.00 61.28  ? 12   VAL B C   1 
ATOM   4256 O O   . VAL B 1 12  ? 0.964   12.361  -68.602 1.00 66.11  ? 12   VAL B O   1 
ATOM   4257 C CB  . VAL B 1 12  ? 0.594   11.634  -65.211 1.00 51.88  ? 12   VAL B CB  1 
ATOM   4258 C CG1 . VAL B 1 12  ? -0.584  11.496  -64.260 1.00 51.28  ? 12   VAL B CG1 1 
ATOM   4259 C CG2 . VAL B 1 12  ? 0.986   10.280  -65.767 1.00 58.24  ? 12   VAL B CG2 1 
ATOM   4260 N N   . ARG B 1 13  ? 2.487   13.015  -67.086 1.00 59.66  ? 13   ARG B N   1 
ATOM   4261 C CA  . ARG B 1 13  ? 3.526   13.220  -68.087 1.00 63.20  ? 13   ARG B CA  1 
ATOM   4262 C C   . ARG B 1 13  ? 3.904   11.968  -68.869 1.00 58.52  ? 13   ARG B C   1 
ATOM   4263 O O   . ARG B 1 13  ? 4.469   12.059  -69.952 1.00 67.58  ? 13   ARG B O   1 
ATOM   4264 C CB  . ARG B 1 13  ? 4.767   13.833  -67.450 1.00 60.58  ? 13   ARG B CB  1 
ATOM   4265 C CG  . ARG B 1 13  ? 4.474   15.150  -66.797 1.00 73.46  ? 13   ARG B CG  1 
ATOM   4266 C CD  . ARG B 1 13  ? 5.693   16.035  -66.721 1.00 76.55  ? 13   ARG B CD  1 
ATOM   4267 N NE  . ARG B 1 13  ? 5.266   17.419  -66.559 1.00 94.55  ? 13   ARG B NE  1 
ATOM   4268 C CZ  . ARG B 1 13  ? 5.885   18.314  -65.795 1.00 105.48 ? 13   ARG B CZ  1 
ATOM   4269 N NH1 . ARG B 1 13  ? 6.973   17.973  -65.107 1.00 99.29  ? 13   ARG B NH1 1 
ATOM   4270 N NH2 . ARG B 1 13  ? 5.408   19.552  -65.714 1.00 103.66 ? 13   ARG B NH2 1 
ATOM   4271 N N   . GLY B 1 14  ? 3.595   10.801  -68.327 1.00 58.46  ? 14   GLY B N   1 
ATOM   4272 C CA  . GLY B 1 14  ? 4.006   9.567   -68.959 1.00 59.50  ? 14   GLY B CA  1 
ATOM   4273 C C   . GLY B 1 14  ? 2.953   9.003   -69.881 1.00 59.82  ? 14   GLY B C   1 
ATOM   4274 O O   . GLY B 1 14  ? 3.194   8.029   -70.590 1.00 61.58  ? 14   GLY B O   1 
ATOM   4275 N N   . GLY B 1 15  ? 1.775   9.611   -69.866 1.00 58.75  ? 15   GLY B N   1 
ATOM   4276 C CA  . GLY B 1 15  ? 0.660   9.101   -70.633 1.00 56.45  ? 15   GLY B CA  1 
ATOM   4277 C C   . GLY B 1 15  ? -0.616  9.145   -69.829 1.00 60.75  ? 15   GLY B C   1 
ATOM   4278 O O   . GLY B 1 15  ? -0.727  9.927   -68.885 1.00 65.42  ? 15   GLY B O   1 
ATOM   4279 N N   . GLN B 1 16  ? -1.575  8.299   -70.194 1.00 62.56  ? 16   GLN B N   1 
ATOM   4280 C CA  . GLN B 1 16  ? -2.901  8.330   -69.581 1.00 62.36  ? 16   GLN B CA  1 
ATOM   4281 C C   . GLN B 1 16  ? -3.146  7.213   -68.586 1.00 58.32  ? 16   GLN B C   1 
ATOM   4282 O O   . GLN B 1 16  ? -2.635  6.107   -68.733 1.00 63.45  ? 16   GLN B O   1 
ATOM   4283 C CB  . GLN B 1 16  ? -3.991  8.300   -70.650 1.00 65.73  ? 16   GLN B CB  1 
ATOM   4284 C CG  . GLN B 1 16  ? -4.075  9.577   -71.447 1.00 79.93  ? 16   GLN B CG  1 
ATOM   4285 C CD  . GLN B 1 16  ? -5.378  9.702   -72.209 1.00 95.99  ? 16   GLN B CD  1 
ATOM   4286 O OE1 . GLN B 1 16  ? -5.682  8.893   -73.097 1.00 75.55  ? 16   GLN B OE1 1 
ATOM   4287 N NE2 . GLN B 1 16  ? -6.159  10.728  -71.869 1.00 91.07  ? 16   GLN B NE2 1 
ATOM   4288 N N   . LEU B 1 17  ? -3.956  7.516   -67.582 1.00 56.98  ? 17   LEU B N   1 
ATOM   4289 C CA  . LEU B 1 17  ? -4.251  6.584   -66.514 1.00 55.29  ? 17   LEU B CA  1 
ATOM   4290 C C   . LEU B 1 17  ? -5.738  6.528   -66.353 1.00 60.76  ? 17   LEU B C   1 
ATOM   4291 O O   . LEU B 1 17  ? -6.424  7.540   -66.495 1.00 58.94  ? 17   LEU B O   1 
ATOM   4292 C CB  . LEU B 1 17  ? -3.670  7.087   -65.184 1.00 56.27  ? 17   LEU B CB  1 
ATOM   4293 C CG  . LEU B 1 17  ? -2.179  7.415   -65.180 1.00 63.82  ? 17   LEU B CG  1 
ATOM   4294 C CD1 . LEU B 1 17  ? -1.819  8.270   -63.981 1.00 62.40  ? 17   LEU B CD1 1 
ATOM   4295 C CD2 . LEU B 1 17  ? -1.351  6.133   -65.233 1.00 61.33  ? 17   LEU B CD2 1 
ATOM   4296 N N   . ARG B 1 18  ? -6.236  5.346   -66.027 1.00 59.65  ? 18   ARG B N   1 
ATOM   4297 C CA  . ARG B 1 18  ? -7.606  5.218   -65.611 1.00 59.04  ? 18   ARG B CA  1 
ATOM   4298 C C   . ARG B 1 18  ? -7.627  4.649   -64.211 1.00 59.02  ? 18   ARG B C   1 
ATOM   4299 O O   . ARG B 1 18  ? -7.181  3.525   -63.978 1.00 59.83  ? 18   ARG B O   1 
ATOM   4300 C CB  . ARG B 1 18  ? -8.382  4.300   -66.550 1.00 69.76  ? 18   ARG B CB  1 
ATOM   4301 C CG  . ARG B 1 18  ? -9.783  3.977   -66.033 1.00 73.16  ? 18   ARG B CG  1 
ATOM   4302 C CD  . ARG B 1 18  ? -10.497 2.984   -66.922 1.00 84.90  ? 18   ARG B CD  1 
ATOM   4303 N NE  . ARG B 1 18  ? -9.547  2.059   -67.529 1.00 93.71  ? 18   ARG B NE  1 
ATOM   4304 C CZ  . ARG B 1 18  ? -9.264  2.025   -68.827 1.00 87.01  ? 18   ARG B CZ  1 
ATOM   4305 N NH1 . ARG B 1 18  ? -9.876  2.857   -69.665 1.00 76.27  ? 18   ARG B NH1 1 
ATOM   4306 N NH2 . ARG B 1 18  ? -8.372  1.154   -69.284 1.00 89.16  ? 18   ARG B NH2 1 
ATOM   4307 N N   . GLY B 1 19  ? -8.153  5.428   -63.278 1.00 56.82  ? 19   GLY B N   1 
ATOM   4308 C CA  . GLY B 1 19  ? -8.319  4.954   -61.923 1.00 56.14  ? 19   GLY B CA  1 
ATOM   4309 C C   . GLY B 1 19  ? -9.641  4.239   -61.790 1.00 61.99  ? 19   GLY B C   1 
ATOM   4310 O O   . GLY B 1 19  ? -10.253 3.827   -62.771 1.00 69.70  ? 19   GLY B O   1 
ATOM   4311 N N   . ILE B 1 20  ? -10.105 4.116   -60.563 1.00 59.23  ? 20   ILE B N   1 
ATOM   4312 C CA  . ILE B 1 20  ? -11.313 3.374   -60.305 1.00 57.82  ? 20   ILE B CA  1 
ATOM   4313 C C   . ILE B 1 20  ? -12.034 4.005   -59.139 1.00 63.81  ? 20   ILE B C   1 
ATOM   4314 O O   . ILE B 1 20  ? -11.407 4.358   -58.144 1.00 67.81  ? 20   ILE B O   1 
ATOM   4315 C CB  . ILE B 1 20  ? -10.965 1.949   -59.940 1.00 52.68  ? 20   ILE B CB  1 
ATOM   4316 C CG1 . ILE B 1 20  ? -12.142 1.282   -59.244 1.00 52.76  ? 20   ILE B CG1 1 
ATOM   4317 C CG2 . ILE B 1 20  ? -9.751  1.937   -59.028 1.00 59.43  ? 20   ILE B CG2 1 
ATOM   4318 C CD1 . ILE B 1 20  ? -11.916 -0.199  -58.985 1.00 46.43  ? 20   ILE B CD1 1 
ATOM   4319 N N   . ARG B 1 21  ? -13.348 4.154   -59.262 1.00 62.17  ? 21   ARG B N   1 
ATOM   4320 C CA  . ARG B 1 21  ? -14.154 4.729   -58.193 1.00 56.67  ? 21   ARG B CA  1 
ATOM   4321 C C   . ARG B 1 21  ? -14.345 3.709   -57.075 1.00 59.02  ? 21   ARG B C   1 
ATOM   4322 O O   . ARG B 1 21  ? -14.709 2.558   -57.316 1.00 59.14  ? 21   ARG B O   1 
ATOM   4323 C CB  . ARG B 1 21  ? -15.498 5.227   -58.726 1.00 60.59  ? 21   ARG B CB  1 
ATOM   4324 C CG  . ARG B 1 21  ? -16.528 5.486   -57.651 1.00 71.75  ? 21   ARG B CG  1 
ATOM   4325 C CD  . ARG B 1 21  ? -17.736 6.243   -58.194 1.00 86.83  ? 21   ARG B CD  1 
ATOM   4326 N NE  . ARG B 1 21  ? -18.777 5.351   -58.697 1.00 87.87  ? 21   ARG B NE  1 
ATOM   4327 C CZ  . ARG B 1 21  ? -19.645 4.702   -57.924 1.00 105.85 ? 21   ARG B CZ  1 
ATOM   4328 N NH1 . ARG B 1 21  ? -19.599 4.835   -56.600 1.00 95.71  ? 21   ARG B NH1 1 
ATOM   4329 N NH2 . ARG B 1 21  ? -20.558 3.911   -58.477 1.00 119.29 ? 21   ARG B NH2 1 
ATOM   4330 N N   . LEU B 1 22  ? -14.071 4.142   -55.851 1.00 58.71  ? 22   LEU B N   1 
ATOM   4331 C CA  . LEU B 1 22  ? -14.119 3.267   -54.697 1.00 55.27  ? 22   LEU B CA  1 
ATOM   4332 C C   . LEU B 1 22  ? -15.187 3.734   -53.749 1.00 64.65  ? 22   LEU B C   1 
ATOM   4333 O O   . LEU B 1 22  ? -15.559 4.909   -53.737 1.00 66.84  ? 22   LEU B O   1 
ATOM   4334 C CB  . LEU B 1 22  ? -12.786 3.272   -53.958 1.00 63.56  ? 22   LEU B CB  1 
ATOM   4335 C CG  . LEU B 1 22  ? -11.660 2.399   -54.494 1.00 67.45  ? 22   LEU B CG  1 
ATOM   4336 C CD1 . LEU B 1 22  ? -10.525 2.420   -53.495 1.00 66.91  ? 22   LEU B CD1 1 
ATOM   4337 C CD2 . LEU B 1 22  ? -12.153 0.978   -54.731 1.00 68.68  ? 22   LEU B CD2 1 
ATOM   4338 N N   . LYS B 1 23  ? -15.667 2.804   -52.937 1.00 64.66  ? 23   LYS B N   1 
ATOM   4339 C CA  . LYS B 1 23  ? -16.713 3.109   -51.989 1.00 68.82  ? 23   LYS B CA  1 
ATOM   4340 C C   . LYS B 1 23  ? -16.089 3.425   -50.636 1.00 72.22  ? 23   LYS B C   1 
ATOM   4341 O O   . LYS B 1 23  ? -15.332 2.628   -50.085 1.00 65.76  ? 23   LYS B O   1 
ATOM   4342 C CB  . LYS B 1 23  ? -17.697 1.935   -51.889 1.00 73.92  ? 23   LYS B CB  1 
ATOM   4343 C CG  . LYS B 1 23  ? -18.967 2.248   -51.105 1.00 85.03  ? 23   LYS B CG  1 
ATOM   4344 C CD  . LYS B 1 23  ? -19.571 3.582   -51.549 1.00 85.74  ? 23   LYS B CD  1 
ATOM   4345 C CE  . LYS B 1 23  ? -20.684 4.051   -50.610 1.00 85.75  ? 23   LYS B CE  1 
ATOM   4346 N NZ  . LYS B 1 23  ? -21.154 5.439   -50.944 1.00 85.44  ? 23   LYS B NZ  1 
ATOM   4347 N N   . ALA B 1 24  ? -16.382 4.614   -50.127 1.00 72.53  ? 24   ALA B N   1 
ATOM   4348 C CA  . ALA B 1 24  ? -16.072 4.961   -48.749 1.00 72.03  ? 24   ALA B CA  1 
ATOM   4349 C C   . ALA B 1 24  ? -17.404 5.083   -48.006 1.00 78.84  ? 24   ALA B C   1 
ATOM   4350 O O   . ALA B 1 24  ? -18.401 5.519   -48.586 1.00 73.96  ? 24   ALA B O   1 
ATOM   4351 C CB  . ALA B 1 24  ? -15.295 6.267   -48.693 1.00 66.91  ? 24   ALA B CB  1 
ATOM   4352 N N   . PRO B 1 25  ? -17.432 4.693   -46.722 1.00 83.84  ? 25   PRO B N   1 
ATOM   4353 C CA  . PRO B 1 25  ? -18.685 4.666   -45.956 1.00 77.31  ? 25   PRO B CA  1 
ATOM   4354 C C   . PRO B 1 25  ? -19.600 5.858   -46.229 1.00 77.91  ? 25   PRO B C   1 
ATOM   4355 O O   . PRO B 1 25  ? -20.817 5.678   -46.289 1.00 86.32  ? 25   PRO B O   1 
ATOM   4356 C CB  . PRO B 1 25  ? -18.202 4.675   -44.507 1.00 73.48  ? 25   PRO B CB  1 
ATOM   4357 C CG  . PRO B 1 25  ? -16.910 3.927   -44.566 1.00 77.37  ? 25   PRO B CG  1 
ATOM   4358 C CD  . PRO B 1 25  ? -16.275 4.303   -45.894 1.00 77.98  ? 25   PRO B CD  1 
ATOM   4359 N N   . GLY B 1 26  ? -19.033 7.046   -46.414 1.00 70.28  ? 26   GLY B N   1 
ATOM   4360 C CA  . GLY B 1 26  ? -19.844 8.228   -46.644 1.00 72.47  ? 26   GLY B CA  1 
ATOM   4361 C C   . GLY B 1 26  ? -19.807 8.814   -48.048 1.00 76.75  ? 26   GLY B C   1 
ATOM   4362 O O   . GLY B 1 26  ? -20.166 9.972   -48.244 1.00 75.02  ? 26   GLY B O   1 
ATOM   4363 N N   . GLY B 1 27  ? -19.378 8.030   -49.031 1.00 70.18  ? 27   GLY B N   1 
ATOM   4364 C CA  . GLY B 1 27  ? -19.258 8.539   -50.384 1.00 65.92  ? 27   GLY B CA  1 
ATOM   4365 C C   . GLY B 1 27  ? -18.260 7.771   -51.223 1.00 78.00  ? 27   GLY B C   1 
ATOM   4366 O O   . GLY B 1 27  ? -17.594 6.863   -50.725 1.00 79.42  ? 27   GLY B O   1 
ATOM   4367 N N   . PRO B 1 28  ? -18.153 8.122   -52.513 1.00 77.61  ? 28   PRO B N   1 
ATOM   4368 C CA  . PRO B 1 28  ? -17.152 7.498   -53.374 1.00 69.10  ? 28   PRO B CA  1 
ATOM   4369 C C   . PRO B 1 28  ? -15.852 8.304   -53.389 1.00 65.33  ? 28   PRO B C   1 
ATOM   4370 O O   . PRO B 1 28  ? -15.853 9.511   -53.122 1.00 62.14  ? 28   PRO B O   1 
ATOM   4371 C CB  . PRO B 1 28  ? -17.831 7.557   -54.739 1.00 72.10  ? 28   PRO B CB  1 
ATOM   4372 C CG  . PRO B 1 28  ? -18.543 8.886   -54.712 1.00 58.44  ? 28   PRO B CG  1 
ATOM   4373 C CD  . PRO B 1 28  ? -18.953 9.114   -53.257 1.00 67.31  ? 28   PRO B CD  1 
ATOM   4374 N N   . VAL B 1 29  ? -14.749 7.633   -53.694 1.00 63.47  ? 29   VAL B N   1 
ATOM   4375 C CA  . VAL B 1 29  ? -13.466 8.306   -53.856 1.00 67.83  ? 29   VAL B CA  1 
ATOM   4376 C C   . VAL B 1 29  ? -12.850 7.829   -55.160 1.00 60.66  ? 29   VAL B C   1 
ATOM   4377 O O   . VAL B 1 29  ? -13.111 6.710   -55.577 1.00 58.80  ? 29   VAL B O   1 
ATOM   4378 C CB  . VAL B 1 29  ? -12.499 7.972   -52.698 1.00 66.08  ? 29   VAL B CB  1 
ATOM   4379 C CG1 . VAL B 1 29  ? -13.113 8.336   -51.369 1.00 63.61  ? 29   VAL B CG1 1 
ATOM   4380 C CG2 . VAL B 1 29  ? -12.152 6.502   -52.706 1.00 57.67  ? 29   VAL B CG2 1 
ATOM   4381 N N   . SER B 1 30  ? -12.057 8.676   -55.811 1.00 56.64  ? 30   SER B N   1 
ATOM   4382 C CA  . SER B 1 30  ? -11.262 8.246   -56.957 1.00 58.75  ? 30   SER B CA  1 
ATOM   4383 C C   . SER B 1 30  ? -9.936  7.629   -56.494 1.00 59.97  ? 30   SER B C   1 
ATOM   4384 O O   . SER B 1 30  ? -9.217  8.216   -55.698 1.00 65.90  ? 30   SER B O   1 
ATOM   4385 C CB  . SER B 1 30  ? -10.967 9.419   -57.889 1.00 58.08  ? 30   SER B CB  1 
ATOM   4386 O OG  . SER B 1 30  ? -12.148 10.102  -58.253 1.00 73.11  ? 30   SER B OG  1 
ATOM   4387 N N   . ALA B 1 31  ? -9.607  6.448   -56.997 1.00 62.80  ? 31   ALA B N   1 
ATOM   4388 C CA  . ALA B 1 31  ? -8.340  5.814   -56.650 1.00 53.98  ? 31   ALA B CA  1 
ATOM   4389 C C   . ALA B 1 31  ? -7.534  5.485   -57.897 1.00 49.68  ? 31   ALA B C   1 
ATOM   4390 O O   . ALA B 1 31  ? -8.048  4.925   -58.852 1.00 53.87  ? 31   ALA B O   1 
ATOM   4391 C CB  . ALA B 1 31  ? -8.572  4.566   -55.827 1.00 48.77  ? 31   ALA B CB  1 
ATOM   4392 N N   . PHE B 1 32  ? -6.266  5.864   -57.886 1.00 55.92  ? 32   PHE B N   1 
ATOM   4393 C CA  . PHE B 1 32  ? -5.362  5.522   -58.961 1.00 50.78  ? 32   PHE B CA  1 
ATOM   4394 C C   . PHE B 1 32  ? -4.202  4.705   -58.408 1.00 54.83  ? 32   PHE B C   1 
ATOM   4395 O O   . PHE B 1 32  ? -3.204  5.265   -57.943 1.00 52.38  ? 32   PHE B O   1 
ATOM   4396 C CB  . PHE B 1 32  ? -4.872  6.785   -59.643 1.00 51.82  ? 32   PHE B CB  1 
ATOM   4397 C CG  . PHE B 1 32  ? -5.978  7.697   -60.062 1.00 62.23  ? 32   PHE B CG  1 
ATOM   4398 C CD1 . PHE B 1 32  ? -6.531  8.595   -59.163 1.00 60.33  ? 32   PHE B CD1 1 
ATOM   4399 C CD2 . PHE B 1 32  ? -6.481  7.651   -61.351 1.00 60.01  ? 32   PHE B CD2 1 
ATOM   4400 C CE1 . PHE B 1 32  ? -7.556  9.435   -59.547 1.00 58.38  ? 32   PHE B CE1 1 
ATOM   4401 C CE2 . PHE B 1 32  ? -7.506  8.487   -61.736 1.00 56.47  ? 32   PHE B CE2 1 
ATOM   4402 C CZ  . PHE B 1 32  ? -8.045  9.380   -60.832 1.00 55.96  ? 32   PHE B CZ  1 
ATOM   4403 N N   . LEU B 1 33  ? -4.354  3.381   -58.466 1.00 49.07  ? 33   LEU B N   1 
ATOM   4404 C CA  . LEU B 1 33  ? -3.400  2.432   -57.890 1.00 49.28  ? 33   LEU B CA  1 
ATOM   4405 C C   . LEU B 1 33  ? -2.425  1.794   -58.884 1.00 49.76  ? 33   LEU B C   1 
ATOM   4406 O O   . LEU B 1 33  ? -2.792  1.448   -60.004 1.00 55.77  ? 33   LEU B O   1 
ATOM   4407 C CB  . LEU B 1 33  ? -4.162  1.322   -57.189 1.00 46.87  ? 33   LEU B CB  1 
ATOM   4408 C CG  . LEU B 1 33  ? -5.386  1.812   -56.422 1.00 53.70  ? 33   LEU B CG  1 
ATOM   4409 C CD1 . LEU B 1 33  ? -6.145  0.616   -55.881 1.00 47.26  ? 33   LEU B CD1 1 
ATOM   4410 C CD2 . LEU B 1 33  ? -4.993  2.780   -55.305 1.00 49.16  ? 33   LEU B CD2 1 
ATOM   4411 N N   . GLY B 1 34  ? -1.182  1.623   -58.445 1.00 54.56  ? 34   GLY B N   1 
ATOM   4412 C CA  . GLY B 1 34  ? -0.159  0.960   -59.233 1.00 44.52  ? 34   GLY B CA  1 
ATOM   4413 C C   . GLY B 1 34  ? 0.453   1.796   -60.340 1.00 45.84  ? 34   GLY B C   1 
ATOM   4414 O O   . GLY B 1 34  ? 0.792   1.262   -61.384 1.00 57.56  ? 34   GLY B O   1 
ATOM   4415 N N   . ILE B 1 35  ? 0.602   3.100   -60.117 1.00 48.61  ? 35   ILE B N   1 
ATOM   4416 C CA  . ILE B 1 35  ? 1.224   3.979   -61.097 1.00 42.20  ? 35   ILE B CA  1 
ATOM   4417 C C   . ILE B 1 35  ? 2.735   3.850   -61.063 1.00 45.60  ? 35   ILE B C   1 
ATOM   4418 O O   . ILE B 1 35  ? 3.345   4.033   -60.021 1.00 56.97  ? 35   ILE B O   1 
ATOM   4419 C CB  . ILE B 1 35  ? 0.898   5.453   -60.807 1.00 50.39  ? 35   ILE B CB  1 
ATOM   4420 C CG1 . ILE B 1 35  ? -0.613  5.686   -60.761 1.00 50.78  ? 35   ILE B CG1 1 
ATOM   4421 C CG2 . ILE B 1 35  ? 1.563   6.355   -61.834 1.00 47.17  ? 35   ILE B CG2 1 
ATOM   4422 C CD1 . ILE B 1 35  ? -1.011  7.047   -60.216 1.00 44.09  ? 35   ILE B CD1 1 
ATOM   4423 N N   . PRO B 1 36  ? 3.355   3.569   -62.211 1.00 50.42  ? 36   PRO B N   1 
ATOM   4424 C CA  . PRO B 1 36  ? 4.815   3.439   -62.267 1.00 47.40  ? 36   PRO B CA  1 
ATOM   4425 C C   . PRO B 1 36  ? 5.465   4.799   -62.166 1.00 47.06  ? 36   PRO B C   1 
ATOM   4426 O O   . PRO B 1 36  ? 5.077   5.691   -62.915 1.00 50.94  ? 36   PRO B O   1 
ATOM   4427 C CB  . PRO B 1 36  ? 5.073   2.907   -63.681 1.00 46.20  ? 36   PRO B CB  1 
ATOM   4428 C CG  . PRO B 1 36  ? 3.732   2.814   -64.358 1.00 52.98  ? 36   PRO B CG  1 
ATOM   4429 C CD  . PRO B 1 36  ? 2.747   3.578   -63.548 1.00 51.15  ? 36   PRO B CD  1 
ATOM   4430 N N   . PHE B 1 37  ? 6.438   4.966   -61.282 1.00 48.16  ? 37   PHE B N   1 
ATOM   4431 C CA  . PHE B 1 37  ? 7.139   6.241   -61.215 1.00 47.68  ? 37   PHE B CA  1 
ATOM   4432 C C   . PHE B 1 37  ? 8.610   6.070   -61.550 1.00 47.87  ? 37   PHE B C   1 
ATOM   4433 O O   . PHE B 1 37  ? 9.367   7.032   -61.607 1.00 54.84  ? 37   PHE B O   1 
ATOM   4434 C CB  . PHE B 1 37  ? 6.946   6.924   -59.861 1.00 44.70  ? 37   PHE B CB  1 
ATOM   4435 C CG  . PHE B 1 37  ? 7.512   6.156   -58.704 1.00 45.93  ? 37   PHE B CG  1 
ATOM   4436 C CD1 . PHE B 1 37  ? 8.844   6.284   -58.357 1.00 44.07  ? 37   PHE B CD1 1 
ATOM   4437 C CD2 . PHE B 1 37  ? 6.702   5.320   -57.947 1.00 49.33  ? 37   PHE B CD2 1 
ATOM   4438 C CE1 . PHE B 1 37  ? 9.363   5.581   -57.288 1.00 45.20  ? 37   PHE B CE1 1 
ATOM   4439 C CE2 . PHE B 1 37  ? 7.219   4.615   -56.866 1.00 43.42  ? 37   PHE B CE2 1 
ATOM   4440 C CZ  . PHE B 1 37  ? 8.548   4.745   -56.540 1.00 39.73  ? 37   PHE B CZ  1 
ATOM   4441 N N   . ALA B 1 38  ? 9.008   4.840   -61.818 1.00 49.55  ? 38   ALA B N   1 
ATOM   4442 C CA  . ALA B 1 38  ? 10.392  4.588   -62.175 1.00 53.08  ? 38   ALA B CA  1 
ATOM   4443 C C   . ALA B 1 38  ? 10.492  3.359   -63.061 1.00 55.35  ? 38   ALA B C   1 
ATOM   4444 O O   . ALA B 1 38  ? 9.651   2.460   -62.976 1.00 48.39  ? 38   ALA B O   1 
ATOM   4445 C CB  . ALA B 1 38  ? 11.233  4.400   -60.912 1.00 48.41  ? 38   ALA B CB  1 
ATOM   4446 N N   . GLU B 1 39  ? 11.514  3.337   -63.913 1.00 50.63  ? 39   GLU B N   1 
ATOM   4447 C CA  . GLU B 1 39  ? 11.904  2.129   -64.622 1.00 51.01  ? 39   GLU B CA  1 
ATOM   4448 C C   . GLU B 1 39  ? 12.137  1.031   -63.603 1.00 55.83  ? 39   GLU B C   1 
ATOM   4449 O O   . GLU B 1 39  ? 12.859  1.244   -62.632 1.00 61.48  ? 39   GLU B O   1 
ATOM   4450 C CB  . GLU B 1 39  ? 13.201  2.366   -65.388 1.00 48.63  ? 39   GLU B CB  1 
ATOM   4451 C CG  . GLU B 1 39  ? 13.048  3.327   -66.527 1.00 61.04  ? 39   GLU B CG  1 
ATOM   4452 C CD  . GLU B 1 39  ? 12.074  2.811   -67.565 1.00 61.54  ? 39   GLU B CD  1 
ATOM   4453 O OE1 . GLU B 1 39  ? 12.478  1.970   -68.398 1.00 60.19  ? 39   GLU B OE1 1 
ATOM   4454 O OE2 . GLU B 1 39  ? 10.899  3.240   -67.536 1.00 64.21  ? 39   GLU B OE2 1 
ATOM   4455 N N   . PRO B 1 40  ? 11.530  -0.148  -63.816 1.00 59.08  ? 40   PRO B N   1 
ATOM   4456 C CA  . PRO B 1 40  ? 11.719  -1.300  -62.920 1.00 58.92  ? 40   PRO B CA  1 
ATOM   4457 C C   . PRO B 1 40  ? 13.193  -1.557  -62.580 1.00 56.45  ? 40   PRO B C   1 
ATOM   4458 O O   . PRO B 1 40  ? 14.017  -1.689  -63.481 1.00 58.45  ? 40   PRO B O   1 
ATOM   4459 C CB  . PRO B 1 40  ? 11.148  -2.462  -63.732 1.00 55.86  ? 40   PRO B CB  1 
ATOM   4460 C CG  . PRO B 1 40  ? 10.096  -1.824  -64.579 1.00 59.06  ? 40   PRO B CG  1 
ATOM   4461 C CD  . PRO B 1 40  ? 10.602  -0.450  -64.921 1.00 51.58  ? 40   PRO B CD  1 
ATOM   4462 N N   . PRO B 1 41  ? 13.512  -1.646  -61.282 1.00 57.42  ? 41   PRO B N   1 
ATOM   4463 C CA  . PRO B 1 41  ? 14.886  -1.734  -60.786 1.00 58.96  ? 41   PRO B CA  1 
ATOM   4464 C C   . PRO B 1 41  ? 15.381  -3.166  -60.833 1.00 59.72  ? 41   PRO B C   1 
ATOM   4465 O O   . PRO B 1 41  ? 15.815  -3.678  -59.802 1.00 63.40  ? 41   PRO B O   1 
ATOM   4466 C CB  . PRO B 1 41  ? 14.743  -1.345  -59.318 1.00 51.23  ? 41   PRO B CB  1 
ATOM   4467 C CG  . PRO B 1 41  ? 13.254  -1.442  -59.007 1.00 50.89  ? 41   PRO B CG  1 
ATOM   4468 C CD  . PRO B 1 41  ? 12.542  -1.919  -60.211 1.00 54.53  ? 41   PRO B CD  1 
ATOM   4469 N N   . VAL B 1 42  ? 15.307  -3.798  -61.998 1.00 58.95  ? 42   VAL B N   1 
ATOM   4470 C CA  . VAL B 1 42  ? 15.590  -5.221  -62.115 1.00 60.08  ? 42   VAL B CA  1 
ATOM   4471 C C   . VAL B 1 42  ? 16.828  -5.523  -62.939 1.00 60.94  ? 42   VAL B C   1 
ATOM   4472 O O   . VAL B 1 42  ? 17.308  -4.687  -63.712 1.00 50.06  ? 42   VAL B O   1 
ATOM   4473 C CB  . VAL B 1 42  ? 14.402  -5.973  -62.723 1.00 54.97  ? 42   VAL B CB  1 
ATOM   4474 C CG1 . VAL B 1 42  ? 13.180  -5.842  -61.807 1.00 57.54  ? 42   VAL B CG1 1 
ATOM   4475 C CG2 . VAL B 1 42  ? 14.102  -5.438  -64.103 1.00 46.51  ? 42   VAL B CG2 1 
ATOM   4476 N N   . GLY B 1 43  ? 17.338  -6.738  -62.758 1.00 63.03  ? 43   GLY B N   1 
ATOM   4477 C CA  . GLY B 1 43  ? 18.531  -7.183  -63.452 1.00 55.45  ? 43   GLY B CA  1 
ATOM   4478 C C   . GLY B 1 43  ? 19.762  -6.405  -63.032 1.00 62.72  ? 43   GLY B C   1 
ATOM   4479 O O   . GLY B 1 43  ? 20.271  -6.568  -61.913 1.00 64.66  ? 43   GLY B O   1 
ATOM   4480 N N   . SER B 1 44  ? 20.234  -5.551  -63.933 1.00 55.50  ? 44   SER B N   1 
ATOM   4481 C CA  . SER B 1 44  ? 21.455  -4.792  -63.710 1.00 64.71  ? 44   SER B CA  1 
ATOM   4482 C C   . SER B 1 44  ? 21.135  -3.466  -63.039 1.00 67.46  ? 44   SER B C   1 
ATOM   4483 O O   . SER B 1 44  ? 22.027  -2.684  -62.698 1.00 66.82  ? 44   SER B O   1 
ATOM   4484 C CB  . SER B 1 44  ? 22.143  -4.515  -65.035 1.00 58.46  ? 44   SER B CB  1 
ATOM   4485 O OG  . SER B 1 44  ? 21.638  -3.312  -65.592 1.00 66.57  ? 44   SER B OG  1 
ATOM   4486 N N   . ARG B 1 45  ? 19.847  -3.202  -62.883 1.00 64.16  ? 45   ARG B N   1 
ATOM   4487 C CA  . ARG B 1 45  ? 19.415  -2.010  -62.186 1.00 61.63  ? 45   ARG B CA  1 
ATOM   4488 C C   . ARG B 1 45  ? 19.326  -2.299  -60.691 1.00 56.66  ? 45   ARG B C   1 
ATOM   4489 O O   . ARG B 1 45  ? 19.204  -1.392  -59.892 1.00 61.25  ? 45   ARG B O   1 
ATOM   4490 C CB  . ARG B 1 45  ? 18.071  -1.542  -62.735 1.00 63.22  ? 45   ARG B CB  1 
ATOM   4491 C CG  . ARG B 1 45  ? 18.174  -0.718  -64.011 1.00 65.87  ? 45   ARG B CG  1 
ATOM   4492 C CD  . ARG B 1 45  ? 18.587  0.722   -63.693 1.00 86.15  ? 45   ARG B CD  1 
ATOM   4493 N NE  . ARG B 1 45  ? 20.009  1.005   -63.917 1.00 88.28  ? 45   ARG B NE  1 
ATOM   4494 C CZ  . ARG B 1 45  ? 20.606  2.162   -63.612 1.00 97.17  ? 45   ARG B CZ  1 
ATOM   4495 N NH1 . ARG B 1 45  ? 19.918  3.155   -63.047 1.00 85.19  ? 45   ARG B NH1 1 
ATOM   4496 N NH2 . ARG B 1 45  ? 21.900  2.329   -63.864 1.00 91.55  ? 45   ARG B NH2 1 
ATOM   4497 N N   . ARG B 1 46  ? 19.397  -3.570  -60.318 1.00 53.95  ? 46   ARG B N   1 
ATOM   4498 C CA  . ARG B 1 46  ? 19.400  -3.945  -58.909 1.00 57.79  ? 46   ARG B CA  1 
ATOM   4499 C C   . ARG B 1 46  ? 20.562  -3.289  -58.154 1.00 59.94  ? 46   ARG B C   1 
ATOM   4500 O O   . ARG B 1 46  ? 21.700  -3.301  -58.631 1.00 52.92  ? 46   ARG B O   1 
ATOM   4501 C CB  . ARG B 1 46  ? 19.467  -5.460  -58.769 1.00 56.42  ? 46   ARG B CB  1 
ATOM   4502 C CG  . ARG B 1 46  ? 19.745  -5.929  -57.367 1.00 51.77  ? 46   ARG B CG  1 
ATOM   4503 C CD  . ARG B 1 46  ? 20.112  -7.402  -57.365 1.00 61.28  ? 46   ARG B CD  1 
ATOM   4504 N NE  . ARG B 1 46  ? 18.957  -8.300  -57.345 1.00 55.31  ? 46   ARG B NE  1 
ATOM   4505 C CZ  . ARG B 1 46  ? 19.061  -9.628  -57.355 1.00 57.58  ? 46   ARG B CZ  1 
ATOM   4506 N NH1 . ARG B 1 46  ? 20.256  -10.195 -57.398 1.00 59.66  ? 46   ARG B NH1 1 
ATOM   4507 N NH2 . ARG B 1 46  ? 17.981  -10.394 -57.319 1.00 51.07  ? 46   ARG B NH2 1 
ATOM   4508 N N   . PHE B 1 47  ? 20.261  -2.716  -56.984 1.00 52.91  ? 47   PHE B N   1 
ATOM   4509 C CA  . PHE B 1 47  ? 21.231  -1.952  -56.184 1.00 52.26  ? 47   PHE B CA  1 
ATOM   4510 C C   . PHE B 1 47  ? 21.509  -0.561  -56.746 1.00 52.43  ? 47   PHE B C   1 
ATOM   4511 O O   . PHE B 1 47  ? 22.305  0.192   -56.189 1.00 59.73  ? 47   PHE B O   1 
ATOM   4512 C CB  . PHE B 1 47  ? 22.574  -2.693  -56.030 1.00 52.04  ? 47   PHE B CB  1 
ATOM   4513 C CG  . PHE B 1 47  ? 22.442  -4.085  -55.503 1.00 49.06  ? 47   PHE B CG  1 
ATOM   4514 C CD1 . PHE B 1 47  ? 21.655  -4.348  -54.390 1.00 49.27  ? 47   PHE B CD1 1 
ATOM   4515 C CD2 . PHE B 1 47  ? 23.111  -5.136  -56.116 1.00 56.05  ? 47   PHE B CD2 1 
ATOM   4516 C CE1 . PHE B 1 47  ? 21.522  -5.642  -53.899 1.00 52.30  ? 47   PHE B CE1 1 
ATOM   4517 C CE2 . PHE B 1 47  ? 22.991  -6.436  -55.635 1.00 56.70  ? 47   PHE B CE2 1 
ATOM   4518 C CZ  . PHE B 1 47  ? 22.192  -6.690  -54.525 1.00 58.25  ? 47   PHE B CZ  1 
ATOM   4519 N N   . MET B 1 48  ? 20.877  -0.226  -57.862 1.00 55.63  ? 48   MET B N   1 
ATOM   4520 C CA  . MET B 1 48  ? 21.155  1.038   -58.527 1.00 51.17  ? 48   MET B CA  1 
ATOM   4521 C C   . MET B 1 48  ? 20.125  2.101   -58.185 1.00 51.02  ? 48   MET B C   1 
ATOM   4522 O O   . MET B 1 48  ? 18.969  1.791   -57.889 1.00 50.83  ? 48   MET B O   1 
ATOM   4523 C CB  . MET B 1 48  ? 21.205  0.827   -60.042 1.00 62.95  ? 48   MET B CB  1 
ATOM   4524 C CG  . MET B 1 48  ? 22.417  0.037   -60.539 1.00 70.27  ? 48   MET B CG  1 
ATOM   4525 S SD  . MET B 1 48  ? 23.911  1.058   -60.675 1.00 77.14  ? 48   MET B SD  1 
ATOM   4526 C CE  . MET B 1 48  ? 24.237  1.394   -58.956 1.00 66.99  ? 48   MET B CE  1 
ATOM   4527 N N   . PRO B 1 49  ? 20.544  3.366   -58.218 1.00 51.48  ? 49   PRO B N   1 
ATOM   4528 C CA  . PRO B 1 49  ? 19.603  4.493   -58.127 1.00 54.99  ? 49   PRO B CA  1 
ATOM   4529 C C   . PRO B 1 49  ? 18.541  4.376   -59.220 1.00 53.58  ? 49   PRO B C   1 
ATOM   4530 O O   . PRO B 1 49  ? 18.868  3.985   -60.343 1.00 58.14  ? 49   PRO B O   1 
ATOM   4531 C CB  . PRO B 1 49  ? 20.486  5.719   -58.396 1.00 41.12  ? 49   PRO B CB  1 
ATOM   4532 C CG  . PRO B 1 49  ? 21.862  5.272   -58.066 1.00 50.42  ? 49   PRO B CG  1 
ATOM   4533 C CD  . PRO B 1 49  ? 21.939  3.801   -58.362 1.00 42.57  ? 49   PRO B CD  1 
ATOM   4534 N N   . PRO B 1 50  ? 17.288  4.736   -58.905 1.00 56.18  ? 50   PRO B N   1 
ATOM   4535 C CA  . PRO B 1 50  ? 16.150  4.594   -59.828 1.00 49.77  ? 50   PRO B CA  1 
ATOM   4536 C C   . PRO B 1 50  ? 16.232  5.557   -61.014 1.00 49.01  ? 50   PRO B C   1 
ATOM   4537 O O   . PRO B 1 50  ? 16.787  6.638   -60.847 1.00 51.19  ? 50   PRO B O   1 
ATOM   4538 C CB  . PRO B 1 50  ? 14.941  4.985   -58.968 1.00 46.07  ? 50   PRO B CB  1 
ATOM   4539 C CG  . PRO B 1 50  ? 15.475  5.325   -57.599 1.00 50.00  ? 50   PRO B CG  1 
ATOM   4540 C CD  . PRO B 1 50  ? 16.941  5.521   -57.711 1.00 49.52  ? 50   PRO B CD  1 
ATOM   4541 N N   . GLU B 1 51  ? 15.695  5.177   -62.174 1.00 55.10  ? 51   GLU B N   1 
ATOM   4542 C CA  . GLU B 1 51  ? 15.512  6.118   -63.278 1.00 52.30  ? 51   GLU B CA  1 
ATOM   4543 C C   . GLU B 1 51  ? 14.021  6.395   -63.472 1.00 49.36  ? 51   GLU B C   1 
ATOM   4544 O O   . GLU B 1 51  ? 13.192  5.527   -63.222 1.00 48.96  ? 51   GLU B O   1 
ATOM   4545 C CB  . GLU B 1 51  ? 16.070  5.554   -64.574 1.00 62.23  ? 51   GLU B CB  1 
ATOM   4546 C CG  . GLU B 1 51  ? 17.192  4.549   -64.422 1.00 79.16  ? 51   GLU B CG  1 
ATOM   4547 C CD  . GLU B 1 51  ? 17.459  3.803   -65.731 1.00 98.62  ? 51   GLU B CD  1 
ATOM   4548 O OE1 . GLU B 1 51  ? 17.524  2.549   -65.716 1.00 99.51  ? 51   GLU B OE1 1 
ATOM   4549 O OE2 . GLU B 1 51  ? 17.579  4.476   -66.783 1.00 99.85  ? 51   GLU B OE2 1 
ATOM   4550 N N   . PRO B 1 52  ? 13.674  7.608   -63.922 1.00 53.43  ? 52   PRO B N   1 
ATOM   4551 C CA  . PRO B 1 52  ? 12.257  7.931   -64.161 1.00 55.40  ? 52   PRO B CA  1 
ATOM   4552 C C   . PRO B 1 52  ? 11.603  7.003   -65.190 1.00 52.12  ? 52   PRO B C   1 
ATOM   4553 O O   . PRO B 1 52  ? 12.218  6.687   -66.204 1.00 55.49  ? 52   PRO B O   1 
ATOM   4554 C CB  . PRO B 1 52  ? 12.303  9.383   -64.688 1.00 49.96  ? 52   PRO B CB  1 
ATOM   4555 C CG  . PRO B 1 52  ? 13.762  9.625   -65.055 1.00 50.70  ? 52   PRO B CG  1 
ATOM   4556 C CD  . PRO B 1 52  ? 14.540  8.791   -64.073 1.00 50.81  ? 52   PRO B CD  1 
ATOM   4557 N N   . LYS B 1 53  ? 10.375  6.570   -64.912 1.00 54.04  ? 53   LYS B N   1 
ATOM   4558 C CA  . LYS B 1 53  ? 9.610   5.710   -65.815 1.00 55.01  ? 53   LYS B CA  1 
ATOM   4559 C C   . LYS B 1 53  ? 9.514   6.330   -67.201 1.00 57.86  ? 53   LYS B C   1 
ATOM   4560 O O   . LYS B 1 53  ? 9.307   7.536   -67.342 1.00 56.28  ? 53   LYS B O   1 
ATOM   4561 C CB  . LYS B 1 53  ? 8.198   5.450   -65.256 1.00 52.96  ? 53   LYS B CB  1 
ATOM   4562 C CG  . LYS B 1 53  ? 7.265   4.651   -66.167 1.00 48.15  ? 53   LYS B CG  1 
ATOM   4563 C CD  . LYS B 1 53  ? 7.674   3.186   -66.222 1.00 56.39  ? 53   LYS B CD  1 
ATOM   4564 C CE  . LYS B 1 53  ? 6.721   2.348   -67.084 1.00 51.42  ? 53   LYS B CE  1 
ATOM   4565 N NZ  . LYS B 1 53  ? 6.747   2.750   -68.530 1.00 54.20  ? 53   LYS B NZ  1 
ATOM   4566 N N   . ARG B 1 54  ? 9.668   5.501   -68.227 1.00 58.35  ? 54   ARG B N   1 
ATOM   4567 C CA  . ARG B 1 54  ? 9.484   5.968   -69.592 1.00 59.57  ? 54   ARG B CA  1 
ATOM   4568 C C   . ARG B 1 54  ? 7.996   6.126   -69.920 1.00 58.18  ? 54   ARG B C   1 
ATOM   4569 O O   . ARG B 1 54  ? 7.141   5.405   -69.383 1.00 46.94  ? 54   ARG B O   1 
ATOM   4570 C CB  . ARG B 1 54  ? 10.146  5.010   -70.580 1.00 55.68  ? 54   ARG B CB  1 
ATOM   4571 C CG  . ARG B 1 54  ? 11.661  4.969   -70.467 1.00 60.34  ? 54   ARG B CG  1 
ATOM   4572 C CD  . ARG B 1 54  ? 12.243  3.855   -71.325 1.00 49.40  ? 54   ARG B CD  1 
ATOM   4573 N NE  . ARG B 1 54  ? 11.619  2.570   -71.006 1.00 58.61  ? 54   ARG B NE  1 
ATOM   4574 C CZ  . ARG B 1 54  ? 10.866  1.859   -71.841 1.00 58.73  ? 54   ARG B CZ  1 
ATOM   4575 N NH1 . ARG B 1 54  ? 10.344  0.705   -71.443 1.00 53.47  ? 54   ARG B NH1 1 
ATOM   4576 N NH2 . ARG B 1 54  ? 10.643  2.288   -73.078 1.00 56.46  ? 54   ARG B NH2 1 
ATOM   4577 N N   . PRO B 1 55  ? 7.689   7.089   -70.797 1.00 55.99  ? 55   PRO B N   1 
ATOM   4578 C CA  . PRO B 1 55  ? 6.365   7.305   -71.385 1.00 55.22  ? 55   PRO B CA  1 
ATOM   4579 C C   . PRO B 1 55  ? 5.740   5.997   -71.847 1.00 60.30  ? 55   PRO B C   1 
ATOM   4580 O O   . PRO B 1 55  ? 6.452   5.042   -72.173 1.00 58.58  ? 55   PRO B O   1 
ATOM   4581 C CB  . PRO B 1 55  ? 6.675   8.168   -72.600 1.00 54.79  ? 55   PRO B CB  1 
ATOM   4582 C CG  . PRO B 1 55  ? 7.864   8.969   -72.170 1.00 64.11  ? 55   PRO B CG  1 
ATOM   4583 C CD  . PRO B 1 55  ? 8.679   8.068   -71.278 1.00 53.37  ? 55   PRO B CD  1 
ATOM   4584 N N   . TRP B 1 56  ? 4.413   5.956   -71.877 1.00 56.87  ? 56   TRP B N   1 
ATOM   4585 C CA  . TRP B 1 56  ? 3.700   4.764   -72.303 1.00 54.39  ? 56   TRP B CA  1 
ATOM   4586 C C   . TRP B 1 56  ? 2.524   5.136   -73.192 1.00 62.29  ? 56   TRP B C   1 
ATOM   4587 O O   . TRP B 1 56  ? 1.916   6.203   -73.034 1.00 56.68  ? 56   TRP B O   1 
ATOM   4588 C CB  . TRP B 1 56  ? 3.206   3.973   -71.100 1.00 47.73  ? 56   TRP B CB  1 
ATOM   4589 C CG  . TRP B 1 56  ? 2.229   4.720   -70.286 1.00 60.04  ? 56   TRP B CG  1 
ATOM   4590 C CD1 . TRP B 1 56  ? 0.899   4.859   -70.529 1.00 60.26  ? 56   TRP B CD1 1 
ATOM   4591 C CD2 . TRP B 1 56  ? 2.497   5.448   -69.081 1.00 64.07  ? 56   TRP B CD2 1 
ATOM   4592 N NE1 . TRP B 1 56  ? 0.316   5.628   -69.551 1.00 61.21  ? 56   TRP B NE1 1 
ATOM   4593 C CE2 . TRP B 1 56  ? 1.277   5.999   -68.646 1.00 64.33  ? 56   TRP B CE2 1 
ATOM   4594 C CE3 . TRP B 1 56  ? 3.650   5.681   -68.324 1.00 52.61  ? 56   TRP B CE3 1 
ATOM   4595 C CZ2 . TRP B 1 56  ? 1.175   6.768   -67.485 1.00 64.47  ? 56   TRP B CZ2 1 
ATOM   4596 C CZ3 . TRP B 1 56  ? 3.548   6.448   -67.182 1.00 58.22  ? 56   TRP B CZ3 1 
ATOM   4597 C CH2 . TRP B 1 56  ? 2.317   6.979   -66.769 1.00 58.62  ? 56   TRP B CH2 1 
ATOM   4598 N N   . SER B 1 57  ? 2.210   4.245   -74.125 1.00 54.69  ? 57   SER B N   1 
ATOM   4599 C CA  . SER B 1 57  ? 1.153   4.488   -75.093 1.00 63.10  ? 57   SER B CA  1 
ATOM   4600 C C   . SER B 1 57  ? -0.202  4.137   -74.496 1.00 59.11  ? 57   SER B C   1 
ATOM   4601 O O   . SER B 1 57  ? -0.296  3.290   -73.619 1.00 62.40  ? 57   SER B O   1 
ATOM   4602 C CB  . SER B 1 57  ? 1.400   3.638   -76.336 1.00 58.78  ? 57   SER B CB  1 
ATOM   4603 O OG  . SER B 1 57  ? 1.356   2.264   -75.995 1.00 63.56  ? 57   SER B OG  1 
ATOM   4604 N N   . GLY B 1 58  ? -1.252  4.790   -74.970 1.00 56.20  ? 58   GLY B N   1 
ATOM   4605 C CA  . GLY B 1 58  ? -2.598  4.425   -74.575 1.00 57.27  ? 58   GLY B CA  1 
ATOM   4606 C C   . GLY B 1 58  ? -2.979  4.769   -73.147 1.00 65.51  ? 58   GLY B C   1 
ATOM   4607 O O   . GLY B 1 58  ? -2.468  5.729   -72.559 1.00 60.75  ? 58   GLY B O   1 
ATOM   4608 N N   . VAL B 1 59  ? -3.896  3.982   -72.591 1.00 63.41  ? 59   VAL B N   1 
ATOM   4609 C CA  . VAL B 1 59  ? -4.395  4.224   -71.245 1.00 56.43  ? 59   VAL B CA  1 
ATOM   4610 C C   . VAL B 1 59  ? -3.918  3.148   -70.300 1.00 59.47  ? 59   VAL B C   1 
ATOM   4611 O O   . VAL B 1 59  ? -4.344  1.996   -70.392 1.00 59.48  ? 59   VAL B O   1 
ATOM   4612 C CB  . VAL B 1 59  ? -5.926  4.263   -71.204 1.00 62.97  ? 59   VAL B CB  1 
ATOM   4613 C CG1 . VAL B 1 59  ? -6.433  4.371   -69.753 1.00 56.34  ? 59   VAL B CG1 1 
ATOM   4614 C CG2 . VAL B 1 59  ? -6.429  5.422   -72.042 1.00 63.54  ? 59   VAL B CG2 1 
ATOM   4615 N N   . LEU B 1 60  ? -3.025  3.532   -69.395 1.00 60.04  ? 60   LEU B N   1 
ATOM   4616 C CA  . LEU B 1 60  ? -2.515  2.624   -68.381 1.00 54.10  ? 60   LEU B CA  1 
ATOM   4617 C C   . LEU B 1 60  ? -3.587  2.370   -67.344 1.00 52.39  ? 60   LEU B C   1 
ATOM   4618 O O   . LEU B 1 60  ? -4.099  3.296   -66.716 1.00 58.06  ? 60   LEU B O   1 
ATOM   4619 C CB  . LEU B 1 60  ? -1.291  3.224   -67.706 1.00 61.65  ? 60   LEU B CB  1 
ATOM   4620 C CG  . LEU B 1 60  ? -0.505  2.318   -66.766 1.00 63.91  ? 60   LEU B CG  1 
ATOM   4621 C CD1 . LEU B 1 60  ? 0.311   1.306   -67.559 1.00 62.03  ? 60   LEU B CD1 1 
ATOM   4622 C CD2 . LEU B 1 60  ? 0.401   3.180   -65.930 1.00 68.20  ? 60   LEU B CD2 1 
ATOM   4623 N N   . ASP B 1 61  ? -3.934  1.107   -67.182 1.00 46.54  ? 61   ASP B N   1 
ATOM   4624 C CA  . ASP B 1 61  ? -4.930  0.718   -66.209 1.00 55.18  ? 61   ASP B CA  1 
ATOM   4625 C C   . ASP B 1 61  ? -4.356  0.868   -64.807 1.00 63.87  ? 61   ASP B C   1 
ATOM   4626 O O   . ASP B 1 61  ? -3.433  0.151   -64.428 1.00 61.92  ? 61   ASP B O   1 
ATOM   4627 C CB  . ASP B 1 61  ? -5.352  -0.727  -66.453 1.00 55.14  ? 61   ASP B CB  1 
ATOM   4628 C CG  . ASP B 1 61  ? -5.870  -1.394  -65.205 1.00 69.96  ? 61   ASP B CG  1 
ATOM   4629 O OD1 . ASP B 1 61  ? -5.395  -2.506  -64.886 1.00 80.44  ? 61   ASP B OD1 1 
ATOM   4630 O OD2 . ASP B 1 61  ? -6.738  -0.802  -64.532 1.00 74.72  ? 61   ASP B OD2 1 
ATOM   4631 N N   . ALA B 1 62  ? -4.910  1.803   -64.042 1.00 66.40  ? 62   ALA B N   1 
ATOM   4632 C CA  . ALA B 1 62  ? -4.400  2.124   -62.713 1.00 60.39  ? 62   ALA B CA  1 
ATOM   4633 C C   . ALA B 1 62  ? -5.447  1.844   -61.643 1.00 60.02  ? 62   ALA B C   1 
ATOM   4634 O O   . ALA B 1 62  ? -5.803  2.729   -60.866 1.00 56.23  ? 62   ALA B O   1 
ATOM   4635 C CB  . ALA B 1 62  ? -3.981  3.582   -62.660 1.00 59.69  ? 62   ALA B CB  1 
ATOM   4636 N N   . THR B 1 63  ? -5.931  0.609   -61.593 1.00 56.04  ? 63   THR B N   1 
ATOM   4637 C CA  . THR B 1 63  ? -7.079  0.313   -60.757 1.00 57.22  ? 63   THR B CA  1 
ATOM   4638 C C   . THR B 1 63  ? -6.811  -0.756  -59.717 1.00 55.77  ? 63   THR B C   1 
ATOM   4639 O O   . THR B 1 63  ? -7.703  -1.115  -58.940 1.00 52.04  ? 63   THR B O   1 
ATOM   4640 C CB  . THR B 1 63  ? -8.300  -0.120  -61.611 1.00 70.53  ? 63   THR B CB  1 
ATOM   4641 O OG1 . THR B 1 63  ? -8.045  -1.400  -62.213 1.00 61.06  ? 63   THR B OG1 1 
ATOM   4642 C CG2 . THR B 1 63  ? -8.595  0.926   -62.694 1.00 63.46  ? 63   THR B CG2 1 
ATOM   4643 N N   . THR B 1 64  ? -5.592  -1.274  -59.694 1.00 54.68  ? 64   THR B N   1 
ATOM   4644 C CA  . THR B 1 64  ? -5.258  -2.261  -58.677 1.00 60.70  ? 64   THR B CA  1 
ATOM   4645 C C   . THR B 1 64  ? -3.853  -2.065  -58.100 1.00 60.07  ? 64   THR B C   1 
ATOM   4646 O O   . THR B 1 64  ? -2.978  -1.476  -58.735 1.00 60.22  ? 64   THR B O   1 
ATOM   4647 C CB  . THR B 1 64  ? -5.443  -3.706  -59.195 1.00 61.05  ? 64   THR B CB  1 
ATOM   4648 O OG1 . THR B 1 64  ? -5.247  -4.624  -58.108 1.00 75.23  ? 64   THR B OG1 1 
ATOM   4649 C CG2 . THR B 1 64  ? -4.453  -4.008  -60.310 1.00 54.05  ? 64   THR B CG2 1 
ATOM   4650 N N   . PHE B 1 65  ? -3.652  -2.549  -56.882 1.00 59.68  ? 65   PHE B N   1 
ATOM   4651 C CA  . PHE B 1 65  ? -2.338  -2.478  -56.262 1.00 59.54  ? 65   PHE B CA  1 
ATOM   4652 C C   . PHE B 1 65  ? -1.349  -3.319  -57.036 1.00 56.20  ? 65   PHE B C   1 
ATOM   4653 O O   . PHE B 1 65  ? -1.673  -4.415  -57.505 1.00 60.89  ? 65   PHE B O   1 
ATOM   4654 C CB  . PHE B 1 65  ? -2.388  -2.940  -54.804 1.00 53.99  ? 65   PHE B CB  1 
ATOM   4655 C CG  . PHE B 1 65  ? -2.973  -1.928  -53.878 1.00 57.24  ? 65   PHE B CG  1 
ATOM   4656 C CD1 . PHE B 1 65  ? -2.411  -0.656  -53.777 1.00 52.01  ? 65   PHE B CD1 1 
ATOM   4657 C CD2 . PHE B 1 65  ? -4.089  -2.236  -53.104 1.00 51.99  ? 65   PHE B CD2 1 
ATOM   4658 C CE1 . PHE B 1 65  ? -2.953  0.296   -52.920 1.00 51.24  ? 65   PHE B CE1 1 
ATOM   4659 C CE2 . PHE B 1 65  ? -4.636  -1.294  -52.244 1.00 50.48  ? 65   PHE B CE2 1 
ATOM   4660 C CZ  . PHE B 1 65  ? -4.065  -0.025  -52.150 1.00 55.32  ? 65   PHE B CZ  1 
ATOM   4661 N N   . GLN B 1 66  ? -0.137  -2.799  -57.154 1.00 54.66  ? 66   GLN B N   1 
ATOM   4662 C CA  . GLN B 1 66  ? 0.943   -3.507  -57.831 1.00 54.09  ? 66   GLN B CA  1 
ATOM   4663 C C   . GLN B 1 66  ? 1.698   -4.429  -56.881 1.00 54.21  ? 66   GLN B C   1 
ATOM   4664 O O   . GLN B 1 66  ? 1.302   -4.606  -55.724 1.00 56.94  ? 66   GLN B O   1 
ATOM   4665 C CB  . GLN B 1 66  ? 1.906   -2.496  -58.428 1.00 50.43  ? 66   GLN B CB  1 
ATOM   4666 C CG  . GLN B 1 66  ? 1.482   -1.984  -59.762 1.00 48.72  ? 66   GLN B CG  1 
ATOM   4667 C CD  . GLN B 1 66  ? 1.787   -2.976  -60.873 1.00 69.52  ? 66   GLN B CD  1 
ATOM   4668 O OE1 . GLN B 1 66  ? 2.223   -4.112  -60.623 1.00 67.56  ? 66   GLN B OE1 1 
ATOM   4669 N NE2 . GLN B 1 66  ? 1.567   -2.548  -62.112 1.00 66.89  ? 66   GLN B NE2 1 
ATOM   4670 N N   . ASN B 1 67  ? 2.797   -5.001  -57.364 1.00 52.25  ? 67   ASN B N   1 
ATOM   4671 C CA  . ASN B 1 67  ? 3.619   -5.894  -56.547 1.00 48.54  ? 67   ASN B CA  1 
ATOM   4672 C C   . ASN B 1 67  ? 4.301   -5.223  -55.356 1.00 49.79  ? 67   ASN B C   1 
ATOM   4673 O O   . ASN B 1 67  ? 4.759   -4.086  -55.440 1.00 61.14  ? 67   ASN B O   1 
ATOM   4674 C CB  . ASN B 1 67  ? 4.663   -6.606  -57.407 1.00 54.30  ? 67   ASN B CB  1 
ATOM   4675 C CG  . ASN B 1 67  ? 4.054   -7.686  -58.297 1.00 66.19  ? 67   ASN B CG  1 
ATOM   4676 O OD1 . ASN B 1 67  ? 2.930   -8.140  -58.063 1.00 61.36  ? 67   ASN B OD1 1 
ATOM   4677 N ND2 . ASN B 1 67  ? 4.798   -8.105  -59.316 1.00 53.56  ? 67   ASN B ND2 1 
ATOM   4678 N N   . VAL B 1 68  ? 4.348   -5.947  -54.245 1.00 49.88  ? 68   VAL B N   1 
ATOM   4679 C CA  . VAL B 1 68  ? 5.130   -5.580  -53.080 1.00 42.04  ? 68   VAL B CA  1 
ATOM   4680 C C   . VAL B 1 68  ? 6.616   -5.803  -53.348 1.00 53.92  ? 68   VAL B C   1 
ATOM   4681 O O   . VAL B 1 68  ? 7.014   -6.847  -53.890 1.00 47.50  ? 68   VAL B O   1 
ATOM   4682 C CB  . VAL B 1 68  ? 4.738   -6.449  -51.886 1.00 47.38  ? 68   VAL B CB  1 
ATOM   4683 C CG1 . VAL B 1 68  ? 5.716   -6.251  -50.750 1.00 43.64  ? 68   VAL B CG1 1 
ATOM   4684 C CG2 . VAL B 1 68  ? 3.319   -6.133  -51.451 1.00 45.64  ? 68   VAL B CG2 1 
ATOM   4685 N N   . CYS B 1 69  ? 7.433   -4.824  -52.971 1.00 51.05  ? 69   CYS B N   1 
ATOM   4686 C CA  . CYS B 1 69  ? 8.880   -4.938  -53.112 1.00 46.34  ? 69   CYS B CA  1 
ATOM   4687 C C   . CYS B 1 69  ? 9.416   -6.196  -52.436 1.00 49.65  ? 69   CYS B C   1 
ATOM   4688 O O   . CYS B 1 69  ? 8.996   -6.552  -51.330 1.00 48.26  ? 69   CYS B O   1 
ATOM   4689 C CB  . CYS B 1 69  ? 9.566   -3.708  -52.533 1.00 46.34  ? 69   CYS B CB  1 
ATOM   4690 S SG  . CYS B 1 69  ? 9.492   -2.293  -53.605 1.00 58.47  ? 69   CYS B SG  1 
ATOM   4691 N N   . TYR B 1 70  ? 10.346  -6.867  -53.107 1.00 50.52  ? 70   TYR B N   1 
ATOM   4692 C CA  . TYR B 1 70  ? 10.903  -8.107  -52.581 1.00 55.57  ? 70   TYR B CA  1 
ATOM   4693 C C   . TYR B 1 70  ? 11.517  -7.917  -51.205 1.00 51.75  ? 70   TYR B C   1 
ATOM   4694 O O   . TYR B 1 70  ? 12.405  -7.086  -51.011 1.00 58.58  ? 70   TYR B O   1 
ATOM   4695 C CB  . TYR B 1 70  ? 11.909  -8.762  -53.540 1.00 53.96  ? 70   TYR B CB  1 
ATOM   4696 C CG  . TYR B 1 70  ? 11.844  -10.266 -53.411 1.00 58.38  ? 70   TYR B CG  1 
ATOM   4697 C CD1 . TYR B 1 70  ? 11.004  -11.015 -54.225 1.00 57.18  ? 70   TYR B CD1 1 
ATOM   4698 C CD2 . TYR B 1 70  ? 12.569  -10.929 -52.428 1.00 59.07  ? 70   TYR B CD2 1 
ATOM   4699 C CE1 . TYR B 1 70  ? 10.917  -12.391 -54.084 1.00 58.47  ? 70   TYR B CE1 1 
ATOM   4700 C CE2 . TYR B 1 70  ? 12.491  -12.298 -52.281 1.00 59.14  ? 70   TYR B CE2 1 
ATOM   4701 C CZ  . TYR B 1 70  ? 11.658  -13.022 -53.109 1.00 63.31  ? 70   TYR B CZ  1 
ATOM   4702 O OH  . TYR B 1 70  ? 11.573  -14.380 -52.959 1.00 58.57  ? 70   TYR B OH  1 
ATOM   4703 N N   . GLN B 1 71  ? 11.028  -8.703  -50.256 1.00 51.04  ? 71   GLN B N   1 
ATOM   4704 C CA  . GLN B 1 71  ? 11.371  -8.511  -48.867 1.00 53.45  ? 71   GLN B CA  1 
ATOM   4705 C C   . GLN B 1 71  ? 11.153  -9.796  -48.099 1.00 59.12  ? 71   GLN B C   1 
ATOM   4706 O O   . GLN B 1 71  ? 10.392  -10.655 -48.523 1.00 54.48  ? 71   GLN B O   1 
ATOM   4707 C CB  . GLN B 1 71  ? 10.464  -7.446  -48.268 1.00 49.99  ? 71   GLN B CB  1 
ATOM   4708 C CG  . GLN B 1 71  ? 9.046   -7.913  -48.072 1.00 48.17  ? 71   GLN B CG  1 
ATOM   4709 C CD  . GLN B 1 71  ? 8.103   -6.767  -47.799 1.00 58.06  ? 71   GLN B CD  1 
ATOM   4710 O OE1 . GLN B 1 71  ? 7.447   -6.723  -46.755 1.00 59.05  ? 71   GLN B OE1 1 
ATOM   4711 N NE2 . GLN B 1 71  ? 8.040   -5.816  -48.732 1.00 51.36  ? 71   GLN B NE2 1 
ATOM   4712 N N   . TYR B 1 72  ? 11.817  -9.905  -46.953 1.00 64.30  ? 72   TYR B N   1 
ATOM   4713 C CA  . TYR B 1 72  ? 11.576  -10.981 -46.003 1.00 50.20  ? 72   TYR B CA  1 
ATOM   4714 C C   . TYR B 1 72  ? 10.100  -11.080 -45.609 1.00 56.59  ? 72   TYR B C   1 
ATOM   4715 O O   . TYR B 1 72  ? 9.393   -10.068 -45.519 1.00 62.90  ? 72   TYR B O   1 
ATOM   4716 C CB  . TYR B 1 72  ? 12.431  -10.726 -44.769 1.00 54.32  ? 72   TYR B CB  1 
ATOM   4717 C CG  . TYR B 1 72  ? 12.208  -11.687 -43.632 1.00 62.49  ? 72   TYR B CG  1 
ATOM   4718 C CD1 . TYR B 1 72  ? 11.437  -11.322 -42.528 1.00 58.84  ? 72   TYR B CD1 1 
ATOM   4719 C CD2 . TYR B 1 72  ? 12.784  -12.953 -43.647 1.00 57.44  ? 72   TYR B CD2 1 
ATOM   4720 C CE1 . TYR B 1 72  ? 11.238  -12.199 -41.476 1.00 67.26  ? 72   TYR B CE1 1 
ATOM   4721 C CE2 . TYR B 1 72  ? 12.595  -13.837 -42.601 1.00 60.37  ? 72   TYR B CE2 1 
ATOM   4722 C CZ  . TYR B 1 72  ? 11.823  -13.456 -41.516 1.00 73.07  ? 72   TYR B CZ  1 
ATOM   4723 O OH  . TYR B 1 72  ? 11.635  -14.334 -40.473 1.00 75.51  ? 72   TYR B OH  1 
ATOM   4724 N N   . VAL B 1 73  ? 9.632   -12.299 -45.367 1.00 56.76  ? 73   VAL B N   1 
ATOM   4725 C CA  . VAL B 1 73  ? 8.251   -12.508 -44.934 1.00 61.96  ? 73   VAL B CA  1 
ATOM   4726 C C   . VAL B 1 73  ? 8.188   -13.186 -43.567 1.00 66.00  ? 73   VAL B C   1 
ATOM   4727 O O   . VAL B 1 73  ? 8.913   -14.154 -43.305 1.00 65.89  ? 73   VAL B O   1 
ATOM   4728 C CB  . VAL B 1 73  ? 7.445   -13.325 -45.956 1.00 66.74  ? 73   VAL B CB  1 
ATOM   4729 C CG1 . VAL B 1 73  ? 6.020   -13.541 -45.456 1.00 57.95  ? 73   VAL B CG1 1 
ATOM   4730 C CG2 . VAL B 1 73  ? 7.447   -12.618 -47.306 1.00 62.03  ? 73   VAL B CG2 1 
ATOM   4731 N N   . ASP B 1 74  ? 7.314   -12.671 -42.703 1.00 67.07  ? 74   ASP B N   1 
ATOM   4732 C CA  . ASP B 1 74  ? 7.314   -13.044 -41.291 1.00 65.88  ? 74   ASP B CA  1 
ATOM   4733 C C   . ASP B 1 74  ? 6.694   -14.408 -41.032 1.00 64.99  ? 74   ASP B C   1 
ATOM   4734 O O   . ASP B 1 74  ? 5.692   -14.776 -41.642 1.00 68.28  ? 74   ASP B O   1 
ATOM   4735 C CB  . ASP B 1 74  ? 6.602   -11.986 -40.444 1.00 61.43  ? 74   ASP B CB  1 
ATOM   4736 C CG  . ASP B 1 74  ? 6.957   -12.087 -38.971 1.00 66.55  ? 74   ASP B CG  1 
ATOM   4737 O OD1 . ASP B 1 74  ? 6.104   -12.551 -38.172 1.00 69.02  ? 74   ASP B OD1 1 
ATOM   4738 O OD2 . ASP B 1 74  ? 8.101   -11.718 -38.618 1.00 66.64  ? 74   ASP B OD2 1 
ATOM   4739 N N   . THR B 1 75  ? 7.282   -15.141 -40.095 1.00 60.81  ? 75   THR B N   1 
ATOM   4740 C CA  . THR B 1 75  ? 6.827   -16.488 -39.806 1.00 68.24  ? 75   THR B CA  1 
ATOM   4741 C C   . THR B 1 75  ? 6.588   -16.699 -38.321 1.00 70.14  ? 75   THR B C   1 
ATOM   4742 O O   . THR B 1 75  ? 6.179   -17.781 -37.911 1.00 68.96  ? 75   THR B O   1 
ATOM   4743 C CB  . THR B 1 75  ? 7.880   -17.509 -40.233 1.00 66.19  ? 75   THR B CB  1 
ATOM   4744 O OG1 . THR B 1 75  ? 9.034   -17.349 -39.404 1.00 67.36  ? 75   THR B OG1 1 
ATOM   4745 C CG2 . THR B 1 75  ? 8.273   -17.306 -41.690 1.00 59.08  ? 75   THR B CG2 1 
ATOM   4746 N N   . LEU B 1 76  ? 6.852   -15.678 -37.511 1.00 66.85  ? 76   LEU B N   1 
ATOM   4747 C CA  . LEU B 1 76  ? 6.815   -15.867 -36.066 1.00 66.56  ? 76   LEU B CA  1 
ATOM   4748 C C   . LEU B 1 76  ? 5.503   -16.476 -35.597 1.00 68.98  ? 76   LEU B C   1 
ATOM   4749 O O   . LEU B 1 76  ? 5.500   -17.373 -34.757 1.00 72.53  ? 76   LEU B O   1 
ATOM   4750 C CB  . LEU B 1 76  ? 7.078   -14.560 -35.309 1.00 71.27  ? 76   LEU B CB  1 
ATOM   4751 C CG  . LEU B 1 76  ? 7.120   -14.740 -33.780 1.00 68.58  ? 76   LEU B CG  1 
ATOM   4752 C CD1 . LEU B 1 76  ? 8.360   -15.522 -33.359 1.00 54.77  ? 76   LEU B CD1 1 
ATOM   4753 C CD2 . LEU B 1 76  ? 7.072   -13.407 -33.061 1.00 67.80  ? 76   LEU B CD2 1 
ATOM   4754 N N   . TYR B 1 77  ? 4.395   -15.983 -36.141 1.00 67.53  ? 77   TYR B N   1 
ATOM   4755 C CA  . TYR B 1 77  ? 3.070   -16.406 -35.711 1.00 64.61  ? 77   TYR B CA  1 
ATOM   4756 C C   . TYR B 1 77  ? 2.183   -16.629 -36.918 1.00 66.11  ? 77   TYR B C   1 
ATOM   4757 O O   . TYR B 1 77  ? 1.194   -15.916 -37.102 1.00 61.34  ? 77   TYR B O   1 
ATOM   4758 C CB  . TYR B 1 77  ? 2.435   -15.337 -34.830 1.00 69.78  ? 77   TYR B CB  1 
ATOM   4759 C CG  . TYR B 1 77  ? 3.022   -15.246 -33.444 1.00 76.33  ? 77   TYR B CG  1 
ATOM   4760 C CD1 . TYR B 1 77  ? 3.015   -16.344 -32.594 1.00 72.33  ? 77   TYR B CD1 1 
ATOM   4761 C CD2 . TYR B 1 77  ? 3.564   -14.053 -32.973 1.00 77.19  ? 77   TYR B CD2 1 
ATOM   4762 C CE1 . TYR B 1 77  ? 3.547   -16.264 -31.313 1.00 79.25  ? 77   TYR B CE1 1 
ATOM   4763 C CE2 . TYR B 1 77  ? 4.095   -13.961 -31.692 1.00 74.82  ? 77   TYR B CE2 1 
ATOM   4764 C CZ  . TYR B 1 77  ? 4.087   -15.070 -30.867 1.00 78.70  ? 77   TYR B CZ  1 
ATOM   4765 O OH  . TYR B 1 77  ? 4.614   -14.988 -29.598 1.00 66.62  ? 77   TYR B OH  1 
ATOM   4766 N N   . PRO B 1 78  ? 2.519   -17.637 -37.734 1.00 71.34  ? 78   PRO B N   1 
ATOM   4767 C CA  . PRO B 1 78  ? 1.864   -17.821 -39.037 1.00 71.67  ? 78   PRO B CA  1 
ATOM   4768 C C   . PRO B 1 78  ? 0.352   -17.879 -38.874 1.00 58.94  ? 78   PRO B C   1 
ATOM   4769 O O   . PRO B 1 78  ? -0.128  -18.578 -37.992 1.00 64.27  ? 78   PRO B O   1 
ATOM   4770 C CB  . PRO B 1 78  ? 2.402   -19.173 -39.514 1.00 60.97  ? 78   PRO B CB  1 
ATOM   4771 C CG  . PRO B 1 78  ? 3.629   -19.436 -38.673 1.00 63.93  ? 78   PRO B CG  1 
ATOM   4772 C CD  . PRO B 1 78  ? 3.355   -18.791 -37.358 1.00 60.57  ? 78   PRO B CD  1 
ATOM   4773 N N   . GLY B 1 79  ? -0.385  -17.133 -39.686 1.00 59.01  ? 79   GLY B N   1 
ATOM   4774 C CA  . GLY B 1 79  ? -1.831  -17.101 -39.561 1.00 56.82  ? 79   GLY B CA  1 
ATOM   4775 C C   . GLY B 1 79  ? -2.379  -16.065 -38.589 1.00 68.33  ? 79   GLY B C   1 
ATOM   4776 O O   . GLY B 1 79  ? -3.531  -15.638 -38.716 1.00 69.43  ? 79   GLY B O   1 
ATOM   4777 N N   . PHE B 1 80  ? -1.561  -15.659 -37.619 1.00 66.58  ? 80   PHE B N   1 
ATOM   4778 C CA  . PHE B 1 80  ? -1.957  -14.664 -36.620 1.00 59.82  ? 80   PHE B CA  1 
ATOM   4779 C C   . PHE B 1 80  ? -2.183  -13.287 -37.264 1.00 58.20  ? 80   PHE B C   1 
ATOM   4780 O O   . PHE B 1 80  ? -1.300  -12.738 -37.924 1.00 58.00  ? 80   PHE B O   1 
ATOM   4781 C CB  . PHE B 1 80  ? -0.898  -14.606 -35.502 1.00 62.42  ? 80   PHE B CB  1 
ATOM   4782 C CG  . PHE B 1 80  ? -1.180  -13.582 -34.438 1.00 60.68  ? 80   PHE B CG  1 
ATOM   4783 C CD1 . PHE B 1 80  ? -2.440  -13.463 -33.885 1.00 56.24  ? 80   PHE B CD1 1 
ATOM   4784 C CD2 . PHE B 1 80  ? -0.175  -12.752 -33.981 1.00 67.06  ? 80   PHE B CD2 1 
ATOM   4785 C CE1 . PHE B 1 80  ? -2.705  -12.529 -32.907 1.00 62.08  ? 80   PHE B CE1 1 
ATOM   4786 C CE2 . PHE B 1 80  ? -0.427  -11.810 -32.995 1.00 65.08  ? 80   PHE B CE2 1 
ATOM   4787 C CZ  . PHE B 1 80  ? -1.698  -11.700 -32.457 1.00 68.36  ? 80   PHE B CZ  1 
ATOM   4788 N N   . GLU B 1 81  ? -3.375  -12.735 -37.091 1.00 55.89  ? 81   GLU B N   1 
ATOM   4789 C CA  . GLU B 1 81  ? -3.679  -11.440 -37.696 1.00 63.11  ? 81   GLU B CA  1 
ATOM   4790 C C   . GLU B 1 81  ? -2.703  -10.336 -37.276 1.00 66.69  ? 81   GLU B C   1 
ATOM   4791 O O   . GLU B 1 81  ? -2.304  -9.512  -38.099 1.00 63.53  ? 81   GLU B O   1 
ATOM   4792 C CB  . GLU B 1 81  ? -5.113  -11.001 -37.397 1.00 48.74  ? 81   GLU B CB  1 
ATOM   4793 C CG  . GLU B 1 81  ? -5.209  -9.509  -37.085 1.00 82.73  ? 81   GLU B CG  1 
ATOM   4794 C CD  . GLU B 1 81  ? -6.605  -8.937  -37.275 1.00 90.64  ? 81   GLU B CD  1 
ATOM   4795 O OE1 . GLU B 1 81  ? -7.052  -8.149  -36.402 1.00 90.75  ? 81   GLU B OE1 1 
ATOM   4796 O OE2 . GLU B 1 81  ? -7.247  -9.265  -38.301 1.00 93.40  ? 81   GLU B OE2 1 
ATOM   4797 N N   . GLY B 1 82  ? -2.328  -10.326 -35.999 1.00 61.98  ? 82   GLY B N   1 
ATOM   4798 C CA  . GLY B 1 82  ? -1.446  -9.306  -35.464 1.00 61.48  ? 82   GLY B CA  1 
ATOM   4799 C C   . GLY B 1 82  ? -0.120  -9.156  -36.189 1.00 58.39  ? 82   GLY B C   1 
ATOM   4800 O O   . GLY B 1 82  ? 0.515   -8.115  -36.100 1.00 58.97  ? 82   GLY B O   1 
ATOM   4801 N N   . THR B 1 83  ? 0.308   -10.193 -36.899 1.00 58.71  ? 83   THR B N   1 
ATOM   4802 C CA  . THR B 1 83  ? 1.551   -10.128 -37.656 1.00 56.21  ? 83   THR B CA  1 
ATOM   4803 C C   . THR B 1 83  ? 1.303   -10.142 -39.162 1.00 60.59  ? 83   THR B C   1 
ATOM   4804 O O   . THR B 1 83  ? 2.054   -9.545  -39.937 1.00 59.47  ? 83   THR B O   1 
ATOM   4805 C CB  . THR B 1 83  ? 2.487   -11.294 -37.297 1.00 63.06  ? 83   THR B CB  1 
ATOM   4806 O OG1 . THR B 1 83  ? 1.773   -12.534 -37.396 1.00 65.18  ? 83   THR B OG1 1 
ATOM   4807 C CG2 . THR B 1 83  ? 3.024   -11.136 -35.888 1.00 61.30  ? 83   THR B CG2 1 
ATOM   4808 N N   . GLU B 1 84  ? 0.248   -10.836 -39.573 1.00 61.64  ? 84   GLU B N   1 
ATOM   4809 C CA  . GLU B 1 84  ? -0.049  -10.999 -40.991 1.00 62.23  ? 84   GLU B CA  1 
ATOM   4810 C C   . GLU B 1 84  ? -0.476  -9.673  -41.581 1.00 60.00  ? 84   GLU B C   1 
ATOM   4811 O O   . GLU B 1 84  ? -0.277  -9.417  -42.770 1.00 59.31  ? 84   GLU B O   1 
ATOM   4812 C CB  . GLU B 1 84  ? -1.154  -12.042 -41.204 1.00 62.59  ? 84   GLU B CB  1 
ATOM   4813 C CG  . GLU B 1 84  ? -0.767  -13.482 -40.845 1.00 62.87  ? 84   GLU B CG  1 
ATOM   4814 C CD  . GLU B 1 84  ? 0.419   -13.990 -41.646 1.00 77.79  ? 84   GLU B CD  1 
ATOM   4815 O OE1 . GLU B 1 84  ? 0.705   -13.415 -42.731 1.00 70.45  ? 84   GLU B OE1 1 
ATOM   4816 O OE2 . GLU B 1 84  ? 1.064   -14.966 -41.186 1.00 79.84  ? 84   GLU B OE2 1 
ATOM   4817 N N   . MET B 1 85  ? -1.064  -8.827  -40.737 1.00 63.11  ? 85   MET B N   1 
ATOM   4818 C CA  . MET B 1 85  ? -1.530  -7.507  -41.157 1.00 58.34  ? 85   MET B CA  1 
ATOM   4819 C C   . MET B 1 85  ? -0.368  -6.654  -41.653 1.00 56.78  ? 85   MET B C   1 
ATOM   4820 O O   . MET B 1 85  ? -0.569  -5.667  -42.366 1.00 60.93  ? 85   MET B O   1 
ATOM   4821 C CB  . MET B 1 85  ? -2.241  -6.799  -40.004 1.00 56.18  ? 85   MET B CB  1 
ATOM   4822 C CG  . MET B 1 85  ? -1.330  -6.529  -38.813 1.00 62.82  ? 85   MET B CG  1 
ATOM   4823 S SD  . MET B 1 85  ? -2.181  -5.744  -37.440 1.00 67.18  ? 85   MET B SD  1 
ATOM   4824 C CE  . MET B 1 85  ? -2.651  -4.215  -38.220 1.00 49.33  ? 85   MET B CE  1 
ATOM   4825 N N   . TRP B 1 86  ? 0.846   -7.044  -41.274 1.00 52.32  ? 86   TRP B N   1 
ATOM   4826 C CA  . TRP B 1 86  ? 2.046   -6.346  -41.707 1.00 49.29  ? 86   TRP B CA  1 
ATOM   4827 C C   . TRP B 1 86  ? 2.709   -7.024  -42.899 1.00 56.91  ? 86   TRP B C   1 
ATOM   4828 O O   . TRP B 1 86  ? 3.544   -6.405  -43.565 1.00 53.98  ? 86   TRP B O   1 
ATOM   4829 C CB  . TRP B 1 86  ? 3.033   -6.198  -40.545 1.00 45.62  ? 86   TRP B CB  1 
ATOM   4830 C CG  . TRP B 1 86  ? 2.392   -5.548  -39.374 1.00 56.63  ? 86   TRP B CG  1 
ATOM   4831 C CD1 . TRP B 1 86  ? 2.103   -6.122  -38.176 1.00 51.52  ? 86   TRP B CD1 1 
ATOM   4832 C CD2 . TRP B 1 86  ? 1.895   -4.205  -39.308 1.00 50.30  ? 86   TRP B CD2 1 
ATOM   4833 N NE1 . TRP B 1 86  ? 1.469   -5.220  -37.364 1.00 49.98  ? 86   TRP B NE1 1 
ATOM   4834 C CE2 . TRP B 1 86  ? 1.333   -4.032  -38.033 1.00 53.85  ? 86   TRP B CE2 1 
ATOM   4835 C CE3 . TRP B 1 86  ? 1.890   -3.127  -40.200 1.00 52.68  ? 86   TRP B CE3 1 
ATOM   4836 C CZ2 . TRP B 1 86  ? 0.772   -2.814  -37.615 1.00 57.35  ? 86   TRP B CZ2 1 
ATOM   4837 C CZ3 . TRP B 1 86  ? 1.330   -1.915  -39.788 1.00 53.10  ? 86   TRP B CZ3 1 
ATOM   4838 C CH2 . TRP B 1 86  ? 0.775   -1.773  -38.510 1.00 50.01  ? 86   TRP B CH2 1 
ATOM   4839 N N   . ASN B 1 87  ? 2.341   -8.283  -43.162 1.00 53.47  ? 87   ASN B N   1 
ATOM   4840 C CA  . ASN B 1 87  ? 2.940   -9.066  -44.249 1.00 48.79  ? 87   ASN B CA  1 
ATOM   4841 C C   . ASN B 1 87  ? 2.491   -8.615  -45.646 1.00 53.45  ? 87   ASN B C   1 
ATOM   4842 O O   . ASN B 1 87  ? 1.453   -7.963  -45.794 1.00 48.83  ? 87   ASN B O   1 
ATOM   4843 C CB  . ASN B 1 87  ? 2.662   -10.560 -44.061 1.00 59.16  ? 87   ASN B CB  1 
ATOM   4844 C CG  . ASN B 1 87  ? 3.707   -11.249 -43.201 1.00 63.22  ? 87   ASN B CG  1 
ATOM   4845 O OD1 . ASN B 1 87  ? 4.905   -11.004 -43.342 1.00 60.30  ? 87   ASN B OD1 1 
ATOM   4846 N ND2 . ASN B 1 87  ? 3.256   -12.126 -42.312 1.00 61.02  ? 87   ASN B ND2 1 
ATOM   4847 N N   . PRO B 1 88  ? 3.282   -8.953  -46.681 1.00 55.44  ? 88   PRO B N   1 
ATOM   4848 C CA  . PRO B 1 88  ? 2.882   -8.563  -48.042 1.00 52.20  ? 88   PRO B CA  1 
ATOM   4849 C C   . PRO B 1 88  ? 1.511   -9.130  -48.391 1.00 56.86  ? 88   PRO B C   1 
ATOM   4850 O O   . PRO B 1 88  ? 1.263   -10.318 -48.183 1.00 61.98  ? 88   PRO B O   1 
ATOM   4851 C CB  . PRO B 1 88  ? 3.965   -9.190  -48.926 1.00 44.65  ? 88   PRO B CB  1 
ATOM   4852 C CG  . PRO B 1 88  ? 5.155   -9.349  -48.017 1.00 48.60  ? 88   PRO B CG  1 
ATOM   4853 C CD  . PRO B 1 88  ? 4.574   -9.666  -46.658 1.00 52.43  ? 88   PRO B CD  1 
ATOM   4854 N N   . ASN B 1 89  ? 0.622   -8.279  -48.888 1.00 55.19  ? 89   ASN B N   1 
ATOM   4855 C CA  . ASN B 1 89  ? -0.712  -8.708  -49.270 1.00 46.76  ? 89   ASN B CA  1 
ATOM   4856 C C   . ASN B 1 89  ? -0.860  -8.723  -50.794 1.00 55.57  ? 89   ASN B C   1 
ATOM   4857 O O   . ASN B 1 89  ? -1.973  -8.747  -51.319 1.00 59.94  ? 89   ASN B O   1 
ATOM   4858 C CB  . ASN B 1 89  ? -1.775  -7.826  -48.604 1.00 48.43  ? 89   ASN B CB  1 
ATOM   4859 C CG  . ASN B 1 89  ? -1.723  -6.375  -49.084 1.00 56.78  ? 89   ASN B CG  1 
ATOM   4860 O OD1 . ASN B 1 89  ? -0.739  -5.935  -49.699 1.00 50.32  ? 89   ASN B OD1 1 
ATOM   4861 N ND2 . ASN B 1 89  ? -2.788  -5.630  -48.813 1.00 49.04  ? 89   ASN B ND2 1 
ATOM   4862 N N   . ARG B 1 90  ? 0.278   -8.700  -51.487 1.00 48.85  ? 90   ARG B N   1 
ATOM   4863 C CA  . ARG B 1 90  ? 0.359   -8.891  -52.933 1.00 46.91  ? 90   ARG B CA  1 
ATOM   4864 C C   . ARG B 1 90  ? 1.580   -9.739  -53.248 1.00 54.58  ? 90   ARG B C   1 
ATOM   4865 O O   . ARG B 1 90  ? 2.302   -10.145 -52.345 1.00 61.93  ? 90   ARG B O   1 
ATOM   4866 C CB  . ARG B 1 90  ? 0.501   -7.558  -53.665 1.00 49.62  ? 90   ARG B CB  1 
ATOM   4867 C CG  . ARG B 1 90  ? -0.753  -6.740  -53.700 1.00 51.89  ? 90   ARG B CG  1 
ATOM   4868 C CD  . ARG B 1 90  ? -1.923  -7.566  -54.191 1.00 56.57  ? 90   ARG B CD  1 
ATOM   4869 N NE  . ARG B 1 90  ? -3.081  -6.723  -54.443 1.00 55.41  ? 90   ARG B NE  1 
ATOM   4870 C CZ  . ARG B 1 90  ? -3.967  -6.391  -53.512 1.00 60.54  ? 90   ARG B CZ  1 
ATOM   4871 N NH1 . ARG B 1 90  ? -3.824  -6.849  -52.273 1.00 52.13  ? 90   ARG B NH1 1 
ATOM   4872 N NH2 . ARG B 1 90  ? -4.992  -5.602  -53.819 1.00 57.99  ? 90   ARG B NH2 1 
ATOM   4873 N N   . GLU B 1 91  ? 1.815   -9.992  -54.531 1.00 59.34  ? 91   GLU B N   1 
ATOM   4874 C CA  . GLU B 1 91  ? 2.946   -10.808 -54.963 1.00 62.83  ? 91   GLU B CA  1 
ATOM   4875 C C   . GLU B 1 91  ? 4.242   -10.039 -54.801 1.00 57.15  ? 91   GLU B C   1 
ATOM   4876 O O   . GLU B 1 91  ? 4.302   -8.854  -55.132 1.00 53.78  ? 91   GLU B O   1 
ATOM   4877 C CB  . GLU B 1 91  ? 2.802   -11.212 -56.435 1.00 66.92  ? 91   GLU B CB  1 
ATOM   4878 C CG  . GLU B 1 91  ? 1.872   -12.391 -56.692 1.00 84.12  ? 91   GLU B CG  1 
ATOM   4879 C CD  . GLU B 1 91  ? 2.408   -13.695 -56.120 1.00 96.15  ? 91   GLU B CD  1 
ATOM   4880 O OE1 . GLU B 1 91  ? 3.648   -13.886 -56.117 1.00 92.00  ? 91   GLU B OE1 1 
ATOM   4881 O OE2 . GLU B 1 91  ? 1.588   -14.530 -55.674 1.00 108.06 ? 91   GLU B OE2 1 
ATOM   4882 N N   . LEU B 1 92  ? 5.277   -10.716 -54.312 1.00 42.72  ? 92   LEU B N   1 
ATOM   4883 C CA  . LEU B 1 92  ? 6.593   -10.102 -54.203 1.00 46.89  ? 92   LEU B CA  1 
ATOM   4884 C C   . LEU B 1 92  ? 7.246   -9.992  -55.567 1.00 52.82  ? 92   LEU B C   1 
ATOM   4885 O O   . LEU B 1 92  ? 7.157   -10.914 -56.359 1.00 58.63  ? 92   LEU B O   1 
ATOM   4886 C CB  . LEU B 1 92  ? 7.500   -10.907 -53.276 1.00 45.82  ? 92   LEU B CB  1 
ATOM   4887 C CG  . LEU B 1 92  ? 7.000   -11.139 -51.853 1.00 54.47  ? 92   LEU B CG  1 
ATOM   4888 C CD1 . LEU B 1 92  ? 8.087   -11.780 -51.021 1.00 46.35  ? 92   LEU B CD1 1 
ATOM   4889 C CD2 . LEU B 1 92  ? 6.537   -9.832  -51.234 1.00 53.68  ? 92   LEU B CD2 1 
ATOM   4890 N N   . SER B 1 93  ? 7.916   -8.872  -55.827 1.00 54.61  ? 93   SER B N   1 
ATOM   4891 C CA  . SER B 1 93  ? 8.673   -8.690  -57.060 1.00 50.13  ? 93   SER B CA  1 
ATOM   4892 C C   . SER B 1 93  ? 9.719   -7.581  -56.881 1.00 52.37  ? 93   SER B C   1 
ATOM   4893 O O   . SER B 1 93  ? 9.526   -6.675  -56.087 1.00 54.64  ? 93   SER B O   1 
ATOM   4894 C CB  . SER B 1 93  ? 7.713   -8.350  -58.208 1.00 50.88  ? 93   SER B CB  1 
ATOM   4895 O OG  . SER B 1 93  ? 8.395   -7.818  -59.335 1.00 54.34  ? 93   SER B OG  1 
ATOM   4896 N N   . GLU B 1 94  ? 10.830  -7.650  -57.605 1.00 55.00  ? 94   GLU B N   1 
ATOM   4897 C CA  . GLU B 1 94  ? 11.774  -6.532  -57.617 1.00 51.56  ? 94   GLU B CA  1 
ATOM   4898 C C   . GLU B 1 94  ? 11.229  -5.409  -58.482 1.00 50.94  ? 94   GLU B C   1 
ATOM   4899 O O   . GLU B 1 94  ? 11.705  -4.275  -58.427 1.00 57.44  ? 94   GLU B O   1 
ATOM   4900 C CB  . GLU B 1 94  ? 13.155  -6.962  -58.129 1.00 49.27  ? 94   GLU B CB  1 
ATOM   4901 C CG  . GLU B 1 94  ? 14.017  -7.699  -57.092 1.00 47.79  ? 94   GLU B CG  1 
ATOM   4902 C CD  . GLU B 1 94  ? 15.412  -8.033  -57.614 1.00 65.77  ? 94   GLU B CD  1 
ATOM   4903 O OE1 . GLU B 1 94  ? 16.232  -7.094  -57.807 1.00 69.94  ? 94   GLU B OE1 1 
ATOM   4904 O OE2 . GLU B 1 94  ? 15.685  -9.240  -57.831 1.00 58.75  ? 94   GLU B OE2 1 
ATOM   4905 N N   . ASP B 1 95  ? 10.242  -5.743  -59.303 1.00 49.93  ? 95   ASP B N   1 
ATOM   4906 C CA  . ASP B 1 95  ? 9.566   -4.759  -60.124 1.00 52.38  ? 95   ASP B CA  1 
ATOM   4907 C C   . ASP B 1 95  ? 8.434   -4.228  -59.259 1.00 50.96  ? 95   ASP B C   1 
ATOM   4908 O O   . ASP B 1 95  ? 7.325   -4.748  -59.309 1.00 52.40  ? 95   ASP B O   1 
ATOM   4909 C CB  . ASP B 1 95  ? 9.039   -5.439  -61.392 1.00 48.06  ? 95   ASP B CB  1 
ATOM   4910 C CG  . ASP B 1 95  ? 8.234   -4.503  -62.298 1.00 56.56  ? 95   ASP B CG  1 
ATOM   4911 O OD1 . ASP B 1 95  ? 7.968   -3.334  -61.935 1.00 56.11  ? 95   ASP B OD1 1 
ATOM   4912 O OD2 . ASP B 1 95  ? 7.854   -4.956  -63.397 1.00 54.35  ? 95   ASP B OD2 1 
ATOM   4913 N N   . CYS B 1 96  ? 8.715   -3.202  -58.454 1.00 51.91  ? 96   CYS B N   1 
ATOM   4914 C CA  . CYS B 1 96  ? 7.771   -2.758  -57.415 1.00 46.45  ? 96   CYS B CA  1 
ATOM   4915 C C   . CYS B 1 96  ? 7.638   -1.246  -57.273 1.00 45.63  ? 96   CYS B C   1 
ATOM   4916 O O   . CYS B 1 96  ? 6.941   -0.773  -56.387 1.00 47.68  ? 96   CYS B O   1 
ATOM   4917 C CB  . CYS B 1 96  ? 8.195   -3.320  -56.062 1.00 50.96  ? 96   CYS B CB  1 
ATOM   4918 S SG  . CYS B 1 96  ? 9.881   -2.779  -55.566 1.00 58.82  ? 96   CYS B SG  1 
ATOM   4919 N N   . LEU B 1 97  ? 8.304   -0.488  -58.135 1.00 43.79  ? 97   LEU B N   1 
ATOM   4920 C CA  . LEU B 1 97  ? 8.328   0.959   -57.989 1.00 40.25  ? 97   LEU B CA  1 
ATOM   4921 C C   . LEU B 1 97  ? 7.059   1.643   -58.528 1.00 49.53  ? 97   LEU B C   1 
ATOM   4922 O O   . LEU B 1 97  ? 7.030   2.220   -59.627 1.00 45.49  ? 97   LEU B O   1 
ATOM   4923 C CB  . LEU B 1 97  ? 9.615   1.537   -58.586 1.00 40.05  ? 97   LEU B CB  1 
ATOM   4924 C CG  . LEU B 1 97  ? 10.857  0.991   -57.855 1.00 44.05  ? 97   LEU B CG  1 
ATOM   4925 C CD1 . LEU B 1 97  ? 12.141  1.715   -58.246 1.00 39.00  ? 97   LEU B CD1 1 
ATOM   4926 C CD2 . LEU B 1 97  ? 10.661  1.039   -56.329 1.00 44.85  ? 97   LEU B CD2 1 
ATOM   4927 N N   . TYR B 1 98  ? 6.015   1.577   -57.710 1.00 43.06  ? 98   TYR B N   1 
ATOM   4928 C CA  . TYR B 1 98  ? 4.716   2.124   -58.052 1.00 45.14  ? 98   TYR B CA  1 
ATOM   4929 C C   . TYR B 1 98  ? 4.134   2.910   -56.885 1.00 48.13  ? 98   TYR B C   1 
ATOM   4930 O O   . TYR B 1 98  ? 4.296   2.538   -55.716 1.00 51.07  ? 98   TYR B O   1 
ATOM   4931 C CB  . TYR B 1 98  ? 3.753   0.991   -58.432 1.00 47.86  ? 98   TYR B CB  1 
ATOM   4932 C CG  . TYR B 1 98  ? 4.243   0.140   -59.586 1.00 56.31  ? 98   TYR B CG  1 
ATOM   4933 C CD1 . TYR B 1 98  ? 3.991   0.519   -60.906 1.00 53.19  ? 98   TYR B CD1 1 
ATOM   4934 C CD2 . TYR B 1 98  ? 4.964   -1.036  -59.363 1.00 50.42  ? 98   TYR B CD2 1 
ATOM   4935 C CE1 . TYR B 1 98  ? 4.444   -0.236  -61.968 1.00 52.16  ? 98   TYR B CE1 1 
ATOM   4936 C CE2 . TYR B 1 98  ? 5.421   -1.805  -60.427 1.00 57.05  ? 98   TYR B CE2 1 
ATOM   4937 C CZ  . TYR B 1 98  ? 5.153   -1.396  -61.728 1.00 61.43  ? 98   TYR B CZ  1 
ATOM   4938 O OH  . TYR B 1 98  ? 5.598   -2.129  -62.801 1.00 62.22  ? 98   TYR B OH  1 
ATOM   4939 N N   . LEU B 1 99  ? 3.431   3.988   -57.205 1.00 47.16  ? 99   LEU B N   1 
ATOM   4940 C CA  . LEU B 1 99  ? 2.699   4.724   -56.193 1.00 45.62  ? 99   LEU B CA  1 
ATOM   4941 C C   . LEU B 1 99  ? 1.174   4.656   -56.396 1.00 53.55  ? 99   LEU B C   1 
ATOM   4942 O O   . LEU B 1 99  ? 0.685   4.272   -57.465 1.00 50.73  ? 99   LEU B O   1 
ATOM   4943 C CB  . LEU B 1 99  ? 3.192   6.167   -56.132 1.00 44.35  ? 99   LEU B CB  1 
ATOM   4944 C CG  . LEU B 1 99  ? 3.283   6.929   -57.445 1.00 44.89  ? 99   LEU B CG  1 
ATOM   4945 C CD1 . LEU B 1 99  ? 1.917   7.436   -57.837 1.00 45.16  ? 99   LEU B CD1 1 
ATOM   4946 C CD2 . LEU B 1 99  ? 4.234   8.086   -57.280 1.00 47.48  ? 99   LEU B CD2 1 
ATOM   4947 N N   . ASN B 1 100 ? 0.443   5.028   -55.348 1.00 46.79  ? 100  ASN B N   1 
ATOM   4948 C CA  . ASN B 1 100 ? -1.005  5.047   -55.350 1.00 41.48  ? 100  ASN B CA  1 
ATOM   4949 C C   . ASN B 1 100 ? -1.503  6.422   -54.966 1.00 51.21  ? 100  ASN B C   1 
ATOM   4950 O O   . ASN B 1 100 ? -0.927  7.081   -54.105 1.00 54.21  ? 100  ASN B O   1 
ATOM   4951 C CB  . ASN B 1 100 ? -1.536  4.046   -54.341 1.00 41.83  ? 100  ASN B CB  1 
ATOM   4952 C CG  . ASN B 1 100 ? -0.855  2.714   -54.444 1.00 51.08  ? 100  ASN B CG  1 
ATOM   4953 O OD1 . ASN B 1 100 ? -0.765  2.136   -55.523 1.00 52.72  ? 100  ASN B OD1 1 
ATOM   4954 N ND2 . ASN B 1 100 ? -0.374  2.205   -53.317 1.00 53.81  ? 100  ASN B ND2 1 
ATOM   4955 N N   . VAL B 1 101 ? -2.588  6.852   -55.592 1.00 55.34  ? 101  VAL B N   1 
ATOM   4956 C CA  . VAL B 1 101 ? -3.174  8.150   -55.287 1.00 51.35  ? 101  VAL B CA  1 
ATOM   4957 C C   . VAL B 1 101 ? -4.674  8.008   -55.014 1.00 60.48  ? 101  VAL B C   1 
ATOM   4958 O O   . VAL B 1 101 ? -5.402  7.411   -55.808 1.00 57.63  ? 101  VAL B O   1 
ATOM   4959 C CB  . VAL B 1 101 ? -2.975  9.108   -56.458 1.00 45.99  ? 101  VAL B CB  1 
ATOM   4960 C CG1 . VAL B 1 101 ? -3.637  10.436  -56.174 1.00 54.57  ? 101  VAL B CG1 1 
ATOM   4961 C CG2 . VAL B 1 101 ? -1.494  9.285   -56.748 1.00 46.76  ? 101  VAL B CG2 1 
ATOM   4962 N N   . TRP B 1 102 ? -5.136  8.531   -53.884 1.00 56.86  ? 102  TRP B N   1 
ATOM   4963 C CA  . TRP B 1 102 ? -6.574  8.642   -53.651 1.00 52.50  ? 102  TRP B CA  1 
ATOM   4964 C C   . TRP B 1 102 ? -6.976  10.115  -53.661 1.00 56.31  ? 102  TRP B C   1 
ATOM   4965 O O   . TRP B 1 102 ? -6.304  10.949  -53.055 1.00 58.69  ? 102  TRP B O   1 
ATOM   4966 C CB  . TRP B 1 102 ? -6.955  8.060   -52.301 1.00 44.57  ? 102  TRP B CB  1 
ATOM   4967 C CG  . TRP B 1 102 ? -6.797  6.595   -52.118 1.00 49.86  ? 102  TRP B CG  1 
ATOM   4968 C CD1 . TRP B 1 102 ? -7.782  5.650   -52.177 1.00 54.04  ? 102  TRP B CD1 1 
ATOM   4969 C CD2 . TRP B 1 102 ? -5.598  5.900   -51.762 1.00 52.64  ? 102  TRP B CD2 1 
ATOM   4970 N NE1 . TRP B 1 102 ? -7.266  4.403   -51.906 1.00 52.35  ? 102  TRP B NE1 1 
ATOM   4971 C CE2 . TRP B 1 102 ? -5.927  4.529   -51.647 1.00 54.96  ? 102  TRP B CE2 1 
ATOM   4972 C CE3 . TRP B 1 102 ? -4.278  6.298   -51.539 1.00 47.43  ? 102  TRP B CE3 1 
ATOM   4973 C CZ2 . TRP B 1 102 ? -4.983  3.561   -51.319 1.00 48.23  ? 102  TRP B CZ2 1 
ATOM   4974 C CZ3 . TRP B 1 102 ? -3.346  5.341   -51.212 1.00 48.69  ? 102  TRP B CZ3 1 
ATOM   4975 C CH2 . TRP B 1 102 ? -3.699  3.985   -51.109 1.00 50.98  ? 102  TRP B CH2 1 
ATOM   4976 N N   . THR B 1 103 ? -8.065  10.444  -54.343 1.00 56.29  ? 103  THR B N   1 
ATOM   4977 C CA  . THR B 1 103 ? -8.594  11.804  -54.282 1.00 62.71  ? 103  THR B CA  1 
ATOM   4978 C C   . THR B 1 103 ? -10.058 11.745  -53.896 1.00 61.76  ? 103  THR B C   1 
ATOM   4979 O O   . THR B 1 103 ? -10.629 10.662  -53.796 1.00 62.36  ? 103  THR B O   1 
ATOM   4980 C CB  . THR B 1 103 ? -8.438  12.590  -55.613 1.00 61.99  ? 103  THR B CB  1 
ATOM   4981 O OG1 . THR B 1 103 ? -9.294  12.028  -56.616 1.00 69.44  ? 103  THR B OG1 1 
ATOM   4982 C CG2 . THR B 1 103 ? -7.006  12.548  -56.098 1.00 59.41  ? 103  THR B CG2 1 
ATOM   4983 N N   . PRO B 1 104 ? -10.661 12.910  -53.634 1.00 66.98  ? 104  PRO B N   1 
ATOM   4984 C CA  . PRO B 1 104 ? -12.113 12.952  -53.492 1.00 69.07  ? 104  PRO B CA  1 
ATOM   4985 C C   . PRO B 1 104 ? -12.758 12.656  -54.843 1.00 73.02  ? 104  PRO B C   1 
ATOM   4986 O O   . PRO B 1 104 ? -12.125 12.825  -55.888 1.00 70.43  ? 104  PRO B O   1 
ATOM   4987 C CB  . PRO B 1 104 ? -12.378 14.401  -53.086 1.00 62.27  ? 104  PRO B CB  1 
ATOM   4988 C CG  . PRO B 1 104 ? -11.101 14.876  -52.514 1.00 65.18  ? 104  PRO B CG  1 
ATOM   4989 C CD  . PRO B 1 104 ? -10.045 14.207  -53.318 1.00 71.08  ? 104  PRO B CD  1 
ATOM   4990 N N   . TYR B 1 105 ? -13.999 12.189  -54.810 1.00 76.95  ? 105  TYR B N   1 
ATOM   4991 C CA  . TYR B 1 105 ? -14.770 11.951  -56.019 1.00 73.70  ? 105  TYR B CA  1 
ATOM   4992 C C   . TYR B 1 105 ? -16.077 12.698  -55.878 1.00 74.59  ? 105  TYR B C   1 
ATOM   4993 O O   . TYR B 1 105 ? -16.912 12.332  -55.050 1.00 81.49  ? 105  TYR B O   1 
ATOM   4994 C CB  . TYR B 1 105 ? -15.059 10.466  -56.188 1.00 71.66  ? 105  TYR B CB  1 
ATOM   4995 C CG  . TYR B 1 105 ? -15.810 10.144  -57.453 1.00 73.41  ? 105  TYR B CG  1 
ATOM   4996 C CD1 . TYR B 1 105 ? -15.261 9.310   -58.415 1.00 74.43  ? 105  TYR B CD1 1 
ATOM   4997 C CD2 . TYR B 1 105 ? -17.063 10.684  -57.692 1.00 74.83  ? 105  TYR B CD2 1 
ATOM   4998 C CE1 . TYR B 1 105 ? -15.943 9.018   -59.569 1.00 82.66  ? 105  TYR B CE1 1 
ATOM   4999 C CE2 . TYR B 1 105 ? -17.750 10.401  -58.840 1.00 72.66  ? 105  TYR B CE2 1 
ATOM   5000 C CZ  . TYR B 1 105 ? -17.190 9.567   -59.777 1.00 83.16  ? 105  TYR B CZ  1 
ATOM   5001 O OH  . TYR B 1 105 ? -17.881 9.284   -60.932 1.00 85.81  ? 105  TYR B OH  1 
ATOM   5002 N N   . PRO B 1 106 ? -16.282 13.724  -56.711 1.00 79.37  ? 106  PRO B N   1 
ATOM   5003 C CA  . PRO B 1 106 ? -15.421 14.023  -57.858 1.00 83.53  ? 106  PRO B CA  1 
ATOM   5004 C C   . PRO B 1 106 ? -14.111 14.691  -57.456 1.00 79.95  ? 106  PRO B C   1 
ATOM   5005 O O   . PRO B 1 106 ? -13.930 15.046  -56.295 1.00 75.79  ? 106  PRO B O   1 
ATOM   5006 C CB  . PRO B 1 106 ? -16.269 15.002  -58.669 1.00 86.50  ? 106  PRO B CB  1 
ATOM   5007 C CG  . PRO B 1 106 ? -17.091 15.719  -57.638 1.00 78.16  ? 106  PRO B CG  1 
ATOM   5008 C CD  . PRO B 1 106 ? -17.314 14.758  -56.501 1.00 76.19  ? 106  PRO B CD  1 
ATOM   5009 N N   . ARG B 1 107 ? -13.220 14.856  -58.428 1.00 76.51  ? 107  ARG B N   1 
ATOM   5010 C CA  . ARG B 1 107 ? -11.930 15.499  -58.230 1.00 77.02  ? 107  ARG B CA  1 
ATOM   5011 C C   . ARG B 1 107 ? -12.077 16.893  -57.625 1.00 80.45  ? 107  ARG B C   1 
ATOM   5012 O O   . ARG B 1 107 ? -12.986 17.633  -57.983 1.00 80.41  ? 107  ARG B O   1 
ATOM   5013 C CB  . ARG B 1 107 ? -11.214 15.598  -59.575 1.00 74.35  ? 107  ARG B CB  1 
ATOM   5014 C CG  . ARG B 1 107 ? -9.746  15.976  -59.504 1.00 74.03  ? 107  ARG B CG  1 
ATOM   5015 C CD  . ARG B 1 107 ? -9.096  15.770  -60.866 1.00 78.76  ? 107  ARG B CD  1 
ATOM   5016 N NE  . ARG B 1 107 ? -9.574  14.530  -61.479 1.00 83.22  ? 107  ARG B NE  1 
ATOM   5017 C CZ  . ARG B 1 107 ? -9.310  14.150  -62.725 1.00 80.40  ? 107  ARG B CZ  1 
ATOM   5018 N NH1 . ARG B 1 107 ? -9.802  13.002  -63.182 1.00 75.48  ? 107  ARG B NH1 1 
ATOM   5019 N NH2 . ARG B 1 107 ? -8.557  14.912  -63.512 1.00 69.91  ? 107  ARG B NH2 1 
ATOM   5020 N N   . PRO B 1 108 ? -11.173 17.253  -56.703 1.00 81.99  ? 108  PRO B N   1 
ATOM   5021 C CA  . PRO B 1 108 ? -11.127 18.581  -56.078 1.00 80.64  ? 108  PRO B CA  1 
ATOM   5022 C C   . PRO B 1 108 ? -11.152 19.713  -57.101 1.00 86.04  ? 108  PRO B C   1 
ATOM   5023 O O   . PRO B 1 108 ? -10.402 19.672  -58.082 1.00 79.78  ? 108  PRO B O   1 
ATOM   5024 C CB  . PRO B 1 108 ? -9.775  18.576  -55.365 1.00 71.16  ? 108  PRO B CB  1 
ATOM   5025 C CG  . PRO B 1 108 ? -9.548  17.144  -55.028 1.00 79.02  ? 108  PRO B CG  1 
ATOM   5026 C CD  . PRO B 1 108 ? -10.140 16.351  -56.161 1.00 79.78  ? 108  PRO B CD  1 
ATOM   5027 N N   . ALA B 1 109 ? -11.994 20.716  -56.856 1.00 83.89  ? 109  ALA B N   1 
ATOM   5028 C CA  . ALA B 1 109 ? -12.101 21.880  -57.735 1.00 84.05  ? 109  ALA B CA  1 
ATOM   5029 C C   . ALA B 1 109 ? -10.886 22.804  -57.617 1.00 85.59  ? 109  ALA B C   1 
ATOM   5030 O O   . ALA B 1 109 ? -10.358 23.283  -58.619 1.00 81.05  ? 109  ALA B O   1 
ATOM   5031 C CB  . ALA B 1 109 ? -13.377 22.648  -57.442 1.00 86.90  ? 109  ALA B CB  1 
ATOM   5032 N N   . SER B 1 110 ? -10.448 23.066  -56.392 1.00 79.90  ? 110  SER B N   1 
ATOM   5033 C CA  . SER B 1 110 ? -9.214  23.816  -56.197 1.00 82.42  ? 110  SER B CA  1 
ATOM   5034 C C   . SER B 1 110 ? -8.102  22.889  -55.695 1.00 80.13  ? 110  SER B C   1 
ATOM   5035 O O   . SER B 1 110 ? -8.380  21.795  -55.205 1.00 73.32  ? 110  SER B O   1 
ATOM   5036 C CB  . SER B 1 110 ? -9.449  24.991  -55.246 1.00 72.32  ? 110  SER B CB  1 
ATOM   5037 O OG  . SER B 1 110 ? -10.588 24.754  -54.444 1.00 81.45  ? 110  SER B OG  1 
ATOM   5038 N N   . PRO B 1 111 ? -6.837  23.317  -55.841 1.00 75.14  ? 111  PRO B N   1 
ATOM   5039 C CA  . PRO B 1 111 ? -5.657  22.573  -55.376 1.00 67.28  ? 111  PRO B CA  1 
ATOM   5040 C C   . PRO B 1 111 ? -5.746  22.166  -53.903 1.00 65.47  ? 111  PRO B C   1 
ATOM   5041 O O   . PRO B 1 111 ? -5.716  23.020  -53.018 1.00 64.78  ? 111  PRO B O   1 
ATOM   5042 C CB  . PRO B 1 111 ? -4.519  23.578  -55.562 1.00 68.04  ? 111  PRO B CB  1 
ATOM   5043 C CG  . PRO B 1 111 ? -4.980  24.477  -56.655 1.00 62.77  ? 111  PRO B CG  1 
ATOM   5044 C CD  . PRO B 1 111 ? -6.473  24.576  -56.515 1.00 68.84  ? 111  PRO B CD  1 
ATOM   5045 N N   . THR B 1 112 ? -5.836  20.863  -53.663 1.00 64.89  ? 112  THR B N   1 
ATOM   5046 C CA  . THR B 1 112 ? -5.972  20.298  -52.327 1.00 61.51  ? 112  THR B CA  1 
ATOM   5047 C C   . THR B 1 112 ? -4.620  19.905  -51.760 1.00 59.64  ? 112  THR B C   1 
ATOM   5048 O O   . THR B 1 112 ? -3.794  19.353  -52.473 1.00 61.83  ? 112  THR B O   1 
ATOM   5049 C CB  . THR B 1 112 ? -6.811  19.018  -52.378 1.00 58.99  ? 112  THR B CB  1 
ATOM   5050 O OG1 . THR B 1 112 ? -7.962  19.241  -53.193 1.00 73.42  ? 112  THR B OG1 1 
ATOM   5051 C CG2 . THR B 1 112 ? -7.245  18.591  -50.983 1.00 63.75  ? 112  THR B CG2 1 
ATOM   5052 N N   . PRO B 1 113 ? -4.397  20.178  -50.467 1.00 60.11  ? 113  PRO B N   1 
ATOM   5053 C CA  . PRO B 1 113 ? -3.166  19.755  -49.793 1.00 60.64  ? 113  PRO B CA  1 
ATOM   5054 C C   . PRO B 1 113 ? -2.888  18.285  -50.029 1.00 57.21  ? 113  PRO B C   1 
ATOM   5055 O O   . PRO B 1 113 ? -3.818  17.474  -50.015 1.00 54.80  ? 113  PRO B O   1 
ATOM   5056 C CB  . PRO B 1 113 ? -3.487  19.988  -48.316 1.00 62.75  ? 113  PRO B CB  1 
ATOM   5057 C CG  . PRO B 1 113 ? -4.425  21.148  -48.338 1.00 65.69  ? 113  PRO B CG  1 
ATOM   5058 C CD  . PRO B 1 113 ? -5.260  20.986  -49.586 1.00 61.34  ? 113  PRO B CD  1 
ATOM   5059 N N   . VAL B 1 114 ? -1.622  17.949  -50.254 1.00 48.67  ? 114  VAL B N   1 
ATOM   5060 C CA  . VAL B 1 114 ? -1.254  16.565  -50.482 1.00 48.03  ? 114  VAL B CA  1 
ATOM   5061 C C   . VAL B 1 114 ? -0.566  15.974  -49.270 1.00 46.91  ? 114  VAL B C   1 
ATOM   5062 O O   . VAL B 1 114 ? 0.349   16.567  -48.709 1.00 50.60  ? 114  VAL B O   1 
ATOM   5063 C CB  . VAL B 1 114 ? -0.302  16.418  -51.677 1.00 51.66  ? 114  VAL B CB  1 
ATOM   5064 C CG1 . VAL B 1 114 ? -0.189  14.958  -52.065 1.00 47.09  ? 114  VAL B CG1 1 
ATOM   5065 C CG2 . VAL B 1 114 ? -0.791  17.242  -52.842 1.00 51.14  ? 114  VAL B CG2 1 
ATOM   5066 N N   . LEU B 1 115 ? -1.011  14.792  -48.874 1.00 50.41  ? 115  LEU B N   1 
ATOM   5067 C CA  . LEU B 1 115 ? -0.327  14.012  -47.860 1.00 45.86  ? 115  LEU B CA  1 
ATOM   5068 C C   . LEU B 1 115 ? 0.380   12.854  -48.557 1.00 52.73  ? 115  LEU B C   1 
ATOM   5069 O O   . LEU B 1 115 ? -0.190  12.214  -49.438 1.00 56.71  ? 115  LEU B O   1 
ATOM   5070 C CB  . LEU B 1 115 ? -1.332  13.465  -46.864 1.00 49.32  ? 115  LEU B CB  1 
ATOM   5071 C CG  . LEU B 1 115 ? -1.801  14.346  -45.706 1.00 56.13  ? 115  LEU B CG  1 
ATOM   5072 C CD1 . LEU B 1 115 ? -3.075  13.787  -45.131 1.00 45.00  ? 115  LEU B CD1 1 
ATOM   5073 C CD2 . LEU B 1 115 ? -0.739  14.400  -44.617 1.00 59.59  ? 115  LEU B CD2 1 
ATOM   5074 N N   . ILE B 1 116 ? 1.625   12.595  -48.181 1.00 44.68  ? 116  ILE B N   1 
ATOM   5075 C CA  . ILE B 1 116 ? 2.348   11.469  -48.734 1.00 38.82  ? 116  ILE B CA  1 
ATOM   5076 C C   . ILE B 1 116 ? 2.771   10.509  -47.631 1.00 45.61  ? 116  ILE B C   1 
ATOM   5077 O O   . ILE B 1 116 ? 3.545   10.869  -46.742 1.00 48.27  ? 116  ILE B O   1 
ATOM   5078 C CB  . ILE B 1 116 ? 3.595   11.937  -49.483 1.00 45.61  ? 116  ILE B CB  1 
ATOM   5079 C CG1 . ILE B 1 116 ? 3.218   12.994  -50.513 1.00 47.77  ? 116  ILE B CG1 1 
ATOM   5080 C CG2 . ILE B 1 116 ? 4.290   10.758  -50.156 1.00 44.36  ? 116  ILE B CG2 1 
ATOM   5081 C CD1 . ILE B 1 116 ? 4.381   13.437  -51.346 1.00 45.34  ? 116  ILE B CD1 1 
ATOM   5082 N N   . TRP B 1 117 ? 2.276   9.282   -47.694 1.00 41.73  ? 117  TRP B N   1 
ATOM   5083 C CA  . TRP B 1 117 ? 2.606   8.269   -46.701 1.00 42.39  ? 117  TRP B CA  1 
ATOM   5084 C C   . TRP B 1 117 ? 3.829   7.447   -47.079 1.00 43.40  ? 117  TRP B C   1 
ATOM   5085 O O   . TRP B 1 117 ? 3.980   7.023   -48.217 1.00 46.35  ? 117  TRP B O   1 
ATOM   5086 C CB  . TRP B 1 117 ? 1.419   7.343   -46.491 1.00 44.48  ? 117  TRP B CB  1 
ATOM   5087 C CG  . TRP B 1 117 ? 1.689   6.173   -45.621 1.00 44.31  ? 117  TRP B CG  1 
ATOM   5088 C CD1 . TRP B 1 117 ? 1.831   4.875   -46.013 1.00 44.18  ? 117  TRP B CD1 1 
ATOM   5089 C CD2 . TRP B 1 117 ? 1.822   6.180   -44.196 1.00 47.78  ? 117  TRP B CD2 1 
ATOM   5090 N NE1 . TRP B 1 117 ? 2.038   4.069   -44.916 1.00 43.18  ? 117  TRP B NE1 1 
ATOM   5091 C CE2 . TRP B 1 117 ? 2.044   4.847   -43.789 1.00 43.65  ? 117  TRP B CE2 1 
ATOM   5092 C CE3 . TRP B 1 117 ? 1.778   7.187   -43.222 1.00 45.40  ? 117  TRP B CE3 1 
ATOM   5093 C CZ2 . TRP B 1 117 ? 2.225   4.495   -42.453 1.00 40.75  ? 117  TRP B CZ2 1 
ATOM   5094 C CZ3 . TRP B 1 117 ? 1.966   6.836   -41.898 1.00 44.44  ? 117  TRP B CZ3 1 
ATOM   5095 C CH2 . TRP B 1 117 ? 2.186   5.499   -41.526 1.00 45.70  ? 117  TRP B CH2 1 
ATOM   5096 N N   . ILE B 1 118 ? 4.702   7.237   -46.105 1.00 43.99  ? 118  ILE B N   1 
ATOM   5097 C CA  . ILE B 1 118 ? 5.871   6.388   -46.270 1.00 47.82  ? 118  ILE B CA  1 
ATOM   5098 C C   . ILE B 1 118 ? 5.820   5.298   -45.206 1.00 48.09  ? 118  ILE B C   1 
ATOM   5099 O O   . ILE B 1 118 ? 5.942   5.576   -44.011 1.00 52.79  ? 118  ILE B O   1 
ATOM   5100 C CB  . ILE B 1 118 ? 7.175   7.193   -46.129 1.00 39.65  ? 118  ILE B CB  1 
ATOM   5101 C CG1 . ILE B 1 118 ? 7.164   8.383   -47.079 1.00 40.37  ? 118  ILE B CG1 1 
ATOM   5102 C CG2 . ILE B 1 118 ? 8.386   6.320   -46.411 1.00 36.35  ? 118  ILE B CG2 1 
ATOM   5103 C CD1 . ILE B 1 118 ? 8.407   9.238   -46.992 1.00 38.24  ? 118  ILE B CD1 1 
ATOM   5104 N N   . TYR B 1 119 ? 5.621   4.060   -45.635 1.00 44.33  ? 119  TYR B N   1 
ATOM   5105 C CA  . TYR B 1 119 ? 5.453   2.964   -44.688 1.00 46.34  ? 119  TYR B CA  1 
ATOM   5106 C C   . TYR B 1 119 ? 6.759   2.620   -43.983 1.00 46.44  ? 119  TYR B C   1 
ATOM   5107 O O   . TYR B 1 119 ? 7.843   2.971   -44.454 1.00 45.80  ? 119  TYR B O   1 
ATOM   5108 C CB  . TYR B 1 119 ? 4.896   1.721   -45.388 1.00 47.17  ? 119  TYR B CB  1 
ATOM   5109 C CG  . TYR B 1 119 ? 5.746   1.188   -46.527 1.00 43.78  ? 119  TYR B CG  1 
ATOM   5110 C CD1 . TYR B 1 119 ? 6.941   0.509   -46.283 1.00 43.90  ? 119  TYR B CD1 1 
ATOM   5111 C CD2 . TYR B 1 119 ? 5.337   1.334   -47.844 1.00 43.43  ? 119  TYR B CD2 1 
ATOM   5112 C CE1 . TYR B 1 119 ? 7.713   0.006   -47.326 1.00 42.54  ? 119  TYR B CE1 1 
ATOM   5113 C CE2 . TYR B 1 119 ? 6.090   0.831   -48.894 1.00 48.89  ? 119  TYR B CE2 1 
ATOM   5114 C CZ  . TYR B 1 119 ? 7.280   0.169   -48.637 1.00 51.34  ? 119  TYR B CZ  1 
ATOM   5115 O OH  . TYR B 1 119 ? 8.029   -0.310  -49.702 1.00 45.88  ? 119  TYR B OH  1 
ATOM   5116 N N   . GLY B 1 120 ? 6.639   1.922   -42.858 1.00 48.73  ? 120  GLY B N   1 
ATOM   5117 C CA  . GLY B 1 120 ? 7.788   1.434   -42.116 1.00 47.23  ? 120  GLY B CA  1 
ATOM   5118 C C   . GLY B 1 120 ? 7.886   -0.078  -42.191 1.00 55.42  ? 120  GLY B C   1 
ATOM   5119 O O   . GLY B 1 120 ? 7.138   -0.727  -42.922 1.00 65.62  ? 120  GLY B O   1 
ATOM   5120 N N   . GLY B 1 121 ? 8.810   -0.647  -41.431 1.00 59.30  ? 121  GLY B N   1 
ATOM   5121 C CA  . GLY B 1 121 ? 9.069   -2.069  -41.495 1.00 53.39  ? 121  GLY B CA  1 
ATOM   5122 C C   . GLY B 1 121 ? 10.551  -2.357  -41.356 1.00 53.65  ? 121  GLY B C   1 
ATOM   5123 O O   . GLY B 1 121 ? 11.078  -3.279  -41.983 1.00 51.81  ? 121  GLY B O   1 
ATOM   5124 N N   . GLY B 1 122 ? 11.230  -1.551  -40.546 1.00 50.09  ? 122  GLY B N   1 
ATOM   5125 C CA  . GLY B 1 122 ? 12.640  -1.760  -40.272 1.00 49.26  ? 122  GLY B CA  1 
ATOM   5126 C C   . GLY B 1 122 ? 13.547  -1.635  -41.483 1.00 50.45  ? 122  GLY B C   1 
ATOM   5127 O O   . GLY B 1 122 ? 14.717  -2.012  -41.428 1.00 52.63  ? 122  GLY B O   1 
ATOM   5128 N N   . PHE B 1 123 ? 13.015  -1.101  -42.576 1.00 48.70  ? 123  PHE B N   1 
ATOM   5129 C CA  . PHE B 1 123 ? 13.797  -0.930  -43.791 1.00 47.81  ? 123  PHE B CA  1 
ATOM   5130 C C   . PHE B 1 123 ? 14.022  -2.265  -44.505 1.00 49.46  ? 123  PHE B C   1 
ATOM   5131 O O   . PHE B 1 123 ? 14.796  -2.335  -45.456 1.00 56.56  ? 123  PHE B O   1 
ATOM   5132 C CB  . PHE B 1 123 ? 15.154  -0.273  -43.478 1.00 47.16  ? 123  PHE B CB  1 
ATOM   5133 C CG  . PHE B 1 123 ? 15.077  1.207   -43.204 1.00 51.44  ? 123  PHE B CG  1 
ATOM   5134 C CD1 . PHE B 1 123 ? 14.651  2.095   -44.189 1.00 51.06  ? 123  PHE B CD1 1 
ATOM   5135 C CD2 . PHE B 1 123 ? 15.454  1.716   -41.974 1.00 51.40  ? 123  PHE B CD2 1 
ATOM   5136 C CE1 . PHE B 1 123 ? 14.575  3.451   -43.941 1.00 40.71  ? 123  PHE B CE1 1 
ATOM   5137 C CE2 . PHE B 1 123 ? 15.390  3.071   -41.721 1.00 44.02  ? 123  PHE B CE2 1 
ATOM   5138 C CZ  . PHE B 1 123 ? 14.950  3.940   -42.705 1.00 48.67  ? 123  PHE B CZ  1 
ATOM   5139 N N   . TYR B 1 124 ? 13.358  -3.323  -44.049 1.00 48.55  ? 124  TYR B N   1 
ATOM   5140 C CA  . TYR B 1 124 ? 13.538  -4.657  -44.644 1.00 53.75  ? 124  TYR B CA  1 
ATOM   5141 C C   . TYR B 1 124 ? 12.196  -5.227  -45.128 1.00 58.36  ? 124  TYR B C   1 
ATOM   5142 O O   . TYR B 1 124 ? 12.142  -6.321  -45.708 1.00 57.19  ? 124  TYR B O   1 
ATOM   5143 C CB  . TYR B 1 124 ? 14.165  -5.626  -43.634 1.00 40.90  ? 124  TYR B CB  1 
ATOM   5144 C CG  . TYR B 1 124 ? 13.180  -6.038  -42.567 1.00 48.66  ? 124  TYR B CG  1 
ATOM   5145 C CD1 . TYR B 1 124 ? 12.291  -7.090  -42.780 1.00 49.93  ? 124  TYR B CD1 1 
ATOM   5146 C CD2 . TYR B 1 124 ? 13.112  -5.355  -41.354 1.00 49.72  ? 124  TYR B CD2 1 
ATOM   5147 C CE1 . TYR B 1 124 ? 11.372  -7.459  -41.819 1.00 46.59  ? 124  TYR B CE1 1 
ATOM   5148 C CE2 . TYR B 1 124 ? 12.194  -5.713  -40.385 1.00 50.34  ? 124  TYR B CE2 1 
ATOM   5149 C CZ  . TYR B 1 124 ? 11.326  -6.770  -40.624 1.00 53.73  ? 124  TYR B CZ  1 
ATOM   5150 O OH  . TYR B 1 124 ? 10.410  -7.127  -39.661 1.00 54.67  ? 124  TYR B OH  1 
ATOM   5151 N N   . SER B 1 125 ? 11.119  -4.486  -44.876 1.00 54.11  ? 125  SER B N   1 
ATOM   5152 C CA  . SER B 1 125 ? 9.781   -4.948  -45.205 1.00 51.17  ? 125  SER B CA  1 
ATOM   5153 C C   . SER B 1 125 ? 8.839   -3.767  -45.328 1.00 51.25  ? 125  SER B C   1 
ATOM   5154 O O   . SER B 1 125 ? 9.262   -2.627  -45.176 1.00 54.97  ? 125  SER B O   1 
ATOM   5155 C CB  . SER B 1 125 ? 9.275   -5.926  -44.146 1.00 48.01  ? 125  SER B CB  1 
ATOM   5156 O OG  . SER B 1 125 ? 9.111   -5.298  -42.888 1.00 47.35  ? 125  SER B OG  1 
ATOM   5157 N N   . GLY B 1 126 ? 7.566   -4.052  -45.601 1.00 50.65  ? 126  GLY B N   1 
ATOM   5158 C CA  . GLY B 1 126 ? 6.553   -3.029  -45.809 1.00 39.43  ? 126  GLY B CA  1 
ATOM   5159 C C   . GLY B 1 126 ? 6.012   -2.937  -47.230 1.00 41.55  ? 126  GLY B C   1 
ATOM   5160 O O   . GLY B 1 126 ? 6.687   -3.293  -48.199 1.00 46.03  ? 126  GLY B O   1 
ATOM   5161 N N   . ALA B 1 127 ? 4.782   -2.449  -47.350 1.00 42.08  ? 127  ALA B N   1 
ATOM   5162 C CA  . ALA B 1 127 ? 4.108   -2.281  -48.643 1.00 48.61  ? 127  ALA B CA  1 
ATOM   5163 C C   . ALA B 1 127 ? 3.090   -1.162  -48.528 1.00 44.72  ? 127  ALA B C   1 
ATOM   5164 O O   . ALA B 1 127 ? 2.505   -0.974  -47.467 1.00 48.02  ? 127  ALA B O   1 
ATOM   5165 C CB  . ALA B 1 127 ? 3.401   -3.559  -49.044 1.00 39.54  ? 127  ALA B CB  1 
ATOM   5166 N N   . ALA B 1 128 ? 2.860   -0.434  -49.612 1.00 40.08  ? 128  ALA B N   1 
ATOM   5167 C CA  . ALA B 1 128 ? 1.880   0.652   -49.590 1.00 51.11  ? 128  ALA B CA  1 
ATOM   5168 C C   . ALA B 1 128 ? 0.441   0.123   -49.681 1.00 54.13  ? 128  ALA B C   1 
ATOM   5169 O O   . ALA B 1 128 ? -0.517  0.886   -49.547 1.00 53.85  ? 128  ALA B O   1 
ATOM   5170 C CB  . ALA B 1 128 ? 2.164   1.675   -50.705 1.00 36.92  ? 128  ALA B CB  1 
ATOM   5171 N N   . SER B 1 129 ? 0.307   -1.188  -49.877 1.00 53.61  ? 129  SER B N   1 
ATOM   5172 C CA  . SER B 1 129 ? -0.985  -1.812  -50.169 1.00 48.61  ? 129  SER B CA  1 
ATOM   5173 C C   . SER B 1 129 ? -1.682  -2.415  -48.960 1.00 50.77  ? 129  SER B C   1 
ATOM   5174 O O   . SER B 1 129 ? -2.809  -2.906  -49.071 1.00 54.26  ? 129  SER B O   1 
ATOM   5175 C CB  . SER B 1 129 ? -0.818  -2.884  -51.245 1.00 48.65  ? 129  SER B CB  1 
ATOM   5176 O OG  . SER B 1 129 ? 0.162   -3.833  -50.872 1.00 51.53  ? 129  SER B OG  1 
ATOM   5177 N N   . LEU B 1 130 ? -1.013  -2.381  -47.811 1.00 49.74  ? 130  LEU B N   1 
ATOM   5178 C CA  . LEU B 1 130 ? -1.574  -2.937  -46.593 1.00 46.40  ? 130  LEU B CA  1 
ATOM   5179 C C   . LEU B 1 130 ? -2.852  -2.209  -46.283 1.00 49.57  ? 130  LEU B C   1 
ATOM   5180 O O   . LEU B 1 130 ? -3.006  -1.029  -46.611 1.00 48.32  ? 130  LEU B O   1 
ATOM   5181 C CB  . LEU B 1 130 ? -0.612  -2.793  -45.416 1.00 50.94  ? 130  LEU B CB  1 
ATOM   5182 C CG  . LEU B 1 130 ? 0.756   -3.457  -45.578 1.00 54.48  ? 130  LEU B CG  1 
ATOM   5183 C CD1 . LEU B 1 130 ? 1.521   -3.379  -44.265 1.00 45.76  ? 130  LEU B CD1 1 
ATOM   5184 C CD2 . LEU B 1 130 ? 0.584   -4.889  -46.036 1.00 47.67  ? 130  LEU B CD2 1 
ATOM   5185 N N   . ASP B 1 131 ? -3.762  -2.917  -45.633 1.00 51.80  ? 131  ASP B N   1 
ATOM   5186 C CA  . ASP B 1 131 ? -5.081  -2.383  -45.359 1.00 55.08  ? 131  ASP B CA  1 
ATOM   5187 C C   . ASP B 1 131 ? -5.009  -1.211  -44.399 1.00 57.17  ? 131  ASP B C   1 
ATOM   5188 O O   . ASP B 1 131 ? -5.763  -0.250  -44.535 1.00 61.02  ? 131  ASP B O   1 
ATOM   5189 C CB  . ASP B 1 131 ? -6.005  -3.475  -44.809 1.00 64.73  ? 131  ASP B CB  1 
ATOM   5190 C CG  . ASP B 1 131 ? -6.245  -4.596  -45.810 1.00 74.32  ? 131  ASP B CG  1 
ATOM   5191 O OD1 . ASP B 1 131 ? -5.853  -4.448  -46.995 1.00 74.21  ? 131  ASP B OD1 1 
ATOM   5192 O OD2 . ASP B 1 131 ? -6.826  -5.628  -45.410 1.00 82.06  ? 131  ASP B OD2 1 
ATOM   5193 N N   . VAL B 1 132 ? -4.102  -1.275  -43.430 1.00 55.97  ? 132  VAL B N   1 
ATOM   5194 C CA  . VAL B 1 132 ? -3.989  -0.162  -42.494 1.00 55.57  ? 132  VAL B CA  1 
ATOM   5195 C C   . VAL B 1 132 ? -3.572  1.152   -43.161 1.00 53.07  ? 132  VAL B C   1 
ATOM   5196 O O   . VAL B 1 132 ? -3.765  2.220   -42.578 1.00 56.89  ? 132  VAL B O   1 
ATOM   5197 C CB  . VAL B 1 132 ? -3.104  -0.485  -41.272 1.00 47.66  ? 132  VAL B CB  1 
ATOM   5198 C CG1 . VAL B 1 132 ? -3.745  -1.577  -40.459 1.00 45.78  ? 132  VAL B CG1 1 
ATOM   5199 C CG2 . VAL B 1 132 ? -1.704  -0.881  -41.689 1.00 47.80  ? 132  VAL B CG2 1 
ATOM   5200 N N   . TYR B 1 133 ? -3.038  1.084   -44.383 1.00 48.35  ? 133  TYR B N   1 
ATOM   5201 C CA  . TYR B 1 133 ? -2.649  2.300   -45.100 1.00 48.70  ? 133  TYR B CA  1 
ATOM   5202 C C   . TYR B 1 133 ? -3.650  2.675   -46.170 1.00 50.59  ? 133  TYR B C   1 
ATOM   5203 O O   . TYR B 1 133 ? -3.305  3.348   -47.139 1.00 56.71  ? 133  TYR B O   1 
ATOM   5204 C CB  . TYR B 1 133 ? -1.271  2.171   -45.759 1.00 48.86  ? 133  TYR B CB  1 
ATOM   5205 C CG  . TYR B 1 133 ? -0.182  1.602   -44.888 1.00 49.75  ? 133  TYR B CG  1 
ATOM   5206 C CD1 . TYR B 1 133 ? -0.182  1.792   -43.510 1.00 48.04  ? 133  TYR B CD1 1 
ATOM   5207 C CD2 . TYR B 1 133 ? 0.859   0.881   -45.451 1.00 47.31  ? 133  TYR B CD2 1 
ATOM   5208 C CE1 . TYR B 1 133 ? 0.820   1.262   -42.721 1.00 46.59  ? 133  TYR B CE1 1 
ATOM   5209 C CE2 . TYR B 1 133 ? 1.870   0.355   -44.676 1.00 47.54  ? 133  TYR B CE2 1 
ATOM   5210 C CZ  . TYR B 1 133 ? 1.852   0.548   -43.311 1.00 52.02  ? 133  TYR B CZ  1 
ATOM   5211 O OH  . TYR B 1 133 ? 2.870   0.019   -42.548 1.00 48.73  ? 133  TYR B OH  1 
ATOM   5212 N N   . ASP B 1 134 ? -4.889  2.236   -46.010 1.00 52.72  ? 134  ASP B N   1 
ATOM   5213 C CA  . ASP B 1 134 ? -5.920  2.520   -46.996 1.00 50.93  ? 134  ASP B CA  1 
ATOM   5214 C C   . ASP B 1 134 ? -6.306  4.005   -46.970 1.00 54.36  ? 134  ASP B C   1 
ATOM   5215 O O   . ASP B 1 134 ? -6.844  4.505   -45.978 1.00 56.43  ? 134  ASP B O   1 
ATOM   5216 C CB  . ASP B 1 134 ? -7.123  1.631   -46.717 1.00 54.15  ? 134  ASP B CB  1 
ATOM   5217 C CG  . ASP B 1 134 ? -8.254  1.852   -47.687 1.00 63.94  ? 134  ASP B CG  1 
ATOM   5218 O OD1 . ASP B 1 134 ? -8.203  2.806   -48.496 1.00 56.07  ? 134  ASP B OD1 1 
ATOM   5219 O OD2 . ASP B 1 134 ? -9.212  1.055   -47.623 1.00 70.33  ? 134  ASP B OD2 1 
ATOM   5220 N N   . GLY B 1 135 ? -6.029  4.709   -48.064 1.00 53.69  ? 135  GLY B N   1 
ATOM   5221 C CA  . GLY B 1 135 ? -6.221  6.151   -48.118 1.00 56.48  ? 135  GLY B CA  1 
ATOM   5222 C C   . GLY B 1 135 ? -7.628  6.671   -48.395 1.00 60.24  ? 135  GLY B C   1 
ATOM   5223 O O   . GLY B 1 135 ? -7.840  7.889   -48.464 1.00 52.12  ? 135  GLY B O   1 
ATOM   5224 N N   . ARG B 1 136 ? -8.601  5.778   -48.545 1.00 52.68  ? 136  ARG B N   1 
ATOM   5225 C CA  . ARG B 1 136 ? -9.907  6.231   -49.004 1.00 54.91  ? 136  ARG B CA  1 
ATOM   5226 C C   . ARG B 1 136 ? -10.596 7.110   -47.977 1.00 59.06  ? 136  ARG B C   1 
ATOM   5227 O O   . ARG B 1 136 ? -11.321 8.037   -48.348 1.00 60.70  ? 136  ARG B O   1 
ATOM   5228 C CB  . ARG B 1 136 ? -10.801 5.068   -49.458 1.00 64.29  ? 136  ARG B CB  1 
ATOM   5229 C CG  . ARG B 1 136 ? -11.535 4.317   -48.374 1.00 59.83  ? 136  ARG B CG  1 
ATOM   5230 C CD  . ARG B 1 136 ? -11.368 2.820   -48.565 1.00 57.52  ? 136  ARG B CD  1 
ATOM   5231 N NE  . ARG B 1 136 ? -12.249 2.254   -49.579 1.00 69.91  ? 136  ARG B NE  1 
ATOM   5232 C CZ  . ARG B 1 136 ? -12.008 1.116   -50.235 1.00 74.15  ? 136  ARG B CZ  1 
ATOM   5233 N NH1 . ARG B 1 136 ? -10.899 0.423   -50.007 1.00 65.47  ? 136  ARG B NH1 1 
ATOM   5234 N NH2 . ARG B 1 136 ? -12.875 0.668   -51.137 1.00 72.85  ? 136  ARG B NH2 1 
ATOM   5235 N N   . PHE B 1 137 ? -10.342 6.847   -46.696 1.00 46.63  ? 137  PHE B N   1 
ATOM   5236 C CA  . PHE B 1 137 ? -11.043 7.552   -45.627 1.00 49.14  ? 137  PHE B CA  1 
ATOM   5237 C C   . PHE B 1 137 ? -10.669 9.034   -45.509 1.00 58.35  ? 137  PHE B C   1 
ATOM   5238 O O   . PHE B 1 137 ? -11.550 9.896   -45.454 1.00 58.51  ? 137  PHE B O   1 
ATOM   5239 C CB  . PHE B 1 137 ? -10.846 6.841   -44.299 1.00 51.16  ? 137  PHE B CB  1 
ATOM   5240 C CG  . PHE B 1 137 ? -11.232 5.404   -44.336 1.00 60.14  ? 137  PHE B CG  1 
ATOM   5241 C CD1 . PHE B 1 137 ? -12.567 5.032   -44.257 1.00 56.67  ? 137  PHE B CD1 1 
ATOM   5242 C CD2 . PHE B 1 137 ? -10.261 4.414   -44.476 1.00 60.50  ? 137  PHE B CD2 1 
ATOM   5243 C CE1 . PHE B 1 137 ? -12.933 3.688   -44.301 1.00 61.99  ? 137  PHE B CE1 1 
ATOM   5244 C CE2 . PHE B 1 137 ? -10.616 3.073   -44.519 1.00 59.70  ? 137  PHE B CE2 1 
ATOM   5245 C CZ  . PHE B 1 137 ? -11.958 2.709   -44.429 1.00 60.31  ? 137  PHE B CZ  1 
ATOM   5246 N N   . LEU B 1 138 ? -9.372  9.328   -45.470 1.00 53.46  ? 138  LEU B N   1 
ATOM   5247 C CA  . LEU B 1 138 ? -8.905  10.714  -45.426 1.00 54.51  ? 138  LEU B CA  1 
ATOM   5248 C C   . LEU B 1 138 ? -9.273  11.453  -46.709 1.00 57.16  ? 138  LEU B C   1 
ATOM   5249 O O   . LEU B 1 138 ? -9.511  12.661  -46.698 1.00 60.31  ? 138  LEU B O   1 
ATOM   5250 C CB  . LEU B 1 138 ? -7.388  10.778  -45.229 1.00 56.21  ? 138  LEU B CB  1 
ATOM   5251 C CG  . LEU B 1 138 ? -6.789  10.341  -43.899 1.00 53.53  ? 138  LEU B CG  1 
ATOM   5252 C CD1 . LEU B 1 138 ? -5.343  9.973   -44.110 1.00 42.17  ? 138  LEU B CD1 1 
ATOM   5253 C CD2 . LEU B 1 138 ? -6.922  11.440  -42.860 1.00 47.90  ? 138  LEU B CD2 1 
ATOM   5254 N N   . ALA B 1 139 ? -9.298  10.727  -47.820 1.00 56.12  ? 139  ALA B N   1 
ATOM   5255 C CA  . ALA B 1 139 ? -9.679  11.325  -49.092 1.00 60.49  ? 139  ALA B CA  1 
ATOM   5256 C C   . ALA B 1 139 ? -11.161 11.690  -49.060 1.00 60.72  ? 139  ALA B C   1 
ATOM   5257 O O   . ALA B 1 139 ? -11.544 12.808  -49.397 1.00 58.26  ? 139  ALA B O   1 
ATOM   5258 C CB  . ALA B 1 139 ? -9.370  10.377  -50.260 1.00 56.09  ? 139  ALA B CB  1 
ATOM   5259 N N   . GLN B 1 140 ? -11.993 10.746  -48.637 1.00 61.34  ? 140  GLN B N   1 
ATOM   5260 C CA  . GLN B 1 140 ? -13.425 10.998  -48.576 1.00 61.34  ? 140  GLN B CA  1 
ATOM   5261 C C   . GLN B 1 140 ? -13.769 12.025  -47.500 1.00 61.79  ? 140  GLN B C   1 
ATOM   5262 O O   . GLN B 1 140 ? -14.391 13.035  -47.791 1.00 60.83  ? 140  GLN B O   1 
ATOM   5263 C CB  . GLN B 1 140 ? -14.190 9.700   -48.338 1.00 63.04  ? 140  GLN B CB  1 
ATOM   5264 C CG  . GLN B 1 140 ? -15.624 9.743   -48.831 1.00 69.98  ? 140  GLN B CG  1 
ATOM   5265 C CD  . GLN B 1 140 ? -16.510 10.614  -47.964 1.00 71.62  ? 140  GLN B CD  1 
ATOM   5266 O OE1 . GLN B 1 140 ? -16.716 10.326  -46.784 1.00 72.21  ? 140  GLN B OE1 1 
ATOM   5267 N NE2 . GLN B 1 140 ? -17.046 11.680  -48.547 1.00 63.32  ? 140  GLN B NE2 1 
ATOM   5268 N N   . VAL B 1 141 ? -13.343 11.774  -46.266 1.00 60.11  ? 141  VAL B N   1 
ATOM   5269 C CA  . VAL B 1 141 ? -13.773 12.579  -45.123 1.00 54.94  ? 141  VAL B CA  1 
ATOM   5270 C C   . VAL B 1 141 ? -13.153 13.970  -45.046 1.00 60.67  ? 141  VAL B C   1 
ATOM   5271 O O   . VAL B 1 141 ? -13.859 14.958  -44.826 1.00 61.75  ? 141  VAL B O   1 
ATOM   5272 C CB  . VAL B 1 141 ? -13.483 11.856  -43.807 1.00 61.14  ? 141  VAL B CB  1 
ATOM   5273 C CG1 . VAL B 1 141 ? -13.814 12.752  -42.624 1.00 47.38  ? 141  VAL B CG1 1 
ATOM   5274 C CG2 . VAL B 1 141 ? -14.254 10.544  -43.750 1.00 55.74  ? 141  VAL B CG2 1 
ATOM   5275 N N   . GLU B 1 142 ? -11.837 14.045  -45.213 1.00 58.29  ? 142  GLU B N   1 
ATOM   5276 C CA  . GLU B 1 142 ? -11.121 15.312  -45.086 1.00 51.74  ? 142  GLU B CA  1 
ATOM   5277 C C   . GLU B 1 142 ? -10.874 15.967  -46.439 1.00 59.72  ? 142  GLU B C   1 
ATOM   5278 O O   . GLU B 1 142 ? -10.272 17.044  -46.525 1.00 59.76  ? 142  GLU B O   1 
ATOM   5279 C CB  . GLU B 1 142 ? -9.793  15.102  -44.357 1.00 52.21  ? 142  GLU B CB  1 
ATOM   5280 C CG  . GLU B 1 142 ? -9.950  14.662  -42.913 1.00 59.73  ? 142  GLU B CG  1 
ATOM   5281 C CD  . GLU B 1 142 ? -10.802 15.631  -42.088 1.00 72.35  ? 142  GLU B CD  1 
ATOM   5282 O OE1 . GLU B 1 142 ? -10.829 16.844  -42.425 1.00 70.02  ? 142  GLU B OE1 1 
ATOM   5283 O OE2 . GLU B 1 142 ? -11.442 15.174  -41.104 1.00 66.30  ? 142  GLU B OE2 1 
ATOM   5284 N N   . GLY B 1 143 ? -11.340 15.311  -47.497 1.00 61.54  ? 143  GLY B N   1 
ATOM   5285 C CA  . GLY B 1 143 ? -11.123 15.795  -48.848 1.00 57.74  ? 143  GLY B CA  1 
ATOM   5286 C C   . GLY B 1 143 ? -9.646  15.910  -49.177 1.00 68.17  ? 143  GLY B C   1 
ATOM   5287 O O   . GLY B 1 143 ? -9.230  16.798  -49.926 1.00 68.37  ? 143  GLY B O   1 
ATOM   5288 N N   . ALA B 1 144 ? -8.846  15.012  -48.609 1.00 63.22  ? 144  ALA B N   1 
ATOM   5289 C CA  . ALA B 1 144 ? -7.406  15.067  -48.807 1.00 63.10  ? 144  ALA B CA  1 
ATOM   5290 C C   . ALA B 1 144 ? -7.023  14.340  -50.083 1.00 61.49  ? 144  ALA B C   1 
ATOM   5291 O O   . ALA B 1 144 ? -7.694  13.391  -50.489 1.00 57.61  ? 144  ALA B O   1 
ATOM   5292 C CB  . ALA B 1 144 ? -6.687  14.462  -47.619 1.00 59.46  ? 144  ALA B CB  1 
ATOM   5293 N N   . VAL B 1 145 ? -5.963  14.807  -50.732 1.00 57.70  ? 145  VAL B N   1 
ATOM   5294 C CA  . VAL B 1 145 ? -5.347  14.026  -51.792 1.00 57.77  ? 145  VAL B CA  1 
ATOM   5295 C C   . VAL B 1 145 ? -4.185  13.275  -51.169 1.00 56.77  ? 145  VAL B C   1 
ATOM   5296 O O   . VAL B 1 145 ? -3.249  13.877  -50.641 1.00 57.35  ? 145  VAL B O   1 
ATOM   5297 C CB  . VAL B 1 145 ? -4.840  14.896  -52.941 1.00 59.97  ? 145  VAL B CB  1 
ATOM   5298 C CG1 . VAL B 1 145 ? -3.939  14.073  -53.868 1.00 45.08  ? 145  VAL B CG1 1 
ATOM   5299 C CG2 . VAL B 1 145 ? -6.018  15.496  -53.696 1.00 63.16  ? 145  VAL B CG2 1 
ATOM   5300 N N   . LEU B 1 146 ? -4.251  11.955  -51.221 1.00 55.56  ? 146  LEU B N   1 
ATOM   5301 C CA  . LEU B 1 146 ? -3.294  11.139  -50.503 1.00 56.06  ? 146  LEU B CA  1 
ATOM   5302 C C   . LEU B 1 146 ? -2.464  10.255  -51.421 1.00 52.55  ? 146  LEU B C   1 
ATOM   5303 O O   . LEU B 1 146 ? -2.998  9.554   -52.280 1.00 59.65  ? 146  LEU B O   1 
ATOM   5304 C CB  . LEU B 1 146 ? -4.020  10.300  -49.454 1.00 60.31  ? 146  LEU B CB  1 
ATOM   5305 C CG  . LEU B 1 146 ? -3.069  9.633   -48.466 1.00 67.59  ? 146  LEU B CG  1 
ATOM   5306 C CD1 . LEU B 1 146 ? -3.715  9.529   -47.106 1.00 61.96  ? 146  LEU B CD1 1 
ATOM   5307 C CD2 . LEU B 1 146 ? -2.620  8.270   -48.983 1.00 62.77  ? 146  LEU B CD2 1 
ATOM   5308 N N   . VAL B 1 147 ? -1.152  10.292  -51.232 1.00 47.82  ? 147  VAL B N   1 
ATOM   5309 C CA  . VAL B 1 147 ? -0.241  9.503   -52.053 1.00 46.88  ? 147  VAL B CA  1 
ATOM   5310 C C   . VAL B 1 147 ? 0.556   8.517   -51.202 1.00 50.45  ? 147  VAL B C   1 
ATOM   5311 O O   . VAL B 1 147 ? 0.996   8.870   -50.117 1.00 51.57  ? 147  VAL B O   1 
ATOM   5312 C CB  . VAL B 1 147 ? 0.755   10.403  -52.765 1.00 42.69  ? 147  VAL B CB  1 
ATOM   5313 C CG1 . VAL B 1 147 ? 1.590   9.596   -53.727 1.00 43.94  ? 147  VAL B CG1 1 
ATOM   5314 C CG2 . VAL B 1 147 ? 0.030   11.516  -53.490 1.00 46.67  ? 147  VAL B CG2 1 
ATOM   5315 N N   . SER B 1 148 ? 0.724   7.283   -51.678 1.00 48.69  ? 148  SER B N   1 
ATOM   5316 C CA  . SER B 1 148 ? 1.671   6.350   -51.057 1.00 47.85  ? 148  SER B CA  1 
ATOM   5317 C C   . SER B 1 148 ? 2.490   5.625   -52.121 1.00 51.41  ? 148  SER B C   1 
ATOM   5318 O O   . SER B 1 148 ? 1.969   5.315   -53.189 1.00 48.67  ? 148  SER B O   1 
ATOM   5319 C CB  . SER B 1 148 ? 0.979   5.350   -50.128 1.00 44.25  ? 148  SER B CB  1 
ATOM   5320 O OG  . SER B 1 148 ? 0.127   4.470   -50.840 1.00 49.64  ? 148  SER B OG  1 
ATOM   5321 N N   . MET B 1 149 ? 3.771   5.374   -51.834 1.00 49.37  ? 149  MET B N   1 
ATOM   5322 C CA  . MET B 1 149 ? 4.655   4.677   -52.774 1.00 43.66  ? 149  MET B CA  1 
ATOM   5323 C C   . MET B 1 149 ? 5.284   3.406   -52.193 1.00 50.08  ? 149  MET B C   1 
ATOM   5324 O O   . MET B 1 149 ? 5.380   3.231   -50.969 1.00 46.68  ? 149  MET B O   1 
ATOM   5325 C CB  . MET B 1 149 ? 5.783   5.587   -53.220 1.00 43.33  ? 149  MET B CB  1 
ATOM   5326 C CG  . MET B 1 149 ? 6.990   5.548   -52.283 1.00 50.72  ? 149  MET B CG  1 
ATOM   5327 S SD  . MET B 1 149 ? 6.713   6.449   -50.736 1.00 49.57  ? 149  MET B SD  1 
ATOM   5328 C CE  . MET B 1 149 ? 7.018   8.120   -51.311 1.00 36.30  ? 149  MET B CE  1 
ATOM   5329 N N   . ASN B 1 150 ? 5.706   2.512   -53.079 1.00 46.76  ? 150  ASN B N   1 
ATOM   5330 C CA  . ASN B 1 150 ? 6.595   1.442   -52.664 1.00 50.32  ? 150  ASN B CA  1 
ATOM   5331 C C   . ASN B 1 150 ? 8.016   1.925   -52.867 1.00 48.95  ? 150  ASN B C   1 
ATOM   5332 O O   . ASN B 1 150 ? 8.285   2.706   -53.767 1.00 45.23  ? 150  ASN B O   1 
ATOM   5333 C CB  . ASN B 1 150 ? 6.371   0.182   -53.477 1.00 43.68  ? 150  ASN B CB  1 
ATOM   5334 C CG  . ASN B 1 150 ? 5.077   -0.497  -53.141 1.00 57.81  ? 150  ASN B CG  1 
ATOM   5335 O OD1 . ASN B 1 150 ? 4.435   -0.172  -52.146 1.00 53.49  ? 150  ASN B OD1 1 
ATOM   5336 N ND2 . ASN B 1 150 ? 4.680   -1.453  -53.970 1.00 58.76  ? 150  ASN B ND2 1 
ATOM   5337 N N   . TYR B 1 151 ? 8.918   1.470   -52.015 1.00 42.92  ? 151  TYR B N   1 
ATOM   5338 C CA  . TYR B 1 151 ? 10.329  1.722   -52.213 1.00 47.54  ? 151  TYR B CA  1 
ATOM   5339 C C   . TYR B 1 151 ? 11.054  0.432   -51.828 1.00 43.00  ? 151  TYR B C   1 
ATOM   5340 O O   . TYR B 1 151 ? 10.585  -0.311  -50.961 1.00 41.19  ? 151  TYR B O   1 
ATOM   5341 C CB  . TYR B 1 151 ? 10.785  2.925   -51.371 1.00 43.18  ? 151  TYR B CB  1 
ATOM   5342 C CG  . TYR B 1 151 ? 10.641  2.706   -49.888 1.00 45.92  ? 151  TYR B CG  1 
ATOM   5343 C CD1 . TYR B 1 151 ? 9.422   2.909   -49.246 1.00 46.61  ? 151  TYR B CD1 1 
ATOM   5344 C CD2 . TYR B 1 151 ? 11.712  2.260   -49.134 1.00 38.97  ? 151  TYR B CD2 1 
ATOM   5345 C CE1 . TYR B 1 151 ? 9.287   2.696   -47.884 1.00 44.71  ? 151  TYR B CE1 1 
ATOM   5346 C CE2 . TYR B 1 151 ? 11.585  2.046   -47.779 1.00 45.23  ? 151  TYR B CE2 1 
ATOM   5347 C CZ  . TYR B 1 151 ? 10.376  2.269   -47.153 1.00 46.92  ? 151  TYR B CZ  1 
ATOM   5348 O OH  . TYR B 1 151 ? 10.269  2.052   -45.791 1.00 43.55  ? 151  TYR B OH  1 
ATOM   5349 N N   . ARG B 1 152 ? 12.173  0.149   -52.485 1.00 42.94  ? 152  ARG B N   1 
ATOM   5350 C CA  . ARG B 1 152 ? 12.905  -1.090  -52.230 1.00 49.01  ? 152  ARG B CA  1 
ATOM   5351 C C   . ARG B 1 152 ? 13.376  -1.189  -50.772 1.00 43.27  ? 152  ARG B C   1 
ATOM   5352 O O   . ARG B 1 152 ? 13.844  -0.215  -50.196 1.00 40.75  ? 152  ARG B O   1 
ATOM   5353 C CB  . ARG B 1 152 ? 14.105  -1.195  -53.167 1.00 44.04  ? 152  ARG B CB  1 
ATOM   5354 C CG  . ARG B 1 152 ? 13.752  -1.412  -54.612 1.00 45.92  ? 152  ARG B CG  1 
ATOM   5355 C CD  . ARG B 1 152 ? 14.992  -1.262  -55.490 1.00 44.05  ? 152  ARG B CD  1 
ATOM   5356 N NE  . ARG B 1 152 ? 15.262  0.130   -55.829 1.00 44.46  ? 152  ARG B NE  1 
ATOM   5357 C CZ  . ARG B 1 152 ? 16.329  0.541   -56.509 1.00 51.68  ? 152  ARG B CZ  1 
ATOM   5358 N NH1 . ARG B 1 152 ? 17.240  -0.335  -56.932 1.00 42.55  ? 152  ARG B NH1 1 
ATOM   5359 N NH2 . ARG B 1 152 ? 16.479  1.832   -56.771 1.00 43.46  ? 152  ARG B NH2 1 
ATOM   5360 N N   . VAL B 1 153 ? 13.262  -2.376  -50.192 1.00 46.13  ? 153  VAL B N   1 
ATOM   5361 C CA  . VAL B 1 153 ? 13.711  -2.609  -48.827 1.00 41.47  ? 153  VAL B CA  1 
ATOM   5362 C C   . VAL B 1 153 ? 14.803  -3.680  -48.763 1.00 47.77  ? 153  VAL B C   1 
ATOM   5363 O O   . VAL B 1 153 ? 15.233  -4.200  -49.789 1.00 54.14  ? 153  VAL B O   1 
ATOM   5364 C CB  . VAL B 1 153 ? 12.537  -3.001  -47.932 1.00 47.00  ? 153  VAL B CB  1 
ATOM   5365 C CG1 . VAL B 1 153 ? 11.501  -1.892  -47.934 1.00 50.74  ? 153  VAL B CG1 1 
ATOM   5366 C CG2 . VAL B 1 153 ? 11.913  -4.307  -48.402 1.00 42.57  ? 153  VAL B CG2 1 
ATOM   5367 N N   . GLY B 1 154 ? 15.258  -3.997  -47.553 1.00 53.34  ? 154  GLY B N   1 
ATOM   5368 C CA  . GLY B 1 154 ? 16.332  -4.958  -47.352 1.00 48.58  ? 154  GLY B CA  1 
ATOM   5369 C C   . GLY B 1 154 ? 17.527  -4.746  -48.268 1.00 53.54  ? 154  GLY B C   1 
ATOM   5370 O O   . GLY B 1 154 ? 17.922  -3.609  -48.554 1.00 54.52  ? 154  GLY B O   1 
ATOM   5371 N N   . THR B 1 155 ? 18.109  -5.844  -48.740 1.00 51.42  ? 155  THR B N   1 
ATOM   5372 C CA  . THR B 1 155 ? 19.289  -5.752  -49.593 1.00 54.91  ? 155  THR B CA  1 
ATOM   5373 C C   . THR B 1 155 ? 19.053  -4.932  -50.857 1.00 54.03  ? 155  THR B C   1 
ATOM   5374 O O   . THR B 1 155 ? 19.954  -4.240  -51.328 1.00 56.11  ? 155  THR B O   1 
ATOM   5375 C CB  . THR B 1 155 ? 19.781  -7.132  -50.016 1.00 51.06  ? 155  THR B CB  1 
ATOM   5376 O OG1 . THR B 1 155 ? 18.680  -7.875  -50.541 1.00 63.23  ? 155  THR B OG1 1 
ATOM   5377 C CG2 . THR B 1 155 ? 20.353  -7.875  -48.826 1.00 56.77  ? 155  THR B CG2 1 
ATOM   5378 N N   . PHE B 1 156 ? 17.848  -5.003  -51.409 1.00 42.23  ? 156  PHE B N   1 
ATOM   5379 C CA  . PHE B 1 156 ? 17.619  -4.383  -52.710 1.00 45.79  ? 156  PHE B CA  1 
ATOM   5380 C C   . PHE B 1 156 ? 17.585  -2.874  -52.633 1.00 49.04  ? 156  PHE B C   1 
ATOM   5381 O O   . PHE B 1 156 ? 17.934  -2.207  -53.594 1.00 53.76  ? 156  PHE B O   1 
ATOM   5382 C CB  . PHE B 1 156 ? 16.344  -4.920  -53.342 1.00 41.81  ? 156  PHE B CB  1 
ATOM   5383 C CG  . PHE B 1 156 ? 16.242  -6.407  -53.272 1.00 49.99  ? 156  PHE B CG  1 
ATOM   5384 C CD1 . PHE B 1 156 ? 16.846  -7.200  -54.233 1.00 44.96  ? 156  PHE B CD1 1 
ATOM   5385 C CD2 . PHE B 1 156 ? 15.581  -7.021  -52.215 1.00 50.30  ? 156  PHE B CD2 1 
ATOM   5386 C CE1 . PHE B 1 156 ? 16.768  -8.576  -54.155 1.00 50.69  ? 156  PHE B CE1 1 
ATOM   5387 C CE2 . PHE B 1 156 ? 15.497  -8.401  -52.139 1.00 51.77  ? 156  PHE B CE2 1 
ATOM   5388 C CZ  . PHE B 1 156 ? 16.092  -9.179  -53.108 1.00 46.78  ? 156  PHE B CZ  1 
ATOM   5389 N N   . GLY B 1 157 ? 17.170  -2.340  -51.486 1.00 49.33  ? 157  GLY B N   1 
ATOM   5390 C CA  . GLY B 1 157 ? 17.093  -0.902  -51.294 1.00 47.83  ? 157  GLY B CA  1 
ATOM   5391 C C   . GLY B 1 157 ? 18.254  -0.270  -50.534 1.00 48.67  ? 157  GLY B C   1 
ATOM   5392 O O   . GLY B 1 157 ? 18.574  0.898   -50.749 1.00 44.76  ? 157  GLY B O   1 
ATOM   5393 N N   . PHE B 1 158 ? 18.906  -1.025  -49.655 1.00 51.37  ? 158  PHE B N   1 
ATOM   5394 C CA  . PHE B 1 158 ? 19.934  -0.403  -48.824 1.00 51.38  ? 158  PHE B CA  1 
ATOM   5395 C C   . PHE B 1 158 ? 21.284  -1.092  -48.752 1.00 54.79  ? 158  PHE B C   1 
ATOM   5396 O O   . PHE B 1 158 ? 22.152  -0.647  -48.013 1.00 55.37  ? 158  PHE B O   1 
ATOM   5397 C CB  . PHE B 1 158 ? 19.388  -0.130  -47.428 1.00 41.96  ? 158  PHE B CB  1 
ATOM   5398 C CG  . PHE B 1 158 ? 18.160  0.705   -47.448 1.00 44.44  ? 158  PHE B CG  1 
ATOM   5399 C CD1 . PHE B 1 158 ? 18.252  2.073   -47.586 1.00 41.95  ? 158  PHE B CD1 1 
ATOM   5400 C CD2 . PHE B 1 158 ? 16.910  0.122   -47.389 1.00 44.31  ? 158  PHE B CD2 1 
ATOM   5401 C CE1 . PHE B 1 158 ? 17.122  2.848   -47.631 1.00 46.03  ? 158  PHE B CE1 1 
ATOM   5402 C CE2 . PHE B 1 158 ? 15.777  0.894   -47.435 1.00 46.79  ? 158  PHE B CE2 1 
ATOM   5403 C CZ  . PHE B 1 158 ? 15.880  2.258   -47.561 1.00 44.74  ? 158  PHE B CZ  1 
ATOM   5404 N N   . LEU B 1 159 ? 21.478  -2.160  -49.518 1.00 60.98  ? 159  LEU B N   1 
ATOM   5405 C CA  . LEU B 1 159 ? 22.787  -2.808  -49.543 1.00 55.24  ? 159  LEU B CA  1 
ATOM   5406 C C   . LEU B 1 159 ? 23.799  -1.928  -50.269 1.00 47.59  ? 159  LEU B C   1 
ATOM   5407 O O   . LEU B 1 159 ? 23.634  -1.619  -51.443 1.00 55.91  ? 159  LEU B O   1 
ATOM   5408 C CB  . LEU B 1 159 ? 22.714  -4.196  -50.183 1.00 49.98  ? 159  LEU B CB  1 
ATOM   5409 C CG  . LEU B 1 159 ? 24.066  -4.899  -50.362 1.00 56.91  ? 159  LEU B CG  1 
ATOM   5410 C CD1 . LEU B 1 159 ? 23.905  -6.417  -50.327 1.00 53.09  ? 159  LEU B CD1 1 
ATOM   5411 C CD2 . LEU B 1 159 ? 24.767  -4.459  -51.641 1.00 50.19  ? 159  LEU B CD2 1 
ATOM   5412 N N   . ALA B 1 160 ? 24.847  -1.521  -49.566 1.00 53.61  ? 160  ALA B N   1 
ATOM   5413 C CA  . ALA B 1 160 ? 25.840  -0.631  -50.160 1.00 62.76  ? 160  ALA B CA  1 
ATOM   5414 C C   . ALA B 1 160 ? 27.280  -1.130  -50.038 1.00 62.22  ? 160  ALA B C   1 
ATOM   5415 O O   . ALA B 1 160 ? 27.658  -1.799  -49.065 1.00 55.57  ? 160  ALA B O   1 
ATOM   5416 C CB  . ALA B 1 160 ? 25.720  0.773   -49.575 1.00 58.48  ? 160  ALA B CB  1 
ATOM   5417 N N   . LEU B 1 161 ? 28.056  -0.816  -51.068 1.00 60.04  ? 161  LEU B N   1 
ATOM   5418 C CA  . LEU B 1 161 ? 29.503  -0.840  -51.012 1.00 58.45  ? 161  LEU B CA  1 
ATOM   5419 C C   . LEU B 1 161 ? 29.886  0.602   -51.218 1.00 58.69  ? 161  LEU B C   1 
ATOM   5420 O O   . LEU B 1 161 ? 30.106  1.043   -52.346 1.00 54.44  ? 161  LEU B O   1 
ATOM   5421 C CB  . LEU B 1 161 ? 30.083  -1.703  -52.123 1.00 59.84  ? 161  LEU B CB  1 
ATOM   5422 C CG  . LEU B 1 161 ? 29.844  -3.185  -51.861 1.00 65.81  ? 161  LEU B CG  1 
ATOM   5423 C CD1 . LEU B 1 161 ? 30.479  -4.025  -52.940 1.00 80.23  ? 161  LEU B CD1 1 
ATOM   5424 C CD2 . LEU B 1 161 ? 30.409  -3.561  -50.509 1.00 66.07  ? 161  LEU B CD2 1 
ATOM   5425 N N   . PRO B 1 162 ? 29.936  1.355   -50.119 1.00 57.13  ? 162  PRO B N   1 
ATOM   5426 C CA  . PRO B 1 162 ? 30.136  2.803   -50.151 1.00 60.28  ? 162  PRO B CA  1 
ATOM   5427 C C   . PRO B 1 162 ? 31.273  3.197   -51.074 1.00 59.29  ? 162  PRO B C   1 
ATOM   5428 O O   . PRO B 1 162 ? 32.335  2.578   -51.033 1.00 65.59  ? 162  PRO B O   1 
ATOM   5429 C CB  . PRO B 1 162 ? 30.467  3.127   -48.698 1.00 57.86  ? 162  PRO B CB  1 
ATOM   5430 C CG  . PRO B 1 162 ? 29.719  2.094   -47.927 1.00 56.71  ? 162  PRO B CG  1 
ATOM   5431 C CD  . PRO B 1 162 ? 29.843  0.842   -48.744 1.00 58.60  ? 162  PRO B CD  1 
ATOM   5432 N N   . GLY B 1 163 ? 31.034  4.198   -51.915 1.00 60.79  ? 163  GLY B N   1 
ATOM   5433 C CA  . GLY B 1 163 ? 32.037  4.671   -52.849 1.00 54.94  ? 163  GLY B CA  1 
ATOM   5434 C C   . GLY B 1 163 ? 32.000  3.940   -54.177 1.00 69.48  ? 163  GLY B C   1 
ATOM   5435 O O   . GLY B 1 163 ? 32.547  4.428   -55.175 1.00 65.71  ? 163  GLY B O   1 
ATOM   5436 N N   . SER B 1 164 ? 31.368  2.767   -54.200 1.00 61.67  ? 164  SER B N   1 
ATOM   5437 C CA  . SER B 1 164 ? 31.216  2.024   -55.449 1.00 61.37  ? 164  SER B CA  1 
ATOM   5438 C C   . SER B 1 164 ? 30.271  2.772   -56.379 1.00 65.38  ? 164  SER B C   1 
ATOM   5439 O O   . SER B 1 164 ? 29.500  3.625   -55.936 1.00 65.05  ? 164  SER B O   1 
ATOM   5440 C CB  . SER B 1 164 ? 30.670  0.629   -55.186 1.00 59.80  ? 164  SER B CB  1 
ATOM   5441 O OG  . SER B 1 164 ? 29.315  0.689   -54.778 1.00 62.24  ? 164  SER B OG  1 
ATOM   5442 N N   . ARG B 1 165 ? 30.325  2.454   -57.668 1.00 69.97  ? 165  ARG B N   1 
ATOM   5443 C CA  . ARG B 1 165 ? 29.424  3.085   -58.621 1.00 73.85  ? 165  ARG B CA  1 
ATOM   5444 C C   . ARG B 1 165 ? 28.130  2.278   -58.716 1.00 74.77  ? 165  ARG B C   1 
ATOM   5445 O O   . ARG B 1 165 ? 27.060  2.828   -58.985 1.00 70.13  ? 165  ARG B O   1 
ATOM   5446 C CB  . ARG B 1 165 ? 30.075  3.188   -60.001 1.00 74.83  ? 165  ARG B CB  1 
ATOM   5447 C CG  . ARG B 1 165 ? 29.431  4.231   -60.912 1.00 94.60  ? 165  ARG B CG  1 
ATOM   5448 C CD  . ARG B 1 165 ? 29.469  3.834   -62.400 1.00 99.14  ? 165  ARG B CD  1 
ATOM   5449 N NE  . ARG B 1 165 ? 28.217  3.223   -62.861 1.00 98.65  ? 165  ARG B NE  1 
ATOM   5450 C CZ  . ARG B 1 165 ? 28.048  1.923   -63.113 1.00 100.69 ? 165  ARG B CZ  1 
ATOM   5451 N NH1 . ARG B 1 165 ? 29.057  1.073   -62.955 1.00 101.36 ? 165  ARG B NH1 1 
ATOM   5452 N NH2 . ARG B 1 165 ? 26.868  1.468   -63.529 1.00 79.80  ? 165  ARG B NH2 1 
ATOM   5453 N N   . GLU B 1 166 ? 28.237  0.975   -58.468 1.00 64.92  ? 166  GLU B N   1 
ATOM   5454 C CA  . GLU B 1 166 ? 27.142  0.046   -58.740 1.00 72.07  ? 166  GLU B CA  1 
ATOM   5455 C C   . GLU B 1 166 ? 26.401  -0.439  -57.489 1.00 66.58  ? 166  GLU B C   1 
ATOM   5456 O O   . GLU B 1 166 ? 25.553  -1.335  -57.557 1.00 60.98  ? 166  GLU B O   1 
ATOM   5457 C CB  . GLU B 1 166 ? 27.652  -1.145  -59.559 1.00 77.53  ? 166  GLU B CB  1 
ATOM   5458 C CG  . GLU B 1 166 ? 28.943  -1.745  -59.029 1.00 82.47  ? 166  GLU B CG  1 
ATOM   5459 C CD  . GLU B 1 166 ? 30.191  -1.024  -59.531 1.00 89.81  ? 166  GLU B CD  1 
ATOM   5460 O OE1 . GLU B 1 166 ? 30.426  -1.038  -60.766 1.00 80.99  ? 166  GLU B OE1 1 
ATOM   5461 O OE2 . GLU B 1 166 ? 30.941  -0.466  -58.687 1.00 82.08  ? 166  GLU B OE2 1 
ATOM   5462 N N   . ALA B 1 167 ? 26.727  0.162   -56.352 1.00 65.98  ? 167  ALA B N   1 
ATOM   5463 C CA  . ALA B 1 167 ? 26.004  -0.073  -55.106 1.00 64.46  ? 167  ALA B CA  1 
ATOM   5464 C C   . ALA B 1 167 ? 26.328  1.069   -54.156 1.00 58.89  ? 167  ALA B C   1 
ATOM   5465 O O   . ALA B 1 167 ? 27.057  0.887   -53.190 1.00 57.45  ? 167  ALA B O   1 
ATOM   5466 C CB  . ALA B 1 167 ? 26.384  -1.412  -54.498 1.00 48.89  ? 167  ALA B CB  1 
ATOM   5467 N N   . PRO B 1 168 ? 25.784  2.258   -54.448 1.00 63.26  ? 168  PRO B N   1 
ATOM   5468 C CA  . PRO B 1 168 ? 26.125  3.524   -53.791 1.00 59.98  ? 168  PRO B CA  1 
ATOM   5469 C C   . PRO B 1 168 ? 25.491  3.668   -52.407 1.00 57.35  ? 168  PRO B C   1 
ATOM   5470 O O   . PRO B 1 168 ? 25.962  4.455   -51.588 1.00 59.58  ? 168  PRO B O   1 
ATOM   5471 C CB  . PRO B 1 168 ? 25.531  4.576   -54.737 1.00 49.37  ? 168  PRO B CB  1 
ATOM   5472 C CG  . PRO B 1 168 ? 25.064  3.827   -55.959 1.00 57.28  ? 168  PRO B CG  1 
ATOM   5473 C CD  . PRO B 1 168 ? 24.770  2.450   -55.495 1.00 55.26  ? 168  PRO B CD  1 
ATOM   5474 N N   . GLY B 1 169 ? 24.426  2.917   -52.162 1.00 53.79  ? 169  GLY B N   1 
ATOM   5475 C CA  . GLY B 1 169 ? 23.691  3.019   -50.919 1.00 52.60  ? 169  GLY B CA  1 
ATOM   5476 C C   . GLY B 1 169 ? 22.471  3.921   -51.015 1.00 50.84  ? 169  GLY B C   1 
ATOM   5477 O O   . GLY B 1 169 ? 22.360  4.761   -51.916 1.00 53.00  ? 169  GLY B O   1 
ATOM   5478 N N   . ASN B 1 170 ? 21.550  3.730   -50.078 1.00 46.66  ? 170  ASN B N   1 
ATOM   5479 C CA  . ASN B 1 170 ? 20.383  4.589   -49.936 1.00 49.74  ? 170  ASN B CA  1 
ATOM   5480 C C   . ASN B 1 170 ? 19.451  4.614   -51.148 1.00 54.85  ? 170  ASN B C   1 
ATOM   5481 O O   . ASN B 1 170 ? 18.693  5.575   -51.312 1.00 48.88  ? 170  ASN B O   1 
ATOM   5482 C CB  . ASN B 1 170 ? 20.822  6.023   -49.611 1.00 52.94  ? 170  ASN B CB  1 
ATOM   5483 C CG  . ASN B 1 170 ? 21.594  6.124   -48.297 1.00 58.31  ? 170  ASN B CG  1 
ATOM   5484 O OD1 . ASN B 1 170 ? 21.253  5.469   -47.306 1.00 49.55  ? 170  ASN B OD1 1 
ATOM   5485 N ND2 . ASN B 1 170 ? 22.634  6.961   -48.283 1.00 52.03  ? 170  ASN B ND2 1 
ATOM   5486 N N   . VAL B 1 171 ? 19.495  3.589   -52.002 1.00 43.76  ? 171  VAL B N   1 
ATOM   5487 C CA  . VAL B 1 171 ? 18.663  3.647   -53.197 1.00 43.15  ? 171  VAL B CA  1 
ATOM   5488 C C   . VAL B 1 171 ? 17.174  3.619   -52.834 1.00 46.93  ? 171  VAL B C   1 
ATOM   5489 O O   . VAL B 1 171 ? 16.344  4.215   -53.517 1.00 44.96  ? 171  VAL B O   1 
ATOM   5490 C CB  . VAL B 1 171 ? 19.014  2.564   -54.250 1.00 50.50  ? 171  VAL B CB  1 
ATOM   5491 C CG1 . VAL B 1 171 ? 20.477  2.670   -54.637 1.00 50.71  ? 171  VAL B CG1 1 
ATOM   5492 C CG2 . VAL B 1 171 ? 18.646  1.155   -53.768 1.00 43.09  ? 171  VAL B CG2 1 
ATOM   5493 N N   . GLY B 1 172 ? 16.843  2.951   -51.738 1.00 44.30  ? 172  GLY B N   1 
ATOM   5494 C CA  . GLY B 1 172 ? 15.478  2.939   -51.263 1.00 44.56  ? 172  GLY B CA  1 
ATOM   5495 C C   . GLY B 1 172 ? 14.997  4.336   -50.910 1.00 49.37  ? 172  GLY B C   1 
ATOM   5496 O O   . GLY B 1 172 ? 13.812  4.631   -51.028 1.00 48.45  ? 172  GLY B O   1 
ATOM   5497 N N   . LEU B 1 173 ? 15.905  5.204   -50.466 1.00 46.90  ? 173  LEU B N   1 
ATOM   5498 C CA  . LEU B 1 173 ? 15.518  6.575   -50.141 1.00 42.78  ? 173  LEU B CA  1 
ATOM   5499 C C   . LEU B 1 173 ? 15.393  7.379   -51.417 1.00 44.56  ? 173  LEU B C   1 
ATOM   5500 O O   . LEU B 1 173 ? 14.539  8.256   -51.529 1.00 43.24  ? 173  LEU B O   1 
ATOM   5501 C CB  . LEU B 1 173 ? 16.508  7.238   -49.178 1.00 51.45  ? 173  LEU B CB  1 
ATOM   5502 C CG  . LEU B 1 173 ? 16.610  6.644   -47.766 1.00 49.95  ? 173  LEU B CG  1 
ATOM   5503 C CD1 . LEU B 1 173 ? 17.821  7.191   -47.049 1.00 49.36  ? 173  LEU B CD1 1 
ATOM   5504 C CD2 . LEU B 1 173 ? 15.353  6.878   -46.948 1.00 41.12  ? 173  LEU B CD2 1 
ATOM   5505 N N   . LEU B 1 174 ? 16.241  7.064   -52.387 1.00 40.98  ? 174  LEU B N   1 
ATOM   5506 C CA  . LEU B 1 174 ? 16.118  7.644   -53.714 1.00 44.09  ? 174  LEU B CA  1 
ATOM   5507 C C   . LEU B 1 174 ? 14.796  7.275   -54.387 1.00 45.31  ? 174  LEU B C   1 
ATOM   5508 O O   . LEU B 1 174 ? 14.191  8.099   -55.054 1.00 48.31  ? 174  LEU B O   1 
ATOM   5509 C CB  . LEU B 1 174 ? 17.297  7.234   -54.577 1.00 45.93  ? 174  LEU B CB  1 
ATOM   5510 C CG  . LEU B 1 174 ? 18.589  7.779   -53.977 1.00 49.58  ? 174  LEU B CG  1 
ATOM   5511 C CD1 . LEU B 1 174 ? 19.810  7.311   -54.765 1.00 42.63  ? 174  LEU B CD1 1 
ATOM   5512 C CD2 . LEU B 1 174 ? 18.515  9.293   -53.895 1.00 40.59  ? 174  LEU B CD2 1 
ATOM   5513 N N   . ASP B 1 175 ? 14.346  6.039   -54.214 1.00 48.88  ? 175  ASP B N   1 
ATOM   5514 C CA  . ASP B 1 175 ? 13.008  5.665   -54.650 1.00 47.24  ? 175  ASP B CA  1 
ATOM   5515 C C   . ASP B 1 175 ? 11.988  6.641   -54.088 1.00 44.60  ? 175  ASP B C   1 
ATOM   5516 O O   . ASP B 1 175 ? 11.178  7.189   -54.822 1.00 44.83  ? 175  ASP B O   1 
ATOM   5517 C CB  . ASP B 1 175 ? 12.657  4.258   -54.174 1.00 44.68  ? 175  ASP B CB  1 
ATOM   5518 C CG  . ASP B 1 175 ? 13.547  3.204   -54.787 1.00 49.45  ? 175  ASP B CG  1 
ATOM   5519 O OD1 . ASP B 1 175 ? 14.342  3.552   -55.685 1.00 46.58  ? 175  ASP B OD1 1 
ATOM   5520 O OD2 . ASP B 1 175 ? 13.453  2.029   -54.369 1.00 50.00  ? 175  ASP B OD2 1 
ATOM   5521 N N   . GLN B 1 176 ? 12.026  6.847   -52.778 1.00 36.74  ? 176  GLN B N   1 
ATOM   5522 C CA  . GLN B 1 176 ? 11.096  7.755   -52.134 1.00 42.68  ? 176  GLN B CA  1 
ATOM   5523 C C   . GLN B 1 176 ? 11.215  9.160   -52.729 1.00 48.65  ? 176  GLN B C   1 
ATOM   5524 O O   . GLN B 1 176 ? 10.207  9.802   -53.025 1.00 46.43  ? 176  GLN B O   1 
ATOM   5525 C CB  . GLN B 1 176 ? 11.326  7.794   -50.620 1.00 46.26  ? 176  GLN B CB  1 
ATOM   5526 C CG  . GLN B 1 176 ? 11.183  6.447   -49.920 1.00 41.95  ? 176  GLN B CG  1 
ATOM   5527 C CD  . GLN B 1 176 ? 11.657  6.497   -48.471 1.00 50.08  ? 176  GLN B CD  1 
ATOM   5528 O OE1 . GLN B 1 176 ? 11.902  7.582   -47.923 1.00 46.69  ? 176  GLN B OE1 1 
ATOM   5529 N NE2 . GLN B 1 176 ? 11.776  5.321   -47.836 1.00 40.58  ? 176  GLN B NE2 1 
ATOM   5530 N N   . ARG B 1 177 ? 12.443  9.634   -52.914 1.00 39.45  ? 177  ARG B N   1 
ATOM   5531 C CA  . ARG B 1 177 ? 12.641  10.965  -53.469 1.00 46.21  ? 177  ARG B CA  1 
ATOM   5532 C C   . ARG B 1 177 ? 12.057  11.086  -54.880 1.00 49.74  ? 177  ARG B C   1 
ATOM   5533 O O   . ARG B 1 177 ? 11.520  12.128  -55.266 1.00 46.68  ? 177  ARG B O   1 
ATOM   5534 C CB  . ARG B 1 177 ? 14.128  11.334  -53.476 1.00 44.75  ? 177  ARG B CB  1 
ATOM   5535 C CG  . ARG B 1 177 ? 14.429  12.591  -54.262 1.00 50.70  ? 177  ARG B CG  1 
ATOM   5536 C CD  . ARG B 1 177 ? 15.887  12.992  -54.157 1.00 43.95  ? 177  ARG B CD  1 
ATOM   5537 N NE  . ARG B 1 177 ? 16.222  13.394  -52.802 1.00 60.99  ? 177  ARG B NE  1 
ATOM   5538 C CZ  . ARG B 1 177 ? 17.463  13.433  -52.325 1.00 71.54  ? 177  ARG B CZ  1 
ATOM   5539 N NH1 . ARG B 1 177 ? 18.479  13.083  -53.114 1.00 67.05  ? 177  ARG B NH1 1 
ATOM   5540 N NH2 . ARG B 1 177 ? 17.686  13.820  -51.065 1.00 56.52  ? 177  ARG B NH2 1 
ATOM   5541 N N   . LEU B 1 178 ? 12.164  10.009  -55.649 1.00 52.15  ? 178  LEU B N   1 
ATOM   5542 C CA  . LEU B 1 178 ? 11.738  10.031  -57.036 1.00 48.76  ? 178  LEU B CA  1 
ATOM   5543 C C   . LEU B 1 178 ? 10.227  10.161  -57.087 1.00 48.54  ? 178  LEU B C   1 
ATOM   5544 O O   . LEU B 1 178 ? 9.689   10.942  -57.870 1.00 54.99  ? 178  LEU B O   1 
ATOM   5545 C CB  . LEU B 1 178 ? 12.223  8.781   -57.782 1.00 47.74  ? 178  LEU B CB  1 
ATOM   5546 C CG  . LEU B 1 178 ? 11.894  8.722   -59.280 1.00 54.48  ? 178  LEU B CG  1 
ATOM   5547 C CD1 . LEU B 1 178 ? 12.390  9.965   -60.012 1.00 46.59  ? 178  LEU B CD1 1 
ATOM   5548 C CD2 . LEU B 1 178 ? 12.473  7.475   -59.891 1.00 53.52  ? 178  LEU B CD2 1 
ATOM   5549 N N   . ALA B 1 179 ? 9.554   9.398   -56.235 1.00 44.15  ? 179  ALA B N   1 
ATOM   5550 C CA  . ALA B 1 179 ? 8.113   9.495   -56.087 1.00 42.51  ? 179  ALA B CA  1 
ATOM   5551 C C   . ALA B 1 179 ? 7.693   10.902  -55.629 1.00 47.18  ? 179  ALA B C   1 
ATOM   5552 O O   . ALA B 1 179 ? 6.661   11.411  -56.054 1.00 53.86  ? 179  ALA B O   1 
ATOM   5553 C CB  . ALA B 1 179 ? 7.607   8.425   -55.128 1.00 39.63  ? 179  ALA B CB  1 
ATOM   5554 N N   . LEU B 1 180 ? 8.500   11.540  -54.786 1.00 49.20  ? 180  LEU B N   1 
ATOM   5555 C CA  . LEU B 1 180 ? 8.235   12.924  -54.375 1.00 47.92  ? 180  LEU B CA  1 
ATOM   5556 C C   . LEU B 1 180 ? 8.269   13.870  -55.565 1.00 48.60  ? 180  LEU B C   1 
ATOM   5557 O O   . LEU B 1 180 ? 7.380   14.709  -55.704 1.00 51.43  ? 180  LEU B O   1 
ATOM   5558 C CB  . LEU B 1 180 ? 9.229   13.397  -53.309 1.00 42.49  ? 180  LEU B CB  1 
ATOM   5559 C CG  . LEU B 1 180 ? 8.856   13.270  -51.829 1.00 48.08  ? 180  LEU B CG  1 
ATOM   5560 C CD1 . LEU B 1 180 ? 8.154   11.956  -51.503 1.00 40.49  ? 180  LEU B CD1 1 
ATOM   5561 C CD2 . LEU B 1 180 ? 10.094  13.451  -50.958 1.00 44.23  ? 180  LEU B CD2 1 
ATOM   5562 N N   . GLN B 1 181 ? 9.298   13.742  -56.406 1.00 48.53  ? 181  GLN B N   1 
ATOM   5563 C CA  . GLN B 1 181 ? 9.406   14.527  -57.640 1.00 52.18  ? 181  GLN B CA  1 
ATOM   5564 C C   . GLN B 1 181 ? 8.218   14.247  -58.560 1.00 53.98  ? 181  GLN B C   1 
ATOM   5565 O O   . GLN B 1 181 ? 7.693   15.145  -59.204 1.00 55.25  ? 181  GLN B O   1 
ATOM   5566 C CB  . GLN B 1 181 ? 10.707  14.211  -58.394 1.00 54.57  ? 181  GLN B CB  1 
ATOM   5567 C CG  . GLN B 1 181 ? 11.956  14.901  -57.858 1.00 68.75  ? 181  GLN B CG  1 
ATOM   5568 C CD  . GLN B 1 181 ? 13.243  14.063  -58.033 1.00 74.63  ? 181  GLN B CD  1 
ATOM   5569 O OE1 . GLN B 1 181 ? 13.208  12.911  -58.488 1.00 74.20  ? 181  GLN B OE1 1 
ATOM   5570 N NE2 . GLN B 1 181 ? 14.378  14.645  -57.654 1.00 64.47  ? 181  GLN B NE2 1 
ATOM   5571 N N   . TRP B 1 182 ? 7.803   12.990  -58.624 1.00 48.52  ? 182  TRP B N   1 
ATOM   5572 C CA  . TRP B 1 182 ? 6.673   12.628  -59.456 1.00 54.47  ? 182  TRP B CA  1 
ATOM   5573 C C   . TRP B 1 182 ? 5.441   13.395  -58.998 1.00 54.35  ? 182  TRP B C   1 
ATOM   5574 O O   . TRP B 1 182 ? 4.631   13.822  -59.819 1.00 52.12  ? 182  TRP B O   1 
ATOM   5575 C CB  . TRP B 1 182 ? 6.407   11.125  -59.382 1.00 51.57  ? 182  TRP B CB  1 
ATOM   5576 C CG  . TRP B 1 182 ? 5.312   10.664  -60.301 1.00 58.33  ? 182  TRP B CG  1 
ATOM   5577 C CD1 . TRP B 1 182 ? 5.465   10.122  -61.546 1.00 52.93  ? 182  TRP B CD1 1 
ATOM   5578 C CD2 . TRP B 1 182 ? 3.898   10.699  -60.051 1.00 52.97  ? 182  TRP B CD2 1 
ATOM   5579 N NE1 . TRP B 1 182 ? 4.237   9.817   -62.082 1.00 51.76  ? 182  TRP B NE1 1 
ATOM   5580 C CE2 . TRP B 1 182 ? 3.259   10.162  -61.188 1.00 53.08  ? 182  TRP B CE2 1 
ATOM   5581 C CE3 . TRP B 1 182 ? 3.113   11.128  -58.978 1.00 55.44  ? 182  TRP B CE3 1 
ATOM   5582 C CZ2 . TRP B 1 182 ? 1.871   10.047  -61.286 1.00 57.55  ? 182  TRP B CZ2 1 
ATOM   5583 C CZ3 . TRP B 1 182 ? 1.727   11.014  -59.079 1.00 58.44  ? 182  TRP B CZ3 1 
ATOM   5584 C CH2 . TRP B 1 182 ? 1.124   10.478  -60.223 1.00 56.88  ? 182  TRP B CH2 1 
ATOM   5585 N N   . VAL B 1 183 ? 5.307   13.552  -57.681 1.00 50.14  ? 183  VAL B N   1 
ATOM   5586 C CA  . VAL B 1 183 ? 4.175   14.261  -57.101 1.00 52.15  ? 183  VAL B CA  1 
ATOM   5587 C C   . VAL B 1 183 ? 4.218   15.751  -57.438 1.00 53.77  ? 183  VAL B C   1 
ATOM   5588 O O   . VAL B 1 183 ? 3.185   16.371  -57.685 1.00 54.21  ? 183  VAL B O   1 
ATOM   5589 C CB  . VAL B 1 183 ? 4.101   14.076  -55.579 1.00 47.86  ? 183  VAL B CB  1 
ATOM   5590 C CG1 . VAL B 1 183 ? 3.243   15.174  -54.950 1.00 40.20  ? 183  VAL B CG1 1 
ATOM   5591 C CG2 . VAL B 1 183 ? 3.568   12.695  -55.242 1.00 41.85  ? 183  VAL B CG2 1 
ATOM   5592 N N   . GLN B 1 184 ? 5.414   16.321  -57.459 1.00 47.95  ? 184  GLN B N   1 
ATOM   5593 C CA  . GLN B 1 184 ? 5.570   17.706  -57.869 1.00 53.74  ? 184  GLN B CA  1 
ATOM   5594 C C   . GLN B 1 184 ? 5.123   17.901  -59.306 1.00 59.02  ? 184  GLN B C   1 
ATOM   5595 O O   . GLN B 1 184 ? 4.421   18.863  -59.614 1.00 58.61  ? 184  GLN B O   1 
ATOM   5596 C CB  . GLN B 1 184 ? 7.020   18.138  -57.727 1.00 51.53  ? 184  GLN B CB  1 
ATOM   5597 C CG  . GLN B 1 184 ? 7.395   18.401  -56.308 1.00 65.46  ? 184  GLN B CG  1 
ATOM   5598 C CD  . GLN B 1 184 ? 6.575   19.534  -55.728 1.00 68.70  ? 184  GLN B CD  1 
ATOM   5599 O OE1 . GLN B 1 184 ? 6.559   20.632  -56.277 1.00 70.53  ? 184  GLN B OE1 1 
ATOM   5600 N NE2 . GLN B 1 184 ? 5.890   19.273  -54.613 1.00 53.51  ? 184  GLN B NE2 1 
ATOM   5601 N N   . GLU B 1 185 ? 5.525   16.975  -60.174 1.00 54.17  ? 185  GLU B N   1 
ATOM   5602 C CA  . GLU B 1 185 ? 5.300   17.099  -61.609 1.00 57.28  ? 185  GLU B CA  1 
ATOM   5603 C C   . GLU B 1 185 ? 3.929   16.645  -62.066 1.00 58.80  ? 185  GLU B C   1 
ATOM   5604 O O   . GLU B 1 185 ? 3.526   16.929  -63.193 1.00 64.53  ? 185  GLU B O   1 
ATOM   5605 C CB  . GLU B 1 185 ? 6.311   16.266  -62.376 1.00 61.43  ? 185  GLU B CB  1 
ATOM   5606 C CG  . GLU B 1 185 ? 7.733   16.710  -62.245 1.00 74.86  ? 185  GLU B CG  1 
ATOM   5607 C CD  . GLU B 1 185 ? 8.681   15.612  -62.681 1.00 92.82  ? 185  GLU B CD  1 
ATOM   5608 O OE1 . GLU B 1 185 ? 8.191   14.482  -62.935 1.00 91.79  ? 185  GLU B OE1 1 
ATOM   5609 O OE2 . GLU B 1 185 ? 9.904   15.875  -62.764 1.00 98.59  ? 185  GLU B OE2 1 
ATOM   5610 N N   . ASN B 1 186 ? 3.218   15.921  -61.216 1.00 49.59  ? 186  ASN B N   1 
ATOM   5611 C CA  . ASN B 1 186 ? 2.001   15.275  -61.671 1.00 48.60  ? 186  ASN B CA  1 
ATOM   5612 C C   . ASN B 1 186 ? 0.772   15.520  -60.803 1.00 56.06  ? 186  ASN B C   1 
ATOM   5613 O O   . ASN B 1 186 ? -0.356  15.397  -61.274 1.00 60.16  ? 186  ASN B O   1 
ATOM   5614 C CB  . ASN B 1 186 ? 2.250   13.770  -61.813 1.00 56.29  ? 186  ASN B CB  1 
ATOM   5615 C CG  . ASN B 1 186 ? 3.229   13.449  -62.922 1.00 55.96  ? 186  ASN B CG  1 
ATOM   5616 O OD1 . ASN B 1 186 ? 2.934   13.650  -64.095 1.00 60.17  ? 186  ASN B OD1 1 
ATOM   5617 N ND2 . ASN B 1 186 ? 4.405   12.958  -62.556 1.00 60.13  ? 186  ASN B ND2 1 
ATOM   5618 N N   . ILE B 1 187 ? 0.980   15.856  -59.536 1.00 53.38  ? 187  ILE B N   1 
ATOM   5619 C CA  . ILE B 1 187 ? -0.121  15.821  -58.588 1.00 47.97  ? 187  ILE B CA  1 
ATOM   5620 C C   . ILE B 1 187 ? -1.274  16.749  -58.972 1.00 54.50  ? 187  ILE B C   1 
ATOM   5621 O O   . ILE B 1 187 ? -2.438  16.408  -58.760 1.00 53.51  ? 187  ILE B O   1 
ATOM   5622 C CB  . ILE B 1 187 ? 0.348   16.058  -57.132 1.00 51.00  ? 187  ILE B CB  1 
ATOM   5623 C CG1 . ILE B 1 187 ? -0.620  15.371  -56.164 1.00 44.99  ? 187  ILE B CG1 1 
ATOM   5624 C CG2 . ILE B 1 187 ? 0.518   17.539  -56.836 1.00 46.07  ? 187  ILE B CG2 1 
ATOM   5625 C CD1 . ILE B 1 187 ? -0.797  13.879  -56.461 1.00 45.17  ? 187  ILE B CD1 1 
ATOM   5626 N N   . ALA B 1 188 ? -0.953  17.905  -59.553 1.00 56.91  ? 188  ALA B N   1 
ATOM   5627 C CA  . ALA B 1 188 ? -1.977  18.856  -59.997 1.00 57.26  ? 188  ALA B CA  1 
ATOM   5628 C C   . ALA B 1 188 ? -3.022  18.225  -60.924 1.00 58.10  ? 188  ALA B C   1 
ATOM   5629 O O   . ALA B 1 188 ? -4.196  18.583  -60.868 1.00 63.23  ? 188  ALA B O   1 
ATOM   5630 C CB  . ALA B 1 188 ? -1.344  20.083  -60.659 1.00 45.30  ? 188  ALA B CB  1 
ATOM   5631 N N   . ALA B 1 189 ? -2.606  17.288  -61.769 1.00 57.39  ? 189  ALA B N   1 
ATOM   5632 C CA  . ALA B 1 189 ? -3.550  16.621  -62.665 1.00 57.83  ? 189  ALA B CA  1 
ATOM   5633 C C   . ALA B 1 189 ? -4.664  15.936  -61.890 1.00 59.29  ? 189  ALA B C   1 
ATOM   5634 O O   . ALA B 1 189 ? -5.748  15.706  -62.422 1.00 66.17  ? 189  ALA B O   1 
ATOM   5635 C CB  . ALA B 1 189 ? -2.836  15.614  -63.552 1.00 54.42  ? 189  ALA B CB  1 
ATOM   5636 N N   . PHE B 1 190 ? -4.384  15.607  -60.632 1.00 61.28  ? 190  PHE B N   1 
ATOM   5637 C CA  . PHE B 1 190 ? -5.324  14.888  -59.780 1.00 56.50  ? 190  PHE B CA  1 
ATOM   5638 C C   . PHE B 1 190 ? -6.103  15.844  -58.879 1.00 61.89  ? 190  PHE B C   1 
ATOM   5639 O O   . PHE B 1 190 ? -7.016  15.431  -58.150 1.00 58.59  ? 190  PHE B O   1 
ATOM   5640 C CB  . PHE B 1 190 ? -4.567  13.888  -58.909 1.00 56.08  ? 190  PHE B CB  1 
ATOM   5641 C CG  . PHE B 1 190 ? -3.878  12.808  -59.681 1.00 57.01  ? 190  PHE B CG  1 
ATOM   5642 C CD1 . PHE B 1 190 ? -2.653  13.040  -60.277 1.00 56.26  ? 190  PHE B CD1 1 
ATOM   5643 C CD2 . PHE B 1 190 ? -4.447  11.548  -59.794 1.00 61.54  ? 190  PHE B CD2 1 
ATOM   5644 C CE1 . PHE B 1 190 ? -2.013  12.043  -60.986 1.00 57.56  ? 190  PHE B CE1 1 
ATOM   5645 C CE2 . PHE B 1 190 ? -3.808  10.547  -60.503 1.00 55.45  ? 190  PHE B CE2 1 
ATOM   5646 C CZ  . PHE B 1 190 ? -2.591  10.798  -61.099 1.00 49.80  ? 190  PHE B CZ  1 
ATOM   5647 N N   . GLY B 1 191 ? -5.719  17.118  -58.922 1.00 57.07  ? 191  GLY B N   1 
ATOM   5648 C CA  . GLY B 1 191 ? -6.321  18.139  -58.086 1.00 58.74  ? 191  GLY B CA  1 
ATOM   5649 C C   . GLY B 1 191 ? -5.543  18.386  -56.806 1.00 64.01  ? 191  GLY B C   1 
ATOM   5650 O O   . GLY B 1 191 ? -6.084  18.916  -55.837 1.00 63.48  ? 191  GLY B O   1 
ATOM   5651 N N   . GLY B 1 192 ? -4.274  17.990  -56.802 1.00 63.99  ? 192  GLY B N   1 
ATOM   5652 C CA  . GLY B 1 192 ? -3.418  18.169  -55.643 1.00 57.13  ? 192  GLY B CA  1 
ATOM   5653 C C   . GLY B 1 192 ? -2.649  19.466  -55.731 1.00 54.79  ? 192  GLY B C   1 
ATOM   5654 O O   . GLY B 1 192 ? -2.461  19.994  -56.822 1.00 62.66  ? 192  GLY B O   1 
ATOM   5655 N N   . ASP B 1 193 ? -2.214  19.985  -54.587 1.00 57.17  ? 193  ASP B N   1 
ATOM   5656 C CA  . ASP B 1 193 ? -1.418  21.210  -54.548 1.00 56.64  ? 193  ASP B CA  1 
ATOM   5657 C C   . ASP B 1 193 ? 0.059   20.879  -54.318 1.00 56.70  ? 193  ASP B C   1 
ATOM   5658 O O   . ASP B 1 193 ? 0.462   20.548  -53.205 1.00 59.74  ? 193  ASP B O   1 
ATOM   5659 C CB  . ASP B 1 193 ? -1.931  22.150  -53.452 1.00 59.74  ? 193  ASP B CB  1 
ATOM   5660 C CG  . ASP B 1 193 ? -1.253  23.528  -53.479 1.00 70.78  ? 193  ASP B CG  1 
ATOM   5661 O OD1 . ASP B 1 193 ? -0.233  23.692  -54.188 1.00 65.29  ? 193  ASP B OD1 1 
ATOM   5662 O OD2 . ASP B 1 193 ? -1.745  24.452  -52.786 1.00 69.09  ? 193  ASP B OD2 1 
ATOM   5663 N N   . PRO B 1 194 ? 0.874   20.976  -55.373 1.00 52.57  ? 194  PRO B N   1 
ATOM   5664 C CA  . PRO B 1 194 ? 2.306   20.684  -55.240 1.00 62.57  ? 194  PRO B CA  1 
ATOM   5665 C C   . PRO B 1 194 ? 2.987   21.651  -54.270 1.00 58.64  ? 194  PRO B C   1 
ATOM   5666 O O   . PRO B 1 194 ? 4.102   21.390  -53.822 1.00 58.29  ? 194  PRO B O   1 
ATOM   5667 C CB  . PRO B 1 194 ? 2.859   20.899  -56.662 1.00 55.85  ? 194  PRO B CB  1 
ATOM   5668 C CG  . PRO B 1 194 ? 1.650   21.061  -57.554 1.00 60.90  ? 194  PRO B CG  1 
ATOM   5669 C CD  . PRO B 1 194 ? 0.534   21.540  -56.689 1.00 57.46  ? 194  PRO B CD  1 
ATOM   5670 N N   . MET B 1 195 ? 2.330   22.762  -53.958 1.00 60.18  ? 195  MET B N   1 
ATOM   5671 C CA  . MET B 1 195 ? 2.916   23.742  -53.046 1.00 66.19  ? 195  MET B CA  1 
ATOM   5672 C C   . MET B 1 195 ? 2.536   23.495  -51.588 1.00 63.44  ? 195  MET B C   1 
ATOM   5673 O O   . MET B 1 195 ? 2.954   24.230  -50.694 1.00 60.92  ? 195  MET B O   1 
ATOM   5674 C CB  . MET B 1 195 ? 2.562   25.162  -53.473 1.00 64.06  ? 195  MET B CB  1 
ATOM   5675 C CG  . MET B 1 195 ? 3.223   25.561  -54.776 1.00 71.33  ? 195  MET B CG  1 
ATOM   5676 S SD  . MET B 1 195 ? 3.328   27.346  -54.957 1.00 107.36 ? 195  MET B SD  1 
ATOM   5677 C CE  . MET B 1 195 ? 1.671   27.833  -54.453 1.00 92.96  ? 195  MET B CE  1 
ATOM   5678 N N   . SER B 1 196 ? 1.760   22.443  -51.355 1.00 57.06  ? 196  SER B N   1 
ATOM   5679 C CA  . SER B 1 196 ? 1.440   22.024  -50.002 1.00 58.02  ? 196  SER B CA  1 
ATOM   5680 C C   . SER B 1 196 ? 1.484   20.495  -49.899 1.00 56.88  ? 196  SER B C   1 
ATOM   5681 O O   . SER B 1 196 ? 0.471   19.799  -50.032 1.00 52.08  ? 196  SER B O   1 
ATOM   5682 C CB  . SER B 1 196 ? 0.089   22.582  -49.564 1.00 54.25  ? 196  SER B CB  1 
ATOM   5683 O OG  . SER B 1 196 ? -0.254  22.086  -48.286 1.00 62.54  ? 196  SER B OG  1 
ATOM   5684 N N   . VAL B 1 197 ? 2.688   19.989  -49.670 1.00 55.47  ? 197  VAL B N   1 
ATOM   5685 C CA  . VAL B 1 197 ? 2.939   18.565  -49.584 1.00 52.85  ? 197  VAL B CA  1 
ATOM   5686 C C   . VAL B 1 197 ? 3.451   18.235  -48.203 1.00 47.71  ? 197  VAL B C   1 
ATOM   5687 O O   . VAL B 1 197 ? 4.474   18.764  -47.771 1.00 52.30  ? 197  VAL B O   1 
ATOM   5688 C CB  . VAL B 1 197 ? 4.001   18.138  -50.607 1.00 53.03  ? 197  VAL B CB  1 
ATOM   5689 C CG1 . VAL B 1 197 ? 4.337   16.665  -50.433 1.00 45.31  ? 197  VAL B CG1 1 
ATOM   5690 C CG2 . VAL B 1 197 ? 3.506   18.427  -52.010 1.00 52.85  ? 197  VAL B CG2 1 
ATOM   5691 N N   . THR B 1 198 ? 2.737   17.363  -47.511 1.00 46.24  ? 198  THR B N   1 
ATOM   5692 C CA  . THR B 1 198 ? 3.139   16.926  -46.187 1.00 44.81  ? 198  THR B CA  1 
ATOM   5693 C C   . THR B 1 198 ? 3.536   15.459  -46.226 1.00 50.32  ? 198  THR B C   1 
ATOM   5694 O O   . THR B 1 198 ? 2.727   14.603  -46.615 1.00 49.14  ? 198  THR B O   1 
ATOM   5695 C CB  . THR B 1 198 ? 1.971   17.048  -45.208 1.00 44.27  ? 198  THR B CB  1 
ATOM   5696 O OG1 . THR B 1 198 ? 1.442   18.374  -45.257 1.00 56.82  ? 198  THR B OG1 1 
ATOM   5697 C CG2 . THR B 1 198 ? 2.421   16.739  -43.801 1.00 41.10  ? 198  THR B CG2 1 
ATOM   5698 N N   . LEU B 1 199 ? 4.772   15.158  -45.833 1.00 39.79  ? 199  LEU B N   1 
ATOM   5699 C CA  . LEU B 1 199 ? 5.166   13.760  -45.652 1.00 45.11  ? 199  LEU B CA  1 
ATOM   5700 C C   . LEU B 1 199 ? 4.741   13.272  -44.279 1.00 40.71  ? 199  LEU B C   1 
ATOM   5701 O O   . LEU B 1 199 ? 4.823   14.003  -43.313 1.00 47.54  ? 199  LEU B O   1 
ATOM   5702 C CB  . LEU B 1 199 ? 6.674   13.585  -45.780 1.00 34.14  ? 199  LEU B CB  1 
ATOM   5703 C CG  . LEU B 1 199 ? 7.319   14.236  -46.994 1.00 41.75  ? 199  LEU B CG  1 
ATOM   5704 C CD1 . LEU B 1 199 ? 8.833   14.079  -46.922 1.00 37.07  ? 199  LEU B CD1 1 
ATOM   5705 C CD2 . LEU B 1 199 ? 6.752   13.651  -48.287 1.00 36.46  ? 199  LEU B CD2 1 
ATOM   5706 N N   . PHE B 1 200 ? 4.286   12.036  -44.188 1.00 41.65  ? 200  PHE B N   1 
ATOM   5707 C CA  . PHE B 1 200 ? 4.154   11.403  -42.887 1.00 40.11  ? 200  PHE B CA  1 
ATOM   5708 C C   . PHE B 1 200 ? 4.469   9.944   -43.001 1.00 40.71  ? 200  PHE B C   1 
ATOM   5709 O O   . PHE B 1 200 ? 4.289   9.362   -44.055 1.00 43.75  ? 200  PHE B O   1 
ATOM   5710 C CB  . PHE B 1 200 ? 2.775   11.627  -42.263 1.00 45.70  ? 200  PHE B CB  1 
ATOM   5711 C CG  . PHE B 1 200 ? 1.635   10.980  -42.994 1.00 44.80  ? 200  PHE B CG  1 
ATOM   5712 C CD1 . PHE B 1 200 ? 1.565   10.994  -44.374 1.00 45.45  ? 200  PHE B CD1 1 
ATOM   5713 C CD2 . PHE B 1 200 ? 0.580   10.431  -42.281 1.00 45.86  ? 200  PHE B CD2 1 
ATOM   5714 C CE1 . PHE B 1 200 ? 0.487   10.426  -45.033 1.00 48.09  ? 200  PHE B CE1 1 
ATOM   5715 C CE2 . PHE B 1 200 ? -0.497  9.872   -42.925 1.00 43.67  ? 200  PHE B CE2 1 
ATOM   5716 C CZ  . PHE B 1 200 ? -0.547  9.862   -44.306 1.00 49.80  ? 200  PHE B CZ  1 
ATOM   5717 N N   . GLY B 1 201 ? 4.970   9.360   -41.921 1.00 46.00  ? 201  GLY B N   1 
ATOM   5718 C CA  . GLY B 1 201 ? 5.303   7.950   -41.922 1.00 40.80  ? 201  GLY B CA  1 
ATOM   5719 C C   . GLY B 1 201 ? 5.459   7.463   -40.505 1.00 46.79  ? 201  GLY B C   1 
ATOM   5720 O O   . GLY B 1 201 ? 5.406   8.266   -39.565 1.00 44.65  ? 201  GLY B O   1 
ATOM   5721 N N   . GLU B 1 202 ? 5.663   6.152   -40.367 1.00 44.91  ? 202  GLU B N   1 
ATOM   5722 C CA  . GLU B 1 202 ? 5.773   5.491   -39.075 1.00 42.15  ? 202  GLU B CA  1 
ATOM   5723 C C   . GLU B 1 202 ? 6.959   4.510   -39.043 1.00 43.78  ? 202  GLU B C   1 
ATOM   5724 O O   . GLU B 1 202 ? 7.332   3.952   -40.068 1.00 43.17  ? 202  GLU B O   1 
ATOM   5725 C CB  . GLU B 1 202 ? 4.455   4.790   -38.764 1.00 43.34  ? 202  GLU B CB  1 
ATOM   5726 C CG  . GLU B 1 202 ? 4.326   4.232   -37.360 1.00 48.51  ? 202  GLU B CG  1 
ATOM   5727 C CD  . GLU B 1 202 ? 4.822   2.808   -37.255 1.00 56.41  ? 202  GLU B CD  1 
ATOM   5728 O OE1 . GLU B 1 202 ? 5.147   2.203   -38.301 1.00 54.59  ? 202  GLU B OE1 1 
ATOM   5729 O OE2 . GLU B 1 202 ? 4.884   2.290   -36.121 1.00 62.80  ? 202  GLU B OE2 1 
ATOM   5730 N N   . SER B 1 203 ? 7.559   4.320   -37.867 1.00 47.59  ? 203  SER B N   1 
ATOM   5731 C CA  . SER B 1 203 ? 8.764   3.494   -37.723 1.00 48.24  ? 203  SER B CA  1 
ATOM   5732 C C   . SER B 1 203 ? 9.837   3.906   -38.755 1.00 48.04  ? 203  SER B C   1 
ATOM   5733 O O   . SER B 1 203 ? 10.210  5.076   -38.814 1.00 48.46  ? 203  SER B O   1 
ATOM   5734 C CB  . SER B 1 203 ? 8.420   1.997   -37.815 1.00 53.24  ? 203  SER B CB  1 
ATOM   5735 O OG  . SER B 1 203 ? 9.570   1.175   -37.620 1.00 68.57  ? 203  SER B OG  1 
ATOM   5736 N N   . ALA B 1 204 ? 10.317  2.967   -39.571 1.00 45.06  ? 204  ALA B N   1 
ATOM   5737 C CA  . ALA B 1 204 ? 11.305  3.293   -40.602 1.00 47.29  ? 204  ALA B CA  1 
ATOM   5738 C C   . ALA B 1 204 ? 10.803  4.374   -41.556 1.00 44.97  ? 204  ALA B C   1 
ATOM   5739 O O   . ALA B 1 204 ? 11.594  5.121   -42.130 1.00 43.13  ? 204  ALA B O   1 
ATOM   5740 C CB  . ALA B 1 204 ? 11.721  2.051   -41.376 1.00 47.85  ? 204  ALA B CB  1 
ATOM   5741 N N   . GLY B 1 205 ? 9.487   4.454   -41.717 1.00 44.66  ? 205  GLY B N   1 
ATOM   5742 C CA  . GLY B 1 205 ? 8.877   5.516   -42.496 1.00 46.92  ? 205  GLY B CA  1 
ATOM   5743 C C   . GLY B 1 205 ? 9.084   6.892   -41.869 1.00 47.99  ? 205  GLY B C   1 
ATOM   5744 O O   . GLY B 1 205 ? 9.332   7.875   -42.571 1.00 41.73  ? 205  GLY B O   1 
ATOM   5745 N N   . ALA B 1 206 ? 8.977   6.966   -40.545 1.00 43.42  ? 206  ALA B N   1 
ATOM   5746 C CA  . ALA B 1 206 ? 9.234   8.211   -39.841 1.00 44.00  ? 206  ALA B CA  1 
ATOM   5747 C C   . ALA B 1 206 ? 10.694  8.598   -40.019 1.00 44.56  ? 206  ALA B C   1 
ATOM   5748 O O   . ALA B 1 206 ? 11.000  9.752   -40.332 1.00 44.11  ? 206  ALA B O   1 
ATOM   5749 C CB  . ALA B 1 206 ? 8.889   8.084   -38.371 1.00 43.77  ? 206  ALA B CB  1 
ATOM   5750 N N   . ALA B 1 207 ? 11.592  7.631   -39.841 1.00 38.25  ? 207  ALA B N   1 
ATOM   5751 C CA  . ALA B 1 207 ? 13.013  7.889   -40.048 1.00 41.30  ? 207  ALA B CA  1 
ATOM   5752 C C   . ALA B 1 207 ? 13.309  8.360   -41.473 1.00 45.70  ? 207  ALA B C   1 
ATOM   5753 O O   . ALA B 1 207 ? 14.179  9.215   -41.679 1.00 45.26  ? 207  ALA B O   1 
ATOM   5754 C CB  . ALA B 1 207 ? 13.837  6.663   -39.708 1.00 42.45  ? 207  ALA B CB  1 
ATOM   5755 N N   . SER B 1 208 ? 12.584  7.815   -42.453 1.00 42.27  ? 208  SER B N   1 
ATOM   5756 C CA  . SER B 1 208 ? 12.797  8.204   -43.852 1.00 44.63  ? 208  SER B CA  1 
ATOM   5757 C C   . SER B 1 208 ? 12.423  9.666   -44.061 1.00 45.18  ? 208  SER B C   1 
ATOM   5758 O O   . SER B 1 208 ? 13.184  10.433  -44.639 1.00 43.98  ? 208  SER B O   1 
ATOM   5759 C CB  . SER B 1 208 ? 11.996  7.319   -44.811 1.00 45.63  ? 208  SER B CB  1 
ATOM   5760 O OG  . SER B 1 208 ? 12.472  5.990   -44.813 1.00 45.37  ? 208  SER B OG  1 
ATOM   5761 N N   . VAL B 1 209 ? 11.234  10.035  -43.592 1.00 42.27  ? 209  VAL B N   1 
ATOM   5762 C CA  . VAL B 1 209 ? 10.803  11.427  -43.576 1.00 44.41  ? 209  VAL B CA  1 
ATOM   5763 C C   . VAL B 1 209 ? 11.890  12.292  -42.927 1.00 49.08  ? 209  VAL B C   1 
ATOM   5764 O O   . VAL B 1 209 ? 12.266  13.341  -43.457 1.00 44.66  ? 209  VAL B O   1 
ATOM   5765 C CB  . VAL B 1 209 ? 9.493   11.598  -42.777 1.00 40.58  ? 209  VAL B CB  1 
ATOM   5766 C CG1 . VAL B 1 209 ? 9.241   13.053  -42.485 1.00 45.73  ? 209  VAL B CG1 1 
ATOM   5767 C CG2 . VAL B 1 209 ? 8.309   10.982  -43.516 1.00 39.22  ? 209  VAL B CG2 1 
ATOM   5768 N N   . GLY B 1 210 ? 12.393  11.841  -41.778 1.00 42.73  ? 210  GLY B N   1 
ATOM   5769 C CA  . GLY B 1 210 ? 13.446  12.550  -41.075 1.00 44.22  ? 210  GLY B CA  1 
ATOM   5770 C C   . GLY B 1 210 ? 14.664  12.749  -41.960 1.00 52.40  ? 210  GLY B C   1 
ATOM   5771 O O   . GLY B 1 210 ? 15.241  13.839  -42.018 1.00 43.33  ? 210  GLY B O   1 
ATOM   5772 N N   . MET B 1 211 ? 15.051  11.694  -42.670 1.00 48.90  ? 211  MET B N   1 
ATOM   5773 C CA  . MET B 1 211 ? 16.164  11.808  -43.600 1.00 51.67  ? 211  MET B CA  1 
ATOM   5774 C C   . MET B 1 211 ? 15.921  12.746  -44.779 1.00 47.65  ? 211  MET B C   1 
ATOM   5775 O O   . MET B 1 211 ? 16.865  13.322  -45.300 1.00 50.48  ? 211  MET B O   1 
ATOM   5776 C CB  . MET B 1 211 ? 16.638  10.436  -44.064 1.00 44.14  ? 211  MET B CB  1 
ATOM   5777 C CG  . MET B 1 211 ? 17.675  9.880   -43.110 1.00 52.09  ? 211  MET B CG  1 
ATOM   5778 S SD  . MET B 1 211 ? 17.715  8.101   -43.110 1.00 57.76  ? 211  MET B SD  1 
ATOM   5779 C CE  . MET B 1 211 ? 17.714  7.755   -41.362 1.00 51.98  ? 211  MET B CE  1 
ATOM   5780 N N   . HIS B 1 212 ? 14.671  12.917  -45.193 1.00 42.39  ? 212  HIS B N   1 
ATOM   5781 C CA  . HIS B 1 212 ? 14.405  13.845  -46.284 1.00 47.81  ? 212  HIS B CA  1 
ATOM   5782 C C   . HIS B 1 212 ? 14.523  15.261  -45.774 1.00 49.05  ? 212  HIS B C   1 
ATOM   5783 O O   . HIS B 1 212 ? 14.901  16.162  -46.516 1.00 56.34  ? 212  HIS B O   1 
ATOM   5784 C CB  . HIS B 1 212 ? 13.034  13.603  -46.916 1.00 43.21  ? 212  HIS B CB  1 
ATOM   5785 C CG  . HIS B 1 212 ? 12.967  12.348  -47.719 1.00 45.26  ? 212  HIS B CG  1 
ATOM   5786 N ND1 . HIS B 1 212 ? 13.531  12.239  -48.971 1.00 47.27  ? 212  HIS B ND1 1 
ATOM   5787 C CD2 . HIS B 1 212 ? 12.436  11.136  -47.437 1.00 46.51  ? 212  HIS B CD2 1 
ATOM   5788 C CE1 . HIS B 1 212 ? 13.336  11.017  -49.432 1.00 51.05  ? 212  HIS B CE1 1 
ATOM   5789 N NE2 . HIS B 1 212 ? 12.670  10.329  -48.522 1.00 48.88  ? 212  HIS B NE2 1 
ATOM   5790 N N   . ILE B 1 213 ? 14.197  15.447  -44.500 1.00 45.78  ? 213  ILE B N   1 
ATOM   5791 C CA  . ILE B 1 213 ? 14.379  16.731  -43.844 1.00 48.96  ? 213  ILE B CA  1 
ATOM   5792 C C   . ILE B 1 213 ? 15.854  17.106  -43.822 1.00 52.04  ? 213  ILE B C   1 
ATOM   5793 O O   . ILE B 1 213 ? 16.208  18.271  -43.956 1.00 50.64  ? 213  ILE B O   1 
ATOM   5794 C CB  . ILE B 1 213 ? 13.868  16.685  -42.403 1.00 49.18  ? 213  ILE B CB  1 
ATOM   5795 C CG1 . ILE B 1 213 ? 12.346  16.546  -42.391 1.00 46.34  ? 213  ILE B CG1 1 
ATOM   5796 C CG2 . ILE B 1 213 ? 14.285  17.935  -41.640 1.00 50.12  ? 213  ILE B CG2 1 
ATOM   5797 C CD1 . ILE B 1 213 ? 11.773  16.312  -41.016 1.00 42.36  ? 213  ILE B CD1 1 
ATOM   5798 N N   . LEU B 1 214 ? 16.704  16.095  -43.673 1.00 50.78  ? 214  LEU B N   1 
ATOM   5799 C CA  . LEU B 1 214 ? 18.131  16.283  -43.461 1.00 45.00  ? 214  LEU B CA  1 
ATOM   5800 C C   . LEU B 1 214 ? 18.933  16.179  -44.745 1.00 53.81  ? 214  LEU B C   1 
ATOM   5801 O O   . LEU B 1 214 ? 20.160  16.128  -44.710 1.00 56.68  ? 214  LEU B O   1 
ATOM   5802 C CB  . LEU B 1 214 ? 18.658  15.234  -42.480 1.00 40.98  ? 214  LEU B CB  1 
ATOM   5803 C CG  . LEU B 1 214 ? 18.093  15.309  -41.063 1.00 47.87  ? 214  LEU B CG  1 
ATOM   5804 C CD1 . LEU B 1 214 ? 18.667  14.219  -40.164 1.00 40.58  ? 214  LEU B CD1 1 
ATOM   5805 C CD2 . LEU B 1 214 ? 18.349  16.687  -40.482 1.00 48.80  ? 214  LEU B CD2 1 
ATOM   5806 N N   . SER B 1 215 ? 18.254  16.115  -45.881 1.00 50.94  ? 215  SER B N   1 
ATOM   5807 C CA  . SER B 1 215 ? 18.964  15.972  -47.140 1.00 47.23  ? 215  SER B CA  1 
ATOM   5808 C C   . SER B 1 215 ? 18.469  17.016  -48.126 1.00 54.82  ? 215  SER B C   1 
ATOM   5809 O O   . SER B 1 215 ? 17.342  16.942  -48.611 1.00 59.36  ? 215  SER B O   1 
ATOM   5810 C CB  . SER B 1 215 ? 18.808  14.554  -47.691 1.00 47.77  ? 215  SER B CB  1 
ATOM   5811 O OG  . SER B 1 215 ? 19.427  14.436  -48.959 1.00 58.29  ? 215  SER B OG  1 
ATOM   5812 N N   . LEU B 1 216 ? 19.327  17.993  -48.403 1.00 56.15  ? 216  LEU B N   1 
ATOM   5813 C CA  . LEU B 1 216 ? 18.970  19.183  -49.175 1.00 56.06  ? 216  LEU B CA  1 
ATOM   5814 C C   . LEU B 1 216 ? 18.141  18.947  -50.448 1.00 57.50  ? 216  LEU B C   1 
ATOM   5815 O O   . LEU B 1 216 ? 17.108  19.583  -50.632 1.00 62.16  ? 216  LEU B O   1 
ATOM   5816 C CB  . LEU B 1 216 ? 20.225  19.998  -49.502 1.00 62.04  ? 216  LEU B CB  1 
ATOM   5817 C CG  . LEU B 1 216 ? 19.968  21.259  -50.326 1.00 74.10  ? 216  LEU B CG  1 
ATOM   5818 C CD1 . LEU B 1 216 ? 19.056  22.230  -49.565 1.00 67.83  ? 216  LEU B CD1 1 
ATOM   5819 C CD2 . LEU B 1 216 ? 21.278  21.932  -50.737 1.00 80.71  ? 216  LEU B CD2 1 
ATOM   5820 N N   . PRO B 1 217 ? 18.582  18.037  -51.332 1.00 58.74  ? 217  PRO B N   1 
ATOM   5821 C CA  . PRO B 1 217 ? 17.809  17.803  -52.560 1.00 52.37  ? 217  PRO B CA  1 
ATOM   5822 C C   . PRO B 1 217 ? 16.344  17.423  -52.310 1.00 57.37  ? 217  PRO B C   1 
ATOM   5823 O O   . PRO B 1 217 ? 15.497  17.735  -53.146 1.00 62.42  ? 217  PRO B O   1 
ATOM   5824 C CB  . PRO B 1 217 ? 18.554  16.649  -53.229 1.00 51.81  ? 217  PRO B CB  1 
ATOM   5825 C CG  . PRO B 1 217 ? 19.951  16.727  -52.668 1.00 47.34  ? 217  PRO B CG  1 
ATOM   5826 C CD  . PRO B 1 217 ? 19.775  17.173  -51.256 1.00 58.70  ? 217  PRO B CD  1 
ATOM   5827 N N   . SER B 1 218 ? 16.045  16.774  -51.186 1.00 59.91  ? 218  SER B N   1 
ATOM   5828 C CA  . SER B 1 218 ? 14.665  16.415  -50.852 1.00 51.56  ? 218  SER B CA  1 
ATOM   5829 C C   . SER B 1 218 ? 13.845  17.606  -50.408 1.00 55.69  ? 218  SER B C   1 
ATOM   5830 O O   . SER B 1 218 ? 12.640  17.653  -50.645 1.00 54.07  ? 218  SER B O   1 
ATOM   5831 C CB  . SER B 1 218 ? 14.625  15.373  -49.742 1.00 51.60  ? 218  SER B CB  1 
ATOM   5832 O OG  . SER B 1 218 ? 14.719  14.070  -50.264 1.00 52.73  ? 218  SER B OG  1 
ATOM   5833 N N   . ARG B 1 219 ? 14.505  18.556  -49.749 1.00 59.73  ? 219  ARG B N   1 
ATOM   5834 C CA  . ARG B 1 219 ? 13.831  19.697  -49.127 1.00 58.24  ? 219  ARG B CA  1 
ATOM   5835 C C   . ARG B 1 219 ? 12.924  20.468  -50.076 1.00 55.97  ? 219  ARG B C   1 
ATOM   5836 O O   . ARG B 1 219 ? 11.859  20.933  -49.683 1.00 66.79  ? 219  ARG B O   1 
ATOM   5837 C CB  . ARG B 1 219 ? 14.845  20.647  -48.495 1.00 52.15  ? 219  ARG B CB  1 
ATOM   5838 C CG  . ARG B 1 219 ? 15.580  20.057  -47.312 1.00 57.97  ? 219  ARG B CG  1 
ATOM   5839 C CD  . ARG B 1 219 ? 14.622  19.729  -46.183 1.00 64.16  ? 219  ARG B CD  1 
ATOM   5840 N NE  . ARG B 1 219 ? 13.890  20.907  -45.707 1.00 66.81  ? 219  ARG B NE  1 
ATOM   5841 C CZ  . ARG B 1 219 ? 14.284  21.688  -44.702 1.00 73.87  ? 219  ARG B CZ  1 
ATOM   5842 N NH1 . ARG B 1 219 ? 15.419  21.433  -44.045 1.00 69.42  ? 219  ARG B NH1 1 
ATOM   5843 N NH2 . ARG B 1 219 ? 13.542  22.735  -44.354 1.00 76.51  ? 219  ARG B NH2 1 
ATOM   5844 N N   . SER B 1 220 ? 13.328  20.599  -51.328 1.00 51.06  ? 220  SER B N   1 
ATOM   5845 C CA  . SER B 1 220 ? 12.507  21.334  -52.280 1.00 56.22  ? 220  SER B CA  1 
ATOM   5846 C C   . SER B 1 220 ? 11.250  20.583  -52.712 1.00 52.59  ? 220  SER B C   1 
ATOM   5847 O O   . SER B 1 220 ? 10.610  20.970  -53.681 1.00 55.93  ? 220  SER B O   1 
ATOM   5848 C CB  . SER B 1 220 ? 13.335  21.688  -53.514 1.00 62.81  ? 220  SER B CB  1 
ATOM   5849 O OG  . SER B 1 220 ? 14.017  20.546  -54.002 1.00 69.97  ? 220  SER B OG  1 
ATOM   5850 N N   . LEU B 1 221 ? 10.896  19.514  -52.004 1.00 51.69  ? 221  LEU B N   1 
ATOM   5851 C CA  . LEU B 1 221 ? 9.841   18.617  -52.478 1.00 50.18  ? 221  LEU B CA  1 
ATOM   5852 C C   . LEU B 1 221 ? 8.687   18.438  -51.491 1.00 49.37  ? 221  LEU B C   1 
ATOM   5853 O O   . LEU B 1 221 ? 7.705   17.776  -51.799 1.00 50.25  ? 221  LEU B O   1 
ATOM   5854 C CB  . LEU B 1 221 ? 10.419  17.239  -52.846 1.00 52.34  ? 221  LEU B CB  1 
ATOM   5855 C CG  . LEU B 1 221 ? 11.548  17.104  -53.877 1.00 49.83  ? 221  LEU B CG  1 
ATOM   5856 C CD1 . LEU B 1 221 ? 12.059  15.677  -53.935 1.00 47.08  ? 221  LEU B CD1 1 
ATOM   5857 C CD2 . LEU B 1 221 ? 11.086  17.521  -55.241 1.00 50.85  ? 221  LEU B CD2 1 
ATOM   5858 N N   . PHE B 1 222 ? 8.802   19.010  -50.301 1.00 46.93  ? 222  PHE B N   1 
ATOM   5859 C CA  . PHE B 1 222 ? 7.703   18.950  -49.342 1.00 52.92  ? 222  PHE B CA  1 
ATOM   5860 C C   . PHE B 1 222 ? 7.810   20.137  -48.404 1.00 47.56  ? 222  PHE B C   1 
ATOM   5861 O O   . PHE B 1 222 ? 8.805   20.850  -48.431 1.00 45.59  ? 222  PHE B O   1 
ATOM   5862 C CB  . PHE B 1 222 ? 7.731   17.637  -48.555 1.00 46.96  ? 222  PHE B CB  1 
ATOM   5863 C CG  . PHE B 1 222 ? 8.962   17.460  -47.732 1.00 43.35  ? 222  PHE B CG  1 
ATOM   5864 C CD1 . PHE B 1 222 ? 10.156  17.064  -48.325 1.00 45.30  ? 222  PHE B CD1 1 
ATOM   5865 C CD2 . PHE B 1 222 ? 8.938   17.705  -46.363 1.00 45.62  ? 222  PHE B CD2 1 
ATOM   5866 C CE1 . PHE B 1 222 ? 11.309  16.900  -47.570 1.00 50.98  ? 222  PHE B CE1 1 
ATOM   5867 C CE2 . PHE B 1 222 ? 10.083  17.552  -45.591 1.00 43.08  ? 222  PHE B CE2 1 
ATOM   5868 C CZ  . PHE B 1 222 ? 11.276  17.139  -46.197 1.00 53.34  ? 222  PHE B CZ  1 
ATOM   5869 N N   . HIS B 1 223 ? 6.791   20.342  -47.573 1.00 49.85  ? 223  HIS B N   1 
ATOM   5870 C CA  . HIS B 1 223 ? 6.704   21.554  -46.758 1.00 51.76  ? 223  HIS B CA  1 
ATOM   5871 C C   . HIS B 1 223 ? 6.542   21.279  -45.262 1.00 50.52  ? 223  HIS B C   1 
ATOM   5872 O O   . HIS B 1 223 ? 6.774   22.152  -44.429 1.00 59.28  ? 223  HIS B O   1 
ATOM   5873 C CB  . HIS B 1 223 ? 5.540   22.416  -47.247 1.00 53.69  ? 223  HIS B CB  1 
ATOM   5874 C CG  . HIS B 1 223 ? 5.399   22.438  -48.735 1.00 57.00  ? 223  HIS B CG  1 
ATOM   5875 N ND1 . HIS B 1 223 ? 6.158   23.257  -49.544 1.00 55.25  ? 223  HIS B ND1 1 
ATOM   5876 C CD2 . HIS B 1 223 ? 4.594   21.730  -49.563 1.00 52.10  ? 223  HIS B CD2 1 
ATOM   5877 C CE1 . HIS B 1 223 ? 5.824   23.055  -50.807 1.00 55.76  ? 223  HIS B CE1 1 
ATOM   5878 N NE2 . HIS B 1 223 ? 4.878   22.134  -50.845 1.00 56.92  ? 223  HIS B NE2 1 
ATOM   5879 N N   . ARG B 1 224 ? 6.140   20.064  -44.928 1.00 48.98  ? 224  ARG B N   1 
ATOM   5880 C CA  . ARG B 1 224 ? 5.875   19.700  -43.549 1.00 48.05  ? 224  ARG B CA  1 
ATOM   5881 C C   . ARG B 1 224 ? 6.097   18.203  -43.402 1.00 49.71  ? 224  ARG B C   1 
ATOM   5882 O O   . ARG B 1 224 ? 6.092   17.462  -44.391 1.00 45.98  ? 224  ARG B O   1 
ATOM   5883 C CB  . ARG B 1 224 ? 4.430   20.054  -43.193 1.00 52.56  ? 224  ARG B CB  1 
ATOM   5884 C CG  . ARG B 1 224 ? 4.184   21.540  -43.085 1.00 56.13  ? 224  ARG B CG  1 
ATOM   5885 C CD  . ARG B 1 224 ? 2.736   21.834  -42.782 1.00 56.07  ? 224  ARG B CD  1 
ATOM   5886 N NE  . ARG B 1 224 ? 1.941   21.989  -43.992 1.00 62.19  ? 224  ARG B NE  1 
ATOM   5887 C CZ  . ARG B 1 224 ? 2.081   23.001  -44.841 1.00 67.63  ? 224  ARG B CZ  1 
ATOM   5888 N NH1 . ARG B 1 224 ? 3.001   23.935  -44.615 1.00 54.48  ? 224  ARG B NH1 1 
ATOM   5889 N NH2 . ARG B 1 224 ? 1.314   23.067  -45.923 1.00 69.90  ? 224  ARG B NH2 1 
ATOM   5890 N N   . ALA B 1 225 ? 6.273   17.757  -42.168 1.00 42.17  ? 225  ALA B N   1 
ATOM   5891 C CA  . ALA B 1 225 ? 6.634   16.379  -41.927 1.00 40.68  ? 225  ALA B CA  1 
ATOM   5892 C C   . ALA B 1 225 ? 5.950   15.874  -40.678 1.00 45.33  ? 225  ALA B C   1 
ATOM   5893 O O   . ALA B 1 225 ? 5.765   16.620  -39.728 1.00 52.68  ? 225  ALA B O   1 
ATOM   5894 C CB  . ALA B 1 225 ? 8.148   16.264  -41.788 1.00 40.36  ? 225  ALA B CB  1 
ATOM   5895 N N   . VAL B 1 226 ? 5.574   14.604  -40.679 1.00 41.59  ? 226  VAL B N   1 
ATOM   5896 C CA  . VAL B 1 226 ? 5.005   13.981  -39.500 1.00 39.13  ? 226  VAL B CA  1 
ATOM   5897 C C   . VAL B 1 226 ? 5.787   12.720  -39.298 1.00 41.15  ? 226  VAL B C   1 
ATOM   5898 O O   . VAL B 1 226 ? 5.854   11.890  -40.202 1.00 42.00  ? 226  VAL B O   1 
ATOM   5899 C CB  . VAL B 1 226 ? 3.536   13.598  -39.707 1.00 41.31  ? 226  VAL B CB  1 
ATOM   5900 C CG1 . VAL B 1 226 ? 2.962   12.946  -38.436 1.00 39.50  ? 226  VAL B CG1 1 
ATOM   5901 C CG2 . VAL B 1 226 ? 2.725   14.813  -40.145 1.00 38.98  ? 226  VAL B CG2 1 
ATOM   5902 N N   . LEU B 1 227 ? 6.399   12.586  -38.128 1.00 40.02  ? 227  LEU B N   1 
ATOM   5903 C CA  . LEU B 1 227 ? 7.219   11.419  -37.835 1.00 43.25  ? 227  LEU B CA  1 
ATOM   5904 C C   . LEU B 1 227 ? 6.563   10.679  -36.710 1.00 49.68  ? 227  LEU B C   1 
ATOM   5905 O O   . LEU B 1 227 ? 6.517   11.175  -35.580 1.00 48.97  ? 227  LEU B O   1 
ATOM   5906 C CB  . LEU B 1 227 ? 8.636   11.813  -37.423 1.00 38.65  ? 227  LEU B CB  1 
ATOM   5907 C CG  . LEU B 1 227 ? 9.504   12.345  -38.555 1.00 44.39  ? 227  LEU B CG  1 
ATOM   5908 C CD1 . LEU B 1 227 ? 9.039   13.728  -38.961 1.00 40.32  ? 227  LEU B CD1 1 
ATOM   5909 C CD2 . LEU B 1 227 ? 10.955  12.374  -38.128 1.00 40.79  ? 227  LEU B CD2 1 
ATOM   5910 N N   . GLN B 1 228 ? 6.036   9.498   -37.014 1.00 44.20  ? 228  GLN B N   1 
ATOM   5911 C CA  . GLN B 1 228 ? 5.372   8.710   -35.996 1.00 42.09  ? 228  GLN B CA  1 
ATOM   5912 C C   . GLN B 1 228 ? 6.260   7.557   -35.581 1.00 45.66  ? 228  GLN B C   1 
ATOM   5913 O O   . GLN B 1 228 ? 6.523   6.659   -36.378 1.00 48.94  ? 228  GLN B O   1 
ATOM   5914 C CB  . GLN B 1 228 ? 4.042   8.185   -36.522 1.00 45.08  ? 228  GLN B CB  1 
ATOM   5915 C CG  . GLN B 1 228 ? 3.209   9.225   -37.250 1.00 46.98  ? 228  GLN B CG  1 
ATOM   5916 C CD  . GLN B 1 228 ? 1.951   8.618   -37.852 1.00 55.57  ? 228  GLN B CD  1 
ATOM   5917 O OE1 . GLN B 1 228 ? 1.300   9.209   -38.720 1.00 50.06  ? 228  GLN B OE1 1 
ATOM   5918 N NE2 . GLN B 1 228 ? 1.609   7.420   -37.396 1.00 61.82  ? 228  GLN B NE2 1 
ATOM   5919 N N   . SER B 1 229 ? 6.744   7.598   -34.343 1.00 40.81  ? 229  SER B N   1 
ATOM   5920 C CA  . SER B 1 229 ? 7.497   6.486   -33.762 1.00 46.80  ? 229  SER B CA  1 
ATOM   5921 C C   . SER B 1 229 ? 8.786   6.129   -34.499 1.00 47.11  ? 229  SER B C   1 
ATOM   5922 O O   . SER B 1 229 ? 9.165   4.968   -34.562 1.00 47.85  ? 229  SER B O   1 
ATOM   5923 C CB  . SER B 1 229 ? 6.613   5.243   -33.664 1.00 47.38  ? 229  SER B CB  1 
ATOM   5924 O OG  . SER B 1 229 ? 5.482   5.512   -32.862 1.00 49.35  ? 229  SER B OG  1 
ATOM   5925 N N   . GLY B 1 230 ? 9.468   7.123   -35.043 1.00 42.65  ? 230  GLY B N   1 
ATOM   5926 C CA  . GLY B 1 230 ? 10.706  6.859   -35.742 1.00 45.69  ? 230  GLY B CA  1 
ATOM   5927 C C   . GLY B 1 230 ? 11.478  8.126   -36.034 1.00 44.31  ? 230  GLY B C   1 
ATOM   5928 O O   . GLY B 1 230 ? 10.891  9.189   -36.207 1.00 48.33  ? 230  GLY B O   1 
ATOM   5929 N N   . THR B 1 231 ? 12.799  8.002   -36.098 1.00 45.99  ? 231  THR B N   1 
ATOM   5930 C CA  . THR B 1 231 ? 13.678  9.152   -36.242 1.00 44.77  ? 231  THR B CA  1 
ATOM   5931 C C   . THR B 1 231 ? 14.883  8.752   -37.057 1.00 40.37  ? 231  THR B C   1 
ATOM   5932 O O   . THR B 1 231 ? 15.252  7.580   -37.062 1.00 48.05  ? 231  THR B O   1 
ATOM   5933 C CB  . THR B 1 231 ? 14.194  9.644   -34.858 1.00 51.28  ? 231  THR B CB  1 
ATOM   5934 O OG1 . THR B 1 231 ? 14.749  8.542   -34.129 1.00 52.84  ? 231  THR B OG1 1 
ATOM   5935 C CG2 . THR B 1 231 ? 13.076  10.250  -34.038 1.00 47.34  ? 231  THR B CG2 1 
ATOM   5936 N N   . PRO B 1 232 ? 15.520  9.727   -37.726 1.00 45.21  ? 232  PRO B N   1 
ATOM   5937 C CA  . PRO B 1 232 ? 16.764  9.446   -38.455 1.00 46.71  ? 232  PRO B CA  1 
ATOM   5938 C C   . PRO B 1 232 ? 17.881  9.155   -37.455 1.00 50.02  ? 232  PRO B C   1 
ATOM   5939 O O   . PRO B 1 232 ? 18.608  8.172   -37.599 1.00 55.77  ? 232  PRO B O   1 
ATOM   5940 C CB  . PRO B 1 232 ? 17.042  10.752  -39.209 1.00 48.02  ? 232  PRO B CB  1 
ATOM   5941 C CG  . PRO B 1 232 ? 15.840  11.656  -38.959 1.00 41.74  ? 232  PRO B CG  1 
ATOM   5942 C CD  . PRO B 1 232 ? 15.199  11.165  -37.713 1.00 43.35  ? 232  PRO B CD  1 
ATOM   5943 N N   . ASN B 1 233 ? 17.996  10.001  -36.435 1.00 49.74  ? 233  ASN B N   1 
ATOM   5944 C CA  . ASN B 1 233 ? 18.903  9.749   -35.323 1.00 52.06  ? 233  ASN B CA  1 
ATOM   5945 C C   . ASN B 1 233 ? 18.488  8.490   -34.562 1.00 54.46  ? 233  ASN B C   1 
ATOM   5946 O O   . ASN B 1 233 ? 17.411  7.946   -34.785 1.00 48.87  ? 233  ASN B O   1 
ATOM   5947 C CB  . ASN B 1 233 ? 18.937  10.950  -34.376 1.00 44.96  ? 233  ASN B CB  1 
ATOM   5948 C CG  . ASN B 1 233 ? 17.578  11.267  -33.791 1.00 52.23  ? 233  ASN B CG  1 
ATOM   5949 O OD1 . ASN B 1 233 ? 16.634  11.587  -34.517 1.00 53.33  ? 233  ASN B OD1 1 
ATOM   5950 N ND2 . ASN B 1 233 ? 17.469  11.188  -32.469 1.00 50.37  ? 233  ASN B ND2 1 
ATOM   5951 N N   . GLY B 1 234 ? 19.344  8.019   -33.666 1.00 54.67  ? 234  GLY B N   1 
ATOM   5952 C CA  . GLY B 1 234 ? 19.035  6.820   -32.912 1.00 49.98  ? 234  GLY B CA  1 
ATOM   5953 C C   . GLY B 1 234 ? 19.819  5.619   -33.408 1.00 55.91  ? 234  GLY B C   1 
ATOM   5954 O O   . GLY B 1 234 ? 20.478  5.679   -34.453 1.00 55.67  ? 234  GLY B O   1 
ATOM   5955 N N   . PRO B 1 235 ? 19.726  4.505   -32.673 1.00 45.25  ? 235  PRO B N   1 
ATOM   5956 C CA  . PRO B 1 235 ? 20.619  3.351   -32.843 1.00 54.41  ? 235  PRO B CA  1 
ATOM   5957 C C   . PRO B 1 235 ? 20.385  2.502   -34.110 1.00 56.94  ? 235  PRO B C   1 
ATOM   5958 O O   . PRO B 1 235 ? 21.341  1.892   -34.615 1.00 49.39  ? 235  PRO B O   1 
ATOM   5959 C CB  . PRO B 1 235 ? 20.349  2.506   -31.587 1.00 51.25  ? 235  PRO B CB  1 
ATOM   5960 C CG  . PRO B 1 235 ? 19.335  3.271   -30.768 1.00 51.27  ? 235  PRO B CG  1 
ATOM   5961 C CD  . PRO B 1 235 ? 18.676  4.247   -31.680 1.00 46.25  ? 235  PRO B CD  1 
ATOM   5962 N N   . TRP B 1 236 ? 19.155  2.460   -34.619 1.00 48.97  ? 236  TRP B N   1 
ATOM   5963 C CA  . TRP B 1 236 ? 18.821  1.482   -35.655 1.00 43.03  ? 236  TRP B CA  1 
ATOM   5964 C C   . TRP B 1 236 ? 18.674  2.033   -37.071 1.00 49.29  ? 236  TRP B C   1 
ATOM   5965 O O   . TRP B 1 236 ? 18.696  1.267   -38.030 1.00 52.39  ? 236  TRP B O   1 
ATOM   5966 C CB  . TRP B 1 236 ? 17.549  0.755   -35.271 1.00 42.61  ? 236  TRP B CB  1 
ATOM   5967 C CG  . TRP B 1 236 ? 16.413  1.692   -35.053 1.00 47.24  ? 236  TRP B CG  1 
ATOM   5968 C CD1 . TRP B 1 236 ? 16.044  2.271   -33.876 1.00 42.57  ? 236  TRP B CD1 1 
ATOM   5969 C CD2 . TRP B 1 236 ? 15.492  2.168   -36.043 1.00 46.77  ? 236  TRP B CD2 1 
ATOM   5970 N NE1 . TRP B 1 236 ? 14.949  3.077   -34.069 1.00 42.77  ? 236  TRP B NE1 1 
ATOM   5971 C CE2 . TRP B 1 236 ? 14.586  3.029   -35.389 1.00 47.85  ? 236  TRP B CE2 1 
ATOM   5972 C CE3 . TRP B 1 236 ? 15.333  1.934   -37.415 1.00 44.32  ? 236  TRP B CE3 1 
ATOM   5973 C CZ2 . TRP B 1 236 ? 13.535  3.664   -36.059 1.00 52.87  ? 236  TRP B CZ2 1 
ATOM   5974 C CZ3 . TRP B 1 236 ? 14.296  2.572   -38.086 1.00 50.81  ? 236  TRP B CZ3 1 
ATOM   5975 C CH2 . TRP B 1 236 ? 13.410  3.429   -37.406 1.00 56.62  ? 236  TRP B CH2 1 
ATOM   5976 N N   . ALA B 1 237 ? 18.525  3.348   -37.207 1.00 52.04  ? 237  ALA B N   1 
ATOM   5977 C CA  . ALA B 1 237 ? 18.122  3.933   -38.487 1.00 45.37  ? 237  ALA B CA  1 
ATOM   5978 C C   . ALA B 1 237 ? 19.246  4.136   -39.495 1.00 44.69  ? 237  ALA B C   1 
ATOM   5979 O O   . ALA B 1 237 ? 18.992  4.203   -40.693 1.00 52.59  ? 237  ALA B O   1 
ATOM   5980 C CB  . ALA B 1 237 ? 17.358  5.235   -38.271 1.00 47.05  ? 237  ALA B CB  1 
ATOM   5981 N N   . THR B 1 238 ? 20.482  4.251   -39.027 1.00 48.34  ? 238  THR B N   1 
ATOM   5982 C CA  . THR B 1 238 ? 21.605  4.434   -39.946 1.00 49.76  ? 238  THR B CA  1 
ATOM   5983 C C   . THR B 1 238 ? 22.781  3.556   -39.590 1.00 46.93  ? 238  THR B C   1 
ATOM   5984 O O   . THR B 1 238 ? 22.867  3.033   -38.487 1.00 52.46  ? 238  THR B O   1 
ATOM   5985 C CB  . THR B 1 238 ? 22.101  5.894   -39.999 1.00 48.08  ? 238  THR B CB  1 
ATOM   5986 O OG1 . THR B 1 238 ? 22.535  6.301   -38.697 1.00 53.95  ? 238  THR B OG1 1 
ATOM   5987 C CG2 . THR B 1 238 ? 20.999  6.802   -40.474 1.00 44.64  ? 238  THR B CG2 1 
ATOM   5988 N N   . VAL B 1 239 ? 23.681  3.389   -40.544 1.00 48.56  ? 239  VAL B N   1 
ATOM   5989 C CA  . VAL B 1 239 ? 24.955  2.742   -40.276 1.00 49.62  ? 239  VAL B CA  1 
ATOM   5990 C C   . VAL B 1 239 ? 26.075  3.536   -40.921 1.00 53.76  ? 239  VAL B C   1 
ATOM   5991 O O   . VAL B 1 239 ? 25.843  4.360   -41.825 1.00 56.28  ? 239  VAL B O   1 
ATOM   5992 C CB  . VAL B 1 239 ? 24.998  1.281   -40.779 1.00 52.51  ? 239  VAL B CB  1 
ATOM   5993 C CG1 . VAL B 1 239 ? 24.132  0.403   -39.905 1.00 50.55  ? 239  VAL B CG1 1 
ATOM   5994 C CG2 . VAL B 1 239 ? 24.569  1.196   -42.249 1.00 47.18  ? 239  VAL B CG2 1 
ATOM   5995 N N   . SER B 1 240 ? 27.289  3.287   -40.447 1.00 55.47  ? 240  SER B N   1 
ATOM   5996 C CA  . SER B 1 240 ? 28.472  3.937   -40.994 1.00 59.72  ? 240  SER B CA  1 
ATOM   5997 C C   . SER B 1 240 ? 28.801  3.305   -42.334 1.00 57.87  ? 240  SER B C   1 
ATOM   5998 O O   . SER B 1 240 ? 28.446  2.151   -42.584 1.00 53.35  ? 240  SER B O   1 
ATOM   5999 C CB  . SER B 1 240 ? 29.658  3.742   -40.055 1.00 52.56  ? 240  SER B CB  1 
ATOM   6000 O OG  . SER B 1 240 ? 30.086  2.387   -40.077 1.00 61.83  ? 240  SER B OG  1 
ATOM   6001 N N   . ALA B 1 241 ? 29.486  4.055   -43.188 1.00 56.06  ? 241  ALA B N   1 
ATOM   6002 C CA  . ALA B 1 241 ? 29.991  3.494   -44.439 1.00 56.84  ? 241  ALA B CA  1 
ATOM   6003 C C   . ALA B 1 241 ? 30.771  2.208   -44.184 1.00 57.50  ? 241  ALA B C   1 
ATOM   6004 O O   . ALA B 1 241 ? 30.591  1.217   -44.891 1.00 55.35  ? 241  ALA B O   1 
ATOM   6005 C CB  . ALA B 1 241 ? 30.848  4.496   -45.159 1.00 44.84  ? 241  ALA B CB  1 
ATOM   6006 N N   . GLY B 1 242 ? 31.617  2.225   -43.155 1.00 54.13  ? 242  GLY B N   1 
ATOM   6007 C CA  . GLY B 1 242 ? 32.394  1.059   -42.780 1.00 49.93  ? 242  GLY B CA  1 
ATOM   6008 C C   . GLY B 1 242 ? 31.551  -0.158  -42.464 1.00 56.04  ? 242  GLY B C   1 
ATOM   6009 O O   . GLY B 1 242 ? 31.783  -1.253  -42.981 1.00 59.18  ? 242  GLY B O   1 
ATOM   6010 N N   . GLU B 1 243 ? 30.561  0.025   -41.604 1.00 58.71  ? 243  GLU B N   1 
ATOM   6011 C CA  . GLU B 1 243 ? 29.721  -1.093  -41.196 1.00 58.11  ? 243  GLU B CA  1 
ATOM   6012 C C   . GLU B 1 243 ? 28.813  -1.596  -42.338 1.00 62.63  ? 243  GLU B C   1 
ATOM   6013 O O   . GLU B 1 243 ? 28.433  -2.775  -42.368 1.00 58.37  ? 243  GLU B O   1 
ATOM   6014 C CB  . GLU B 1 243 ? 28.908  -0.708  -39.961 1.00 51.09  ? 243  GLU B CB  1 
ATOM   6015 C CG  . GLU B 1 243 ? 27.923  -1.763  -39.510 1.00 58.82  ? 243  GLU B CG  1 
ATOM   6016 C CD  . GLU B 1 243 ? 28.581  -2.995  -38.912 1.00 56.88  ? 243  GLU B CD  1 
ATOM   6017 O OE1 . GLU B 1 243 ? 27.835  -3.871  -38.426 1.00 55.72  ? 243  GLU B OE1 1 
ATOM   6018 O OE2 . GLU B 1 243 ? 29.829  -3.093  -38.923 1.00 63.96  ? 243  GLU B OE2 1 
ATOM   6019 N N   . ALA B 1 244 ? 28.472  -0.705  -43.273 1.00 54.37  ? 244  ALA B N   1 
ATOM   6020 C CA  . ALA B 1 244 ? 27.660  -1.089  -44.431 1.00 57.10  ? 244  ALA B CA  1 
ATOM   6021 C C   . ALA B 1 244 ? 28.485  -1.927  -45.392 1.00 58.52  ? 244  ALA B C   1 
ATOM   6022 O O   . ALA B 1 244 ? 28.016  -2.940  -45.911 1.00 53.70  ? 244  ALA B O   1 
ATOM   6023 C CB  . ALA B 1 244 ? 27.095  0.129   -45.144 1.00 43.57  ? 244  ALA B CB  1 
ATOM   6024 N N   . ARG B 1 245 ? 29.718  -1.488  -45.623 1.00 62.30  ? 245  ARG B N   1 
ATOM   6025 C CA  . ARG B 1 245 ? 30.673  -2.247  -46.416 1.00 57.17  ? 245  ARG B CA  1 
ATOM   6026 C C   . ARG B 1 245 ? 30.893  -3.602  -45.771 1.00 58.27  ? 245  ARG B C   1 
ATOM   6027 O O   . ARG B 1 245 ? 30.891  -4.638  -46.436 1.00 57.89  ? 245  ARG B O   1 
ATOM   6028 C CB  . ARG B 1 245 ? 31.990  -1.498  -46.497 1.00 60.04  ? 245  ARG B CB  1 
ATOM   6029 C CG  . ARG B 1 245 ? 33.035  -2.218  -47.301 1.00 56.84  ? 245  ARG B CG  1 
ATOM   6030 C CD  . ARG B 1 245 ? 34.100  -1.245  -47.724 1.00 56.28  ? 245  ARG B CD  1 
ATOM   6031 N NE  . ARG B 1 245 ? 33.682  -0.387  -48.833 1.00 61.43  ? 245  ARG B NE  1 
ATOM   6032 C CZ  . ARG B 1 245 ? 33.638  -0.792  -50.100 1.00 68.32  ? 245  ARG B CZ  1 
ATOM   6033 N NH1 . ARG B 1 245 ? 33.262  0.045   -51.068 1.00 61.35  ? 245  ARG B NH1 1 
ATOM   6034 N NH2 . ARG B 1 245 ? 33.964  -2.046  -50.396 1.00 61.81  ? 245  ARG B NH2 1 
ATOM   6035 N N   . ARG B 1 246 ? 31.056  -3.592  -44.457 1.00 56.42  ? 246  ARG B N   1 
ATOM   6036 C CA  . ARG B 1 246 ? 31.218  -4.836  -43.736 1.00 58.11  ? 246  ARG B CA  1 
ATOM   6037 C C   . ARG B 1 246 ? 30.058  -5.804  -44.005 1.00 58.25  ? 246  ARG B C   1 
ATOM   6038 O O   . ARG B 1 246 ? 30.287  -6.936  -44.420 1.00 59.68  ? 246  ARG B O   1 
ATOM   6039 C CB  . ARG B 1 246 ? 31.387  -4.572  -42.243 1.00 59.49  ? 246  ARG B CB  1 
ATOM   6040 C CG  . ARG B 1 246 ? 31.700  -5.811  -41.443 1.00 51.74  ? 246  ARG B CG  1 
ATOM   6041 C CD  . ARG B 1 246 ? 31.057  -5.745  -40.062 1.00 51.17  ? 246  ARG B CD  1 
ATOM   6042 N NE  . ARG B 1 246 ? 30.517  -7.050  -39.704 1.00 53.62  ? 246  ARG B NE  1 
ATOM   6043 C CZ  . ARG B 1 246 ? 29.275  -7.276  -39.281 1.00 66.28  ? 246  ARG B CZ  1 
ATOM   6044 N NH1 . ARG B 1 246 ? 28.425  -6.273  -39.119 1.00 59.91  ? 246  ARG B NH1 1 
ATOM   6045 N NH2 . ARG B 1 246 ? 28.889  -8.518  -38.987 1.00 74.97  ? 246  ARG B NH2 1 
ATOM   6046 N N   . ARG B 1 247 ? 28.818  -5.367  -43.790 1.00 57.40  ? 247  ARG B N   1 
ATOM   6047 C CA  . ARG B 1 247 ? 27.679  -6.283  -43.908 1.00 59.04  ? 247  ARG B CA  1 
ATOM   6048 C C   . ARG B 1 247 ? 27.441  -6.754  -45.342 1.00 58.36  ? 247  ARG B C   1 
ATOM   6049 O O   . ARG B 1 247 ? 27.053  -7.900  -45.581 1.00 56.18  ? 247  ARG B O   1 
ATOM   6050 C CB  . ARG B 1 247 ? 26.404  -5.655  -43.346 1.00 58.85  ? 247  ARG B CB  1 
ATOM   6051 C CG  . ARG B 1 247 ? 26.444  -5.381  -41.854 1.00 60.53  ? 247  ARG B CG  1 
ATOM   6052 C CD  . ARG B 1 247 ? 25.182  -4.674  -41.404 1.00 57.40  ? 247  ARG B CD  1 
ATOM   6053 N NE  . ARG B 1 247 ? 25.341  -4.005  -40.121 1.00 58.26  ? 247  ARG B NE  1 
ATOM   6054 C CZ  . ARG B 1 247 ? 24.334  -3.489  -39.423 1.00 63.60  ? 247  ARG B CZ  1 
ATOM   6055 N NH1 . ARG B 1 247 ? 23.093  -3.570  -39.889 1.00 62.26  ? 247  ARG B NH1 1 
ATOM   6056 N NH2 . ARG B 1 247 ? 24.561  -2.897  -38.260 1.00 59.45  ? 247  ARG B NH2 1 
ATOM   6057 N N   . ALA B 1 248 ? 27.670  -5.856  -46.291 1.00 55.75  ? 248  ALA B N   1 
ATOM   6058 C CA  . ALA B 1 248 ? 27.566  -6.188  -47.704 1.00 54.52  ? 248  ALA B CA  1 
ATOM   6059 C C   . ALA B 1 248 ? 28.474  -7.363  -48.075 1.00 67.47  ? 248  ALA B C   1 
ATOM   6060 O O   . ALA B 1 248 ? 28.000  -8.378  -48.598 1.00 67.75  ? 248  ALA B O   1 
ATOM   6061 C CB  . ALA B 1 248 ? 27.895  -4.974  -48.559 1.00 47.91  ? 248  ALA B CB  1 
ATOM   6062 N N   . THR B 1 249 ? 29.774  -7.242  -47.809 1.00 61.84  ? 249  THR B N   1 
ATOM   6063 C CA  . THR B 1 249 ? 30.695  -8.286  -48.248 1.00 66.63  ? 249  THR B CA  1 
ATOM   6064 C C   . THR B 1 249 ? 30.455  -9.606  -47.512 1.00 62.16  ? 249  THR B C   1 
ATOM   6065 O O   . THR B 1 249 ? 30.599  -10.684 -48.085 1.00 67.75  ? 249  THR B O   1 
ATOM   6066 C CB  . THR B 1 249 ? 32.163  -7.883  -48.105 1.00 57.22  ? 249  THR B CB  1 
ATOM   6067 O OG1 . THR B 1 249 ? 32.679  -8.432  -46.896 1.00 66.83  ? 249  THR B OG1 1 
ATOM   6068 C CG2 . THR B 1 249 ? 32.322  -6.375  -48.117 1.00 52.92  ? 249  THR B CG2 1 
ATOM   6069 N N   . LEU B 1 250 ? 30.079  -9.519  -46.247 1.00 54.88  ? 250  LEU B N   1 
ATOM   6070 C CA  . LEU B 1 250 ? 29.748  -10.711 -45.495 1.00 61.89  ? 250  LEU B CA  1 
ATOM   6071 C C   . LEU B 1 250 ? 28.547  -11.421 -46.126 1.00 67.45  ? 250  LEU B C   1 
ATOM   6072 O O   . LEU B 1 250 ? 28.488  -12.654 -46.175 1.00 69.33  ? 250  LEU B O   1 
ATOM   6073 C CB  . LEU B 1 250 ? 29.480  -10.367 -44.027 1.00 57.86  ? 250  LEU B CB  1 
ATOM   6074 C CG  . LEU B 1 250 ? 28.758  -11.440 -43.208 1.00 58.21  ? 250  LEU B CG  1 
ATOM   6075 C CD1 . LEU B 1 250 ? 29.478  -12.785 -43.309 1.00 57.13  ? 250  LEU B CD1 1 
ATOM   6076 C CD2 . LEU B 1 250 ? 28.600  -11.018 -41.755 1.00 49.15  ? 250  LEU B CD2 1 
ATOM   6077 N N   . LEU B 1 251 ? 27.584  -10.654 -46.618 1.00 63.75  ? 251  LEU B N   1 
ATOM   6078 C CA  . LEU B 1 251 ? 26.446  -11.288 -47.264 1.00 69.22  ? 251  LEU B CA  1 
ATOM   6079 C C   . LEU B 1 251 ? 26.874  -11.868 -48.609 1.00 64.84  ? 251  LEU B C   1 
ATOM   6080 O O   . LEU B 1 251 ? 26.404  -12.930 -49.008 1.00 69.99  ? 251  LEU B O   1 
ATOM   6081 C CB  . LEU B 1 251 ? 25.278  -10.319 -47.438 1.00 64.20  ? 251  LEU B CB  1 
ATOM   6082 C CG  . LEU B 1 251 ? 24.042  -10.958 -48.078 1.00 60.79  ? 251  LEU B CG  1 
ATOM   6083 C CD1 . LEU B 1 251 ? 22.987  -11.330 -47.037 1.00 63.04  ? 251  LEU B CD1 1 
ATOM   6084 C CD2 . LEU B 1 251 ? 23.472  -10.003 -49.082 1.00 55.99  ? 251  LEU B CD2 1 
ATOM   6085 N N   . ALA B 1 252 ? 27.768  -11.171 -49.303 1.00 62.26  ? 252  ALA B N   1 
ATOM   6086 C CA  . ALA B 1 252 ? 28.294  -11.670 -50.568 1.00 66.30  ? 252  ALA B CA  1 
ATOM   6087 C C   . ALA B 1 252 ? 28.917  -13.026 -50.325 1.00 67.94  ? 252  ALA B C   1 
ATOM   6088 O O   . ALA B 1 252 ? 28.768  -13.952 -51.112 1.00 72.74  ? 252  ALA B O   1 
ATOM   6089 C CB  . ALA B 1 252 ? 29.329  -10.723 -51.116 1.00 63.82  ? 252  ALA B CB  1 
ATOM   6090 N N   . ARG B 1 253 ? 29.619  -13.130 -49.208 1.00 67.90  ? 253  ARG B N   1 
ATOM   6091 C CA  . ARG B 1 253 ? 30.302  -14.352 -48.853 1.00 66.99  ? 253  ARG B CA  1 
ATOM   6092 C C   . ARG B 1 253 ? 29.288  -15.455 -48.580 1.00 68.92  ? 253  ARG B C   1 
ATOM   6093 O O   . ARG B 1 253 ? 29.434  -16.575 -49.060 1.00 73.38  ? 253  ARG B O   1 
ATOM   6094 C CB  . ARG B 1 253 ? 31.196  -14.106 -47.640 1.00 70.84  ? 253  ARG B CB  1 
ATOM   6095 C CG  . ARG B 1 253 ? 31.956  -15.315 -47.166 1.00 80.01  ? 253  ARG B CG  1 
ATOM   6096 C CD  . ARG B 1 253 ? 32.854  -14.969 -45.993 1.00 91.64  ? 253  ARG B CD  1 
ATOM   6097 N NE  . ARG B 1 253 ? 33.486  -16.161 -45.436 1.00 106.97 ? 253  ARG B NE  1 
ATOM   6098 C CZ  . ARG B 1 253 ? 33.026  -16.826 -44.381 1.00 113.30 ? 253  ARG B CZ  1 
ATOM   6099 N NH1 . ARG B 1 253 ? 31.929  -16.408 -43.756 1.00 98.43  ? 253  ARG B NH1 1 
ATOM   6100 N NH2 . ARG B 1 253 ? 33.668  -17.906 -43.948 1.00 113.03 ? 253  ARG B NH2 1 
ATOM   6101 N N   . LEU B 1 254 ? 28.252  -15.133 -47.818 1.00 66.48  ? 254  LEU B N   1 
ATOM   6102 C CA  . LEU B 1 254 ? 27.223  -16.111 -47.491 1.00 69.66  ? 254  LEU B CA  1 
ATOM   6103 C C   . LEU B 1 254 ? 26.503  -16.659 -48.726 1.00 70.64  ? 254  LEU B C   1 
ATOM   6104 O O   . LEU B 1 254 ? 25.788  -17.663 -48.639 1.00 63.87  ? 254  LEU B O   1 
ATOM   6105 C CB  . LEU B 1 254 ? 26.196  -15.505 -46.531 1.00 75.84  ? 254  LEU B CB  1 
ATOM   6106 C CG  . LEU B 1 254 ? 26.762  -14.863 -45.274 1.00 72.68  ? 254  LEU B CG  1 
ATOM   6107 C CD1 . LEU B 1 254 ? 25.642  -14.558 -44.295 1.00 68.78  ? 254  LEU B CD1 1 
ATOM   6108 C CD2 . LEU B 1 254 ? 27.778  -15.799 -44.665 1.00 67.89  ? 254  LEU B CD2 1 
ATOM   6109 N N   . VAL B 1 255 ? 26.668  -15.987 -49.864 1.00 69.80  ? 255  VAL B N   1 
ATOM   6110 C CA  . VAL B 1 255 ? 26.017  -16.422 -51.102 1.00 73.76  ? 255  VAL B CA  1 
ATOM   6111 C C   . VAL B 1 255 ? 27.034  -16.772 -52.187 1.00 72.22  ? 255  VAL B C   1 
ATOM   6112 O O   . VAL B 1 255 ? 26.680  -16.940 -53.353 1.00 79.27  ? 255  VAL B O   1 
ATOM   6113 C CB  . VAL B 1 255 ? 24.993  -15.378 -51.639 1.00 63.71  ? 255  VAL B CB  1 
ATOM   6114 C CG1 . VAL B 1 255 ? 23.818  -15.243 -50.684 1.00 58.23  ? 255  VAL B CG1 1 
ATOM   6115 C CG2 . VAL B 1 255 ? 25.656  -14.036 -51.883 1.00 59.79  ? 255  VAL B CG2 1 
ATOM   6116 N N   . GLY B 1 256 ? 28.297  -16.877 -51.789 1.00 70.65  ? 256  GLY B N   1 
ATOM   6117 C CA  . GLY B 1 256 ? 29.366  -17.284 -52.682 1.00 69.65  ? 256  GLY B CA  1 
ATOM   6118 C C   . GLY B 1 256 ? 29.877  -16.205 -53.619 1.00 72.51  ? 256  GLY B C   1 
ATOM   6119 O O   . GLY B 1 256 ? 29.837  -16.382 -54.828 1.00 83.64  ? 256  GLY B O   1 
ATOM   6120 N N   . CYS B 1 257 ? 30.382  -15.101 -53.078 1.00 72.04  ? 257  CYS B N   1 
ATOM   6121 C CA  . CYS B 1 257 ? 30.849  -14.010 -53.924 1.00 73.93  ? 257  CYS B CA  1 
ATOM   6122 C C   . CYS B 1 257 ? 32.071  -13.280 -53.364 1.00 81.46  ? 257  CYS B C   1 
ATOM   6123 O O   . CYS B 1 257 ? 33.013  -12.973 -54.103 1.00 81.70  ? 257  CYS B O   1 
ATOM   6124 C CB  . CYS B 1 257 ? 29.700  -13.028 -54.196 1.00 79.50  ? 257  CYS B CB  1 
ATOM   6125 S SG  . CYS B 1 257 ? 28.396  -13.670 -55.327 1.00 110.06 ? 257  CYS B SG  1 
ATOM   6126 N N   . ASN B 1 265 ? 37.663  -6.425  -55.138 1.00 78.16  ? 265  ASN B N   1 
ATOM   6127 C CA  . ASN B 1 265 ? 37.135  -5.350  -55.976 1.00 88.09  ? 265  ASN B CA  1 
ATOM   6128 C C   . ASN B 1 265 ? 35.596  -5.359  -56.075 1.00 85.34  ? 265  ASN B C   1 
ATOM   6129 O O   . ASN B 1 265 ? 34.982  -6.405  -56.310 1.00 76.68  ? 265  ASN B O   1 
ATOM   6130 C CB  . ASN B 1 265 ? 37.807  -5.379  -57.355 1.00 84.47  ? 265  ASN B CB  1 
ATOM   6131 C CG  . ASN B 1 265 ? 36.962  -4.739  -58.439 1.00 92.24  ? 265  ASN B CG  1 
ATOM   6132 O OD1 . ASN B 1 265 ? 35.869  -5.213  -58.744 1.00 91.20  ? 265  ASN B OD1 1 
ATOM   6133 N ND2 . ASN B 1 265 ? 37.478  -3.675  -59.049 1.00 90.76  ? 265  ASN B ND2 1 
ATOM   6134 N N   . ASP B 1 266 ? 34.991  -4.184  -55.890 1.00 80.13  ? 266  ASP B N   1 
ATOM   6135 C CA  . ASP B 1 266 ? 33.532  -4.040  -55.787 1.00 77.30  ? 266  ASP B CA  1 
ATOM   6136 C C   . ASP B 1 266 ? 32.772  -4.532  -57.009 1.00 76.78  ? 266  ASP B C   1 
ATOM   6137 O O   . ASP B 1 266 ? 31.887  -5.379  -56.906 1.00 70.64  ? 266  ASP B O   1 
ATOM   6138 C CB  . ASP B 1 266 ? 33.151  -2.576  -55.535 1.00 72.67  ? 266  ASP B CB  1 
ATOM   6139 C CG  . ASP B 1 266 ? 33.618  -2.074  -54.180 1.00 87.36  ? 266  ASP B CG  1 
ATOM   6140 O OD1 . ASP B 1 266 ? 33.959  -2.926  -53.322 1.00 85.56  ? 266  ASP B OD1 1 
ATOM   6141 O OD2 . ASP B 1 266 ? 33.640  -0.833  -53.976 1.00 73.61  ? 266  ASP B OD2 1 
ATOM   6142 N N   . THR B 1 267 ? 33.109  -3.968  -58.161 1.00 77.85  ? 267  THR B N   1 
ATOM   6143 C CA  . THR B 1 267 ? 32.461  -4.316  -59.413 1.00 71.59  ? 267  THR B CA  1 
ATOM   6144 C C   . THR B 1 267 ? 32.224  -5.813  -59.549 1.00 73.84  ? 267  THR B C   1 
ATOM   6145 O O   . THR B 1 267 ? 31.125  -6.253  -59.898 1.00 74.11  ? 267  THR B O   1 
ATOM   6146 C CB  . THR B 1 267 ? 33.289  -3.842  -60.599 1.00 68.78  ? 267  THR B CB  1 
ATOM   6147 O OG1 . THR B 1 267 ? 33.445  -2.419  -60.526 1.00 75.18  ? 267  THR B OG1 1 
ATOM   6148 C CG2 . THR B 1 267 ? 32.593  -4.204  -61.894 1.00 75.79  ? 267  THR B CG2 1 
ATOM   6149 N N   . GLU B 1 268 ? 33.260  -6.592  -59.270 1.00 77.36  ? 268  GLU B N   1 
ATOM   6150 C CA  . GLU B 1 268 ? 33.164  -8.040  -59.374 1.00 82.72  ? 268  GLU B CA  1 
ATOM   6151 C C   . GLU B 1 268 ? 32.157  -8.583  -58.363 1.00 73.52  ? 268  GLU B C   1 
ATOM   6152 O O   . GLU B 1 268 ? 31.216  -9.293  -58.727 1.00 68.05  ? 268  GLU B O   1 
ATOM   6153 C CB  . GLU B 1 268 ? 34.544  -8.686  -59.200 1.00 86.87  ? 268  GLU B CB  1 
ATOM   6154 C CG  . GLU B 1 268 ? 35.543  -8.316  -60.310 1.00 105.28 ? 268  GLU B CG  1 
ATOM   6155 C CD  . GLU B 1 268 ? 37.000  -8.229  -59.824 1.00 122.98 ? 268  GLU B CD  1 
ATOM   6156 O OE1 . GLU B 1 268 ? 37.259  -8.464  -58.616 1.00 111.60 ? 268  GLU B OE1 1 
ATOM   6157 O OE2 . GLU B 1 268 ? 37.885  -7.915  -60.659 1.00 123.10 ? 268  GLU B OE2 1 
ATOM   6158 N N   . LEU B 1 269 ? 32.343  -8.233  -57.096 1.00 75.20  ? 269  LEU B N   1 
ATOM   6159 C CA  . LEU B 1 269 ? 31.409  -8.644  -56.052 1.00 70.65  ? 269  LEU B CA  1 
ATOM   6160 C C   . LEU B 1 269 ? 29.953  -8.300  -56.411 1.00 69.56  ? 269  LEU B C   1 
ATOM   6161 O O   . LEU B 1 269 ? 29.060  -9.151  -56.343 1.00 64.59  ? 269  LEU B O   1 
ATOM   6162 C CB  . LEU B 1 269 ? 31.799  -7.999  -54.721 1.00 73.07  ? 269  LEU B CB  1 
ATOM   6163 C CG  . LEU B 1 269 ? 31.109  -8.525  -53.458 1.00 74.87  ? 269  LEU B CG  1 
ATOM   6164 C CD1 . LEU B 1 269 ? 31.855  -8.068  -52.232 1.00 68.79  ? 269  LEU B CD1 1 
ATOM   6165 C CD2 . LEU B 1 269 ? 29.669  -8.062  -53.379 1.00 70.82  ? 269  LEU B CD2 1 
ATOM   6166 N N   . ILE B 1 270 ? 29.721  -7.050  -56.795 1.00 65.05  ? 270  ILE B N   1 
ATOM   6167 C CA  . ILE B 1 270 ? 28.371  -6.587  -57.071 1.00 70.38  ? 270  ILE B CA  1 
ATOM   6168 C C   . ILE B 1 270 ? 27.748  -7.296  -58.274 1.00 76.33  ? 270  ILE B C   1 
ATOM   6169 O O   . ILE B 1 270 ? 26.561  -7.661  -58.255 1.00 63.64  ? 270  ILE B O   1 
ATOM   6170 C CB  . ILE B 1 270 ? 28.343  -5.071  -57.247 1.00 69.55  ? 270  ILE B CB  1 
ATOM   6171 C CG1 . ILE B 1 270 ? 28.684  -4.409  -55.910 1.00 71.16  ? 270  ILE B CG1 1 
ATOM   6172 C CG2 . ILE B 1 270 ? 26.977  -4.613  -57.721 1.00 68.96  ? 270  ILE B CG2 1 
ATOM   6173 C CD1 . ILE B 1 270 ? 29.280  -3.020  -56.035 1.00 76.50  ? 270  ILE B CD1 1 
ATOM   6174 N N   . ALA B 1 271 ? 28.551  -7.508  -59.311 1.00 70.90  ? 271  ALA B N   1 
ATOM   6175 C CA  . ALA B 1 271 ? 28.085  -8.266  -60.463 1.00 64.41  ? 271  ALA B CA  1 
ATOM   6176 C C   . ALA B 1 271 ? 27.566  -9.646  -60.053 1.00 62.49  ? 271  ALA B C   1 
ATOM   6177 O O   . ALA B 1 271 ? 26.474  -10.049 -60.449 1.00 68.73  ? 271  ALA B O   1 
ATOM   6178 C CB  . ALA B 1 271 ? 29.177  -8.391  -61.494 1.00 58.41  ? 271  ALA B CB  1 
ATOM   6179 N N   . CYS B 1 272 ? 28.337  -10.369 -59.252 1.00 67.50  ? 272  CYS B N   1 
ATOM   6180 C CA  . CYS B 1 272 ? 27.921  -11.706 -58.837 1.00 69.30  ? 272  CYS B CA  1 
ATOM   6181 C C   . CYS B 1 272 ? 26.625  -11.668 -58.019 1.00 69.84  ? 272  CYS B C   1 
ATOM   6182 O O   . CYS B 1 272 ? 25.777  -12.561 -58.143 1.00 71.24  ? 272  CYS B O   1 
ATOM   6183 C CB  . CYS B 1 272 ? 29.042  -12.425 -58.070 1.00 62.63  ? 272  CYS B CB  1 
ATOM   6184 S SG  . CYS B 1 272 ? 28.560  -14.042 -57.351 1.00 90.20  ? 272  CYS B SG  1 
ATOM   6185 N N   . LEU B 1 273 ? 26.474  -10.638 -57.185 1.00 67.19  ? 273  LEU B N   1 
ATOM   6186 C CA  . LEU B 1 273 ? 25.259  -10.481 -56.385 1.00 63.23  ? 273  LEU B CA  1 
ATOM   6187 C C   . LEU B 1 273 ? 24.021  -10.257 -57.259 1.00 59.83  ? 273  LEU B C   1 
ATOM   6188 O O   . LEU B 1 273 ? 22.950  -10.803 -56.985 1.00 57.11  ? 273  LEU B O   1 
ATOM   6189 C CB  . LEU B 1 273 ? 25.414  -9.342  -55.380 1.00 63.03  ? 273  LEU B CB  1 
ATOM   6190 C CG  . LEU B 1 273 ? 26.056  -9.694  -54.040 1.00 60.96  ? 273  LEU B CG  1 
ATOM   6191 C CD1 . LEU B 1 273 ? 26.068  -8.474  -53.147 1.00 61.55  ? 273  LEU B CD1 1 
ATOM   6192 C CD2 . LEU B 1 273 ? 25.323  -10.835 -53.363 1.00 57.96  ? 273  LEU B CD2 1 
ATOM   6193 N N   . ARG B 1 274 ? 24.186  -9.468  -58.320 1.00 61.21  ? 274  ARG B N   1 
ATOM   6194 C CA  . ARG B 1 274 ? 23.110  -9.202  -59.277 1.00 59.36  ? 274  ARG B CA  1 
ATOM   6195 C C   . ARG B 1 274 ? 22.602  -10.454 -59.993 1.00 62.29  ? 274  ARG B C   1 
ATOM   6196 O O   . ARG B 1 274 ? 21.533  -10.433 -60.606 1.00 71.32  ? 274  ARG B O   1 
ATOM   6197 C CB  . ARG B 1 274 ? 23.544  -8.151  -60.304 1.00 53.09  ? 274  ARG B CB  1 
ATOM   6198 C CG  . ARG B 1 274 ? 23.387  -6.709  -59.810 1.00 62.18  ? 274  ARG B CG  1 
ATOM   6199 C CD  . ARG B 1 274 ? 23.557  -5.738  -60.943 1.00 59.86  ? 274  ARG B CD  1 
ATOM   6200 N NE  . ARG B 1 274 ? 24.852  -5.943  -61.573 1.00 68.87  ? 274  ARG B NE  1 
ATOM   6201 C CZ  . ARG B 1 274 ? 25.808  -5.020  -61.626 1.00 88.09  ? 274  ARG B CZ  1 
ATOM   6202 N NH1 . ARG B 1 274 ? 25.599  -3.809  -61.113 1.00 77.74  ? 274  ARG B NH1 1 
ATOM   6203 N NH2 . ARG B 1 274 ? 26.970  -5.305  -62.208 1.00 81.44  ? 274  ARG B NH2 1 
ATOM   6204 N N   . THR B 1 275 ? 23.362  -11.540 -59.906 1.00 58.39  ? 275  THR B N   1 
ATOM   6205 C CA  . THR B 1 275 ? 22.990  -12.793 -60.555 1.00 63.85  ? 275  THR B CA  1 
ATOM   6206 C C   . THR B 1 275 ? 22.316  -13.771 -59.603 1.00 64.69  ? 275  THR B C   1 
ATOM   6207 O O   . THR B 1 275 ? 22.072  -14.910 -59.967 1.00 67.18  ? 275  THR B O   1 
ATOM   6208 C CB  . THR B 1 275 ? 24.221  -13.528 -61.116 1.00 66.23  ? 275  THR B CB  1 
ATOM   6209 O OG1 . THR B 1 275 ? 24.902  -14.199 -60.043 1.00 70.15  ? 275  THR B OG1 1 
ATOM   6210 C CG2 . THR B 1 275 ? 25.170  -12.558 -61.811 1.00 56.55  ? 275  THR B CG2 1 
ATOM   6211 N N   . ARG B 1 276 ? 22.041  -13.350 -58.379 1.00 58.60  ? 276  ARG B N   1 
ATOM   6212 C CA  . ARG B 1 276 ? 21.410  -14.248 -57.427 1.00 59.38  ? 276  ARG B CA  1 
ATOM   6213 C C   . ARG B 1 276 ? 19.899  -14.038 -57.372 1.00 57.18  ? 276  ARG B C   1 
ATOM   6214 O O   . ARG B 1 276 ? 19.434  -12.912 -57.264 1.00 63.30  ? 276  ARG B O   1 
ATOM   6215 C CB  . ARG B 1 276 ? 22.023  -14.054 -56.039 1.00 66.13  ? 276  ARG B CB  1 
ATOM   6216 C CG  . ARG B 1 276 ? 23.463  -14.518 -55.931 1.00 73.06  ? 276  ARG B CG  1 
ATOM   6217 C CD  . ARG B 1 276 ? 23.535  -16.033 -56.016 1.00 71.56  ? 276  ARG B CD  1 
ATOM   6218 N NE  . ARG B 1 276 ? 24.895  -16.526 -55.856 1.00 80.56  ? 276  ARG B NE  1 
ATOM   6219 C CZ  . ARG B 1 276 ? 25.751  -16.669 -56.861 1.00 87.87  ? 276  ARG B CZ  1 
ATOM   6220 N NH1 . ARG B 1 276 ? 25.377  -16.350 -58.093 1.00 85.31  ? 276  ARG B NH1 1 
ATOM   6221 N NH2 . ARG B 1 276 ? 26.978  -17.124 -56.635 1.00 79.38  ? 276  ARG B NH2 1 
ATOM   6222 N N   . PRO B 1 277 ? 19.126  -15.125 -57.445 1.00 52.54  ? 277  PRO B N   1 
ATOM   6223 C CA  . PRO B 1 277 ? 17.691  -14.983 -57.201 1.00 65.89  ? 277  PRO B CA  1 
ATOM   6224 C C   . PRO B 1 277 ? 17.442  -14.131 -55.960 1.00 63.53  ? 277  PRO B C   1 
ATOM   6225 O O   . PRO B 1 277 ? 18.194  -14.211 -54.986 1.00 56.82  ? 277  PRO B O   1 
ATOM   6226 C CB  . PRO B 1 277 ? 17.231  -16.427 -56.953 1.00 59.17  ? 277  PRO B CB  1 
ATOM   6227 C CG  . PRO B 1 277 ? 18.186  -17.242 -57.708 1.00 59.80  ? 277  PRO B CG  1 
ATOM   6228 C CD  . PRO B 1 277 ? 19.512  -16.528 -57.658 1.00 54.80  ? 277  PRO B CD  1 
ATOM   6229 N N   . ALA B 1 278 ? 16.390  -13.323 -56.004 1.00 63.82  ? 278  ALA B N   1 
ATOM   6230 C CA  . ALA B 1 278 ? 16.055  -12.447 -54.897 1.00 57.92  ? 278  ALA B CA  1 
ATOM   6231 C C   . ALA B 1 278 ? 16.057  -13.214 -53.583 1.00 61.59  ? 278  ALA B C   1 
ATOM   6232 O O   . ALA B 1 278 ? 16.671  -12.779 -52.607 1.00 58.00  ? 278  ALA B O   1 
ATOM   6233 C CB  . ALA B 1 278 ? 14.708  -11.807 -55.128 1.00 54.25  ? 278  ALA B CB  1 
ATOM   6234 N N   . GLN B 1 279 ? 15.384  -14.364 -53.568 1.00 62.28  ? 279  GLN B N   1 
ATOM   6235 C CA  . GLN B 1 279 ? 15.188  -15.108 -52.325 1.00 63.34  ? 279  GLN B CA  1 
ATOM   6236 C C   . GLN B 1 279 ? 16.468  -15.659 -51.713 1.00 65.88  ? 279  GLN B C   1 
ATOM   6237 O O   . GLN B 1 279 ? 16.496  -15.973 -50.526 1.00 63.04  ? 279  GLN B O   1 
ATOM   6238 C CB  . GLN B 1 279 ? 14.183  -16.240 -52.494 1.00 53.37  ? 279  GLN B CB  1 
ATOM   6239 C CG  . GLN B 1 279 ? 13.780  -16.843 -51.164 1.00 57.93  ? 279  GLN B CG  1 
ATOM   6240 C CD  . GLN B 1 279 ? 13.122  -15.834 -50.235 1.00 61.43  ? 279  GLN B CD  1 
ATOM   6241 O OE1 . GLN B 1 279 ? 12.507  -14.871 -50.683 1.00 65.37  ? 279  GLN B OE1 1 
ATOM   6242 N NE2 . GLN B 1 279 ? 13.237  -16.062 -48.937 1.00 63.35  ? 279  GLN B NE2 1 
ATOM   6243 N N   . ASP B 1 280 ? 17.518  -15.783 -52.516 1.00 62.58  ? 280  ASP B N   1 
ATOM   6244 C CA  . ASP B 1 280 ? 18.807  -16.205 -51.985 1.00 66.03  ? 280  ASP B CA  1 
ATOM   6245 C C   . ASP B 1 280 ? 19.335  -15.101 -51.083 1.00 68.90  ? 280  ASP B C   1 
ATOM   6246 O O   . ASP B 1 280 ? 19.845  -15.372 -49.998 1.00 73.09  ? 280  ASP B O   1 
ATOM   6247 C CB  . ASP B 1 280 ? 19.813  -16.475 -53.107 1.00 66.64  ? 280  ASP B CB  1 
ATOM   6248 C CG  . ASP B 1 280 ? 19.564  -17.794 -53.829 1.00 76.09  ? 280  ASP B CG  1 
ATOM   6249 O OD1 . ASP B 1 280 ? 18.515  -18.446 -53.593 1.00 83.64  ? 280  ASP B OD1 1 
ATOM   6250 O OD2 . ASP B 1 280 ? 20.434  -18.176 -54.643 1.00 74.07  ? 280  ASP B OD2 1 
ATOM   6251 N N   . LEU B 1 281 ? 19.210  -13.858 -51.549 1.00 66.66  ? 281  LEU B N   1 
ATOM   6252 C CA  . LEU B 1 281 ? 19.632  -12.680 -50.793 1.00 62.54  ? 281  LEU B CA  1 
ATOM   6253 C C   . LEU B 1 281 ? 18.852  -12.537 -49.486 1.00 63.00  ? 281  LEU B C   1 
ATOM   6254 O O   . LEU B 1 281 ? 19.432  -12.333 -48.422 1.00 61.36  ? 281  LEU B O   1 
ATOM   6255 C CB  . LEU B 1 281 ? 19.471  -11.421 -51.645 1.00 61.00  ? 281  LEU B CB  1 
ATOM   6256 C CG  . LEU B 1 281 ? 20.704  -10.946 -52.414 1.00 58.31  ? 281  LEU B CG  1 
ATOM   6257 C CD1 . LEU B 1 281 ? 21.582  -12.119 -52.801 1.00 63.66  ? 281  LEU B CD1 1 
ATOM   6258 C CD2 . LEU B 1 281 ? 20.300  -10.141 -53.632 1.00 59.08  ? 281  LEU B CD2 1 
ATOM   6259 N N   . VAL B 1 282 ? 17.536  -12.665 -49.571 1.00 54.84  ? 282  VAL B N   1 
ATOM   6260 C CA  . VAL B 1 282 ? 16.695  -12.567 -48.395 1.00 52.57  ? 282  VAL B CA  1 
ATOM   6261 C C   . VAL B 1 282 ? 17.034  -13.660 -47.380 1.00 60.22  ? 282  VAL B C   1 
ATOM   6262 O O   . VAL B 1 282 ? 16.909  -13.458 -46.168 1.00 59.51  ? 282  VAL B O   1 
ATOM   6263 C CB  . VAL B 1 282 ? 15.207  -12.613 -48.789 1.00 48.88  ? 282  VAL B CB  1 
ATOM   6264 C CG1 . VAL B 1 282 ? 14.319  -12.825 -47.566 1.00 49.12  ? 282  VAL B CG1 1 
ATOM   6265 C CG2 . VAL B 1 282 ? 14.831  -11.336 -49.515 1.00 48.76  ? 282  VAL B CG2 1 
ATOM   6266 N N   . ASP B 1 283 ? 17.478  -14.811 -47.882 1.00 67.76  ? 283  ASP B N   1 
ATOM   6267 C CA  . ASP B 1 283 ? 17.774  -15.977 -47.043 1.00 65.19  ? 283  ASP B CA  1 
ATOM   6268 C C   . ASP B 1 283 ? 18.896  -15.710 -46.034 1.00 68.21  ? 283  ASP B C   1 
ATOM   6269 O O   . ASP B 1 283 ? 18.968  -16.359 -44.991 1.00 62.64  ? 283  ASP B O   1 
ATOM   6270 C CB  . ASP B 1 283 ? 18.122  -17.204 -47.906 1.00 73.05  ? 283  ASP B CB  1 
ATOM   6271 C CG  . ASP B 1 283 ? 16.880  -17.953 -48.416 1.00 83.68  ? 283  ASP B CG  1 
ATOM   6272 O OD1 . ASP B 1 283 ? 15.749  -17.593 -48.019 1.00 72.81  ? 283  ASP B OD1 1 
ATOM   6273 O OD2 . ASP B 1 283 ? 17.037  -18.908 -49.219 1.00 83.50  ? 283  ASP B OD2 1 
ATOM   6274 N N   . HIS B 1 284 ? 19.768  -14.756 -46.339 1.00 59.78  ? 284  HIS B N   1 
ATOM   6275 C CA  . HIS B 1 284 ? 20.849  -14.427 -45.424 1.00 64.14  ? 284  HIS B CA  1 
ATOM   6276 C C   . HIS B 1 284 ? 20.779  -13.018 -44.851 1.00 62.05  ? 284  HIS B C   1 
ATOM   6277 O O   . HIS B 1 284 ? 21.676  -12.611 -44.118 1.00 65.39  ? 284  HIS B O   1 
ATOM   6278 C CB  . HIS B 1 284 ? 22.192  -14.643 -46.105 1.00 68.57  ? 284  HIS B CB  1 
ATOM   6279 C CG  . HIS B 1 284 ? 22.456  -16.072 -46.443 1.00 74.15  ? 284  HIS B CG  1 
ATOM   6280 N ND1 . HIS B 1 284 ? 22.460  -17.068 -45.490 1.00 78.69  ? 284  HIS B ND1 1 
ATOM   6281 C CD2 . HIS B 1 284 ? 22.711  -16.677 -47.626 1.00 66.68  ? 284  HIS B CD2 1 
ATOM   6282 C CE1 . HIS B 1 284 ? 22.710  -18.227 -46.072 1.00 79.10  ? 284  HIS B CE1 1 
ATOM   6283 N NE2 . HIS B 1 284 ? 22.869  -18.016 -47.366 1.00 82.99  ? 284  HIS B NE2 1 
ATOM   6284 N N   . GLU B 1 285 ? 19.715  -12.290 -45.186 1.00 63.04  ? 285  GLU B N   1 
ATOM   6285 C CA  . GLU B 1 285 ? 19.544  -10.898 -44.772 1.00 64.44  ? 285  GLU B CA  1 
ATOM   6286 C C   . GLU B 1 285 ? 19.900  -10.737 -43.298 1.00 65.15  ? 285  GLU B C   1 
ATOM   6287 O O   . GLU B 1 285 ? 20.670  -9.854  -42.923 1.00 59.90  ? 285  GLU B O   1 
ATOM   6288 C CB  . GLU B 1 285 ? 18.096  -10.442 -45.024 1.00 61.05  ? 285  GLU B CB  1 
ATOM   6289 C CG  . GLU B 1 285 ? 17.955  -8.990  -45.491 1.00 65.11  ? 285  GLU B CG  1 
ATOM   6290 C CD  . GLU B 1 285 ? 16.686  -8.728  -46.313 1.00 75.29  ? 285  GLU B CD  1 
ATOM   6291 O OE1 . GLU B 1 285 ? 16.772  -8.668  -47.576 1.00 74.63  ? 285  GLU B OE1 1 
ATOM   6292 O OE2 . GLU B 1 285 ? 15.605  -8.578  -45.698 1.00 73.34  ? 285  GLU B OE2 1 
ATOM   6293 N N   . TRP B 1 286 ? 19.365  -11.640 -42.484 1.00 63.44  ? 286  TRP B N   1 
ATOM   6294 C CA  . TRP B 1 286 ? 19.446  -11.549 -41.035 1.00 62.84  ? 286  TRP B CA  1 
ATOM   6295 C C   . TRP B 1 286 ? 20.729  -12.079 -40.403 1.00 67.83  ? 286  TRP B C   1 
ATOM   6296 O O   . TRP B 1 286 ? 20.827  -12.144 -39.179 1.00 73.09  ? 286  TRP B O   1 
ATOM   6297 C CB  . TRP B 1 286 ? 18.262  -12.283 -40.414 1.00 60.97  ? 286  TRP B CB  1 
ATOM   6298 C CG  . TRP B 1 286 ? 16.968  -11.592 -40.648 1.00 69.77  ? 286  TRP B CG  1 
ATOM   6299 C CD1 . TRP B 1 286 ? 15.965  -11.993 -41.477 1.00 67.45  ? 286  TRP B CD1 1 
ATOM   6300 C CD2 . TRP B 1 286 ? 16.530  -10.363 -40.050 1.00 72.20  ? 286  TRP B CD2 1 
ATOM   6301 N NE1 . TRP B 1 286 ? 14.924  -11.097 -41.429 1.00 64.48  ? 286  TRP B NE1 1 
ATOM   6302 C CE2 . TRP B 1 286 ? 15.246  -10.086 -40.561 1.00 71.62  ? 286  TRP B CE2 1 
ATOM   6303 C CE3 . TRP B 1 286 ? 17.097  -9.473  -39.131 1.00 64.23  ? 286  TRP B CE3 1 
ATOM   6304 C CZ2 . TRP B 1 286 ? 14.520  -8.951  -40.188 1.00 66.47  ? 286  TRP B CZ2 1 
ATOM   6305 C CZ3 . TRP B 1 286 ? 16.377  -8.352  -38.761 1.00 66.18  ? 286  TRP B CZ3 1 
ATOM   6306 C CH2 . TRP B 1 286 ? 15.101  -8.100  -39.289 1.00 61.90  ? 286  TRP B CH2 1 
ATOM   6307 N N   . HIS B 1 287 ? 21.710  -12.460 -41.207 1.00 63.02  ? 287  HIS B N   1 
ATOM   6308 C CA  . HIS B 1 287 ? 22.895  -13.095 -40.634 1.00 66.44  ? 287  HIS B CA  1 
ATOM   6309 C C   . HIS B 1 287 ? 24.130  -12.236 -40.743 1.00 64.20  ? 287  HIS B C   1 
ATOM   6310 O O   . HIS B 1 287 ? 25.241  -12.733 -40.605 1.00 64.08  ? 287  HIS B O   1 
ATOM   6311 C CB  . HIS B 1 287 ? 23.173  -14.454 -41.277 1.00 60.63  ? 287  HIS B CB  1 
ATOM   6312 C CG  . HIS B 1 287 ? 21.987  -15.357 -41.298 1.00 66.66  ? 287  HIS B CG  1 
ATOM   6313 N ND1 . HIS B 1 287 ? 21.762  -16.265 -42.310 1.00 73.69  ? 287  HIS B ND1 1 
ATOM   6314 C CD2 . HIS B 1 287 ? 20.941  -15.472 -40.446 1.00 68.64  ? 287  HIS B CD2 1 
ATOM   6315 C CE1 . HIS B 1 287 ? 20.638  -16.917 -42.068 1.00 81.08  ? 287  HIS B CE1 1 
ATOM   6316 N NE2 . HIS B 1 287 ? 20.117  -16.451 -40.946 1.00 80.76  ? 287  HIS B NE2 1 
ATOM   6317 N N   . VAL B 1 288 ? 23.952  -10.951 -41.006 1.00 63.31  ? 288  VAL B N   1 
ATOM   6318 C CA  . VAL B 1 288 ? 25.109  -10.076 -41.090 1.00 58.22  ? 288  VAL B CA  1 
ATOM   6319 C C   . VAL B 1 288 ? 25.211  -9.149  -39.880 1.00 57.35  ? 288  VAL B C   1 
ATOM   6320 O O   . VAL B 1 288 ? 26.147  -8.368  -39.786 1.00 59.87  ? 288  VAL B O   1 
ATOM   6321 C CB  . VAL B 1 288 ? 25.117  -9.261  -42.395 1.00 63.33  ? 288  VAL B CB  1 
ATOM   6322 C CG1 . VAL B 1 288 ? 25.158  -10.197 -43.597 1.00 60.23  ? 288  VAL B CG1 1 
ATOM   6323 C CG2 . VAL B 1 288 ? 23.898  -8.341  -42.456 1.00 59.23  ? 288  VAL B CG2 1 
ATOM   6324 N N   . LEU B 1 289 ? 24.251  -9.237  -38.960 1.00 55.88  ? 289  LEU B N   1 
ATOM   6325 C CA  . LEU B 1 289 ? 24.275  -8.400  -37.761 1.00 62.73  ? 289  LEU B CA  1 
ATOM   6326 C C   . LEU B 1 289 ? 25.472  -8.721  -36.850 1.00 68.37  ? 289  LEU B C   1 
ATOM   6327 O O   . LEU B 1 289 ? 25.737  -9.889  -36.546 1.00 64.00  ? 289  LEU B O   1 
ATOM   6328 C CB  . LEU B 1 289 ? 22.957  -8.519  -36.990 1.00 60.86  ? 289  LEU B CB  1 
ATOM   6329 C CG  . LEU B 1 289 ? 21.783  -7.726  -37.566 1.00 66.47  ? 289  LEU B CG  1 
ATOM   6330 C CD1 . LEU B 1 289 ? 20.480  -8.015  -36.825 1.00 53.92  ? 289  LEU B CD1 1 
ATOM   6331 C CD2 . LEU B 1 289 ? 22.104  -6.238  -37.558 1.00 56.68  ? 289  LEU B CD2 1 
ATOM   6332 N N   . PRO B 1 290 ? 26.193  -7.676  -36.409 1.00 70.23  ? 290  PRO B N   1 
ATOM   6333 C CA  . PRO B 1 290 ? 27.429  -7.792  -35.620 1.00 64.96  ? 290  PRO B CA  1 
ATOM   6334 C C   . PRO B 1 290 ? 27.238  -8.432  -34.244 1.00 60.54  ? 290  PRO B C   1 
ATOM   6335 O O   . PRO B 1 290 ? 28.197  -8.953  -33.688 1.00 70.33  ? 290  PRO B O   1 
ATOM   6336 C CB  . PRO B 1 290 ? 27.885  -6.335  -35.474 1.00 61.68  ? 290  PRO B CB  1 
ATOM   6337 C CG  . PRO B 1 290 ? 26.639  -5.540  -35.667 1.00 68.24  ? 290  PRO B CG  1 
ATOM   6338 C CD  . PRO B 1 290 ? 25.906  -6.272  -36.744 1.00 69.05  ? 290  PRO B CD  1 
ATOM   6339 N N   . GLN B 1 291 ? 26.033  -8.390  -33.694 1.00 60.21  ? 291  GLN B N   1 
ATOM   6340 C CA  . GLN B 1 291 ? 25.770  -9.069  -32.429 1.00 65.51  ? 291  GLN B CA  1 
ATOM   6341 C C   . GLN B 1 291 ? 24.342  -9.550  -32.411 1.00 59.37  ? 291  GLN B C   1 
ATOM   6342 O O   . GLN B 1 291 ? 23.554  -9.191  -33.272 1.00 61.18  ? 291  GLN B O   1 
ATOM   6343 C CB  . GLN B 1 291 ? 25.977  -8.141  -31.224 1.00 66.11  ? 291  GLN B CB  1 
ATOM   6344 C CG  . GLN B 1 291 ? 27.218  -7.276  -31.262 1.00 57.92  ? 291  GLN B CG  1 
ATOM   6345 C CD  . GLN B 1 291 ? 26.911  -5.868  -31.708 1.00 76.27  ? 291  GLN B CD  1 
ATOM   6346 O OE1 . GLN B 1 291 ? 27.815  -5.062  -31.942 1.00 83.57  ? 291  GLN B OE1 1 
ATOM   6347 N NE2 . GLN B 1 291 ? 25.623  -5.558  -31.832 1.00 78.00  ? 291  GLN B NE2 1 
ATOM   6348 N N   . GLU B 1 292 ? 24.001  -10.354 -31.418 1.00 63.55  ? 292  GLU B N   1 
ATOM   6349 C CA  . GLU B 1 292 ? 22.610  -10.710 -31.214 1.00 68.56  ? 292  GLU B CA  1 
ATOM   6350 C C   . GLU B 1 292 ? 21.884  -9.467  -30.704 1.00 72.45  ? 292  GLU B C   1 
ATOM   6351 O O   . GLU B 1 292 ? 22.338  -8.827  -29.754 1.00 77.78  ? 292  GLU B O   1 
ATOM   6352 C CB  . GLU B 1 292 ? 22.497  -11.849 -30.204 1.00 70.21  ? 292  GLU B CB  1 
ATOM   6353 C CG  . GLU B 1 292 ? 21.111  -12.477 -30.131 1.00 87.68  ? 292  GLU B CG  1 
ATOM   6354 C CD  . GLU B 1 292 ? 21.021  -13.583 -29.088 1.00 98.25  ? 292  GLU B CD  1 
ATOM   6355 O OE1 . GLU B 1 292 ? 22.070  -13.948 -28.509 1.00 86.39  ? 292  GLU B OE1 1 
ATOM   6356 O OE2 . GLU B 1 292 ? 19.898  -14.083 -28.848 1.00 103.93 ? 292  GLU B OE2 1 
ATOM   6357 N N   . SER B 1 293 ? 20.769  -9.109  -31.331 1.00 64.15  ? 293  SER B N   1 
ATOM   6358 C CA  . SER B 1 293 ? 20.073  -7.895  -30.928 1.00 63.65  ? 293  SER B CA  1 
ATOM   6359 C C   . SER B 1 293 ? 18.599  -7.865  -31.278 1.00 61.16  ? 293  SER B C   1 
ATOM   6360 O O   . SER B 1 293 ? 18.120  -8.675  -32.067 1.00 70.99  ? 293  SER B O   1 
ATOM   6361 C CB  . SER B 1 293 ? 20.771  -6.661  -31.505 1.00 62.75  ? 293  SER B CB  1 
ATOM   6362 O OG  . SER B 1 293 ? 21.280  -6.896  -32.802 1.00 56.21  ? 293  SER B OG  1 
ATOM   6363 N N   . ILE B 1 294 ? 17.880  -6.935  -30.656 1.00 64.51  ? 294  ILE B N   1 
ATOM   6364 C CA  . ILE B 1 294 ? 16.527  -6.608  -31.088 1.00 67.94  ? 294  ILE B CA  1 
ATOM   6365 C C   . ILE B 1 294 ? 16.459  -5.164  -31.530 1.00 57.84  ? 294  ILE B C   1 
ATOM   6366 O O   . ILE B 1 294 ? 17.283  -4.339  -31.134 1.00 64.08  ? 294  ILE B O   1 
ATOM   6367 C CB  . ILE B 1 294 ? 15.465  -6.832  -30.003 1.00 65.53  ? 294  ILE B CB  1 
ATOM   6368 C CG1 . ILE B 1 294 ? 16.006  -6.438  -28.638 1.00 56.19  ? 294  ILE B CG1 1 
ATOM   6369 C CG2 . ILE B 1 294 ? 14.980  -8.283  -30.021 1.00 75.44  ? 294  ILE B CG2 1 
ATOM   6370 C CD1 . ILE B 1 294 ? 15.013  -6.671  -27.528 1.00 71.06  ? 294  ILE B CD1 1 
ATOM   6371 N N   . PHE B 1 295 ? 15.463  -4.872  -32.353 1.00 53.13  ? 295  PHE B N   1 
ATOM   6372 C CA  . PHE B 1 295 ? 15.314  -3.559  -32.934 1.00 48.42  ? 295  PHE B CA  1 
ATOM   6373 C C   . PHE B 1 295 ? 16.587  -3.160  -33.644 1.00 54.71  ? 295  PHE B C   1 
ATOM   6374 O O   . PHE B 1 295 ? 17.027  -2.008  -33.553 1.00 53.83  ? 295  PHE B O   1 
ATOM   6375 C CB  . PHE B 1 295 ? 14.985  -2.525  -31.869 1.00 47.78  ? 295  PHE B CB  1 
ATOM   6376 C CG  . PHE B 1 295 ? 14.054  -1.467  -32.350 1.00 51.46  ? 295  PHE B CG  1 
ATOM   6377 C CD1 . PHE B 1 295 ? 14.310  -0.797  -33.537 1.00 45.26  ? 295  PHE B CD1 1 
ATOM   6378 C CD2 . PHE B 1 295 ? 12.902  -1.163  -31.639 1.00 45.48  ? 295  PHE B CD2 1 
ATOM   6379 C CE1 . PHE B 1 295 ? 13.447  0.157   -34.002 1.00 41.61  ? 295  PHE B CE1 1 
ATOM   6380 C CE2 . PHE B 1 295 ? 12.044  -0.195  -32.091 1.00 46.47  ? 295  PHE B CE2 1 
ATOM   6381 C CZ  . PHE B 1 295 ? 12.314  0.463   -33.283 1.00 46.66  ? 295  PHE B CZ  1 
ATOM   6382 N N   . ARG B 1 296 ? 17.189  -4.122  -34.330 1.00 45.16  ? 296  ARG B N   1 
ATOM   6383 C CA  . ARG B 1 296 ? 18.344  -3.842  -35.154 1.00 49.62  ? 296  ARG B CA  1 
ATOM   6384 C C   . ARG B 1 296 ? 18.160  -4.579  -36.487 1.00 55.75  ? 296  ARG B C   1 
ATOM   6385 O O   . ARG B 1 296 ? 17.682  -5.710  -36.520 1.00 62.90  ? 296  ARG B O   1 
ATOM   6386 C CB  . ARG B 1 296 ? 19.623  -4.259  -34.434 1.00 47.17  ? 296  ARG B CB  1 
ATOM   6387 C CG  . ARG B 1 296 ? 20.806  -3.345  -34.683 1.00 60.81  ? 296  ARG B CG  1 
ATOM   6388 C CD  . ARG B 1 296 ? 21.100  -2.441  -33.494 1.00 59.08  ? 296  ARG B CD  1 
ATOM   6389 N NE  . ARG B 1 296 ? 19.877  -1.954  -32.881 1.00 58.68  ? 296  ARG B NE  1 
ATOM   6390 C CZ  . ARG B 1 296 ? 19.834  -1.162  -31.814 1.00 60.60  ? 296  ARG B CZ  1 
ATOM   6391 N NH1 . ARG B 1 296 ? 20.953  -0.749  -31.233 1.00 52.14  ? 296  ARG B NH1 1 
ATOM   6392 N NH2 . ARG B 1 296 ? 18.662  -0.781  -31.330 1.00 57.33  ? 296  ARG B NH2 1 
ATOM   6393 N N   . PHE B 1 297 ? 18.516  -3.924  -37.584 1.00 49.23  ? 297  PHE B N   1 
ATOM   6394 C CA  . PHE B 1 297 ? 18.198  -4.415  -38.918 1.00 45.46  ? 297  PHE B CA  1 
ATOM   6395 C C   . PHE B 1 297 ? 19.429  -4.367  -39.813 1.00 52.23  ? 297  PHE B C   1 
ATOM   6396 O O   . PHE B 1 297 ? 20.210  -3.410  -39.753 1.00 50.88  ? 297  PHE B O   1 
ATOM   6397 C CB  . PHE B 1 297 ? 17.085  -3.567  -39.526 1.00 46.01  ? 297  PHE B CB  1 
ATOM   6398 C CG  . PHE B 1 297 ? 15.970  -3.261  -38.571 1.00 50.55  ? 297  PHE B CG  1 
ATOM   6399 C CD1 . PHE B 1 297 ? 15.114  -4.264  -38.140 1.00 50.95  ? 297  PHE B CD1 1 
ATOM   6400 C CD2 . PHE B 1 297 ? 15.777  -1.968  -38.097 1.00 48.65  ? 297  PHE B CD2 1 
ATOM   6401 C CE1 . PHE B 1 297 ? 14.086  -3.988  -37.259 1.00 50.30  ? 297  PHE B CE1 1 
ATOM   6402 C CE2 . PHE B 1 297 ? 14.749  -1.684  -37.214 1.00 48.22  ? 297  PHE B CE2 1 
ATOM   6403 C CZ  . PHE B 1 297 ? 13.902  -2.697  -36.797 1.00 49.19  ? 297  PHE B CZ  1 
ATOM   6404 N N   . SER B 1 298 ? 19.587  -5.387  -40.655 1.00 48.94  ? 298  SER B N   1 
ATOM   6405 C CA  . SER B 1 298 ? 20.818  -5.586  -41.436 1.00 52.14  ? 298  SER B CA  1 
ATOM   6406 C C   . SER B 1 298 ? 21.107  -4.526  -42.503 1.00 49.35  ? 298  SER B C   1 
ATOM   6407 O O   . SER B 1 298 ? 22.254  -4.111  -42.676 1.00 55.09  ? 298  SER B O   1 
ATOM   6408 C CB  . SER B 1 298 ? 20.826  -6.975  -42.081 1.00 56.22  ? 298  SER B CB  1 
ATOM   6409 O OG  . SER B 1 298 ? 20.482  -7.974  -41.137 1.00 62.44  ? 298  SER B OG  1 
ATOM   6410 N N   . PHE B 1 299 ? 20.084  -4.086  -43.227 1.00 51.10  ? 299  PHE B N   1 
ATOM   6411 C CA  . PHE B 1 299 ? 20.314  -3.123  -44.298 1.00 49.83  ? 299  PHE B CA  1 
ATOM   6412 C C   . PHE B 1 299 ? 19.412  -1.915  -44.200 1.00 50.74  ? 299  PHE B C   1 
ATOM   6413 O O   . PHE B 1 299 ? 18.188  -2.012  -44.346 1.00 57.55  ? 299  PHE B O   1 
ATOM   6414 C CB  . PHE B 1 299 ? 20.235  -3.803  -45.662 1.00 49.03  ? 299  PHE B CB  1 
ATOM   6415 C CG  . PHE B 1 299 ? 21.294  -4.835  -45.854 1.00 50.06  ? 299  PHE B CG  1 
ATOM   6416 C CD1 . PHE B 1 299 ? 22.553  -4.474  -46.312 1.00 48.82  ? 299  PHE B CD1 1 
ATOM   6417 C CD2 . PHE B 1 299 ? 21.056  -6.162  -45.517 1.00 49.01  ? 299  PHE B CD2 1 
ATOM   6418 C CE1 . PHE B 1 299 ? 23.552  -5.426  -46.455 1.00 51.68  ? 299  PHE B CE1 1 
ATOM   6419 C CE2 . PHE B 1 299 ? 22.047  -7.119  -45.655 1.00 47.93  ? 299  PHE B CE2 1 
ATOM   6420 C CZ  . PHE B 1 299 ? 23.294  -6.756  -46.126 1.00 49.06  ? 299  PHE B CZ  1 
ATOM   6421 N N   . VAL B 1 300 ? 20.052  -0.781  -43.930 1.00 46.39  ? 300  VAL B N   1 
ATOM   6422 C CA  . VAL B 1 300 ? 19.383  0.468   -43.605 1.00 45.93  ? 300  VAL B CA  1 
ATOM   6423 C C   . VAL B 1 300 ? 20.223  1.569   -44.215 1.00 46.61  ? 300  VAL B C   1 
ATOM   6424 O O   . VAL B 1 300 ? 21.333  1.308   -44.689 1.00 48.88  ? 300  VAL B O   1 
ATOM   6425 C CB  . VAL B 1 300 ? 19.299  0.693   -42.068 1.00 43.01  ? 300  VAL B CB  1 
ATOM   6426 C CG1 . VAL B 1 300 ? 18.566  -0.455  -41.384 1.00 44.89  ? 300  VAL B CG1 1 
ATOM   6427 C CG2 . VAL B 1 300 ? 20.690  0.862   -41.479 1.00 43.55  ? 300  VAL B CG2 1 
ATOM   6428 N N   . PRO B 1 301 ? 19.703  2.805   -44.210 1.00 44.44  ? 301  PRO B N   1 
ATOM   6429 C CA  . PRO B 1 301 ? 20.426  3.923   -44.809 1.00 42.99  ? 301  PRO B CA  1 
ATOM   6430 C C   . PRO B 1 301 ? 21.826  4.014   -44.248 1.00 50.04  ? 301  PRO B C   1 
ATOM   6431 O O   . PRO B 1 301 ? 22.069  3.625   -43.099 1.00 49.82  ? 301  PRO B O   1 
ATOM   6432 C CB  . PRO B 1 301 ? 19.609  5.137   -44.371 1.00 41.72  ? 301  PRO B CB  1 
ATOM   6433 C CG  . PRO B 1 301 ? 18.258  4.636   -44.251 1.00 45.69  ? 301  PRO B CG  1 
ATOM   6434 C CD  . PRO B 1 301 ? 18.381  3.222   -43.720 1.00 47.09  ? 301  PRO B CD  1 
ATOM   6435 N N   . VAL B 1 302 ? 22.741  4.529   -45.058 1.00 48.25  ? 302  VAL B N   1 
ATOM   6436 C CA  . VAL B 1 302 ? 24.138  4.580   -44.678 1.00 53.33  ? 302  VAL B CA  1 
ATOM   6437 C C   . VAL B 1 302 ? 24.667  6.002   -44.798 1.00 43.12  ? 302  VAL B C   1 
ATOM   6438 O O   . VAL B 1 302 ? 24.424  6.674   -45.792 1.00 48.66  ? 302  VAL B O   1 
ATOM   6439 C CB  . VAL B 1 302 ? 24.964  3.618   -45.548 1.00 45.96  ? 302  VAL B CB  1 
ATOM   6440 C CG1 . VAL B 1 302 ? 24.756  3.932   -47.021 1.00 47.86  ? 302  VAL B CG1 1 
ATOM   6441 C CG2 . VAL B 1 302 ? 26.436  3.699   -45.183 1.00 53.15  ? 302  VAL B CG2 1 
ATOM   6442 N N   . VAL B 1 303 ? 25.367  6.473   -43.774 1.00 45.72  ? 303  VAL B N   1 
ATOM   6443 C CA  . VAL B 1 303 ? 26.002  7.790   -43.862 1.00 58.02  ? 303  VAL B CA  1 
ATOM   6444 C C   . VAL B 1 303 ? 27.069  7.744   -44.956 1.00 55.51  ? 303  VAL B C   1 
ATOM   6445 O O   . VAL B 1 303 ? 28.142  7.176   -44.768 1.00 59.85  ? 303  VAL B O   1 
ATOM   6446 C CB  . VAL B 1 303 ? 26.636  8.236   -42.521 1.00 50.08  ? 303  VAL B CB  1 
ATOM   6447 C CG1 . VAL B 1 303 ? 27.049  9.687   -42.588 1.00 56.02  ? 303  VAL B CG1 1 
ATOM   6448 C CG2 . VAL B 1 303 ? 25.671  8.031   -41.382 1.00 49.59  ? 303  VAL B CG2 1 
ATOM   6449 N N   . ASP B 1 304 ? 26.757  8.328   -46.106 1.00 61.35  ? 304  ASP B N   1 
ATOM   6450 C CA  . ASP B 1 304 ? 27.593  8.198   -47.296 1.00 54.86  ? 304  ASP B CA  1 
ATOM   6451 C C   . ASP B 1 304 ? 28.200  9.530   -47.705 1.00 59.15  ? 304  ASP B C   1 
ATOM   6452 O O   . ASP B 1 304 ? 28.777  9.651   -48.778 1.00 63.40  ? 304  ASP B O   1 
ATOM   6453 C CB  . ASP B 1 304 ? 26.752  7.660   -48.458 1.00 54.14  ? 304  ASP B CB  1 
ATOM   6454 C CG  . ASP B 1 304 ? 25.541  8.544   -48.768 1.00 61.91  ? 304  ASP B CG  1 
ATOM   6455 O OD1 . ASP B 1 304 ? 25.142  9.355   -47.899 1.00 54.53  ? 304  ASP B OD1 1 
ATOM   6456 O OD2 . ASP B 1 304 ? 24.983  8.424   -49.882 1.00 62.87  ? 304  ASP B OD2 1 
ATOM   6457 N N   . GLY B 1 305 ? 28.051  10.542  -46.863 1.00 59.40  ? 305  GLY B N   1 
ATOM   6458 C CA  . GLY B 1 305 ? 28.453  11.881  -47.243 1.00 61.42  ? 305  GLY B CA  1 
ATOM   6459 C C   . GLY B 1 305 ? 27.777  12.363  -48.518 1.00 64.17  ? 305  GLY B C   1 
ATOM   6460 O O   . GLY B 1 305 ? 28.194  13.352  -49.114 1.00 64.50  ? 305  GLY B O   1 
ATOM   6461 N N   . ASP B 1 306 ? 26.724  11.675  -48.942 1.00 64.51  ? 306  ASP B N   1 
ATOM   6462 C CA  . ASP B 1 306 ? 26.007  12.074  -50.148 1.00 62.79  ? 306  ASP B CA  1 
ATOM   6463 C C   . ASP B 1 306 ? 24.536  12.361  -49.843 1.00 64.37  ? 306  ASP B C   1 
ATOM   6464 O O   . ASP B 1 306 ? 24.157  13.518  -49.636 1.00 61.57  ? 306  ASP B O   1 
ATOM   6465 C CB  . ASP B 1 306 ? 26.145  11.008  -51.232 1.00 64.66  ? 306  ASP B CB  1 
ATOM   6466 C CG  . ASP B 1 306 ? 25.566  11.449  -52.565 1.00 80.25  ? 306  ASP B CG  1 
ATOM   6467 O OD1 . ASP B 1 306 ? 25.066  12.593  -52.654 1.00 76.07  ? 306  ASP B OD1 1 
ATOM   6468 O OD2 . ASP B 1 306 ? 25.613  10.649  -53.529 1.00 87.36  ? 306  ASP B OD2 1 
ATOM   6469 N N   . PHE B 1 307 ? 23.702  11.321  -49.813 1.00 64.37  ? 307  PHE B N   1 
ATOM   6470 C CA  . PHE B 1 307 ? 22.326  11.531  -49.383 1.00 58.92  ? 307  PHE B CA  1 
ATOM   6471 C C   . PHE B 1 307 ? 22.378  12.129  -47.990 1.00 55.04  ? 307  PHE B C   1 
ATOM   6472 O O   . PHE B 1 307 ? 21.771  13.155  -47.715 1.00 54.08  ? 307  PHE B O   1 
ATOM   6473 C CB  . PHE B 1 307 ? 21.519  10.238  -49.360 1.00 55.29  ? 307  PHE B CB  1 
ATOM   6474 C CG  . PHE B 1 307 ? 20.037  10.472  -49.270 1.00 59.22  ? 307  PHE B CG  1 
ATOM   6475 C CD1 . PHE B 1 307 ? 19.459  10.891  -48.078 1.00 53.30  ? 307  PHE B CD1 1 
ATOM   6476 C CD2 . PHE B 1 307 ? 19.223  10.309  -50.383 1.00 55.54  ? 307  PHE B CD2 1 
ATOM   6477 C CE1 . PHE B 1 307 ? 18.100  11.128  -47.995 1.00 46.33  ? 307  PHE B CE1 1 
ATOM   6478 C CE2 . PHE B 1 307 ? 17.850  10.534  -50.305 1.00 51.07  ? 307  PHE B CE2 1 
ATOM   6479 C CZ  . PHE B 1 307 ? 17.291  10.944  -49.111 1.00 54.58  ? 307  PHE B CZ  1 
ATOM   6480 N N   . LEU B 1 308 ? 23.128  11.468  -47.121 1.00 56.87  ? 308  LEU B N   1 
ATOM   6481 C CA  . LEU B 1 308 ? 23.424  11.984  -45.801 1.00 58.96  ? 308  LEU B CA  1 
ATOM   6482 C C   . LEU B 1 308 ? 24.861  12.477  -45.793 1.00 64.52  ? 308  LEU B C   1 
ATOM   6483 O O   . LEU B 1 308 ? 25.797  11.681  -45.868 1.00 66.04  ? 308  LEU B O   1 
ATOM   6484 C CB  . LEU B 1 308 ? 23.252  10.882  -44.762 1.00 52.09  ? 308  LEU B CB  1 
ATOM   6485 C CG  . LEU B 1 308 ? 21.825  10.354  -44.669 1.00 56.14  ? 308  LEU B CG  1 
ATOM   6486 C CD1 . LEU B 1 308 ? 21.736  9.239   -43.657 1.00 55.24  ? 308  LEU B CD1 1 
ATOM   6487 C CD2 . LEU B 1 308 ? 20.853  11.484  -44.337 1.00 52.43  ? 308  LEU B CD2 1 
ATOM   6488 N N   . SER B 1 309 ? 25.036  13.788  -45.699 1.00 58.43  ? 309  SER B N   1 
ATOM   6489 C CA  . SER B 1 309 ? 26.370  14.372  -45.726 1.00 59.96  ? 309  SER B CA  1 
ATOM   6490 C C   . SER B 1 309 ? 27.165  14.096  -44.440 1.00 68.04  ? 309  SER B C   1 
ATOM   6491 O O   . SER B 1 309 ? 28.388  13.978  -44.469 1.00 71.26  ? 309  SER B O   1 
ATOM   6492 C CB  . SER B 1 309 ? 26.289  15.869  -46.017 1.00 57.38  ? 309  SER B CB  1 
ATOM   6493 O OG  . SER B 1 309 ? 25.522  16.548  -45.040 1.00 64.78  ? 309  SER B OG  1 
ATOM   6494 N N   . ASP B 1 310 ? 26.465  13.989  -43.318 1.00 62.92  ? 310  ASP B N   1 
ATOM   6495 C CA  . ASP B 1 310 ? 27.083  13.640  -42.045 1.00 64.64  ? 310  ASP B CA  1 
ATOM   6496 C C   . ASP B 1 310 ? 26.093  12.748  -41.308 1.00 61.20  ? 310  ASP B C   1 
ATOM   6497 O O   . ASP B 1 310 ? 25.048  12.440  -41.856 1.00 66.32  ? 310  ASP B O   1 
ATOM   6498 C CB  . ASP B 1 310 ? 27.378  14.900  -41.233 1.00 70.45  ? 310  ASP B CB  1 
ATOM   6499 C CG  . ASP B 1 310 ? 28.574  14.736  -40.299 1.00 78.66  ? 310  ASP B CG  1 
ATOM   6500 O OD1 . ASP B 1 310 ? 28.802  13.607  -39.801 1.00 70.06  ? 310  ASP B OD1 1 
ATOM   6501 O OD2 . ASP B 1 310 ? 29.283  15.743  -40.061 1.00 74.29  ? 310  ASP B OD2 1 
ATOM   6502 N N   . THR B 1 311 ? 26.401  12.321  -40.086 1.00 60.52  ? 311  THR B N   1 
ATOM   6503 C CA  . THR B 1 311 ? 25.441  11.519  -39.335 1.00 53.79  ? 311  THR B CA  1 
ATOM   6504 C C   . THR B 1 311 ? 24.189  12.333  -39.028 1.00 58.77  ? 311  THR B C   1 
ATOM   6505 O O   . THR B 1 311 ? 24.229  13.568  -38.991 1.00 58.41  ? 311  THR B O   1 
ATOM   6506 C CB  . THR B 1 311 ? 26.022  10.984  -38.020 1.00 60.23  ? 311  THR B CB  1 
ATOM   6507 O OG1 . THR B 1 311 ? 26.183  12.058  -37.081 1.00 54.92  ? 311  THR B OG1 1 
ATOM   6508 C CG2 . THR B 1 311 ? 27.347  10.305  -38.270 1.00 52.50  ? 311  THR B CG2 1 
ATOM   6509 N N   . PRO B 1 312 ? 23.064  11.644  -38.819 1.00 55.76  ? 312  PRO B N   1 
ATOM   6510 C CA  . PRO B 1 312 ? 21.844  12.384  -38.486 1.00 59.66  ? 312  PRO B CA  1 
ATOM   6511 C C   . PRO B 1 312 ? 22.070  13.247  -37.255 1.00 60.34  ? 312  PRO B C   1 
ATOM   6512 O O   . PRO B 1 312 ? 21.634  14.403  -37.213 1.00 56.87  ? 312  PRO B O   1 
ATOM   6513 C CB  . PRO B 1 312 ? 20.828  11.277  -38.194 1.00 54.86  ? 312  PRO B CB  1 
ATOM   6514 C CG  . PRO B 1 312 ? 21.316  10.109  -39.002 1.00 61.14  ? 312  PRO B CG  1 
ATOM   6515 C CD  . PRO B 1 312 ? 22.828  10.196  -38.942 1.00 57.28  ? 312  PRO B CD  1 
ATOM   6516 N N   . GLU B 1 313 ? 22.766  12.698  -36.267 1.00 56.24  ? 313  GLU B N   1 
ATOM   6517 C CA  . GLU B 1 313 ? 22.986  13.444  -35.030 1.00 69.22  ? 313  GLU B CA  1 
ATOM   6518 C C   . GLU B 1 313 ? 23.744  14.742  -35.313 1.00 62.16  ? 313  GLU B C   1 
ATOM   6519 O O   . GLU B 1 313 ? 23.358  15.807  -34.843 1.00 62.81  ? 313  GLU B O   1 
ATOM   6520 C CB  . GLU B 1 313 ? 23.660  12.578  -33.960 1.00 52.91  ? 313  GLU B CB  1 
ATOM   6521 C CG  . GLU B 1 313 ? 24.228  11.265  -34.508 1.00 74.37  ? 313  GLU B CG  1 
ATOM   6522 C CD  . GLU B 1 313 ? 23.182  10.142  -34.639 1.00 80.50  ? 313  GLU B CD  1 
ATOM   6523 O OE1 . GLU B 1 313 ? 22.319  10.000  -33.727 1.00 70.15  ? 313  GLU B OE1 1 
ATOM   6524 O OE2 . GLU B 1 313 ? 23.241  9.393   -35.651 1.00 71.48  ? 313  GLU B OE2 1 
ATOM   6525 N N   . ALA B 1 314 ? 24.791  14.659  -36.122 1.00 56.24  ? 314  ALA B N   1 
ATOM   6526 C CA  . ALA B 1 314 ? 25.526  15.852  -36.522 1.00 54.10  ? 314  ALA B CA  1 
ATOM   6527 C C   . ALA B 1 314 ? 24.616  16.863  -37.221 1.00 63.15  ? 314  ALA B C   1 
ATOM   6528 O O   . ALA B 1 314 ? 24.564  18.034  -36.849 1.00 65.56  ? 314  ALA B O   1 
ATOM   6529 C CB  . ALA B 1 314 ? 26.690  15.475  -37.423 1.00 53.41  ? 314  ALA B CB  1 
ATOM   6530 N N   . LEU B 1 315 ? 23.898  16.389  -38.233 1.00 62.91  ? 315  LEU B N   1 
ATOM   6531 C CA  . LEU B 1 315 ? 23.045  17.232  -39.062 1.00 56.45  ? 315  LEU B CA  1 
ATOM   6532 C C   . LEU B 1 315 ? 21.912  17.929  -38.312 1.00 58.52  ? 315  LEU B C   1 
ATOM   6533 O O   . LEU B 1 315 ? 21.538  19.041  -38.663 1.00 63.04  ? 315  LEU B O   1 
ATOM   6534 C CB  . LEU B 1 315 ? 22.444  16.401  -40.191 1.00 57.13  ? 315  LEU B CB  1 
ATOM   6535 C CG  . LEU B 1 315 ? 23.459  15.830  -41.161 1.00 58.89  ? 315  LEU B CG  1 
ATOM   6536 C CD1 . LEU B 1 315 ? 22.754  15.195  -42.339 1.00 53.93  ? 315  LEU B CD1 1 
ATOM   6537 C CD2 . LEU B 1 315 ? 24.350  16.956  -41.617 1.00 60.77  ? 315  LEU B CD2 1 
ATOM   6538 N N   . ILE B 1 316 ? 21.336  17.273  -37.310 1.00 54.29  ? 316  ILE B N   1 
ATOM   6539 C CA  . ILE B 1 316 ? 20.250  17.906  -36.573 1.00 61.39  ? 316  ILE B CA  1 
ATOM   6540 C C   . ILE B 1 316 ? 20.820  18.886  -35.569 1.00 68.38  ? 316  ILE B C   1 
ATOM   6541 O O   . ILE B 1 316 ? 20.148  19.836  -35.189 1.00 73.05  ? 316  ILE B O   1 
ATOM   6542 C CB  . ILE B 1 316 ? 19.308  16.905  -35.841 1.00 55.30  ? 316  ILE B CB  1 
ATOM   6543 C CG1 . ILE B 1 316 ? 20.033  16.197  -34.701 1.00 62.54  ? 316  ILE B CG1 1 
ATOM   6544 C CG2 . ILE B 1 316 ? 18.731  15.893  -36.802 1.00 57.37  ? 316  ILE B CG2 1 
ATOM   6545 C CD1 . ILE B 1 316 ? 19.206  15.113  -34.026 1.00 66.96  ? 316  ILE B CD1 1 
ATOM   6546 N N   . ASN B 1 317 ? 22.060  18.651  -35.140 1.00 71.07  ? 317  ASN B N   1 
ATOM   6547 C CA  . ASN B 1 317 ? 22.735  19.550  -34.202 1.00 72.52  ? 317  ASN B CA  1 
ATOM   6548 C C   . ASN B 1 317 ? 23.076  20.884  -34.836 1.00 76.31  ? 317  ASN B C   1 
ATOM   6549 O O   . ASN B 1 317 ? 23.064  21.920  -34.170 1.00 72.73  ? 317  ASN B O   1 
ATOM   6550 C CB  . ASN B 1 317 ? 24.022  18.924  -33.667 1.00 66.90  ? 317  ASN B CB  1 
ATOM   6551 C CG  . ASN B 1 317 ? 23.780  18.028  -32.474 1.00 78.19  ? 317  ASN B CG  1 
ATOM   6552 O OD1 . ASN B 1 317 ? 22.654  17.911  -31.994 1.00 77.88  ? 317  ASN B OD1 1 
ATOM   6553 N ND2 . ASN B 1 317 ? 24.838  17.388  -31.984 1.00 79.88  ? 317  ASN B ND2 1 
ATOM   6554 N N   . THR B 1 318 ? 23.373  20.848  -36.130 1.00 65.70  ? 318  THR B N   1 
ATOM   6555 C CA  . THR B 1 318 ? 23.942  22.001  -36.804 1.00 71.46  ? 318  THR B CA  1 
ATOM   6556 C C   . THR B 1 318 ? 23.032  22.562  -37.888 1.00 72.81  ? 318  THR B C   1 
ATOM   6557 O O   . THR B 1 318 ? 23.382  23.533  -38.552 1.00 76.99  ? 318  THR B O   1 
ATOM   6558 C CB  . THR B 1 318 ? 25.303  21.640  -37.438 1.00 76.53  ? 318  THR B CB  1 
ATOM   6559 O OG1 . THR B 1 318 ? 25.099  20.763  -38.556 1.00 64.81  ? 318  THR B OG1 1 
ATOM   6560 C CG2 . THR B 1 318 ? 26.207  20.959  -36.414 1.00 65.39  ? 318  THR B CG2 1 
ATOM   6561 N N   . GLY B 1 319 ? 21.867  21.958  -38.074 1.00 63.78  ? 319  GLY B N   1 
ATOM   6562 C CA  . GLY B 1 319 ? 20.996  22.379  -39.153 1.00 65.78  ? 319  GLY B CA  1 
ATOM   6563 C C   . GLY B 1 319 ? 20.177  23.612  -38.821 1.00 68.55  ? 319  GLY B C   1 
ATOM   6564 O O   . GLY B 1 319 ? 20.014  23.970  -37.654 1.00 63.15  ? 319  GLY B O   1 
ATOM   6565 N N   . ASP B 1 320 ? 19.666  24.269  -39.857 1.00 71.68  ? 320  ASP B N   1 
ATOM   6566 C CA  . ASP B 1 320 ? 18.747  25.384  -39.671 1.00 76.76  ? 320  ASP B CA  1 
ATOM   6567 C C   . ASP B 1 320 ? 17.360  24.965  -40.119 1.00 78.22  ? 320  ASP B C   1 
ATOM   6568 O O   . ASP B 1 320 ? 17.155  24.576  -41.277 1.00 71.55  ? 320  ASP B O   1 
ATOM   6569 C CB  . ASP B 1 320 ? 19.183  26.617  -40.457 1.00 81.36  ? 320  ASP B CB  1 
ATOM   6570 C CG  . ASP B 1 320 ? 18.171  27.750  -40.365 1.00 88.63  ? 320  ASP B CG  1 
ATOM   6571 O OD1 . ASP B 1 320 ? 17.573  27.927  -39.280 1.00 83.85  ? 320  ASP B OD1 1 
ATOM   6572 O OD2 . ASP B 1 320 ? 17.973  28.464  -41.373 1.00 99.82  ? 320  ASP B OD2 1 
ATOM   6573 N N   . PHE B 1 321 ? 16.407  25.058  -39.200 1.00 65.68  ? 321  PHE B N   1 
ATOM   6574 C CA  . PHE B 1 321 ? 15.094  24.494  -39.442 1.00 71.52  ? 321  PHE B CA  1 
ATOM   6575 C C   . PHE B 1 321 ? 13.989  25.539  -39.380 1.00 71.83  ? 321  PHE B C   1 
ATOM   6576 O O   . PHE B 1 321 ? 12.836  25.224  -39.104 1.00 71.51  ? 321  PHE B O   1 
ATOM   6577 C CB  . PHE B 1 321 ? 14.856  23.331  -38.481 1.00 60.35  ? 321  PHE B CB  1 
ATOM   6578 C CG  . PHE B 1 321 ? 15.841  22.210  -38.657 1.00 55.86  ? 321  PHE B CG  1 
ATOM   6579 C CD1 . PHE B 1 321 ? 15.826  21.435  -39.805 1.00 60.12  ? 321  PHE B CD1 1 
ATOM   6580 C CD2 . PHE B 1 321 ? 16.792  21.940  -37.690 1.00 61.88  ? 321  PHE B CD2 1 
ATOM   6581 C CE1 . PHE B 1 321 ? 16.736  20.402  -39.979 1.00 57.25  ? 321  PHE B CE1 1 
ATOM   6582 C CE2 . PHE B 1 321 ? 17.705  20.901  -37.858 1.00 62.20  ? 321  PHE B CE2 1 
ATOM   6583 C CZ  . PHE B 1 321 ? 17.677  20.137  -39.004 1.00 53.88  ? 321  PHE B CZ  1 
ATOM   6584 N N   . GLN B 1 322 ? 14.363  26.778  -39.685 1.00 81.72  ? 322  GLN B N   1 
ATOM   6585 C CA  . GLN B 1 322 ? 13.468  27.928  -39.618 1.00 79.87  ? 322  GLN B CA  1 
ATOM   6586 C C   . GLN B 1 322 ? 12.041  27.665  -40.102 1.00 82.29  ? 322  GLN B C   1 
ATOM   6587 O O   . GLN B 1 322 ? 11.109  27.569  -39.300 1.00 83.54  ? 322  GLN B O   1 
ATOM   6588 C CB  . GLN B 1 322 ? 14.060  29.108  -40.394 1.00 89.87  ? 322  GLN B CB  1 
ATOM   6589 C CG  . GLN B 1 322 ? 15.153  29.858  -39.649 1.00 99.03  ? 322  GLN B CG  1 
ATOM   6590 C CD  . GLN B 1 322 ? 14.649  30.480  -38.360 1.00 108.55 ? 322  GLN B CD  1 
ATOM   6591 O OE1 . GLN B 1 322 ? 13.438  30.541  -38.117 1.00 102.88 ? 322  GLN B OE1 1 
ATOM   6592 N NE2 . GLN B 1 322 ? 15.576  30.946  -37.524 1.00 103.78 ? 322  GLN B NE2 1 
ATOM   6593 N N   . ASP B 1 323 ? 11.866  27.557  -41.412 1.00 77.38  ? 323  ASP B N   1 
ATOM   6594 C CA  . ASP B 1 323 ? 10.520  27.524  -41.982 1.00 88.18  ? 323  ASP B CA  1 
ATOM   6595 C C   . ASP B 1 323 ? 9.962   26.105  -42.118 1.00 77.48  ? 323  ASP B C   1 
ATOM   6596 O O   . ASP B 1 323 ? 9.282   25.773  -43.090 1.00 82.09  ? 323  ASP B O   1 
ATOM   6597 C CB  . ASP B 1 323 ? 10.480  28.291  -43.313 1.00 99.28  ? 323  ASP B CB  1 
ATOM   6598 C CG  . ASP B 1 323 ? 10.772  29.791  -43.138 1.00 103.02 ? 323  ASP B CG  1 
ATOM   6599 O OD1 . ASP B 1 323 ? 10.041  30.465  -42.375 1.00 107.20 ? 323  ASP B OD1 1 
ATOM   6600 O OD2 . ASP B 1 323 ? 11.732  30.295  -43.766 1.00 102.22 ? 323  ASP B OD2 1 
ATOM   6601 N N   . LEU B 1 324 ? 10.247  25.288  -41.113 1.00 69.96  ? 324  LEU B N   1 
ATOM   6602 C CA  . LEU B 1 324 ? 9.819   23.904  -41.071 1.00 65.75  ? 324  LEU B CA  1 
ATOM   6603 C C   . LEU B 1 324 ? 8.722   23.690  -40.033 1.00 56.56  ? 324  LEU B C   1 
ATOM   6604 O O   . LEU B 1 324 ? 8.803   24.204  -38.924 1.00 62.26  ? 324  LEU B O   1 
ATOM   6605 C CB  . LEU B 1 324 ? 11.014  23.024  -40.707 1.00 66.54  ? 324  LEU B CB  1 
ATOM   6606 C CG  . LEU B 1 324 ? 10.760  21.526  -40.854 1.00 63.83  ? 324  LEU B CG  1 
ATOM   6607 C CD1 . LEU B 1 324 ? 10.280  21.235  -42.271 1.00 62.05  ? 324  LEU B CD1 1 
ATOM   6608 C CD2 . LEU B 1 324 ? 12.003  20.725  -40.524 1.00 63.11  ? 324  LEU B CD2 1 
ATOM   6609 N N   . GLN B 1 325 ? 7.698   22.929  -40.381 1.00 50.28  ? 325  GLN B N   1 
ATOM   6610 C CA  . GLN B 1 325 ? 6.779   22.455  -39.356 1.00 51.17  ? 325  GLN B CA  1 
ATOM   6611 C C   . GLN B 1 325 ? 6.750   20.934  -39.310 1.00 52.23  ? 325  GLN B C   1 
ATOM   6612 O O   . GLN B 1 325 ? 6.649   20.256  -40.342 1.00 50.46  ? 325  GLN B O   1 
ATOM   6613 C CB  . GLN B 1 325 ? 5.371   23.011  -39.524 1.00 47.94  ? 325  GLN B CB  1 
ATOM   6614 C CG  . GLN B 1 325 ? 5.321   24.498  -39.748 1.00 55.45  ? 325  GLN B CG  1 
ATOM   6615 C CD  . GLN B 1 325 ? 5.239   24.839  -41.213 1.00 58.50  ? 325  GLN B CD  1 
ATOM   6616 O OE1 . GLN B 1 325 ? 4.344   24.374  -41.917 1.00 62.81  ? 325  GLN B OE1 1 
ATOM   6617 N NE2 . GLN B 1 325 ? 6.181   25.644  -41.687 1.00 71.32  ? 325  GLN B NE2 1 
ATOM   6618 N N   . VAL B 1 326 ? 6.815   20.420  -38.089 1.00 45.32  ? 326  VAL B N   1 
ATOM   6619 C CA  . VAL B 1 326 ? 7.005   19.012  -37.841 1.00 48.70  ? 326  VAL B CA  1 
ATOM   6620 C C   . VAL B 1 326 ? 6.096   18.564  -36.717 1.00 46.25  ? 326  VAL B C   1 
ATOM   6621 O O   . VAL B 1 326 ? 5.982   19.232  -35.694 1.00 47.76  ? 326  VAL B O   1 
ATOM   6622 C CB  . VAL B 1 326 ? 8.461   18.729  -37.428 1.00 49.54  ? 326  VAL B CB  1 
ATOM   6623 C CG1 . VAL B 1 326 ? 8.676   17.251  -37.268 1.00 56.23  ? 326  VAL B CG1 1 
ATOM   6624 C CG2 . VAL B 1 326 ? 9.416   19.278  -38.464 1.00 52.59  ? 326  VAL B CG2 1 
ATOM   6625 N N   . LEU B 1 327 ? 5.453   17.424  -36.913 1.00 45.94  ? 327  LEU B N   1 
ATOM   6626 C CA  . LEU B 1 327 ? 4.632   16.810  -35.886 1.00 45.76  ? 327  LEU B CA  1 
ATOM   6627 C C   . LEU B 1 327 ? 5.264   15.454  -35.573 1.00 41.06  ? 327  LEU B C   1 
ATOM   6628 O O   . LEU B 1 327 ? 5.565   14.677  -36.476 1.00 44.74  ? 327  LEU B O   1 
ATOM   6629 C CB  . LEU B 1 327 ? 3.182   16.667  -36.379 1.00 40.48  ? 327  LEU B CB  1 
ATOM   6630 C CG  . LEU B 1 327 ? 2.295   15.735  -35.546 1.00 49.60  ? 327  LEU B CG  1 
ATOM   6631 C CD1 . LEU B 1 327 ? 2.198   16.217  -34.110 1.00 48.15  ? 327  LEU B CD1 1 
ATOM   6632 C CD2 . LEU B 1 327 ? 0.913   15.604  -36.155 1.00 50.76  ? 327  LEU B CD2 1 
ATOM   6633 N N   . VAL B 1 328 ? 5.501   15.174  -34.302 1.00 35.11  ? 328  VAL B N   1 
ATOM   6634 C CA  . VAL B 1 328 ? 6.189   13.942  -33.947 1.00 38.96  ? 328  VAL B CA  1 
ATOM   6635 C C   . VAL B 1 328 ? 5.553   13.319  -32.730 1.00 42.33  ? 328  VAL B C   1 
ATOM   6636 O O   . VAL B 1 328 ? 4.986   14.017  -31.884 1.00 45.88  ? 328  VAL B O   1 
ATOM   6637 C CB  . VAL B 1 328 ? 7.707   14.172  -33.675 1.00 42.35  ? 328  VAL B CB  1 
ATOM   6638 C CG1 . VAL B 1 328 ? 8.357   14.843  -34.863 1.00 48.43  ? 328  VAL B CG1 1 
ATOM   6639 C CG2 . VAL B 1 328 ? 7.899   15.037  -32.461 1.00 48.51  ? 328  VAL B CG2 1 
ATOM   6640 N N   . GLY B 1 329 ? 5.641   12.001  -32.628 1.00 38.58  ? 329  GLY B N   1 
ATOM   6641 C CA  . GLY B 1 329 ? 5.030   11.347  -31.500 1.00 36.21  ? 329  GLY B CA  1 
ATOM   6642 C C   . GLY B 1 329 ? 5.339   9.881   -31.432 1.00 42.44  ? 329  GLY B C   1 
ATOM   6643 O O   . GLY B 1 329 ? 5.951   9.332   -32.332 1.00 48.70  ? 329  GLY B O   1 
ATOM   6644 N N   . VAL B 1 330 ? 4.877   9.259   -30.355 1.00 43.36  ? 330  VAL B N   1 
ATOM   6645 C CA  . VAL B 1 330 ? 5.187   7.892   -30.036 1.00 39.31  ? 330  VAL B CA  1 
ATOM   6646 C C   . VAL B 1 330 ? 3.937   7.285   -29.436 1.00 50.67  ? 330  VAL B C   1 
ATOM   6647 O O   . VAL B 1 330 ? 3.019   8.010   -29.040 1.00 48.88  ? 330  VAL B O   1 
ATOM   6648 C CB  . VAL B 1 330 ? 6.308   7.828   -28.981 1.00 49.93  ? 330  VAL B CB  1 
ATOM   6649 C CG1 . VAL B 1 330 ? 7.610   8.417   -29.538 1.00 44.36  ? 330  VAL B CG1 1 
ATOM   6650 C CG2 . VAL B 1 330 ? 5.878   8.547   -27.693 1.00 32.86  ? 330  VAL B CG2 1 
ATOM   6651 N N   . VAL B 1 331 ? 3.901   5.958   -29.367 1.00 47.12  ? 331  VAL B N   1 
ATOM   6652 C CA  . VAL B 1 331 ? 2.785   5.251   -28.749 1.00 42.56  ? 331  VAL B CA  1 
ATOM   6653 C C   . VAL B 1 331 ? 3.172   4.900   -27.329 1.00 49.09  ? 331  VAL B C   1 
ATOM   6654 O O   . VAL B 1 331 ? 4.356   4.951   -26.977 1.00 48.62  ? 331  VAL B O   1 
ATOM   6655 C CB  . VAL B 1 331 ? 2.442   3.963   -29.519 1.00 44.57  ? 331  VAL B CB  1 
ATOM   6656 C CG1 . VAL B 1 331 ? 1.971   4.307   -30.911 1.00 44.34  ? 331  VAL B CG1 1 
ATOM   6657 C CG2 . VAL B 1 331 ? 3.638   3.031   -29.580 1.00 35.03  ? 331  VAL B CG2 1 
ATOM   6658 N N   . LYS B 1 332 ? 2.185   4.542   -26.510 1.00 52.28  ? 332  LYS B N   1 
ATOM   6659 C CA  . LYS B 1 332 ? 2.434   4.323   -25.087 1.00 52.35  ? 332  LYS B CA  1 
ATOM   6660 C C   . LYS B 1 332 ? 3.489   3.244   -24.835 1.00 53.07  ? 332  LYS B C   1 
ATOM   6661 O O   . LYS B 1 332 ? 4.294   3.377   -23.920 1.00 64.60  ? 332  LYS B O   1 
ATOM   6662 C CB  . LYS B 1 332 ? 1.139   4.014   -24.320 1.00 56.81  ? 332  LYS B CB  1 
ATOM   6663 C CG  . LYS B 1 332 ? 1.274   4.147   -22.790 1.00 50.86  ? 332  LYS B CG  1 
ATOM   6664 C CD  . LYS B 1 332 ? -0.060  3.932   -22.050 1.00 68.41  ? 332  LYS B CD  1 
ATOM   6665 C CE  . LYS B 1 332 ? -0.083  2.632   -21.220 1.00 78.23  ? 332  LYS B CE  1 
ATOM   6666 N NZ  . LYS B 1 332 ? -0.265  1.370   -22.024 1.00 66.85  ? 332  LYS B NZ  1 
ATOM   6667 N N   . ASP B 1 333 ? 3.501   2.193   -25.649 1.00 47.96  ? 333  ASP B N   1 
ATOM   6668 C CA  . ASP B 1 333 ? 4.394   1.052   -25.410 1.00 52.67  ? 333  ASP B CA  1 
ATOM   6669 C C   . ASP B 1 333 ? 5.228   0.681   -26.629 1.00 52.37  ? 333  ASP B C   1 
ATOM   6670 O O   . ASP B 1 333 ? 5.154   -0.425  -27.141 1.00 53.99  ? 333  ASP B O   1 
ATOM   6671 C CB  . ASP B 1 333 ? 3.614   -0.162  -24.896 1.00 50.88  ? 333  ASP B CB  1 
ATOM   6672 C CG  . ASP B 1 333 ? 2.653   0.198   -23.769 1.00 59.22  ? 333  ASP B CG  1 
ATOM   6673 O OD1 . ASP B 1 333 ? 1.490   0.574   -24.052 1.00 57.14  ? 333  ASP B OD1 1 
ATOM   6674 O OD2 . ASP B 1 333 ? 3.060   0.106   -22.592 1.00 63.15  ? 333  ASP B OD2 1 
ATOM   6675 N N   . GLU B 1 334 ? 6.033   1.634   -27.073 1.00 57.18  ? 334  GLU B N   1 
ATOM   6676 C CA  . GLU B 1 334 ? 6.961   1.438   -28.171 1.00 48.70  ? 334  GLU B CA  1 
ATOM   6677 C C   . GLU B 1 334 ? 7.692   0.088   -28.163 1.00 50.59  ? 334  GLU B C   1 
ATOM   6678 O O   . GLU B 1 334 ? 7.876   -0.522  -29.211 1.00 56.46  ? 334  GLU B O   1 
ATOM   6679 C CB  . GLU B 1 334 ? 7.979   2.588   -28.193 1.00 45.02  ? 334  GLU B CB  1 
ATOM   6680 C CG  . GLU B 1 334 ? 7.413   3.931   -28.670 1.00 48.89  ? 334  GLU B CG  1 
ATOM   6681 C CD  . GLU B 1 334 ? 6.860   3.859   -30.088 1.00 56.51  ? 334  GLU B CD  1 
ATOM   6682 O OE1 . GLU B 1 334 ? 7.197   2.879   -30.785 1.00 55.00  ? 334  GLU B OE1 1 
ATOM   6683 O OE2 . GLU B 1 334 ? 6.097   4.771   -30.507 1.00 50.58  ? 334  GLU B OE2 1 
ATOM   6684 N N   . GLY B 1 335 ? 8.107   -0.393  -26.998 1.00 51.95  ? 335  GLY B N   1 
ATOM   6685 C CA  . GLY B 1 335 ? 9.036   -1.517  -26.976 1.00 55.55  ? 335  GLY B CA  1 
ATOM   6686 C C   . GLY B 1 335 ? 8.504   -2.944  -27.074 1.00 59.31  ? 335  GLY B C   1 
ATOM   6687 O O   . GLY B 1 335 ? 9.244   -3.850  -27.464 1.00 54.33  ? 335  GLY B O   1 
ATOM   6688 N N   . SER B 1 336 ? 7.231   -3.146  -26.740 1.00 53.39  ? 336  SER B N   1 
ATOM   6689 C CA  . SER B 1 336 ? 6.706   -4.489  -26.469 1.00 57.99  ? 336  SER B CA  1 
ATOM   6690 C C   . SER B 1 336 ? 6.721   -5.444  -27.666 1.00 58.63  ? 336  SER B C   1 
ATOM   6691 O O   . SER B 1 336 ? 7.090   -6.615  -27.537 1.00 61.70  ? 336  SER B O   1 
ATOM   6692 C CB  . SER B 1 336 ? 5.296   -4.401  -25.867 1.00 57.20  ? 336  SER B CB  1 
ATOM   6693 O OG  . SER B 1 336 ? 4.366   -3.875  -26.796 1.00 56.67  ? 336  SER B OG  1 
ATOM   6694 N N   . TYR B 1 337 ? 6.314   -4.936  -28.822 1.00 56.58  ? 337  TYR B N   1 
ATOM   6695 C CA  . TYR B 1 337 ? 6.244   -5.719  -30.052 1.00 54.24  ? 337  TYR B CA  1 
ATOM   6696 C C   . TYR B 1 337 ? 7.526   -6.497  -30.332 1.00 61.68  ? 337  TYR B C   1 
ATOM   6697 O O   . TYR B 1 337 ? 7.481   -7.602  -30.870 1.00 61.85  ? 337  TYR B O   1 
ATOM   6698 C CB  . TYR B 1 337 ? 5.969   -4.781  -31.222 1.00 59.40  ? 337  TYR B CB  1 
ATOM   6699 C CG  . TYR B 1 337 ? 5.521   -5.447  -32.501 1.00 60.41  ? 337  TYR B CG  1 
ATOM   6700 C CD1 . TYR B 1 337 ? 4.187   -5.405  -32.889 1.00 62.39  ? 337  TYR B CD1 1 
ATOM   6701 C CD2 . TYR B 1 337 ? 6.431   -6.085  -33.338 1.00 60.89  ? 337  TYR B CD2 1 
ATOM   6702 C CE1 . TYR B 1 337 ? 3.761   -5.994  -34.070 1.00 60.33  ? 337  TYR B CE1 1 
ATOM   6703 C CE2 . TYR B 1 337 ? 6.016   -6.681  -34.526 1.00 63.14  ? 337  TYR B CE2 1 
ATOM   6704 C CZ  . TYR B 1 337 ? 4.674   -6.633  -34.882 1.00 65.13  ? 337  TYR B CZ  1 
ATOM   6705 O OH  . TYR B 1 337 ? 4.237   -7.215  -36.051 1.00 60.96  ? 337  TYR B OH  1 
ATOM   6706 N N   . PHE B 1 338 ? 8.666   -5.922  -29.961 1.00 55.05  ? 338  PHE B N   1 
ATOM   6707 C CA  . PHE B 1 338 ? 9.961   -6.442  -30.380 1.00 51.60  ? 338  PHE B CA  1 
ATOM   6708 C C   . PHE B 1 338 ? 10.450  -7.544  -29.487 1.00 55.93  ? 338  PHE B C   1 
ATOM   6709 O O   . PHE B 1 338 ? 11.378  -8.269  -29.849 1.00 56.43  ? 338  PHE B O   1 
ATOM   6710 C CB  . PHE B 1 338 ? 11.007  -5.326  -30.381 1.00 53.92  ? 338  PHE B CB  1 
ATOM   6711 C CG  . PHE B 1 338 ? 10.749  -4.275  -31.402 1.00 59.18  ? 338  PHE B CG  1 
ATOM   6712 C CD1 . PHE B 1 338 ? 9.861   -3.240  -31.138 1.00 54.25  ? 338  PHE B CD1 1 
ATOM   6713 C CD2 . PHE B 1 338 ? 11.371  -4.332  -32.637 1.00 54.00  ? 338  PHE B CD2 1 
ATOM   6714 C CE1 . PHE B 1 338 ? 9.604   -2.280  -32.079 1.00 51.20  ? 338  PHE B CE1 1 
ATOM   6715 C CE2 . PHE B 1 338 ? 11.123  -3.365  -33.588 1.00 56.22  ? 338  PHE B CE2 1 
ATOM   6716 C CZ  . PHE B 1 338 ? 10.234  -2.339  -33.310 1.00 59.98  ? 338  PHE B CZ  1 
ATOM   6717 N N   . LEU B 1 339 ? 9.846   -7.645  -28.308 1.00 54.90  ? 339  LEU B N   1 
ATOM   6718 C CA  . LEU B 1 339 ? 10.329  -8.569  -27.290 1.00 61.24  ? 339  LEU B CA  1 
ATOM   6719 C C   . LEU B 1 339 ? 10.011  -10.007 -27.675 1.00 63.29  ? 339  LEU B C   1 
ATOM   6720 O O   . LEU B 1 339 ? 10.842  -10.894 -27.508 1.00 65.16  ? 339  LEU B O   1 
ATOM   6721 C CB  . LEU B 1 339 ? 9.740   -8.225  -25.918 1.00 58.34  ? 339  LEU B CB  1 
ATOM   6722 C CG  . LEU B 1 339 ? 10.155  -6.869  -25.339 1.00 56.73  ? 339  LEU B CG  1 
ATOM   6723 C CD1 . LEU B 1 339 ? 9.507   -6.623  -23.975 1.00 49.64  ? 339  LEU B CD1 1 
ATOM   6724 C CD2 . LEU B 1 339 ? 11.674  -6.758  -25.260 1.00 54.28  ? 339  LEU B CD2 1 
ATOM   6725 N N   . VAL B 1 340 ? 8.810   -10.220 -28.207 1.00 61.69  ? 340  VAL B N   1 
ATOM   6726 C CA  . VAL B 1 340 ? 8.358   -11.548 -28.602 1.00 59.03  ? 340  VAL B CA  1 
ATOM   6727 C C   . VAL B 1 340 ? 9.213   -12.123 -29.732 1.00 65.10  ? 340  VAL B C   1 
ATOM   6728 O O   . VAL B 1 340 ? 9.141   -13.316 -30.033 1.00 64.86  ? 340  VAL B O   1 
ATOM   6729 C CB  . VAL B 1 340 ? 6.877   -11.538 -29.032 1.00 54.15  ? 340  VAL B CB  1 
ATOM   6730 C CG1 . VAL B 1 340 ? 6.053   -10.788 -28.027 1.00 54.40  ? 340  VAL B CG1 1 
ATOM   6731 C CG2 . VAL B 1 340 ? 6.720   -10.905 -30.396 1.00 52.49  ? 340  VAL B CG2 1 
ATOM   6732 N N   . TYR B 1 341 ? 10.023  -11.276 -30.357 1.00 57.34  ? 341  TYR B N   1 
ATOM   6733 C CA  . TYR B 1 341 ? 10.899  -11.734 -31.428 1.00 59.34  ? 341  TYR B CA  1 
ATOM   6734 C C   . TYR B 1 341 ? 12.267  -12.136 -30.889 1.00 67.19  ? 341  TYR B C   1 
ATOM   6735 O O   . TYR B 1 341 ? 13.292  -11.569 -31.266 1.00 73.47  ? 341  TYR B O   1 
ATOM   6736 C CB  . TYR B 1 341 ? 11.057  -10.666 -32.517 1.00 59.60  ? 341  TYR B CB  1 
ATOM   6737 C CG  . TYR B 1 341 ? 9.897   -10.570 -33.484 1.00 61.93  ? 341  TYR B CG  1 
ATOM   6738 C CD1 . TYR B 1 341 ? 8.817   -9.734  -33.220 1.00 59.08  ? 341  TYR B CD1 1 
ATOM   6739 C CD2 . TYR B 1 341 ? 9.892   -11.297 -34.674 1.00 58.93  ? 341  TYR B CD2 1 
ATOM   6740 C CE1 . TYR B 1 341 ? 7.750   -9.635  -34.102 1.00 58.30  ? 341  TYR B CE1 1 
ATOM   6741 C CE2 . TYR B 1 341 ? 8.828   -11.201 -35.568 1.00 61.44  ? 341  TYR B CE2 1 
ATOM   6742 C CZ  . TYR B 1 341 ? 7.759   -10.369 -35.273 1.00 65.72  ? 341  TYR B CZ  1 
ATOM   6743 O OH  . TYR B 1 341 ? 6.696   -10.264 -36.146 1.00 67.47  ? 341  TYR B OH  1 
ATOM   6744 N N   . GLY B 1 342 ? 12.281  -13.109 -29.987 1.00 81.62  ? 342  GLY B N   1 
ATOM   6745 C CA  . GLY B 1 342 ? 13.531  -13.717 -29.572 1.00 78.69  ? 342  GLY B CA  1 
ATOM   6746 C C   . GLY B 1 342 ? 14.122  -13.287 -28.245 1.00 73.92  ? 342  GLY B C   1 
ATOM   6747 O O   . GLY B 1 342 ? 15.252  -13.666 -27.927 1.00 74.90  ? 342  GLY B O   1 
ATOM   6748 N N   . VAL B 1 343 ? 13.388  -12.494 -27.471 1.00 69.17  ? 343  VAL B N   1 
ATOM   6749 C CA  . VAL B 1 343 ? 13.836  -12.189 -26.118 1.00 64.93  ? 343  VAL B CA  1 
ATOM   6750 C C   . VAL B 1 343 ? 13.294  -13.270 -25.198 1.00 66.56  ? 343  VAL B C   1 
ATOM   6751 O O   . VAL B 1 343 ? 12.080  -13.362 -24.983 1.00 68.99  ? 343  VAL B O   1 
ATOM   6752 C CB  . VAL B 1 343 ? 13.388  -10.800 -25.628 1.00 72.08  ? 343  VAL B CB  1 
ATOM   6753 C CG1 . VAL B 1 343 ? 13.899  -10.556 -24.212 1.00 69.60  ? 343  VAL B CG1 1 
ATOM   6754 C CG2 . VAL B 1 343 ? 13.897  -9.715  -26.563 1.00 69.96  ? 343  VAL B CG2 1 
ATOM   6755 N N   . PRO B 1 344 ? 14.198  -14.112 -24.672 1.00 64.04  ? 344  PRO B N   1 
ATOM   6756 C CA  . PRO B 1 344 ? 13.823  -15.279 -23.872 1.00 60.34  ? 344  PRO B CA  1 
ATOM   6757 C C   . PRO B 1 344 ? 12.930  -14.858 -22.723 1.00 67.07  ? 344  PRO B C   1 
ATOM   6758 O O   . PRO B 1 344 ? 13.335  -14.017 -21.921 1.00 68.65  ? 344  PRO B O   1 
ATOM   6759 C CB  . PRO B 1 344 ? 15.164  -15.785 -23.346 1.00 60.17  ? 344  PRO B CB  1 
ATOM   6760 C CG  . PRO B 1 344 ? 16.161  -15.303 -24.336 1.00 65.88  ? 344  PRO B CG  1 
ATOM   6761 C CD  . PRO B 1 344 ? 15.657  -13.971 -24.795 1.00 65.72  ? 344  PRO B CD  1 
ATOM   6762 N N   . GLY B 1 345 ? 11.725  -15.418 -22.668 1.00 64.63  ? 345  GLY B N   1 
ATOM   6763 C CA  . GLY B 1 345 ? 10.767  -15.091 -21.631 1.00 49.07  ? 345  GLY B CA  1 
ATOM   6764 C C   . GLY B 1 345 ? 9.492   -14.533 -22.219 1.00 66.17  ? 345  GLY B C   1 
ATOM   6765 O O   . GLY B 1 345 ? 8.439   -14.546 -21.574 1.00 72.50  ? 345  GLY B O   1 
ATOM   6766 N N   . PHE B 1 346 ? 9.572   -14.045 -23.453 1.00 62.11  ? 346  PHE B N   1 
ATOM   6767 C CA  . PHE B 1 346 ? 8.433   -13.339 -24.035 1.00 64.57  ? 346  PHE B CA  1 
ATOM   6768 C C   . PHE B 1 346 ? 7.705   -14.121 -25.124 1.00 69.07  ? 346  PHE B C   1 
ATOM   6769 O O   . PHE B 1 346 ? 8.318   -14.721 -26.015 1.00 68.05  ? 346  PHE B O   1 
ATOM   6770 C CB  . PHE B 1 346 ? 8.841   -11.946 -24.540 1.00 64.18  ? 346  PHE B CB  1 
ATOM   6771 C CG  . PHE B 1 346 ? 9.338   -11.037 -23.453 1.00 64.19  ? 346  PHE B CG  1 
ATOM   6772 C CD1 . PHE B 1 346 ? 10.674  -11.044 -23.083 1.00 58.23  ? 346  PHE B CD1 1 
ATOM   6773 C CD2 . PHE B 1 346 ? 8.465   -10.192 -22.783 1.00 62.37  ? 346  PHE B CD2 1 
ATOM   6774 C CE1 . PHE B 1 346 ? 11.132  -10.226 -22.072 1.00 57.36  ? 346  PHE B CE1 1 
ATOM   6775 C CE2 . PHE B 1 346 ? 8.919   -9.367  -21.770 1.00 58.36  ? 346  PHE B CE2 1 
ATOM   6776 C CZ  . PHE B 1 346 ? 10.254  -9.384  -21.415 1.00 58.34  ? 346  PHE B CZ  1 
ATOM   6777 N N   . SER B 1 347 ? 6.383   -14.094 -25.028 1.00 60.26  ? 347  SER B N   1 
ATOM   6778 C CA  . SER B 1 347 ? 5.507   -14.700 -26.002 1.00 60.30  ? 347  SER B CA  1 
ATOM   6779 C C   . SER B 1 347 ? 4.241   -13.885 -25.962 1.00 58.77  ? 347  SER B C   1 
ATOM   6780 O O   . SER B 1 347 ? 3.948   -13.259 -24.941 1.00 54.30  ? 347  SER B O   1 
ATOM   6781 C CB  . SER B 1 347 ? 5.191   -16.145 -25.593 1.00 74.56  ? 347  SER B CB  1 
ATOM   6782 O OG  . SER B 1 347 ? 3.891   -16.541 -26.016 1.00 62.38  ? 347  SER B OG  1 
ATOM   6783 N N   . LYS B 1 348 ? 3.485   -13.902 -27.056 1.00 55.79  ? 348  LYS B N   1 
ATOM   6784 C CA  . LYS B 1 348 ? 2.147   -13.321 -27.068 1.00 58.54  ? 348  LYS B CA  1 
ATOM   6785 C C   . LYS B 1 348 ? 1.143   -14.261 -26.397 1.00 68.97  ? 348  LYS B C   1 
ATOM   6786 O O   . LYS B 1 348 ? -0.024  -13.916 -26.215 1.00 60.25  ? 348  LYS B O   1 
ATOM   6787 C CB  . LYS B 1 348 ? 1.688   -13.038 -28.500 1.00 63.22  ? 348  LYS B CB  1 
ATOM   6788 C CG  . LYS B 1 348 ? 1.383   -14.287 -29.317 1.00 65.59  ? 348  LYS B CG  1 
ATOM   6789 C CD  . LYS B 1 348 ? 0.597   -13.947 -30.573 1.00 68.33  ? 348  LYS B CD  1 
ATOM   6790 C CE  . LYS B 1 348 ? 0.087   -15.202 -31.278 1.00 72.62  ? 348  LYS B CE  1 
ATOM   6791 N NZ  . LYS B 1 348 ? -0.942  -15.920 -30.484 1.00 67.85  ? 348  LYS B NZ  1 
ATOM   6792 N N   . ASP B 1 349 ? 1.595   -15.456 -26.036 1.00 70.20  ? 349  ASP B N   1 
ATOM   6793 C CA  . ASP B 1 349 ? 0.683   -16.458 -25.498 1.00 68.59  ? 349  ASP B CA  1 
ATOM   6794 C C   . ASP B 1 349 ? 0.618   -16.471 -23.958 1.00 73.99  ? 349  ASP B C   1 
ATOM   6795 O O   . ASP B 1 349 ? -0.475  -16.452 -23.391 1.00 82.85  ? 349  ASP B O   1 
ATOM   6796 C CB  . ASP B 1 349 ? 0.952   -17.831 -26.130 1.00 72.23  ? 349  ASP B CB  1 
ATOM   6797 C CG  . ASP B 1 349 ? 0.618   -17.858 -27.638 1.00 75.46  ? 349  ASP B CG  1 
ATOM   6798 O OD1 . ASP B 1 349 ? -0.509  -17.452 -28.010 1.00 63.28  ? 349  ASP B OD1 1 
ATOM   6799 O OD2 . ASP B 1 349 ? 1.481   -18.274 -28.451 1.00 69.44  ? 349  ASP B OD2 1 
ATOM   6800 N N   . ASN B 1 350 ? 1.759   -16.461 -23.273 1.00 71.83  ? 350  ASN B N   1 
ATOM   6801 C CA  . ASN B 1 350 ? 1.715   -16.260 -21.822 1.00 67.87  ? 350  ASN B CA  1 
ATOM   6802 C C   . ASN B 1 350 ? 1.802   -14.782 -21.420 1.00 75.49  ? 350  ASN B C   1 
ATOM   6803 O O   . ASN B 1 350 ? 1.844   -13.903 -22.272 1.00 76.36  ? 350  ASN B O   1 
ATOM   6804 C CB  . ASN B 1 350 ? 2.729   -17.136 -21.064 1.00 67.13  ? 350  ASN B CB  1 
ATOM   6805 C CG  . ASN B 1 350 ? 4.140   -17.030 -21.608 1.00 78.56  ? 350  ASN B CG  1 
ATOM   6806 O OD1 . ASN B 1 350 ? 4.652   -15.936 -21.826 1.00 77.72  ? 350  ASN B OD1 1 
ATOM   6807 N ND2 . ASN B 1 350 ? 4.792   -18.185 -21.803 1.00 88.68  ? 350  ASN B ND2 1 
ATOM   6808 N N   . GLU B 1 351 ? 1.805   -14.509 -20.123 1.00 82.27  ? 351  GLU B N   1 
ATOM   6809 C CA  . GLU B 1 351 ? 1.856   -13.134 -19.650 1.00 74.14  ? 351  GLU B CA  1 
ATOM   6810 C C   . GLU B 1 351 ? 3.282   -12.645 -19.545 1.00 68.14  ? 351  GLU B C   1 
ATOM   6811 O O   . GLU B 1 351 ? 3.548   -11.575 -19.005 1.00 62.48  ? 351  GLU B O   1 
ATOM   6812 C CB  . GLU B 1 351 ? 1.157   -13.010 -18.309 1.00 72.11  ? 351  GLU B CB  1 
ATOM   6813 C CG  . GLU B 1 351 ? -0.339  -13.011 -18.451 1.00 76.77  ? 351  GLU B CG  1 
ATOM   6814 C CD  . GLU B 1 351 ? -1.016  -12.342 -17.283 1.00 101.85 ? 351  GLU B CD  1 
ATOM   6815 O OE1 . GLU B 1 351 ? -0.531  -12.515 -16.142 1.00 104.57 ? 351  GLU B OE1 1 
ATOM   6816 O OE2 . GLU B 1 351 ? -2.028  -11.641 -17.506 1.00 115.01 ? 351  GLU B OE2 1 
ATOM   6817 N N   . SER B 1 352 ? 4.192   -13.451 -20.074 1.00 66.70  ? 352  SER B N   1 
ATOM   6818 C CA  . SER B 1 352 ? 5.607   -13.118 -20.123 1.00 67.41  ? 352  SER B CA  1 
ATOM   6819 C C   . SER B 1 352 ? 6.123   -12.436 -18.855 1.00 67.60  ? 352  SER B C   1 
ATOM   6820 O O   . SER B 1 352 ? 6.920   -11.501 -18.918 1.00 63.04  ? 352  SER B O   1 
ATOM   6821 C CB  . SER B 1 352 ? 5.906   -12.266 -21.355 1.00 69.93  ? 352  SER B CB  1 
ATOM   6822 O OG  . SER B 1 352 ? 5.352   -12.850 -22.520 1.00 73.44  ? 352  SER B OG  1 
ATOM   6823 N N   . LEU B 1 353 ? 5.673   -12.909 -17.700 1.00 70.97  ? 353  LEU B N   1 
ATOM   6824 C CA  . LEU B 1 353 ? 6.263   -12.466 -16.445 1.00 62.76  ? 353  LEU B CA  1 
ATOM   6825 C C   . LEU B 1 353 ? 7.664   -13.047 -16.405 1.00 63.60  ? 353  LEU B C   1 
ATOM   6826 O O   . LEU B 1 353 ? 7.868   -14.200 -16.746 1.00 73.24  ? 353  LEU B O   1 
ATOM   6827 C CB  . LEU B 1 353 ? 5.418   -12.924 -15.264 1.00 52.37  ? 353  LEU B CB  1 
ATOM   6828 C CG  . LEU B 1 353 ? 3.948   -12.500 -15.392 1.00 69.15  ? 353  LEU B CG  1 
ATOM   6829 C CD1 . LEU B 1 353 ? 3.095   -13.078 -14.281 1.00 68.80  ? 353  LEU B CD1 1 
ATOM   6830 C CD2 . LEU B 1 353 ? 3.798   -10.983 -15.423 1.00 69.63  ? 353  LEU B CD2 1 
ATOM   6831 N N   . ILE B 1 354 ? 8.650   -12.247 -16.040 1.00 68.33  ? 354  ILE B N   1 
ATOM   6832 C CA  . ILE B 1 354 ? 10.019  -12.713 -16.184 1.00 67.04  ? 354  ILE B CA  1 
ATOM   6833 C C   . ILE B 1 354 ? 10.814  -12.601 -14.901 1.00 64.30  ? 354  ILE B C   1 
ATOM   6834 O O   . ILE B 1 354 ? 10.422  -11.901 -13.969 1.00 61.92  ? 354  ILE B O   1 
ATOM   6835 C CB  . ILE B 1 354 ? 10.761  -11.951 -17.310 1.00 71.00  ? 354  ILE B CB  1 
ATOM   6836 C CG1 . ILE B 1 354 ? 10.580  -10.435 -17.141 1.00 68.13  ? 354  ILE B CG1 1 
ATOM   6837 C CG2 . ILE B 1 354 ? 10.261  -12.407 -18.672 1.00 62.91  ? 354  ILE B CG2 1 
ATOM   6838 C CD1 . ILE B 1 354 ? 11.625  -9.601  -17.866 1.00 62.94  ? 354  ILE B CD1 1 
ATOM   6839 N N   . SER B 1 355 ? 11.941  -13.300 -14.876 1.00 68.09  ? 355  SER B N   1 
ATOM   6840 C CA  . SER B 1 355 ? 12.852  -13.282 -13.744 1.00 71.85  ? 355  SER B CA  1 
ATOM   6841 C C   . SER B 1 355 ? 13.824  -12.116 -13.884 1.00 76.40  ? 355  SER B C   1 
ATOM   6842 O O   . SER B 1 355 ? 13.986  -11.553 -14.969 1.00 73.44  ? 355  SER B O   1 
ATOM   6843 C CB  . SER B 1 355 ? 13.649  -14.585 -13.704 1.00 68.01  ? 355  SER B CB  1 
ATOM   6844 O OG  . SER B 1 355 ? 14.694  -14.558 -14.667 1.00 69.34  ? 355  SER B OG  1 
ATOM   6845 N N   . ARG B 1 356 ? 14.484  -11.765 -12.788 1.00 72.22  ? 356  ARG B N   1 
ATOM   6846 C CA  . ARG B 1 356 ? 15.516  -10.745 -12.843 1.00 72.26  ? 356  ARG B CA  1 
ATOM   6847 C C   . ARG B 1 356 ? 16.659  -11.204 -13.751 1.00 74.94  ? 356  ARG B C   1 
ATOM   6848 O O   . ARG B 1 356 ? 17.325  -10.387 -14.403 1.00 76.63  ? 356  ARG B O   1 
ATOM   6849 C CB  . ARG B 1 356 ? 16.022  -10.415 -11.436 1.00 72.49  ? 356  ARG B CB  1 
ATOM   6850 C CG  . ARG B 1 356 ? 17.069  -9.337  -11.413 1.00 70.14  ? 356  ARG B CG  1 
ATOM   6851 C CD  . ARG B 1 356 ? 16.902  -8.403  -10.232 1.00 70.46  ? 356  ARG B CD  1 
ATOM   6852 N NE  . ARG B 1 356 ? 17.957  -7.397  -10.262 1.00 79.48  ? 356  ARG B NE  1 
ATOM   6853 C CZ  . ARG B 1 356 ? 17.823  -6.187  -10.795 1.00 81.96  ? 356  ARG B CZ  1 
ATOM   6854 N NH1 . ARG B 1 356 ? 16.662  -5.817  -11.322 1.00 74.40  ? 356  ARG B NH1 1 
ATOM   6855 N NH2 . ARG B 1 356 ? 18.846  -5.341  -10.785 1.00 76.07  ? 356  ARG B NH2 1 
ATOM   6856 N N   . ALA B 1 357 ? 16.872  -12.516 -13.803 1.00 69.43  ? 357  ALA B N   1 
ATOM   6857 C CA  . ALA B 1 357 ? 17.933  -13.079 -14.631 1.00 69.02  ? 357  ALA B CA  1 
ATOM   6858 C C   . ALA B 1 357 ? 17.640  -12.821 -16.097 1.00 67.25  ? 357  ALA B C   1 
ATOM   6859 O O   . ALA B 1 357 ? 18.504  -12.362 -16.842 1.00 64.02  ? 357  ALA B O   1 
ATOM   6860 C CB  . ALA B 1 357 ? 18.063  -14.558 -14.381 1.00 67.67  ? 357  ALA B CB  1 
ATOM   6861 N N   . GLN B 1 358 ? 16.412  -13.123 -16.503 1.00 66.31  ? 358  GLN B N   1 
ATOM   6862 C CA  . GLN B 1 358 ? 15.981  -12.873 -17.871 1.00 69.94  ? 358  GLN B CA  1 
ATOM   6863 C C   . GLN B 1 358 ? 16.077  -11.384 -18.205 1.00 72.29  ? 358  GLN B C   1 
ATOM   6864 O O   . GLN B 1 358 ? 16.513  -11.023 -19.296 1.00 65.73  ? 358  GLN B O   1 
ATOM   6865 C CB  . GLN B 1 358 ? 14.558  -13.390 -18.094 1.00 71.55  ? 358  GLN B CB  1 
ATOM   6866 C CG  . GLN B 1 358 ? 14.457  -14.909 -18.256 1.00 63.13  ? 358  GLN B CG  1 
ATOM   6867 C CD  . GLN B 1 358 ? 13.088  -15.448 -17.865 1.00 63.57  ? 358  GLN B CD  1 
ATOM   6868 O OE1 . GLN B 1 358 ? 12.577  -15.147 -16.788 1.00 68.88  ? 358  GLN B OE1 1 
ATOM   6869 N NE2 . GLN B 1 358 ? 12.493  -16.251 -18.735 1.00 60.09  ? 358  GLN B NE2 1 
ATOM   6870 N N   . PHE B 1 359 ? 15.689  -10.525 -17.260 1.00 69.65  ? 359  PHE B N   1 
ATOM   6871 C CA  . PHE B 1 359 ? 15.781  -9.078  -17.462 1.00 65.38  ? 359  PHE B CA  1 
ATOM   6872 C C   . PHE B 1 359 ? 17.202  -8.639  -17.813 1.00 63.44  ? 359  PHE B C   1 
ATOM   6873 O O   . PHE B 1 359 ? 17.404  -7.896  -18.773 1.00 64.03  ? 359  PHE B O   1 
ATOM   6874 C CB  . PHE B 1 359 ? 15.243  -8.299  -16.250 1.00 70.10  ? 359  PHE B CB  1 
ATOM   6875 C CG  . PHE B 1 359 ? 15.373  -6.797  -16.377 1.00 69.48  ? 359  PHE B CG  1 
ATOM   6876 C CD1 . PHE B 1 359 ? 16.171  -6.075  -15.497 1.00 71.39  ? 359  PHE B CD1 1 
ATOM   6877 C CD2 . PHE B 1 359 ? 14.709  -6.107  -17.382 1.00 68.40  ? 359  PHE B CD2 1 
ATOM   6878 C CE1 . PHE B 1 359 ? 16.299  -4.692  -15.613 1.00 66.40  ? 359  PHE B CE1 1 
ATOM   6879 C CE2 . PHE B 1 359 ? 14.838  -4.721  -17.510 1.00 62.96  ? 359  PHE B CE2 1 
ATOM   6880 C CZ  . PHE B 1 359 ? 15.631  -4.016  -16.623 1.00 59.83  ? 359  PHE B CZ  1 
ATOM   6881 N N   . LEU B 1 360 ? 18.189  -9.105  -17.057 1.00 63.23  ? 360  LEU B N   1 
ATOM   6882 C CA  . LEU B 1 360 ? 19.571  -8.721  -17.349 1.00 70.93  ? 360  LEU B CA  1 
ATOM   6883 C C   . LEU B 1 360 ? 19.979  -9.252  -18.717 1.00 68.13  ? 360  LEU B C   1 
ATOM   6884 O O   . LEU B 1 360 ? 20.639  -8.561  -19.502 1.00 61.07  ? 360  LEU B O   1 
ATOM   6885 C CB  . LEU B 1 360 ? 20.535  -9.218  -16.266 1.00 67.19  ? 360  LEU B CB  1 
ATOM   6886 C CG  . LEU B 1 360 ? 20.129  -8.915  -14.814 1.00 78.71  ? 360  LEU B CG  1 
ATOM   6887 C CD1 . LEU B 1 360 ? 21.227  -9.292  -13.844 1.00 82.20  ? 360  LEU B CD1 1 
ATOM   6888 C CD2 . LEU B 1 360 ? 19.757  -7.449  -14.629 1.00 77.75  ? 360  LEU B CD2 1 
ATOM   6889 N N   . ALA B 1 361 ? 19.569  -10.482 -19.003 1.00 61.36  ? 361  ALA B N   1 
ATOM   6890 C CA  . ALA B 1 361 ? 19.891  -11.104 -20.277 1.00 66.07  ? 361  ALA B CA  1 
ATOM   6891 C C   . ALA B 1 361 ? 19.285  -10.299 -21.429 1.00 62.38  ? 361  ALA B C   1 
ATOM   6892 O O   . ALA B 1 361 ? 19.951  -10.037 -22.443 1.00 60.77  ? 361  ALA B O   1 
ATOM   6893 C CB  . ALA B 1 361 ? 19.397  -12.547 -20.295 1.00 55.97  ? 361  ALA B CB  1 
ATOM   6894 N N   . GLY B 1 362 ? 18.026  -9.898  -21.248 1.00 62.28  ? 362  GLY B N   1 
ATOM   6895 C CA  . GLY B 1 362 ? 17.294  -9.095  -22.217 1.00 62.73  ? 362  GLY B CA  1 
ATOM   6896 C C   . GLY B 1 362 ? 17.916  -7.738  -22.514 1.00 63.58  ? 362  GLY B C   1 
ATOM   6897 O O   . GLY B 1 362 ? 17.805  -7.236  -23.631 1.00 59.21  ? 362  GLY B O   1 
ATOM   6898 N N   . VAL B 1 363 ? 18.578  -7.150  -21.520 1.00 64.78  ? 363  VAL B N   1 
ATOM   6899 C CA  . VAL B 1 363 ? 19.259  -5.866  -21.696 1.00 65.83  ? 363  VAL B CA  1 
ATOM   6900 C C   . VAL B 1 363 ? 20.529  -5.957  -22.578 1.00 64.83  ? 363  VAL B C   1 
ATOM   6901 O O   . VAL B 1 363 ? 20.832  -5.025  -23.324 1.00 64.68  ? 363  VAL B O   1 
ATOM   6902 C CB  . VAL B 1 363 ? 19.545  -5.181  -20.323 1.00 59.20  ? 363  VAL B CB  1 
ATOM   6903 C CG1 . VAL B 1 363 ? 20.442  -3.963  -20.486 1.00 50.90  ? 363  VAL B CG1 1 
ATOM   6904 C CG2 . VAL B 1 363 ? 18.243  -4.798  -19.644 1.00 56.66  ? 363  VAL B CG2 1 
ATOM   6905 N N   . ARG B 1 364 ? 21.256  -7.073  -22.511 1.00 67.08  ? 364  ARG B N   1 
ATOM   6906 C CA  . ARG B 1 364 ? 22.433  -7.260  -23.365 1.00 63.10  ? 364  ARG B CA  1 
ATOM   6907 C C   . ARG B 1 364 ? 21.998  -7.308  -24.810 1.00 63.23  ? 364  ARG B C   1 
ATOM   6908 O O   . ARG B 1 364 ? 22.734  -6.931  -25.710 1.00 68.84  ? 364  ARG B O   1 
ATOM   6909 C CB  . ARG B 1 364 ? 23.143  -8.571  -23.047 1.00 64.58  ? 364  ARG B CB  1 
ATOM   6910 C CG  . ARG B 1 364 ? 23.606  -8.713  -21.625 1.00 69.32  ? 364  ARG B CG  1 
ATOM   6911 C CD  . ARG B 1 364 ? 24.170  -7.409  -21.085 1.00 78.05  ? 364  ARG B CD  1 
ATOM   6912 N NE  . ARG B 1 364 ? 25.219  -6.821  -21.920 1.00 78.28  ? 364  ARG B NE  1 
ATOM   6913 C CZ  . ARG B 1 364 ? 26.513  -6.802  -21.602 1.00 84.24  ? 364  ARG B CZ  1 
ATOM   6914 N NH1 . ARG B 1 364 ? 26.937  -7.357  -20.468 1.00 77.08  ? 364  ARG B NH1 1 
ATOM   6915 N NH2 . ARG B 1 364 ? 27.386  -6.230  -22.423 1.00 81.76  ? 364  ARG B NH2 1 
ATOM   6916 N N   . ILE B 1 365 ? 20.787  -7.799  -25.017 1.00 67.97  ? 365  ILE B N   1 
ATOM   6917 C CA  . ILE B 1 365 ? 20.219  -7.943  -26.345 1.00 69.91  ? 365  ILE B CA  1 
ATOM   6918 C C   . ILE B 1 365 ? 19.602  -6.625  -26.818 1.00 70.59  ? 365  ILE B C   1 
ATOM   6919 O O   . ILE B 1 365 ? 19.744  -6.247  -27.988 1.00 65.75  ? 365  ILE B O   1 
ATOM   6920 C CB  . ILE B 1 365 ? 19.160  -9.059  -26.334 1.00 72.45  ? 365  ILE B CB  1 
ATOM   6921 C CG1 . ILE B 1 365 ? 19.836  -10.421 -26.377 1.00 56.49  ? 365  ILE B CG1 1 
ATOM   6922 C CG2 . ILE B 1 365 ? 18.192  -8.921  -27.495 1.00 76.10  ? 365  ILE B CG2 1 
ATOM   6923 C CD1 . ILE B 1 365 ? 18.849  -11.536 -26.407 1.00 74.75  ? 365  ILE B CD1 1 
ATOM   6924 N N   . GLY B 1 366 ? 18.929  -5.933  -25.896 1.00 69.34  ? 366  GLY B N   1 
ATOM   6925 C CA  . GLY B 1 366 ? 18.310  -4.641  -26.166 1.00 62.90  ? 366  GLY B CA  1 
ATOM   6926 C C   . GLY B 1 366 ? 19.300  -3.517  -26.430 1.00 58.73  ? 366  GLY B C   1 
ATOM   6927 O O   . GLY B 1 366 ? 19.062  -2.634  -27.256 1.00 62.72  ? 366  GLY B O   1 
ATOM   6928 N N   . VAL B 1 367 ? 20.421  -3.547  -25.725 1.00 59.65  ? 367  VAL B N   1 
ATOM   6929 C CA  . VAL B 1 367 ? 21.469  -2.565  -25.936 1.00 63.59  ? 367  VAL B CA  1 
ATOM   6930 C C   . VAL B 1 367 ? 22.725  -3.294  -26.373 1.00 64.36  ? 367  VAL B C   1 
ATOM   6931 O O   . VAL B 1 367 ? 23.726  -3.298  -25.667 1.00 64.80  ? 367  VAL B O   1 
ATOM   6932 C CB  . VAL B 1 367 ? 21.755  -1.776  -24.656 1.00 60.95  ? 367  VAL B CB  1 
ATOM   6933 C CG1 . VAL B 1 367 ? 22.571  -0.544  -24.973 1.00 51.64  ? 367  VAL B CG1 1 
ATOM   6934 C CG2 . VAL B 1 367 ? 20.452  -1.387  -23.982 1.00 59.62  ? 367  VAL B CG2 1 
ATOM   6935 N N   . PRO B 1 368 ? 22.670  -3.918  -27.553 1.00 70.90  ? 368  PRO B N   1 
ATOM   6936 C CA  . PRO B 1 368 ? 23.711  -4.832  -28.028 1.00 67.60  ? 368  PRO B CA  1 
ATOM   6937 C C   . PRO B 1 368 ? 25.061  -4.151  -28.023 1.00 71.18  ? 368  PRO B C   1 
ATOM   6938 O O   . PRO B 1 368 ? 26.105  -4.805  -27.983 1.00 72.25  ? 368  PRO B O   1 
ATOM   6939 C CB  . PRO B 1 368 ? 23.285  -5.106  -29.474 1.00 75.12  ? 368  PRO B CB  1 
ATOM   6940 C CG  . PRO B 1 368 ? 22.414  -3.924  -29.830 1.00 71.82  ? 368  PRO B CG  1 
ATOM   6941 C CD  . PRO B 1 368 ? 21.640  -3.699  -28.581 1.00 68.85  ? 368  PRO B CD  1 
ATOM   6942 N N   . GLN B 1 369 ? 25.032  -2.827  -28.065 1.00 76.09  ? 369  GLN B N   1 
ATOM   6943 C CA  . GLN B 1 369 ? 26.254  -2.052  -28.195 1.00 76.53  ? 369  GLN B CA  1 
ATOM   6944 C C   . GLN B 1 369 ? 26.877  -1.708  -26.845 1.00 77.29  ? 369  GLN B C   1 
ATOM   6945 O O   . GLN B 1 369 ? 27.970  -1.148  -26.788 1.00 83.93  ? 369  GLN B O   1 
ATOM   6946 C CB  . GLN B 1 369 ? 25.986  -0.784  -29.008 1.00 80.45  ? 369  GLN B CB  1 
ATOM   6947 C CG  . GLN B 1 369 ? 26.114  -0.982  -30.532 1.00 99.06  ? 369  GLN B CG  1 
ATOM   6948 C CD  . GLN B 1 369 ? 24.818  -1.444  -31.217 1.00 97.97  ? 369  GLN B CD  1 
ATOM   6949 O OE1 . GLN B 1 369 ? 23.709  -1.169  -30.739 1.00 102.69 ? 369  GLN B OE1 1 
ATOM   6950 N NE2 . GLN B 1 369 ? 24.960  -2.129  -32.354 1.00 82.01  ? 369  GLN B NE2 1 
ATOM   6951 N N   . ALA B 1 370 ? 26.193  -2.069  -25.761 1.00 72.89  ? 370  ALA B N   1 
ATOM   6952 C CA  . ALA B 1 370 ? 26.612  -1.678  -24.410 1.00 79.76  ? 370  ALA B CA  1 
ATOM   6953 C C   . ALA B 1 370 ? 27.722  -2.532  -23.780 1.00 80.53  ? 370  ALA B C   1 
ATOM   6954 O O   . ALA B 1 370 ? 27.697  -3.765  -23.844 1.00 73.72  ? 370  ALA B O   1 
ATOM   6955 C CB  . ALA B 1 370 ? 25.403  -1.632  -23.477 1.00 68.80  ? 370  ALA B CB  1 
ATOM   6956 N N   . SER B 1 371 ? 28.683  -1.855  -23.157 1.00 75.19  ? 371  SER B N   1 
ATOM   6957 C CA  . SER B 1 371 ? 29.682  -2.518  -22.333 1.00 72.21  ? 371  SER B CA  1 
ATOM   6958 C C   . SER B 1 371 ? 29.010  -3.105  -21.100 1.00 74.74  ? 371  SER B C   1 
ATOM   6959 O O   . SER B 1 371 ? 27.827  -2.872  -20.850 1.00 74.67  ? 371  SER B O   1 
ATOM   6960 C CB  . SER B 1 371 ? 30.756  -1.523  -21.907 1.00 75.00  ? 371  SER B CB  1 
ATOM   6961 O OG  . SER B 1 371 ? 30.200  -0.490  -21.115 1.00 74.30  ? 371  SER B OG  1 
ATOM   6962 N N   . ASP B 1 372 ? 29.758  -3.868  -20.322 1.00 76.08  ? 372  ASP B N   1 
ATOM   6963 C CA  . ASP B 1 372 ? 29.192  -4.449  -19.117 1.00 74.99  ? 372  ASP B CA  1 
ATOM   6964 C C   . ASP B 1 372 ? 28.720  -3.352  -18.178 1.00 75.77  ? 372  ASP B C   1 
ATOM   6965 O O   . ASP B 1 372 ? 27.621  -3.426  -17.620 1.00 69.67  ? 372  ASP B O   1 
ATOM   6966 C CB  . ASP B 1 372 ? 30.217  -5.336  -18.422 1.00 82.79  ? 372  ASP B CB  1 
ATOM   6967 C CG  . ASP B 1 372 ? 30.676  -6.477  -19.301 1.00 98.22  ? 372  ASP B CG  1 
ATOM   6968 O OD1 . ASP B 1 372 ? 30.408  -7.642  -18.934 1.00 93.76  ? 372  ASP B OD1 1 
ATOM   6969 O OD2 . ASP B 1 372 ? 31.280  -6.205  -20.368 1.00 95.84  ? 372  ASP B OD2 1 
ATOM   6970 N N   . LEU B 1 373 ? 29.550  -2.325  -18.015 1.00 68.37  ? 373  LEU B N   1 
ATOM   6971 C CA  . LEU B 1 373 ? 29.232  -1.246  -17.089 1.00 66.58  ? 373  LEU B CA  1 
ATOM   6972 C C   . LEU B 1 373 ? 27.991  -0.473  -17.525 1.00 70.67  ? 373  LEU B C   1 
ATOM   6973 O O   . LEU B 1 373 ? 27.133  -0.132  -16.702 1.00 62.49  ? 373  LEU B O   1 
ATOM   6974 C CB  . LEU B 1 373 ? 30.420  -0.302  -16.937 1.00 69.65  ? 373  LEU B CB  1 
ATOM   6975 C CG  . LEU B 1 373 ? 30.187  0.913   -16.045 1.00 67.28  ? 373  LEU B CG  1 
ATOM   6976 C CD1 . LEU B 1 373 ? 29.946  0.502   -14.600 1.00 57.45  ? 373  LEU B CD1 1 
ATOM   6977 C CD2 . LEU B 1 373 ? 31.370  1.838   -16.155 1.00 72.56  ? 373  LEU B CD2 1 
ATOM   6978 N N   . ALA B 1 374 ? 27.900  -0.202  -18.824 1.00 70.15  ? 374  ALA B N   1 
ATOM   6979 C CA  . ALA B 1 374 ? 26.730  0.469   -19.380 1.00 69.08  ? 374  ALA B CA  1 
ATOM   6980 C C   . ALA B 1 374 ? 25.459  -0.379  -19.232 1.00 61.16  ? 374  ALA B C   1 
ATOM   6981 O O   . ALA B 1 374 ? 24.392  0.136   -18.915 1.00 61.84  ? 374  ALA B O   1 
ATOM   6982 C CB  . ALA B 1 374 ? 26.974  0.832   -20.830 1.00 68.02  ? 374  ALA B CB  1 
ATOM   6983 N N   . ALA B 1 375 ? 25.577  -1.680  -19.455 1.00 60.36  ? 375  ALA B N   1 
ATOM   6984 C CA  . ALA B 1 375 ? 24.430  -2.561  -19.295 1.00 62.21  ? 375  ALA B CA  1 
ATOM   6985 C C   . ALA B 1 375 ? 24.006  -2.551  -17.837 1.00 60.37  ? 375  ALA B C   1 
ATOM   6986 O O   . ALA B 1 375 ? 22.820  -2.590  -17.518 1.00 57.59  ? 375  ALA B O   1 
ATOM   6987 C CB  . ALA B 1 375 ? 24.767  -3.979  -19.755 1.00 58.43  ? 375  ALA B CB  1 
ATOM   6988 N N   . GLU B 1 376 ? 24.986  -2.488  -16.945 1.00 60.33  ? 376  GLU B N   1 
ATOM   6989 C CA  . GLU B 1 376 ? 24.688  -2.424  -15.524 1.00 60.51  ? 376  GLU B CA  1 
ATOM   6990 C C   . GLU B 1 376 ? 23.910  -1.146  -15.212 1.00 63.66  ? 376  GLU B C   1 
ATOM   6991 O O   . GLU B 1 376 ? 22.877  -1.183  -14.530 1.00 60.07  ? 376  GLU B O   1 
ATOM   6992 C CB  . GLU B 1 376 ? 25.975  -2.502  -14.706 1.00 61.11  ? 376  GLU B CB  1 
ATOM   6993 C CG  . GLU B 1 376 ? 25.766  -2.500  -13.202 1.00 76.25  ? 376  GLU B CG  1 
ATOM   6994 C CD  . GLU B 1 376 ? 24.799  -3.579  -12.731 1.00 99.49  ? 376  GLU B CD  1 
ATOM   6995 O OE1 . GLU B 1 376 ? 24.541  -4.535  -13.505 1.00 98.78  ? 376  GLU B OE1 1 
ATOM   6996 O OE2 . GLU B 1 376 ? 24.299  -3.469  -11.583 1.00 101.25 ? 376  GLU B OE2 1 
ATOM   6997 N N   . ALA B 1 377 ? 24.399  -0.022  -15.734 1.00 51.50  ? 377  ALA B N   1 
ATOM   6998 C CA  . ALA B 1 377 ? 23.717  1.254   -15.562 1.00 50.57  ? 377  ALA B CA  1 
ATOM   6999 C C   . ALA B 1 377 ? 22.264  1.200   -16.051 1.00 61.47  ? 377  ALA B C   1 
ATOM   7000 O O   . ALA B 1 377 ? 21.379  1.810   -15.442 1.00 58.98  ? 377  ALA B O   1 
ATOM   7001 C CB  . ALA B 1 377 ? 24.478  2.376   -16.264 1.00 49.67  ? 377  ALA B CB  1 
ATOM   7002 N N   . VAL B 1 378 ? 22.005  0.482   -17.145 1.00 52.99  ? 378  VAL B N   1 
ATOM   7003 C CA  . VAL B 1 378 ? 20.638  0.402   -17.641 1.00 50.79  ? 378  VAL B CA  1 
ATOM   7004 C C   . VAL B 1 378 ? 19.777  -0.356  -16.655 1.00 51.39  ? 378  VAL B C   1 
ATOM   7005 O O   . VAL B 1 378 ? 18.691  0.088   -16.304 1.00 54.66  ? 378  VAL B O   1 
ATOM   7006 C CB  . VAL B 1 378 ? 20.549  -0.249  -19.020 1.00 53.08  ? 378  VAL B CB  1 
ATOM   7007 C CG1 . VAL B 1 378 ? 19.095  -0.400  -19.427 1.00 43.42  ? 378  VAL B CG1 1 
ATOM   7008 C CG2 . VAL B 1 378 ? 21.291  0.590   -20.031 1.00 49.36  ? 378  VAL B CG2 1 
ATOM   7009 N N   . VAL B 1 379 ? 20.291  -1.487  -16.189 1.00 53.12  ? 379  VAL B N   1 
ATOM   7010 C CA  . VAL B 1 379 ? 19.597  -2.329  -15.222 1.00 56.59  ? 379  VAL B CA  1 
ATOM   7011 C C   . VAL B 1 379 ? 19.306  -1.613  -13.912 1.00 56.84  ? 379  VAL B C   1 
ATOM   7012 O O   . VAL B 1 379 ? 18.238  -1.769  -13.324 1.00 56.64  ? 379  VAL B O   1 
ATOM   7013 C CB  . VAL B 1 379 ? 20.433  -3.563  -14.886 1.00 62.36  ? 379  VAL B CB  1 
ATOM   7014 C CG1 . VAL B 1 379 ? 19.822  -4.294  -13.704 1.00 58.53  ? 379  VAL B CG1 1 
ATOM   7015 C CG2 . VAL B 1 379 ? 20.568  -4.464  -16.115 1.00 58.31  ? 379  VAL B CG2 1 
ATOM   7016 N N   . LEU B 1 380 ? 20.266  -0.837  -13.441 1.00 54.36  ? 380  LEU B N   1 
ATOM   7017 C CA  . LEU B 1 380 ? 20.063  -0.121  -12.195 1.00 63.86  ? 380  LEU B CA  1 
ATOM   7018 C C   . LEU B 1 380 ? 19.015  0.963   -12.370 1.00 59.25  ? 380  LEU B C   1 
ATOM   7019 O O   . LEU B 1 380 ? 18.153  1.152   -11.511 1.00 59.88  ? 380  LEU B O   1 
ATOM   7020 C CB  . LEU B 1 380 ? 21.384  0.448   -11.671 1.00 65.44  ? 380  LEU B CB  1 
ATOM   7021 C CG  . LEU B 1 380 ? 22.361  -0.686  -11.322 1.00 66.36  ? 380  LEU B CG  1 
ATOM   7022 C CD1 . LEU B 1 380 ? 23.666  -0.156  -10.752 1.00 74.90  ? 380  LEU B CD1 1 
ATOM   7023 C CD2 . LEU B 1 380 ? 21.724  -1.685  -10.353 1.00 61.40  ? 380  LEU B CD2 1 
ATOM   7024 N N   . HIS B 1 381 ? 19.072  1.657   -13.500 1.00 57.55  ? 381  HIS B N   1 
ATOM   7025 C CA  . HIS B 1 381 ? 18.155  2.759   -13.745 1.00 56.39  ? 381  HIS B CA  1 
ATOM   7026 C C   . HIS B 1 381 ? 16.712  2.283   -13.864 1.00 58.03  ? 381  HIS B C   1 
ATOM   7027 O O   . HIS B 1 381 ? 15.781  2.960   -13.420 1.00 53.58  ? 381  HIS B O   1 
ATOM   7028 C CB  . HIS B 1 381 ? 18.549  3.530   -15.005 1.00 56.88  ? 381  HIS B CB  1 
ATOM   7029 C CG  . HIS B 1 381 ? 17.618  4.655   -15.325 1.00 60.03  ? 381  HIS B CG  1 
ATOM   7030 N ND1 . HIS B 1 381 ? 17.874  5.960   -14.961 1.00 67.66  ? 381  HIS B ND1 1 
ATOM   7031 C CD2 . HIS B 1 381 ? 16.409  4.667   -15.939 1.00 64.34  ? 381  HIS B CD2 1 
ATOM   7032 C CE1 . HIS B 1 381 ? 16.871  6.729   -15.349 1.00 70.25  ? 381  HIS B CE1 1 
ATOM   7033 N NE2 . HIS B 1 381 ? 15.970  5.969   -15.950 1.00 65.86  ? 381  HIS B NE2 1 
ATOM   7034 N N   . TYR B 1 382 ? 16.537  1.106   -14.457 1.00 60.74  ? 382  TYR B N   1 
ATOM   7035 C CA  . TYR B 1 382 ? 15.207  0.607   -14.787 1.00 51.89  ? 382  TYR B CA  1 
ATOM   7036 C C   . TYR B 1 382 ? 14.615  -0.321  -13.736 1.00 58.46  ? 382  TYR B C   1 
ATOM   7037 O O   . TYR B 1 382 ? 13.410  -0.585  -13.748 1.00 55.51  ? 382  TYR B O   1 
ATOM   7038 C CB  . TYR B 1 382 ? 15.206  -0.067  -16.163 1.00 50.69  ? 382  TYR B CB  1 
ATOM   7039 C CG  . TYR B 1 382 ? 15.027  0.908   -17.298 1.00 46.20  ? 382  TYR B CG  1 
ATOM   7040 C CD1 . TYR B 1 382 ? 16.124  1.479   -17.936 1.00 48.89  ? 382  TYR B CD1 1 
ATOM   7041 C CD2 . TYR B 1 382 ? 13.756  1.279   -17.721 1.00 47.97  ? 382  TYR B CD2 1 
ATOM   7042 C CE1 . TYR B 1 382 ? 15.955  2.395   -18.985 1.00 50.96  ? 382  TYR B CE1 1 
ATOM   7043 C CE2 . TYR B 1 382 ? 13.574  2.184   -18.774 1.00 44.51  ? 382  TYR B CE2 1 
ATOM   7044 C CZ  . TYR B 1 382 ? 14.672  2.740   -19.400 1.00 49.11  ? 382  TYR B CZ  1 
ATOM   7045 O OH  . TYR B 1 382 ? 14.486  3.636   -20.438 1.00 46.03  ? 382  TYR B OH  1 
ATOM   7046 N N   . THR B 1 383 ? 15.450  -0.811  -12.823 1.00 59.01  ? 383  THR B N   1 
ATOM   7047 C CA  . THR B 1 383 ? 14.931  -1.578  -11.700 1.00 57.61  ? 383  THR B CA  1 
ATOM   7048 C C   . THR B 1 383 ? 14.041  -0.708  -10.801 1.00 54.82  ? 383  THR B C   1 
ATOM   7049 O O   . THR B 1 383 ? 14.322  0.470   -10.585 1.00 61.38  ? 383  THR B O   1 
ATOM   7050 C CB  . THR B 1 383 ? 16.059  -2.212  -10.878 1.00 55.25  ? 383  THR B CB  1 
ATOM   7051 O OG1 . THR B 1 383 ? 16.802  -3.113  -11.705 1.00 56.05  ? 383  THR B OG1 1 
ATOM   7052 C CG2 . THR B 1 383 ? 15.488  -2.980  -9.715  1.00 59.67  ? 383  THR B CG2 1 
ATOM   7053 N N   . ASP B 1 384 ? 12.946  -1.283  -10.314 1.00 58.02  ? 384  ASP B N   1 
ATOM   7054 C CA  . ASP B 1 384 ? 12.157  -0.656  -9.256  1.00 66.62  ? 384  ASP B CA  1 
ATOM   7055 C C   . ASP B 1 384 ? 12.639  -1.185  -7.910  1.00 70.97  ? 384  ASP B C   1 
ATOM   7056 O O   . ASP B 1 384 ? 12.255  -2.273  -7.479  1.00 67.54  ? 384  ASP B O   1 
ATOM   7057 C CB  . ASP B 1 384 ? 10.668  -0.946  -9.421  1.00 65.67  ? 384  ASP B CB  1 
ATOM   7058 C CG  . ASP B 1 384 ? 9.838   -0.386  -8.282  1.00 78.70  ? 384  ASP B CG  1 
ATOM   7059 O OD1 . ASP B 1 384 ? 10.416  0.188   -7.331  1.00 77.11  ? 384  ASP B OD1 1 
ATOM   7060 O OD2 . ASP B 1 384 ? 8.598   -0.517  -8.335  1.00 89.81  ? 384  ASP B OD2 1 
ATOM   7061 N N   . TRP B 1 385 ? 13.479  -0.406  -7.244  1.00 66.68  ? 385  TRP B N   1 
ATOM   7062 C CA  . TRP B 1 385 ? 14.154  -0.893  -6.054  1.00 69.18  ? 385  TRP B CA  1 
ATOM   7063 C C   . TRP B 1 385 ? 13.218  -1.209  -4.898  1.00 69.10  ? 385  TRP B C   1 
ATOM   7064 O O   . TRP B 1 385 ? 13.599  -1.897  -3.964  1.00 77.46  ? 385  TRP B O   1 
ATOM   7065 C CB  . TRP B 1 385 ? 15.291  0.049   -5.673  1.00 62.65  ? 385  TRP B CB  1 
ATOM   7066 C CG  . TRP B 1 385 ? 16.290  0.029   -6.751  1.00 60.24  ? 385  TRP B CG  1 
ATOM   7067 C CD1 . TRP B 1 385 ? 16.463  0.961   -7.725  1.00 61.25  ? 385  TRP B CD1 1 
ATOM   7068 C CD2 . TRP B 1 385 ? 17.210  -1.028  -7.035  1.00 60.38  ? 385  TRP B CD2 1 
ATOM   7069 N NE1 . TRP B 1 385 ? 17.462  0.570   -8.581  1.00 61.58  ? 385  TRP B NE1 1 
ATOM   7070 C CE2 . TRP B 1 385 ? 17.936  -0.651  -8.179  1.00 60.79  ? 385  TRP B CE2 1 
ATOM   7071 C CE3 . TRP B 1 385 ? 17.499  -2.251  -6.425  1.00 61.04  ? 385  TRP B CE3 1 
ATOM   7072 C CZ2 . TRP B 1 385 ? 18.941  -1.451  -8.723  1.00 60.99  ? 385  TRP B CZ2 1 
ATOM   7073 C CZ3 . TRP B 1 385 ? 18.495  -3.048  -6.970  1.00 58.37  ? 385  TRP B CZ3 1 
ATOM   7074 C CH2 . TRP B 1 385 ? 19.200  -2.645  -8.108  1.00 63.28  ? 385  TRP B CH2 1 
ATOM   7075 N N   . LEU B 1 386 ? 11.981  -0.742  -4.984  1.00 70.97  ? 386  LEU B N   1 
ATOM   7076 C CA  . LEU B 1 386 ? 10.957  -1.182  -4.048  1.00 76.36  ? 386  LEU B CA  1 
ATOM   7077 C C   . LEU B 1 386 ? 10.451  -2.598  -4.335  1.00 74.57  ? 386  LEU B C   1 
ATOM   7078 O O   . LEU B 1 386 ? 9.890   -3.247  -3.449  1.00 72.26  ? 386  LEU B O   1 
ATOM   7079 C CB  . LEU B 1 386 ? 9.793   -0.201  -4.044  1.00 79.87  ? 386  LEU B CB  1 
ATOM   7080 C CG  . LEU B 1 386 ? 9.764   0.661   -2.790  1.00 84.96  ? 386  LEU B CG  1 
ATOM   7081 C CD1 . LEU B 1 386 ? 8.905   1.904   -3.000  1.00 87.27  ? 386  LEU B CD1 1 
ATOM   7082 C CD2 . LEU B 1 386 ? 9.257   -0.188  -1.625  1.00 83.33  ? 386  LEU B CD2 1 
ATOM   7083 N N   . HIS B 1 387 ? 10.639  -3.050  -5.579  1.00 77.71  ? 387  HIS B N   1 
ATOM   7084 C CA  . HIS B 1 387 ? 10.210  -4.377  -6.042  1.00 76.09  ? 387  HIS B CA  1 
ATOM   7085 C C   . HIS B 1 387 ? 11.182  -4.916  -7.089  1.00 73.03  ? 387  HIS B C   1 
ATOM   7086 O O   . HIS B 1 387 ? 10.787  -5.219  -8.215  1.00 77.01  ? 387  HIS B O   1 
ATOM   7087 C CB  . HIS B 1 387 ? 8.819   -4.311  -6.675  1.00 76.29  ? 387  HIS B CB  1 
ATOM   7088 C CG  . HIS B 1 387 ? 7.822   -3.534  -5.873  1.00 85.72  ? 387  HIS B CG  1 
ATOM   7089 N ND1 . HIS B 1 387 ? 7.487   -2.229  -6.166  1.00 83.51  ? 387  HIS B ND1 1 
ATOM   7090 C CD2 . HIS B 1 387 ? 7.086   -3.879  -4.790  1.00 85.93  ? 387  HIS B CD2 1 
ATOM   7091 C CE1 . HIS B 1 387 ? 6.589   -1.801  -5.297  1.00 82.17  ? 387  HIS B CE1 1 
ATOM   7092 N NE2 . HIS B 1 387 ? 6.328   -2.782  -4.451  1.00 93.37  ? 387  HIS B NE2 1 
ATOM   7093 N N   . PRO B 1 388 ? 12.457  -5.041  -6.718  1.00 65.48  ? 388  PRO B N   1 
ATOM   7094 C CA  . PRO B 1 388 ? 13.546  -5.351  -7.647  1.00 67.46  ? 388  PRO B CA  1 
ATOM   7095 C C   . PRO B 1 388 ? 13.394  -6.699  -8.321  1.00 68.31  ? 388  PRO B C   1 
ATOM   7096 O O   . PRO B 1 388 ? 14.135  -6.997  -9.261  1.00 65.84  ? 388  PRO B O   1 
ATOM   7097 C CB  . PRO B 1 388 ? 14.773  -5.390  -6.728  1.00 72.24  ? 388  PRO B CB  1 
ATOM   7098 C CG  . PRO B 1 388 ? 14.200  -5.688  -5.378  1.00 68.99  ? 388  PRO B CG  1 
ATOM   7099 C CD  . PRO B 1 388 ? 12.963  -4.862  -5.350  1.00 68.79  ? 388  PRO B CD  1 
ATOM   7100 N N   . GLU B 1 389 ? 12.467  -7.517  -7.841  1.00 76.34  ? 389  GLU B N   1 
ATOM   7101 C CA  . GLU B 1 389 ? 12.353  -8.873  -8.368  1.00 79.31  ? 389  GLU B CA  1 
ATOM   7102 C C   . GLU B 1 389 ? 10.940  -9.253  -8.769  1.00 69.56  ? 389  GLU B C   1 
ATOM   7103 O O   . GLU B 1 389 ? 10.682  -10.405 -9.100  1.00 66.41  ? 389  GLU B O   1 
ATOM   7104 C CB  . GLU B 1 389 ? 12.926  -9.897  -7.386  1.00 73.47  ? 389  GLU B CB  1 
ATOM   7105 C CG  . GLU B 1 389 ? 14.297  -9.512  -6.847  1.00 86.48  ? 389  GLU B CG  1 
ATOM   7106 C CD  . GLU B 1 389 ? 15.250  -10.692 -6.738  1.00 101.33 ? 389  GLU B CD  1 
ATOM   7107 O OE1 . GLU B 1 389 ? 15.555  -11.315 -7.780  1.00 101.12 ? 389  GLU B OE1 1 
ATOM   7108 O OE2 . GLU B 1 389 ? 15.708  -10.983 -5.611  1.00 114.74 ? 389  GLU B OE2 1 
ATOM   7109 N N   . ASP B 1 390 ? 10.029  -8.289  -8.753  1.00 65.30  ? 390  ASP B N   1 
ATOM   7110 C CA  . ASP B 1 390 ? 8.686   -8.552  -9.242  1.00 66.97  ? 390  ASP B CA  1 
ATOM   7111 C C   . ASP B 1 390 ? 8.660   -8.608  -10.767 1.00 70.79  ? 390  ASP B C   1 
ATOM   7112 O O   . ASP B 1 390 ? 8.951   -7.614  -11.432 1.00 72.88  ? 390  ASP B O   1 
ATOM   7113 C CB  . ASP B 1 390 ? 7.705   -7.503  -8.760  1.00 57.70  ? 390  ASP B CB  1 
ATOM   7114 C CG  . ASP B 1 390 ? 6.434   -7.514  -9.561  1.00 70.81  ? 390  ASP B CG  1 
ATOM   7115 O OD1 . ASP B 1 390 ? 5.986   -8.610  -9.968  1.00 77.33  ? 390  ASP B OD1 1 
ATOM   7116 O OD2 . ASP B 1 390 ? 5.882   -6.426  -9.800  1.00 80.59  ? 390  ASP B OD2 1 
ATOM   7117 N N   . PRO B 1 391 ? 8.295   -9.777  -11.318 1.00 70.93  ? 391  PRO B N   1 
ATOM   7118 C CA  . PRO B 1 391 ? 8.277   -10.115 -12.747 1.00 67.90  ? 391  PRO B CA  1 
ATOM   7119 C C   . PRO B 1 391 ? 7.336   -9.252  -13.588 1.00 62.52  ? 391  PRO B C   1 
ATOM   7120 O O   . PRO B 1 391 ? 7.593   -9.083  -14.773 1.00 63.11  ? 391  PRO B O   1 
ATOM   7121 C CB  . PRO B 1 391 ? 7.794   -11.574 -12.749 1.00 67.42  ? 391  PRO B CB  1 
ATOM   7122 C CG  . PRO B 1 391 ? 7.060   -11.713 -11.454 1.00 67.41  ? 391  PRO B CG  1 
ATOM   7123 C CD  . PRO B 1 391 ? 7.898   -10.935 -10.501 1.00 66.61  ? 391  PRO B CD  1 
ATOM   7124 N N   . THR B 1 392 ? 6.261   -8.729  -13.012 1.00 56.18  ? 392  THR B N   1 
ATOM   7125 C CA  . THR B 1 392 ? 5.437   -7.800  -13.770 1.00 64.53  ? 392  THR B CA  1 
ATOM   7126 C C   . THR B 1 392 ? 6.217   -6.518  -14.059 1.00 65.79  ? 392  THR B C   1 
ATOM   7127 O O   . THR B 1 392 ? 6.181   -6.009  -15.173 1.00 65.21  ? 392  THR B O   1 
ATOM   7128 C CB  . THR B 1 392 ? 4.121   -7.449  -13.060 1.00 65.63  ? 392  THR B CB  1 
ATOM   7129 O OG1 . THR B 1 392 ? 3.210   -8.544  -13.187 1.00 72.55  ? 392  THR B OG1 1 
ATOM   7130 C CG2 . THR B 1 392 ? 3.496   -6.226  -13.705 1.00 53.94  ? 392  THR B CG2 1 
ATOM   7131 N N   . HIS B 1 393 ? 6.921   -6.004  -13.053 1.00 65.88  ? 393  HIS B N   1 
ATOM   7132 C CA  . HIS B 1 393 ? 7.758   -4.820  -13.239 1.00 72.30  ? 393  HIS B CA  1 
ATOM   7133 C C   . HIS B 1 393 ? 8.906   -5.095  -14.181 1.00 65.08  ? 393  HIS B C   1 
ATOM   7134 O O   . HIS B 1 393 ? 9.207   -4.283  -15.048 1.00 60.01  ? 393  HIS B O   1 
ATOM   7135 C CB  . HIS B 1 393 ? 8.322   -4.323  -11.911 1.00 72.51  ? 393  HIS B CB  1 
ATOM   7136 C CG  . HIS B 1 393 ? 7.356   -3.502  -11.125 1.00 79.34  ? 393  HIS B CG  1 
ATOM   7137 N ND1 . HIS B 1 393 ? 6.654   -4.004  -10.051 1.00 83.31  ? 393  HIS B ND1 1 
ATOM   7138 C CD2 . HIS B 1 393 ? 6.957   -2.217  -11.268 1.00 91.81  ? 393  HIS B CD2 1 
ATOM   7139 C CE1 . HIS B 1 393 ? 5.871   -3.063  -9.559  1.00 84.24  ? 393  HIS B CE1 1 
ATOM   7140 N NE2 . HIS B 1 393 ? 6.036   -1.967  -10.279 1.00 99.04  ? 393  HIS B NE2 1 
ATOM   7141 N N   . LEU B 1 394 ? 9.552   -6.241  -13.992 1.00 60.38  ? 394  LEU B N   1 
ATOM   7142 C CA  . LEU B 1 394 ? 10.684  -6.618  -14.821 1.00 66.39  ? 394  LEU B CA  1 
ATOM   7143 C C   . LEU B 1 394 ? 10.298  -6.719  -16.298 1.00 61.17  ? 394  LEU B C   1 
ATOM   7144 O O   . LEU B 1 394 ? 11.023  -6.256  -17.170 1.00 54.99  ? 394  LEU B O   1 
ATOM   7145 C CB  . LEU B 1 394 ? 11.292  -7.917  -14.305 1.00 66.38  ? 394  LEU B CB  1 
ATOM   7146 C CG  . LEU B 1 394 ? 11.952  -7.685  -12.939 1.00 72.10  ? 394  LEU B CG  1 
ATOM   7147 C CD1 . LEU B 1 394 ? 12.224  -8.993  -12.206 1.00 65.95  ? 394  LEU B CD1 1 
ATOM   7148 C CD2 . LEU B 1 394 ? 13.232  -6.865  -13.103 1.00 60.10  ? 394  LEU B CD2 1 
ATOM   7149 N N   . ARG B 1 395 ? 9.141   -7.308  -16.563 1.00 60.76  ? 395  ARG B N   1 
ATOM   7150 C CA  . ARG B 1 395 ? 8.639   -7.438  -17.916 1.00 55.39  ? 395  ARG B CA  1 
ATOM   7151 C C   . ARG B 1 395 ? 8.381   -6.059  -18.515 1.00 62.05  ? 395  ARG B C   1 
ATOM   7152 O O   . ARG B 1 395 ? 8.892   -5.740  -19.586 1.00 60.83  ? 395  ARG B O   1 
ATOM   7153 C CB  . ARG B 1 395 ? 7.368   -8.287  -17.920 1.00 58.87  ? 395  ARG B CB  1 
ATOM   7154 C CG  . ARG B 1 395 ? 6.709   -8.420  -19.268 1.00 57.17  ? 395  ARG B CG  1 
ATOM   7155 C CD  . ARG B 1 395 ? 5.405   -7.677  -19.270 1.00 64.98  ? 395  ARG B CD  1 
ATOM   7156 N NE  . ARG B 1 395 ? 4.322   -8.496  -18.746 1.00 66.25  ? 395  ARG B NE  1 
ATOM   7157 C CZ  . ARG B 1 395 ? 3.246   -8.012  -18.138 1.00 62.91  ? 395  ARG B CZ  1 
ATOM   7158 N NH1 . ARG B 1 395 ? 3.115   -6.707  -17.957 1.00 67.04  ? 395  ARG B NH1 1 
ATOM   7159 N NH2 . ARG B 1 395 ? 2.305   -8.834  -17.694 1.00 70.05  ? 395  ARG B NH2 1 
ATOM   7160 N N   . ASP B 1 396 ? 7.596   -5.240  -17.823 1.00 55.11  ? 396  ASP B N   1 
ATOM   7161 C CA  . ASP B 1 396 ? 7.343   -3.878  -18.274 1.00 47.77  ? 396  ASP B CA  1 
ATOM   7162 C C   . ASP B 1 396 ? 8.639   -3.094  -18.474 1.00 53.34  ? 396  ASP B C   1 
ATOM   7163 O O   . ASP B 1 396 ? 8.790   -2.354  -19.444 1.00 56.79  ? 396  ASP B O   1 
ATOM   7164 C CB  . ASP B 1 396 ? 6.454   -3.141  -17.281 1.00 47.52  ? 396  ASP B CB  1 
ATOM   7165 C CG  . ASP B 1 396 ? 5.022   -3.649  -17.279 1.00 65.27  ? 396  ASP B CG  1 
ATOM   7166 O OD1 . ASP B 1 396 ? 4.574   -4.190  -18.315 1.00 69.01  ? 396  ASP B OD1 1 
ATOM   7167 O OD2 . ASP B 1 396 ? 4.339   -3.499  -16.238 1.00 69.29  ? 396  ASP B OD2 1 
ATOM   7168 N N   . ALA B 1 397 ? 9.576   -3.255  -17.552 1.00 52.43  ? 397  ALA B N   1 
ATOM   7169 C CA  . ALA B 1 397 ? 10.832  -2.525  -17.625 1.00 52.08  ? 397  ALA B CA  1 
ATOM   7170 C C   . ALA B 1 397 ? 11.581  -2.875  -18.902 1.00 56.63  ? 397  ALA B C   1 
ATOM   7171 O O   . ALA B 1 397 ? 12.127  -1.990  -19.567 1.00 55.50  ? 397  ALA B O   1 
ATOM   7172 C CB  . ALA B 1 397 ? 11.698  -2.813  -16.396 1.00 46.69  ? 397  ALA B CB  1 
ATOM   7173 N N   . MET B 1 398 ? 11.611  -4.166  -19.230 1.00 48.54  ? 398  MET B N   1 
ATOM   7174 C CA  . MET B 1 398 ? 12.281  -4.656  -20.430 1.00 49.50  ? 398  MET B CA  1 
ATOM   7175 C C   . MET B 1 398 ? 11.708  -3.996  -21.680 1.00 52.72  ? 398  MET B C   1 
ATOM   7176 O O   . MET B 1 398 ? 12.440  -3.637  -22.605 1.00 49.46  ? 398  MET B O   1 
ATOM   7177 C CB  . MET B 1 398 ? 12.115  -6.172  -20.540 1.00 58.69  ? 398  MET B CB  1 
ATOM   7178 C CG  . MET B 1 398 ? 12.874  -6.807  -21.694 1.00 54.10  ? 398  MET B CG  1 
ATOM   7179 S SD  . MET B 1 398 ? 14.669  -6.750  -21.478 1.00 72.20  ? 398  MET B SD  1 
ATOM   7180 C CE  . MET B 1 398 ? 15.153  -5.469  -22.641 1.00 57.42  ? 398  MET B CE  1 
ATOM   7181 N N   . SER B 1 399 ? 10.389  -3.845  -21.699 1.00 46.22  ? 399  SER B N   1 
ATOM   7182 C CA  . SER B 1 399 ? 9.720   -3.170  -22.786 1.00 46.93  ? 399  SER B CA  1 
ATOM   7183 C C   . SER B 1 399 ? 10.144  -1.693  -22.855 1.00 53.41  ? 399  SER B C   1 
ATOM   7184 O O   . SER B 1 399 ? 10.506  -1.188  -23.926 1.00 50.28  ? 399  SER B O   1 
ATOM   7185 C CB  . SER B 1 399 ? 8.214   -3.299  -22.609 1.00 47.39  ? 399  SER B CB  1 
ATOM   7186 O OG  . SER B 1 399 ? 7.521   -2.419  -23.470 1.00 55.62  ? 399  SER B OG  1 
ATOM   7187 N N   . ALA B 1 400 ? 10.117  -1.011  -21.710 1.00 46.37  ? 400  ALA B N   1 
ATOM   7188 C CA  . ALA B 1 400 ? 10.519  0.399   -21.649 1.00 51.96  ? 400  ALA B CA  1 
ATOM   7189 C C   . ALA B 1 400 ? 11.960  0.624   -22.094 1.00 49.86  ? 400  ALA B C   1 
ATOM   7190 O O   . ALA B 1 400 ? 12.239  1.574   -22.827 1.00 48.99  ? 400  ALA B O   1 
ATOM   7191 C CB  . ALA B 1 400 ? 10.301  0.978   -20.262 1.00 43.89  ? 400  ALA B CB  1 
ATOM   7192 N N   . VAL B 1 401 ? 12.879  -0.237  -21.662 1.00 46.12  ? 401  VAL B N   1 
ATOM   7193 C CA  . VAL B 1 401 ? 14.256  -0.111  -22.132 1.00 48.67  ? 401  VAL B CA  1 
ATOM   7194 C C   . VAL B 1 401 ? 14.251  -0.060  -23.655 1.00 45.85  ? 401  VAL B C   1 
ATOM   7195 O O   . VAL B 1 401 ? 14.827  0.848   -24.261 1.00 45.67  ? 401  VAL B O   1 
ATOM   7196 C CB  . VAL B 1 401 ? 15.172  -1.265  -21.658 1.00 50.63  ? 401  VAL B CB  1 
ATOM   7197 C CG1 . VAL B 1 401 ? 16.473  -1.269  -22.451 1.00 40.68  ? 401  VAL B CG1 1 
ATOM   7198 C CG2 . VAL B 1 401 ? 15.454  -1.156  -20.168 1.00 42.28  ? 401  VAL B CG2 1 
ATOM   7199 N N   . VAL B 1 402 ? 13.562  -1.019  -24.266 1.00 47.40  ? 402  VAL B N   1 
ATOM   7200 C CA  . VAL B 1 402 ? 13.572  -1.145  -25.720 1.00 50.59  ? 402  VAL B CA  1 
ATOM   7201 C C   . VAL B 1 402 ? 12.917  0.055   -26.399 1.00 48.02  ? 402  VAL B C   1 
ATOM   7202 O O   . VAL B 1 402 ? 13.484  0.626   -27.322 1.00 47.25  ? 402  VAL B O   1 
ATOM   7203 C CB  . VAL B 1 402 ? 12.939  -2.484  -26.196 1.00 52.53  ? 402  VAL B CB  1 
ATOM   7204 C CG1 . VAL B 1 402 ? 12.761  -2.496  -27.697 1.00 48.07  ? 402  VAL B CG1 1 
ATOM   7205 C CG2 . VAL B 1 402 ? 13.809  -3.645  -25.786 1.00 45.51  ? 402  VAL B CG2 1 
ATOM   7206 N N   . GLY B 1 403 ? 11.737  0.443   -25.926 1.00 47.39  ? 403  GLY B N   1 
ATOM   7207 C CA  . GLY B 1 403 ? 11.034  1.587   -26.479 1.00 46.81  ? 403  GLY B CA  1 
ATOM   7208 C C   . GLY B 1 403 ? 11.784  2.900   -26.318 1.00 54.52  ? 403  GLY B C   1 
ATOM   7209 O O   . GLY B 1 403 ? 11.823  3.738   -27.234 1.00 51.33  ? 403  GLY B O   1 
ATOM   7210 N N   . ASP B 1 404 ? 12.396  3.070   -25.150 1.00 46.56  ? 404  ASP B N   1 
ATOM   7211 C CA  . ASP B 1 404 ? 13.058  4.312   -24.800 1.00 41.99  ? 404  ASP B CA  1 
ATOM   7212 C C   . ASP B 1 404 ? 14.362  4.474   -25.552 1.00 47.42  ? 404  ASP B C   1 
ATOM   7213 O O   . ASP B 1 404 ? 14.653  5.535   -26.111 1.00 47.36  ? 404  ASP B O   1 
ATOM   7214 C CB  . ASP B 1 404 ? 13.298  4.356   -23.294 1.00 46.59  ? 404  ASP B CB  1 
ATOM   7215 C CG  . ASP B 1 404 ? 12.014  4.508   -22.517 1.00 50.51  ? 404  ASP B CG  1 
ATOM   7216 O OD1 . ASP B 1 404 ? 10.967  4.722   -23.165 1.00 59.33  ? 404  ASP B OD1 1 
ATOM   7217 O OD2 . ASP B 1 404 ? 12.035  4.413   -21.269 1.00 50.08  ? 404  ASP B OD2 1 
ATOM   7218 N N   . HIS B 1 405 ? 15.140  3.403   -25.575 1.00 44.29  ? 405  HIS B N   1 
ATOM   7219 C CA  . HIS B 1 405 ? 16.424  3.423   -26.242 1.00 48.08  ? 405  HIS B CA  1 
ATOM   7220 C C   . HIS B 1 405 ? 16.249  3.693   -27.748 1.00 54.05  ? 405  HIS B C   1 
ATOM   7221 O O   . HIS B 1 405 ? 17.062  4.383   -28.374 1.00 52.17  ? 405  HIS B O   1 
ATOM   7222 C CB  . HIS B 1 405 ? 17.148  2.094   -25.989 1.00 42.11  ? 405  HIS B CB  1 
ATOM   7223 C CG  . HIS B 1 405 ? 18.413  1.923   -26.775 1.00 48.70  ? 405  HIS B CG  1 
ATOM   7224 N ND1 . HIS B 1 405 ? 19.395  2.891   -26.834 1.00 46.22  ? 405  HIS B ND1 1 
ATOM   7225 C CD2 . HIS B 1 405 ? 18.868  0.882   -27.515 1.00 53.06  ? 405  HIS B CD2 1 
ATOM   7226 C CE1 . HIS B 1 405 ? 20.395  2.459   -27.585 1.00 43.84  ? 405  HIS B CE1 1 
ATOM   7227 N NE2 . HIS B 1 405 ? 20.100  1.243   -28.011 1.00 54.58  ? 405  HIS B NE2 1 
ATOM   7228 N N   . ASN B 1 406 ? 15.167  3.175   -28.315 1.00 47.91  ? 406  ASN B N   1 
ATOM   7229 C CA  . ASN B 1 406 ? 15.055  3.086   -29.766 1.00 51.51  ? 406  ASN B CA  1 
ATOM   7230 C C   . ASN B 1 406 ? 14.115  4.092   -30.379 1.00 49.64  ? 406  ASN B C   1 
ATOM   7231 O O   . ASN B 1 406 ? 14.283  4.461   -31.537 1.00 45.59  ? 406  ASN B O   1 
ATOM   7232 C CB  . ASN B 1 406 ? 14.665  1.663   -30.192 1.00 43.70  ? 406  ASN B CB  1 
ATOM   7233 C CG  . ASN B 1 406 ? 15.776  0.682   -29.952 1.00 46.06  ? 406  ASN B CG  1 
ATOM   7234 O OD1 . ASN B 1 406 ? 16.849  0.805   -30.541 1.00 48.26  ? 406  ASN B OD1 1 
ATOM   7235 N ND2 . ASN B 1 406 ? 15.551  -0.276  -29.051 1.00 49.22  ? 406  ASN B ND2 1 
ATOM   7236 N N   . VAL B 1 407 ? 13.129  4.537   -29.608 1.00 44.66  ? 407  VAL B N   1 
ATOM   7237 C CA  . VAL B 1 407 ? 12.129  5.435   -30.159 1.00 42.93  ? 407  VAL B CA  1 
ATOM   7238 C C   . VAL B 1 407 ? 11.935  6.705   -29.322 1.00 45.49  ? 407  VAL B C   1 
ATOM   7239 O O   . VAL B 1 407 ? 12.270  7.799   -29.768 1.00 44.61  ? 407  VAL B O   1 
ATOM   7240 C CB  . VAL B 1 407 ? 10.791  4.689   -30.394 1.00 46.68  ? 407  VAL B CB  1 
ATOM   7241 C CG1 . VAL B 1 407 ? 9.773   5.589   -31.045 1.00 45.24  ? 407  VAL B CG1 1 
ATOM   7242 C CG2 . VAL B 1 407 ? 11.023  3.472   -31.258 1.00 45.97  ? 407  VAL B CG2 1 
ATOM   7243 N N   . VAL B 1 408 ? 11.426  6.561   -28.103 1.00 41.02  ? 408  VAL B N   1 
ATOM   7244 C CA  . VAL B 1 408 ? 11.056  7.721   -27.303 1.00 43.56  ? 408  VAL B CA  1 
ATOM   7245 C C   . VAL B 1 408 ? 12.198  8.731   -27.096 1.00 50.19  ? 408  VAL B C   1 
ATOM   7246 O O   . VAL B 1 408 ? 12.034  9.933   -27.297 1.00 45.70  ? 408  VAL B O   1 
ATOM   7247 C CB  . VAL B 1 408 ? 10.487  7.316   -25.926 1.00 47.47  ? 408  VAL B CB  1 
ATOM   7248 C CG1 . VAL B 1 408 ? 10.000  8.553   -25.191 1.00 52.15  ? 408  VAL B CG1 1 
ATOM   7249 C CG2 . VAL B 1 408 ? 9.349   6.325   -26.080 1.00 37.29  ? 408  VAL B CG2 1 
ATOM   7250 N N   . CYS B 1 409 ? 13.359  8.254   -26.689 1.00 46.91  ? 409  CYS B N   1 
ATOM   7251 C CA  . CYS B 1 409 ? 14.437  9.182   -26.399 1.00 43.60  ? 409  CYS B CA  1 
ATOM   7252 C C   . CYS B 1 409 ? 15.033  9.828   -27.653 1.00 50.35  ? 409  CYS B C   1 
ATOM   7253 O O   . CYS B 1 409 ? 15.296  11.037  -27.668 1.00 49.89  ? 409  CYS B O   1 
ATOM   7254 C CB  . CYS B 1 409 ? 15.470  8.531   -25.481 1.00 43.95  ? 409  CYS B CB  1 
ATOM   7255 S SG  . CYS B 1 409 ? 14.721  8.190   -23.838 1.00 55.24  ? 409  CYS B SG  1 
ATOM   7256 N N   . PRO B 1 410 ? 15.234  9.034   -28.714 1.00 48.20  ? 410  PRO B N   1 
ATOM   7257 C CA  . PRO B 1 410 ? 15.568  9.598   -30.026 1.00 46.75  ? 410  PRO B CA  1 
ATOM   7258 C C   . PRO B 1 410 ? 14.559  10.663  -30.494 1.00 50.49  ? 410  PRO B C   1 
ATOM   7259 O O   . PRO B 1 410 ? 14.944  11.673  -31.082 1.00 47.63  ? 410  PRO B O   1 
ATOM   7260 C CB  . PRO B 1 410 ? 15.505  8.377   -30.942 1.00 40.18  ? 410  PRO B CB  1 
ATOM   7261 C CG  . PRO B 1 410 ? 15.888  7.251   -30.082 1.00 44.96  ? 410  PRO B CG  1 
ATOM   7262 C CD  . PRO B 1 410 ? 15.385  7.569   -28.690 1.00 48.07  ? 410  PRO B CD  1 
ATOM   7263 N N   . VAL B 1 411 ? 13.279  10.431  -30.238 1.00 42.95  ? 411  VAL B N   1 
ATOM   7264 C CA  . VAL B 1 411 ? 12.248  11.396  -30.595 1.00 43.42  ? 411  VAL B CA  1 
ATOM   7265 C C   . VAL B 1 411 ? 12.339  12.650  -29.714 1.00 48.00  ? 411  VAL B C   1 
ATOM   7266 O O   . VAL B 1 411 ? 12.259  13.769  -30.214 1.00 48.47  ? 411  VAL B O   1 
ATOM   7267 C CB  . VAL B 1 411 ? 10.822  10.770  -30.500 1.00 42.72  ? 411  VAL B CB  1 
ATOM   7268 C CG1 . VAL B 1 411 ? 9.762   11.829  -30.484 1.00 42.38  ? 411  VAL B CG1 1 
ATOM   7269 C CG2 . VAL B 1 411 ? 10.575  9.829   -31.646 1.00 41.80  ? 411  VAL B CG2 1 
ATOM   7270 N N   . ALA B 1 412 ? 12.506  12.467  -28.408 1.00 42.38  ? 412  ALA B N   1 
ATOM   7271 C CA  . ALA B 1 412 ? 12.615  13.603  -27.496 1.00 46.62  ? 412  ALA B CA  1 
ATOM   7272 C C   . ALA B 1 412 ? 13.802  14.456  -27.913 1.00 48.52  ? 412  ALA B C   1 
ATOM   7273 O O   . ALA B 1 412 ? 13.727  15.684  -27.983 1.00 46.77  ? 412  ALA B O   1 
ATOM   7274 C CB  . ALA B 1 412 ? 12.777  13.126  -26.056 1.00 44.18  ? 412  ALA B CB  1 
ATOM   7275 N N   . GLN B 1 413 ? 14.895  13.768  -28.198 1.00 42.22  ? 413  GLN B N   1 
ATOM   7276 C CA  . GLN B 1 413 ? 16.107  14.372  -28.699 1.00 44.12  ? 413  GLN B CA  1 
ATOM   7277 C C   . GLN B 1 413 ? 15.893  15.209  -29.968 1.00 51.49  ? 413  GLN B C   1 
ATOM   7278 O O   . GLN B 1 413 ? 16.288  16.378  -30.049 1.00 50.47  ? 413  GLN B O   1 
ATOM   7279 C CB  . GLN B 1 413 ? 17.078  13.252  -28.996 1.00 49.14  ? 413  GLN B CB  1 
ATOM   7280 C CG  . GLN B 1 413 ? 18.170  13.648  -29.923 1.00 61.46  ? 413  GLN B CG  1 
ATOM   7281 C CD  . GLN B 1 413 ? 19.438  13.897  -29.184 1.00 74.79  ? 413  GLN B CD  1 
ATOM   7282 O OE1 . GLN B 1 413 ? 19.535  14.835  -28.383 1.00 76.10  ? 413  GLN B OE1 1 
ATOM   7283 N NE2 . GLN B 1 413 ? 20.435  13.048  -29.432 1.00 73.54  ? 413  GLN B NE2 1 
ATOM   7284 N N   . LEU B 1 414 ? 15.275  14.599  -30.969 1.00 48.25  ? 414  LEU B N   1 
ATOM   7285 C CA  . LEU B 1 414 ? 15.006  15.287  -32.215 1.00 44.42  ? 414  LEU B CA  1 
ATOM   7286 C C   . LEU B 1 414 ? 14.095  16.503  -32.011 1.00 48.02  ? 414  LEU B C   1 
ATOM   7287 O O   . LEU B 1 414 ? 14.327  17.569  -32.588 1.00 47.61  ? 414  LEU B O   1 
ATOM   7288 C CB  . LEU B 1 414 ? 14.367  14.319  -33.201 1.00 44.60  ? 414  LEU B CB  1 
ATOM   7289 C CG  . LEU B 1 414 ? 14.084  14.905  -34.576 1.00 45.46  ? 414  LEU B CG  1 
ATOM   7290 C CD1 . LEU B 1 414 ? 15.403  15.256  -35.256 1.00 48.73  ? 414  LEU B CD1 1 
ATOM   7291 C CD2 . LEU B 1 414 ? 13.290  13.920  -35.396 1.00 43.43  ? 414  LEU B CD2 1 
ATOM   7292 N N   . ALA B 1 415 ? 13.052  16.332  -31.202 1.00 42.80  ? 415  ALA B N   1 
ATOM   7293 C CA  . ALA B 1 415 ? 12.069  17.384  -30.980 1.00 41.26  ? 415  ALA B CA  1 
ATOM   7294 C C   . ALA B 1 415 ? 12.759  18.634  -30.442 1.00 57.42  ? 415  ALA B C   1 
ATOM   7295 O O   . ALA B 1 415 ? 12.556  19.753  -30.938 1.00 52.31  ? 415  ALA B O   1 
ATOM   7296 C CB  . ALA B 1 415 ? 11.043  16.921  -30.014 1.00 43.19  ? 415  ALA B CB  1 
ATOM   7297 N N   . GLY B 1 416 ? 13.581  18.420  -29.421 1.00 51.33  ? 416  GLY B N   1 
ATOM   7298 C CA  . GLY B 1 416 ? 14.370  19.477  -28.830 1.00 54.27  ? 416  GLY B CA  1 
ATOM   7299 C C   . GLY B 1 416 ? 15.280  20.183  -29.818 1.00 56.03  ? 416  GLY B C   1 
ATOM   7300 O O   . GLY B 1 416 ? 15.328  21.414  -29.839 1.00 56.10  ? 416  GLY B O   1 
ATOM   7301 N N   . ARG B 1 417 ? 16.002  19.421  -30.635 1.00 51.49  ? 417  ARG B N   1 
ATOM   7302 C CA  . ARG B 1 417 ? 16.921  20.032  -31.596 1.00 51.99  ? 417  ARG B CA  1 
ATOM   7303 C C   . ARG B 1 417 ? 16.189  20.844  -32.655 1.00 54.42  ? 417  ARG B C   1 
ATOM   7304 O O   . ARG B 1 417 ? 16.653  21.909  -33.054 1.00 59.04  ? 417  ARG B O   1 
ATOM   7305 C CB  . ARG B 1 417 ? 17.810  18.988  -32.270 1.00 58.08  ? 417  ARG B CB  1 
ATOM   7306 C CG  . ARG B 1 417 ? 18.614  18.148  -31.318 1.00 54.21  ? 417  ARG B CG  1 
ATOM   7307 C CD  . ARG B 1 417 ? 19.372  18.997  -30.331 1.00 64.43  ? 417  ARG B CD  1 
ATOM   7308 N NE  . ARG B 1 417 ? 20.255  19.943  -31.006 1.00 86.30  ? 417  ARG B NE  1 
ATOM   7309 C CZ  . ARG B 1 417 ? 21.422  20.368  -30.519 1.00 92.69  ? 417  ARG B CZ  1 
ATOM   7310 N NH1 . ARG B 1 417 ? 21.868  19.921  -29.344 1.00 82.59  ? 417  ARG B NH1 1 
ATOM   7311 N NH2 . ARG B 1 417 ? 22.155  21.231  -31.220 1.00 81.25  ? 417  ARG B NH2 1 
ATOM   7312 N N   . LEU B 1 418 ? 15.046  20.350  -33.120 1.00 52.95  ? 418  LEU B N   1 
ATOM   7313 C CA  . LEU B 1 418 ? 14.325  21.075  -34.157 1.00 50.19  ? 418  LEU B CA  1 
ATOM   7314 C C   . LEU B 1 418 ? 13.714  22.349  -33.570 1.00 54.41  ? 418  LEU B C   1 
ATOM   7315 O O   . LEU B 1 418 ? 13.737  23.409  -34.196 1.00 54.05  ? 418  LEU B O   1 
ATOM   7316 C CB  . LEU B 1 418 ? 13.257  20.201  -34.816 1.00 48.79  ? 418  LEU B CB  1 
ATOM   7317 C CG  . LEU B 1 418 ? 13.701  18.920  -35.535 1.00 56.64  ? 418  LEU B CG  1 
ATOM   7318 C CD1 . LEU B 1 418 ? 12.518  18.038  -35.776 1.00 52.99  ? 418  LEU B CD1 1 
ATOM   7319 C CD2 . LEU B 1 418 ? 14.375  19.214  -36.847 1.00 49.36  ? 418  LEU B CD2 1 
ATOM   7320 N N   . ALA B 1 419 ? 13.180  22.246  -32.359 1.00 51.25  ? 419  ALA B N   1 
ATOM   7321 C CA  . ALA B 1 419 ? 12.558  23.395  -31.719 1.00 51.00  ? 419  ALA B CA  1 
ATOM   7322 C C   . ALA B 1 419 ? 13.609  24.470  -31.480 1.00 55.21  ? 419  ALA B C   1 
ATOM   7323 O O   . ALA B 1 419 ? 13.458  25.621  -31.896 1.00 56.27  ? 419  ALA B O   1 
ATOM   7324 C CB  . ALA B 1 419 ? 11.917  22.984  -30.419 1.00 41.28  ? 419  ALA B CB  1 
ATOM   7325 N N   . ALA B 1 420 ? 14.681  24.063  -30.813 1.00 60.20  ? 420  ALA B N   1 
ATOM   7326 C CA  . ALA B 1 420 ? 15.834  24.909  -30.559 1.00 55.00  ? 420  ALA B CA  1 
ATOM   7327 C C   . ALA B 1 420 ? 16.317  25.619  -31.820 1.00 66.34  ? 420  ALA B C   1 
ATOM   7328 O O   . ALA B 1 420 ? 16.685  26.789  -31.766 1.00 70.94  ? 420  ALA B O   1 
ATOM   7329 C CB  . ALA B 1 420 ? 16.955  24.080  -29.978 1.00 46.21  ? 420  ALA B CB  1 
ATOM   7330 N N   . GLN B 1 421 ? 16.318  24.924  -32.952 1.00 55.01  ? 421  GLN B N   1 
ATOM   7331 C CA  . GLN B 1 421 ? 16.859  25.510  -34.165 1.00 53.01  ? 421  GLN B CA  1 
ATOM   7332 C C   . GLN B 1 421 ? 15.834  26.039  -35.167 1.00 60.94  ? 421  GLN B C   1 
ATOM   7333 O O   . GLN B 1 421 ? 16.050  25.982  -36.378 1.00 61.23  ? 421  GLN B O   1 
ATOM   7334 C CB  . GLN B 1 421 ? 17.839  24.548  -34.819 1.00 61.98  ? 421  GLN B CB  1 
ATOM   7335 C CG  . GLN B 1 421 ? 19.123  24.439  -34.026 1.00 63.85  ? 421  GLN B CG  1 
ATOM   7336 C CD  . GLN B 1 421 ? 19.656  23.040  -34.024 1.00 75.29  ? 421  GLN B CD  1 
ATOM   7337 O OE1 . GLN B 1 421 ? 20.082  22.516  -32.988 1.00 76.89  ? 421  GLN B OE1 1 
ATOM   7338 N NE2 . GLN B 1 421 ? 19.613  22.402  -35.185 1.00 79.28  ? 421  GLN B NE2 1 
ATOM   7339 N N   . GLY B 1 422 ? 14.730  26.573  -34.653 1.00 58.60  ? 422  GLY B N   1 
ATOM   7340 C CA  . GLY B 1 422 ? 13.819  27.353  -35.469 1.00 57.61  ? 422  GLY B CA  1 
ATOM   7341 C C   . GLY B 1 422 ? 12.539  26.667  -35.895 1.00 64.86  ? 422  GLY B C   1 
ATOM   7342 O O   . GLY B 1 422 ? 11.570  27.336  -36.253 1.00 66.65  ? 422  GLY B O   1 
ATOM   7343 N N   . ALA B 1 423 ? 12.523  25.338  -35.866 1.00 62.22  ? 423  ALA B N   1 
ATOM   7344 C CA  . ALA B 1 423 ? 11.353  24.599  -36.328 1.00 60.15  ? 423  ALA B CA  1 
ATOM   7345 C C   . ALA B 1 423 ? 10.144  24.778  -35.413 1.00 57.95  ? 423  ALA B C   1 
ATOM   7346 O O   . ALA B 1 423 ? 10.280  24.970  -34.208 1.00 64.32  ? 423  ALA B O   1 
ATOM   7347 C CB  . ALA B 1 423 ? 11.680  23.129  -36.489 1.00 54.82  ? 423  ALA B CB  1 
ATOM   7348 N N   . ARG B 1 424 ? 8.961   24.722  -36.003 1.00 47.09  ? 424  ARG B N   1 
ATOM   7349 C CA  . ARG B 1 424 ? 7.729   24.683  -35.245 1.00 53.06  ? 424  ARG B CA  1 
ATOM   7350 C C   . ARG B 1 424 ? 7.381   23.217  -35.015 1.00 55.08  ? 424  ARG B C   1 
ATOM   7351 O O   . ARG B 1 424 ? 7.164   22.471  -35.965 1.00 49.90  ? 424  ARG B O   1 
ATOM   7352 C CB  . ARG B 1 424 ? 6.631   25.370  -36.041 1.00 54.82  ? 424  ARG B CB  1 
ATOM   7353 C CG  . ARG B 1 424 ? 5.256   25.284  -35.440 1.00 62.87  ? 424  ARG B CG  1 
ATOM   7354 C CD  . ARG B 1 424 ? 4.285   26.188  -36.211 1.00 69.37  ? 424  ARG B CD  1 
ATOM   7355 N NE  . ARG B 1 424 ? 3.476   26.954  -35.274 1.00 77.81  ? 424  ARG B NE  1 
ATOM   7356 C CZ  . ARG B 1 424 ? 3.990   27.704  -34.303 1.00 73.17  ? 424  ARG B CZ  1 
ATOM   7357 N NH1 . ARG B 1 424 ? 5.308   27.790  -34.144 1.00 70.04  ? 424  ARG B NH1 1 
ATOM   7358 N NH2 . ARG B 1 424 ? 3.187   28.358  -33.483 1.00 80.23  ? 424  ARG B NH2 1 
ATOM   7359 N N   . VAL B 1 425 ? 7.340   22.801  -33.755 1.00 50.77  ? 425  VAL B N   1 
ATOM   7360 C CA  . VAL B 1 425 ? 7.206   21.388  -33.433 1.00 46.67  ? 425  VAL B CA  1 
ATOM   7361 C C   . VAL B 1 425 ? 5.964   21.102  -32.602 1.00 47.92  ? 425  VAL B C   1 
ATOM   7362 O O   . VAL B 1 425 ? 5.667   21.816  -31.647 1.00 49.81  ? 425  VAL B O   1 
ATOM   7363 C CB  . VAL B 1 425 ? 8.448   20.882  -32.672 1.00 46.07  ? 425  VAL B CB  1 
ATOM   7364 C CG1 . VAL B 1 425 ? 8.409   19.369  -32.523 1.00 46.79  ? 425  VAL B CG1 1 
ATOM   7365 C CG2 . VAL B 1 425 ? 9.708   21.314  -33.390 1.00 41.33  ? 425  VAL B CG2 1 
ATOM   7366 N N   . TYR B 1 426 ? 5.233   20.059  -32.980 1.00 47.56  ? 426  TYR B N   1 
ATOM   7367 C CA  . TYR B 1 426 ? 4.097   19.583  -32.193 1.00 47.44  ? 426  TYR B CA  1 
ATOM   7368 C C   . TYR B 1 426 ? 4.343   18.132  -31.824 1.00 50.33  ? 426  TYR B C   1 
ATOM   7369 O O   . TYR B 1 426 ? 4.831   17.344  -32.643 1.00 48.23  ? 426  TYR B O   1 
ATOM   7370 C CB  . TYR B 1 426 ? 2.786   19.719  -32.968 1.00 43.62  ? 426  TYR B CB  1 
ATOM   7371 C CG  . TYR B 1 426 ? 2.364   21.147  -33.191 1.00 42.78  ? 426  TYR B CG  1 
ATOM   7372 C CD1 . TYR B 1 426 ? 2.737   21.836  -34.341 1.00 46.75  ? 426  TYR B CD1 1 
ATOM   7373 C CD2 . TYR B 1 426 ? 1.594   21.812  -32.251 1.00 43.87  ? 426  TYR B CD2 1 
ATOM   7374 C CE1 . TYR B 1 426 ? 2.346   23.150  -34.544 1.00 47.42  ? 426  TYR B CE1 1 
ATOM   7375 C CE2 . TYR B 1 426 ? 1.203   23.122  -32.440 1.00 47.56  ? 426  TYR B CE2 1 
ATOM   7376 C CZ  . TYR B 1 426 ? 1.577   23.786  -33.587 1.00 51.93  ? 426  TYR B CZ  1 
ATOM   7377 O OH  . TYR B 1 426 ? 1.179   25.088  -33.766 1.00 57.90  ? 426  TYR B OH  1 
ATOM   7378 N N   . ALA B 1 427 ? 4.005   17.777  -30.593 1.00 43.79  ? 427  ALA B N   1 
ATOM   7379 C CA  . ALA B 1 427 ? 4.395   16.486  -30.067 1.00 40.12  ? 427  ALA B CA  1 
ATOM   7380 C C   . ALA B 1 427 ? 3.227   15.819  -29.401 1.00 48.14  ? 427  ALA B C   1 
ATOM   7381 O O   . ALA B 1 427 ? 2.388   16.489  -28.792 1.00 49.24  ? 427  ALA B O   1 
ATOM   7382 C CB  . ALA B 1 427 ? 5.513   16.655  -29.076 1.00 39.37  ? 427  ALA B CB  1 
ATOM   7383 N N   . TYR B 1 428 ? 3.185   14.494  -29.488 1.00 41.16  ? 428  TYR B N   1 
ATOM   7384 C CA  . TYR B 1 428 ? 2.097   13.742  -28.876 1.00 41.73  ? 428  TYR B CA  1 
ATOM   7385 C C   . TYR B 1 428 ? 2.582   12.416  -28.355 1.00 42.77  ? 428  TYR B C   1 
ATOM   7386 O O   . TYR B 1 428 ? 3.667   11.947  -28.688 1.00 41.50  ? 428  TYR B O   1 
ATOM   7387 C CB  . TYR B 1 428 ? 0.975   13.467  -29.888 1.00 41.08  ? 428  TYR B CB  1 
ATOM   7388 C CG  . TYR B 1 428 ? 1.417   12.515  -30.970 1.00 45.75  ? 428  TYR B CG  1 
ATOM   7389 C CD1 . TYR B 1 428 ? 1.490   11.140  -30.732 1.00 44.78  ? 428  TYR B CD1 1 
ATOM   7390 C CD2 . TYR B 1 428 ? 1.810   12.991  -32.221 1.00 43.52  ? 428  TYR B CD2 1 
ATOM   7391 C CE1 . TYR B 1 428 ? 1.929   10.258  -31.723 1.00 42.11  ? 428  TYR B CE1 1 
ATOM   7392 C CE2 . TYR B 1 428 ? 2.241   12.126  -33.216 1.00 42.20  ? 428  TYR B CE2 1 
ATOM   7393 C CZ  . TYR B 1 428 ? 2.298   10.760  -32.962 1.00 44.58  ? 428  TYR B CZ  1 
ATOM   7394 O OH  . TYR B 1 428 ? 2.731   9.909   -33.951 1.00 47.36  ? 428  TYR B OH  1 
ATOM   7395 N N   . ILE B 1 429 ? 1.743   11.806  -27.537 1.00 48.49  ? 429  ILE B N   1 
ATOM   7396 C CA  . ILE B 1 429 ? 1.881   10.408  -27.217 1.00 44.20  ? 429  ILE B CA  1 
ATOM   7397 C C   . ILE B 1 429 ? 0.511   9.775   -27.399 1.00 50.91  ? 429  ILE B C   1 
ATOM   7398 O O   . ILE B 1 429 ? -0.506  10.342  -26.988 1.00 51.15  ? 429  ILE B O   1 
ATOM   7399 C CB  . ILE B 1 429 ? 2.390   10.213  -25.803 1.00 48.26  ? 429  ILE B CB  1 
ATOM   7400 C CG1 . ILE B 1 429 ? 2.356   8.735   -25.443 1.00 46.59  ? 429  ILE B CG1 1 
ATOM   7401 C CG2 . ILE B 1 429 ? 1.556   11.020  -24.822 1.00 56.07  ? 429  ILE B CG2 1 
ATOM   7402 C CD1 . ILE B 1 429 ? 3.011   8.463   -24.120 1.00 54.11  ? 429  ILE B CD1 1 
ATOM   7403 N N   . PHE B 1 430 ? 0.493   8.616   -28.047 1.00 49.40  ? 430  PHE B N   1 
ATOM   7404 C CA  . PHE B 1 430 ? -0.738  7.908   -28.362 1.00 46.02  ? 430  PHE B CA  1 
ATOM   7405 C C   . PHE B 1 430 ? -0.964  6.814   -27.329 1.00 46.70  ? 430  PHE B C   1 
ATOM   7406 O O   . PHE B 1 430 ? -0.168  5.887   -27.214 1.00 51.00  ? 430  PHE B O   1 
ATOM   7407 C CB  . PHE B 1 430 ? -0.619  7.294   -29.754 1.00 47.04  ? 430  PHE B CB  1 
ATOM   7408 C CG  . PHE B 1 430 ? -1.918  6.801   -30.322 1.00 50.76  ? 430  PHE B CG  1 
ATOM   7409 C CD1 . PHE B 1 430 ? -2.279  5.469   -30.208 1.00 57.27  ? 430  PHE B CD1 1 
ATOM   7410 C CD2 . PHE B 1 430 ? -2.767  7.663   -30.995 1.00 53.06  ? 430  PHE B CD2 1 
ATOM   7411 C CE1 . PHE B 1 430 ? -3.473  5.000   -30.750 1.00 53.34  ? 430  PHE B CE1 1 
ATOM   7412 C CE2 . PHE B 1 430 ? -3.965  7.205   -31.533 1.00 64.52  ? 430  PHE B CE2 1 
ATOM   7413 C CZ  . PHE B 1 430 ? -4.315  5.864   -31.411 1.00 56.84  ? 430  PHE B CZ  1 
ATOM   7414 N N   . GLU B 1 431 ? -2.054  6.914   -26.581 1.00 57.72  ? 431  GLU B N   1 
ATOM   7415 C CA  . GLU B 1 431 ? -2.256  6.032   -25.431 1.00 62.77  ? 431  GLU B CA  1 
ATOM   7416 C C   . GLU B 1 431 ? -3.490  5.144   -25.523 1.00 54.41  ? 431  GLU B C   1 
ATOM   7417 O O   . GLU B 1 431 ? -3.831  4.452   -24.571 1.00 58.62  ? 431  GLU B O   1 
ATOM   7418 C CB  . GLU B 1 431 ? -2.336  6.854   -24.146 1.00 51.10  ? 431  GLU B CB  1 
ATOM   7419 C CG  . GLU B 1 431 ? -1.076  7.592   -23.818 1.00 55.06  ? 431  GLU B CG  1 
ATOM   7420 C CD  . GLU B 1 431 ? -1.167  8.332   -22.493 1.00 69.61  ? 431  GLU B CD  1 
ATOM   7421 O OE1 . GLU B 1 431 ? -2.244  8.916   -22.208 1.00 60.95  ? 431  GLU B OE1 1 
ATOM   7422 O OE2 . GLU B 1 431 ? -0.158  8.325   -21.743 1.00 67.29  ? 431  GLU B OE2 1 
ATOM   7423 N N   . HIS B 1 432 ? -4.170  5.165   -26.657 1.00 56.55  ? 432  HIS B N   1 
ATOM   7424 C CA  . HIS B 1 432 ? -5.356  4.340   -26.794 1.00 60.80  ? 432  HIS B CA  1 
ATOM   7425 C C   . HIS B 1 432 ? -5.102  2.991   -27.460 1.00 56.61  ? 432  HIS B C   1 
ATOM   7426 O O   . HIS B 1 432 ? -4.716  2.936   -28.626 1.00 63.52  ? 432  HIS B O   1 
ATOM   7427 C CB  . HIS B 1 432 ? -6.436  5.068   -27.568 1.00 61.60  ? 432  HIS B CB  1 
ATOM   7428 C CG  . HIS B 1 432 ? -7.626  4.212   -27.833 1.00 66.57  ? 432  HIS B CG  1 
ATOM   7429 N ND1 . HIS B 1 432 ? -8.536  3.890   -26.851 1.00 68.51  ? 432  HIS B ND1 1 
ATOM   7430 C CD2 . HIS B 1 432 ? -8.034  3.571   -28.953 1.00 68.34  ? 432  HIS B CD2 1 
ATOM   7431 C CE1 . HIS B 1 432 ? -9.468  3.106   -27.362 1.00 66.41  ? 432  HIS B CE1 1 
ATOM   7432 N NE2 . HIS B 1 432 ? -9.189  2.900   -28.636 1.00 72.19  ? 432  HIS B NE2 1 
ATOM   7433 N N   . ARG B 1 433 ? -5.333  1.910   -26.716 1.00 56.56  ? 433  ARG B N   1 
ATOM   7434 C CA  . ARG B 1 433 ? -5.246  0.543   -27.244 1.00 49.96  ? 433  ARG B CA  1 
ATOM   7435 C C   . ARG B 1 433 ? -6.548  0.149   -27.967 1.00 62.89  ? 433  ARG B C   1 
ATOM   7436 O O   . ARG B 1 433 ? -7.637  0.240   -27.401 1.00 55.62  ? 433  ARG B O   1 
ATOM   7437 C CB  . ARG B 1 433 ? -4.978  -0.428  -26.099 1.00 52.28  ? 433  ARG B CB  1 
ATOM   7438 C CG  . ARG B 1 433 ? -4.912  -1.874  -26.510 1.00 60.04  ? 433  ARG B CG  1 
ATOM   7439 C CD  . ARG B 1 433 ? -4.701  -2.781  -25.314 1.00 52.10  ? 433  ARG B CD  1 
ATOM   7440 N NE  . ARG B 1 433 ? -5.065  -4.160  -25.639 1.00 59.70  ? 433  ARG B NE  1 
ATOM   7441 C CZ  . ARG B 1 433 ? -4.196  -5.146  -25.849 1.00 64.99  ? 433  ARG B CZ  1 
ATOM   7442 N NH1 . ARG B 1 433 ? -2.882  -4.931  -25.761 1.00 56.79  ? 433  ARG B NH1 1 
ATOM   7443 N NH2 . ARG B 1 433 ? -4.647  -6.357  -26.137 1.00 64.70  ? 433  ARG B NH2 1 
ATOM   7444 N N   . ALA B 1 434 ? -6.437  -0.283  -29.219 1.00 64.47  ? 434  ALA B N   1 
ATOM   7445 C CA  . ALA B 1 434 ? -7.621  -0.584  -30.024 1.00 56.64  ? 434  ALA B CA  1 
ATOM   7446 C C   . ALA B 1 434 ? -8.408  -1.738  -29.430 1.00 66.14  ? 434  ALA B C   1 
ATOM   7447 O O   . ALA B 1 434 ? -7.826  -2.729  -28.982 1.00 62.72  ? 434  ALA B O   1 
ATOM   7448 C CB  . ALA B 1 434 ? -7.231  -0.902  -31.453 1.00 54.82  ? 434  ALA B CB  1 
ATOM   7449 N N   . SER B 1 435 ? -9.732  -1.602  -29.436 1.00 63.35  ? 435  SER B N   1 
ATOM   7450 C CA  . SER B 1 435 ? -10.621 -2.638  -28.925 1.00 59.78  ? 435  SER B CA  1 
ATOM   7451 C C   . SER B 1 435 ? -10.511 -3.926  -29.737 1.00 65.86  ? 435  SER B C   1 
ATOM   7452 O O   . SER B 1 435 ? -10.732 -5.014  -29.215 1.00 71.46  ? 435  SER B O   1 
ATOM   7453 C CB  . SER B 1 435 ? -12.068 -2.143  -28.918 1.00 63.11  ? 435  SER B CB  1 
ATOM   7454 O OG  . SER B 1 435 ? -12.520 -1.857  -30.228 1.00 63.92  ? 435  SER B OG  1 
ATOM   7455 N N   . THR B 1 436 ? -10.153 -3.790  -31.009 1.00 65.62  ? 436  THR B N   1 
ATOM   7456 C CA  . THR B 1 436 ? -10.004 -4.922  -31.913 1.00 58.55  ? 436  THR B CA  1 
ATOM   7457 C C   . THR B 1 436 ? -8.604  -5.537  -31.909 1.00 65.62  ? 436  THR B C   1 
ATOM   7458 O O   . THR B 1 436 ? -8.288  -6.361  -32.770 1.00 67.75  ? 436  THR B O   1 
ATOM   7459 C CB  . THR B 1 436 ? -10.277 -4.484  -33.355 1.00 69.97  ? 436  THR B CB  1 
ATOM   7460 O OG1 . THR B 1 436 ? -9.266  -3.543  -33.766 1.00 79.72  ? 436  THR B OG1 1 
ATOM   7461 C CG2 . THR B 1 436 ? -11.659 -3.846  -33.473 1.00 61.84  ? 436  THR B CG2 1 
ATOM   7462 N N   . LEU B 1 437 ? -7.759  -5.135  -30.962 1.00 64.61  ? 437  LEU B N   1 
ATOM   7463 C CA  . LEU B 1 437 ? -6.352  -5.552  -30.971 1.00 61.57  ? 437  LEU B CA  1 
ATOM   7464 C C   . LEU B 1 437 ? -6.152  -7.047  -30.693 1.00 62.73  ? 437  LEU B C   1 
ATOM   7465 O O   . LEU B 1 437 ? -6.680  -7.579  -29.720 1.00 60.55  ? 437  LEU B O   1 
ATOM   7466 C CB  . LEU B 1 437 ? -5.553  -4.734  -29.964 1.00 57.82  ? 437  LEU B CB  1 
ATOM   7467 C CG  . LEU B 1 437 ? -4.038  -4.772  -30.145 1.00 60.08  ? 437  LEU B CG  1 
ATOM   7468 C CD1 . LEU B 1 437 ? -3.642  -3.834  -31.250 1.00 56.87  ? 437  LEU B CD1 1 
ATOM   7469 C CD2 . LEU B 1 437 ? -3.338  -4.396  -28.858 1.00 63.69  ? 437  LEU B CD2 1 
ATOM   7470 N N   . THR B 1 438 ? -5.360  -7.714  -31.528 1.00 58.71  ? 438  THR B N   1 
ATOM   7471 C CA  . THR B 1 438 ? -5.149  -9.153  -31.369 1.00 64.78  ? 438  THR B CA  1 
ATOM   7472 C C   . THR B 1 438 ? -3.956  -9.558  -30.496 1.00 67.89  ? 438  THR B C   1 
ATOM   7473 O O   . THR B 1 438 ? -3.768  -10.749 -30.234 1.00 68.41  ? 438  THR B O   1 
ATOM   7474 C CB  . THR B 1 438 ? -5.033  -9.865  -32.730 1.00 67.12  ? 438  THR B CB  1 
ATOM   7475 O OG1 . THR B 1 438 ? -3.870  -9.396  -33.421 1.00 67.60  ? 438  THR B OG1 1 
ATOM   7476 C CG2 . THR B 1 438 ? -6.262  -9.580  -33.568 1.00 64.66  ? 438  THR B CG2 1 
ATOM   7477 N N   . TRP B 1 439 ? -3.149  -8.593  -30.050 1.00 60.94  ? 439  TRP B N   1 
ATOM   7478 C CA  . TRP B 1 439 ? -2.021  -8.909  -29.159 1.00 59.64  ? 439  TRP B CA  1 
ATOM   7479 C C   . TRP B 1 439 ? -2.456  -8.918  -27.690 1.00 54.22  ? 439  TRP B C   1 
ATOM   7480 O O   . TRP B 1 439 ? -3.421  -8.251  -27.320 1.00 54.90  ? 439  TRP B O   1 
ATOM   7481 C CB  . TRP B 1 439 ? -0.857  -7.924  -29.343 1.00 58.34  ? 439  TRP B CB  1 
ATOM   7482 C CG  . TRP B 1 439 ? -0.224  -7.916  -30.702 1.00 49.78  ? 439  TRP B CG  1 
ATOM   7483 C CD1 . TRP B 1 439 ? -0.506  -7.065  -31.725 1.00 49.26  ? 439  TRP B CD1 1 
ATOM   7484 C CD2 . TRP B 1 439 ? 0.813   -8.786  -31.179 1.00 57.46  ? 439  TRP B CD2 1 
ATOM   7485 N NE1 . TRP B 1 439 ? 0.272   -7.356  -32.814 1.00 49.14  ? 439  TRP B NE1 1 
ATOM   7486 C CE2 . TRP B 1 439 ? 1.099   -8.403  -32.506 1.00 56.04  ? 439  TRP B CE2 1 
ATOM   7487 C CE3 . TRP B 1 439 ? 1.523   -9.854  -30.617 1.00 55.70  ? 439  TRP B CE3 1 
ATOM   7488 C CZ2 . TRP B 1 439 ? 2.064   -9.047  -33.282 1.00 57.04  ? 439  TRP B CZ2 1 
ATOM   7489 C CZ3 . TRP B 1 439 ? 2.484   -10.487 -31.383 1.00 55.05  ? 439  TRP B CZ3 1 
ATOM   7490 C CH2 . TRP B 1 439 ? 2.742   -10.085 -32.705 1.00 58.43  ? 439  TRP B CH2 1 
ATOM   7491 N N   . PRO B 1 440 ? -1.724  -9.651  -26.839 1.00 54.76  ? 440  PRO B N   1 
ATOM   7492 C CA  . PRO B 1 440 ? -2.064  -9.748  -25.410 1.00 55.37  ? 440  PRO B CA  1 
ATOM   7493 C C   . PRO B 1 440 ? -2.105  -8.374  -24.756 1.00 61.33  ? 440  PRO B C   1 
ATOM   7494 O O   . PRO B 1 440 ? -1.424  -7.448  -25.206 1.00 61.65  ? 440  PRO B O   1 
ATOM   7495 C CB  . PRO B 1 440 ? -0.889  -10.518 -24.801 1.00 50.53  ? 440  PRO B CB  1 
ATOM   7496 C CG  . PRO B 1 440 ? -0.042  -10.952 -25.912 1.00 58.33  ? 440  PRO B CG  1 
ATOM   7497 C CD  . PRO B 1 440 ? -0.387  -10.180 -27.140 1.00 54.76  ? 440  PRO B CD  1 
ATOM   7498 N N   . LEU B 1 441 ? -2.870  -8.256  -23.681 1.00 60.47  ? 441  LEU B N   1 
ATOM   7499 C CA  . LEU B 1 441 ? -2.980  -6.999  -22.962 1.00 62.38  ? 441  LEU B CA  1 
ATOM   7500 C C   . LEU B 1 441 ? -1.631  -6.455  -22.521 1.00 65.33  ? 441  LEU B C   1 
ATOM   7501 O O   . LEU B 1 441 ? -1.431  -5.241  -22.485 1.00 66.54  ? 441  LEU B O   1 
ATOM   7502 C CB  . LEU B 1 441 ? -3.876  -7.158  -21.738 1.00 61.64  ? 441  LEU B CB  1 
ATOM   7503 C CG  . LEU B 1 441 ? -5.364  -7.290  -22.042 1.00 72.01  ? 441  LEU B CG  1 
ATOM   7504 C CD1 . LEU B 1 441 ? -6.165  -7.386  -20.748 1.00 70.38  ? 441  LEU B CD1 1 
ATOM   7505 C CD2 . LEU B 1 441 ? -5.829  -6.111  -22.881 1.00 66.66  ? 441  LEU B CD2 1 
ATOM   7506 N N   . TRP B 1 442 ? -0.704  -7.342  -22.183 1.00 64.51  ? 442  TRP B N   1 
ATOM   7507 C CA  . TRP B 1 442 ? 0.537   -6.884  -21.565 1.00 66.85  ? 442  TRP B CA  1 
ATOM   7508 C C   . TRP B 1 442 ? 1.395   -6.005  -22.463 1.00 64.76  ? 442  TRP B C   1 
ATOM   7509 O O   . TRP B 1 442 ? 2.289   -5.314  -21.976 1.00 69.98  ? 442  TRP B O   1 
ATOM   7510 C CB  . TRP B 1 442 ? 1.358   -8.043  -20.981 1.00 65.30  ? 442  TRP B CB  1 
ATOM   7511 C CG  . TRP B 1 442 ? 1.987   -8.991  -21.972 1.00 68.90  ? 442  TRP B CG  1 
ATOM   7512 C CD1 . TRP B 1 442 ? 1.513   -10.220 -22.344 1.00 67.79  ? 442  TRP B CD1 1 
ATOM   7513 C CD2 . TRP B 1 442 ? 3.227   -8.813  -22.671 1.00 67.00  ? 442  TRP B CD2 1 
ATOM   7514 N NE1 . TRP B 1 442 ? 2.375   -10.808 -23.239 1.00 65.92  ? 442  TRP B NE1 1 
ATOM   7515 C CE2 . TRP B 1 442 ? 3.434   -9.967  -23.457 1.00 64.62  ? 442  TRP B CE2 1 
ATOM   7516 C CE3 . TRP B 1 442 ? 4.179   -7.788  -22.712 1.00 64.48  ? 442  TRP B CE3 1 
ATOM   7517 C CZ2 . TRP B 1 442 ? 4.551   -10.122 -24.280 1.00 61.94  ? 442  TRP B CZ2 1 
ATOM   7518 C CZ3 . TRP B 1 442 ? 5.290   -7.945  -23.529 1.00 61.87  ? 442  TRP B CZ3 1 
ATOM   7519 C CH2 . TRP B 1 442 ? 5.466   -9.103  -24.302 1.00 65.61  ? 442  TRP B CH2 1 
ATOM   7520 N N   . MET B 1 443 ? 1.123   -6.028  -23.764 1.00 57.49  ? 443  MET B N   1 
ATOM   7521 C CA  . MET B 1 443 ? 1.886   -5.224  -24.701 1.00 55.86  ? 443  MET B CA  1 
ATOM   7522 C C   . MET B 1 443 ? 1.298   -3.819  -24.809 1.00 63.11  ? 443  MET B C   1 
ATOM   7523 O O   . MET B 1 443 ? 1.891   -2.933  -25.436 1.00 57.26  ? 443  MET B O   1 
ATOM   7524 C CB  . MET B 1 443 ? 1.918   -5.886  -26.073 1.00 54.28  ? 443  MET B CB  1 
ATOM   7525 C CG  . MET B 1 443 ? 2.376   -7.325  -26.058 1.00 56.64  ? 443  MET B CG  1 
ATOM   7526 S SD  . MET B 1 443 ? 2.737   -7.902  -27.736 1.00 63.09  ? 443  MET B SD  1 
ATOM   7527 C CE  . MET B 1 443 ? 3.134   -9.605  -27.411 1.00 63.95  ? 443  MET B CE  1 
ATOM   7528 N N   . GLY B 1 444 ? 0.133   -3.630  -24.192 1.00 55.89  ? 444  GLY B N   1 
ATOM   7529 C CA  . GLY B 1 444 ? -0.562  -2.357  -24.211 1.00 51.29  ? 444  GLY B CA  1 
ATOM   7530 C C   . GLY B 1 444 ? -0.818  -1.848  -25.616 1.00 57.44  ? 444  GLY B C   1 
ATOM   7531 O O   . GLY B 1 444 ? -1.440  -2.541  -26.420 1.00 60.88  ? 444  GLY B O   1 
ATOM   7532 N N   . VAL B 1 445 ? -0.337  -0.633  -25.897 1.00 59.33  ? 445  VAL B N   1 
ATOM   7533 C CA  . VAL B 1 445 ? -0.409  -0.001  -27.218 1.00 53.44  ? 445  VAL B CA  1 
ATOM   7534 C C   . VAL B 1 445 ? 0.942   -0.130  -27.924 1.00 56.07  ? 445  VAL B C   1 
ATOM   7535 O O   . VAL B 1 445 ? 1.851   0.644   -27.650 1.00 51.86  ? 445  VAL B O   1 
ATOM   7536 C CB  . VAL B 1 445 ? -0.709  1.491   -27.066 1.00 51.76  ? 445  VAL B CB  1 
ATOM   7537 C CG1 . VAL B 1 445 ? -1.081  2.118   -28.412 1.00 47.15  ? 445  VAL B CG1 1 
ATOM   7538 C CG2 . VAL B 1 445 ? -1.789  1.696   -26.029 1.00 45.59  ? 445  VAL B CG2 1 
ATOM   7539 N N   . PRO B 1 446 ? 1.091   -1.124  -28.822 1.00 61.02  ? 446  PRO B N   1 
ATOM   7540 C CA  . PRO B 1 446 ? 2.415   -1.410  -29.401 1.00 49.66  ? 446  PRO B CA  1 
ATOM   7541 C C   . PRO B 1 446 ? 2.766   -0.585  -30.629 1.00 53.19  ? 446  PRO B C   1 
ATOM   7542 O O   . PRO B 1 446 ? 1.905   0.011   -31.286 1.00 44.68  ? 446  PRO B O   1 
ATOM   7543 C CB  . PRO B 1 446 ? 2.317   -2.877  -29.823 1.00 47.26  ? 446  PRO B CB  1 
ATOM   7544 C CG  . PRO B 1 446 ? 0.929   -3.348  -29.396 1.00 58.33  ? 446  PRO B CG  1 
ATOM   7545 C CD  . PRO B 1 446 ? 0.094   -2.136  -29.203 1.00 50.89  ? 446  PRO B CD  1 
ATOM   7546 N N   . HIS B 1 447 ? 4.060   -0.581  -30.921 1.00 45.58  ? 447  HIS B N   1 
ATOM   7547 C CA  . HIS B 1 447 ? 4.620   -0.006  -32.127 1.00 45.40  ? 447  HIS B CA  1 
ATOM   7548 C C   . HIS B 1 447 ? 3.783   -0.374  -33.351 1.00 51.24  ? 447  HIS B C   1 
ATOM   7549 O O   . HIS B 1 447 ? 3.742   -1.537  -33.756 1.00 68.03  ? 447  HIS B O   1 
ATOM   7550 C CB  . HIS B 1 447 ? 6.050   -0.538  -32.273 1.00 48.85  ? 447  HIS B CB  1 
ATOM   7551 C CG  . HIS B 1 447 ? 6.856   0.119   -33.352 1.00 58.48  ? 447  HIS B CG  1 
ATOM   7552 N ND1 . HIS B 1 447 ? 7.147   1.466   -33.352 1.00 57.99  ? 447  HIS B ND1 1 
ATOM   7553 C CD2 . HIS B 1 447 ? 7.478   -0.402  -34.437 1.00 62.85  ? 447  HIS B CD2 1 
ATOM   7554 C CE1 . HIS B 1 447 ? 7.898   1.751   -34.402 1.00 61.65  ? 447  HIS B CE1 1 
ATOM   7555 N NE2 . HIS B 1 447 ? 8.114   0.636   -35.076 1.00 65.28  ? 447  HIS B NE2 1 
ATOM   7556 N N   . GLY B 1 448 ? 3.119   0.618   -33.937 1.00 49.48  ? 448  GLY B N   1 
ATOM   7557 C CA  . GLY B 1 448 ? 2.360   0.429   -35.162 1.00 46.34  ? 448  GLY B CA  1 
ATOM   7558 C C   . GLY B 1 448 ? 0.865   0.698   -35.056 1.00 53.42  ? 448  GLY B C   1 
ATOM   7559 O O   . GLY B 1 448 ? 0.218   0.988   -36.060 1.00 61.63  ? 448  GLY B O   1 
ATOM   7560 N N   . TYR B 1 449 ? 0.312   0.637   -33.848 1.00 49.63  ? 449  TYR B N   1 
ATOM   7561 C CA  . TYR B 1 449 ? -1.146  0.565   -33.687 1.00 53.45  ? 449  TYR B CA  1 
ATOM   7562 C C   . TYR B 1 449 ? -1.928  1.867   -33.508 1.00 50.08  ? 449  TYR B C   1 
ATOM   7563 O O   . TYR B 1 449 ? -3.066  1.856   -33.067 1.00 58.33  ? 449  TYR B O   1 
ATOM   7564 C CB  . TYR B 1 449 ? -1.522  -0.500  -32.648 1.00 46.03  ? 449  TYR B CB  1 
ATOM   7565 C CG  . TYR B 1 449 ? -1.174  -1.850  -33.207 1.00 51.12  ? 449  TYR B CG  1 
ATOM   7566 C CD1 . TYR B 1 449 ? 0.111   -2.348  -33.085 1.00 49.62  ? 449  TYR B CD1 1 
ATOM   7567 C CD2 . TYR B 1 449 ? -2.102  -2.581  -33.944 1.00 47.23  ? 449  TYR B CD2 1 
ATOM   7568 C CE1 . TYR B 1 449 ? 0.456   -3.561  -33.632 1.00 55.69  ? 449  TYR B CE1 1 
ATOM   7569 C CE2 . TYR B 1 449 ? -1.772  -3.802  -34.491 1.00 51.55  ? 449  TYR B CE2 1 
ATOM   7570 C CZ  . TYR B 1 449 ? -0.485  -4.287  -34.334 1.00 55.02  ? 449  TYR B CZ  1 
ATOM   7571 O OH  . TYR B 1 449 ? -0.117  -5.495  -34.878 1.00 48.59  ? 449  TYR B OH  1 
ATOM   7572 N N   . GLU B 1 450 ? -1.326  2.976   -33.899 1.00 47.29  ? 450  GLU B N   1 
ATOM   7573 C CA  . GLU B 1 450 ? -2.046  4.231   -34.014 1.00 48.63  ? 450  GLU B CA  1 
ATOM   7574 C C   . GLU B 1 450 ? -2.439  4.437   -35.477 1.00 48.96  ? 450  GLU B C   1 
ATOM   7575 O O   . GLU B 1 450 ? -3.346  5.206   -35.795 1.00 53.54  ? 450  GLU B O   1 
ATOM   7576 C CB  . GLU B 1 450 ? -1.159  5.389   -33.548 1.00 48.42  ? 450  GLU B CB  1 
ATOM   7577 C CG  . GLU B 1 450 ? -0.113  5.857   -34.577 1.00 44.63  ? 450  GLU B CG  1 
ATOM   7578 C CD  . GLU B 1 450 ? 1.156   5.000   -34.635 1.00 48.68  ? 450  GLU B CD  1 
ATOM   7579 O OE1 . GLU B 1 450 ? 1.154   3.821   -34.204 1.00 51.67  ? 450  GLU B OE1 1 
ATOM   7580 O OE2 . GLU B 1 450 ? 2.174   5.521   -35.128 1.00 52.84  ? 450  GLU B OE2 1 
ATOM   7581 N N   . ILE B 1 451 ? -1.742  3.742   -36.367 1.00 47.52  ? 451  ILE B N   1 
ATOM   7582 C CA  . ILE B 1 451 ? -1.924  3.927   -37.801 1.00 46.75  ? 451  ILE B CA  1 
ATOM   7583 C C   . ILE B 1 451 ? -3.361  3.713   -38.268 1.00 47.38  ? 451  ILE B C   1 
ATOM   7584 O O   . ILE B 1 451 ? -3.907  4.540   -38.993 1.00 51.66  ? 451  ILE B O   1 
ATOM   7585 C CB  . ILE B 1 451 ? -0.976  3.021   -38.609 1.00 49.62  ? 451  ILE B CB  1 
ATOM   7586 C CG1 . ILE B 1 451 ? 0.486   3.377   -38.298 1.00 50.22  ? 451  ILE B CG1 1 
ATOM   7587 C CG2 . ILE B 1 451 ? -1.281  3.154   -40.092 1.00 45.07  ? 451  ILE B CG2 1 
ATOM   7588 C CD1 . ILE B 1 451 ? 1.523   2.406   -38.867 1.00 46.06  ? 451  ILE B CD1 1 
ATOM   7589 N N   . GLU B 1 452 ? -3.974  2.605   -37.863 1.00 52.52  ? 452  GLU B N   1 
ATOM   7590 C CA  . GLU B 1 452 ? -5.362  2.337   -38.240 1.00 50.67  ? 452  GLU B CA  1 
ATOM   7591 C C   . GLU B 1 452 ? -6.282  3.499   -37.866 1.00 54.47  ? 452  GLU B C   1 
ATOM   7592 O O   . GLU B 1 452 ? -7.238  3.788   -38.581 1.00 57.39  ? 452  GLU B O   1 
ATOM   7593 C CB  . GLU B 1 452 ? -5.861  1.023   -37.630 1.00 49.67  ? 452  GLU B CB  1 
ATOM   7594 C CG  . GLU B 1 452 ? -5.738  0.940   -36.113 1.00 60.96  ? 452  GLU B CG  1 
ATOM   7595 C CD  . GLU B 1 452 ? -5.722  -0.504  -35.585 1.00 68.75  ? 452  GLU B CD  1 
ATOM   7596 O OE1 . GLU B 1 452 ? -6.742  -0.944  -35.005 1.00 69.67  ? 452  GLU B OE1 1 
ATOM   7597 O OE2 . GLU B 1 452 ? -4.689  -1.198  -35.744 1.00 65.63  ? 452  GLU B OE2 1 
ATOM   7598 N N   . PHE B 1 453 ? -5.986  4.178   -36.760 1.00 52.56  ? 453  PHE B N   1 
ATOM   7599 C CA  . PHE B 1 453 ? -6.810  5.310   -36.334 1.00 50.49  ? 453  PHE B CA  1 
ATOM   7600 C C   . PHE B 1 453 ? -6.579  6.570   -37.150 1.00 52.91  ? 453  PHE B C   1 
ATOM   7601 O O   . PHE B 1 453 ? -7.533  7.274   -37.473 1.00 55.53  ? 453  PHE B O   1 
ATOM   7602 C CB  . PHE B 1 453 ? -6.625  5.601   -34.850 1.00 45.76  ? 453  PHE B CB  1 
ATOM   7603 C CG  . PHE B 1 453 ? -7.158  4.528   -33.970 1.00 53.95  ? 453  PHE B CG  1 
ATOM   7604 C CD1 . PHE B 1 453 ? -8.497  4.521   -33.601 1.00 53.99  ? 453  PHE B CD1 1 
ATOM   7605 C CD2 . PHE B 1 453 ? -6.332  3.505   -33.532 1.00 49.61  ? 453  PHE B CD2 1 
ATOM   7606 C CE1 . PHE B 1 453 ? -8.997  3.526   -32.787 1.00 58.14  ? 453  PHE B CE1 1 
ATOM   7607 C CE2 . PHE B 1 453 ? -6.823  2.502   -32.724 1.00 54.79  ? 453  PHE B CE2 1 
ATOM   7608 C CZ  . PHE B 1 453 ? -8.161  2.510   -32.349 1.00 62.01  ? 453  PHE B CZ  1 
ATOM   7609 N N   . ILE B 1 454 ? -5.319  6.848   -37.479 1.00 52.43  ? 454  ILE B N   1 
ATOM   7610 C CA  . ILE B 1 454 ? -4.962  8.024   -38.276 1.00 47.34  ? 454  ILE B CA  1 
ATOM   7611 C C   . ILE B 1 454 ? -5.532  7.941   -39.688 1.00 48.84  ? 454  ILE B C   1 
ATOM   7612 O O   . ILE B 1 454 ? -5.934  8.962   -40.255 1.00 54.83  ? 454  ILE B O   1 
ATOM   7613 C CB  . ILE B 1 454 ? -3.435  8.193   -38.395 1.00 54.65  ? 454  ILE B CB  1 
ATOM   7614 C CG1 . ILE B 1 454 ? -2.781  8.181   -37.017 1.00 50.06  ? 454  ILE B CG1 1 
ATOM   7615 C CG2 . ILE B 1 454 ? -3.100  9.485   -39.121 1.00 48.93  ? 454  ILE B CG2 1 
ATOM   7616 C CD1 . ILE B 1 454 ? -3.126  9.408   -36.202 1.00 54.89  ? 454  ILE B CD1 1 
ATOM   7617 N N   . PHE B 1 455 ? -5.550  6.731   -40.255 1.00 48.60  ? 455  PHE B N   1 
ATOM   7618 C CA  . PHE B 1 455 ? -6.099  6.501   -41.594 1.00 48.46  ? 455  PHE B CA  1 
ATOM   7619 C C   . PHE B 1 455 ? -7.624  6.426   -41.577 1.00 54.78  ? 455  PHE B C   1 
ATOM   7620 O O   . PHE B 1 455 ? -8.266  6.522   -42.617 1.00 56.14  ? 455  PHE B O   1 
ATOM   7621 C CB  . PHE B 1 455 ? -5.501  5.247   -42.234 1.00 52.12  ? 455  PHE B CB  1 
ATOM   7622 C CG  . PHE B 1 455 ? -4.210  5.505   -42.951 1.00 54.13  ? 455  PHE B CG  1 
ATOM   7623 C CD1 . PHE B 1 455 ? -2.995  5.304   -42.320 1.00 56.57  ? 455  PHE B CD1 1 
ATOM   7624 C CD2 . PHE B 1 455 ? -4.209  5.984   -44.250 1.00 56.92  ? 455  PHE B CD2 1 
ATOM   7625 C CE1 . PHE B 1 455 ? -1.799  5.568   -42.975 1.00 52.04  ? 455  PHE B CE1 1 
ATOM   7626 C CE2 . PHE B 1 455 ? -3.017  6.246   -44.916 1.00 54.99  ? 455  PHE B CE2 1 
ATOM   7627 C CZ  . PHE B 1 455 ? -1.810  6.037   -44.274 1.00 52.02  ? 455  PHE B CZ  1 
ATOM   7628 N N   . GLY B 1 456 ? -8.196  6.268   -40.386 1.00 54.22  ? 456  GLY B N   1 
ATOM   7629 C CA  . GLY B 1 456 ? -9.633  6.349   -40.210 1.00 56.90  ? 456  GLY B CA  1 
ATOM   7630 C C   . GLY B 1 456 ? -10.407 5.057   -40.396 1.00 59.50  ? 456  GLY B C   1 
ATOM   7631 O O   . GLY B 1 456 ? -11.604 5.085   -40.660 1.00 62.61  ? 456  GLY B O   1 
ATOM   7632 N N   . LEU B 1 457 ? -9.734  3.923   -40.252 1.00 57.89  ? 457  LEU B N   1 
ATOM   7633 C CA  . LEU B 1 457 ? -10.391 2.632   -40.425 1.00 61.95  ? 457  LEU B CA  1 
ATOM   7634 C C   . LEU B 1 457 ? -11.619 2.407   -39.523 1.00 63.96  ? 457  LEU B C   1 
ATOM   7635 O O   . LEU B 1 457 ? -12.555 1.719   -39.916 1.00 62.46  ? 457  LEU B O   1 
ATOM   7636 C CB  . LEU B 1 457 ? -9.385  1.486   -40.275 1.00 55.39  ? 457  LEU B CB  1 
ATOM   7637 C CG  . LEU B 1 457 ? -8.627  1.152   -41.565 1.00 59.18  ? 457  LEU B CG  1 
ATOM   7638 C CD1 . LEU B 1 457 ? -7.843  2.349   -42.094 1.00 47.64  ? 457  LEU B CD1 1 
ATOM   7639 C CD2 . LEU B 1 457 ? -7.714  -0.045  -41.368 1.00 53.72  ? 457  LEU B CD2 1 
ATOM   7640 N N   . PRO B 1 458 ? -11.621 2.969   -38.307 1.00 60.21  ? 458  PRO B N   1 
ATOM   7641 C CA  . PRO B 1 458 ? -12.815 2.700   -37.502 1.00 64.36  ? 458  PRO B CA  1 
ATOM   7642 C C   . PRO B 1 458 ? -14.079 3.318   -38.086 1.00 66.88  ? 458  PRO B C   1 
ATOM   7643 O O   . PRO B 1 458 ? -15.166 3.063   -37.578 1.00 76.19  ? 458  PRO B O   1 
ATOM   7644 C CB  . PRO B 1 458 ? -12.471 3.321   -36.147 1.00 57.93  ? 458  PRO B CB  1 
ATOM   7645 C CG  . PRO B 1 458 ? -10.991 3.250   -36.090 1.00 59.96  ? 458  PRO B CG  1 
ATOM   7646 C CD  . PRO B 1 458 ? -10.529 3.523   -37.493 1.00 58.80  ? 458  PRO B CD  1 
ATOM   7647 N N   . LEU B 1 459 ? -13.936 4.109   -39.142 1.00 63.53  ? 459  LEU B N   1 
ATOM   7648 C CA  . LEU B 1 459 ? -15.082 4.677   -39.833 1.00 60.04  ? 459  LEU B CA  1 
ATOM   7649 C C   . LEU B 1 459 ? -15.792 3.651   -40.718 1.00 68.29  ? 459  LEU B C   1 
ATOM   7650 O O   . LEU B 1 459 ? -16.905 3.885   -41.187 1.00 73.11  ? 459  LEU B O   1 
ATOM   7651 C CB  . LEU B 1 459 ? -14.654 5.878   -40.670 1.00 62.72  ? 459  LEU B CB  1 
ATOM   7652 C CG  . LEU B 1 459 ? -14.744 7.237   -39.981 1.00 52.97  ? 459  LEU B CG  1 
ATOM   7653 C CD1 . LEU B 1 459 ? -13.863 7.303   -38.760 1.00 62.10  ? 459  LEU B CD1 1 
ATOM   7654 C CD2 . LEU B 1 459 ? -14.352 8.295   -40.969 1.00 59.49  ? 459  LEU B CD2 1 
ATOM   7655 N N   . ASP B 1 460 ? -15.133 2.524   -40.961 1.00 70.55  ? 460  ASP B N   1 
ATOM   7656 C CA  . ASP B 1 460 ? -15.753 1.405   -41.651 1.00 66.81  ? 460  ASP B CA  1 
ATOM   7657 C C   . ASP B 1 460 ? -16.467 0.525   -40.631 1.00 77.12  ? 460  ASP B C   1 
ATOM   7658 O O   . ASP B 1 460 ? -15.828 -0.125  -39.795 1.00 71.95  ? 460  ASP B O   1 
ATOM   7659 C CB  . ASP B 1 460 ? -14.707 0.591   -42.398 1.00 74.73  ? 460  ASP B CB  1 
ATOM   7660 C CG  . ASP B 1 460 ? -15.313 -0.575  -43.152 1.00 82.36  ? 460  ASP B CG  1 
ATOM   7661 O OD1 . ASP B 1 460 ? -16.552 -0.728  -43.111 1.00 79.31  ? 460  ASP B OD1 1 
ATOM   7662 O OD2 . ASP B 1 460 ? -14.549 -1.333  -43.789 1.00 87.98  ? 460  ASP B OD2 1 
ATOM   7663 N N   . PRO B 1 461 ? -17.806 0.494   -40.704 1.00 84.53  ? 461  PRO B N   1 
ATOM   7664 C CA  . PRO B 1 461 ? -18.618 -0.111  -39.644 1.00 75.06  ? 461  PRO B CA  1 
ATOM   7665 C C   . PRO B 1 461 ? -18.407 -1.616  -39.559 1.00 77.96  ? 461  PRO B C   1 
ATOM   7666 O O   . PRO B 1 461 ? -18.526 -2.199  -38.478 1.00 86.75  ? 461  PRO B O   1 
ATOM   7667 C CB  . PRO B 1 461 ? -20.051 0.214   -40.074 1.00 70.16  ? 461  PRO B CB  1 
ATOM   7668 C CG  . PRO B 1 461 ? -19.919 1.306   -41.106 1.00 75.28  ? 461  PRO B CG  1 
ATOM   7669 C CD  . PRO B 1 461 ? -18.637 1.016   -41.802 1.00 75.43  ? 461  PRO B CD  1 
ATOM   7670 N N   . SER B 1 462 ? -18.075 -2.231  -40.688 1.00 68.96  ? 462  SER B N   1 
ATOM   7671 C CA  . SER B 1 462 ? -17.884 -3.674  -40.740 1.00 76.39  ? 462  SER B CA  1 
ATOM   7672 C C   . SER B 1 462 ? -16.644 -4.129  -39.973 1.00 80.70  ? 462  SER B C   1 
ATOM   7673 O O   . SER B 1 462 ? -16.429 -5.331  -39.793 1.00 79.57  ? 462  SER B O   1 
ATOM   7674 C CB  . SER B 1 462 ? -17.802 -4.147  -42.190 1.00 79.87  ? 462  SER B CB  1 
ATOM   7675 O OG  . SER B 1 462 ? -16.692 -3.564  -42.848 1.00 81.86  ? 462  SER B OG  1 
ATOM   7676 N N   . LEU B 1 463 ? -15.835 -3.171  -39.522 1.00 78.72  ? 463  LEU B N   1 
ATOM   7677 C CA  . LEU B 1 463 ? -14.604 -3.486  -38.799 1.00 73.20  ? 463  LEU B CA  1 
ATOM   7678 C C   . LEU B 1 463 ? -14.847 -3.682  -37.304 1.00 76.67  ? 463  LEU B C   1 
ATOM   7679 O O   . LEU B 1 463 ? -14.022 -4.274  -36.600 1.00 72.71  ? 463  LEU B O   1 
ATOM   7680 C CB  . LEU B 1 463 ? -13.546 -2.410  -39.038 1.00 70.98  ? 463  LEU B CB  1 
ATOM   7681 C CG  . LEU B 1 463 ? -13.089 -2.308  -40.489 1.00 75.04  ? 463  LEU B CG  1 
ATOM   7682 C CD1 . LEU B 1 463 ? -12.073 -1.193  -40.699 1.00 65.83  ? 463  LEU B CD1 1 
ATOM   7683 C CD2 . LEU B 1 463 ? -12.513 -3.641  -40.897 1.00 70.36  ? 463  LEU B CD2 1 
ATOM   7684 N N   . ASN B 1 464 ? -15.979 -3.178  -36.825 1.00 69.29  ? 464  ASN B N   1 
ATOM   7685 C CA  . ASN B 1 464 ? -16.397 -3.425  -35.449 1.00 79.33  ? 464  ASN B CA  1 
ATOM   7686 C C   . ASN B 1 464 ? -15.542 -2.712  -34.398 1.00 80.62  ? 464  ASN B C   1 
ATOM   7687 O O   . ASN B 1 464 ? -15.220 -3.279  -33.349 1.00 77.47  ? 464  ASN B O   1 
ATOM   7688 C CB  . ASN B 1 464 ? -16.460 -4.933  -35.163 1.00 85.06  ? 464  ASN B CB  1 
ATOM   7689 C CG  . ASN B 1 464 ? -17.506 -5.654  -36.013 1.00 94.95  ? 464  ASN B CG  1 
ATOM   7690 O OD1 . ASN B 1 464 ? -18.490 -5.051  -36.466 1.00 88.86  ? 464  ASN B OD1 1 
ATOM   7691 N ND2 . ASN B 1 464 ? -17.298 -6.956  -36.228 1.00 95.39  ? 464  ASN B ND2 1 
ATOM   7692 N N   . TYR B 1 465 ? -15.170 -1.470  -34.690 1.00 80.53  ? 465  TYR B N   1 
ATOM   7693 C CA  . TYR B 1 465 ? -14.595 -0.587  -33.687 1.00 69.68  ? 465  TYR B CA  1 
ATOM   7694 C C   . TYR B 1 465 ? -15.763 0.018   -32.927 1.00 68.68  ? 465  TYR B C   1 
ATOM   7695 O O   . TYR B 1 465 ? -16.822 0.227   -33.512 1.00 74.83  ? 465  TYR B O   1 
ATOM   7696 C CB  . TYR B 1 465 ? -13.811 0.546   -34.353 1.00 71.55  ? 465  TYR B CB  1 
ATOM   7697 C CG  . TYR B 1 465 ? -12.491 0.146   -34.960 1.00 65.14  ? 465  TYR B CG  1 
ATOM   7698 C CD1 . TYR B 1 465 ? -11.360 -0.014  -34.166 1.00 63.67  ? 465  TYR B CD1 1 
ATOM   7699 C CD2 . TYR B 1 465 ? -12.370 -0.053  -36.326 1.00 59.77  ? 465  TYR B CD2 1 
ATOM   7700 C CE1 . TYR B 1 465 ? -10.150 -0.375  -34.715 1.00 59.32  ? 465  TYR B CE1 1 
ATOM   7701 C CE2 . TYR B 1 465 ? -11.168 -0.400  -36.888 1.00 60.81  ? 465  TYR B CE2 1 
ATOM   7702 C CZ  . TYR B 1 465 ? -10.059 -0.566  -36.079 1.00 64.02  ? 465  TYR B CZ  1 
ATOM   7703 O OH  . TYR B 1 465 ? -8.854  -0.918  -36.643 1.00 54.39  ? 465  TYR B OH  1 
ATOM   7704 N N   . THR B 1 466 ? -15.580 0.315   -31.642 1.00 67.19  ? 466  THR B N   1 
ATOM   7705 C CA  . THR B 1 466 ? -16.625 0.988   -30.873 1.00 63.23  ? 466  THR B CA  1 
ATOM   7706 C C   . THR B 1 466 ? -16.923 2.340   -31.479 1.00 66.73  ? 466  THR B C   1 
ATOM   7707 O O   . THR B 1 466 ? -16.171 2.836   -32.314 1.00 63.88  ? 466  THR B O   1 
ATOM   7708 C CB  . THR B 1 466 ? -16.225 1.237   -29.418 1.00 69.67  ? 466  THR B CB  1 
ATOM   7709 O OG1 . THR B 1 466 ? -15.414 2.422   -29.341 1.00 73.13  ? 466  THR B OG1 1 
ATOM   7710 C CG2 . THR B 1 466 ? -15.478 0.047   -28.858 1.00 59.35  ? 466  THR B CG2 1 
ATOM   7711 N N   . THR B 1 467 ? -18.022 2.940   -31.041 1.00 69.16  ? 467  THR B N   1 
ATOM   7712 C CA  . THR B 1 467 ? -18.446 4.211   -31.592 1.00 67.10  ? 467  THR B CA  1 
ATOM   7713 C C   . THR B 1 467 ? -17.550 5.329   -31.078 1.00 70.89  ? 467  THR B C   1 
ATOM   7714 O O   . THR B 1 467 ? -17.380 6.353   -31.746 1.00 73.35  ? 467  THR B O   1 
ATOM   7715 C CB  . THR B 1 467 ? -19.927 4.520   -31.267 1.00 70.96  ? 467  THR B CB  1 
ATOM   7716 O OG1 . THR B 1 467 ? -20.494 5.311   -32.318 1.00 84.12  ? 467  THR B OG1 1 
ATOM   7717 C CG2 . THR B 1 467 ? -20.052 5.273   -29.952 1.00 66.50  ? 467  THR B CG2 1 
ATOM   7718 N N   . GLU B 1 468 ? -16.975 5.133   -29.893 1.00 71.41  ? 468  GLU B N   1 
ATOM   7719 C CA  . GLU B 1 468 ? -16.032 6.109   -29.348 1.00 75.57  ? 468  GLU B CA  1 
ATOM   7720 C C   . GLU B 1 468 ? -14.766 6.138   -30.208 1.00 72.56  ? 468  GLU B C   1 
ATOM   7721 O O   . GLU B 1 468 ? -14.235 7.206   -30.513 1.00 68.35  ? 468  GLU B O   1 
ATOM   7722 C CB  . GLU B 1 468 ? -15.668 5.789   -27.895 1.00 75.50  ? 468  GLU B CB  1 
ATOM   7723 C CG  . GLU B 1 468 ? -16.825 5.857   -26.913 1.00 85.20  ? 468  GLU B CG  1 
ATOM   7724 C CD  . GLU B 1 468 ? -17.429 4.488   -26.604 1.00 101.54 ? 468  GLU B CD  1 
ATOM   7725 O OE1 . GLU B 1 468 ? -18.226 3.981   -27.430 1.00 91.30  ? 468  GLU B OE1 1 
ATOM   7726 O OE2 . GLU B 1 468 ? -17.114 3.928   -25.524 1.00 106.26 ? 468  GLU B OE2 1 
ATOM   7727 N N   . GLU B 1 469 ? -14.301 4.956   -30.602 1.00 61.89  ? 469  GLU B N   1 
ATOM   7728 C CA  . GLU B 1 469 ? -13.133 4.837   -31.452 1.00 58.47  ? 469  GLU B CA  1 
ATOM   7729 C C   . GLU B 1 469 ? -13.348 5.510   -32.793 1.00 62.02  ? 469  GLU B C   1 
ATOM   7730 O O   . GLU B 1 469 ? -12.401 5.977   -33.427 1.00 67.52  ? 469  GLU B O   1 
ATOM   7731 C CB  . GLU B 1 469 ? -12.777 3.372   -31.644 1.00 53.77  ? 469  GLU B CB  1 
ATOM   7732 C CG  . GLU B 1 469 ? -12.134 2.790   -30.424 1.00 60.99  ? 469  GLU B CG  1 
ATOM   7733 C CD  . GLU B 1 469 ? -11.974 1.302   -30.513 1.00 64.32  ? 469  GLU B CD  1 
ATOM   7734 O OE1 . GLU B 1 469 ? -12.890 0.656   -31.055 1.00 65.61  ? 469  GLU B OE1 1 
ATOM   7735 O OE2 . GLU B 1 469 ? -10.941 0.776   -30.033 1.00 63.09  ? 469  GLU B OE2 1 
ATOM   7736 N N   . ARG B 1 470 ? -14.598 5.566   -33.222 1.00 56.52  ? 470  ARG B N   1 
ATOM   7737 C CA  . ARG B 1 470 ? -14.919 6.165   -34.500 1.00 58.97  ? 470  ARG B CA  1 
ATOM   7738 C C   . ARG B 1 470 ? -14.783 7.685   -34.383 1.00 62.22  ? 470  ARG B C   1 
ATOM   7739 O O   . ARG B 1 470 ? -14.214 8.340   -35.252 1.00 62.31  ? 470  ARG B O   1 
ATOM   7740 C CB  . ARG B 1 470 ? -16.324 5.744   -34.913 1.00 58.69  ? 470  ARG B CB  1 
ATOM   7741 C CG  . ARG B 1 470 ? -16.611 5.832   -36.392 1.00 71.79  ? 470  ARG B CG  1 
ATOM   7742 C CD  . ARG B 1 470 ? -17.419 7.076   -36.707 1.00 82.27  ? 470  ARG B CD  1 
ATOM   7743 N NE  . ARG B 1 470 ? -18.477 7.264   -35.718 1.00 95.04  ? 470  ARG B NE  1 
ATOM   7744 C CZ  . ARG B 1 470 ? -19.431 8.188   -35.797 1.00 99.26  ? 470  ARG B CZ  1 
ATOM   7745 N NH1 . ARG B 1 470 ? -19.476 9.018   -36.835 1.00 95.86  ? 470  ARG B NH1 1 
ATOM   7746 N NH2 . ARG B 1 470 ? -20.345 8.276   -34.835 1.00 87.24  ? 470  ARG B NH2 1 
ATOM   7747 N N   . ILE B 1 471 ? -15.273 8.231   -33.276 1.00 62.72  ? 471  ILE B N   1 
ATOM   7748 C CA  . ILE B 1 471 ? -15.187 9.660   -32.985 1.00 62.28  ? 471  ILE B CA  1 
ATOM   7749 C C   . ILE B 1 471 ? -13.741 10.099  -32.731 1.00 58.94  ? 471  ILE B C   1 
ATOM   7750 O O   . ILE B 1 471 ? -13.321 11.197  -33.119 1.00 53.33  ? 471  ILE B O   1 
ATOM   7751 C CB  . ILE B 1 471 ? -16.043 9.989   -31.751 1.00 66.87  ? 471  ILE B CB  1 
ATOM   7752 C CG1 . ILE B 1 471 ? -17.523 9.900   -32.109 1.00 66.50  ? 471  ILE B CG1 1 
ATOM   7753 C CG2 . ILE B 1 471 ? -15.702 11.360  -31.189 1.00 52.47  ? 471  ILE B CG2 1 
ATOM   7754 C CD1 . ILE B 1 471 ? -18.403 9.612   -30.927 1.00 67.28  ? 471  ILE B CD1 1 
ATOM   7755 N N   . PHE B 1 472 ? -12.997 9.231   -32.059 1.00 49.16  ? 472  PHE B N   1 
ATOM   7756 C CA  . PHE B 1 472 ? -11.569 9.390   -31.879 1.00 51.82  ? 472  PHE B CA  1 
ATOM   7757 C C   . PHE B 1 472 ? -10.874 9.492   -33.242 1.00 59.87  ? 472  PHE B C   1 
ATOM   7758 O O   . PHE B 1 472 ? -10.203 10.490  -33.537 1.00 51.53  ? 472  PHE B O   1 
ATOM   7759 C CB  . PHE B 1 472 ? -11.045 8.187   -31.105 1.00 55.62  ? 472  PHE B CB  1 
ATOM   7760 C CG  . PHE B 1 472 ? -9.607  8.291   -30.717 1.00 57.70  ? 472  PHE B CG  1 
ATOM   7761 C CD1 . PHE B 1 472 ? -9.110  9.457   -30.169 1.00 49.25  ? 472  PHE B CD1 1 
ATOM   7762 C CD2 . PHE B 1 472 ? -8.754  7.207   -30.881 1.00 59.26  ? 472  PHE B CD2 1 
ATOM   7763 C CE1 . PHE B 1 472 ? -7.783  9.545   -29.804 1.00 62.96  ? 472  PHE B CE1 1 
ATOM   7764 C CE2 . PHE B 1 472 ? -7.422  7.283   -30.514 1.00 57.91  ? 472  PHE B CE2 1 
ATOM   7765 C CZ  . PHE B 1 472 ? -6.934  8.450   -29.973 1.00 60.46  ? 472  PHE B CZ  1 
ATOM   7766 N N   . ALA B 1 473 ? -11.053 8.461   -34.072 1.00 52.86  ? 473  ALA B N   1 
ATOM   7767 C CA  . ALA B 1 473 ? -10.455 8.436   -35.403 1.00 50.21  ? 473  ALA B CA  1 
ATOM   7768 C C   . ALA B 1 473 ? -10.723 9.741   -36.133 1.00 48.76  ? 473  ALA B C   1 
ATOM   7769 O O   . ALA B 1 473 ? -9.873  10.257  -36.855 1.00 54.77  ? 473  ALA B O   1 
ATOM   7770 C CB  . ALA B 1 473 ? -10.974 7.258   -36.214 1.00 48.33  ? 473  ALA B CB  1 
ATOM   7771 N N   . GLN B 1 474 ? -11.911 10.284  -35.947 1.00 47.67  ? 474  GLN B N   1 
ATOM   7772 C CA  . GLN B 1 474 ? -12.252 11.514  -36.638 1.00 55.85  ? 474  GLN B CA  1 
ATOM   7773 C C   . GLN B 1 474 ? -11.446 12.705  -36.111 1.00 59.55  ? 474  GLN B C   1 
ATOM   7774 O O   . GLN B 1 474 ? -11.058 13.589  -36.883 1.00 54.31  ? 474  GLN B O   1 
ATOM   7775 C CB  . GLN B 1 474 ? -13.755 11.773  -36.563 1.00 57.05  ? 474  GLN B CB  1 
ATOM   7776 C CG  . GLN B 1 474 ? -14.570 10.895  -37.504 1.00 67.46  ? 474  GLN B CG  1 
ATOM   7777 C CD  . GLN B 1 474 ? -16.078 10.994  -37.273 1.00 75.49  ? 474  GLN B CD  1 
ATOM   7778 O OE1 . GLN B 1 474 ? -16.614 10.406  -36.330 1.00 79.93  ? 474  GLN B OE1 1 
ATOM   7779 N NE2 . GLN B 1 474 ? -16.768 11.723  -38.149 1.00 67.57  ? 474  GLN B NE2 1 
ATOM   7780 N N   . ARG B 1 475 ? -11.185 12.722  -34.805 1.00 52.03  ? 475  ARG B N   1 
ATOM   7781 C CA  . ARG B 1 475 ? -10.363 13.774  -34.231 1.00 53.24  ? 475  ARG B CA  1 
ATOM   7782 C C   . ARG B 1 475 ? -8.970  13.689  -34.826 1.00 56.15  ? 475  ARG B C   1 
ATOM   7783 O O   . ARG B 1 475 ? -8.424  14.691  -35.296 1.00 53.54  ? 475  ARG B O   1 
ATOM   7784 C CB  . ARG B 1 475 ? -10.261 13.631  -32.718 1.00 55.08  ? 475  ARG B CB  1 
ATOM   7785 C CG  . ARG B 1 475 ? -11.338 14.329  -31.909 1.00 63.08  ? 475  ARG B CG  1 
ATOM   7786 C CD  . ARG B 1 475 ? -11.256 13.897  -30.432 1.00 64.88  ? 475  ARG B CD  1 
ATOM   7787 N NE  . ARG B 1 475 ? -9.983  14.303  -29.838 1.00 53.72  ? 475  ARG B NE  1 
ATOM   7788 C CZ  . ARG B 1 475 ? -9.365  13.667  -28.848 1.00 57.85  ? 475  ARG B CZ  1 
ATOM   7789 N NH1 . ARG B 1 475 ? -9.894  12.577  -28.308 1.00 50.42  ? 475  ARG B NH1 1 
ATOM   7790 N NH2 . ARG B 1 475 ? -8.200  14.128  -28.404 1.00 60.50  ? 475  ARG B NH2 1 
ATOM   7791 N N   . LEU B 1 476 ? -8.397  12.488  -34.805 1.00 45.69  ? 476  LEU B N   1 
ATOM   7792 C CA  . LEU B 1 476 ? -7.030  12.304  -35.270 1.00 53.11  ? 476  LEU B CA  1 
ATOM   7793 C C   . LEU B 1 476 ? -6.865  12.728  -36.722 1.00 52.43  ? 476  LEU B C   1 
ATOM   7794 O O   . LEU B 1 476 ? -5.912  13.421  -37.065 1.00 54.91  ? 476  LEU B O   1 
ATOM   7795 C CB  . LEU B 1 476 ? -6.593  10.856  -35.090 1.00 55.92  ? 476  LEU B CB  1 
ATOM   7796 C CG  . LEU B 1 476 ? -6.717  10.354  -33.660 1.00 54.57  ? 476  LEU B CG  1 
ATOM   7797 C CD1 . LEU B 1 476 ? -6.375  8.882   -33.598 1.00 59.30  ? 476  LEU B CD1 1 
ATOM   7798 C CD2 . LEU B 1 476 ? -5.809  11.169  -32.759 1.00 56.82  ? 476  LEU B CD2 1 
ATOM   7799 N N   . MET B 1 477 ? -7.793  12.308  -37.574 1.00 52.19  ? 477  MET B N   1 
ATOM   7800 C CA  . MET B 1 477 ? -7.745  12.685  -38.979 1.00 51.33  ? 477  MET B CA  1 
ATOM   7801 C C   . MET B 1 477 ? -7.780  14.198  -39.118 1.00 53.54  ? 477  MET B C   1 
ATOM   7802 O O   . MET B 1 477 ? -7.167  14.770  -40.017 1.00 54.05  ? 477  MET B O   1 
ATOM   7803 C CB  . MET B 1 477 ? -8.918  12.066  -39.737 1.00 58.15  ? 477  MET B CB  1 
ATOM   7804 C CG  . MET B 1 477 ? -8.831  10.549  -39.903 1.00 60.70  ? 477  MET B CG  1 
ATOM   7805 S SD  . MET B 1 477 ? -10.355 9.815   -40.557 1.00 63.72  ? 477  MET B SD  1 
ATOM   7806 C CE  . MET B 1 477 ? -10.533 10.625  -42.139 1.00 59.39  ? 477  MET B CE  1 
ATOM   7807 N N   . LYS B 1 478 ? -8.506  14.844  -38.213 1.00 58.03  ? 478  LYS B N   1 
ATOM   7808 C CA  . LYS B 1 478 ? -8.672  16.289  -38.258 1.00 55.92  ? 478  LYS B CA  1 
ATOM   7809 C C   . LYS B 1 478 ? -7.372  16.978  -37.840 1.00 52.64  ? 478  LYS B C   1 
ATOM   7810 O O   . LYS B 1 478 ? -7.015  18.013  -38.399 1.00 47.11  ? 478  LYS B O   1 
ATOM   7811 C CB  . LYS B 1 478 ? -9.829  16.719  -37.351 1.00 52.58  ? 478  LYS B CB  1 
ATOM   7812 C CG  . LYS B 1 478 ? -10.844 17.658  -37.994 1.00 62.62  ? 478  LYS B CG  1 
ATOM   7813 C CD  . LYS B 1 478 ? -10.254 19.022  -38.327 1.00 79.95  ? 478  LYS B CD  1 
ATOM   7814 C CE  . LYS B 1 478 ? -11.171 19.837  -39.259 1.00 90.92  ? 478  LYS B CE  1 
ATOM   7815 N NZ  . LYS B 1 478 ? -11.298 19.272  -40.660 1.00 77.36  ? 478  LYS B NZ  1 
ATOM   7816 N N   . TYR B 1 479 ? -6.667  16.408  -36.861 1.00 47.78  ? 479  TYR B N   1 
ATOM   7817 C CA  . TYR B 1 479 ? -5.407  16.996  -36.406 1.00 49.64  ? 479  TYR B CA  1 
ATOM   7818 C C   . TYR B 1 479 ? -4.396  16.900  -37.522 1.00 51.14  ? 479  TYR B C   1 
ATOM   7819 O O   . TYR B 1 479 ? -3.784  17.899  -37.916 1.00 49.13  ? 479  TYR B O   1 
ATOM   7820 C CB  . TYR B 1 479 ? -4.828  16.252  -35.212 1.00 48.69  ? 479  TYR B CB  1 
ATOM   7821 C CG  . TYR B 1 479 ? -5.576  16.389  -33.913 1.00 51.69  ? 479  TYR B CG  1 
ATOM   7822 C CD1 . TYR B 1 479 ? -6.069  17.616  -33.486 1.00 49.95  ? 479  TYR B CD1 1 
ATOM   7823 C CD2 . TYR B 1 479 ? -5.744  15.285  -33.079 1.00 55.55  ? 479  TYR B CD2 1 
ATOM   7824 C CE1 . TYR B 1 479 ? -6.751  17.727  -32.275 1.00 49.82  ? 479  TYR B CE1 1 
ATOM   7825 C CE2 . TYR B 1 479 ? -6.415  15.385  -31.872 1.00 53.28  ? 479  TYR B CE2 1 
ATOM   7826 C CZ  . TYR B 1 479 ? -6.919  16.603  -31.474 1.00 57.00  ? 479  TYR B CZ  1 
ATOM   7827 O OH  . TYR B 1 479 ? -7.584  16.686  -30.268 1.00 58.58  ? 479  TYR B OH  1 
ATOM   7828 N N   . TRP B 1 480 ? -4.227  15.676  -38.016 1.00 47.99  ? 480  TRP B N   1 
ATOM   7829 C CA  . TRP B 1 480 ? -3.293  15.383  -39.098 1.00 49.12  ? 480  TRP B CA  1 
ATOM   7830 C C   . TRP B 1 480 ? -3.540  16.226  -40.341 1.00 47.25  ? 480  TRP B C   1 
ATOM   7831 O O   . TRP B 1 480 ? -2.610  16.821  -40.891 1.00 46.59  ? 480  TRP B O   1 
ATOM   7832 C CB  . TRP B 1 480 ? -3.317  13.891  -39.445 1.00 51.73  ? 480  TRP B CB  1 
ATOM   7833 C CG  . TRP B 1 480 ? -2.212  13.106  -38.798 1.00 48.80  ? 480  TRP B CG  1 
ATOM   7834 C CD1 . TRP B 1 480 ? -1.187  12.458  -39.427 1.00 45.96  ? 480  TRP B CD1 1 
ATOM   7835 C CD2 . TRP B 1 480 ? -2.011  12.900  -37.394 1.00 52.76  ? 480  TRP B CD2 1 
ATOM   7836 N NE1 . TRP B 1 480 ? -0.361  11.853  -38.503 1.00 41.86  ? 480  TRP B NE1 1 
ATOM   7837 C CE2 . TRP B 1 480 ? -0.841  12.113  -37.248 1.00 48.67  ? 480  TRP B CE2 1 
ATOM   7838 C CE3 . TRP B 1 480 ? -2.701  13.304  -36.248 1.00 46.12  ? 480  TRP B CE3 1 
ATOM   7839 C CZ2 . TRP B 1 480 ? -0.354  11.718  -36.003 1.00 49.82  ? 480  TRP B CZ2 1 
ATOM   7840 C CZ3 . TRP B 1 480 ? -2.218  12.911  -35.011 1.00 53.51  ? 480  TRP B CZ3 1 
ATOM   7841 C CH2 . TRP B 1 480 ? -1.055  12.122  -34.897 1.00 48.54  ? 480  TRP B CH2 1 
ATOM   7842 N N   . THR B 1 481 ? -4.788  16.298  -40.782 1.00 46.91  ? 481  THR B N   1 
ATOM   7843 C CA  . THR B 1 481 ? -5.085  17.087  -41.974 1.00 49.98  ? 481  THR B CA  1 
ATOM   7844 C C   . THR B 1 481 ? -5.028  18.594  -41.716 1.00 47.88  ? 481  THR B C   1 
ATOM   7845 O O   . THR B 1 481 ? -4.689  19.358  -42.612 1.00 48.44  ? 481  THR B O   1 
ATOM   7846 C CB  . THR B 1 481 ? -6.419  16.686  -42.624 1.00 50.39  ? 481  THR B CB  1 
ATOM   7847 O OG1 . THR B 1 481 ? -7.438  16.610  -41.626 1.00 57.27  ? 481  THR B OG1 1 
ATOM   7848 C CG2 . THR B 1 481 ? -6.285  15.326  -43.267 1.00 51.31  ? 481  THR B CG2 1 
ATOM   7849 N N   . ASN B 1 482 ? -5.351  19.024  -40.499 1.00 48.76  ? 482  ASN B N   1 
ATOM   7850 C CA  . ASN B 1 482 ? -5.190  20.434  -40.150 1.00 53.07  ? 482  ASN B CA  1 
ATOM   7851 C C   . ASN B 1 482 ? -3.736  20.772  -40.216 1.00 46.54  ? 482  ASN B C   1 
ATOM   7852 O O   . ASN B 1 482 ? -3.340  21.770  -40.809 1.00 47.76  ? 482  ASN B O   1 
ATOM   7853 C CB  . ASN B 1 482 ? -5.692  20.747  -38.746 1.00 52.34  ? 482  ASN B CB  1 
ATOM   7854 C CG  . ASN B 1 482 ? -7.183  20.900  -38.694 1.00 60.83  ? 482  ASN B CG  1 
ATOM   7855 O OD1 . ASN B 1 482 ? -7.822  21.205  -39.702 1.00 59.78  ? 482  ASN B OD1 1 
ATOM   7856 N ND2 . ASN B 1 482 ? -7.755  20.690  -37.514 1.00 68.49  ? 482  ASN B ND2 1 
ATOM   7857 N N   . PHE B 1 483 ? -2.935  19.921  -39.601 1.00 42.89  ? 483  PHE B N   1 
ATOM   7858 C CA  . PHE B 1 483 ? -1.514  20.111  -39.676 1.00 46.54  ? 483  PHE B CA  1 
ATOM   7859 C C   . PHE B 1 483 ? -1.094  20.166  -41.150 1.00 53.69  ? 483  PHE B C   1 
ATOM   7860 O O   . PHE B 1 483 ? -0.279  21.006  -41.538 1.00 52.50  ? 483  PHE B O   1 
ATOM   7861 C CB  . PHE B 1 483 ? -0.760  19.017  -38.923 1.00 46.88  ? 483  PHE B CB  1 
ATOM   7862 C CG  . PHE B 1 483 ? 0.719   19.125  -39.066 1.00 45.97  ? 483  PHE B CG  1 
ATOM   7863 C CD1 . PHE B 1 483 ? 1.429   20.050  -38.318 1.00 44.94  ? 483  PHE B CD1 1 
ATOM   7864 C CD2 . PHE B 1 483 ? 1.404   18.329  -39.980 1.00 45.56  ? 483  PHE B CD2 1 
ATOM   7865 C CE1 . PHE B 1 483 ? 2.801   20.176  -38.463 1.00 45.36  ? 483  PHE B CE1 1 
ATOM   7866 C CE2 . PHE B 1 483 ? 2.776   18.447  -40.131 1.00 47.45  ? 483  PHE B CE2 1 
ATOM   7867 C CZ  . PHE B 1 483 ? 3.475   19.375  -39.372 1.00 47.94  ? 483  PHE B CZ  1 
ATOM   7868 N N   . ALA B 1 484 ? -1.660  19.290  -41.978 1.00 49.13  ? 484  ALA B N   1 
ATOM   7869 C CA  . ALA B 1 484 ? -1.301  19.280  -43.401 1.00 49.45  ? 484  ALA B CA  1 
ATOM   7870 C C   . ALA B 1 484 ? -1.649  20.595  -44.088 1.00 46.83  ? 484  ALA B C   1 
ATOM   7871 O O   . ALA B 1 484 ? -0.858  21.118  -44.865 1.00 53.24  ? 484  ALA B O   1 
ATOM   7872 C CB  . ALA B 1 484 ? -1.950  18.105  -44.127 1.00 45.35  ? 484  ALA B CB  1 
ATOM   7873 N N   . ARG B 1 485 ? -2.829  21.131  -43.791 1.00 53.94  ? 485  ARG B N   1 
ATOM   7874 C CA  . ARG B 1 485 ? -3.272  22.393  -44.388 1.00 58.77  ? 485  ARG B CA  1 
ATOM   7875 C C   . ARG B 1 485 ? -2.445  23.586  -43.921 1.00 55.53  ? 485  ARG B C   1 
ATOM   7876 O O   . ARG B 1 485 ? -2.105  24.448  -44.718 1.00 55.77  ? 485  ARG B O   1 
ATOM   7877 C CB  . ARG B 1 485 ? -4.752  22.660  -44.090 1.00 50.74  ? 485  ARG B CB  1 
ATOM   7878 C CG  . ARG B 1 485 ? -5.715  21.799  -44.891 1.00 66.16  ? 485  ARG B CG  1 
ATOM   7879 C CD  . ARG B 1 485 ? -7.171  22.001  -44.460 1.00 59.66  ? 485  ARG B CD  1 
ATOM   7880 N NE  . ARG B 1 485 ? -7.537  21.086  -43.389 1.00 64.81  ? 485  ARG B NE  1 
ATOM   7881 C CZ  . ARG B 1 485 ? -8.193  19.939  -43.569 1.00 80.58  ? 485  ARG B CZ  1 
ATOM   7882 N NH1 . ARG B 1 485 ? -8.573  19.573  -44.793 1.00 71.56  ? 485  ARG B NH1 1 
ATOM   7883 N NH2 . ARG B 1 485 ? -8.476  19.161  -42.522 1.00 66.71  ? 485  ARG B NH2 1 
ATOM   7884 N N   . THR B 1 486 ? -2.101  23.618  -42.635 1.00 54.95  ? 486  THR B N   1 
ATOM   7885 C CA  . THR B 1 486 ? -1.615  24.850  -42.020 1.00 52.54  ? 486  THR B CA  1 
ATOM   7886 C C   . THR B 1 486 ? -0.323  24.737  -41.233 1.00 56.51  ? 486  THR B C   1 
ATOM   7887 O O   . THR B 1 486 ? 0.220   25.751  -40.801 1.00 58.28  ? 486  THR B O   1 
ATOM   7888 C CB  . THR B 1 486 ? -2.628  25.381  -41.016 1.00 54.37  ? 486  THR B CB  1 
ATOM   7889 O OG1 . THR B 1 486 ? -2.797  24.409  -39.968 1.00 52.89  ? 486  THR B OG1 1 
ATOM   7890 C CG2 . THR B 1 486 ? -3.955  25.659  -41.696 1.00 49.87  ? 486  THR B CG2 1 
ATOM   7891 N N   . GLY B 1 487 ? 0.156   23.523  -41.004 1.00 53.71  ? 487  GLY B N   1 
ATOM   7892 C CA  . GLY B 1 487 ? 1.351   23.354  -40.195 1.00 47.63  ? 487  GLY B CA  1 
ATOM   7893 C C   . GLY B 1 487 ? 1.038   23.457  -38.718 1.00 45.69  ? 487  GLY B C   1 
ATOM   7894 O O   . GLY B 1 487 ? 1.952   23.527  -37.896 1.00 46.69  ? 487  GLY B O   1 
ATOM   7895 N N   . ASP B 1 488 ? -0.259  23.455  -38.396 1.00 49.54  ? 488  ASP B N   1 
ATOM   7896 C CA  . ASP B 1 488 ? -0.763  23.524  -37.026 1.00 48.87  ? 488  ASP B CA  1 
ATOM   7897 C C   . ASP B 1 488 ? -1.948  22.578  -36.898 1.00 49.88  ? 488  ASP B C   1 
ATOM   7898 O O   . ASP B 1 488 ? -2.946  22.771  -37.576 1.00 56.55  ? 488  ASP B O   1 
ATOM   7899 C CB  . ASP B 1 488 ? -1.219  24.957  -36.736 1.00 55.19  ? 488  ASP B CB  1 
ATOM   7900 C CG  . ASP B 1 488 ? -1.618  25.188  -35.277 1.00 60.72  ? 488  ASP B CG  1 
ATOM   7901 O OD1 . ASP B 1 488 ? -2.158  24.275  -34.606 1.00 56.18  ? 488  ASP B OD1 1 
ATOM   7902 O OD2 . ASP B 1 488 ? -1.413  26.326  -34.808 1.00 61.59  ? 488  ASP B OD2 1 
ATOM   7903 N N   . PRO B 1 489 ? -1.853  21.570  -36.008 1.00 48.31  ? 489  PRO B N   1 
ATOM   7904 C CA  . PRO B 1 489 ? -2.873  20.524  -35.830 1.00 47.13  ? 489  PRO B CA  1 
ATOM   7905 C C   . PRO B 1 489 ? -4.208  21.038  -35.294 1.00 54.75  ? 489  PRO B C   1 
ATOM   7906 O O   . PRO B 1 489 ? -5.188  20.288  -35.298 1.00 58.26  ? 489  PRO B O   1 
ATOM   7907 C CB  . PRO B 1 489 ? -2.266  19.597  -34.766 1.00 47.67  ? 489  PRO B CB  1 
ATOM   7908 C CG  . PRO B 1 489 ? -0.957  20.159  -34.400 1.00 51.54  ? 489  PRO B CG  1 
ATOM   7909 C CD  . PRO B 1 489 ? -0.833  21.534  -34.952 1.00 45.91  ? 489  PRO B CD  1 
ATOM   7910 N N   . ASN B 1 490 ? -4.243  22.281  -34.825 1.00 55.68  ? 490  ASN B N   1 
ATOM   7911 C CA  . ASN B 1 490 ? -5.424  22.812  -34.149 1.00 59.44  ? 490  ASN B CA  1 
ATOM   7912 C C   . ASN B 1 490 ? -6.539  23.254  -35.096 1.00 64.47  ? 490  ASN B C   1 
ATOM   7913 O O   . ASN B 1 490 ? -6.292  23.936  -36.087 1.00 59.03  ? 490  ASN B O   1 
ATOM   7914 C CB  . ASN B 1 490 ? -5.040  23.970  -33.222 1.00 49.06  ? 490  ASN B CB  1 
ATOM   7915 C CG  . ASN B 1 490 ? -4.272  23.516  -32.000 1.00 59.64  ? 490  ASN B CG  1 
ATOM   7916 O OD1 . ASN B 1 490 ? -4.851  22.964  -31.060 1.00 50.42  ? 490  ASN B OD1 1 
ATOM   7917 N ND2 . ASN B 1 490 ? -2.955  23.768  -31.993 1.00 57.30  ? 490  ASN B ND2 1 
ATOM   7918 N N   . ASP B 1 491 ? -7.768  22.866  -34.767 1.00 74.73  ? 491  ASP B N   1 
ATOM   7919 C CA  . ASP B 1 491 ? -8.950  23.256  -35.531 1.00 83.14  ? 491  ASP B CA  1 
ATOM   7920 C C   . ASP B 1 491 ? -9.068  24.775  -35.576 1.00 82.51  ? 491  ASP B C   1 
ATOM   7921 O O   . ASP B 1 491 ? -9.432  25.391  -34.578 1.00 87.93  ? 491  ASP B O   1 
ATOM   7922 C CB  . ASP B 1 491 ? -10.207 22.648  -34.902 1.00 90.03  ? 491  ASP B CB  1 
ATOM   7923 C CG  . ASP B 1 491 ? -11.253 22.277  -35.935 1.00 99.84  ? 491  ASP B CG  1 
ATOM   7924 O OD1 . ASP B 1 491 ? -11.684 23.170  -36.701 1.00 96.32  ? 491  ASP B OD1 1 
ATOM   7925 O OD2 . ASP B 1 491 ? -11.639 21.087  -35.980 1.00 100.52 ? 491  ASP B OD2 1 
ATOM   7926 N N   . PRO B 1 492 ? -8.796  25.373  -36.751 1.00 86.65  ? 492  PRO B N   1 
ATOM   7927 C CA  . PRO B 1 492 ? -8.558  26.811  -36.964 1.00 90.38  ? 492  PRO B CA  1 
ATOM   7928 C C   . PRO B 1 492 ? -9.787  27.676  -36.682 1.00 91.71  ? 492  PRO B C   1 
ATOM   7929 O O   . PRO B 1 492 ? -9.673  28.907  -36.609 1.00 73.14  ? 492  PRO B O   1 
ATOM   7930 C CB  . PRO B 1 492 ? -8.201  26.899  -38.458 1.00 86.97  ? 492  PRO B CB  1 
ATOM   7931 C CG  . PRO B 1 492 ? -8.143  25.471  -38.961 1.00 81.06  ? 492  PRO B CG  1 
ATOM   7932 C CD  . PRO B 1 492 ? -8.981  24.668  -38.029 1.00 83.72  ? 492  PRO B CD  1 
ATOM   7933 N N   . ARG B 1 493 ? -10.943 27.028  -36.556 1.00 89.64  ? 493  ARG B N   1 
ATOM   7934 C CA  . ARG B 1 493 ? -12.165 27.683  -36.113 1.00 87.53  ? 493  ARG B CA  1 
ATOM   7935 C C   . ARG B 1 493 ? -12.866 26.713  -35.169 1.00 99.33  ? 493  ARG B C   1 
ATOM   7936 O O   . ARG B 1 493 ? -13.650 25.856  -35.588 1.00 99.45  ? 493  ARG B O   1 
ATOM   7937 C CB  . ARG B 1 493 ? -13.054 28.075  -37.299 1.00 88.15  ? 493  ARG B CB  1 
ATOM   7938 N N   . ASP B 1 494 ? -12.535 26.848  -33.888 1.00 103.02 ? 494  ASP B N   1 
ATOM   7939 C CA  . ASP B 1 494 ? -12.982 25.946  -32.835 1.00 99.76  ? 494  ASP B CA  1 
ATOM   7940 C C   . ASP B 1 494 ? -12.306 26.367  -31.541 1.00 95.12  ? 494  ASP B C   1 
ATOM   7941 O O   . ASP B 1 494 ? -11.080 26.288  -31.408 1.00 95.34  ? 494  ASP B O   1 
ATOM   7942 C CB  . ASP B 1 494 ? -12.613 24.489  -33.149 1.00 100.83 ? 494  ASP B CB  1 
ATOM   7943 C CG  . ASP B 1 494 ? -12.675 23.583  -31.914 1.00 113.95 ? 494  ASP B CG  1 
ATOM   7944 O OD1 . ASP B 1 494 ? -13.792 23.148  -31.536 1.00 112.11 ? 494  ASP B OD1 1 
ATOM   7945 O OD2 . ASP B 1 494 ? -11.602 23.302  -31.325 1.00 104.18 ? 494  ASP B OD2 1 
ATOM   7946 N N   . SER B 1 495 ? -13.109 26.828  -30.591 1.00 96.93  ? 495  SER B N   1 
ATOM   7947 C CA  . SER B 1 495 ? -12.600 27.146  -29.264 1.00 97.83  ? 495  SER B CA  1 
ATOM   7948 C C   . SER B 1 495 ? -12.583 25.908  -28.363 1.00 102.94 ? 495  SER B C   1 
ATOM   7949 O O   . SER B 1 495 ? -13.425 25.004  -28.487 1.00 99.12  ? 495  SER B O   1 
ATOM   7950 C CB  . SER B 1 495 ? -13.425 28.273  -28.620 1.00 92.72  ? 495  SER B CB  1 
ATOM   7951 O OG  . SER B 1 495 ? -13.165 28.394  -27.224 1.00 78.23  ? 495  SER B OG  1 
ATOM   7952 N N   . LYS B 1 496 ? -11.603 25.874  -27.466 1.00 99.16  ? 496  LYS B N   1 
ATOM   7953 C CA  . LYS B 1 496 ? -11.563 24.868  -26.412 1.00 115.09 ? 496  LYS B CA  1 
ATOM   7954 C C   . LYS B 1 496 ? -11.357 23.440  -26.941 1.00 115.10 ? 496  LYS B C   1 
ATOM   7955 O O   . LYS B 1 496 ? -12.122 22.938  -27.779 1.00 105.69 ? 496  LYS B O   1 
ATOM   7956 C CB  . LYS B 1 496 ? -12.837 24.938  -25.551 1.00 104.55 ? 496  LYS B CB  1 
ATOM   7957 C CG  . LYS B 1 496 ? -12.595 24.845  -24.039 1.00 93.51  ? 496  LYS B CG  1 
ATOM   7958 C CD  . LYS B 1 496 ? -12.484 26.226  -23.401 1.00 74.54  ? 496  LYS B CD  1 
ATOM   7959 C CE  . LYS B 1 496 ? -13.802 26.997  -23.518 1.00 80.66  ? 496  LYS B CE  1 
ATOM   7960 N NZ  . LYS B 1 496 ? -14.955 26.305  -22.854 1.00 74.49  ? 496  LYS B NZ  1 
ATOM   7961 N N   . SER B 1 497 ? -10.300 22.809  -26.436 1.00 108.00 ? 497  SER B N   1 
ATOM   7962 C CA  . SER B 1 497 ? -10.072 21.374  -26.583 1.00 97.27  ? 497  SER B CA  1 
ATOM   7963 C C   . SER B 1 497 ? -9.312  20.774  -25.378 1.00 96.78  ? 497  SER B C   1 
ATOM   7964 O O   . SER B 1 497 ? -9.513  19.602  -25.048 1.00 90.44  ? 497  SER B O   1 
ATOM   7965 C CB  . SER B 1 497 ? -9.387  21.046  -27.916 1.00 104.46 ? 497  SER B CB  1 
ATOM   7966 O OG  . SER B 1 497 ? -8.643  22.154  -28.398 1.00 107.27 ? 497  SER B OG  1 
ATOM   7967 N N   . PRO B 1 498 ? -8.436  21.570  -24.718 1.00 95.18  ? 498  PRO B N   1 
ATOM   7968 C CA  . PRO B 1 498 ? -7.959  22.903  -25.115 1.00 93.38  ? 498  PRO B CA  1 
ATOM   7969 C C   . PRO B 1 498 ? -6.938  22.790  -26.235 1.00 77.97  ? 498  PRO B C   1 
ATOM   7970 O O   . PRO B 1 498 ? -6.787  21.729  -26.834 1.00 78.36  ? 498  PRO B O   1 
ATOM   7971 C CB  . PRO B 1 498 ? -7.273  23.419  -23.843 1.00 90.37  ? 498  PRO B CB  1 
ATOM   7972 C CG  . PRO B 1 498 ? -6.851  22.158  -23.134 1.00 86.95  ? 498  PRO B CG  1 
ATOM   7973 C CD  . PRO B 1 498 ? -8.038  21.267  -23.330 1.00 78.97  ? 498  PRO B CD  1 
ATOM   7974 N N   . GLN B 1 499 ? -6.221  23.873  -26.490 1.00 73.19  ? 499  GLN B N   1 
ATOM   7975 C CA  . GLN B 1 499 ? -5.265  23.924  -27.589 1.00 64.13  ? 499  GLN B CA  1 
ATOM   7976 C C   . GLN B 1 499 ? -4.094  22.932  -27.486 1.00 55.49  ? 499  GLN B C   1 
ATOM   7977 O O   . GLN B 1 499 ? -3.632  22.604  -26.394 1.00 55.03  ? 499  GLN B O   1 
ATOM   7978 C CB  . GLN B 1 499 ? -4.755  25.358  -27.723 1.00 63.73  ? 499  GLN B CB  1 
ATOM   7979 C CG  . GLN B 1 499 ? -5.890  26.338  -27.960 1.00 57.09  ? 499  GLN B CG  1 
ATOM   7980 C CD  . GLN B 1 499 ? -6.574  26.100  -29.299 1.00 65.77  ? 499  GLN B CD  1 
ATOM   7981 O OE1 . GLN B 1 499 ? -5.995  26.368  -30.355 1.00 65.87  ? 499  GLN B OE1 1 
ATOM   7982 N NE2 . GLN B 1 499 ? -7.810  25.600  -29.264 1.00 67.68  ? 499  GLN B NE2 1 
ATOM   7983 N N   . TRP B 1 500 ? -3.641  22.444  -28.641 1.00 53.05  ? 500  TRP B N   1 
ATOM   7984 C CA  . TRP B 1 500 ? -2.381  21.703  -28.748 1.00 53.72  ? 500  TRP B CA  1 
ATOM   7985 C C   . TRP B 1 500 ? -1.237  22.713  -28.854 1.00 50.61  ? 500  TRP B C   1 
ATOM   7986 O O   . TRP B 1 500 ? -1.100  23.395  -29.870 1.00 51.64  ? 500  TRP B O   1 
ATOM   7987 C CB  . TRP B 1 500 ? -2.382  20.822  -30.000 1.00 49.71  ? 500  TRP B CB  1 
ATOM   7988 C CG  . TRP B 1 500 ? -1.274  19.803  -30.055 1.00 48.64  ? 500  TRP B CG  1 
ATOM   7989 C CD1 . TRP B 1 500 ? -0.060  19.881  -29.450 1.00 41.89  ? 500  TRP B CD1 1 
ATOM   7990 C CD2 . TRP B 1 500 ? -1.278  18.564  -30.790 1.00 51.09  ? 500  TRP B CD2 1 
ATOM   7991 N NE1 . TRP B 1 500 ? 0.689   18.762  -29.741 1.00 45.01  ? 500  TRP B NE1 1 
ATOM   7992 C CE2 . TRP B 1 500 ? -0.032  17.940  -30.564 1.00 46.16  ? 500  TRP B CE2 1 
ATOM   7993 C CE3 . TRP B 1 500 ? -2.217  17.922  -31.616 1.00 49.79  ? 500  TRP B CE3 1 
ATOM   7994 C CZ2 . TRP B 1 500 ? 0.302   16.701  -31.124 1.00 51.77  ? 500  TRP B CZ2 1 
ATOM   7995 C CZ3 . TRP B 1 500 ? -1.884  16.682  -32.176 1.00 45.04  ? 500  TRP B CZ3 1 
ATOM   7996 C CH2 . TRP B 1 500 ? -0.634  16.090  -31.926 1.00 47.86  ? 500  TRP B CH2 1 
ATOM   7997 N N   . PRO B 1 501 ? -0.415  22.818  -27.802 1.00 45.50  ? 501  PRO B N   1 
ATOM   7998 C CA  . PRO B 1 501 ? 0.674   23.796  -27.800 1.00 48.76  ? 501  PRO B CA  1 
ATOM   7999 C C   . PRO B 1 501 ? 1.917   23.242  -28.499 1.00 43.84  ? 501  PRO B C   1 
ATOM   8000 O O   . PRO B 1 501 ? 2.156   22.033  -28.497 1.00 41.13  ? 501  PRO B O   1 
ATOM   8001 C CB  . PRO B 1 501 ? 0.966   23.995  -26.302 1.00 39.34  ? 501  PRO B CB  1 
ATOM   8002 C CG  . PRO B 1 501 ? 0.141   22.942  -25.563 1.00 49.35  ? 501  PRO B CG  1 
ATOM   8003 C CD  . PRO B 1 501 ? -0.400  21.989  -26.588 1.00 46.12  ? 501  PRO B CD  1 
ATOM   8004 N N   . PRO B 1 502 ? 2.705   24.125  -29.107 1.00 44.52  ? 502  PRO B N   1 
ATOM   8005 C CA  . PRO B 1 502 ? 3.974   23.707  -29.714 1.00 45.48  ? 502  PRO B CA  1 
ATOM   8006 C C   . PRO B 1 502 ? 4.946   23.132  -28.687 1.00 46.95  ? 502  PRO B C   1 
ATOM   8007 O O   . PRO B 1 502 ? 4.985   23.559  -27.536 1.00 49.09  ? 502  PRO B O   1 
ATOM   8008 C CB  . PRO B 1 502 ? 4.529   25.013  -30.281 1.00 41.99  ? 502  PRO B CB  1 
ATOM   8009 C CG  . PRO B 1 502 ? 3.308   25.844  -30.559 1.00 52.74  ? 502  PRO B CG  1 
ATOM   8010 C CD  . PRO B 1 502 ? 2.332   25.502  -29.471 1.00 47.13  ? 502  PRO B CD  1 
ATOM   8011 N N   . TYR B 1 503 ? 5.738   22.159  -29.105 1.00 47.24  ? 503  TYR B N   1 
ATOM   8012 C CA  . TYR B 1 503 ? 6.787   21.657  -28.246 1.00 46.23  ? 503  TYR B CA  1 
ATOM   8013 C C   . TYR B 1 503 ? 7.990   22.600  -28.313 1.00 46.35  ? 503  TYR B C   1 
ATOM   8014 O O   . TYR B 1 503 ? 8.412   23.012  -29.396 1.00 53.20  ? 503  TYR B O   1 
ATOM   8015 C CB  . TYR B 1 503 ? 7.176   20.237  -28.650 1.00 43.99  ? 503  TYR B CB  1 
ATOM   8016 C CG  . TYR B 1 503 ? 8.290   19.657  -27.818 1.00 46.18  ? 503  TYR B CG  1 
ATOM   8017 C CD1 . TYR B 1 503 ? 9.625   19.888  -28.148 1.00 43.31  ? 503  TYR B CD1 1 
ATOM   8018 C CD2 . TYR B 1 503 ? 8.009   18.880  -26.691 1.00 44.21  ? 503  TYR B CD2 1 
ATOM   8019 C CE1 . TYR B 1 503 ? 10.645  19.353  -27.382 1.00 49.66  ? 503  TYR B CE1 1 
ATOM   8020 C CE2 . TYR B 1 503 ? 9.022   18.350  -25.914 1.00 42.19  ? 503  TYR B CE2 1 
ATOM   8021 C CZ  . TYR B 1 503 ? 10.330  18.585  -26.267 1.00 46.24  ? 503  TYR B CZ  1 
ATOM   8022 O OH  . TYR B 1 503 ? 11.330  18.056  -25.508 1.00 48.21  ? 503  TYR B OH  1 
ATOM   8023 N N   . THR B 1 504 ? 8.519   22.948  -27.146 1.00 45.36  ? 504  THR B N   1 
ATOM   8024 C CA  . THR B 1 504 ? 9.664   23.847  -27.029 1.00 52.69  ? 504  THR B CA  1 
ATOM   8025 C C   . THR B 1 504 ? 10.612  23.258  -26.017 1.00 55.10  ? 504  THR B C   1 
ATOM   8026 O O   . THR B 1 504 ? 10.195  22.514  -25.129 1.00 54.50  ? 504  THR B O   1 
ATOM   8027 C CB  . THR B 1 504 ? 9.260   25.222  -26.485 1.00 58.34  ? 504  THR B CB  1 
ATOM   8028 O OG1 . THR B 1 504 ? 8.762   25.076  -25.144 1.00 54.97  ? 504  THR B OG1 1 
ATOM   8029 C CG2 . THR B 1 504 ? 8.194   25.853  -27.363 1.00 40.19  ? 504  THR B CG2 1 
ATOM   8030 N N   . THR B 1 505 ? 11.885  23.598  -26.140 1.00 52.94  ? 505  THR B N   1 
ATOM   8031 C CA  . THR B 1 505 ? 12.893  23.074  -25.230 1.00 57.03  ? 505  THR B CA  1 
ATOM   8032 C C   . THR B 1 505 ? 12.637  23.546  -23.804 1.00 52.99  ? 505  THR B C   1 
ATOM   8033 O O   . THR B 1 505 ? 12.850  22.802  -22.853 1.00 58.49  ? 505  THR B O   1 
ATOM   8034 C CB  . THR B 1 505 ? 14.307  23.456  -25.682 1.00 60.98  ? 505  THR B CB  1 
ATOM   8035 O OG1 . THR B 1 505 ? 14.292  24.783  -26.221 1.00 69.38  ? 505  THR B OG1 1 
ATOM   8036 C CG2 . THR B 1 505 ? 14.775  22.503  -26.771 1.00 62.02  ? 505  THR B CG2 1 
ATOM   8037 N N   . ALA B 1 506 ? 12.144  24.770  -23.661 1.00 56.55  ? 506  ALA B N   1 
ATOM   8038 C CA  . ALA B 1 506 ? 11.785  25.295  -22.342 1.00 59.49  ? 506  ALA B CA  1 
ATOM   8039 C C   . ALA B 1 506 ? 10.629  24.513  -21.684 1.00 66.66  ? 506  ALA B C   1 
ATOM   8040 O O   . ALA B 1 506 ? 10.846  23.708  -20.769 1.00 65.30  ? 506  ALA B O   1 
ATOM   8041 C CB  . ALA B 1 506 ? 11.445  26.784  -22.440 1.00 59.11  ? 506  ALA B CB  1 
ATOM   8042 N N   . ALA B 1 507 ? 9.405   24.744  -22.158 1.00 55.96  ? 507  ALA B N   1 
ATOM   8043 C CA  . ALA B 1 507 ? 8.232   24.129  -21.542 1.00 55.38  ? 507  ALA B CA  1 
ATOM   8044 C C   . ALA B 1 507 ? 8.075   22.628  -21.834 1.00 51.73  ? 507  ALA B C   1 
ATOM   8045 O O   . ALA B 1 507 ? 7.479   21.915  -21.040 1.00 50.02  ? 507  ALA B O   1 
ATOM   8046 C CB  . ALA B 1 507 ? 6.965   24.898  -21.911 1.00 47.58  ? 507  ALA B CB  1 
ATOM   8047 N N   . GLN B 1 508 ? 8.608   22.163  -22.960 1.00 50.21  ? 508  GLN B N   1 
ATOM   8048 C CA  . GLN B 1 508 ? 8.559   20.743  -23.338 1.00 53.43  ? 508  GLN B CA  1 
ATOM   8049 C C   . GLN B 1 508 ? 7.154   20.137  -23.331 1.00 50.69  ? 508  GLN B C   1 
ATOM   8050 O O   . GLN B 1 508 ? 6.966   18.966  -22.986 1.00 48.06  ? 508  GLN B O   1 
ATOM   8051 C CB  . GLN B 1 508 ? 9.490   19.917  -22.453 1.00 48.01  ? 508  GLN B CB  1 
ATOM   8052 C CG  . GLN B 1 508 ? 10.901  20.454  -22.427 1.00 58.12  ? 508  GLN B CG  1 
ATOM   8053 C CD  . GLN B 1 508 ? 11.799  19.699  -21.470 1.00 60.13  ? 508  GLN B CD  1 
ATOM   8054 O OE1 . GLN B 1 508 ? 11.923  18.476  -21.545 1.00 55.21  ? 508  GLN B OE1 1 
ATOM   8055 N NE2 . GLN B 1 508 ? 12.438  20.429  -20.566 1.00 65.79  ? 508  GLN B NE2 1 
ATOM   8056 N N   . GLN B 1 509 ? 6.170   20.932  -23.728 1.00 45.47  ? 509  GLN B N   1 
ATOM   8057 C CA  . GLN B 1 509 ? 4.789   20.458  -23.760 1.00 49.86  ? 509  GLN B CA  1 
ATOM   8058 C C   . GLN B 1 509 ? 4.453   19.534  -24.925 1.00 49.87  ? 509  GLN B C   1 
ATOM   8059 O O   . GLN B 1 509 ? 4.865   19.749  -26.067 1.00 46.61  ? 509  GLN B O   1 
ATOM   8060 C CB  . GLN B 1 509 ? 3.838   21.634  -23.798 1.00 43.87  ? 509  GLN B CB  1 
ATOM   8061 C CG  . GLN B 1 509 ? 3.863   22.458  -22.566 1.00 46.11  ? 509  GLN B CG  1 
ATOM   8062 C CD  . GLN B 1 509 ? 3.154   23.758  -22.780 1.00 52.87  ? 509  GLN B CD  1 
ATOM   8063 O OE1 . GLN B 1 509 ? 3.646   24.645  -23.485 1.00 44.29  ? 509  GLN B OE1 1 
ATOM   8064 N NE2 . GLN B 1 509 ? 1.980   23.885  -22.182 1.00 57.44  ? 509  GLN B NE2 1 
ATOM   8065 N N   . TYR B 1 510 ? 3.664   18.520  -24.619 1.00 46.88  ? 510  TYR B N   1 
ATOM   8066 C CA  . TYR B 1 510 ? 3.202   17.579  -25.614 1.00 51.60  ? 510  TYR B CA  1 
ATOM   8067 C C   . TYR B 1 510 ? 1.799   17.116  -25.187 1.00 50.41  ? 510  TYR B C   1 
ATOM   8068 O O   . TYR B 1 510 ? 1.337   17.446  -24.098 1.00 50.41  ? 510  TYR B O   1 
ATOM   8069 C CB  . TYR B 1 510 ? 4.188   16.425  -25.699 1.00 45.55  ? 510  TYR B CB  1 
ATOM   8070 C CG  . TYR B 1 510 ? 4.209   15.576  -24.461 1.00 49.08  ? 510  TYR B CG  1 
ATOM   8071 C CD1 . TYR B 1 510 ? 5.061   15.865  -23.395 1.00 51.02  ? 510  TYR B CD1 1 
ATOM   8072 C CD2 . TYR B 1 510 ? 3.368   14.479  -24.353 1.00 47.45  ? 510  TYR B CD2 1 
ATOM   8073 C CE1 . TYR B 1 510 ? 5.072   15.067  -22.251 1.00 48.97  ? 510  TYR B CE1 1 
ATOM   8074 C CE2 . TYR B 1 510 ? 3.372   13.686  -23.232 1.00 51.20  ? 510  TYR B CE2 1 
ATOM   8075 C CZ  . TYR B 1 510 ? 4.221   13.973  -22.186 1.00 54.68  ? 510  TYR B CZ  1 
ATOM   8076 O OH  . TYR B 1 510 ? 4.177   13.148  -21.083 1.00 56.50  ? 510  TYR B OH  1 
ATOM   8077 N N   . VAL B 1 511 ? 1.092   16.385  -26.034 1.00 43.44  ? 511  VAL B N   1 
ATOM   8078 C CA  . VAL B 1 511 ? -0.277  16.046  -25.671 1.00 41.91  ? 511  VAL B CA  1 
ATOM   8079 C C   . VAL B 1 511 ? -0.531  14.556  -25.680 1.00 47.32  ? 511  VAL B C   1 
ATOM   8080 O O   . VAL B 1 511 ? 0.185   13.783  -26.320 1.00 49.95  ? 511  VAL B O   1 
ATOM   8081 C CB  . VAL B 1 511 ? -1.286  16.742  -26.575 1.00 47.74  ? 511  VAL B CB  1 
ATOM   8082 C CG1 . VAL B 1 511 ? -1.087  18.245  -26.499 1.00 42.06  ? 511  VAL B CG1 1 
ATOM   8083 C CG2 . VAL B 1 511 ? -1.159  16.229  -28.020 1.00 47.04  ? 511  VAL B CG2 1 
ATOM   8084 N N   . SER B 1 512 ? -1.546  14.143  -24.942 1.00 48.25  ? 512  SER B N   1 
ATOM   8085 C CA  . SER B 1 512 ? -1.892  12.736  -24.912 1.00 54.36  ? 512  SER B CA  1 
ATOM   8086 C C   . SER B 1 512 ? -3.069  12.518  -25.852 1.00 51.39  ? 512  SER B C   1 
ATOM   8087 O O   . SER B 1 512 ? -4.106  13.169  -25.726 1.00 52.07  ? 512  SER B O   1 
ATOM   8088 C CB  . SER B 1 512 ? -2.230  12.293  -23.495 1.00 43.75  ? 512  SER B CB  1 
ATOM   8089 O OG  . SER B 1 512 ? -3.345  13.011  -23.023 1.00 55.81  ? 512  SER B OG  1 
ATOM   8090 N N   . LEU B 1 513 ? -2.883  11.629  -26.819 1.00 49.26  ? 513  LEU B N   1 
ATOM   8091 C CA  . LEU B 1 513 ? -3.950  11.269  -27.744 1.00 55.03  ? 513  LEU B CA  1 
ATOM   8092 C C   . LEU B 1 513 ? -4.622  9.985   -27.265 1.00 53.78  ? 513  LEU B C   1 
ATOM   8093 O O   . LEU B 1 513 ? -4.033  8.900   -27.327 1.00 52.94  ? 513  LEU B O   1 
ATOM   8094 C CB  . LEU B 1 513 ? -3.391  11.073  -29.151 1.00 46.86  ? 513  LEU B CB  1 
ATOM   8095 C CG  . LEU B 1 513 ? -2.803  12.324  -29.790 1.00 49.59  ? 513  LEU B CG  1 
ATOM   8096 C CD1 . LEU B 1 513 ? -2.129  12.036  -31.138 1.00 43.84  ? 513  LEU B CD1 1 
ATOM   8097 C CD2 . LEU B 1 513 ? -3.890  13.354  -29.934 1.00 47.74  ? 513  LEU B CD2 1 
ATOM   8098 N N   . ASN B 1 514 ? -5.842  10.121  -26.760 1.00 48.92  ? 514  ASN B N   1 
ATOM   8099 C CA  . ASN B 1 514 ? -6.652  8.968   -26.366 1.00 60.30  ? 514  ASN B CA  1 
ATOM   8100 C C   . ASN B 1 514 ? -8.129  9.337   -26.363 1.00 59.55  ? 514  ASN B C   1 
ATOM   8101 O O   . ASN B 1 514 ? -8.518  10.360  -26.930 1.00 61.61  ? 514  ASN B O   1 
ATOM   8102 C CB  . ASN B 1 514 ? -6.215  8.379   -25.011 1.00 57.69  ? 514  ASN B CB  1 
ATOM   8103 C CG  . ASN B 1 514 ? -6.287  9.396   -23.867 1.00 62.93  ? 514  ASN B CG  1 
ATOM   8104 O OD1 . ASN B 1 514 ? -7.044  10.372  -23.918 1.00 51.31  ? 514  ASN B OD1 1 
ATOM   8105 N ND2 . ASN B 1 514 ? -5.497  9.157   -22.823 1.00 63.63  ? 514  ASN B ND2 1 
ATOM   8106 N N   . LEU B 1 515 ? -8.947  8.514   -25.719 1.00 60.23  ? 515  LEU B N   1 
ATOM   8107 C CA  . LEU B 1 515 ? -10.394 8.681   -25.806 1.00 61.74  ? 515  LEU B CA  1 
ATOM   8108 C C   . LEU B 1 515 ? -10.892 9.915   -25.072 1.00 64.87  ? 515  LEU B C   1 
ATOM   8109 O O   . LEU B 1 515 ? -11.902 10.500  -25.454 1.00 59.37  ? 515  LEU B O   1 
ATOM   8110 C CB  . LEU B 1 515 ? -11.107 7.426   -25.312 1.00 64.63  ? 515  LEU B CB  1 
ATOM   8111 C CG  . LEU B 1 515 ? -10.914 6.271   -26.295 1.00 70.15  ? 515  LEU B CG  1 
ATOM   8112 C CD1 . LEU B 1 515 ? -11.714 5.076   -25.864 1.00 60.58  ? 515  LEU B CD1 1 
ATOM   8113 C CD2 . LEU B 1 515 ? -11.315 6.697   -27.697 1.00 65.23  ? 515  LEU B CD2 1 
ATOM   8114 N N   . LYS B 1 516 ? -10.174 10.314  -24.026 1.00 59.70  ? 516  LYS B N   1 
ATOM   8115 C CA  . LYS B 1 516 ? -10.481 11.553  -23.327 1.00 61.58  ? 516  LYS B CA  1 
ATOM   8116 C C   . LYS B 1 516 ? -9.939  12.731  -24.142 1.00 59.91  ? 516  LYS B C   1 
ATOM   8117 O O   . LYS B 1 516 ? -9.092  12.553  -25.015 1.00 64.21  ? 516  LYS B O   1 
ATOM   8118 C CB  . LYS B 1 516 ? -9.891  11.500  -21.919 1.00 56.01  ? 516  LYS B CB  1 
ATOM   8119 C CG  . LYS B 1 516 ? -9.973  10.089  -21.344 1.00 63.76  ? 516  LYS B CG  1 
ATOM   8120 C CD  . LYS B 1 516 ? -9.776  10.041  -19.844 1.00 77.39  ? 516  LYS B CD  1 
ATOM   8121 C CE  . LYS B 1 516 ? -8.343  9.662   -19.470 1.00 93.02  ? 516  LYS B CE  1 
ATOM   8122 N NZ  . LYS B 1 516 ? -8.169  9.496   -17.985 1.00 100.46 ? 516  LYS B NZ  1 
ATOM   8123 N N   . PRO B 1 517 ? -10.444 13.938  -23.881 1.00 59.25  ? 517  PRO B N   1 
ATOM   8124 C CA  . PRO B 1 517 ? -10.005 15.142  -24.604 1.00 63.91  ? 517  PRO B CA  1 
ATOM   8125 C C   . PRO B 1 517 ? -8.519  15.452  -24.378 1.00 62.93  ? 517  PRO B C   1 
ATOM   8126 O O   . PRO B 1 517 ? -7.934  14.988  -23.396 1.00 63.09  ? 517  PRO B O   1 
ATOM   8127 C CB  . PRO B 1 517 ? -10.857 16.259  -23.982 1.00 59.70  ? 517  PRO B CB  1 
ATOM   8128 C CG  . PRO B 1 517 ? -11.976 15.575  -23.305 1.00 54.07  ? 517  PRO B CG  1 
ATOM   8129 C CD  . PRO B 1 517 ? -11.448 14.242  -22.854 1.00 55.73  ? 517  PRO B CD  1 
ATOM   8130 N N   . LEU B 1 518 ? -7.925  16.240  -25.268 1.00 59.02  ? 518  LEU B N   1 
ATOM   8131 C CA  . LEU B 1 518 ? -6.505  16.577  -25.170 1.00 54.88  ? 518  LEU B CA  1 
ATOM   8132 C C   . LEU B 1 518 ? -6.063  16.964  -23.767 1.00 59.76  ? 518  LEU B C   1 
ATOM   8133 O O   . LEU B 1 518 ? -6.653  17.824  -23.115 1.00 65.83  ? 518  LEU B O   1 
ATOM   8134 C CB  . LEU B 1 518 ? -6.152  17.732  -26.093 1.00 53.23  ? 518  LEU B CB  1 
ATOM   8135 C CG  . LEU B 1 518 ? -5.747  17.439  -27.520 1.00 52.64  ? 518  LEU B CG  1 
ATOM   8136 C CD1 . LEU B 1 518 ? -5.187  18.716  -28.094 1.00 53.06  ? 518  LEU B CD1 1 
ATOM   8137 C CD2 . LEU B 1 518 ? -4.725  16.331  -27.569 1.00 52.36  ? 518  LEU B CD2 1 
ATOM   8138 N N   . GLU B 1 519 ? -4.986  16.343  -23.328 1.00 59.52  ? 519  GLU B N   1 
ATOM   8139 C CA  . GLU B 1 519 ? -4.368  16.689  -22.072 1.00 59.96  ? 519  GLU B CA  1 
ATOM   8140 C C   . GLU B 1 519 ? -2.942  17.140  -22.378 1.00 58.74  ? 519  GLU B C   1 
ATOM   8141 O O   . GLU B 1 519 ? -2.172  16.408  -22.998 1.00 56.50  ? 519  GLU B O   1 
ATOM   8142 C CB  . GLU B 1 519 ? -4.376  15.461  -21.180 1.00 55.68  ? 519  GLU B CB  1 
ATOM   8143 C CG  . GLU B 1 519 ? -3.815  15.667  -19.808 1.00 66.21  ? 519  GLU B CG  1 
ATOM   8144 C CD  . GLU B 1 519 ? -3.831  14.377  -18.997 1.00 83.18  ? 519  GLU B CD  1 
ATOM   8145 O OE1 . GLU B 1 519 ? -4.947  13.874  -18.707 1.00 89.84  ? 519  GLU B OE1 1 
ATOM   8146 O OE2 . GLU B 1 519 ? -2.729  13.870  -18.661 1.00 68.73  ? 519  GLU B OE2 1 
ATOM   8147 N N   . VAL B 1 520 ? -2.607  18.363  -21.982 1.00 54.01  ? 520  VAL B N   1 
ATOM   8148 C CA  . VAL B 1 520 ? -1.258  18.882  -22.155 1.00 44.78  ? 520  VAL B CA  1 
ATOM   8149 C C   . VAL B 1 520 ? -0.362  18.429  -21.014 1.00 46.75  ? 520  VAL B C   1 
ATOM   8150 O O   . VAL B 1 520 ? -0.680  18.654  -19.850 1.00 56.87  ? 520  VAL B O   1 
ATOM   8151 C CB  . VAL B 1 520 ? -1.257  20.421  -22.217 1.00 52.87  ? 520  VAL B CB  1 
ATOM   8152 C CG1 . VAL B 1 520 ? 0.172   20.948  -22.391 1.00 48.64  ? 520  VAL B CG1 1 
ATOM   8153 C CG2 . VAL B 1 520 ? -2.155  20.904  -23.358 1.00 45.55  ? 520  VAL B CG2 1 
ATOM   8154 N N   . ARG B 1 521 ? 0.745   17.773  -21.342 1.00 43.51  ? 521  ARG B N   1 
ATOM   8155 C CA  . ARG B 1 521 ? 1.719   17.354  -20.331 1.00 49.18  ? 521  ARG B CA  1 
ATOM   8156 C C   . ARG B 1 521 ? 3.071   18.003  -20.587 1.00 47.85  ? 521  ARG B C   1 
ATOM   8157 O O   . ARG B 1 521 ? 3.300   18.569  -21.652 1.00 50.72  ? 521  ARG B O   1 
ATOM   8158 C CB  . ARG B 1 521 ? 1.890   15.844  -20.340 1.00 52.67  ? 521  ARG B CB  1 
ATOM   8159 C CG  . ARG B 1 521 ? 0.603   15.098  -20.202 1.00 53.86  ? 521  ARG B CG  1 
ATOM   8160 C CD  . ARG B 1 521 ? 0.867   13.630  -20.001 1.00 54.03  ? 521  ARG B CD  1 
ATOM   8161 N NE  . ARG B 1 521 ? -0.382  12.880  -20.025 1.00 59.37  ? 521  ARG B NE  1 
ATOM   8162 C CZ  . ARG B 1 521 ? -0.481  11.612  -20.407 1.00 60.67  ? 521  ARG B CZ  1 
ATOM   8163 N NH1 . ARG B 1 521 ? 0.598   10.944  -20.805 1.00 52.05  ? 521  ARG B NH1 1 
ATOM   8164 N NH2 . ARG B 1 521 ? -1.665  11.020  -20.402 1.00 59.27  ? 521  ARG B NH2 1 
ATOM   8165 N N   . ARG B 1 522 ? 3.975   17.929  -19.619 1.00 46.04  ? 522  ARG B N   1 
ATOM   8166 C CA  . ARG B 1 522 ? 5.282   18.551  -19.813 1.00 47.18  ? 522  ARG B CA  1 
ATOM   8167 C C   . ARG B 1 522 ? 6.395   17.544  -19.655 1.00 48.20  ? 522  ARG B C   1 
ATOM   8168 O O   . ARG B 1 522 ? 6.412   16.785  -18.693 1.00 53.12  ? 522  ARG B O   1 
ATOM   8169 C CB  . ARG B 1 522 ? 5.475   19.750  -18.880 1.00 42.57  ? 522  ARG B CB  1 
ATOM   8170 C CG  . ARG B 1 522 ? 4.613   20.949  -19.280 1.00 45.19  ? 522  ARG B CG  1 
ATOM   8171 C CD  . ARG B 1 522 ? 4.710   22.102  -18.306 1.00 45.25  ? 522  ARG B CD  1 
ATOM   8172 N NE  . ARG B 1 522 ? 6.067   22.635  -18.234 1.00 71.99  ? 522  ARG B NE  1 
ATOM   8173 C CZ  . ARG B 1 522 ? 6.373   23.846  -17.777 1.00 66.26  ? 522  ARG B CZ  1 
ATOM   8174 N NH1 . ARG B 1 522 ? 5.405   24.651  -17.358 1.00 54.03  ? 522  ARG B NH1 1 
ATOM   8175 N NH2 . ARG B 1 522 ? 7.644   24.251  -17.752 1.00 59.66  ? 522  ARG B NH2 1 
ATOM   8176 N N   . GLY B 1 523 ? 7.305   17.519  -20.623 1.00 48.54  ? 523  GLY B N   1 
ATOM   8177 C CA  . GLY B 1 523 ? 8.484   16.676  -20.539 1.00 50.55  ? 523  GLY B CA  1 
ATOM   8178 C C   . GLY B 1 523 ? 8.229   15.248  -20.971 1.00 55.14  ? 523  GLY B C   1 
ATOM   8179 O O   . GLY B 1 523 ? 7.533   14.495  -20.297 1.00 56.85  ? 523  GLY B O   1 
ATOM   8180 N N   . LEU B 1 524 ? 8.798   14.886  -22.115 1.00 57.84  ? 524  LEU B N   1 
ATOM   8181 C CA  . LEU B 1 524 ? 8.676   13.547  -22.664 1.00 52.92  ? 524  LEU B CA  1 
ATOM   8182 C C   . LEU B 1 524 ? 9.743   12.641  -22.058 1.00 53.72  ? 524  LEU B C   1 
ATOM   8183 O O   . LEU B 1 524 ? 10.862  12.564  -22.578 1.00 59.42  ? 524  LEU B O   1 
ATOM   8184 C CB  . LEU B 1 524 ? 8.871   13.602  -24.182 1.00 60.43  ? 524  LEU B CB  1 
ATOM   8185 C CG  . LEU B 1 524 ? 7.950   12.709  -25.006 1.00 64.63  ? 524  LEU B CG  1 
ATOM   8186 C CD1 . LEU B 1 524 ? 7.524   11.505  -24.178 1.00 54.48  ? 524  LEU B CD1 1 
ATOM   8187 C CD2 . LEU B 1 524 ? 6.726   13.503  -25.453 1.00 66.68  ? 524  LEU B CD2 1 
ATOM   8188 N N   . ARG B 1 525 ? 9.407   11.961  -20.963 1.00 51.13  ? 525  ARG B N   1 
ATOM   8189 C CA  . ARG B 1 525 ? 10.375  11.116  -20.268 1.00 49.04  ? 525  ARG B CA  1 
ATOM   8190 C C   . ARG B 1 525 ? 11.695  11.840  -19.975 1.00 57.77  ? 525  ARG B C   1 
ATOM   8191 O O   . ARG B 1 525 ? 12.776  11.268  -20.155 1.00 54.19  ? 525  ARG B O   1 
ATOM   8192 C CB  . ARG B 1 525 ? 10.695  9.912   -21.130 1.00 59.23  ? 525  ARG B CB  1 
ATOM   8193 C CG  . ARG B 1 525 ? 9.599   8.931   -21.221 1.00 54.61  ? 525  ARG B CG  1 
ATOM   8194 C CD  . ARG B 1 525 ? 9.898   7.761   -20.345 1.00 65.80  ? 525  ARG B CD  1 
ATOM   8195 N NE  . ARG B 1 525 ? 9.522   6.522   -21.014 1.00 83.78  ? 525  ARG B NE  1 
ATOM   8196 C CZ  . ARG B 1 525 ? 8.307   6.267   -21.496 1.00 72.84  ? 525  ARG B CZ  1 
ATOM   8197 N NH1 . ARG B 1 525 ? 7.335   7.171   -21.389 1.00 73.15  ? 525  ARG B NH1 1 
ATOM   8198 N NH2 . ARG B 1 525 ? 8.070   5.103   -22.086 1.00 59.40  ? 525  ARG B NH2 1 
ATOM   8199 N N   . ALA B 1 526 ? 11.612  13.086  -19.519 1.00 57.64  ? 526  ALA B N   1 
ATOM   8200 C CA  . ALA B 1 526 ? 12.796  13.944  -19.419 1.00 56.48  ? 526  ALA B CA  1 
ATOM   8201 C C   . ALA B 1 526 ? 13.993  13.358  -18.643 1.00 51.26  ? 526  ALA B C   1 
ATOM   8202 O O   . ALA B 1 526 ? 15.131  13.433  -19.123 1.00 56.05  ? 526  ALA B O   1 
ATOM   8203 C CB  . ALA B 1 526 ? 12.418  15.309  -18.890 1.00 49.57  ? 526  ALA B CB  1 
ATOM   8204 N N   . GLN B 1 527 ? 13.741  12.778  -17.466 1.00 47.51  ? 527  GLN B N   1 
ATOM   8205 C CA  . GLN B 1 527 ? 14.819  12.210  -16.648 1.00 51.82  ? 527  GLN B CA  1 
ATOM   8206 C C   . GLN B 1 527 ? 15.442  11.006  -17.320 1.00 50.94  ? 527  GLN B C   1 
ATOM   8207 O O   . GLN B 1 527 ? 16.658  10.880  -17.364 1.00 56.08  ? 527  GLN B O   1 
ATOM   8208 C CB  . GLN B 1 527 ? 14.341  11.796  -15.252 1.00 48.88  ? 527  GLN B CB  1 
ATOM   8209 C CG  . GLN B 1 527 ? 14.006  12.931  -14.319 1.00 53.60  ? 527  GLN B CG  1 
ATOM   8210 C CD  . GLN B 1 527 ? 15.141  13.927  -14.179 1.00 70.64  ? 527  GLN B CD  1 
ATOM   8211 O OE1 . GLN B 1 527 ? 15.061  15.063  -14.690 1.00 61.46  ? 527  GLN B OE1 1 
ATOM   8212 N NE2 . GLN B 1 527 ? 16.214  13.509  -13.489 1.00 65.95  ? 527  GLN B NE2 1 
ATOM   8213 N N   . THR B 1 528 ? 14.602  10.116  -17.831 1.00 51.71  ? 528  THR B N   1 
ATOM   8214 C CA  . THR B 1 528 ? 15.086  8.905   -18.475 1.00 52.89  ? 528  THR B CA  1 
ATOM   8215 C C   . THR B 1 528 ? 15.785  9.189   -19.805 1.00 53.66  ? 528  THR B C   1 
ATOM   8216 O O   . THR B 1 528 ? 16.761  8.524   -20.159 1.00 55.20  ? 528  THR B O   1 
ATOM   8217 C CB  . THR B 1 528 ? 13.950  7.896   -18.684 1.00 54.89  ? 528  THR B CB  1 
ATOM   8218 O OG1 . THR B 1 528 ? 13.577  7.350   -17.414 1.00 61.98  ? 528  THR B OG1 1 
ATOM   8219 C CG2 . THR B 1 528 ? 14.395  6.763   -19.605 1.00 43.99  ? 528  THR B CG2 1 
ATOM   8220 N N   . CYS B 1 529 ? 15.297  10.176  -20.543 1.00 47.80  ? 529  CYS B N   1 
ATOM   8221 C CA  . CYS B 1 529 ? 15.932  10.508  -21.811 1.00 50.90  ? 529  CYS B CA  1 
ATOM   8222 C C   . CYS B 1 529 ? 17.236  11.251  -21.589 1.00 51.47  ? 529  CYS B C   1 
ATOM   8223 O O   . CYS B 1 529 ? 18.150  11.154  -22.400 1.00 50.75  ? 529  CYS B O   1 
ATOM   8224 C CB  . CYS B 1 529 ? 14.960  11.216  -22.770 1.00 56.60  ? 529  CYS B CB  1 
ATOM   8225 S SG  . CYS B 1 529 ? 13.761  9.979   -23.480 1.00 75.06  ? 529  CYS B SG  1 
ATOM   8226 N N   . ALA B 1 530 ? 17.336  11.943  -20.459 1.00 47.38  ? 530  ALA B N   1 
ATOM   8227 C CA  . ALA B 1 530 ? 18.610  12.501  -20.033 1.00 52.39  ? 530  ALA B CA  1 
ATOM   8228 C C   . ALA B 1 530 ? 19.643  11.383  -19.829 1.00 53.83  ? 530  ALA B C   1 
ATOM   8229 O O   . ALA B 1 530 ? 20.806  11.508  -20.221 1.00 52.16  ? 530  ALA B O   1 
ATOM   8230 C CB  . ALA B 1 530 ? 18.432  13.302  -18.762 1.00 53.11  ? 530  ALA B CB  1 
ATOM   8231 N N   . PHE B 1 531 ? 19.215  10.287  -19.215 1.00 45.31  ? 531  PHE B N   1 
ATOM   8232 C CA  . PHE B 1 531 ? 20.085  9.131   -19.058 1.00 54.66  ? 531  PHE B CA  1 
ATOM   8233 C C   . PHE B 1 531 ? 20.550  8.629   -20.418 1.00 56.68  ? 531  PHE B C   1 
ATOM   8234 O O   . PHE B 1 531 ? 21.751  8.463   -20.660 1.00 51.97  ? 531  PHE B O   1 
ATOM   8235 C CB  . PHE B 1 531 ? 19.367  8.009   -18.305 1.00 47.91  ? 531  PHE B CB  1 
ATOM   8236 C CG  . PHE B 1 531 ? 20.106  6.702   -18.315 1.00 53.45  ? 531  PHE B CG  1 
ATOM   8237 C CD1 . PHE B 1 531 ? 21.179  6.485   -17.464 1.00 61.39  ? 531  PHE B CD1 1 
ATOM   8238 C CD2 . PHE B 1 531 ? 19.729  5.679   -19.169 1.00 59.17  ? 531  PHE B CD2 1 
ATOM   8239 C CE1 . PHE B 1 531 ? 21.862  5.263   -17.462 1.00 54.46  ? 531  PHE B CE1 1 
ATOM   8240 C CE2 . PHE B 1 531 ? 20.414  4.455   -19.177 1.00 58.61  ? 531  PHE B CE2 1 
ATOM   8241 C CZ  . PHE B 1 531 ? 21.477  4.252   -18.321 1.00 54.48  ? 531  PHE B CZ  1 
ATOM   8242 N N   . TRP B 1 532 ? 19.592  8.395   -21.310 1.00 54.02  ? 532  TRP B N   1 
ATOM   8243 C CA  . TRP B 1 532 ? 19.903  7.812   -22.608 1.00 55.07  ? 532  TRP B CA  1 
ATOM   8244 C C   . TRP B 1 532 ? 20.596  8.794   -23.526 1.00 50.21  ? 532  TRP B C   1 
ATOM   8245 O O   . TRP B 1 532 ? 21.508  8.414   -24.241 1.00 56.48  ? 532  TRP B O   1 
ATOM   8246 C CB  . TRP B 1 532 ? 18.647  7.300   -23.300 1.00 50.18  ? 532  TRP B CB  1 
ATOM   8247 C CG  . TRP B 1 532 ? 18.089  6.037   -22.743 1.00 47.04  ? 532  TRP B CG  1 
ATOM   8248 C CD1 . TRP B 1 532 ? 16.966  5.910   -21.986 1.00 49.58  ? 532  TRP B CD1 1 
ATOM   8249 C CD2 . TRP B 1 532 ? 18.601  4.710   -22.928 1.00 39.37  ? 532  TRP B CD2 1 
ATOM   8250 N NE1 . TRP B 1 532 ? 16.743  4.584   -21.683 1.00 46.46  ? 532  TRP B NE1 1 
ATOM   8251 C CE2 . TRP B 1 532 ? 17.732  3.828   -22.251 1.00 43.22  ? 532  TRP B CE2 1 
ATOM   8252 C CE3 . TRP B 1 532 ? 19.702  4.183   -23.605 1.00 43.27  ? 532  TRP B CE3 1 
ATOM   8253 C CZ2 . TRP B 1 532 ? 17.937  2.444   -22.221 1.00 39.89  ? 532  TRP B CZ2 1 
ATOM   8254 C CZ3 . TRP B 1 532 ? 19.908  2.808   -23.578 1.00 44.30  ? 532  TRP B CZ3 1 
ATOM   8255 C CH2 . TRP B 1 532 ? 19.026  1.956   -22.886 1.00 46.62  ? 532  TRP B CH2 1 
ATOM   8256 N N   . ASN B 1 533 ? 20.162  10.050  -23.518 1.00 46.58  ? 533  ASN B N   1 
ATOM   8257 C CA  . ASN B 1 533 ? 20.686  11.025  -24.478 1.00 48.90  ? 533  ASN B CA  1 
ATOM   8258 C C   . ASN B 1 533 ? 21.934  11.753  -23.993 1.00 56.82  ? 533  ASN B C   1 
ATOM   8259 O O   . ASN B 1 533 ? 22.764  12.180  -24.798 1.00 50.06  ? 533  ASN B O   1 
ATOM   8260 C CB  . ASN B 1 533 ? 19.612  12.039  -24.895 1.00 50.40  ? 533  ASN B CB  1 
ATOM   8261 C CG  . ASN B 1 533 ? 18.425  11.383  -25.582 1.00 53.63  ? 533  ASN B CG  1 
ATOM   8262 O OD1 . ASN B 1 533 ? 18.546  10.282  -26.113 1.00 59.22  ? 533  ASN B OD1 1 
ATOM   8263 N ND2 . ASN B 1 533 ? 17.270  12.048  -25.560 1.00 46.77  ? 533  ASN B ND2 1 
ATOM   8264 N N   . ARG B 1 534 ? 22.077  11.881  -22.675 1.00 60.78  ? 534  ARG B N   1 
ATOM   8265 C CA  . ARG B 1 534 ? 23.184  12.649  -22.108 1.00 54.85  ? 534  ARG B CA  1 
ATOM   8266 C C   . ARG B 1 534 ? 24.234  11.814  -21.376 1.00 58.78  ? 534  ARG B C   1 
ATOM   8267 O O   . ARG B 1 534 ? 25.423  12.082  -21.474 1.00 66.47  ? 534  ARG B O   1 
ATOM   8268 C CB  . ARG B 1 534 ? 22.655  13.747  -21.189 1.00 60.05  ? 534  ARG B CB  1 
ATOM   8269 C CG  . ARG B 1 534 ? 21.925  14.866  -21.909 1.00 57.22  ? 534  ARG B CG  1 
ATOM   8270 C CD  . ARG B 1 534 ? 21.231  15.732  -20.895 1.00 60.95  ? 534  ARG B CD  1 
ATOM   8271 N NE  . ARG B 1 534 ? 20.278  16.655  -21.496 1.00 69.26  ? 534  ARG B NE  1 
ATOM   8272 C CZ  . ARG B 1 534 ? 20.595  17.878  -21.905 1.00 74.50  ? 534  ARG B CZ  1 
ATOM   8273 N NH1 . ARG B 1 534 ? 21.850  18.310  -21.790 1.00 65.55  ? 534  ARG B NH1 1 
ATOM   8274 N NH2 . ARG B 1 534 ? 19.662  18.666  -22.429 1.00 76.60  ? 534  ARG B NH2 1 
ATOM   8275 N N   . PHE B 1 535 ? 23.810  10.799  -20.640 1.00 62.28  ? 535  PHE B N   1 
ATOM   8276 C CA  . PHE B 1 535 ? 24.779  10.053  -19.867 1.00 53.52  ? 535  PHE B CA  1 
ATOM   8277 C C   . PHE B 1 535 ? 25.371  8.846   -20.581 1.00 57.12  ? 535  PHE B C   1 
ATOM   8278 O O   . PHE B 1 535 ? 26.588  8.734   -20.698 1.00 64.92  ? 535  PHE B O   1 
ATOM   8279 C CB  . PHE B 1 535 ? 24.217  9.631   -18.523 1.00 49.14  ? 535  PHE B CB  1 
ATOM   8280 C CG  . PHE B 1 535 ? 25.196  8.874   -17.706 1.00 55.87  ? 535  PHE B CG  1 
ATOM   8281 C CD1 . PHE B 1 535 ? 26.335  9.509   -17.218 1.00 53.14  ? 535  PHE B CD1 1 
ATOM   8282 C CD2 . PHE B 1 535 ? 25.014  7.520   -17.458 1.00 51.91  ? 535  PHE B CD2 1 
ATOM   8283 C CE1 . PHE B 1 535 ? 27.267  8.814   -16.482 1.00 47.39  ? 535  PHE B CE1 1 
ATOM   8284 C CE2 . PHE B 1 535 ? 25.935  6.816   -16.710 1.00 53.36  ? 535  PHE B CE2 1 
ATOM   8285 C CZ  . PHE B 1 535 ? 27.066  7.466   -16.217 1.00 57.75  ? 535  PHE B CZ  1 
ATOM   8286 N N   . LEU B 1 536 ? 24.522  7.932   -21.031 1.00 50.51  ? 536  LEU B N   1 
ATOM   8287 C CA  . LEU B 1 536 ? 25.014  6.708   -21.654 1.00 53.70  ? 536  LEU B CA  1 
ATOM   8288 C C   . LEU B 1 536 ? 26.129  6.912   -22.678 1.00 66.04  ? 536  LEU B C   1 
ATOM   8289 O O   . LEU B 1 536 ? 27.099  6.155   -22.690 1.00 70.67  ? 536  LEU B O   1 
ATOM   8290 C CB  . LEU B 1 536 ? 23.886  5.918   -22.298 1.00 54.56  ? 536  LEU B CB  1 
ATOM   8291 C CG  . LEU B 1 536 ? 23.510  4.607   -21.618 1.00 70.29  ? 536  LEU B CG  1 
ATOM   8292 C CD1 . LEU B 1 536 ? 23.377  3.566   -22.715 1.00 63.78  ? 536  LEU B CD1 1 
ATOM   8293 C CD2 . LEU B 1 536 ? 24.549  4.162   -20.588 1.00 63.83  ? 536  LEU B CD2 1 
ATOM   8294 N N   . PRO B 1 537 ? 25.981  7.910   -23.566 1.00 65.90  ? 537  PRO B N   1 
ATOM   8295 C CA  . PRO B 1 537 ? 27.026  8.161   -24.562 1.00 63.46  ? 537  PRO B CA  1 
ATOM   8296 C C   . PRO B 1 537 ? 28.407  8.343   -23.923 1.00 78.37  ? 537  PRO B C   1 
ATOM   8297 O O   . PRO B 1 537 ? 29.375  7.728   -24.382 1.00 76.62  ? 537  PRO B O   1 
ATOM   8298 C CB  . PRO B 1 537 ? 26.563  9.460   -25.225 1.00 65.08  ? 537  PRO B CB  1 
ATOM   8299 C CG  . PRO B 1 537 ? 25.082  9.423   -25.106 1.00 56.55  ? 537  PRO B CG  1 
ATOM   8300 C CD  . PRO B 1 537 ? 24.800  8.769   -23.782 1.00 67.95  ? 537  PRO B CD  1 
ATOM   8301 N N   . LYS B 1 538 ? 28.492  9.173   -22.884 1.00 75.28  ? 538  LYS B N   1 
ATOM   8302 C CA  . LYS B 1 538 ? 29.742  9.361   -22.156 1.00 65.18  ? 538  LYS B CA  1 
ATOM   8303 C C   . LYS B 1 538 ? 30.255  8.023   -21.669 1.00 67.39  ? 538  LYS B C   1 
ATOM   8304 O O   . LYS B 1 538 ? 31.432  7.709   -21.791 1.00 77.29  ? 538  LYS B O   1 
ATOM   8305 C CB  . LYS B 1 538 ? 29.536  10.297  -20.968 1.00 59.03  ? 538  LYS B CB  1 
ATOM   8306 C CG  . LYS B 1 538 ? 29.014  11.664  -21.359 1.00 73.56  ? 538  LYS B CG  1 
ATOM   8307 C CD  . LYS B 1 538 ? 28.903  12.584  -20.155 1.00 84.39  ? 538  LYS B CD  1 
ATOM   8308 C CE  . LYS B 1 538 ? 28.576  14.011  -20.576 1.00 90.75  ? 538  LYS B CE  1 
ATOM   8309 N NZ  . LYS B 1 538 ? 29.636  14.597  -21.454 1.00 101.05 ? 538  LYS B NZ  1 
ATOM   8310 N N   . LEU B 1 539 ? 29.349  7.228   -21.128 1.00 68.78  ? 539  LEU B N   1 
ATOM   8311 C CA  . LEU B 1 539 ? 29.702  5.953   -20.527 1.00 72.83  ? 539  LEU B CA  1 
ATOM   8312 C C   . LEU B 1 539 ? 30.270  4.967   -21.540 1.00 78.38  ? 539  LEU B C   1 
ATOM   8313 O O   . LEU B 1 539 ? 30.925  3.995   -21.177 1.00 82.79  ? 539  LEU B O   1 
ATOM   8314 C CB  . LEU B 1 539 ? 28.468  5.359   -19.868 1.00 67.85  ? 539  LEU B CB  1 
ATOM   8315 C CG  . LEU B 1 539 ? 28.734  4.117   -19.046 1.00 70.69  ? 539  LEU B CG  1 
ATOM   8316 C CD1 . LEU B 1 539 ? 29.858  4.438   -18.098 1.00 73.09  ? 539  LEU B CD1 1 
ATOM   8317 C CD2 . LEU B 1 539 ? 27.470  3.688   -18.311 1.00 72.79  ? 539  LEU B CD2 1 
ATOM   8318 N N   . LEU B 1 540 ? 30.009  5.214   -22.814 1.00 80.72  ? 540  LEU B N   1 
ATOM   8319 C CA  . LEU B 1 540 ? 30.449  4.308   -23.862 1.00 84.45  ? 540  LEU B CA  1 
ATOM   8320 C C   . LEU B 1 540 ? 31.641  4.866   -24.627 1.00 92.41  ? 540  LEU B C   1 
ATOM   8321 O O   . LEU B 1 540 ? 32.550  4.122   -25.000 1.00 97.49  ? 540  LEU B O   1 
ATOM   8322 C CB  . LEU B 1 540 ? 29.295  4.002   -24.808 1.00 77.86  ? 540  LEU B CB  1 
ATOM   8323 C CG  . LEU B 1 540 ? 28.277  3.112   -24.109 1.00 85.02  ? 540  LEU B CG  1 
ATOM   8324 C CD1 . LEU B 1 540 ? 27.163  2.719   -25.056 1.00 67.34  ? 540  LEU B CD1 1 
ATOM   8325 C CD2 . LEU B 1 540 ? 28.991  1.888   -23.538 1.00 82.73  ? 540  LEU B CD2 1 
ATOM   8326 N N   . SER B 1 541 ? 31.627  6.175   -24.866 1.00 88.68  ? 541  SER B N   1 
ATOM   8327 C CA  . SER B 1 541 ? 32.784  6.861   -25.431 1.00 91.93  ? 541  SER B CA  1 
ATOM   8328 C C   . SER B 1 541 ? 33.786  7.100   -24.304 1.00 103.40 ? 541  SER B C   1 
ATOM   8329 O O   . SER B 1 541 ? 34.309  8.205   -24.124 1.00 107.92 ? 541  SER B O   1 
ATOM   8330 C CB  . SER B 1 541 ? 32.379  8.176   -26.109 1.00 107.41 ? 541  SER B CB  1 
ATOM   8331 O OG  . SER B 1 541 ? 31.942  9.148   -25.169 1.00 104.23 ? 541  SER B OG  1 
ATOM   8332 N N   . ALA B 1 542 ? 34.012  6.031   -23.545 1.00 107.89 ? 542  ALA B N   1 
ATOM   8333 C CA  . ALA B 1 542 ? 34.936  5.957   -22.415 1.00 106.06 ? 542  ALA B CA  1 
ATOM   8334 C C   . ALA B 1 542 ? 34.763  4.525   -21.941 1.00 102.30 ? 542  ALA B C   1 
ATOM   8335 O O   . ALA B 1 542 ? 35.008  4.200   -20.777 1.00 91.37  ? 542  ALA B O   1 
ATOM   8336 C CB  . ALA B 1 542 ? 34.555  6.940   -21.314 1.00 89.34  ? 542  ALA B CB  1 
ATOM   8337 N N   . THR B 1 543 ? 34.317  3.695   -22.889 1.00 107.05 ? 543  THR B N   1 
ATOM   8338 C CA  . THR B 1 543 ? 33.949  2.281   -22.704 1.00 111.97 ? 543  THR B CA  1 
ATOM   8339 C C   . THR B 1 543 ? 33.267  1.935   -21.364 1.00 110.98 ? 543  THR B C   1 
ATOM   8340 O O   . THR B 1 543 ? 32.259  1.216   -21.326 1.00 101.28 ? 543  THR B O   1 
ATOM   8341 C CB  . THR B 1 543 ? 35.139  1.326   -23.011 1.00 108.66 ? 543  THR B CB  1 
ATOM   8342 O OG1 . THR B 1 543 ? 35.584  1.529   -24.362 1.00 98.63  ? 543  THR B OG1 1 
ATOM   8343 C CG2 . THR B 1 543 ? 34.723  -0.132  -22.825 1.00 96.00  ? 543  THR B CG2 1 
ATOM   8344 O OXT . THR B 1 543 ? 33.681  2.367   -20.288 1.00 112.36 ? 543  THR B OXT 1 
HETATM 8345 C C1  . NAG C 2 .   ? 24.248  34.836  -0.635  0.70 71.16  ? 601  NAG A C1  1 
HETATM 8346 C C2  . NAG C 2 .   ? 24.504  35.177  -2.104  0.70 74.06  ? 601  NAG A C2  1 
HETATM 8347 C C3  . NAG C 2 .   ? 25.842  34.608  -2.568  0.70 76.98  ? 601  NAG A C3  1 
HETATM 8348 C C4  . NAG C 2 .   ? 26.930  35.189  -1.687  0.70 80.67  ? 601  NAG A C4  1 
HETATM 8349 C C5  . NAG C 2 .   ? 26.664  34.789  -0.240  0.70 79.24  ? 601  NAG A C5  1 
HETATM 8350 C C6  . NAG C 2 .   ? 27.720  35.390  0.691   0.70 89.94  ? 601  NAG A C6  1 
HETATM 8351 C C7  . NAG C 2 .   ? 22.703  35.615  -3.652  0.70 75.46  ? 601  NAG A C7  1 
HETATM 8352 C C8  . NAG C 2 .   ? 22.295  35.176  -5.027  0.70 79.58  ? 601  NAG A C8  1 
HETATM 8353 N N2  . NAG C 2 .   ? 23.409  34.730  -2.951  0.70 74.22  ? 601  NAG A N2  1 
HETATM 8354 O O3  . NAG C 2 .   ? 26.112  34.930  -3.915  0.70 80.83  ? 601  NAG A O3  1 
HETATM 8355 O O4  . NAG C 2 .   ? 28.193  34.719  -2.113  0.70 88.49  ? 601  NAG A O4  1 
HETATM 8356 O O5  . NAG C 2 .   ? 25.363  35.183  0.179   0.70 74.69  ? 601  NAG A O5  1 
HETATM 8357 O O6  . NAG C 2 .   ? 27.409  36.728  1.040   0.70 92.28  ? 601  NAG A O6  1 
HETATM 8358 O O7  . NAG C 2 .   ? 22.394  36.734  -3.222  0.70 84.30  ? 601  NAG A O7  1 
HETATM 8359 C C1  . NAG D 2 .   ? 11.205  33.520  25.142  0.70 87.73  ? 701  NAG A C1  1 
HETATM 8360 C C2  . NAG D 2 .   ? 12.600  34.148  25.192  0.70 90.94  ? 701  NAG A C2  1 
HETATM 8361 C C3  . NAG D 2 .   ? 12.693  35.345  26.138  0.70 91.54  ? 701  NAG A C3  1 
HETATM 8362 C C4  . NAG D 2 .   ? 11.584  36.321  25.785  0.70 94.00  ? 701  NAG A C4  1 
HETATM 8363 C C5  . NAG D 2 .   ? 10.270  35.580  25.977  0.70 91.69  ? 701  NAG A C5  1 
HETATM 8364 C C6  . NAG D 2 .   ? 9.092   36.529  25.801  0.70 88.41  ? 701  NAG A C6  1 
HETATM 8365 C C7  . NAG D 2 .   ? 14.410  32.649  24.659  0.70 82.83  ? 701  NAG A C7  1 
HETATM 8366 C C8  . NAG D 2 .   ? 15.303  31.542  25.130  0.70 75.97  ? 701  NAG A C8  1 
HETATM 8367 N N2  . NAG D 2 .   ? 13.567  33.134  25.563  0.70 86.17  ? 701  NAG A N2  1 
HETATM 8368 O O3  . NAG D 2 .   ? 13.953  35.977  26.042  0.70 95.85  ? 701  NAG A O3  1 
HETATM 8369 O O4  . NAG D 2 .   ? 11.638  37.492  26.580  0.70 91.40  ? 701  NAG A O4  1 
HETATM 8370 O O5  . NAG D 2 .   ? 10.180  34.498  25.066  0.70 93.38  ? 701  NAG A O5  1 
HETATM 8371 O O6  . NAG D 2 .   ? 9.434   37.492  24.828  0.70 104.02 ? 701  NAG A O6  1 
HETATM 8372 O O7  . NAG D 2 .   ? 14.465  33.070  23.500  0.70 82.53  ? 701  NAG A O7  1 
HETATM 8373 C C4  . X13 E 3 .   ? 37.227  25.754  8.962   1.00 81.07  ? 1543 X13 A C4  1 
HETATM 8374 C C5  . X13 E 3 .   ? 36.181  24.860  8.296   1.00 67.43  ? 1543 X13 A C5  1 
HETATM 8375 C C6  . X13 E 3 .   ? 35.269  24.178  9.316   1.00 65.21  ? 1543 X13 A C6  1 
HETATM 8376 C C7  . X13 E 3 .   ? 34.414  23.119  8.621   1.00 59.51  ? 1543 X13 A C7  1 
HETATM 8377 C C8  . X13 E 3 .   ? 33.075  22.901  9.325   1.00 64.25  ? 1543 X13 A C8  1 
HETATM 8378 C C9  . X13 E 3 .   ? 32.138  22.042  8.479   1.00 60.90  ? 1543 X13 A C9  1 
HETATM 8379 C C10 . X13 E 3 .   ? 30.793  21.840  9.166   1.00 57.21  ? 1543 X13 A C10 1 
HETATM 8380 C C11 . X13 E 3 .   ? 30.758  20.500  9.887   1.00 62.01  ? 1543 X13 A C11 1 
HETATM 8381 C C12 . X13 E 3 .   ? 29.379  20.147  10.434  1.00 52.52  ? 1543 X13 A C12 1 
HETATM 8382 C C13 . X13 E 3 .   ? 29.545  19.276  11.673  1.00 57.33  ? 1543 X13 A C13 1 
HETATM 8383 C C14 . X13 E 3 .   ? 28.290  18.456  11.943  1.00 64.91  ? 1543 X13 A C14 1 
HETATM 8384 C C15 . X13 E 3 .   ? 28.165  18.162  13.433  1.00 64.75  ? 1543 X13 A C15 1 
HETATM 8385 C C16 . X13 E 3 .   ? 26.713  17.910  13.833  1.00 60.02  ? 1543 X13 A C16 1 
HETATM 8386 N N1  . X13 E 3 .   ? 26.391  18.804  14.953  1.00 64.59  ? 1543 X13 A N1  1 
HETATM 8387 C C19 . X13 E 3 .   ? 24.974  18.674  15.309  1.00 57.43  ? 1543 X13 A C19 1 
HETATM 8388 S S18 . X13 E 3 .   ? 38.658  25.944  7.935   0.60 78.43  ? 1543 X13 A S18 1 
HETATM 8389 C C17 . X13 E 3 .   ? 26.652  20.201  14.550  1.00 57.70  ? 1543 X13 A C17 1 
HETATM 8390 C C18 . X13 E 3 .   ? 27.212  18.424  16.113  1.00 59.68  ? 1543 X13 A C18 1 
HETATM 8391 C C4  . X13 F 3 .   ? 14.075  -13.759 -37.807 1.00 75.82  ? 1544 X13 B C4  1 
HETATM 8392 C C5  . X13 F 3 .   ? 14.103  -12.274 -38.183 1.00 72.14  ? 1544 X13 B C5  1 
HETATM 8393 C C6  . X13 F 3 .   ? 12.824  -11.539 -37.785 1.00 65.15  ? 1544 X13 B C6  1 
HETATM 8394 C C7  . X13 F 3 .   ? 13.159  -10.270 -37.006 1.00 67.70  ? 1544 X13 B C7  1 
HETATM 8395 C C8  . X13 F 3 .   ? 11.959  -9.346  -36.806 1.00 64.96  ? 1544 X13 B C8  1 
HETATM 8396 C C9  . X13 F 3 .   ? 12.295  -8.244  -35.801 1.00 64.23  ? 1544 X13 B C9  1 
HETATM 8397 C C10 . X13 F 3 .   ? 11.054  -7.462  -35.368 1.00 68.79  ? 1544 X13 B C10 1 
HETATM 8398 C C11 . X13 F 3 .   ? 11.000  -6.109  -36.067 1.00 70.67  ? 1544 X13 B C11 1 
HETATM 8399 C C12 . X13 F 3 .   ? 9.669   -5.397  -35.866 1.00 65.09  ? 1544 X13 B C12 1 
HETATM 8400 C C13 . X13 F 3 .   ? 9.647   -4.146  -36.742 1.00 68.33  ? 1544 X13 B C13 1 
HETATM 8401 C C14 . X13 F 3 .   ? 8.277   -3.475  -36.692 1.00 72.29  ? 1544 X13 B C14 1 
HETATM 8402 C C15 . X13 F 3 .   ? 7.949   -2.784  -38.012 1.00 58.65  ? 1544 X13 B C15 1 
HETATM 8403 C C16 . X13 F 3 .   ? 6.868   -1.726  -37.833 1.00 65.13  ? 1544 X13 B C16 1 
HETATM 8404 N N1  . X13 F 3 .   ? 5.519   -2.187  -38.213 1.00 68.34  ? 1544 X13 B N1  1 
HETATM 8405 C C19 . X13 F 3 .   ? 4.540   -1.144  -37.867 1.00 62.44  ? 1544 X13 B C19 1 
HETATM 8406 S S18 . X13 F 3 .   ? 15.561  -14.564 -38.326 0.60 83.80  ? 1544 X13 B S18 1 
HETATM 8407 C C17 . X13 F 3 .   ? 5.153   -3.425  -37.500 1.00 60.94  ? 1544 X13 B C17 1 
HETATM 8408 C C18 . X13 F 3 .   ? 5.470   -2.401  -39.663 1.00 61.13  ? 1544 X13 B C18 1 
HETATM 8409 C C1  . PEG G 4 .   ? 31.888  10.314  -45.850 1.00 74.27  ? 1545 PEG B C1  1 
HETATM 8410 O O1  . PEG G 4 .   ? 31.827  8.956   -46.300 1.00 67.84  ? 1545 PEG B O1  1 
HETATM 8411 C C2  . PEG G 4 .   ? 31.241  10.350  -44.472 1.00 78.51  ? 1545 PEG B C2  1 
HETATM 8412 O O2  . PEG G 4 .   ? 30.617  11.615  -44.264 1.00 83.43  ? 1545 PEG B O2  1 
HETATM 8413 C C3  . PEG G 4 .   ? 31.033  12.229  -43.044 1.00 88.71  ? 1545 PEG B C3  1 
HETATM 8414 C C4  . PEG G 4 .   ? 31.706  13.572  -43.332 1.00 92.65  ? 1545 PEG B C4  1 
HETATM 8415 O O4  . PEG G 4 .   ? 31.847  14.321  -42.113 1.00 93.10  ? 1545 PEG B O4  1 
HETATM 8416 O O1  . P6G H 5 .   ? 15.251  6.398   -12.353 1.00 78.69  ? 1546 P6G B O1  1 
HETATM 8417 C C2  . P6G H 5 .   ? 16.119  6.228   -11.354 1.00 77.91  ? 1546 P6G B C2  1 
HETATM 8418 C C3  . P6G H 5 .   ? 17.419  6.066   -11.600 1.00 68.29  ? 1546 P6G B C3  1 
HETATM 8419 O O4  . P6G H 5 .   ? 18.358  5.889   -10.502 1.00 70.99  ? 1546 P6G B O4  1 
HETATM 8420 C C5  . P6G H 5 .   ? 18.789  4.561   -10.084 1.00 71.11  ? 1546 P6G B C5  1 
HETATM 8421 C C6  . P6G H 5 .   ? 19.888  3.974   -10.580 1.00 71.90  ? 1546 P6G B C6  1 
HETATM 8422 O O7  . P6G H 5 .   ? 20.732  4.607   -11.588 1.00 70.96  ? 1546 P6G B O7  1 
HETATM 8423 C C8  . P6G H 5 .   ? 21.999  4.025   -11.905 1.00 62.06  ? 1546 P6G B C8  1 
HETATM 8424 C C9  . P6G H 5 .   ? 22.564  4.594   -13.211 1.00 61.34  ? 1546 P6G B C9  1 
HETATM 8425 O O10 . P6G H 5 .   ? 22.444  6.016   -13.312 1.00 60.85  ? 1546 P6G B O10 1 
HETATM 8426 C C11 . P6G H 5 .   ? 23.465  6.746   -14.040 1.00 54.04  ? 1546 P6G B C11 1 
HETATM 8427 C C12 . P6G H 5 .   ? 23.330  7.997   -14.489 1.00 55.93  ? 1546 P6G B C12 1 
HETATM 8428 O O13 . P6G H 5 .   ? 22.128  8.813   -14.345 1.00 72.06  ? 1546 P6G B O13 1 
HETATM 8429 C C14 . P6G H 5 .   ? 21.998  10.068  -15.105 1.00 69.08  ? 1546 P6G B C14 1 
HETATM 8430 C C15 . P6G H 5 .   ? 20.809  10.608  -15.407 1.00 62.78  ? 1546 P6G B C15 1 
HETATM 8431 O O16 . P6G H 5 .   ? 19.585  9.920   -14.997 1.00 76.46  ? 1546 P6G B O16 1 
HETATM 8432 C C17 . P6G H 5 .   ? 18.611  10.495  -14.077 1.00 67.78  ? 1546 P6G B C17 1 
HETATM 8433 C C18 . P6G H 5 .   ? 17.888  9.677   -13.309 1.00 70.79  ? 1546 P6G B C18 1 
HETATM 8434 O O19 . P6G H 5 .   ? 16.986  10.147  -12.443 1.00 76.52  ? 1546 P6G B O19 1 
HETATM 8435 O O   . HOH I 6 .   ? 19.049  18.723  51.916  1.00 54.95  ? 2001 HOH A O   1 
HETATM 8436 O O   . HOH I 6 .   ? 21.251  19.944  52.644  1.00 64.51  ? 2002 HOH A O   1 
HETATM 8437 O O   . HOH I 6 .   ? 23.110  20.104  50.553  1.00 62.00  ? 2003 HOH A O   1 
HETATM 8438 O O   . HOH I 6 .   ? 33.741  22.704  48.671  1.00 74.26  ? 2004 HOH A O   1 
HETATM 8439 O O   . HOH I 6 .   ? 28.764  2.384   45.811  1.00 45.06  ? 2005 HOH A O   1 
HETATM 8440 O O   . HOH I 6 .   ? 27.698  4.467   46.926  1.00 51.48  ? 2006 HOH A O   1 
HETATM 8441 O O   . HOH I 6 .   ? 41.905  1.124   45.022  1.00 50.02  ? 2007 HOH A O   1 
HETATM 8442 O O   . HOH I 6 .   ? 37.894  4.019   38.408  1.00 64.37  ? 2008 HOH A O   1 
HETATM 8443 O O   . HOH I 6 .   ? 36.161  9.168   50.486  1.00 63.86  ? 2009 HOH A O   1 
HETATM 8444 O O   . HOH I 6 .   ? 32.011  21.016  50.055  1.00 74.98  ? 2010 HOH A O   1 
HETATM 8445 O O   . HOH I 6 .   ? 24.497  22.176  34.854  1.00 66.78  ? 2011 HOH A O   1 
HETATM 8446 O O   . HOH I 6 .   ? 18.927  23.672  38.594  1.00 60.11  ? 2012 HOH A O   1 
HETATM 8447 O O   . HOH I 6 .   ? 13.403  23.252  34.596  1.00 60.06  ? 2013 HOH A O   1 
HETATM 8448 O O   . HOH I 6 .   ? 41.592  5.108   -2.400  1.00 74.24  ? 2014 HOH A O   1 
HETATM 8449 O O   . HOH I 6 .   ? 40.077  12.552  33.444  1.00 54.63  ? 2015 HOH A O   1 
HETATM 8450 O O   . HOH I 6 .   ? 44.958  8.144   29.905  1.00 52.48  ? 2016 HOH A O   1 
HETATM 8451 O O   . HOH I 6 .   ? 56.347  14.979  26.029  1.00 60.02  ? 2017 HOH A O   1 
HETATM 8452 O O   . HOH I 6 .   ? 46.865  7.719   18.103  1.00 49.01  ? 2018 HOH A O   1 
HETATM 8453 O O   . HOH I 6 .   ? 11.465  24.864  1.181   1.00 63.39  ? 2019 HOH A O   1 
HETATM 8454 O O   . HOH I 6 .   ? 49.348  5.674   27.930  1.00 67.47  ? 2020 HOH A O   1 
HETATM 8455 O O   . HOH I 6 .   ? 50.847  2.425   29.846  1.00 73.32  ? 2021 HOH A O   1 
HETATM 8456 O O   . HOH I 6 .   ? 44.781  10.820  38.226  1.00 65.56  ? 2022 HOH A O   1 
HETATM 8457 O O   . HOH I 6 .   ? 8.668   8.603   36.250  1.00 73.34  ? 2023 HOH A O   1 
HETATM 8458 O O   . HOH I 6 .   ? 39.459  15.311  39.055  1.00 50.81  ? 2024 HOH A O   1 
HETATM 8459 O O   . HOH I 6 .   ? 39.503  15.278  45.598  1.00 63.75  ? 2025 HOH A O   1 
HETATM 8460 O O   . HOH I 6 .   ? 25.205  23.091  37.472  1.00 65.22  ? 2026 HOH A O   1 
HETATM 8461 O O   . HOH I 6 .   ? 27.700  23.914  41.520  1.00 71.61  ? 2027 HOH A O   1 
HETATM 8462 O O   . HOH I 6 .   ? 26.421  24.365  39.318  1.00 72.10  ? 2028 HOH A O   1 
HETATM 8463 O O   . HOH I 6 .   ? 40.711  16.701  21.962  1.00 49.50  ? 2029 HOH A O   1 
HETATM 8464 O O   . HOH I 6 .   ? 40.637  26.456  19.462  1.00 53.97  ? 2030 HOH A O   1 
HETATM 8465 O O   . HOH I 6 .   ? 34.247  27.825  11.276  1.00 65.97  ? 2031 HOH A O   1 
HETATM 8466 O O   . HOH I 6 .   ? 33.694  23.474  18.584  1.00 55.31  ? 2032 HOH A O   1 
HETATM 8467 O O   . HOH I 6 .   ? 40.122  27.095  17.020  1.00 49.80  ? 2033 HOH A O   1 
HETATM 8468 O O   . HOH I 6 .   ? 21.049  34.232  17.106  1.00 63.65  ? 2034 HOH A O   1 
HETATM 8469 O O   . HOH I 6 .   ? 23.713  23.527  23.207  1.00 52.22  ? 2035 HOH A O   1 
HETATM 8470 O O   . HOH I 6 .   ? 29.223  20.205  18.865  1.00 39.33  ? 2036 HOH A O   1 
HETATM 8471 O O   . HOH I 6 .   ? 34.069  3.901   1.594   1.00 67.34  ? 2037 HOH A O   1 
HETATM 8472 O O   . HOH I 6 .   ? 27.357  25.861  23.192  1.00 58.86  ? 2038 HOH A O   1 
HETATM 8473 O O   . HOH I 6 .   ? 31.650  23.491  16.466  1.00 58.34  ? 2039 HOH A O   1 
HETATM 8474 O O   . HOH I 6 .   ? 36.190  4.465   2.931   1.00 59.76  ? 2040 HOH A O   1 
HETATM 8475 O O   . HOH I 6 .   ? 33.427  28.392  22.343  1.00 58.04  ? 2041 HOH A O   1 
HETATM 8476 O O   . HOH I 6 .   ? 29.447  29.440  23.988  1.00 67.11  ? 2042 HOH A O   1 
HETATM 8477 O O   . HOH I 6 .   ? 43.068  6.475   0.284   1.00 62.52  ? 2043 HOH A O   1 
HETATM 8478 O O   . HOH I 6 .   ? 52.793  8.657   4.102   1.00 58.36  ? 2044 HOH A O   1 
HETATM 8479 O O   . HOH I 6 .   ? 45.906  8.651   -1.915  1.00 67.55  ? 2045 HOH A O   1 
HETATM 8480 O O   . HOH I 6 .   ? 43.580  9.966   -4.089  1.00 61.81  ? 2046 HOH A O   1 
HETATM 8481 O O   . HOH I 6 .   ? 50.881  3.482   4.574   1.00 66.65  ? 2047 HOH A O   1 
HETATM 8482 O O   . HOH I 6 .   ? 28.892  23.051  34.887  1.00 60.58  ? 2048 HOH A O   1 
HETATM 8483 O O   . HOH I 6 .   ? 35.653  24.082  32.996  1.00 53.07  ? 2049 HOH A O   1 
HETATM 8484 O O   . HOH I 6 .   ? 37.175  28.552  29.889  1.00 56.64  ? 2050 HOH A O   1 
HETATM 8485 O O   . HOH I 6 .   ? 38.971  27.889  26.836  1.00 52.56  ? 2051 HOH A O   1 
HETATM 8486 O O   . HOH I 6 .   ? 45.517  15.053  24.540  1.00 47.33  ? 2052 HOH A O   1 
HETATM 8487 O O   . HOH I 6 .   ? 42.601  15.896  24.604  1.00 54.89  ? 2053 HOH A O   1 
HETATM 8488 O O   . HOH I 6 .   ? 47.636  21.342  26.213  1.00 54.82  ? 2054 HOH A O   1 
HETATM 8489 O O   . HOH I 6 .   ? 41.336  13.733  31.514  1.00 52.82  ? 2055 HOH A O   1 
HETATM 8490 O O   . HOH I 6 .   ? 32.034  16.871  32.439  1.00 46.58  ? 2056 HOH A O   1 
HETATM 8491 O O   . HOH I 6 .   ? 28.906  12.041  24.757  1.00 48.25  ? 2057 HOH A O   1 
HETATM 8492 O O   . HOH I 6 .   ? 34.884  17.205  24.528  1.00 43.94  ? 2058 HOH A O   1 
HETATM 8493 O O   . HOH I 6 .   ? 32.758  23.559  13.771  1.00 54.50  ? 2059 HOH A O   1 
HETATM 8494 O O   . HOH I 6 .   ? 30.359  20.652  16.276  1.00 50.15  ? 2060 HOH A O   1 
HETATM 8495 O O   . HOH I 6 .   ? 11.911  27.496  1.358   1.00 71.62  ? 2061 HOH A O   1 
HETATM 8496 O O   . HOH I 6 .   ? 24.657  18.607  28.754  1.00 41.13  ? 2062 HOH A O   1 
HETATM 8497 O O   . HOH I 6 .   ? 28.497  17.687  19.763  1.00 38.28  ? 2063 HOH A O   1 
HETATM 8498 O O   . HOH I 6 .   ? 16.980  14.950  28.756  1.00 54.38  ? 2064 HOH A O   1 
HETATM 8499 O O   . HOH I 6 .   ? 20.910  24.103  36.501  1.00 64.88  ? 2065 HOH A O   1 
HETATM 8500 O O   . HOH I 6 .   ? 20.781  24.634  31.324  1.00 63.08  ? 2066 HOH A O   1 
HETATM 8501 O O   . HOH I 6 .   ? 14.637  15.408  -10.156 1.00 54.97  ? 2067 HOH A O   1 
HETATM 8502 O O   . HOH I 6 .   ? 16.332  13.596  -6.471  1.00 59.33  ? 2068 HOH A O   1 
HETATM 8503 O O   . HOH I 6 .   ? 11.778  9.938   37.480  1.00 64.24  ? 2069 HOH A O   1 
HETATM 8504 O O   . HOH I 6 .   ? 7.911   11.153  27.513  1.00 60.54  ? 2070 HOH A O   1 
HETATM 8505 O O   . HOH I 6 .   ? 32.739  14.280  17.055  1.00 39.38  ? 2071 HOH A O   1 
HETATM 8506 O O   . HOH I 6 .   ? 45.520  12.489  22.943  1.00 50.85  ? 2072 HOH A O   1 
HETATM 8507 O O   . HOH I 6 .   ? 43.150  18.741  16.349  1.00 52.55  ? 2073 HOH A O   1 
HETATM 8508 O O   . HOH I 6 .   ? 42.523  7.382   14.236  1.00 46.71  ? 2074 HOH A O   1 
HETATM 8509 O O   . HOH I 6 .   ? 42.940  9.491   11.342  1.00 41.11  ? 2075 HOH A O   1 
HETATM 8510 O O   . HOH I 6 .   ? 46.169  10.258  11.168  1.00 38.21  ? 2076 HOH A O   1 
HETATM 8511 O O   . HOH I 6 .   ? 39.898  -1.919  23.892  1.00 54.50  ? 2077 HOH A O   1 
HETATM 8512 O O   . HOH I 6 .   ? 36.574  1.613   34.009  1.00 55.35  ? 2078 HOH A O   1 
HETATM 8513 O O   . HOH I 6 .   ? 27.305  -1.270  37.260  1.00 42.01  ? 2079 HOH A O   1 
HETATM 8514 O O   . HOH I 6 .   ? 26.397  -6.535  31.775  1.00 63.20  ? 2080 HOH A O   1 
HETATM 8515 O O   . HOH I 6 .   ? 33.710  -1.559  41.842  1.00 55.30  ? 2081 HOH A O   1 
HETATM 8516 O O   . HOH I 6 .   ? 35.868  1.796   36.961  1.00 48.59  ? 2082 HOH A O   1 
HETATM 8517 O O   . HOH I 6 .   ? 25.170  4.361   46.010  1.00 50.22  ? 2083 HOH A O   1 
HETATM 8518 O O   . HOH I 6 .   ? 25.542  15.390  18.219  1.00 45.67  ? 2084 HOH A O   1 
HETATM 8519 O O   . HOH I 6 .   ? 36.433  -4.834  14.228  1.00 56.54  ? 2085 HOH A O   1 
HETATM 8520 O O   . HOH I 6 .   ? 36.833  -6.354  16.388  1.00 56.22  ? 2086 HOH A O   1 
HETATM 8521 O O   . HOH I 6 .   ? 25.710  -5.850  21.566  1.00 59.71  ? 2087 HOH A O   1 
HETATM 8522 O O   . HOH I 6 .   ? 28.292  -0.190  29.500  1.00 43.22  ? 2088 HOH A O   1 
HETATM 8523 O O   . HOH I 6 .   ? 30.559  8.095   6.647   1.00 48.79  ? 2089 HOH A O   1 
HETATM 8524 O O   . HOH I 6 .   ? 27.838  3.094   2.221   1.00 48.92  ? 2090 HOH A O   1 
HETATM 8525 O O   . HOH I 6 .   ? 31.574  1.992   3.051   1.00 63.84  ? 2091 HOH A O   1 
HETATM 8526 O O   . HOH I 6 .   ? 33.452  4.530   6.414   1.00 57.30  ? 2092 HOH A O   1 
HETATM 8527 O O   . HOH I 6 .   ? 37.171  9.391   4.427   1.00 43.36  ? 2093 HOH A O   1 
HETATM 8528 O O   . HOH I 6 .   ? 31.312  5.707   0.539   1.00 66.19  ? 2094 HOH A O   1 
HETATM 8529 O O   . HOH I 6 .   ? 36.480  12.396  6.931   1.00 41.67  ? 2095 HOH A O   1 
HETATM 8530 O O   . HOH I 6 .   ? 37.579  3.254   4.864   1.00 60.16  ? 2096 HOH A O   1 
HETATM 8531 O O   . HOH I 6 .   ? 41.106  6.671   3.034   1.00 49.77  ? 2097 HOH A O   1 
HETATM 8532 O O   . HOH I 6 .   ? 46.248  1.575   3.433   1.00 62.75  ? 2098 HOH A O   1 
HETATM 8533 O O   . HOH I 6 .   ? 50.635  6.940   3.291   1.00 64.33  ? 2099 HOH A O   1 
HETATM 8534 O O   . HOH I 6 .   ? 46.939  8.044   0.280   1.00 55.50  ? 2100 HOH A O   1 
HETATM 8535 O O   . HOH I 6 .   ? 44.863  10.900  -1.389  1.00 60.37  ? 2101 HOH A O   1 
HETATM 8536 O O   . HOH I 6 .   ? 50.577  3.111   7.284   0.50 41.66  ? 2102 HOH A O   1 
HETATM 8537 O O   . HOH I 6 .   ? 50.787  14.675  1.592   1.00 57.63  ? 2103 HOH A O   1 
HETATM 8538 O O   . HOH I 6 .   ? 38.067  11.854  4.796   1.00 42.50  ? 2104 HOH A O   1 
HETATM 8539 O O   . HOH I 6 .   ? 53.158  11.103  3.171   1.00 56.17  ? 2105 HOH A O   1 
HETATM 8540 O O   . HOH I 6 .   ? 54.918  15.217  4.362   1.00 62.23  ? 2106 HOH A O   1 
HETATM 8541 O O   . HOH I 6 .   ? 59.353  20.721  3.705   1.00 62.43  ? 2107 HOH A O   1 
HETATM 8542 O O   . HOH I 6 .   ? 61.393  17.493  12.330  1.00 69.45  ? 2108 HOH A O   1 
HETATM 8543 O O   . HOH I 6 .   ? 63.911  5.492   17.126  1.00 66.94  ? 2109 HOH A O   1 
HETATM 8544 O O   . HOH I 6 .   ? 58.622  4.697   10.008  1.00 72.42  ? 2110 HOH A O   1 
HETATM 8545 O O   . HOH I 6 .   ? 52.284  9.438   22.194  1.00 55.66  ? 2111 HOH A O   1 
HETATM 8546 O O   . HOH I 6 .   ? 53.337  20.735  25.313  1.00 56.35  ? 2112 HOH A O   1 
HETATM 8547 O O   . HOH I 6 .   ? 49.339  23.429  24.842  1.00 55.87  ? 2113 HOH A O   1 
HETATM 8548 O O   . HOH I 6 .   ? 48.105  26.001  23.755  1.00 55.66  ? 2114 HOH A O   1 
HETATM 8549 O O   . HOH I 6 .   ? 53.322  28.598  15.436  1.00 62.59  ? 2115 HOH A O   1 
HETATM 8550 O O   . HOH I 6 .   ? 53.019  26.153  14.029  1.00 61.29  ? 2116 HOH A O   1 
HETATM 8551 O O   . HOH I 6 .   ? 48.980  28.249  15.890  1.00 61.69  ? 2117 HOH A O   1 
HETATM 8552 O O   . HOH I 6 .   ? 39.344  20.027  16.351  1.00 49.95  ? 2118 HOH A O   1 
HETATM 8553 O O   . HOH I 6 .   ? 47.335  24.204  2.363   1.00 78.64  ? 2119 HOH A O   1 
HETATM 8554 O O   . HOH I 6 .   ? 42.958  21.676  0.580   1.00 67.50  ? 2120 HOH A O   1 
HETATM 8555 O O   . HOH I 6 .   ? 38.790  15.338  0.810   1.00 50.58  ? 2121 HOH A O   1 
HETATM 8556 O O   . HOH I 6 .   ? 41.124  11.890  -6.540  1.00 70.10  ? 2122 HOH A O   1 
HETATM 8557 O O   . HOH I 6 .   ? 40.306  25.835  -2.501  1.00 81.50  ? 2123 HOH A O   1 
HETATM 8558 O O   . HOH I 6 .   ? 37.118  22.830  4.465   1.00 55.97  ? 2124 HOH A O   1 
HETATM 8559 O O   . HOH I 6 .   ? 36.344  11.804  -0.246  1.00 56.06  ? 2125 HOH A O   1 
HETATM 8560 O O   . HOH I 6 .   ? 43.661  11.045  9.452   1.00 46.56  ? 2126 HOH A O   1 
HETATM 8561 O O   . HOH I 6 .   ? 38.916  18.407  10.193  1.00 48.88  ? 2127 HOH A O   1 
HETATM 8562 O O   . HOH I 6 .   ? 38.139  15.310  12.555  1.00 44.90  ? 2128 HOH A O   1 
HETATM 8563 O O   . HOH I 6 .   ? 30.280  1.638   -1.756  1.00 70.42  ? 2129 HOH A O   1 
HETATM 8564 O O   . HOH I 6 .   ? 33.657  1.599   4.688   1.00 61.15  ? 2130 HOH A O   1 
HETATM 8565 O O   . HOH I 6 .   ? 32.715  0.560   -1.921  1.00 56.00  ? 2131 HOH A O   1 
HETATM 8566 O O   . HOH I 6 .   ? 23.334  -14.778 9.576   1.00 75.65  ? 2132 HOH A O   1 
HETATM 8567 O O   . HOH I 6 .   ? 11.191  22.304  6.416   1.00 59.12  ? 2133 HOH A O   1 
HETATM 8568 O O   . HOH I 6 .   ? 18.255  14.357  4.031   1.00 50.53  ? 2134 HOH A O   1 
HETATM 8569 O O   . HOH I 6 .   ? 22.003  19.802  7.188   1.00 52.72  ? 2135 HOH A O   1 
HETATM 8570 O O   . HOH I 6 .   ? 29.021  24.183  13.351  1.00 63.60  ? 2136 HOH A O   1 
HETATM 8571 O O   . HOH I 6 .   ? 34.488  27.998  6.272   1.00 64.79  ? 2137 HOH A O   1 
HETATM 8572 O O   . HOH I 6 .   ? 35.215  24.226  0.977   1.00 66.75  ? 2138 HOH A O   1 
HETATM 8573 O O   . HOH I 6 .   ? 22.654  38.732  -0.429  1.00 63.46  ? 2139 HOH A O   1 
HETATM 8574 O O   . HOH I 6 .   ? 13.178  29.970  0.577   1.00 65.04  ? 2140 HOH A O   1 
HETATM 8575 O O   . HOH I 6 .   ? 14.992  30.661  3.021   1.00 66.10  ? 2141 HOH A O   1 
HETATM 8576 O O   . HOH I 6 .   ? 27.207  31.909  -11.364 1.00 59.45  ? 2142 HOH A O   1 
HETATM 8577 O O   . HOH I 6 .   ? 25.039  19.698  -17.168 1.00 59.95  ? 2143 HOH A O   1 
HETATM 8578 O O   . HOH I 6 .   ? 31.123  25.027  -12.696 1.00 58.73  ? 2144 HOH A O   1 
HETATM 8579 O O   . HOH I 6 .   ? 34.341  23.270  -7.563  1.00 55.10  ? 2145 HOH A O   1 
HETATM 8580 O O   . HOH I 6 .   ? 35.076  15.738  -7.863  1.00 61.61  ? 2146 HOH A O   1 
HETATM 8581 O O   . HOH I 6 .   ? 30.264  15.883  0.669   1.00 52.40  ? 2147 HOH A O   1 
HETATM 8582 O O   . HOH I 6 .   ? 33.381  7.115   -1.590  1.00 70.89  ? 2148 HOH A O   1 
HETATM 8583 O O   . HOH I 6 .   ? 40.186  10.716  -8.636  1.00 63.28  ? 2149 HOH A O   1 
HETATM 8584 O O   . HOH I 6 .   ? 16.001  13.710  -8.829  1.00 53.72  ? 2150 HOH A O   1 
HETATM 8585 O O   . HOH I 6 .   ? 16.427  20.365  -20.561 1.00 58.79  ? 2151 HOH A O   1 
HETATM 8586 O O   . HOH I 6 .   ? 13.561  29.216  -8.528  1.00 49.69  ? 2152 HOH A O   1 
HETATM 8587 O O   . HOH I 6 .   ? 10.879  25.943  -8.756  1.00 58.31  ? 2153 HOH A O   1 
HETATM 8588 O O   . HOH I 6 .   ? 17.047  19.079  -0.805  1.00 54.35  ? 2154 HOH A O   1 
HETATM 8589 O O   . HOH I 6 .   ? 13.313  21.024  0.049   1.00 63.44  ? 2155 HOH A O   1 
HETATM 8590 O O   . HOH I 6 .   ? 27.405  7.591   -0.581  1.00 54.32  ? 2156 HOH A O   1 
HETATM 8591 O O   . HOH I 6 .   ? 26.829  8.605   7.630   1.00 54.68  ? 2157 HOH A O   1 
HETATM 8592 O O   . HOH I 6 .   ? 24.089  -3.686  -1.129  1.00 72.81  ? 2158 HOH A O   1 
HETATM 8593 O O   . HOH I 6 .   ? 16.433  -12.388 7.040   1.00 62.28  ? 2159 HOH A O   1 
HETATM 8594 O O   . HOH I 6 .   ? 14.765  -5.662  11.065  1.00 59.39  ? 2160 HOH A O   1 
HETATM 8595 O O   . HOH I 6 .   ? 13.904  20.832  13.997  1.00 53.68  ? 2161 HOH A O   1 
HETATM 8596 O O   . HOH I 6 .   ? 5.116   18.967  10.911  1.00 56.11  ? 2162 HOH A O   1 
HETATM 8597 O O   . HOH I 6 .   ? 11.244  27.718  12.127  1.00 59.12  ? 2163 HOH A O   1 
HETATM 8598 O O   . HOH I 6 .   ? 16.696  25.624  17.504  1.00 49.99  ? 2164 HOH A O   1 
HETATM 8599 O O   . HOH I 6 .   ? 15.368  27.160  21.694  1.00 65.39  ? 2165 HOH A O   1 
HETATM 8600 O O   . HOH I 6 .   ? 19.772  32.800  9.857   1.00 61.65  ? 2166 HOH A O   1 
HETATM 8601 O O   . HOH I 6 .   ? 14.547  32.281  10.755  1.00 56.79  ? 2167 HOH A O   1 
HETATM 8602 O O   . HOH I 6 .   ? 13.226  22.886  1.760   1.00 55.98  ? 2168 HOH A O   1 
HETATM 8603 O O   . HOH I 6 .   ? 20.696  14.901  12.803  1.00 51.49  ? 2169 HOH A O   1 
HETATM 8604 O O   . HOH I 6 .   ? 18.477  11.802  13.016  1.00 43.62  ? 2170 HOH A O   1 
HETATM 8605 O O   . HOH I 6 .   ? 15.746  23.719  33.200  1.00 61.74  ? 2171 HOH A O   1 
HETATM 8606 O O   . HOH I 6 .   ? 14.351  29.346  22.851  1.00 64.32  ? 2172 HOH A O   1 
HETATM 8607 O O   . HOH I 6 .   ? 17.177  25.215  21.934  1.00 61.99  ? 2173 HOH A O   1 
HETATM 8608 O O   . HOH I 6 .   ? -1.180  19.126  26.559  1.00 67.50  ? 2174 HOH A O   1 
HETATM 8609 O O   . HOH I 6 .   ? 13.216  3.409   32.242  1.00 62.74  ? 2175 HOH A O   1 
HETATM 8610 O O   . HOH I 6 .   ? 9.992   9.808   3.093   1.00 60.55  ? 2176 HOH A O   1 
HETATM 8611 O O   . HOH I 6 .   ? 14.785  1.385   1.455   1.00 58.39  ? 2177 HOH A O   1 
HETATM 8612 O O   . HOH I 6 .   ? 13.119  5.934   -4.368  1.00 63.46  ? 2178 HOH A O   1 
HETATM 8613 O O   . HOH I 6 .   ? 11.771  2.939   -12.075 1.00 57.93  ? 2179 HOH A O   1 
HETATM 8614 O O   . HOH I 6 .   ? 14.866  7.887   -4.244  1.00 58.52  ? 2180 HOH A O   1 
HETATM 8615 O O   . HOH I 6 .   ? 26.461  5.323   0.812   1.00 54.98  ? 2181 HOH A O   1 
HETATM 8616 O O   . HOH I 6 .   ? 30.641  35.904  -0.950  1.00 78.33  ? 2182 HOH A O   1 
HETATM 8617 O O   . HOH I 6 .   ? 29.706  32.338  -1.237  1.00 68.14  ? 2183 HOH A O   1 
HETATM 8618 O O   . HOH J 6 .   ? -0.147  19.372  -64.367 1.00 59.37  ? 2001 HOH B O   1 
HETATM 8619 O O   . HOH J 6 .   ? 2.274   16.268  -70.270 1.00 64.92  ? 2002 HOH B O   1 
HETATM 8620 O O   . HOH J 6 .   ? 0.878   16.809  -65.729 1.00 58.62  ? 2003 HOH B O   1 
HETATM 8621 O O   . HOH J 6 .   ? 0.444   16.498  -68.324 1.00 66.10  ? 2004 HOH B O   1 
HETATM 8622 O O   . HOH J 6 .   ? 8.296   -0.733  -67.541 1.00 56.52  ? 2005 HOH B O   1 
HETATM 8623 O O   . HOH J 6 .   ? 7.151   22.624  -67.026 1.00 73.70  ? 2006 HOH B O   1 
HETATM 8624 O O   . HOH J 6 .   ? 4.317   22.574  -67.638 1.00 75.83  ? 2007 HOH B O   1 
HETATM 8625 O O   . HOH J 6 .   ? -14.593 2.490   -61.428 1.00 60.73  ? 2008 HOH B O   1 
HETATM 8626 O O   . HOH J 6 .   ? -23.411 6.548   -48.827 1.00 72.61  ? 2009 HOH B O   1 
HETATM 8627 O O   . HOH J 6 .   ? -20.242 5.612   -53.691 1.00 77.96  ? 2010 HOH B O   1 
HETATM 8628 O O   . HOH J 6 .   ? -2.420  -7.653  -59.614 1.00 69.10  ? 2011 HOH B O   1 
HETATM 8629 O O   . HOH J 6 .   ? -8.131  -2.636  -53.430 1.00 59.72  ? 2012 HOH B O   1 
HETATM 8630 O O   . HOH J 6 .   ? -2.136  -12.120 -53.190 1.00 77.14  ? 2013 HOH B O   1 
HETATM 8631 O O   . HOH J 6 .   ? 5.287   8.166   -64.290 1.00 49.39  ? 2014 HOH B O   1 
HETATM 8632 O O   . HOH J 6 .   ? 7.995   0.902   -62.135 1.00 47.35  ? 2015 HOH B O   1 
HETATM 8633 O O   . HOH J 6 .   ? 9.260   1.302   -68.655 1.00 51.42  ? 2016 HOH B O   1 
HETATM 8634 O O   . HOH J 6 .   ? 18.490  -12.759 -36.290 1.00 57.82  ? 2017 HOH B O   1 
HETATM 8635 O O   . HOH J 6 .   ? 17.043  -8.097  -60.463 1.00 63.09  ? 2018 HOH B O   1 
HETATM 8636 O O   . HOH J 6 .   ? -14.803 -3.449  -51.874 1.00 76.80  ? 2019 HOH B O   1 
HETATM 8637 O O   . HOH J 6 .   ? 10.793  10.329  -68.189 1.00 57.97  ? 2020 HOH B O   1 
HETATM 8638 O O   . HOH J 6 .   ? 4.455   0.621   -69.086 1.00 55.60  ? 2021 HOH B O   1 
HETATM 8639 O O   . HOH J 6 .   ? 2.826   8.743   -73.689 1.00 62.66  ? 2022 HOH B O   1 
HETATM 8640 O O   . HOH J 6 .   ? -0.665  0.787   -76.314 1.00 69.22  ? 2023 HOH B O   1 
HETATM 8641 O O   . HOH J 6 .   ? -1.702  6.349   -77.116 1.00 70.87  ? 2024 HOH B O   1 
HETATM 8642 O O   . HOH J 6 .   ? -0.619  7.386   -72.811 1.00 58.16  ? 2025 HOH B O   1 
HETATM 8643 O O   . HOH J 6 .   ? -4.976  -1.499  -70.183 1.00 64.49  ? 2026 HOH B O   1 
HETATM 8644 O O   . HOH J 6 .   ? -8.577  -0.507  -66.459 1.00 69.51  ? 2027 HOH B O   1 
HETATM 8645 O O   . HOH J 6 .   ? -4.180  -4.215  -66.974 1.00 52.96  ? 2028 HOH B O   1 
HETATM 8646 O O   . HOH J 6 .   ? 5.145   -5.804  -60.674 1.00 55.52  ? 2029 HOH B O   1 
HETATM 8647 O O   . HOH J 6 .   ? -0.031  -7.266  -57.911 1.00 61.00  ? 2030 HOH B O   1 
HETATM 8648 O O   . HOH J 6 .   ? -1.622  23.483  -19.926 1.00 68.78  ? 2031 HOH B O   1 
HETATM 8649 O O   . HOH J 6 .   ? 9.749   -13.733 -38.797 1.00 64.76  ? 2032 HOH B O   1 
HETATM 8650 O O   . HOH J 6 .   ? 11.187  -14.661 -46.556 1.00 52.27  ? 2033 HOH B O   1 
HETATM 8651 O O   . HOH J 6 .   ? 3.899   -14.019 -38.159 1.00 59.19  ? 2034 HOH B O   1 
HETATM 8652 O O   . HOH J 6 .   ? 11.037  -16.832 -40.550 1.00 60.76  ? 2035 HOH B O   1 
HETATM 8653 O O   . HOH J 6 .   ? -2.577  -16.145 -43.754 1.00 73.81  ? 2036 HOH B O   1 
HETATM 8654 O O   . HOH J 6 .   ? -5.407  -7.949  -41.963 1.00 56.68  ? 2037 HOH B O   1 
HETATM 8655 O O   . HOH J 6 .   ? -0.709  -17.210 -45.234 1.00 63.11  ? 2038 HOH B O   1 
HETATM 8656 O O   . HOH J 6 .   ? 4.787   -3.962  -42.727 1.00 49.54  ? 2039 HOH B O   1 
HETATM 8657 O O   . HOH J 6 .   ? -0.980  -7.786  -45.099 1.00 59.67  ? 2040 HOH B O   1 
HETATM 8658 O O   . HOH J 6 .   ? 2.677   -12.836 -47.027 1.00 56.18  ? 2041 HOH B O   1 
HETATM 8659 O O   . HOH J 6 .   ? 30.730  1.053   -36.461 1.00 55.58  ? 2042 HOH B O   1 
HETATM 8660 O O   . HOH J 6 .   ? -1.997  -11.770 -45.952 1.00 54.67  ? 2043 HOH B O   1 
HETATM 8661 O O   . HOH J 6 .   ? -4.708  -10.898 -50.433 1.00 72.11  ? 2044 HOH B O   1 
HETATM 8662 O O   . HOH J 6 .   ? 0.941   -12.917 -51.554 1.00 65.53  ? 2045 HOH B O   1 
HETATM 8663 O O   . HOH J 6 .   ? -5.977  -4.087  -55.615 1.00 57.98  ? 2046 HOH B O   1 
HETATM 8664 O O   . HOH J 6 .   ? 4.615   -13.782 -53.562 1.00 59.61  ? 2047 HOH B O   1 
HETATM 8665 O O   . HOH J 6 .   ? 10.299  -6.156  -64.463 1.00 45.97  ? 2048 HOH B O   1 
HETATM 8666 O O   . HOH J 6 .   ? 9.295   -1.232  -60.950 1.00 55.24  ? 2049 HOH B O   1 
HETATM 8667 O O   . HOH J 6 .   ? 6.854   -0.094  -65.040 1.00 57.34  ? 2050 HOH B O   1 
HETATM 8668 O O   . HOH J 6 .   ? 0.581   -0.052  -56.259 1.00 53.35  ? 2051 HOH B O   1 
HETATM 8669 O O   . HOH J 6 .   ? 12.779  -20.457 -52.158 1.00 67.23  ? 2052 HOH B O   1 
HETATM 8670 O O   . HOH J 6 .   ? 27.059  -13.459 -36.042 1.00 71.50  ? 2053 HOH B O   1 
HETATM 8671 O O   . HOH J 6 .   ? 17.041  -11.083 -34.737 1.00 59.10  ? 2054 HOH B O   1 
HETATM 8672 O O   . HOH J 6 .   ? -10.001 12.771  -59.745 1.00 59.34  ? 2055 HOH B O   1 
HETATM 8673 O O   . HOH J 6 .   ? 4.396   4.217   -48.442 1.00 45.47  ? 2056 HOH B O   1 
HETATM 8674 O O   . HOH J 6 .   ? 10.780  -0.293  -44.024 1.00 45.50  ? 2057 HOH B O   1 
HETATM 8675 O O   . HOH J 6 .   ? 7.074   -2.802  -50.832 1.00 52.74  ? 2058 HOH B O   1 
HETATM 8676 O O   . HOH J 6 .   ? -3.273  0.380   -48.703 1.00 53.21  ? 2059 HOH B O   1 
HETATM 8677 O O   . HOH J 6 .   ? -4.847  -7.070  -47.200 1.00 59.83  ? 2060 HOH B O   1 
HETATM 8678 O O   . HOH J 6 .   ? -2.928  -5.843  -45.246 1.00 53.15  ? 2061 HOH B O   1 
HETATM 8679 O O   . HOH J 6 .   ? -9.736  -3.474  -48.401 1.00 64.94  ? 2062 HOH B O   1 
HETATM 8680 O O   . HOH J 6 .   ? -7.638  6.921   -45.237 1.00 54.61  ? 2063 HOH B O   1 
HETATM 8681 O O   . HOH J 6 .   ? -15.042 -0.619  -53.103 1.00 61.64  ? 2064 HOH B O   1 
HETATM 8682 O O   . HOH J 6 .   ? -12.672 -1.996  -52.256 1.00 70.96  ? 2065 HOH B O   1 
HETATM 8683 O O   . HOH J 6 .   ? 1.883   -0.115  -53.730 1.00 56.31  ? 2066 HOH B O   1 
HETATM 8684 O O   . HOH J 6 .   ? 17.621  -3.109  -56.005 1.00 56.19  ? 2067 HOH B O   1 
HETATM 8685 O O   . HOH J 6 .   ? 23.266  -1.138  -45.212 1.00 53.45  ? 2068 HOH B O   1 
HETATM 8686 O O   . HOH J 6 .   ? 22.018  1.856   -48.153 1.00 51.50  ? 2069 HOH B O   1 
HETATM 8687 O O   . HOH J 6 .   ? -6.048  5.425   -21.472 1.00 72.74  ? 2070 HOH B O   1 
HETATM 8688 O O   . HOH J 6 .   ? 25.247  -2.790  -46.990 1.00 51.44  ? 2071 HOH B O   1 
HETATM 8689 O O   . HOH J 6 .   ? 31.898  6.641   -58.639 1.00 72.13  ? 2072 HOH B O   1 
HETATM 8690 O O   . HOH J 6 .   ? 28.430  5.687   -51.937 1.00 60.78  ? 2073 HOH B O   1 
HETATM 8691 O O   . HOH J 6 .   ? -14.717 17.996  -42.553 1.00 73.80  ? 2074 HOH B O   1 
HETATM 8692 O O   . HOH J 6 .   ? 9.269   20.510  -57.135 1.00 59.47  ? 2075 HOH B O   1 
HETATM 8693 O O   . HOH J 6 .   ? 7.456   24.092  -54.208 1.00 74.41  ? 2076 HOH B O   1 
HETATM 8694 O O   . HOH J 6 .   ? 9.307   12.104  -61.915 1.00 74.04  ? 2077 HOH B O   1 
HETATM 8695 O O   . HOH J 6 .   ? 1.513   18.843  -59.948 1.00 47.26  ? 2078 HOH B O   1 
HETATM 8696 O O   . HOH J 6 .   ? -4.200  22.689  -20.523 1.00 61.80  ? 2079 HOH B O   1 
HETATM 8697 O O   . HOH J 6 .   ? 0.061   19.480  -47.271 1.00 50.15  ? 2080 HOH B O   1 
HETATM 8698 O O   . HOH J 6 .   ? 4.440   1.773   -40.853 1.00 48.88  ? 2081 HOH B O   1 
HETATM 8699 O O   . HOH J 6 .   ? 3.909   3.594   -33.988 1.00 46.04  ? 2082 HOH B O   1 
HETATM 8700 O O   . HOH J 6 .   ? 22.598  15.751  -46.080 1.00 48.82  ? 2083 HOH B O   1 
HETATM 8701 O O   . HOH J 6 .   ? 22.121  17.465  -47.886 1.00 55.63  ? 2084 HOH B O   1 
HETATM 8702 O O   . HOH J 6 .   ? 14.991  24.025  -42.700 1.00 71.32  ? 2085 HOH B O   1 
HETATM 8703 O O   . HOH J 6 .   ? 11.385  24.054  -45.294 1.00 71.16  ? 2086 HOH B O   1 
HETATM 8704 O O   . HOH J 6 .   ? 6.135   16.430  -53.677 1.00 47.24  ? 2087 HOH B O   1 
HETATM 8705 O O   . HOH J 6 .   ? 20.800  7.034   -36.743 1.00 56.82  ? 2088 HOH B O   1 
HETATM 8706 O O   . HOH J 6 .   ? 17.328  5.190   -34.937 1.00 48.01  ? 2089 HOH B O   1 
HETATM 8707 O O   . HOH J 6 .   ? 22.668  0.638   -36.642 1.00 53.56  ? 2090 HOH B O   1 
HETATM 8708 O O   . HOH J 6 .   ? 25.097  6.191   -37.912 1.00 63.82  ? 2091 HOH B O   1 
HETATM 8709 O O   . HOH J 6 .   ? 32.571  2.049   -38.055 1.00 63.84  ? 2092 HOH B O   1 
HETATM 8710 O O   . HOH J 6 .   ? 34.339  -2.527  -43.528 1.00 56.07  ? 2093 HOH B O   1 
HETATM 8711 O O   . HOH J 6 .   ? 32.613  -2.333  -38.294 1.00 64.48  ? 2094 HOH B O   1 
HETATM 8712 O O   . HOH J 6 .   ? 31.516  -3.630  -36.159 1.00 58.44  ? 2095 HOH B O   1 
HETATM 8713 O O   . HOH J 6 .   ? 32.514  -8.573  -43.610 1.00 61.91  ? 2096 HOH B O   1 
HETATM 8714 O O   . HOH J 6 .   ? 36.471  -12.686 -52.269 1.00 76.72  ? 2097 HOH B O   1 
HETATM 8715 O O   . HOH J 6 .   ? 37.311  -8.968  -54.228 1.00 71.38  ? 2098 HOH B O   1 
HETATM 8716 O O   . HOH J 6 .   ? 37.524  -2.709  -52.555 1.00 66.55  ? 2099 HOH B O   1 
HETATM 8717 O O   . HOH J 6 .   ? 24.061  -3.012  -59.521 1.00 63.49  ? 2100 HOH B O   1 
HETATM 8718 O O   . HOH J 6 .   ? 10.369  -13.916 -49.005 1.00 57.49  ? 2101 HOH B O   1 
HETATM 8719 O O   . HOH J 6 .   ? 9.714   -18.427 -48.936 1.00 72.16  ? 2102 HOH B O   1 
HETATM 8720 O O   . HOH J 6 .   ? 16.204  -19.604 -52.040 1.00 53.81  ? 2103 HOH B O   1 
HETATM 8721 O O   . HOH J 6 .   ? 14.750  -7.566  -49.179 1.00 52.37  ? 2104 HOH B O   1 
HETATM 8722 O O   . HOH J 6 .   ? 25.348  -12.536 -34.152 1.00 66.52  ? 2105 HOH B O   1 
HETATM 8723 O O   . HOH J 6 .   ? 17.611  -12.960 -30.357 1.00 65.98  ? 2106 HOH B O   1 
HETATM 8724 O O   . HOH J 6 .   ? 17.288  -11.268 -32.132 1.00 65.85  ? 2107 HOH B O   1 
HETATM 8725 O O   . HOH J 6 .   ? 15.429  -7.124  -34.186 1.00 63.96  ? 2108 HOH B O   1 
HETATM 8726 O O   . HOH J 6 .   ? 19.715  -1.485  -37.690 1.00 46.39  ? 2109 HOH B O   1 
HETATM 8727 O O   . HOH J 6 .   ? 26.565  8.254   -53.172 1.00 63.42  ? 2110 HOH B O   1 
HETATM 8728 O O   . HOH J 6 .   ? 24.807  6.614   -35.091 1.00 58.58  ? 2111 HOH B O   1 
HETATM 8729 O O   . HOH J 6 .   ? 13.430  26.021  -42.751 1.00 76.20  ? 2112 HOH B O   1 
HETATM 8730 O O   . HOH J 6 .   ? 7.107   28.187  -43.824 1.00 67.00  ? 2113 HOH B O   1 
HETATM 8731 O O   . HOH J 6 .   ? -2.821  -0.153  -22.459 1.00 65.63  ? 2114 HOH B O   1 
HETATM 8732 O O   . HOH J 6 .   ? 5.506   -2.318  -29.179 1.00 54.33  ? 2115 HOH B O   1 
HETATM 8733 O O   . HOH J 6 .   ? 21.286  -6.119  -10.952 1.00 71.15  ? 2116 HOH B O   1 
HETATM 8734 O O   . HOH J 6 .   ? 24.204  -8.619  -27.468 1.00 68.58  ? 2117 HOH B O   1 
HETATM 8735 O O   . HOH J 6 .   ? 23.806  1.215   -32.639 1.00 58.74  ? 2118 HOH B O   1 
HETATM 8736 O O   . HOH J 6 .   ? 24.871  -3.533  -8.249  1.00 73.71  ? 2119 HOH B O   1 
HETATM 8737 O O   . HOH J 6 .   ? 12.143  -4.170  -10.998 1.00 64.22  ? 2120 HOH B O   1 
HETATM 8738 O O   . HOH J 6 .   ? 10.368  -7.597  -5.376  1.00 66.25  ? 2121 HOH B O   1 
HETATM 8739 O O   . HOH J 6 .   ? 0.860   -2.651  -19.648 1.00 52.43  ? 2122 HOH B O   1 
HETATM 8740 O O   . HOH J 6 .   ? 19.706  15.595  -25.961 1.00 62.00  ? 2123 HOH B O   1 
HETATM 8741 O O   . HOH J 6 .   ? 14.633  28.810  -30.799 1.00 59.81  ? 2124 HOH B O   1 
HETATM 8742 O O   . HOH J 6 .   ? 7.146   27.665  -31.748 1.00 59.69  ? 2125 HOH B O   1 
HETATM 8743 O O   . HOH J 6 .   ? 8.435   28.526  -34.520 1.00 64.68  ? 2126 HOH B O   1 
HETATM 8744 O O   . HOH J 6 .   ? 8.023   24.678  -31.753 1.00 49.87  ? 2127 HOH B O   1 
HETATM 8745 O O   . HOH J 6 .   ? -0.480  26.528  -32.129 1.00 49.63  ? 2128 HOH B O   1 
HETATM 8746 O O   . HOH J 6 .   ? 3.354   7.321   -33.359 1.00 51.01  ? 2129 HOH B O   1 
HETATM 8747 O O   . HOH J 6 .   ? -4.672  2.772   -22.756 1.00 64.49  ? 2130 HOH B O   1 
HETATM 8748 O O   . HOH J 6 .   ? -4.162  0.766   -30.510 1.00 55.39  ? 2131 HOH B O   1 
HETATM 8749 O O   . HOH J 6 .   ? -4.529  -6.794  -34.596 1.00 63.64  ? 2132 HOH B O   1 
HETATM 8750 O O   . HOH J 6 .   ? -5.866  -4.068  -34.858 1.00 60.24  ? 2133 HOH B O   1 
HETATM 8751 O O   . HOH J 6 .   ? -16.066 -8.225  -38.218 1.00 76.77  ? 2134 HOH B O   1 
HETATM 8752 O O   . HOH J 6 .   ? -8.635  -3.945  -37.866 1.00 59.80  ? 2135 HOH B O   1 
HETATM 8753 O O   . HOH J 6 .   ? -19.480 9.013   -39.478 1.00 73.03  ? 2136 HOH B O   1 
HETATM 8754 O O   . HOH J 6 .   ? -9.472  17.758  -33.894 1.00 62.84  ? 2137 HOH B O   1 
HETATM 8755 O O   . HOH J 6 .   ? -13.373 17.779  -40.099 1.00 67.72  ? 2138 HOH B O   1 
HETATM 8756 O O   . HOH J 6 .   ? -8.802  19.929  -47.670 1.00 65.11  ? 2139 HOH B O   1 
HETATM 8757 O O   . HOH J 6 .   ? -6.953  18.372  -47.294 1.00 67.81  ? 2140 HOH B O   1 
HETATM 8758 O O   . HOH J 6 .   ? -5.029  24.488  -38.230 1.00 61.65  ? 2141 HOH B O   1 
HETATM 8759 O O   . HOH J 6 .   ? -13.713 30.348  -25.003 1.00 59.45  ? 2142 HOH B O   1 
HETATM 8760 O O   . HOH J 6 .   ? -17.199 27.418  -23.379 1.00 75.30  ? 2143 HOH B O   1 
HETATM 8761 O O   . HOH J 6 .   ? 3.362   19.597  -28.595 1.00 44.68  ? 2144 HOH B O   1 
HETATM 8762 O O   . HOH J 6 .   ? 6.308   23.690  -25.000 1.00 42.03  ? 2145 HOH B O   1 
HETATM 8763 O O   . HOH J 6 .   ? 12.235  26.161  -28.108 1.00 55.52  ? 2146 HOH B O   1 
HETATM 8764 O O   . HOH J 6 .   ? 11.391  27.918  -25.224 1.00 60.17  ? 2147 HOH B O   1 
HETATM 8765 O O   . HOH J 6 .   ? 10.796  16.587  -23.222 1.00 48.23  ? 2148 HOH B O   1 
HETATM 8766 O O   . HOH J 6 .   ? 5.142   14.084  -18.778 1.00 51.18  ? 2149 HOH B O   1 
HETATM 8767 O O   . HOH J 6 .   ? -6.680  13.078  -26.402 1.00 49.25  ? 2150 HOH B O   1 
HETATM 8768 O O   . HOH J 6 .   ? -8.290  6.124   -23.524 1.00 56.21  ? 2151 HOH B O   1 
HETATM 8769 O O   . HOH J 6 .   ? -14.349 8.549   -22.024 1.00 74.22  ? 2152 HOH B O   1 
HETATM 8770 O O   . HOH J 6 .   ? -5.510  9.434   -17.534 1.00 66.22  ? 2153 HOH B O   1 
HETATM 8771 O O   . HOH J 6 .   ? -6.493  12.942  -23.350 1.00 58.62  ? 2154 HOH B O   1 
HETATM 8772 O O   . HOH J 6 .   ? -4.288  20.190  -20.473 1.00 55.41  ? 2155 HOH B O   1 
HETATM 8773 O O   . HOH J 6 .   ? 3.103   16.834  -16.827 1.00 48.80  ? 2156 HOH B O   1 
HETATM 8774 O O   . HOH J 6 .   ? 5.096   23.318  -13.561 1.00 60.76  ? 2157 HOH B O   1 
HETATM 8775 O O   . HOH J 6 .   ? 12.629  14.622  -22.870 1.00 50.35  ? 2158 HOH B O   1 
HETATM 8776 O O   . HOH J 6 .   ? 4.956   8.455   -20.462 1.00 56.93  ? 2159 HOH B O   1 
HETATM 8777 O O   . HOH J 6 .   ? 17.315  15.036  -21.679 1.00 51.64  ? 2160 HOH B O   1 
HETATM 8778 O O   . HOH J 6 .   ? 21.265  21.882  -20.092 1.00 64.73  ? 2161 HOH B O   1 
HETATM 8779 O O   . HOH J 6 .   ? 4.127   -20.336 -24.805 1.00 68.89  ? 2162 HOH B O   1 
HETATM 8780 O O   . HOH J 6 .   ? 3.475   -16.198 -17.641 1.00 69.24  ? 2163 HOH B O   1 
HETATM 8781 O O   . HOH J 6 .   ? 9.656   -22.766 -22.219 1.00 77.99  ? 2164 HOH B O   1 
HETATM 8782 O O   . HOH J 6 .   ? 20.312  7.577   -12.708 1.00 63.38  ? 2165 HOH B O   1 
HETATM 8783 O O   . HOH J 6 .   ? 13.232  7.967   -13.768 1.00 52.95  ? 2166 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   601  601  NAG NAG A . 
D 2 NAG 1   701  701  NAG NAG A . 
E 3 X13 1   1543 1543 X13 X13 A . 
F 3 X13 1   1544 1544 X13 X13 B . 
G 4 PEG 1   1545 1545 PEG PEG B . 
H 5 P6G 1   1546 1546 P6G P6G B . 
I 6 HOH 1   2001 2001 HOH HOH A . 
I 6 HOH 2   2002 2002 HOH HOH A . 
I 6 HOH 3   2003 2003 HOH HOH A . 
I 6 HOH 4   2004 2004 HOH HOH A . 
I 6 HOH 5   2005 2005 HOH HOH A . 
I 6 HOH 6   2006 2006 HOH HOH A . 
I 6 HOH 7   2007 2007 HOH HOH A . 
I 6 HOH 8   2008 2008 HOH HOH A . 
I 6 HOH 9   2009 2009 HOH HOH A . 
I 6 HOH 10  2010 2010 HOH HOH A . 
I 6 HOH 11  2011 2011 HOH HOH A . 
I 6 HOH 12  2012 2012 HOH HOH A . 
I 6 HOH 13  2013 2013 HOH HOH A . 
I 6 HOH 14  2014 2014 HOH HOH A . 
I 6 HOH 15  2015 2015 HOH HOH A . 
I 6 HOH 16  2016 2016 HOH HOH A . 
I 6 HOH 17  2017 2017 HOH HOH A . 
I 6 HOH 18  2018 2018 HOH HOH A . 
I 6 HOH 19  2019 2019 HOH HOH A . 
I 6 HOH 20  2020 2020 HOH HOH A . 
I 6 HOH 21  2021 2021 HOH HOH A . 
I 6 HOH 22  2022 2022 HOH HOH A . 
I 6 HOH 23  2023 2023 HOH HOH A . 
I 6 HOH 24  2024 2024 HOH HOH A . 
I 6 HOH 25  2025 2025 HOH HOH A . 
I 6 HOH 26  2026 2026 HOH HOH A . 
I 6 HOH 27  2027 2027 HOH HOH A . 
I 6 HOH 28  2028 2028 HOH HOH A . 
I 6 HOH 29  2029 2029 HOH HOH A . 
I 6 HOH 30  2030 2030 HOH HOH A . 
I 6 HOH 31  2031 2031 HOH HOH A . 
I 6 HOH 32  2032 2032 HOH HOH A . 
I 6 HOH 33  2033 2033 HOH HOH A . 
I 6 HOH 34  2034 2034 HOH HOH A . 
I 6 HOH 35  2035 2035 HOH HOH A . 
I 6 HOH 36  2036 2036 HOH HOH A . 
I 6 HOH 37  2037 2037 HOH HOH A . 
I 6 HOH 38  2038 2038 HOH HOH A . 
I 6 HOH 39  2039 2039 HOH HOH A . 
I 6 HOH 40  2040 2040 HOH HOH A . 
I 6 HOH 41  2041 2041 HOH HOH A . 
I 6 HOH 42  2042 2042 HOH HOH A . 
I 6 HOH 43  2043 2043 HOH HOH A . 
I 6 HOH 44  2044 2044 HOH HOH A . 
I 6 HOH 45  2045 2045 HOH HOH A . 
I 6 HOH 46  2046 2046 HOH HOH A . 
I 6 HOH 47  2047 2047 HOH HOH A . 
I 6 HOH 48  2048 2048 HOH HOH A . 
I 6 HOH 49  2049 2049 HOH HOH A . 
I 6 HOH 50  2050 2050 HOH HOH A . 
I 6 HOH 51  2051 2051 HOH HOH A . 
I 6 HOH 52  2052 2052 HOH HOH A . 
I 6 HOH 53  2053 2053 HOH HOH A . 
I 6 HOH 54  2054 2054 HOH HOH A . 
I 6 HOH 55  2055 2055 HOH HOH A . 
I 6 HOH 56  2056 2056 HOH HOH A . 
I 6 HOH 57  2057 2057 HOH HOH A . 
I 6 HOH 58  2058 2058 HOH HOH A . 
I 6 HOH 59  2059 2059 HOH HOH A . 
I 6 HOH 60  2060 2060 HOH HOH A . 
I 6 HOH 61  2061 2061 HOH HOH A . 
I 6 HOH 62  2062 2062 HOH HOH A . 
I 6 HOH 63  2063 2063 HOH HOH A . 
I 6 HOH 64  2064 2064 HOH HOH A . 
I 6 HOH 65  2065 2065 HOH HOH A . 
I 6 HOH 66  2066 2066 HOH HOH A . 
I 6 HOH 67  2067 2067 HOH HOH A . 
I 6 HOH 68  2068 2068 HOH HOH A . 
I 6 HOH 69  2069 2069 HOH HOH A . 
I 6 HOH 70  2070 2070 HOH HOH A . 
I 6 HOH 71  2071 2071 HOH HOH A . 
I 6 HOH 72  2072 2072 HOH HOH A . 
I 6 HOH 73  2073 2073 HOH HOH A . 
I 6 HOH 74  2074 2074 HOH HOH A . 
I 6 HOH 75  2075 2075 HOH HOH A . 
I 6 HOH 76  2076 2076 HOH HOH A . 
I 6 HOH 77  2077 2077 HOH HOH A . 
I 6 HOH 78  2078 2078 HOH HOH A . 
I 6 HOH 79  2079 2079 HOH HOH A . 
I 6 HOH 80  2080 2080 HOH HOH A . 
I 6 HOH 81  2081 2081 HOH HOH A . 
I 6 HOH 82  2082 2082 HOH HOH A . 
I 6 HOH 83  2083 2083 HOH HOH A . 
I 6 HOH 84  2084 2084 HOH HOH A . 
I 6 HOH 85  2085 2085 HOH HOH A . 
I 6 HOH 86  2086 2086 HOH HOH A . 
I 6 HOH 87  2087 2087 HOH HOH A . 
I 6 HOH 88  2088 2088 HOH HOH A . 
I 6 HOH 89  2089 2089 HOH HOH A . 
I 6 HOH 90  2090 2090 HOH HOH A . 
I 6 HOH 91  2091 2091 HOH HOH A . 
I 6 HOH 92  2092 2092 HOH HOH A . 
I 6 HOH 93  2093 2093 HOH HOH A . 
I 6 HOH 94  2094 2094 HOH HOH A . 
I 6 HOH 95  2095 2095 HOH HOH A . 
I 6 HOH 96  2096 2096 HOH HOH A . 
I 6 HOH 97  2097 2097 HOH HOH A . 
I 6 HOH 98  2098 2098 HOH HOH A . 
I 6 HOH 99  2099 2099 HOH HOH A . 
I 6 HOH 100 2100 2100 HOH HOH A . 
I 6 HOH 101 2101 2101 HOH HOH A . 
I 6 HOH 102 2102 2102 HOH HOH A . 
I 6 HOH 103 2103 2103 HOH HOH A . 
I 6 HOH 104 2104 2104 HOH HOH A . 
I 6 HOH 105 2105 2105 HOH HOH A . 
I 6 HOH 106 2106 2106 HOH HOH A . 
I 6 HOH 107 2107 2107 HOH HOH A . 
I 6 HOH 108 2108 2108 HOH HOH A . 
I 6 HOH 109 2109 2109 HOH HOH A . 
I 6 HOH 110 2110 2110 HOH HOH A . 
I 6 HOH 111 2111 2111 HOH HOH A . 
I 6 HOH 112 2112 2112 HOH HOH A . 
I 6 HOH 113 2113 2113 HOH HOH A . 
I 6 HOH 114 2114 2114 HOH HOH A . 
I 6 HOH 115 2115 2115 HOH HOH A . 
I 6 HOH 116 2116 2116 HOH HOH A . 
I 6 HOH 117 2117 2117 HOH HOH A . 
I 6 HOH 118 2118 2118 HOH HOH A . 
I 6 HOH 119 2119 2119 HOH HOH A . 
I 6 HOH 120 2120 2120 HOH HOH A . 
I 6 HOH 121 2121 2121 HOH HOH A . 
I 6 HOH 122 2122 2122 HOH HOH A . 
I 6 HOH 123 2123 2123 HOH HOH A . 
I 6 HOH 124 2124 2124 HOH HOH A . 
I 6 HOH 125 2125 2125 HOH HOH A . 
I 6 HOH 126 2126 2126 HOH HOH A . 
I 6 HOH 127 2127 2127 HOH HOH A . 
I 6 HOH 128 2128 2128 HOH HOH A . 
I 6 HOH 129 2129 2129 HOH HOH A . 
I 6 HOH 130 2130 2130 HOH HOH A . 
I 6 HOH 131 2131 2131 HOH HOH A . 
I 6 HOH 132 2132 2132 HOH HOH A . 
I 6 HOH 133 2133 2133 HOH HOH A . 
I 6 HOH 134 2134 2134 HOH HOH A . 
I 6 HOH 135 2135 2135 HOH HOH A . 
I 6 HOH 136 2136 2136 HOH HOH A . 
I 6 HOH 137 2137 2137 HOH HOH A . 
I 6 HOH 138 2138 2138 HOH HOH A . 
I 6 HOH 139 2139 2139 HOH HOH A . 
I 6 HOH 140 2140 2140 HOH HOH A . 
I 6 HOH 141 2141 2141 HOH HOH A . 
I 6 HOH 142 2142 2142 HOH HOH A . 
I 6 HOH 143 2143 2143 HOH HOH A . 
I 6 HOH 144 2144 2144 HOH HOH A . 
I 6 HOH 145 2145 2145 HOH HOH A . 
I 6 HOH 146 2146 2146 HOH HOH A . 
I 6 HOH 147 2147 2147 HOH HOH A . 
I 6 HOH 148 2148 2148 HOH HOH A . 
I 6 HOH 149 2149 2149 HOH HOH A . 
I 6 HOH 150 2150 2150 HOH HOH A . 
I 6 HOH 151 2151 2151 HOH HOH A . 
I 6 HOH 152 2152 2152 HOH HOH A . 
I 6 HOH 153 2153 2153 HOH HOH A . 
I 6 HOH 154 2154 2154 HOH HOH A . 
I 6 HOH 155 2155 2155 HOH HOH A . 
I 6 HOH 156 2156 2156 HOH HOH A . 
I 6 HOH 157 2157 2157 HOH HOH A . 
I 6 HOH 158 2158 2158 HOH HOH A . 
I 6 HOH 159 2159 2159 HOH HOH A . 
I 6 HOH 160 2160 2160 HOH HOH A . 
I 6 HOH 161 2161 2161 HOH HOH A . 
I 6 HOH 162 2162 2162 HOH HOH A . 
I 6 HOH 163 2163 2163 HOH HOH A . 
I 6 HOH 164 2164 2164 HOH HOH A . 
I 6 HOH 165 2165 2165 HOH HOH A . 
I 6 HOH 166 2166 2166 HOH HOH A . 
I 6 HOH 167 2167 2167 HOH HOH A . 
I 6 HOH 168 2168 2168 HOH HOH A . 
I 6 HOH 169 2169 2169 HOH HOH A . 
I 6 HOH 170 2170 2170 HOH HOH A . 
I 6 HOH 171 2171 2171 HOH HOH A . 
I 6 HOH 172 2172 2172 HOH HOH A . 
I 6 HOH 173 2173 2173 HOH HOH A . 
I 6 HOH 174 2174 2174 HOH HOH A . 
I 6 HOH 175 2175 2175 HOH HOH A . 
I 6 HOH 176 2176 2176 HOH HOH A . 
I 6 HOH 177 2177 2177 HOH HOH A . 
I 6 HOH 178 2178 2178 HOH HOH A . 
I 6 HOH 179 2179 2179 HOH HOH A . 
I 6 HOH 180 2180 2180 HOH HOH A . 
I 6 HOH 181 2181 2181 HOH HOH A . 
I 6 HOH 182 2182 2182 HOH HOH A . 
I 6 HOH 183 2183 2183 HOH HOH A . 
J 6 HOH 1   2001 2001 HOH HOH B . 
J 6 HOH 2   2002 2002 HOH HOH B . 
J 6 HOH 3   2003 2003 HOH HOH B . 
J 6 HOH 4   2004 2004 HOH HOH B . 
J 6 HOH 5   2005 2005 HOH HOH B . 
J 6 HOH 6   2006 2006 HOH HOH B . 
J 6 HOH 7   2007 2007 HOH HOH B . 
J 6 HOH 8   2008 2008 HOH HOH B . 
J 6 HOH 9   2009 2009 HOH HOH B . 
J 6 HOH 10  2010 2010 HOH HOH B . 
J 6 HOH 11  2011 2011 HOH HOH B . 
J 6 HOH 12  2012 2012 HOH HOH B . 
J 6 HOH 13  2013 2013 HOH HOH B . 
J 6 HOH 14  2014 2014 HOH HOH B . 
J 6 HOH 15  2015 2015 HOH HOH B . 
J 6 HOH 16  2016 2016 HOH HOH B . 
J 6 HOH 17  2017 2017 HOH HOH B . 
J 6 HOH 18  2018 2018 HOH HOH B . 
J 6 HOH 19  2019 2019 HOH HOH B . 
J 6 HOH 20  2020 2020 HOH HOH B . 
J 6 HOH 21  2021 2021 HOH HOH B . 
J 6 HOH 22  2022 2022 HOH HOH B . 
J 6 HOH 23  2023 2023 HOH HOH B . 
J 6 HOH 24  2024 2024 HOH HOH B . 
J 6 HOH 25  2025 2025 HOH HOH B . 
J 6 HOH 26  2026 2026 HOH HOH B . 
J 6 HOH 27  2027 2027 HOH HOH B . 
J 6 HOH 28  2028 2028 HOH HOH B . 
J 6 HOH 29  2029 2029 HOH HOH B . 
J 6 HOH 30  2030 2030 HOH HOH B . 
J 6 HOH 31  2031 2031 HOH HOH B . 
J 6 HOH 32  2032 2032 HOH HOH B . 
J 6 HOH 33  2033 2033 HOH HOH B . 
J 6 HOH 34  2034 2034 HOH HOH B . 
J 6 HOH 35  2035 2035 HOH HOH B . 
J 6 HOH 36  2036 2036 HOH HOH B . 
J 6 HOH 37  2037 2037 HOH HOH B . 
J 6 HOH 38  2038 2038 HOH HOH B . 
J 6 HOH 39  2039 2039 HOH HOH B . 
J 6 HOH 40  2040 2040 HOH HOH B . 
J 6 HOH 41  2041 2041 HOH HOH B . 
J 6 HOH 42  2042 2042 HOH HOH B . 
J 6 HOH 43  2043 2043 HOH HOH B . 
J 6 HOH 44  2044 2044 HOH HOH B . 
J 6 HOH 45  2045 2045 HOH HOH B . 
J 6 HOH 46  2046 2046 HOH HOH B . 
J 6 HOH 47  2047 2047 HOH HOH B . 
J 6 HOH 48  2048 2048 HOH HOH B . 
J 6 HOH 49  2049 2049 HOH HOH B . 
J 6 HOH 50  2050 2050 HOH HOH B . 
J 6 HOH 51  2051 2051 HOH HOH B . 
J 6 HOH 52  2052 2052 HOH HOH B . 
J 6 HOH 53  2053 2053 HOH HOH B . 
J 6 HOH 54  2054 2054 HOH HOH B . 
J 6 HOH 55  2055 2055 HOH HOH B . 
J 6 HOH 56  2056 2056 HOH HOH B . 
J 6 HOH 57  2057 2057 HOH HOH B . 
J 6 HOH 58  2058 2058 HOH HOH B . 
J 6 HOH 59  2059 2059 HOH HOH B . 
J 6 HOH 60  2060 2060 HOH HOH B . 
J 6 HOH 61  2061 2061 HOH HOH B . 
J 6 HOH 62  2062 2062 HOH HOH B . 
J 6 HOH 63  2063 2063 HOH HOH B . 
J 6 HOH 64  2064 2064 HOH HOH B . 
J 6 HOH 65  2065 2065 HOH HOH B . 
J 6 HOH 66  2066 2066 HOH HOH B . 
J 6 HOH 67  2067 2067 HOH HOH B . 
J 6 HOH 68  2068 2068 HOH HOH B . 
J 6 HOH 69  2069 2069 HOH HOH B . 
J 6 HOH 70  2070 2070 HOH HOH B . 
J 6 HOH 71  2071 2071 HOH HOH B . 
J 6 HOH 72  2072 2072 HOH HOH B . 
J 6 HOH 73  2073 2073 HOH HOH B . 
J 6 HOH 74  2074 2074 HOH HOH B . 
J 6 HOH 75  2075 2075 HOH HOH B . 
J 6 HOH 76  2076 2076 HOH HOH B . 
J 6 HOH 77  2077 2077 HOH HOH B . 
J 6 HOH 78  2078 2078 HOH HOH B . 
J 6 HOH 79  2079 2079 HOH HOH B . 
J 6 HOH 80  2080 2080 HOH HOH B . 
J 6 HOH 81  2081 2081 HOH HOH B . 
J 6 HOH 82  2082 2082 HOH HOH B . 
J 6 HOH 83  2083 2083 HOH HOH B . 
J 6 HOH 84  2084 2084 HOH HOH B . 
J 6 HOH 85  2085 2085 HOH HOH B . 
J 6 HOH 86  2086 2086 HOH HOH B . 
J 6 HOH 87  2087 2087 HOH HOH B . 
J 6 HOH 88  2088 2088 HOH HOH B . 
J 6 HOH 89  2089 2089 HOH HOH B . 
J 6 HOH 90  2090 2090 HOH HOH B . 
J 6 HOH 91  2091 2091 HOH HOH B . 
J 6 HOH 92  2092 2092 HOH HOH B . 
J 6 HOH 93  2093 2093 HOH HOH B . 
J 6 HOH 94  2094 2094 HOH HOH B . 
J 6 HOH 95  2095 2095 HOH HOH B . 
J 6 HOH 96  2096 2096 HOH HOH B . 
J 6 HOH 97  2097 2097 HOH HOH B . 
J 6 HOH 98  2098 2098 HOH HOH B . 
J 6 HOH 99  2099 2099 HOH HOH B . 
J 6 HOH 100 2100 2100 HOH HOH B . 
J 6 HOH 101 2101 2101 HOH HOH B . 
J 6 HOH 102 2102 2102 HOH HOH B . 
J 6 HOH 103 2103 2103 HOH HOH B . 
J 6 HOH 104 2104 2104 HOH HOH B . 
J 6 HOH 105 2105 2105 HOH HOH B . 
J 6 HOH 106 2106 2106 HOH HOH B . 
J 6 HOH 107 2107 2107 HOH HOH B . 
J 6 HOH 108 2108 2108 HOH HOH B . 
J 6 HOH 109 2109 2109 HOH HOH B . 
J 6 HOH 110 2110 2110 HOH HOH B . 
J 6 HOH 111 2111 2111 HOH HOH B . 
J 6 HOH 112 2112 2112 HOH HOH B . 
J 6 HOH 113 2113 2113 HOH HOH B . 
J 6 HOH 114 2114 2114 HOH HOH B . 
J 6 HOH 115 2115 2115 HOH HOH B . 
J 6 HOH 116 2116 2116 HOH HOH B . 
J 6 HOH 117 2117 2117 HOH HOH B . 
J 6 HOH 118 2118 2118 HOH HOH B . 
J 6 HOH 119 2119 2119 HOH HOH B . 
J 6 HOH 120 2120 2120 HOH HOH B . 
J 6 HOH 121 2121 2121 HOH HOH B . 
J 6 HOH 122 2122 2122 HOH HOH B . 
J 6 HOH 123 2123 2123 HOH HOH B . 
J 6 HOH 124 2124 2124 HOH HOH B . 
J 6 HOH 125 2125 2125 HOH HOH B . 
J 6 HOH 126 2126 2126 HOH HOH B . 
J 6 HOH 127 2127 2127 HOH HOH B . 
J 6 HOH 128 2128 2128 HOH HOH B . 
J 6 HOH 129 2129 2129 HOH HOH B . 
J 6 HOH 130 2130 2130 HOH HOH B . 
J 6 HOH 131 2131 2131 HOH HOH B . 
J 6 HOH 132 2132 2132 HOH HOH B . 
J 6 HOH 133 2133 2133 HOH HOH B . 
J 6 HOH 134 2134 2134 HOH HOH B . 
J 6 HOH 135 2135 2135 HOH HOH B . 
J 6 HOH 136 2136 2136 HOH HOH B . 
J 6 HOH 137 2137 2137 HOH HOH B . 
J 6 HOH 138 2138 2138 HOH HOH B . 
J 6 HOH 139 2139 2139 HOH HOH B . 
J 6 HOH 140 2140 2140 HOH HOH B . 
J 6 HOH 141 2141 2141 HOH HOH B . 
J 6 HOH 142 2142 2142 HOH HOH B . 
J 6 HOH 143 2143 2143 HOH HOH B . 
J 6 HOH 144 2144 2144 HOH HOH B . 
J 6 HOH 145 2145 2145 HOH HOH B . 
J 6 HOH 146 2146 2146 HOH HOH B . 
J 6 HOH 147 2147 2147 HOH HOH B . 
J 6 HOH 148 2148 2148 HOH HOH B . 
J 6 HOH 149 2149 2149 HOH HOH B . 
J 6 HOH 150 2150 2150 HOH HOH B . 
J 6 HOH 151 2151 2151 HOH HOH B . 
J 6 HOH 152 2152 2152 HOH HOH B . 
J 6 HOH 153 2153 2153 HOH HOH B . 
J 6 HOH 154 2154 2154 HOH HOH B . 
J 6 HOH 155 2155 2155 HOH HOH B . 
J 6 HOH 156 2156 2156 HOH HOH B . 
J 6 HOH 157 2157 2157 HOH HOH B . 
J 6 HOH 158 2158 2158 HOH HOH B . 
J 6 HOH 159 2159 2159 HOH HOH B . 
J 6 HOH 160 2160 2160 HOH HOH B . 
J 6 HOH 161 2161 2161 HOH HOH B . 
J 6 HOH 162 2162 2162 HOH HOH B . 
J 6 HOH 163 2163 2163 HOH HOH B . 
J 6 HOH 164 2164 2164 HOH HOH B . 
J 6 HOH 165 2165 2165 HOH HOH B . 
J 6 HOH 166 2166 2166 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3300  ? 
1 MORE         -0    ? 
1 'SSA (A^2)'  37270 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-09-08 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-17 
5 'Structure model' 1 4 2020-07-29 
6 'Structure model' 1 5 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' Other                       
7 5 'Structure model' 'Structure summary'         
8 6 'Structure model' 'Derived calculations'      
9 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' diffrn_source             
2  5 'Structure model' chem_comp                 
3  5 'Structure model' entity                    
4  5 'Structure model' pdbx_chem_comp_identifier 
5  5 'Structure model' pdbx_database_status      
6  5 'Structure model' pdbx_entity_nonpoly       
7  5 'Structure model' struct_conn               
8  5 'Structure model' struct_site               
9  5 'Structure model' struct_site_gen           
10 6 'Structure model' chem_comp                 
11 6 'Structure model' pdbx_struct_assembly      
12 6 'Structure model' pdbx_struct_assembly_gen  
13 6 'Structure model' pdbx_struct_assembly_prop 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
2 5 'Structure model' '_chem_comp.name'                      
3 5 'Structure model' '_chem_comp.type'                      
4 5 'Structure model' '_entity.pdbx_description'             
5 5 'Structure model' '_pdbx_database_status.status_code_sf' 
6 5 'Structure model' '_pdbx_entity_nonpoly.name'            
7 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
8 5 'Structure model' '_struct_conn.pdbx_role'               
9 6 'Structure model' '_chem_comp.pdbx_synonyms'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
REFMAC phasing          .                 ? 4 
# 
_pdbx_entry_details.entry_id                 2WLS 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       
;N,N,N-TRIMETHYL-13-(METHYLSULFONYLTHIO)TRIDECAN-1-AMINIUM
 BROMIDE (A13): COMPUND REPORTED IN PANG Y-P, SINGH SK, GAO
 Y, LASSITER TL, MISHRA RK, ET AL.2009 SELECTIVE AND
 IRREVERSIBLE INHIBITORS OF APHID ACETYLCHOLINESTERASES
 STEPS TOWARD HUMAN-SAFE INSECTICIDES. PLOS ONE 4 E4349.
;
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 71.00   -11.37  
2  1 CYS A 96  ? ? -152.35 1.47    
3  1 PHE A 158 ? ? -142.68 -4.26   
4  1 ALA A 167 ? ? -161.55 69.49   
5  1 SER A 203 ? ? 58.94   -124.68 
6  1 ASP A 306 ? ? -140.35 -89.77  
7  1 TYR A 341 ? ? -94.76  56.91   
8  1 SER A 371 ? ? -56.58  174.11  
9  1 VAL A 407 ? ? -128.24 -66.52  
10 1 GLN A 421 ? ? -140.88 31.52   
11 1 SER A 462 ? ? -68.35  7.77    
12 1 ASN A 464 ? ? 83.16   14.97   
13 1 PHE B 47  ? ? 75.76   -0.87   
14 1 PRO B 55  ? ? -45.09  153.34  
15 1 ALA B 62  ? ? -117.95 56.64   
16 1 ALA B 167 ? ? -161.93 71.96   
17 1 SER B 203 ? ? 50.27   -124.29 
18 1 ASP B 306 ? ? -121.43 -83.79  
19 1 GLN B 322 ? ? -39.57  -74.34  
20 1 ASP B 323 ? ? -90.90  39.17   
21 1 TYR B 341 ? ? -91.95  59.55   
22 1 VAL B 367 ? ? -119.14 65.15   
23 1 HIS B 387 ? ? -146.99 58.31   
24 1 VAL B 407 ? ? -128.16 -66.07  
25 1 ASN B 464 ? ? 70.20   40.22   
26 1 ASP B 491 ? ? -58.52  107.79  
27 1 ASP B 494 ? ? 175.53  114.42  
28 1 LYS B 496 ? ? 65.97   123.32  
29 1 SER B 497 ? ? -148.95 -30.55  
30 1 PRO B 498 ? ? -75.82  -165.96 
31 1 ALA B 506 ? ? -64.18  -75.51  
32 1 SER B 541 ? ? -79.56  47.29   
33 1 ALA B 542 ? ? 179.48  24.19   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2014 ? 6.25 . 
2 1 O ? B HOH 2164 ? 6.69 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 3    ? CG  ? A ARG 3   CG  
2  1 Y 1 A ARG 3    ? CD  ? A ARG 3   CD  
3  1 Y 1 A ARG 3    ? NE  ? A ARG 3   NE  
4  1 Y 1 A ARG 3    ? CZ  ? A ARG 3   CZ  
5  1 Y 1 A ARG 3    ? NH1 ? A ARG 3   NH1 
6  1 Y 1 A ARG 3    ? NH2 ? A ARG 3   NH2 
7  1 Y 1 A ASP 323  ? CG  ? A ASP 323 CG  
8  1 Y 1 A ASP 323  ? OD1 ? A ASP 323 OD1 
9  1 Y 1 A ASP 323  ? OD2 ? A ASP 323 OD2 
10 1 Y 1 A ARG 493  ? CG  ? A ARG 493 CG  
11 1 Y 1 A ARG 493  ? CD  ? A ARG 493 CD  
12 1 Y 1 A ARG 493  ? NE  ? A ARG 493 NE  
13 1 Y 1 A ARG 493  ? CZ  ? A ARG 493 CZ  
14 1 Y 1 A ARG 493  ? NH1 ? A ARG 493 NH1 
15 1 Y 1 A ARG 493  ? NH2 ? A ARG 493 NH2 
16 1 Y 1 A LYS 496  ? CG  ? A LYS 496 CG  
17 1 Y 1 A LYS 496  ? CD  ? A LYS 496 CD  
18 1 Y 1 A LYS 496  ? CE  ? A LYS 496 CE  
19 1 Y 1 A LYS 496  ? NZ  ? A LYS 496 NZ  
20 1 Y 1 B ARG 493  ? CG  ? B ARG 493 CG  
21 1 Y 1 B ARG 493  ? CD  ? B ARG 493 CD  
22 1 Y 1 B ARG 493  ? NE  ? B ARG 493 NE  
23 1 Y 1 B ARG 493  ? CZ  ? B ARG 493 CZ  
24 1 Y 1 B ARG 493  ? NH1 ? B ARG 493 NH1 
25 1 Y 1 B ARG 493  ? NH2 ? B ARG 493 NH2 
26 1 N 1 A X13 1543 ? S19 ? E X13 1   S19 
27 1 N 1 A X13 1543 ? O1  ? E X13 1   O1  
28 1 N 1 A X13 1543 ? O2  ? E X13 1   O2  
29 1 N 1 A X13 1543 ? C20 ? E X13 1   C20 
30 1 N 1 B X13 1544 ? S19 ? F X13 1   S19 
31 1 N 1 B X13 1544 ? O1  ? F X13 1   O1  
32 1 N 1 B X13 1544 ? O2  ? F X13 1   O2  
33 1 N 1 B X13 1544 ? C20 ? F X13 1   C20 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 B GLU 1   ? B GLU 1   
10 1 Y 1 B GLY 2   ? B GLY 2   
11 1 Y 1 B ARG 3   ? B ARG 3   
12 1 Y 1 B PRO 258 ? B PRO 258 
13 1 Y 1 B PRO 259 ? B PRO 259 
14 1 Y 1 B GLY 260 ? B GLY 260 
15 1 Y 1 B GLY 261 ? B GLY 261 
16 1 Y 1 B ALA 262 ? B ALA 262 
17 1 Y 1 B GLY 263 ? B GLY 263 
18 1 Y 1 B GLY 264 ? B GLY 264 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                          NAG 
3 'N,N,N-trimethyl-13-[(methylsulfonyl)sulfanyl]tridecan-1-aminium' X13 
4 'DI(HYDROXYETHYL)ETHER'                                           PEG 
5 'HEXAETHYLENE GLYCOL'                                             P6G 
6 water                                                             HOH 
#