data_2WND
# 
_entry.id   2WND 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WND         
PDBE  EBI-40360    
WWPDB D_1290040360 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1PSR unspecified 'HUMAN PSORIASIN (S100A7)'                                            
PDB 3PSR unspecified 'HUMAN PSORIASIN (S100A7) CA2+ BOUND FORM (CRYSTAL FORM I)'           
PDB 2PSR unspecified 'HUMAN PSORIASIN (S100A7) CA2+ AND ZN2+ BOUND FORM (CRYSTAL FORM II)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WND 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'West, N.R.'      1 
'Farnell, B.'     2 
'Watson, P.H.'    3 
'Boulanger, M.J.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structural and Functional Characterization of a Triple Mutant Form of S100A7 Defective for Jab1 Binding.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            18 
_citation.page_first                2615 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19844956 
_citation.pdbx_database_id_DOI      10.1002/PRO.274 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'West, N.R.'      1 
primary 'Farnell, B.'     2 
primary 'Murray, J.I.'    3 
primary 'Hof, F.'         4 
primary 'Watson, P.H.'    5 
primary 'Boulanger, M.J.' 6 
# 
_cell.entry_id           2WND 
_cell.length_a           68.930 
_cell.length_b           68.930 
_cell.length_c           92.520 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WND 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN S100-A7' 10975.527 1   ? YES 'RESIDUES 2-97' ? 
2 non-polymer syn 'CALCIUM ION'     40.078    1   ? ?   ?               ? 
3 non-polymer syn 'ZINC ION'        65.409    1   ? ?   ?               ? 
4 water       nat water             18.015    129 ? ?   ?               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100A7, S100 CALCIUM-BINDING PROTEIN A7, PSORIASIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLAGVFEKKDKNEDKKIDFSEFLSLMGD
IATDYHKKSHGAAPCS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLAGVFEKKDKNEDKKIDFSEFLSLMGD
IATDYHKKSHGAAPCS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  ASN n 
1 3  THR n 
1 4  GLN n 
1 5  ALA n 
1 6  GLU n 
1 7  ARG n 
1 8  SER n 
1 9  ILE n 
1 10 ILE n 
1 11 GLY n 
1 12 MET n 
1 13 ILE n 
1 14 ASP n 
1 15 MET n 
1 16 PHE n 
1 17 HIS n 
1 18 LYS n 
1 19 TYR n 
1 20 THR n 
1 21 ARG n 
1 22 ARG n 
1 23 ASP n 
1 24 ASP n 
1 25 LYS n 
1 26 ILE n 
1 27 ASP n 
1 28 LYS n 
1 29 PRO n 
1 30 SER n 
1 31 LEU n 
1 32 LEU n 
1 33 THR n 
1 34 MET n 
1 35 MET n 
1 36 LYS n 
1 37 GLU n 
1 38 ASN n 
1 39 PHE n 
1 40 PRO n 
1 41 ASN n 
1 42 PHE n 
1 43 LEU n 
1 44 SER n 
1 45 ALA n 
1 46 CYS n 
1 47 ASP n 
1 48 LYS n 
1 49 LYS n 
1 50 GLY n 
1 51 THR n 
1 52 ASN n 
1 53 TYR n 
1 54 LEU n 
1 55 ALA n 
1 56 GLY n 
1 57 VAL n 
1 58 PHE n 
1 59 GLU n 
1 60 LYS n 
1 61 LYS n 
1 62 ASP n 
1 63 LYS n 
1 64 ASN n 
1 65 GLU n 
1 66 ASP n 
1 67 LYS n 
1 68 LYS n 
1 69 ILE n 
1 70 ASP n 
1 71 PHE n 
1 72 SER n 
1 73 GLU n 
1 74 PHE n 
1 75 LEU n 
1 76 SER n 
1 77 LEU n 
1 78 MET n 
1 79 GLY n 
1 80 ASP n 
1 81 ILE n 
1 82 ALA n 
1 83 THR n 
1 84 ASP n 
1 85 TYR n 
1 86 HIS n 
1 87 LYS n 
1 88 LYS n 
1 89 SER n 
1 90 HIS n 
1 91 GLY n 
1 92 ALA n 
1 93 ALA n 
1 94 PRO n 
1 95 CYS n 
1 96 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10A7_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P31151 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2WND 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 96 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P31151 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  97 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       96 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2WND ASP A 27 ? UNP P31151 GLU 28 'SEE REMARK 999'      27 1 
1 2WND GLY A 56 ? UNP P31151 ASP 57 'engineered mutation' 56 2 
1 2WND MET A 78 ? UNP P31151 LEU 79 'engineered mutation' 78 3 
1 2WND LYS A 88 ? UNP P31151 GLN 89 'engineered mutation' 88 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          2WND 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.19 
_exptl_crystal.density_percent_sol   43.40 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2008-09-03 
_diffrn_detector.details                'OSMIC BLUE MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WND 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             24.37 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   18213 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.03 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.30 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              12.8 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.58 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.32 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.10 
_reflns_shell.pdbx_redundancy        10.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WND 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     14296 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.37 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_R_factor_obs                          0.21745 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21583 
_refine.ls_R_factor_R_free                       0.25003 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  754 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               24.528 
_refine.aniso_B[1][1]                            0.01 
_refine.aniso_B[2][2]                            0.01 
_refine.aniso_B[3][3]                            -0.02 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2PSR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.102 
_refine.pdbx_overall_ESU_R_Free                  0.102 
_refine.overall_SU_ML                            0.059 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.624 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        765 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             129 
_refine_hist.number_atoms_total               896 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        24.37 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.029  0.022  ? 780  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.378  1.964  ? 1041 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.881  5.000  ? 95   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.194 25.000 ? 36   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.614 15.000 ? 155  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       29.390 15.000 ? 3    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.160  0.200  ? 109  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.012  0.021  ? 575  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.559  1.500  ? 477  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.588  2.000  ? 765  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.817  3.000  ? 303  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.861  4.500  ? 276  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.600 
_refine_ls_shell.d_res_low                        1.642 
_refine_ls_shell.number_reflns_R_work             1028 
_refine_ls_shell.R_factor_R_work                  0.362 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.386 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             54 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2WND 
_struct.title                     'Structure of an S100A7 triple mutant' 
_struct.pdbx_descriptor           'PROTEIN S100-A7' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WND 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
;METAL BINDING PROTEIN, DISULFIDE BOND, ACETYLATION, POLYMORPHISM, METAL-BINDING, ZINC, S100A7, CALCIUM, EF HAND, SECRETED, CYTOPLASM
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 3  ? ILE A 10 ? THR A 3  ILE A 10 1 ? 8  
HELX_P HELX_P2 2 MET A 12 ? TYR A 19 ? MET A 12 TYR A 19 1 ? 8  
HELX_P HELX_P3 3 ASP A 27 ? PHE A 39 ? ASP A 27 PHE A 39 1 ? 13 
HELX_P HELX_P4 4 PHE A 39 ? LYS A 49 ? PHE A 39 LYS A 49 1 ? 11 
HELX_P HELX_P5 5 VAL A 57 ? ASP A 62 ? VAL A 57 ASP A 62 1 ? 6  
HELX_P HELX_P6 6 ASP A 70 ? MET A 78 ? ASP A 70 MET A 78 1 ? 9  
HELX_P HELX_P7 7 ASP A 80 ? HIS A 90 ? ASP A 80 HIS A 90 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 95 SG  ? ? A CYS 46  A CYS 95   1_555  ? ? ? ? ? ? ? 2.026 ? 
metalc1  metalc ? ? B CA  .  CA ? ? ? 1_555 A ASP 66 OD1 ? ? A CA  102 A ASP 66   1_555  ? ? ? ? ? ? ? 2.406 ? 
metalc2  metalc ? ? B CA  .  CA ? ? ? 1_555 A LYS 68 O   ? ? A CA  102 A LYS 68   1_555  ? ? ? ? ? ? ? 2.347 ? 
metalc3  metalc ? ? B CA  .  CA ? ? ? 1_555 A ASP 62 OD1 ? ? A CA  102 A ASP 62   1_555  ? ? ? ? ? ? ? 2.284 ? 
metalc4  metalc ? ? B CA  .  CA ? ? ? 1_555 A ASN 64 OD1 ? ? A CA  102 A ASN 64   1_555  ? ? ? ? ? ? ? 2.393 ? 
metalc5  metalc ? ? B CA  .  CA ? ? ? 1_555 D HOH .  O   ? ? A CA  102 A HOH 2102 1_555  ? ? ? ? ? ? ? 2.411 ? 
metalc6  metalc ? ? B CA  .  CA ? ? ? 1_555 A GLU 73 OE1 ? ? A CA  102 A GLU 73   1_555  ? ? ? ? ? ? ? 2.424 ? 
metalc7  metalc ? ? B CA  .  CA ? ? ? 1_555 A GLU 73 OE2 ? ? A CA  102 A GLU 73   1_555  ? ? ? ? ? ? ? 2.557 ? 
metalc8  metalc ? ? C ZN  .  ZN ? ? ? 1_555 A HIS 90 NE2 ? ? A ZN  103 A HIS 90   1_555  ? ? ? ? ? ? ? 2.076 ? 
metalc9  metalc ? ? C ZN  .  ZN ? ? ? 1_555 A ASP 24 OD1 ? ? A ZN  103 A ASP 24   10_555 ? ? ? ? ? ? ? 2.098 ? 
metalc10 metalc ? ? C ZN  .  ZN ? ? ? 1_555 A HIS 86 NE2 ? ? A ZN  103 A HIS 86   1_555  ? ? ? ? ? ? ? 2.451 ? 
metalc11 metalc ? ? C ZN  .  ZN ? ? ? 1_555 A HIS 17 NE2 ? ? A ZN  103 A HIS 17   10_555 ? ? ? ? ? ? ? 1.815 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 102' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 103' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 62 ? ASP A 62   . ? 1_555  ? 
2  AC1 6 ASN A 64 ? ASN A 64   . ? 1_555  ? 
3  AC1 6 ASP A 66 ? ASP A 66   . ? 1_555  ? 
4  AC1 6 LYS A 68 ? LYS A 68   . ? 1_555  ? 
5  AC1 6 GLU A 73 ? GLU A 73   . ? 1_555  ? 
6  AC1 6 HOH D .  ? HOH A 2102 . ? 1_555  ? 
7  AC2 4 HIS A 17 ? HIS A 17   . ? 10_555 ? 
8  AC2 4 ASP A 24 ? ASP A 24   . ? 10_555 ? 
9  AC2 4 HIS A 86 ? HIS A 86   . ? 1_555  ? 
10 AC2 4 HIS A 90 ? HIS A 90   . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          2WND 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WND 
_atom_sites.fract_transf_matrix[1][1]   0.014507 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014507 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010808 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . SER A 1 1  ? -11.684 -2.987  6.464  1.00 39.12 ? 1    SER A N   1 
ATOM   2   C  CA  . SER A 1 1  ? -12.936 -2.879  7.299  1.00 37.85 ? 1    SER A CA  1 
ATOM   3   C  C   . SER A 1 1  ? -12.720 -2.343  8.754  1.00 37.32 ? 1    SER A C   1 
ATOM   4   O  O   . SER A 1 1  ? -13.547 -1.580  9.294  1.00 39.14 ? 1    SER A O   1 
ATOM   5   C  CB  . SER A 1 1  ? -13.634 -4.222  7.372  1.00 38.59 ? 1    SER A CB  1 
ATOM   6   O  OG  . SER A 1 1  ? -14.669 -4.171  8.335  1.00 39.03 ? 1    SER A OG  1 
ATOM   7   N  N   . ASN A 1 2  ? -11.647 -2.776  9.383  1.00 33.98 ? 2    ASN A N   1 
ATOM   8   C  CA  . ASN A 1 2  ? -11.227 -2.217  10.681 1.00 30.45 ? 2    ASN A CA  1 
ATOM   9   C  C   . ASN A 1 2  ? -10.554 -0.885  10.380 1.00 27.58 ? 2    ASN A C   1 
ATOM   10  O  O   . ASN A 1 2  ? -10.078 -0.657  9.276  1.00 30.30 ? 2    ASN A O   1 
ATOM   11  C  CB  . ASN A 1 2  ? -10.235 -3.220  11.352 1.00 28.68 ? 2    ASN A CB  1 
ATOM   12  C  CG  . ASN A 1 2  ? -10.910 -4.249  12.168 1.00 27.23 ? 2    ASN A CG  1 
ATOM   13  O  OD1 . ASN A 1 2  ? -11.867 -4.014  12.878 1.00 35.68 ? 2    ASN A OD1 1 
ATOM   14  N  ND2 . ASN A 1 2  ? -10.458 -5.470  12.018 1.00 31.62 ? 2    ASN A ND2 1 
ATOM   15  N  N   . THR A 1 3  ? -10.511 0.070   11.339 1.00 23.26 ? 3    THR A N   1 
ATOM   16  C  CA  . THR A 1 3  ? -9.770  1.310   11.100 1.00 19.84 ? 3    THR A CA  1 
ATOM   17  C  C   . THR A 1 3  ? -8.274  1.132   11.249 1.00 20.04 ? 3    THR A C   1 
ATOM   18  O  O   . THR A 1 3  ? -7.872  0.005   11.732 1.00 18.84 ? 3    THR A O   1 
ATOM   19  C  CB  . THR A 1 3  ? -10.176 2.408   12.209 1.00 17.77 ? 3    THR A CB  1 
ATOM   20  O  OG1 . THR A 1 3  ? -9.814  1.841   13.477 1.00 18.66 ? 3    THR A OG1 1 
ATOM   21  C  CG2 . THR A 1 3  ? -11.705 2.679   12.240 1.00 18.92 ? 3    THR A CG2 1 
ATOM   22  N  N   . GLN A 1 4  ? -7.476  2.169   10.966 1.00 20.14 ? 4    GLN A N   1 
ATOM   23  C  CA  . GLN A 1 4  ? -6.012  2.051   11.137 1.00 22.23 ? 4    GLN A CA  1 
ATOM   24  C  C   . GLN A 1 4  ? -5.657  1.790   12.602 1.00 21.55 ? 4    GLN A C   1 
ATOM   25  O  O   . GLN A 1 4  ? -4.764  0.994   12.920 1.00 21.92 ? 4    GLN A O   1 
ATOM   26  C  CB  . GLN A 1 4  ? -5.284  3.267   10.716 1.00 23.50 ? 4    GLN A CB  1 
ATOM   27  C  CG  . GLN A 1 4  ? -3.767  3.174   10.910 1.00 34.17 ? 4    GLN A CG  1 
ATOM   28  C  CD  . GLN A 1 4  ? -3.173  1.878   10.240 1.00 42.74 ? 4    GLN A CD  1 
ATOM   29  O  OE1 . GLN A 1 4  ? -3.174  1.764   8.988  1.00 47.66 ? 4    GLN A OE1 1 
ATOM   30  N  NE2 . GLN A 1 4  ? -2.689  0.893   11.080 1.00 44.33 ? 4    GLN A NE2 1 
ATOM   31  N  N   . ALA A 1 5  ? -6.325  2.485   13.515 1.00 18.76 ? 5    ALA A N   1 
ATOM   32  C  CA  . ALA A 1 5  ? -6.032  2.246   14.939 1.00 17.80 ? 5    ALA A CA  1 
ATOM   33  C  C   . ALA A 1 5  ? -6.339  0.786   15.332 1.00 17.33 ? 5    ALA A C   1 
ATOM   34  O  O   . ALA A 1 5  ? -5.619  0.183   16.136 1.00 17.86 ? 5    ALA A O   1 
ATOM   35  C  CB  . ALA A 1 5  ? -6.869  3.284   15.932 1.00 16.84 ? 5    ALA A CB  1 
ATOM   36  N  N   . GLU A 1 6  ? -7.464  0.225   14.911 1.00 15.97 ? 6    GLU A N   1 
ATOM   37  C  CA  . GLU A 1 6  ? -7.894  -1.158  15.280 1.00 17.77 ? 6    GLU A CA  1 
ATOM   38  C  C   . GLU A 1 6  ? -6.871  -2.115  14.658 1.00 19.33 ? 6    GLU A C   1 
ATOM   39  O  O   . GLU A 1 6  ? -6.441  -3.063  15.316 1.00 18.68 ? 6    GLU A O   1 
ATOM   40  C  CB  . GLU A 1 6  ? -9.331  -1.484  14.770 1.00 20.01 ? 6    GLU A CB  1 
ATOM   41  C  CG  . GLU A 1 6  ? -10.392 -0.757  15.614 1.00 16.41 ? 6    GLU A CG  1 
ATOM   42  C  CD  . GLU A 1 6  ? -11.793 -0.698  14.917 1.00 14.56 ? 6    GLU A CD  1 
ATOM   43  O  OE1 . GLU A 1 6  ? -11.803 -0.862  13.708 1.00 21.29 ? 6    GLU A OE1 1 
ATOM   44  O  OE2 . GLU A 1 6  ? -12.710 -0.528  15.627 1.00 17.80 ? 6    GLU A OE2 1 
ATOM   45  N  N   . ARG A 1 7  ? -6.497  -1.780  13.444 1.00 18.40 ? 7    ARG A N   1 
ATOM   46  C  CA  . ARG A 1 7  ? -5.452  -2.605  12.731 1.00 21.67 ? 7    ARG A CA  1 
ATOM   47  C  C   . ARG A 1 7  ? -4.145  -2.623  13.496 1.00 22.19 ? 7    ARG A C   1 
ATOM   48  O  O   . ARG A 1 7  ? -3.476  -3.722  13.565 1.00 21.19 ? 7    ARG A O   1 
ATOM   49  C  CB  . ARG A 1 7  ? -5.267  -2.125  11.325 1.00 25.18 ? 7    ARG A CB  1 
ATOM   50  C  CG  . ARG A 1 7  ? -6.405  -2.642  10.443 1.00 27.85 ? 7    ARG A CG  1 
ATOM   51  C  CD  . ARG A 1 7  ? -5.975  -2.540  8.909  1.00 32.05 ? 7    ARG A CD  1 
ATOM   52  N  NE  . ARG A 1 7  ? -5.436  -1.219  8.518  1.00 36.73 ? 7    ARG A NE  1 
ATOM   53  C  CZ  . ARG A 1 7  ? -6.225  -0.187  8.182  1.00 40.06 ? 7    ARG A CZ  1 
ATOM   54  N  NH1 . ARG A 1 7  ? -7.554  -0.346  8.193  1.00 43.67 ? 7    ARG A NH1 1 
ATOM   55  N  NH2 . ARG A 1 7  ? -5.704  0.998   7.858  1.00 38.34 ? 7    ARG A NH2 1 
ATOM   56  N  N   . SER A 1 8  ? -3.728  -1.453  13.992 1.00 20.51 ? 8    SER A N   1 
ATOM   57  C  CA  . SER A 1 8  ? -2.543  -1.363  14.829 1.00 20.78 ? 8    SER A CA  1 
ATOM   58  C  C   . SER A 1 8  ? -2.592  -2.237  16.061 1.00 20.34 ? 8    SER A C   1 
ATOM   59  O  O   . SER A 1 8  ? -1.607  -2.953  16.343 1.00 20.34 ? 8    SER A O   1 
ATOM   60  C  CB  . SER A 1 8  ? -2.248  0.076   15.261 1.00 21.85 ? 8    SER A CB  1 
ATOM   61  O  OG  . SER A 1 8  ? -1.554  0.724   14.191 1.00 27.88 ? 8    SER A OG  1 
ATOM   62  N  N   . ILE A 1 9  ? -3.696  -2.165  16.804 1.00 18.53 ? 9    ILE A N   1 
ATOM   63  C  CA  . ILE A 1 9  ? -3.895  -3.006  17.973 1.00 18.14 ? 9    ILE A CA  1 
ATOM   64  C  C   . ILE A 1 9  ? -3.798  -4.512  17.566 1.00 21.08 ? 9    ILE A C   1 
ATOM   65  O  O   . ILE A 1 9  ? -3.147  -5.329  18.248 1.00 20.16 ? 9    ILE A O   1 
ATOM   66  C  CB  . ILE A 1 9  ? -5.250  -2.691  18.666 1.00 19.87 ? 9    ILE A CB  1 
ATOM   67  C  CG1 . ILE A 1 9  ? -5.330  -1.260  19.297 1.00 21.73 ? 9    ILE A CG1 1 
ATOM   68  C  CG2 . ILE A 1 9  ? -5.586  -3.809  19.641 1.00 20.17 ? 9    ILE A CG2 1 
ATOM   69  C  CD1 . ILE A 1 9  ? -4.274  -0.830  20.341 1.00 27.31 ? 9    ILE A CD1 1 
ATOM   70  N  N   . ILE A 1 10 ? -4.461  -4.855  16.451 1.00 20.63 ? 10   ILE A N   1 
ATOM   71  C  CA  . ILE A 1 10 ? -4.472  -6.232  15.985 1.00 20.46 ? 10   ILE A CA  1 
ATOM   72  C  C   . ILE A 1 10 ? -3.080  -6.686  15.620 1.00 19.52 ? 10   ILE A C   1 
ATOM   73  O  O   . ILE A 1 10 ? -2.712  -7.853  15.962 1.00 20.96 ? 10   ILE A O   1 
ATOM   74  C  CB  . ILE A 1 10 ? -5.455  -6.441  14.832 1.00 21.25 ? 10   ILE A CB  1 
ATOM   75  C  CG1 . ILE A 1 10 ? -6.882  -6.453  15.350 1.00 21.69 ? 10   ILE A CG1 1 
ATOM   76  C  CG2 . ILE A 1 10 ? -5.182  -7.871  14.258 1.00 22.87 ? 10   ILE A CG2 1 
ATOM   77  C  CD1 . ILE A 1 10 ? -7.873  -5.972  14.217 1.00 25.98 ? 10   ILE A CD1 1 
ATOM   78  N  N   . GLY A 1 11 ? -2.288  -5.820  15.008 1.00 17.90 ? 11   GLY A N   1 
ATOM   79  C  CA  . GLY A 1 11 ? -0.880  -6.185  14.605 1.00 19.09 ? 11   GLY A CA  1 
ATOM   80  C  C   . GLY A 1 11 ? -0.020  -6.378  15.839 1.00 20.35 ? 11   GLY A C   1 
ATOM   81  O  O   . GLY A 1 11 ? 0.918   -7.226  15.802 1.00 21.89 ? 11   GLY A O   1 
ATOM   82  N  N   . MET A 1 12 ? -0.347  -5.652  16.911 1.00 20.12 ? 12   MET A N   1 
ATOM   83  C  CA  . MET A 1 12 ? 0.457   -5.776  18.155 1.00 19.92 ? 12   MET A CA  1 
ATOM   84  C  C   . MET A 1 12 ? 0.173   -7.137  18.777 1.00 19.89 ? 12   MET A C   1 
ATOM   85  O  O   . MET A 1 12 ? 1.070   -7.793  19.312 1.00 19.71 ? 12   MET A O   1 
ATOM   86  C  CB  . MET A 1 12 ? 0.172   -4.664  19.157 1.00 21.09 ? 12   MET A CB  1 
ATOM   87  C  CG  . MET A 1 12 ? 0.891   -3.418  18.773 1.00 28.82 ? 12   MET A CG  1 
ATOM   88  S  SD  . MET A 1 12 ? 2.698   -3.505  19.249 1.00 36.41 ? 12   MET A SD  1 
ATOM   89  C  CE  . MET A 1 12 ? 3.484   -2.398  17.975 1.00 34.69 ? 12   MET A CE  1 
ATOM   90  N  N   . ILE A 1 13 ? -1.070  -7.559  18.768 1.00 18.98 ? 13   ILE A N   1 
ATOM   91  C  CA  . ILE A 1 13 ? -1.517  -8.854  19.277 1.00 18.59 ? 13   ILE A CA  1 
ATOM   92  C  C   . ILE A 1 13 ? -0.875  -9.957  18.425 1.00 17.88 ? 13   ILE A C   1 
ATOM   93  O  O   . ILE A 1 13 ? -0.379  -10.974 18.977 1.00 18.18 ? 13   ILE A O   1 
ATOM   94  C  CB  . ILE A 1 13 ? -3.051  -9.024  19.272 1.00 21.10 ? 13   ILE A CB  1 
ATOM   95  C  CG1 . ILE A 1 13 ? -3.543  -8.216  20.452 1.00 24.62 ? 13   ILE A CG1 1 
ATOM   96  C  CG2 . ILE A 1 13 ? -3.444  -10.531 19.474 1.00 21.06 ? 13   ILE A CG2 1 
ATOM   97  C  CD1 . ILE A 1 13 ? -4.907  -7.780  20.366 1.00 27.01 ? 13   ILE A CD1 1 
ATOM   98  N  N   . ASP A 1 14 ? -0.858  -9.771  17.136 1.00 17.30 ? 14   ASP A N   1 
ATOM   99  C  CA  . ASP A 1 14 ? -0.189  -10.757 16.238 1.00 18.45 ? 14   ASP A CA  1 
ATOM   100 C  C   . ASP A 1 14 ? 1.291   -10.830 16.548 1.00 18.86 ? 14   ASP A C   1 
ATOM   101 O  O   . ASP A 1 14 ? 1.840   -11.945 16.540 1.00 17.36 ? 14   ASP A O   1 
ATOM   102 C  CB  . ASP A 1 14 ? -0.450  -10.356 14.792 1.00 20.60 ? 14   ASP A CB  1 
ATOM   103 C  CG  . ASP A 1 14 ? -1.909  -10.633 14.352 1.00 22.36 ? 14   ASP A CG  1 
ATOM   104 O  OD1 . ASP A 1 14 ? -2.693  -11.306 15.020 1.00 27.35 ? 14   ASP A OD1 1 
ATOM   105 O  OD2 . ASP A 1 14 ? -2.267  -10.134 13.270 1.00 30.76 ? 14   ASP A OD2 1 
ATOM   106 N  N   . MET A 1 15 ? 1.960   -9.701  16.788 1.00 16.90 ? 15   MET A N   1 
ATOM   107 C  CA  . MET A 1 15 ? 3.426   -9.706  17.139 1.00 15.83 ? 15   MET A CA  1 
ATOM   108 C  C   . MET A 1 15 ? 3.620   -10.434 18.466 1.00 16.40 ? 15   MET A C   1 
ATOM   109 O  O   . MET A 1 15 ? 4.502   -11.281 18.587 1.00 16.39 ? 15   MET A O   1 
ATOM   110 C  CB  . MET A 1 15 ? 3.918   -8.276  17.321 1.00 15.98 ? 15   MET A CB  1 
ATOM   111 C  CG  . MET A 1 15 ? 5.421   -8.250  17.494 1.00 19.03 ? 15   MET A CG  1 
ATOM   112 S  SD  . MET A 1 15 ? 6.188   -6.664  17.483 1.00 18.06 ? 15   MET A SD  1 
ATOM   113 C  CE  . MET A 1 15 ? 5.594   -5.939  19.010 1.00 17.18 ? 15   MET A CE  1 
ATOM   114 N  N   . PHE A 1 16 ? 2.835   -10.158 19.473 1.00 14.65 ? 16   PHE A N   1 
ATOM   115 C  CA  . PHE A 1 16 ? 2.896   -10.962 20.721 1.00 13.22 ? 16   PHE A CA  1 
ATOM   116 C  C   . PHE A 1 16 ? 2.820   -12.450 20.439 1.00 16.37 ? 16   PHE A C   1 
ATOM   117 O  O   . PHE A 1 16 ? 3.752   -13.198 20.900 1.00 14.31 ? 16   PHE A O   1 
ATOM   118 C  CB  . PHE A 1 16 ? 1.795   -10.501 21.695 1.00 15.50 ? 16   PHE A CB  1 
ATOM   119 C  CG  . PHE A 1 16 ? 1.684   -11.334 22.906 1.00 12.87 ? 16   PHE A CG  1 
ATOM   120 C  CD1 . PHE A 1 16 ? 2.616   -11.078 23.999 1.00 13.92 ? 16   PHE A CD1 1 
ATOM   121 C  CD2 . PHE A 1 16 ? 0.721   -12.326 23.050 1.00 13.05 ? 16   PHE A CD2 1 
ATOM   122 C  CE1 . PHE A 1 16 ? 2.521   -11.823 25.235 1.00 17.00 ? 16   PHE A CE1 1 
ATOM   123 C  CE2 . PHE A 1 16 ? 0.675   -13.109 24.194 1.00 14.55 ? 16   PHE A CE2 1 
ATOM   124 C  CZ  . PHE A 1 16 ? 1.563   -12.870 25.304 1.00 14.70 ? 16   PHE A CZ  1 
ATOM   125 N  N   . HIS A 1 17 ? 1.786   -12.849 19.656 1.00 14.93 ? 17   HIS A N   1 
ATOM   126 C  CA  . HIS A 1 17 ? 1.608   -14.276 19.420 1.00 19.23 ? 17   HIS A CA  1 
ATOM   127 C  C   . HIS A 1 17 ? 2.753   -14.912 18.694 1.00 19.37 ? 17   HIS A C   1 
ATOM   128 O  O   . HIS A 1 17 ? 3.060   -16.108 18.995 1.00 22.37 ? 17   HIS A O   1 
ATOM   129 C  CB  . HIS A 1 17 ? 0.357   -14.492 18.663 1.00 19.64 ? 17   HIS A CB  1 
ATOM   130 C  CG  . HIS A 1 17 ? -0.802  -14.484 19.563 1.00 25.75 ? 17   HIS A CG  1 
ATOM   131 N  ND1 . HIS A 1 17 ? -2.047  -14.019 19.191 1.00 32.22 ? 17   HIS A ND1 1 
ATOM   132 C  CD2 . HIS A 1 17 ? -0.902  -14.875 20.857 1.00 26.56 ? 17   HIS A CD2 1 
ATOM   133 C  CE1 . HIS A 1 17 ? -2.869  -14.131 20.225 1.00 35.29 ? 17   HIS A CE1 1 
ATOM   134 N  NE2 . HIS A 1 17 ? -2.186  -14.618 21.259 1.00 31.37 ? 17   HIS A NE2 1 
ATOM   135 N  N   . LYS A 1 18 ? 3.422   -14.138 17.849 1.00 17.72 ? 18   LYS A N   1 
ATOM   136 C  CA  . LYS A 1 18 ? 4.558   -14.628 17.056 1.00 17.88 ? 18   LYS A CA  1 
ATOM   137 C  C   . LYS A 1 18 ? 5.710   -15.164 17.944 1.00 17.75 ? 18   LYS A C   1 
ATOM   138 O  O   . LYS A 1 18 ? 6.399   -16.110 17.563 1.00 19.96 ? 18   LYS A O   1 
ATOM   139 C  CB  . LYS A 1 18 ? 5.071   -13.574 16.152 1.00 18.27 ? 18   LYS A CB  1 
ATOM   140 C  CG  . LYS A 1 18 ? 6.338   -13.884 15.433 1.00 17.54 ? 18   LYS A CG  1 
ATOM   141 C  CD  . LYS A 1 18 ? 6.564   -12.826 14.358 1.00 23.53 ? 18   LYS A CD  1 
ATOM   142 C  CE  . LYS A 1 18 ? 8.033   -12.771 13.903 1.00 22.91 ? 18   LYS A CE  1 
ATOM   143 N  NZ  . LYS A 1 18 ? 8.476   -11.652 12.977 1.00 26.42 ? 18   LYS A NZ  1 
ATOM   144 N  N   . TYR A 1 19 ? 5.851   -14.603 19.133 1.00 14.90 ? 19   TYR A N   1 
ATOM   145 C  CA  . TYR A 1 19 ? 6.970   -14.900 20.036 1.00 15.12 ? 19   TYR A CA  1 
ATOM   146 C  C   . TYR A 1 19 ? 6.605   -15.781 21.199 1.00 13.24 ? 19   TYR A C   1 
ATOM   147 O  O   . TYR A 1 19 ? 7.481   -16.006 22.025 1.00 16.47 ? 19   TYR A O   1 
ATOM   148 C  CB  . TYR A 1 19 ? 7.582   -13.553 20.486 1.00 15.33 ? 19   TYR A CB  1 
ATOM   149 C  CG  . TYR A 1 19 ? 8.247   -12.849 19.332 1.00 16.13 ? 19   TYR A CG  1 
ATOM   150 C  CD1 . TYR A 1 19 ? 9.511   -13.265 18.839 1.00 13.80 ? 19   TYR A CD1 1 
ATOM   151 C  CD2 . TYR A 1 19 ? 7.591   -11.875 18.615 1.00 15.72 ? 19   TYR A CD2 1 
ATOM   152 C  CE1 . TYR A 1 19 ? 10.126  -12.657 17.735 1.00 15.65 ? 19   TYR A CE1 1 
ATOM   153 C  CE2 . TYR A 1 19 ? 8.175   -11.258 17.538 1.00 17.54 ? 19   TYR A CE2 1 
ATOM   154 C  CZ  . TYR A 1 19 ? 9.421   -11.659 17.031 1.00 16.36 ? 19   TYR A CZ  1 
ATOM   155 O  OH  . TYR A 1 19 ? 10.011  -11.075 15.946 1.00 18.82 ? 19   TYR A OH  1 
ATOM   156 N  N   . THR A 1 20 ? 5.374   -16.270 21.279 1.00 15.78 ? 20   THR A N   1 
ATOM   157 C  CA  . THR A 1 20 ? 4.902   -17.087 22.372 1.00 18.06 ? 20   THR A CA  1 
ATOM   158 C  C   . THR A 1 20 ? 5.239   -18.561 22.085 1.00 18.65 ? 20   THR A C   1 
ATOM   159 O  O   . THR A 1 20 ? 5.461   -18.911 20.945 1.00 21.04 ? 20   THR A O   1 
ATOM   160 C  CB  . THR A 1 20 ? 3.419   -16.991 22.590 1.00 18.43 ? 20   THR A CB  1 
ATOM   161 O  OG1 . THR A 1 20 ? 2.693   -17.384 21.377 1.00 19.53 ? 20   THR A OG1 1 
ATOM   162 C  CG2 . THR A 1 20 ? 3.006   -15.542 23.055 1.00 17.21 ? 20   THR A CG2 1 
ATOM   163 N  N   . ARG A 1 21 ? 5.173   -19.357 23.125 1.00 19.84 ? 21   ARG A N   1 
ATOM   164 C  CA  . ARG A 1 21 ? 5.067   -20.814 22.974 1.00 24.58 ? 21   ARG A CA  1 
ATOM   165 C  C   . ARG A 1 21 ? 3.639   -21.285 23.178 1.00 26.47 ? 21   ARG A C   1 
ATOM   166 O  O   . ARG A 1 21 ? 2.671   -20.498 23.204 1.00 25.96 ? 21   ARG A O   1 
ATOM   167 C  CB  . ARG A 1 21 ? 5.907   -21.473 24.057 1.00 25.10 ? 21   ARG A CB  1 
ATOM   168 C  CG  . ARG A 1 21 ? 7.302   -20.953 24.153 1.00 27.94 ? 21   ARG A CG  1 
ATOM   169 C  CD  . ARG A 1 21 ? 8.110   -21.092 22.923 1.00 33.44 ? 21   ARG A CD  1 
ATOM   170 N  NE  . ARG A 1 21 ? 9.512   -20.670 23.217 1.00 38.65 ? 21   ARG A NE  1 
ATOM   171 C  CZ  . ARG A 1 21 ? 10.649  -21.122 22.665 1.00 42.22 ? 21   ARG A CZ  1 
ATOM   172 N  NH1 . ARG A 1 21 ? 10.671  -22.086 21.738 1.00 42.77 ? 21   ARG A NH1 1 
ATOM   173 N  NH2 . ARG A 1 21 ? 11.816  -20.593 23.066 1.00 35.16 ? 21   ARG A NH2 1 
ATOM   174 N  N   . ARG A 1 22 ? 3.514   -22.596 23.405 1.00 29.84 ? 22   ARG A N   1 
ATOM   175 C  CA  . ARG A 1 22 ? 2.206   -23.219 23.638 1.00 31.41 ? 22   ARG A CA  1 
ATOM   176 C  C   . ARG A 1 22 ? 1.368   -22.593 24.732 1.00 31.85 ? 22   ARG A C   1 
ATOM   177 O  O   . ARG A 1 22 ? 0.102   -22.728 24.676 1.00 32.11 ? 22   ARG A O   1 
ATOM   178 C  CB  . ARG A 1 22 ? 2.375   -24.709 24.022 1.00 33.50 ? 22   ARG A CB  1 
ATOM   179 C  CG  . ARG A 1 22 ? 3.101   -25.497 23.013 1.00 38.83 ? 22   ARG A CG  1 
ATOM   180 C  CD  . ARG A 1 22 ? 3.557   -26.855 23.554 1.00 46.61 ? 22   ARG A CD  1 
ATOM   181 N  NE  . ARG A 1 22 ? 3.432   -27.833 22.478 1.00 51.43 ? 22   ARG A NE  1 
ATOM   182 C  CZ  . ARG A 1 22 ? 2.817   -29.017 22.587 1.00 54.92 ? 22   ARG A CZ  1 
ATOM   183 N  NH1 . ARG A 1 22 ? 2.295   -29.408 23.753 1.00 53.64 ? 22   ARG A NH1 1 
ATOM   184 N  NH2 . ARG A 1 22 ? 2.746   -29.828 21.528 1.00 56.42 ? 22   ARG A NH2 1 
ATOM   185 N  N   . ASP A 1 23 ? 2.031   -21.995 25.759 1.00 28.08 ? 23   ASP A N   1 
ATOM   186 C  CA  . ASP A 1 23 ? 1.320   -21.420 26.895 1.00 27.99 ? 23   ASP A CA  1 
ATOM   187 C  C   . ASP A 1 23 ? 0.881   -19.951 26.713 1.00 25.78 ? 23   ASP A C   1 
ATOM   188 O  O   . ASP A 1 23 ? 0.374   -19.349 27.675 1.00 26.37 ? 23   ASP A O   1 
ATOM   189 C  CB  . ASP A 1 23 ? 2.175   -21.528 28.154 1.00 26.34 ? 23   ASP A CB  1 
ATOM   190 C  CG  . ASP A 1 23 ? 3.463   -20.710 28.077 1.00 30.27 ? 23   ASP A CG  1 
ATOM   191 O  OD1 . ASP A 1 23 ? 3.771   -20.206 27.004 1.00 26.23 ? 23   ASP A OD1 1 
ATOM   192 O  OD2 . ASP A 1 23 ? 4.164   -20.592 29.103 1.00 33.53 ? 23   ASP A OD2 1 
ATOM   193 N  N   . ASP A 1 24 ? 1.074   -19.432 25.485 1.00 24.45 ? 24   ASP A N   1 
ATOM   194 C  CA  . ASP A 1 24 ? 0.617   -18.101 25.117 1.00 22.83 ? 24   ASP A CA  1 
ATOM   195 C  C   . ASP A 1 24 ? 1.378   -17.067 25.895 1.00 20.18 ? 24   ASP A C   1 
ATOM   196 O  O   . ASP A 1 24 ? 0.822   -16.016 26.249 1.00 20.10 ? 24   ASP A O   1 
ATOM   197 C  CB  . ASP A 1 24 ? -0.888  -17.902 25.424 1.00 24.46 ? 24   ASP A CB  1 
ATOM   198 C  CG  . ASP A 1 24 ? -1.463  -16.596 24.793 1.00 29.77 ? 24   ASP A CG  1 
ATOM   199 O  OD1 . ASP A 1 24 ? -0.984  -16.186 23.716 1.00 32.64 ? 24   ASP A OD1 1 
ATOM   200 O  OD2 . ASP A 1 24 ? -2.343  -15.941 25.398 1.00 38.93 ? 24   ASP A OD2 1 
ATOM   201 N  N   . LYS A 1 25 ? 2.601   -17.376 26.298 1.00 17.59 ? 25   LYS A N   1 
ATOM   202 C  CA  . LYS A 1 25 ? 3.465   -16.399 27.004 1.00 14.60 ? 25   LYS A CA  1 
ATOM   203 C  C   . LYS A 1 25 ? 4.850   -16.417 26.318 1.00 13.97 ? 25   LYS A C   1 
ATOM   204 O  O   . LYS A 1 25 ? 5.209   -17.352 25.611 1.00 16.30 ? 25   LYS A O   1 
ATOM   205 C  CB  . LYS A 1 25 ? 3.639   -16.818 28.481 1.00 16.99 ? 25   LYS A CB  1 
ATOM   206 C  CG  . LYS A 1 25 ? 2.356   -16.667 29.376 1.00 19.80 ? 25   LYS A CG  1 
ATOM   207 C  CD  . LYS A 1 25 ? 2.720   -17.025 30.773 1.00 24.41 ? 25   LYS A CD  1 
ATOM   208 C  CE  . LYS A 1 25 ? 1.511   -17.378 31.732 1.00 29.50 ? 25   LYS A CE  1 
ATOM   209 N  NZ  . LYS A 1 25 ? 1.946   -17.759 33.233 1.00 28.12 ? 25   LYS A NZ  1 
ATOM   210 N  N   . ILE A 1 26 ? 5.572   -15.333 26.454 1.00 11.69 ? 26   ILE A N   1 
ATOM   211 C  CA  . ILE A 1 26 ? 6.868   -15.124 25.829 1.00 12.34 ? 26   ILE A CA  1 
ATOM   212 C  C   . ILE A 1 26 ? 7.991   -15.439 26.823 1.00 11.58 ? 26   ILE A C   1 
ATOM   213 O  O   . ILE A 1 26 ? 8.104   -14.836 27.916 1.00 12.62 ? 26   ILE A O   1 
ATOM   214 C  CB  . ILE A 1 26 ? 6.995   -13.714 25.275 1.00 11.52 ? 26   ILE A CB  1 
ATOM   215 C  CG1 . ILE A 1 26 ? 5.835   -13.412 24.306 1.00 12.26 ? 26   ILE A CG1 1 
ATOM   216 C  CG2 . ILE A 1 26 ? 8.401   -13.452 24.594 1.00 13.31 ? 26   ILE A CG2 1 
ATOM   217 C  CD1 . ILE A 1 26 ? 5.946   -11.947 23.748 1.00 12.20 ? 26   ILE A CD1 1 
ATOM   218 N  N   . ASP A 1 27 ? 8.916   -16.352 26.485 1.00 11.63 ? 27   ASP A N   1 
ATOM   219 C  CA  . ASP A 1 27 ? 10.089  -16.542 27.364 1.00 13.15 ? 27   ASP A CA  1 
ATOM   220 C  C   . ASP A 1 27 ? 11.225  -15.535 27.125 1.00 11.95 ? 27   ASP A C   1 
ATOM   221 O  O   . ASP A 1 27 ? 11.140  -14.658 26.198 1.00 11.70 ? 27   ASP A O   1 
ATOM   222 C  CB  . ASP A 1 27 ? 10.640  -17.961 27.223 1.00 12.93 ? 27   ASP A CB  1 
ATOM   223 C  CG  . ASP A 1 27 ? 11.261  -18.217 25.888 1.00 18.82 ? 27   ASP A CG  1 
ATOM   224 O  OD1 . ASP A 1 27 ? 11.719  -17.338 25.117 1.00 14.10 ? 27   ASP A OD1 1 
ATOM   225 O  OD2 . ASP A 1 27 ? 11.386  -19.505 25.697 1.00 28.73 ? 27   ASP A OD2 1 
ATOM   226 N  N   . LYS A 1 28 ? 12.273  -15.524 27.919 1.00 12.15 ? 28   LYS A N   1 
ATOM   227 C  CA  . LYS A 1 28 ? 13.286  -14.526 27.825 1.00 12.46 ? 28   LYS A CA  1 
ATOM   228 C  C   . LYS A 1 28 ? 14.021  -14.416 26.483 1.00 12.44 ? 28   LYS A C   1 
ATOM   229 O  O   . LYS A 1 28 ? 14.083  -13.346 25.879 1.00 11.55 ? 28   LYS A O   1 
ATOM   230 C  CB  . LYS A 1 28 ? 14.280  -14.498 29.021 1.00 12.65 ? 28   LYS A CB  1 
ATOM   231 C  CG  . LYS A 1 28 ? 15.319  -13.493 28.913 1.00 13.06 ? 28   LYS A CG  1 
ATOM   232 C  CD  . LYS A 1 28 ? 16.091  -13.463 30.187 1.00 15.18 ? 28   LYS A CD  1 
ATOM   233 C  CE  . LYS A 1 28 ? 17.250  -12.465 30.075 1.00 17.77 ? 28   LYS A CE  1 
ATOM   234 N  NZ  . LYS A 1 28 ? 17.995  -12.601 31.406 1.00 20.86 ? 28   LYS A NZ  1 
ATOM   235 N  N   . PRO A 1 29 ? 14.557  -15.521 25.958 1.00 13.11 ? 29   PRO A N   1 
ATOM   236 C  CA  . PRO A 1 29 ? 15.254  -15.353 24.660 1.00 12.30 ? 29   PRO A CA  1 
ATOM   237 C  C   . PRO A 1 29 ? 14.329  -14.881 23.575 1.00 12.53 ? 29   PRO A C   1 
ATOM   238 O  O   . PRO A 1 29 ? 14.819  -14.109 22.723 1.00 14.78 ? 29   PRO A O   1 
ATOM   239 C  CB  . PRO A 1 29 ? 15.773  -16.784 24.301 1.00 13.37 ? 29   PRO A CB  1 
ATOM   240 C  CG  . PRO A 1 29 ? 14.922  -17.730 25.287 1.00 21.31 ? 29   PRO A CG  1 
ATOM   241 C  CD  . PRO A 1 29 ? 14.645  -16.893 26.521 1.00 15.24 ? 29   PRO A CD  1 
ATOM   242 N  N   . SER A 1 30 ? 13.068  -15.289 23.601 1.00 11.85 ? 30   SER A N   1 
ATOM   243 C  CA  . SER A 1 30 ? 12.133  -14.786 22.566 1.00 12.55 ? 30   SER A CA  1 
ATOM   244 C  C   . SER A 1 30 ? 11.787  -13.293 22.765 1.00 12.75 ? 30   SER A C   1 
ATOM   245 O  O   . SER A 1 30 ? 11.675  -12.583 21.761 1.00 12.40 ? 30   SER A O   1 
ATOM   246 C  CB  . SER A 1 30 ? 10.873  -15.596 22.678 1.00 11.88 ? 30   SER A CB  1 
ATOM   247 O  OG  . SER A 1 30 ? 11.072  -17.051 22.437 1.00 15.23 ? 30   SER A OG  1 
ATOM   248 N  N   . LEU A 1 31 ? 11.675  -12.862 24.008 1.00 11.99 ? 31   LEU A N   1 
ATOM   249 C  CA  . LEU A 1 31 ? 11.452  -11.384 24.171 1.00 10.73 ? 31   LEU A CA  1 
ATOM   250 C  C   . LEU A 1 31 ? 12.617  -10.548 23.629 1.00 11.94 ? 31   LEU A C   1 
ATOM   251 O  O   . LEU A 1 31 ? 12.388  -9.481  23.010 1.00 11.77 ? 31   LEU A O   1 
ATOM   252 C  CB  . LEU A 1 31 ? 11.255  -11.061 25.678 1.00 11.46 ? 31   LEU A CB  1 
ATOM   253 C  CG  . LEU A 1 31 ? 10.671  -9.571  25.902 1.00 10.61 ? 31   LEU A CG  1 
ATOM   254 C  CD1 . LEU A 1 31 ? 9.184   -9.632  25.674 1.00 14.00 ? 31   LEU A CD1 1 
ATOM   255 C  CD2 . LEU A 1 31 ? 11.082  -9.065  27.246 1.00 11.53 ? 31   LEU A CD2 1 
ATOM   256 N  N   . LEU A 1 32 ? 13.847  -11.033 23.868 1.00 11.26 ? 32   LEU A N   1 
ATOM   257 C  CA  . LEU A 1 32 ? 15.016  -10.292 23.425 1.00 12.62 ? 32   LEU A CA  1 
ATOM   258 C  C   . LEU A 1 32 ? 15.047  -10.320 21.899 1.00 11.79 ? 32   LEU A C   1 
ATOM   259 O  O   . LEU A 1 32 ? 15.311  -9.242  21.348 1.00 13.05 ? 32   LEU A O   1 
ATOM   260 C  CB  . LEU A 1 32 ? 16.284  -10.867 23.959 1.00 14.45 ? 32   LEU A CB  1 
ATOM   261 C  CG  . LEU A 1 32 ? 16.307  -10.806 25.470 1.00 16.60 ? 32   LEU A CG  1 
ATOM   262 C  CD1 . LEU A 1 32 ? 17.500  -11.605 26.013 1.00 20.62 ? 32   LEU A CD1 1 
ATOM   263 C  CD2 . LEU A 1 32 ? 16.358  -9.385  25.953 1.00 21.19 ? 32   LEU A CD2 1 
ATOM   264 N  N   . THR A 1 33 ? 14.762  -11.435 21.252 1.00 14.35 ? 33   THR A N   1 
ATOM   265 C  CA  . THR A 1 33 ? 14.668  -11.535 19.763 1.00 13.90 ? 33   THR A CA  1 
ATOM   266 C  C   . THR A 1 33 ? 13.600  -10.560 19.259 1.00 13.19 ? 33   THR A C   1 
ATOM   267 O  O   . THR A 1 33 ? 13.887  -9.753  18.370 1.00 14.03 ? 33   THR A O   1 
ATOM   268 C  CB  . THR A 1 33 ? 14.418  -12.955 19.311 1.00 16.80 ? 33   THR A CB  1 
ATOM   269 O  OG1 . THR A 1 33 ? 15.566  -13.703 19.732 1.00 17.84 ? 33   THR A OG1 1 
ATOM   270 C  CG2 . THR A 1 33 ? 14.217  -13.071 17.816 1.00 15.66 ? 33   THR A CG2 1 
ATOM   271 N  N   . MET A 1 34 ? 12.399  -10.627 19.892 1.00 12.15 ? 34   MET A N   1 
ATOM   272 C  CA  . MET A 1 34 ? 11.294  -9.721  19.480 1.00 12.30 ? 34   MET A CA  1 
ATOM   273 C  C   . MET A 1 34 ? 11.823  -8.237  19.505 1.00 11.27 ? 34   MET A C   1 
ATOM   274 O  O   . MET A 1 34 ? 11.584  -7.452  18.542 1.00 11.14 ? 34   MET A O   1 
ATOM   275 C  CB  . MET A 1 34 ? 10.102  -9.863  20.461 1.00 13.67 ? 34   MET A CB  1 
ATOM   276 C  CG  . MET A 1 34 ? 9.054   -8.935  19.973 1.00 12.18 ? 34   MET A CG  1 
ATOM   277 S  SD  . MET A 1 34 ? 9.010   -7.303  20.794 1.00 21.53 ? 34   MET A SD  1 
ATOM   278 C  CE  . MET A 1 34 ? 8.697   -7.674  22.556 1.00 13.35 ? 34   MET A CE  1 
ATOM   279 N  N   . MET A 1 35 ? 12.469  -7.790  20.575 1.00 11.04 ? 35   MET A N   1 
ATOM   280 C  CA  . MET A 1 35 ? 12.924  -6.412  20.742 1.00 10.98 ? 35   MET A CA  1 
ATOM   281 C  C   . MET A 1 35 ? 13.990  -6.034  19.643 1.00 12.88 ? 35   MET A C   1 
ATOM   282 O  O   . MET A 1 35 ? 13.849  -5.061  18.967 1.00 13.08 ? 35   MET A O   1 
ATOM   283 C  CB  . MET A 1 35 ? 13.524  -6.121  22.091 1.00 10.88 ? 35   MET A CB  1 
ATOM   284 C  CG  . MET A 1 35 ? 12.461  -6.122  23.225 1.00 12.37 ? 35   MET A CG  1 
ATOM   285 S  SD  . MET A 1 35 ? 11.367  -4.694  23.009 1.00 15.72 ? 35   MET A SD  1 
ATOM   286 C  CE  . MET A 1 35 ? 12.444  -3.308  23.173 1.00 18.78 ? 35   MET A CE  1 
ATOM   287 N  N   . LYS A 1 36 ? 14.949  -6.958  19.448 1.00 11.57 ? 36   LYS A N   1 
ATOM   288 C  CA  . LYS A 1 36 ? 16.033  -6.651  18.495 1.00 13.63 ? 36   LYS A CA  1 
ATOM   289 C  C   . LYS A 1 36 ? 15.492  -6.577  17.069 1.00 13.95 ? 36   LYS A C   1 
ATOM   290 O  O   . LYS A 1 36 ? 15.991  -5.768  16.290 1.00 14.45 ? 36   LYS A O   1 
ATOM   291 C  CB  . LYS A 1 36 ? 17.168  -7.739  18.584 1.00 12.24 ? 36   LYS A CB  1 
ATOM   292 C  CG  . LYS A 1 36 ? 17.786  -7.796  19.916 1.00 12.95 ? 36   LYS A CG  1 
ATOM   293 C  CD  . LYS A 1 36 ? 18.701  -9.001  20.057 1.00 16.67 ? 36   LYS A CD  1 
ATOM   294 C  CE  . LYS A 1 36 ? 19.585  -8.766  21.393 1.00 22.04 ? 36   LYS A CE  1 
ATOM   295 N  NZ  . LYS A 1 36 ? 20.399  -10.072 21.549 1.00 21.18 ? 36   LYS A NZ  1 
ATOM   296 N  N   . GLU A 1 37 ? 14.508  -7.340  16.710 1.00 12.33 ? 37   GLU A N   1 
ATOM   297 C  CA  . GLU A 1 37 ? 14.089  -7.389  15.332 1.00 13.52 ? 37   GLU A CA  1 
ATOM   298 C  C   . GLU A 1 37 ? 12.946  -6.445  15.048 1.00 14.11 ? 37   GLU A C   1 
ATOM   299 O  O   . GLU A 1 37 ? 12.733  -6.055  13.900 1.00 15.25 ? 37   GLU A O   1 
ATOM   300 C  CB  . GLU A 1 37 ? 13.606  -8.794  14.987 1.00 14.44 ? 37   GLU A CB  1 
ATOM   301 C  CG  . GLU A 1 37 ? 14.758  -9.837  15.012 1.00 15.13 ? 37   GLU A CG  1 
ATOM   302 C  CD  . GLU A 1 37 ? 14.409  -11.244 14.633 1.00 19.70 ? 37   GLU A CD  1 
ATOM   303 O  OE1 . GLU A 1 37 ? 13.278  -11.495 14.179 1.00 26.42 ? 37   GLU A OE1 1 
ATOM   304 O  OE2 . GLU A 1 37 ? 15.313  -12.122 14.821 1.00 16.49 ? 37   GLU A OE2 1 
ATOM   305 N  N   . ASN A 1 38 ? 12.161  -6.140  16.098 1.00 12.54 ? 38   ASN A N   1 
ATOM   306 C  CA  . ASN A 1 38 ? 10.995  -5.188  15.867 1.00 12.16 ? 38   ASN A CA  1 
ATOM   307 C  C   . ASN A 1 38 ? 11.218  -3.764  16.318 1.00 13.58 ? 38   ASN A C   1 
ATOM   308 O  O   . ASN A 1 38 ? 10.505  -2.918  15.766 1.00 13.52 ? 38   ASN A O   1 
ATOM   309 C  CB  . ASN A 1 38 ? 9.706   -5.787  16.526 1.00 12.40 ? 38   ASN A CB  1 
ATOM   310 C  CG  . ASN A 1 38 ? 9.289   -7.059  15.819 1.00 14.57 ? 38   ASN A CG  1 
ATOM   311 O  OD1 . ASN A 1 38 ? 8.607   -7.065  14.793 1.00 16.91 ? 38   ASN A OD1 1 
ATOM   312 N  ND2 . ASN A 1 38 ? 9.804   -8.222  16.337 1.00 13.39 ? 38   ASN A ND2 1 
ATOM   313 N  N   . PHE A 1 39 ? 12.182  -3.515  17.162 1.00 12.70 ? 39   PHE A N   1 
ATOM   314 C  CA  . PHE A 1 39 ? 12.522  -2.183  17.631 1.00 14.79 ? 39   PHE A CA  1 
ATOM   315 C  C   . PHE A 1 39 ? 13.968  -1.762  17.422 1.00 13.84 ? 39   PHE A C   1 
ATOM   316 O  O   . PHE A 1 39 ? 14.592  -1.217  18.272 1.00 16.11 ? 39   PHE A O   1 
ATOM   317 C  CB  . PHE A 1 39 ? 12.029  -1.927  19.094 1.00 14.81 ? 39   PHE A CB  1 
ATOM   318 C  CG  . PHE A 1 39 ? 10.555  -2.146  19.234 1.00 12.23 ? 39   PHE A CG  1 
ATOM   319 C  CD1 . PHE A 1 39 ? 9.701   -1.076  18.861 1.00 15.33 ? 39   PHE A CD1 1 
ATOM   320 C  CD2 . PHE A 1 39 ? 10.010  -3.376  19.640 1.00 15.03 ? 39   PHE A CD2 1 
ATOM   321 C  CE1 . PHE A 1 39 ? 8.377   -1.301  18.843 1.00 16.49 ? 39   PHE A CE1 1 
ATOM   322 C  CE2 . PHE A 1 39 ? 8.656   -3.618  19.671 1.00 15.06 ? 39   PHE A CE2 1 
ATOM   323 C  CZ  . PHE A 1 39 ? 7.796   -2.516  19.285 1.00 16.78 ? 39   PHE A CZ  1 
ATOM   324 N  N   . PRO A 1 40 ? 14.536  -2.107  16.222 1.00 14.29 ? 40   PRO A N   1 
ATOM   325 C  CA  . PRO A 1 40 ? 15.982  -1.833  16.061 1.00 16.52 ? 40   PRO A CA  1 
ATOM   326 C  C   . PRO A 1 40 ? 16.380  -0.356  16.073 1.00 15.59 ? 40   PRO A C   1 
ATOM   327 O  O   . PRO A 1 40 ? 17.446  -0.033  16.572 1.00 17.00 ? 40   PRO A O   1 
ATOM   328 C  CB  . PRO A 1 40 ? 16.281  -2.530  14.724 1.00 14.43 ? 40   PRO A CB  1 
ATOM   329 C  CG  . PRO A 1 40 ? 14.977  -2.320  13.960 1.00 16.20 ? 40   PRO A CG  1 
ATOM   330 C  CD  . PRO A 1 40 ? 13.877  -2.625  15.027 1.00 14.96 ? 40   PRO A CD  1 
ATOM   331 N  N   . ASN A 1 41 ? 15.511  0.527   15.593 1.00 18.36 ? 41   ASN A N   1 
ATOM   332 C  CA  . ASN A 1 41 ? 15.891  1.903   15.540 1.00 21.84 ? 41   ASN A CA  1 
ATOM   333 C  C   . ASN A 1 41 ? 15.760  2.469   16.958 1.00 21.14 ? 41   ASN A C   1 
ATOM   334 O  O   . ASN A 1 41 ? 16.569  3.233   17.389 1.00 21.80 ? 41   ASN A O   1 
ATOM   335 C  CB  . ASN A 1 41 ? 15.006  2.548   14.473 1.00 22.82 ? 41   ASN A CB  1 
ATOM   336 C  CG  . ASN A 1 41 ? 15.273  1.951   13.075 1.00 21.66 ? 41   ASN A CG  1 
ATOM   337 O  OD1 . ASN A 1 41 ? 16.431  2.067   12.569 1.00 23.71 ? 41   ASN A OD1 1 
ATOM   338 N  ND2 . ASN A 1 41 ? 14.268  1.221   12.473 1.00 21.04 ? 41   ASN A ND2 1 
ATOM   339 N  N   . PHE A 1 42 ? 14.739  2.044   17.707 1.00 21.15 ? 42   PHE A N   1 
ATOM   340 C  CA  . PHE A 1 42 ? 14.648  2.451   19.091 1.00 21.52 ? 42   PHE A CA  1 
ATOM   341 C  C   . PHE A 1 42 ? 15.894  2.068   19.868 1.00 22.56 ? 42   PHE A C   1 
ATOM   342 O  O   . PHE A 1 42 ? 16.448  2.859   20.635 1.00 24.14 ? 42   PHE A O   1 
ATOM   343 C  CB  . PHE A 1 42 ? 13.444  1.795   19.736 1.00 20.93 ? 42   PHE A CB  1 
ATOM   344 C  CG  . PHE A 1 42 ? 13.426  1.913   21.240 1.00 24.75 ? 42   PHE A CG  1 
ATOM   345 C  CD1 . PHE A 1 42 ? 13.209  3.160   21.850 1.00 28.16 ? 42   PHE A CD1 1 
ATOM   346 C  CD2 . PHE A 1 42 ? 13.640  0.776   22.041 1.00 25.46 ? 42   PHE A CD2 1 
ATOM   347 C  CE1 . PHE A 1 42 ? 13.100  3.258   23.258 1.00 31.38 ? 42   PHE A CE1 1 
ATOM   348 C  CE2 . PHE A 1 42 ? 13.566  0.854   23.436 1.00 28.81 ? 42   PHE A CE2 1 
ATOM   349 C  CZ  . PHE A 1 42 ? 13.295  2.090   24.050 1.00 31.84 ? 42   PHE A CZ  1 
ATOM   350 N  N   . LEU A 1 43 ? 16.318  0.824   19.676 1.00 20.53 ? 43   LEU A N   1 
ATOM   351 C  CA  . LEU A 1 43 ? 17.455  0.272   20.415 1.00 19.57 ? 43   LEU A CA  1 
ATOM   352 C  C   . LEU A 1 43 ? 18.753  0.925   19.941 1.00 22.21 ? 43   LEU A C   1 
ATOM   353 O  O   . LEU A 1 43 ? 19.662  1.105   20.733 1.00 22.24 ? 43   LEU A O   1 
ATOM   354 C  CB  . LEU A 1 43 ? 17.551  -1.220  20.222 1.00 17.99 ? 43   LEU A CB  1 
ATOM   355 C  CG  . LEU A 1 43 ? 16.468  -2.094  20.893 1.00 18.25 ? 43   LEU A CG  1 
ATOM   356 C  CD1 . LEU A 1 43 ? 16.701  -3.533  20.540 1.00 23.22 ? 43   LEU A CD1 1 
ATOM   357 C  CD2 . LEU A 1 43 ? 16.511  -2.017  22.471 1.00 20.26 ? 43   LEU A CD2 1 
ATOM   358 N  N   . SER A 1 44 ? 18.818  1.322   18.676 1.00 23.66 ? 44   SER A N   1 
ATOM   359 C  CA  . SER A 1 44 ? 20.033  1.892   18.103 1.00 25.84 ? 44   SER A CA  1 
ATOM   360 C  C   . SER A 1 44 ? 20.293  3.220   18.793 1.00 28.19 ? 44   SER A C   1 
ATOM   361 O  O   . SER A 1 44 ? 21.457  3.518   19.135 1.00 28.07 ? 44   SER A O   1 
ATOM   362 C  CB  . SER A 1 44 ? 19.885  2.057   16.584 1.00 25.13 ? 44   SER A CB  1 
ATOM   363 O  OG  . SER A 1 44 ? 20.996  2.714   15.990 1.00 37.86 ? 44   SER A OG  1 
ATOM   364 N  N   . ALA A 1 45 ? 19.211  3.968   19.047 1.00 26.80 ? 45   ALA A N   1 
ATOM   365 C  CA  . ALA A 1 45 ? 19.313  5.224   19.757 1.00 28.70 ? 45   ALA A CA  1 
ATOM   366 C  C   . ALA A 1 45 ? 19.800  4.983   21.166 1.00 29.49 ? 45   ALA A C   1 
ATOM   367 O  O   . ALA A 1 45 ? 20.618  5.743   21.635 1.00 31.20 ? 45   ALA A O   1 
ATOM   368 C  CB  . ALA A 1 45 ? 18.012  5.978   19.717 1.00 29.03 ? 45   ALA A CB  1 
ATOM   369 N  N   . CYS A 1 46 ? 19.365  3.911   21.852 1.00 30.47 ? 46   CYS A N   1 
ATOM   370 C  CA  . CYS A 1 46 ? 19.917  3.566   23.197 1.00 32.02 ? 46   CYS A CA  1 
ATOM   371 C  C   . CYS A 1 46 ? 21.411  3.213   23.204 1.00 33.47 ? 46   CYS A C   1 
ATOM   372 O  O   . CYS A 1 46 ? 22.158  3.685   24.064 1.00 31.91 ? 46   CYS A O   1 
ATOM   373 C  CB  . CYS A 1 46 ? 19.174  2.364   23.819 1.00 31.53 ? 46   CYS A CB  1 
ATOM   374 S  SG  . CYS A 1 46 ? 17.457  2.802   24.138 1.00 31.67 ? 46   CYS A SG  1 
ATOM   375 N  N   . ASP A 1 47 ? 21.826  2.391   22.232 1.00 33.98 ? 47   ASP A N   1 
ATOM   376 C  CA  . ASP A 1 47 ? 23.239  1.941   22.127 1.00 37.27 ? 47   ASP A CA  1 
ATOM   377 C  C   . ASP A 1 47 ? 24.227  3.091   21.993 1.00 39.41 ? 47   ASP A C   1 
ATOM   378 O  O   . ASP A 1 47 ? 25.256  3.086   22.660 1.00 40.08 ? 47   ASP A O   1 
ATOM   379 C  CB  . ASP A 1 47 ? 23.406  0.860   21.041 1.00 36.54 ? 47   ASP A CB  1 
ATOM   380 C  CG  . ASP A 1 47 ? 22.816  -0.489  21.496 1.00 39.18 ? 47   ASP A CG  1 
ATOM   381 O  OD1 . ASP A 1 47 ? 22.732  -0.718  22.731 1.00 40.25 ? 47   ASP A OD1 1 
ATOM   382 O  OD2 . ASP A 1 47 ? 22.404  -1.316  20.655 1.00 40.26 ? 47   ASP A OD2 1 
ATOM   383 N  N   . LYS A 1 48 ? 23.867  4.089   21.182 1.00 42.22 ? 48   LYS A N   1 
ATOM   384 C  CA  . LYS A 1 48 ? 24.650  5.350   21.023 1.00 44.59 ? 48   LYS A CA  1 
ATOM   385 C  C   . LYS A 1 48 ? 24.850  6.132   22.320 1.00 45.25 ? 48   LYS A C   1 
ATOM   386 O  O   . LYS A 1 48 ? 25.893  6.762   22.509 1.00 46.16 ? 48   LYS A O   1 
ATOM   387 C  CB  . LYS A 1 48 ? 23.994  6.278   19.981 1.00 45.52 ? 48   LYS A CB  1 
ATOM   388 C  CG  . LYS A 1 48 ? 23.885  5.660   18.587 1.00 47.66 ? 48   LYS A CG  1 
ATOM   389 C  CD  . LYS A 1 48 ? 23.518  6.667   17.503 1.00 51.61 ? 48   LYS A CD  1 
ATOM   390 C  CE  . LYS A 1 48 ? 23.517  5.977   16.140 1.00 55.52 ? 48   LYS A CE  1 
ATOM   391 N  NZ  . LYS A 1 48 ? 24.908  5.568   15.758 1.00 53.74 ? 48   LYS A NZ  1 
ATOM   392 N  N   . LYS A 1 49 ? 23.840  6.111   23.188 1.00 46.22 ? 49   LYS A N   1 
ATOM   393 C  CA  . LYS A 1 49 ? 23.903  6.723   24.522 1.00 47.21 ? 49   LYS A CA  1 
ATOM   394 C  C   . LYS A 1 49 ? 24.810  5.895   25.440 1.00 46.65 ? 49   LYS A C   1 
ATOM   395 O  O   . LYS A 1 49 ? 25.238  6.390   26.491 1.00 47.66 ? 49   LYS A O   1 
ATOM   396 C  CB  . LYS A 1 49 ? 22.523  6.744   25.246 1.00 48.34 ? 49   LYS A CB  1 
ATOM   397 C  CG  . LYS A 1 49 ? 21.233  6.829   24.468 1.00 50.61 ? 49   LYS A CG  1 
ATOM   398 C  CD  . LYS A 1 49 ? 20.852  8.268   24.091 1.00 56.18 ? 49   LYS A CD  1 
ATOM   399 C  CE  . LYS A 1 49 ? 20.631  9.157   25.301 1.00 59.30 ? 49   LYS A CE  1 
ATOM   400 N  NZ  . LYS A 1 49 ? 19.480  8.714   26.123 1.00 62.50 ? 49   LYS A NZ  1 
ATOM   401 N  N   . GLY A 1 50 ? 25.057  4.633   25.086 1.00 45.97 ? 50   GLY A N   1 
ATOM   402 C  CA  . GLY A 1 50 ? 25.704  3.700   26.012 1.00 44.26 ? 50   GLY A CA  1 
ATOM   403 C  C   . GLY A 1 50 ? 24.685  3.030   26.947 1.00 43.15 ? 50   GLY A C   1 
ATOM   404 O  O   . GLY A 1 50 ? 25.027  2.507   28.022 1.00 43.14 ? 50   GLY A O   1 
ATOM   405 N  N   . THR A 1 51 ? 23.417  3.043   26.550 1.00 41.40 ? 51   THR A N   1 
ATOM   406 C  CA  . THR A 1 51 ? 22.392  2.310   27.292 1.00 39.62 ? 51   THR A CA  1 
ATOM   407 C  C   . THR A 1 51 ? 22.169  0.945   26.629 1.00 37.61 ? 51   THR A C   1 
ATOM   408 O  O   . THR A 1 51 ? 21.765  0.869   25.466 1.00 35.95 ? 51   THR A O   1 
ATOM   409 C  CB  . THR A 1 51 ? 21.070  3.116   27.353 1.00 40.65 ? 51   THR A CB  1 
ATOM   410 O  OG1 . THR A 1 51 ? 21.251  4.236   28.227 1.00 43.80 ? 51   THR A OG1 1 
ATOM   411 C  CG2 . THR A 1 51 ? 19.913  2.271   27.885 1.00 38.50 ? 51   THR A CG2 1 
ATOM   412 N  N   . ASN A 1 52 ? 22.460  -0.125  27.371 1.00 36.63 ? 52   ASN A N   1 
ATOM   413 C  CA  . ASN A 1 52 ? 21.963  -1.479  27.020 1.00 34.23 ? 52   ASN A CA  1 
ATOM   414 C  C   . ASN A 1 52 ? 20.569  -1.620  27.623 1.00 33.58 ? 52   ASN A C   1 
ATOM   415 O  O   . ASN A 1 52 ? 20.418  -2.035  28.782 1.00 32.72 ? 52   ASN A O   1 
ATOM   416 C  CB  . ASN A 1 52 ? 22.857  -2.600  27.593 1.00 34.65 ? 52   ASN A CB  1 
ATOM   417 C  CG  . ASN A 1 52 ? 22.457  -4.002  27.099 1.00 35.90 ? 52   ASN A CG  1 
ATOM   418 O  OD1 . ASN A 1 52 ? 23.080  -5.029  27.465 1.00 37.39 ? 52   ASN A OD1 1 
ATOM   419 N  ND2 . ASN A 1 52 ? 21.478  -4.051  26.222 1.00 36.69 ? 52   ASN A ND2 1 
ATOM   420 N  N   . TYR A 1 53 ? 19.582  -1.242  26.800 1.00 31.75 ? 53   TYR A N   1 
ATOM   421 C  CA  . TYR A 1 53 ? 18.193  -1.281  27.164 1.00 27.85 ? 53   TYR A CA  1 
ATOM   422 C  C   . TYR A 1 53 ? 17.873  -2.723  27.565 1.00 26.61 ? 53   TYR A C   1 
ATOM   423 O  O   . TYR A 1 53 ? 17.005  -2.983  28.465 1.00 28.13 ? 53   TYR A O   1 
ATOM   424 C  CB  . TYR A 1 53 ? 17.329  -0.795  25.962 1.00 27.56 ? 53   TYR A CB  1 
ATOM   425 C  CG  . TYR A 1 53 ? 15.912  -0.449  26.363 1.00 29.16 ? 53   TYR A CG  1 
ATOM   426 C  CD1 . TYR A 1 53 ? 15.638  0.793   26.906 1.00 32.36 ? 53   TYR A CD1 1 
ATOM   427 C  CD2 . TYR A 1 53 ? 14.875  -1.375  26.214 1.00 27.78 ? 53   TYR A CD2 1 
ATOM   428 C  CE1 . TYR A 1 53 ? 14.314  1.122   27.320 1.00 31.77 ? 53   TYR A CE1 1 
ATOM   429 C  CE2 . TYR A 1 53 ? 13.561  -1.070  26.644 1.00 30.07 ? 53   TYR A CE2 1 
ATOM   430 C  CZ  . TYR A 1 53 ? 13.308  0.167   27.186 1.00 31.25 ? 53   TYR A CZ  1 
ATOM   431 O  OH  . TYR A 1 53 ? 12.016  0.497   27.602 1.00 27.54 ? 53   TYR A OH  1 
ATOM   432 N  N   . LEU A 1 54 ? 18.518  -3.679  26.910 1.00 21.24 ? 54   LEU A N   1 
ATOM   433 C  CA  . LEU A 1 54 ? 18.032  -5.017  26.990 1.00 20.54 ? 54   LEU A CA  1 
ATOM   434 C  C   . LEU A 1 54 ? 18.430  -5.687  28.302 1.00 20.60 ? 54   LEU A C   1 
ATOM   435 O  O   . LEU A 1 54 ? 17.663  -6.456  28.786 1.00 23.39 ? 54   LEU A O   1 
ATOM   436 C  CB  . LEU A 1 54 ? 18.229  -5.921  25.769 1.00 20.18 ? 54   LEU A CB  1 
ATOM   437 C  CG  . LEU A 1 54 ? 17.621  -5.308  24.459 1.00 21.66 ? 54   LEU A CG  1 
ATOM   438 C  CD1 . LEU A 1 54 ? 18.019  -6.243  23.383 1.00 25.60 ? 54   LEU A CD1 1 
ATOM   439 C  CD2 . LEU A 1 54 ? 16.127  -5.248  24.599 1.00 24.66 ? 54   LEU A CD2 1 
ATOM   440 N  N   . ALA A 1 55 ? 19.616  -5.480  28.860 1.00 19.37 ? 55   ALA A N   1 
ATOM   441 C  CA  . ALA A 1 55 ? 19.908  -6.269  30.042 1.00 20.35 ? 55   ALA A CA  1 
ATOM   442 C  C   . ALA A 1 55 ? 18.905  -5.867  31.142 1.00 18.82 ? 55   ALA A C   1 
ATOM   443 O  O   . ALA A 1 55 ? 18.729  -4.664  31.520 1.00 24.06 ? 55   ALA A O   1 
ATOM   444 C  CB  . ALA A 1 55 ? 21.277  -5.901  30.553 1.00 19.77 ? 55   ALA A CB  1 
ATOM   445 N  N   . GLY A 1 56 ? 18.303  -6.878  31.683 1.00 20.03 ? 56   GLY A N   1 
ATOM   446 C  CA  . GLY A 1 56 ? 17.335  -6.590  32.693 1.00 16.66 ? 56   GLY A CA  1 
ATOM   447 C  C   . GLY A 1 56 ? 15.923  -6.214  32.251 1.00 16.00 ? 56   GLY A C   1 
ATOM   448 O  O   . GLY A 1 56 ? 15.079  -6.124  33.121 1.00 16.48 ? 56   GLY A O   1 
ATOM   449 N  N   . VAL A 1 57 ? 15.696  -5.932  30.985 1.00 13.57 ? 57   VAL A N   1 
ATOM   450 C  CA  . VAL A 1 57 ? 14.287  -5.582  30.507 1.00 14.07 ? 57   VAL A CA  1 
ATOM   451 C  C   . VAL A 1 57 ? 13.285  -6.712  30.842 1.00 13.19 ? 57   VAL A C   1 
ATOM   452 O  O   . VAL A 1 57 ? 12.223  -6.421  31.377 1.00 13.42 ? 57   VAL A O   1 
ATOM   453 C  CB  . VAL A 1 57 ? 14.300  -5.245  29.003 1.00 13.12 ? 57   VAL A CB  1 
ATOM   454 C  CG1 . VAL A 1 57 ? 14.540  -6.321  28.037 1.00 16.50 ? 57   VAL A CG1 1 
ATOM   455 C  CG2 . VAL A 1 57 ? 12.930  -4.613  28.665 1.00 18.28 ? 57   VAL A CG2 1 
ATOM   456 N  N   . PHE A 1 58 ? 13.688  -7.926  30.577 1.00 12.68 ? 58   PHE A N   1 
ATOM   457 C  CA  . PHE A 1 58 ? 12.764  -9.067  30.790 1.00 10.37 ? 58   PHE A CA  1 
ATOM   458 C  C   . PHE A 1 58 ? 12.394  -9.107  32.272 1.00 11.58 ? 58   PHE A C   1 
ATOM   459 O  O   . PHE A 1 58 ? 11.226  -9.254  32.663 1.00 11.16 ? 58   PHE A O   1 
ATOM   460 C  CB  . PHE A 1 58 ? 13.472  -10.380 30.387 1.00 13.44 ? 58   PHE A CB  1 
ATOM   461 C  CG  . PHE A 1 58 ? 12.619  -11.595 30.637 1.00 9.93  ? 58   PHE A CG  1 
ATOM   462 C  CD1 . PHE A 1 58 ? 11.750  -12.038 29.651 1.00 8.14  ? 58   PHE A CD1 1 
ATOM   463 C  CD2 . PHE A 1 58 ? 12.626  -12.224 31.912 1.00 11.50 ? 58   PHE A CD2 1 
ATOM   464 C  CE1 . PHE A 1 58 ? 10.931  -13.091 29.825 1.00 10.44 ? 58   PHE A CE1 1 
ATOM   465 C  CE2 . PHE A 1 58 ? 11.704  -13.334 32.122 1.00 12.61 ? 58   PHE A CE2 1 
ATOM   466 C  CZ  . PHE A 1 58 ? 10.907  -13.751 31.079 1.00 13.53 ? 58   PHE A CZ  1 
ATOM   467 N  N   . GLU A 1 59 ? 13.409  -9.100  33.183 1.00 12.44 ? 59   GLU A N   1 
ATOM   468 C  CA  . GLU A 1 59 ? 13.180  -9.088  34.599 1.00 10.45 ? 59   GLU A CA  1 
ATOM   469 C  C   . GLU A 1 59 ? 12.399  -7.870  35.122 1.00 12.64 ? 59   GLU A C   1 
ATOM   470 O  O   . GLU A 1 59 ? 11.547  -8.033  36.023 1.00 13.75 ? 59   GLU A O   1 
ATOM   471 C  CB  . GLU A 1 59 ? 14.517  -9.177  35.332 1.00 13.38 ? 59   GLU A CB  1 
ATOM   472 C  CG  . GLU A 1 59 ? 15.207  -10.528 35.049 1.00 13.98 ? 59   GLU A CG  1 
ATOM   473 C  CD  . GLU A 1 59 ? 15.858  -10.710 33.706 1.00 11.03 ? 59   GLU A CD  1 
ATOM   474 O  OE1 . GLU A 1 59 ? 16.244  -9.681  33.067 1.00 13.99 ? 59   GLU A OE1 1 
ATOM   475 O  OE2 . GLU A 1 59 ? 16.020  -11.893 33.292 1.00 15.39 ? 59   GLU A OE2 1 
ATOM   476 N  N   . LYS A 1 60 ? 12.607  -6.670  34.527 1.00 11.98 ? 60   LYS A N   1 
ATOM   477 C  CA  . LYS A 1 60 ? 11.825  -5.515  34.947 1.00 11.74 ? 60   LYS A CA  1 
ATOM   478 C  C   . LYS A 1 60 ? 10.357  -5.727  34.576 1.00 11.55 ? 60   LYS A C   1 
ATOM   479 O  O   . LYS A 1 60 ? 9.468   -5.256  35.340 1.00 13.36 ? 60   LYS A O   1 
ATOM   480 C  CB  . LYS A 1 60 ? 12.357  -4.263  34.226 1.00 13.97 ? 60   LYS A CB  1 
ATOM   481 C  CG  . LYS A 1 60 ? 13.652  -3.825  34.919 1.00 18.68 ? 60   LYS A CG  1 
ATOM   482 C  CD  . LYS A 1 60 ? 14.239  -2.733  34.037 1.00 28.03 ? 60   LYS A CD  1 
ATOM   483 C  CE  . LYS A 1 60 ? 15.364  -2.070  34.798 1.00 33.58 ? 60   LYS A CE  1 
ATOM   484 N  NZ  . LYS A 1 60 ? 16.124  -1.255  33.812 1.00 36.32 ? 60   LYS A NZ  1 
ATOM   485 N  N   . LYS A 1 61 ? 10.104  -6.427  33.461 1.00 10.39 ? 61   LYS A N   1 
ATOM   486 C  CA  . LYS A 1 61 ? 8.679   -6.544  32.992 1.00 9.82  ? 61   LYS A CA  1 
ATOM   487 C  C   . LYS A 1 61 ? 7.994   -7.777  33.588 1.00 11.14 ? 61   LYS A C   1 
ATOM   488 O  O   . LYS A 1 61 ? 6.787   -7.854  33.598 1.00 10.65 ? 61   LYS A O   1 
ATOM   489 C  CB  . LYS A 1 61 ? 8.579   -6.563  31.440 1.00 9.90  ? 61   LYS A CB  1 
ATOM   490 C  CG  . LYS A 1 61 ? 9.177   -5.258  30.802 1.00 12.27 ? 61   LYS A CG  1 
ATOM   491 C  CD  . LYS A 1 61 ? 8.807   -3.929  31.541 1.00 16.20 ? 61   LYS A CD  1 
ATOM   492 C  CE  . LYS A 1 61 ? 7.413   -3.544  31.523 1.00 26.09 ? 61   LYS A CE  1 
ATOM   493 N  NZ  . LYS A 1 61 ? 7.512   -2.138  32.251 1.00 22.10 ? 61   LYS A NZ  1 
ATOM   494 N  N   . ASP A 1 62 ? 8.795   -8.755  34.032 1.00 11.66 ? 62   ASP A N   1 
ATOM   495 C  CA  . ASP A 1 62 ? 8.203   -10.017 34.583 1.00 9.49  ? 62   ASP A CA  1 
ATOM   496 C  C   . ASP A 1 62 ? 7.853   -9.790  36.040 1.00 10.21 ? 62   ASP A C   1 
ATOM   497 O  O   . ASP A 1 62 ? 8.592   -10.294 36.973 1.00 12.16 ? 62   ASP A O   1 
ATOM   498 C  CB  . ASP A 1 62 ? 9.226   -11.140 34.406 1.00 11.34 ? 62   ASP A CB  1 
ATOM   499 C  CG  . ASP A 1 62 ? 8.693   -12.492 34.978 1.00 11.21 ? 62   ASP A CG  1 
ATOM   500 O  OD1 . ASP A 1 62 ? 7.470   -12.581 35.146 1.00 11.07 ? 62   ASP A OD1 1 
ATOM   501 O  OD2 . ASP A 1 62 ? 9.559   -13.389 35.251 1.00 12.73 ? 62   ASP A OD2 1 
ATOM   502 N  N   . LYS A 1 63 ? 6.753   -9.029  36.250 1.00 11.25 ? 63   LYS A N   1 
ATOM   503 C  CA  . LYS A 1 63 ? 6.450   -8.527  37.565 1.00 15.06 ? 63   LYS A CA  1 
ATOM   504 C  C   . LYS A 1 63 ? 6.208   -9.677  38.570 1.00 15.67 ? 63   LYS A C   1 
ATOM   505 O  O   . LYS A 1 63 ? 6.516   -9.558  39.730 1.00 17.21 ? 63   LYS A O   1 
ATOM   506 C  CB  . LYS A 1 63 ? 5.234   -7.619  37.437 1.00 18.24 ? 63   LYS A CB  1 
ATOM   507 C  CG  . LYS A 1 63 ? 5.774   -6.143  37.333 1.00 26.36 ? 63   LYS A CG  1 
ATOM   508 C  CD  . LYS A 1 63 ? 6.507   -5.759  36.118 1.00 35.59 ? 63   LYS A CD  1 
ATOM   509 C  CE  . LYS A 1 63 ? 6.442   -4.187  35.985 1.00 39.58 ? 63   LYS A CE  1 
ATOM   510 N  NZ  . LYS A 1 63 ? 6.748   -3.566  34.640 1.00 37.32 ? 63   LYS A NZ  1 
ATOM   511 N  N   . ASN A 1 64 ? 5.625   -10.761 38.060 1.00 13.21 ? 64   ASN A N   1 
ATOM   512 C  CA  . ASN A 1 64 ? 5.307   -11.858 38.965 1.00 14.82 ? 64   ASN A CA  1 
ATOM   513 C  C   . ASN A 1 64 ? 6.381   -12.908 38.999 1.00 14.00 ? 64   ASN A C   1 
ATOM   514 O  O   . ASN A 1 64 ? 6.196   -13.994 39.680 1.00 15.68 ? 64   ASN A O   1 
ATOM   515 C  CB  . ASN A 1 64 ? 3.931   -12.468 38.605 1.00 14.54 ? 64   ASN A CB  1 
ATOM   516 C  CG  . ASN A 1 64 ? 3.935   -13.287 37.339 1.00 13.09 ? 64   ASN A CG  1 
ATOM   517 O  OD1 . ASN A 1 64 ? 4.729   -12.986 36.465 1.00 13.77 ? 64   ASN A OD1 1 
ATOM   518 N  ND2 . ASN A 1 64 ? 3.038   -14.280 37.201 1.00 14.35 ? 64   ASN A ND2 1 
ATOM   519 N  N   . GLU A 1 65 ? 7.531   -12.719 38.356 1.00 14.45 ? 65   GLU A N   1 
ATOM   520 C  CA  . GLU A 1 65 ? 8.684   -13.580 38.461 1.00 14.86 ? 65   GLU A CA  1 
ATOM   521 C  C   . GLU A 1 65 ? 8.353   -15.035 38.117 1.00 14.69 ? 65   GLU A C   1 
ATOM   522 O  O   . GLU A 1 65 ? 8.969   -16.014 38.699 1.00 14.97 ? 65   GLU A O   1 
ATOM   523 C  CB  . GLU A 1 65 ? 9.264   -13.540 39.930 1.00 15.29 ? 65   GLU A CB  1 
ATOM   524 C  CG  . GLU A 1 65 ? 9.981   -12.186 40.195 1.00 17.38 ? 65   GLU A CG  1 
ATOM   525 C  CD  . GLU A 1 65 ? 10.516  -12.190 41.626 1.00 17.70 ? 65   GLU A CD  1 
ATOM   526 O  OE1 . GLU A 1 65 ? 11.735  -12.392 41.737 1.00 25.95 ? 65   GLU A OE1 1 
ATOM   527 O  OE2 . GLU A 1 65 ? 9.702   -12.087 42.561 1.00 19.54 ? 65   GLU A OE2 1 
ATOM   528 N  N   . ASP A 1 66 ? 7.472   -15.223 37.148 1.00 12.56 ? 66   ASP A N   1 
ATOM   529 C  CA  . ASP A 1 66 ? 7.206   -16.615 36.617 1.00 11.76 ? 66   ASP A CA  1 
ATOM   530 C  C   . ASP A 1 66 ? 8.097   -17.040 35.469 1.00 12.57 ? 66   ASP A C   1 
ATOM   531 O  O   . ASP A 1 66 ? 7.927   -18.119 34.873 1.00 14.49 ? 66   ASP A O   1 
ATOM   532 C  CB  . ASP A 1 66 ? 5.706   -16.850 36.330 1.00 12.72 ? 66   ASP A CB  1 
ATOM   533 C  CG  . ASP A 1 66 ? 5.145   -16.005 35.222 1.00 13.37 ? 66   ASP A CG  1 
ATOM   534 O  OD1 . ASP A 1 66 ? 5.906   -15.203 34.670 1.00 11.22 ? 66   ASP A OD1 1 
ATOM   535 O  OD2 . ASP A 1 66 ? 3.948   -16.191 34.904 1.00 14.69 ? 66   ASP A OD2 1 
ATOM   536 N  N   . LYS A 1 67 ? 9.070   -16.151 35.139 1.00 12.60 ? 67   LYS A N   1 
ATOM   537 C  CA  . LYS A 1 67 ? 10.006  -16.346 34.024 1.00 13.18 ? 67   LYS A CA  1 
ATOM   538 C  C   . LYS A 1 67 ? 9.264   -16.384 32.684 1.00 12.68 ? 67   LYS A C   1 
ATOM   539 O  O   . LYS A 1 67 ? 9.735   -16.951 31.723 1.00 15.11 ? 67   LYS A O   1 
ATOM   540 C  CB  . LYS A 1 67 ? 10.860  -17.653 34.184 1.00 16.11 ? 67   LYS A CB  1 
ATOM   541 C  CG  . LYS A 1 67 ? 12.037  -17.303 34.935 1.00 19.77 ? 67   LYS A CG  1 
ATOM   542 C  CD  . LYS A 1 67 ? 13.106  -18.464 34.921 1.00 26.23 ? 67   LYS A CD  1 
ATOM   543 C  CE  . LYS A 1 67 ? 14.196  -18.080 35.852 1.00 35.06 ? 67   LYS A CE  1 
ATOM   544 N  NZ  . LYS A 1 67 ? 14.429  -16.608 35.887 1.00 43.42 ? 67   LYS A NZ  1 
ATOM   545 N  N   . LYS A 1 68 ? 8.108   -15.708 32.558 1.00 13.48 ? 68   LYS A N   1 
ATOM   546 C  CA  . LYS A 1 68 ? 7.420   -15.570 31.260 1.00 11.84 ? 68   LYS A CA  1 
ATOM   547 C  C   . LYS A 1 68 ? 6.868   -14.177 31.239 1.00 10.78 ? 68   LYS A C   1 
ATOM   548 O  O   . LYS A 1 68 ? 6.668   -13.539 32.292 1.00 12.35 ? 68   LYS A O   1 
ATOM   549 C  CB  . LYS A 1 68 ? 6.233   -16.493 31.210 1.00 14.04 ? 68   LYS A CB  1 
ATOM   550 C  CG  . LYS A 1 68 ? 6.555   -18.056 31.316 1.00 15.96 ? 68   LYS A CG  1 
ATOM   551 C  CD  . LYS A 1 68 ? 7.337   -18.568 30.130 1.00 21.29 ? 68   LYS A CD  1 
ATOM   552 C  CE  . LYS A 1 68 ? 7.175   -20.175 30.052 1.00 31.24 ? 68   LYS A CE  1 
ATOM   553 N  NZ  . LYS A 1 68 ? 8.013   -20.538 28.911 1.00 36.81 ? 68   LYS A NZ  1 
ATOM   554 N  N   . ILE A 1 69 ? 6.749   -13.688 30.026 1.00 10.31 ? 69   ILE A N   1 
ATOM   555 C  CA  . ILE A 1 69 ? 6.031   -12.379 29.809 1.00 9.89  ? 69   ILE A CA  1 
ATOM   556 C  C   . ILE A 1 69 ? 4.657   -12.704 29.246 1.00 9.87  ? 69   ILE A C   1 
ATOM   557 O  O   . ILE A 1 69 ? 4.517   -13.278 28.167 1.00 11.79 ? 69   ILE A O   1 
ATOM   558 C  CB  . ILE A 1 69 ? 6.893   -11.518 28.819 1.00 9.83  ? 69   ILE A CB  1 
ATOM   559 C  CG1 . ILE A 1 69 ? 8.195   -11.001 29.512 1.00 10.16 ? 69   ILE A CG1 1 
ATOM   560 C  CG2 . ILE A 1 69 ? 6.035   -10.317 28.259 1.00 11.51 ? 69   ILE A CG2 1 
ATOM   561 C  CD1 . ILE A 1 69 ? 8.035   -10.219 30.778 1.00 14.01 ? 69   ILE A CD1 1 
ATOM   562 N  N   . ASP A 1 70 ? 3.644   -12.365 30.027 1.00 10.11 ? 70   ASP A N   1 
ATOM   563 C  CA  . ASP A 1 70 ? 2.296   -12.581 29.570 1.00 9.36  ? 70   ASP A CA  1 
ATOM   564 C  C   . ASP A 1 70 ? 1.794   -11.282 28.886 1.00 8.68  ? 70   ASP A C   1 
ATOM   565 O  O   . ASP A 1 70 ? 2.540   -10.287 28.750 1.00 10.09 ? 70   ASP A O   1 
ATOM   566 C  CB  . ASP A 1 70 ? 1.395   -13.026 30.734 1.00 11.38 ? 70   ASP A CB  1 
ATOM   567 C  CG  . ASP A 1 70 ? 1.195   -11.998 31.842 1.00 11.63 ? 70   ASP A CG  1 
ATOM   568 O  OD1 . ASP A 1 70 ? 1.275   -10.771 31.606 1.00 11.26 ? 70   ASP A OD1 1 
ATOM   569 O  OD2 . ASP A 1 70 ? 0.983   -12.424 33.047 1.00 15.13 ? 70   ASP A OD2 1 
ATOM   570 N  N   . PHE A 1 71 ? 0.593   -11.374 28.360 1.00 11.14 ? 71   PHE A N   1 
ATOM   571 C  CA  . PHE A 1 71 ? 0.119   -10.229 27.582 1.00 11.14 ? 71   PHE A CA  1 
ATOM   572 C  C   . PHE A 1 71 ? 0.078   -8.938  28.372 1.00 10.01 ? 71   PHE A C   1 
ATOM   573 O  O   . PHE A 1 71 ? 0.504   -7.889  27.833 1.00 11.24 ? 71   PHE A O   1 
ATOM   574 C  CB  . PHE A 1 71 ? -1.290  -10.537 26.978 1.00 11.43 ? 71   PHE A CB  1 
ATOM   575 C  CG  . PHE A 1 71 ? -1.686  -9.569  25.931 1.00 11.23 ? 71   PHE A CG  1 
ATOM   576 C  CD1 . PHE A 1 71 ? -1.021  -9.524  24.735 1.00 12.15 ? 71   PHE A CD1 1 
ATOM   577 C  CD2 . PHE A 1 71 ? -2.683  -8.578  26.231 1.00 14.85 ? 71   PHE A CD2 1 
ATOM   578 C  CE1 . PHE A 1 71 ? -1.324  -8.570  23.717 1.00 15.42 ? 71   PHE A CE1 1 
ATOM   579 C  CE2 . PHE A 1 71 ? -2.981  -7.586  25.253 1.00 15.33 ? 71   PHE A CE2 1 
ATOM   580 C  CZ  . PHE A 1 71 ? -2.348  -7.582  23.994 1.00 17.41 ? 71   PHE A CZ  1 
ATOM   581 N  N   . SER A 1 72 ? -0.322  -8.957  29.632 1.00 11.62 ? 72   SER A N   1 
ATOM   582 C  CA  . SER A 1 72 ? -0.350  -7.733  30.451 1.00 9.78  ? 72   SER A CA  1 
ATOM   583 C  C   . SER A 1 72 ? 1.042   -7.135  30.607 1.00 9.84  ? 72   SER A C   1 
ATOM   584 O  O   . SER A 1 72 ? 1.297   -5.899  30.520 1.00 11.50 ? 72   SER A O   1 
ATOM   585 C  CB  . SER A 1 72 ? -1.005  -7.964  31.805 1.00 10.77 ? 72   SER A CB  1 
ATOM   586 O  OG  . SER A 1 72 ? -0.136  -8.709  32.674 1.00 13.35 ? 72   SER A OG  1 
ATOM   587 N  N   . GLU A 1 73 ? 2.071   -8.019  30.704 1.00 8.90  ? 73   GLU A N   1 
ATOM   588 C  CA  . GLU A 1 73 ? 3.403   -7.492  30.881 1.00 9.63  ? 73   GLU A CA  1 
ATOM   589 C  C   . GLU A 1 73 ? 3.976   -7.012  29.542 1.00 9.56  ? 73   GLU A C   1 
ATOM   590 O  O   . GLU A 1 73 ? 4.773   -6.035  29.498 1.00 10.82 ? 73   GLU A O   1 
ATOM   591 C  CB  . GLU A 1 73 ? 4.248   -8.652  31.447 1.00 9.59  ? 73   GLU A CB  1 
ATOM   592 C  CG  . GLU A 1 73 ? 3.862   -8.983  32.913 1.00 11.99 ? 73   GLU A CG  1 
ATOM   593 C  CD  . GLU A 1 73 ? 4.445   -10.332 33.390 1.00 9.63  ? 73   GLU A CD  1 
ATOM   594 O  OE1 . GLU A 1 73 ? 4.761   -11.216 32.563 1.00 10.41 ? 73   GLU A OE1 1 
ATOM   595 O  OE2 . GLU A 1 73 ? 4.591   -10.525 34.634 1.00 10.68 ? 73   GLU A OE2 1 
ATOM   596 N  N   . PHE A 1 74 ? 3.623   -7.668  28.456 1.00 9.89  ? 74   PHE A N   1 
ATOM   597 C  CA  . PHE A 1 74 ? 3.963   -7.215  27.139 1.00 9.54  ? 74   PHE A CA  1 
ATOM   598 C  C   . PHE A 1 74 ? 3.385   -5.786  26.863 1.00 9.66  ? 74   PHE A C   1 
ATOM   599 O  O   . PHE A 1 74 ? 4.090   -4.958  26.327 1.00 11.48 ? 74   PHE A O   1 
ATOM   600 C  CB  . PHE A 1 74 ? 3.458   -8.238  26.135 1.00 10.39 ? 74   PHE A CB  1 
ATOM   601 C  CG  . PHE A 1 74 ? 3.413   -7.710  24.700 1.00 11.58 ? 74   PHE A CG  1 
ATOM   602 C  CD1 . PHE A 1 74 ? 4.541   -7.824  23.905 1.00 11.81 ? 74   PHE A CD1 1 
ATOM   603 C  CD2 . PHE A 1 74 ? 2.205   -7.257  24.200 1.00 13.52 ? 74   PHE A CD2 1 
ATOM   604 C  CE1 . PHE A 1 74 ? 4.502   -7.353  22.571 1.00 16.08 ? 74   PHE A CE1 1 
ATOM   605 C  CE2 . PHE A 1 74 ? 2.154   -6.787  22.866 1.00 15.79 ? 74   PHE A CE2 1 
ATOM   606 C  CZ  . PHE A 1 74 ? 3.267   -6.871  22.052 1.00 16.55 ? 74   PHE A CZ  1 
ATOM   607 N  N   . LEU A 1 75 ? 2.131   -5.608  27.274 1.00 12.75 ? 75   LEU A N   1 
ATOM   608 C  CA  . LEU A 1 75 ? 1.553   -4.231  27.098 1.00 11.10 ? 75   LEU A CA  1 
ATOM   609 C  C   . LEU A 1 75 ? 2.329   -3.247  27.909 1.00 11.11 ? 75   LEU A C   1 
ATOM   610 O  O   . LEU A 1 75 ? 2.535   -2.130  27.395 1.00 11.89 ? 75   LEU A O   1 
ATOM   611 C  CB  . LEU A 1 75 ? 0.108   -4.286  27.564 1.00 12.99 ? 75   LEU A CB  1 
ATOM   612 C  CG  . LEU A 1 75 ? -0.924  -4.952  26.631 1.00 15.37 ? 75   LEU A CG  1 
ATOM   613 C  CD1 . LEU A 1 75 ? -2.263  -4.884  27.405 1.00 15.44 ? 75   LEU A CD1 1 
ATOM   614 C  CD2 . LEU A 1 75 ? -0.978  -4.394  25.150 1.00 16.98 ? 75   LEU A CD2 1 
ATOM   615 N  N   . SER A 1 76 ? 2.821   -3.557  29.107 1.00 10.11 ? 76   SER A N   1 
ATOM   616 C  CA  . SER A 1 76 ? 3.634   -2.625  29.839 1.00 10.03 ? 76   SER A CA  1 
ATOM   617 C  C   . SER A 1 76 ? 4.872   -2.260  29.087 1.00 10.69 ? 76   SER A C   1 
ATOM   618 O  O   . SER A 1 76 ? 5.289   -1.108  29.034 1.00 11.92 ? 76   SER A O   1 
ATOM   619 C  CB  . SER A 1 76 ? 3.938   -3.250  31.222 1.00 13.30 ? 76   SER A CB  1 
ATOM   620 O  OG  . SER A 1 76 ? 4.589   -2.264  32.017 1.00 17.68 ? 76   SER A OG  1 
ATOM   621 N  N   . LEU A 1 77 ? 5.509   -3.272  28.501 1.00 10.89 ? 77   LEU A N   1 
ATOM   622 C  CA  . LEU A 1 77 ? 6.713   -2.969  27.734 1.00 10.39 ? 77   LEU A CA  1 
ATOM   623 C  C   . LEU A 1 77 ? 6.420   -2.090  26.485 1.00 9.35  ? 77   LEU A C   1 
ATOM   624 O  O   . LEU A 1 77 ? 7.153   -1.151  26.217 1.00 11.32 ? 77   LEU A O   1 
ATOM   625 C  CB  . LEU A 1 77 ? 7.342   -4.337  27.291 1.00 11.46 ? 77   LEU A CB  1 
ATOM   626 C  CG  . LEU A 1 77 ? 8.596   -4.248  26.354 1.00 13.06 ? 77   LEU A CG  1 
ATOM   627 C  CD1 . LEU A 1 77 ? 9.680   -3.425  27.054 1.00 15.37 ? 77   LEU A CD1 1 
ATOM   628 C  CD2 . LEU A 1 77 ? 9.090   -5.730  26.012 1.00 15.52 ? 77   LEU A CD2 1 
ATOM   629 N  N   . MET A 1 78 ? 5.331   -2.410  25.812 1.00 10.50 ? 78   MET A N   1 
ATOM   630 C  CA  . MET A 1 78 ? 4.939   -1.566  24.638 1.00 10.77 ? 78   MET A CA  1 
ATOM   631 C  C   . MET A 1 78 ? 4.687   -0.141  25.080 1.00 10.67 ? 78   MET A C   1 
ATOM   632 O  O   . MET A 1 78 ? 5.130   0.811   24.383 1.00 11.84 ? 78   MET A O   1 
ATOM   633 C  CB  . MET A 1 78 ? 3.725   -2.136  23.879 1.00 12.02 ? 78   MET A CB  1 
ATOM   634 C  CG  . MET A 1 78 ? 3.907   -3.529  23.250 1.00 11.17 ? 78   MET A CG  1 
ATOM   635 S  SD  . MET A 1 78 ? 5.269   -3.530  22.036 1.00 15.22 ? 78   MET A SD  1 
ATOM   636 C  CE  . MET A 1 78 ? 6.613   -4.296  22.998 1.00 13.63 ? 78   MET A CE  1 
ATOM   637 N  N   . GLY A 1 79 ? 4.067   -0.003  26.244 1.00 10.78 ? 79   GLY A N   1 
ATOM   638 C  CA  . GLY A 1 79 ? 3.954   1.359   26.823 1.00 10.08 ? 79   GLY A CA  1 
ATOM   639 C  C   . GLY A 1 79 ? 5.232   2.066   27.123 1.00 9.51  ? 79   GLY A C   1 
ATOM   640 O  O   . GLY A 1 79 ? 5.383   3.239   26.820 1.00 12.05 ? 79   GLY A O   1 
ATOM   641 N  N   . ASP A 1 80 ? 6.233   1.336   27.671 1.00 10.25 ? 80   ASP A N   1 
ATOM   642 C  CA  . ASP A 1 80 ? 7.516   1.962   27.886 1.00 10.72 ? 80   ASP A CA  1 
ATOM   643 C  C   . ASP A 1 80 ? 8.172   2.418   26.545 1.00 12.90 ? 80   ASP A C   1 
ATOM   644 O  O   . ASP A 1 80 ? 8.737   3.529   26.534 1.00 13.53 ? 80   ASP A O   1 
ATOM   645 C  CB  . ASP A 1 80 ? 8.472   0.906   28.562 1.00 11.77 ? 80   ASP A CB  1 
ATOM   646 C  CG  . ASP A 1 80 ? 8.069   0.555   29.906 1.00 14.99 ? 80   ASP A CG  1 
ATOM   647 O  OD1 . ASP A 1 80 ? 7.258   1.189   30.639 1.00 16.51 ? 80   ASP A OD1 1 
ATOM   648 O  OD2 . ASP A 1 80 ? 8.518   -0.589  30.280 1.00 16.08 ? 80   ASP A OD2 1 
ATOM   649 N  N   . ILE A 1 81 ? 8.049   1.627   25.497 1.00 13.33 ? 81   ILE A N   1 
ATOM   650 C  CA  . ILE A 1 81 ? 8.629   2.029   24.180 1.00 12.17 ? 81   ILE A CA  1 
ATOM   651 C  C   . ILE A 1 81 ? 7.883   3.267   23.674 1.00 14.63 ? 81   ILE A C   1 
ATOM   652 O  O   . ILE A 1 81 ? 8.506   4.264   23.306 1.00 14.75 ? 81   ILE A O   1 
ATOM   653 C  CB  . ILE A 1 81 ? 8.575   0.898   23.219 1.00 14.06 ? 81   ILE A CB  1 
ATOM   654 C  CG1 . ILE A 1 81 ? 9.436   -0.279  23.810 1.00 14.68 ? 81   ILE A CG1 1 
ATOM   655 C  CG2 . ILE A 1 81 ? 9.016   1.387   21.855 1.00 15.43 ? 81   ILE A CG2 1 
ATOM   656 C  CD1 . ILE A 1 81 ? 9.153   -1.549  23.097 1.00 16.45 ? 81   ILE A CD1 1 
ATOM   657 N  N   . ALA A 1 82 ? 6.568   3.194   23.722 1.00 12.45 ? 82   ALA A N   1 
ATOM   658 C  CA  . ALA A 1 82 ? 5.739   4.381   23.303 1.00 14.57 ? 82   ALA A CA  1 
ATOM   659 C  C   . ALA A 1 82 ? 6.048   5.599   24.077 1.00 14.84 ? 82   ALA A C   1 
ATOM   660 O  O   . ALA A 1 82 ? 6.105   6.672   23.462 1.00 16.41 ? 82   ALA A O   1 
ATOM   661 C  CB  . ALA A 1 82 ? 4.323   4.081   23.377 1.00 13.65 ? 82   ALA A CB  1 
ATOM   662 N  N   . THR A 1 83 ? 6.259   5.513   25.391 1.00 13.74 ? 83   THR A N   1 
ATOM   663 C  CA  . THR A 1 83 ? 6.622   6.680   26.263 1.00 15.70 ? 83   THR A CA  1 
ATOM   664 C  C   . THR A 1 83 ? 7.918   7.291   25.820 1.00 20.10 ? 83   THR A C   1 
ATOM   665 O  O   . THR A 1 83 ? 8.010   8.545   25.738 1.00 20.30 ? 83   THR A O   1 
ATOM   666 C  CB  . THR A 1 83 ? 6.668   6.235   27.699 1.00 15.61 ? 83   THR A CB  1 
ATOM   667 O  OG1 . THR A 1 83 ? 5.342   5.865   28.072 1.00 15.56 ? 83   THR A OG1 1 
ATOM   668 C  CG2 . THR A 1 83 ? 7.135   7.380   28.591 1.00 16.71 ? 83   THR A CG2 1 
ATOM   669 N  N   . ASP A 1 84 ? 8.890   6.456   25.471 1.00 18.70 ? 84   ASP A N   1 
ATOM   670 C  CA  . ASP A 1 84 ? 10.123  7.059   24.948 1.00 23.39 ? 84   ASP A CA  1 
ATOM   671 C  C   . ASP A 1 84 ? 9.852   7.793   23.625 1.00 24.11 ? 84   ASP A C   1 
ATOM   672 O  O   . ASP A 1 84 ? 10.376  8.895   23.414 1.00 24.33 ? 84   ASP A O   1 
ATOM   673 C  CB  . ASP A 1 84 ? 11.214  6.016   24.808 1.00 23.59 ? 84   ASP A CB  1 
ATOM   674 C  CG  . ASP A 1 84 ? 12.551  6.663   24.500 1.00 27.75 ? 84   ASP A CG  1 
ATOM   675 O  OD1 . ASP A 1 84 ? 13.111  7.239   25.457 1.00 35.17 ? 84   ASP A OD1 1 
ATOM   676 O  OD2 . ASP A 1 84 ? 12.963  6.628   23.326 1.00 31.02 ? 84   ASP A OD2 1 
ATOM   677 N  N   . TYR A 1 85 ? 9.017   7.264   22.747 1.00 22.65 ? 85   TYR A N   1 
ATOM   678 C  CA  . TYR A 1 85 ? 8.742   7.993   21.497 1.00 24.12 ? 85   TYR A CA  1 
ATOM   679 C  C   . TYR A 1 85 ? 7.923   9.277   21.732 1.00 25.49 ? 85   TYR A C   1 
ATOM   680 O  O   . TYR A 1 85 ? 8.096   10.293  20.997 1.00 26.34 ? 85   TYR A O   1 
ATOM   681 C  CB  . TYR A 1 85 ? 8.006   7.147   20.507 1.00 24.14 ? 85   TYR A CB  1 
ATOM   682 C  CG  . TYR A 1 85 ? 8.865   6.209   19.720 1.00 26.08 ? 85   TYR A CG  1 
ATOM   683 C  CD1 . TYR A 1 85 ? 8.987   4.871   20.095 1.00 25.28 ? 85   TYR A CD1 1 
ATOM   684 C  CD2 . TYR A 1 85 ? 9.535   6.640   18.608 1.00 28.56 ? 85   TYR A CD2 1 
ATOM   685 C  CE1 . TYR A 1 85 ? 9.814   3.971   19.347 1.00 28.21 ? 85   TYR A CE1 1 
ATOM   686 C  CE2 . TYR A 1 85 ? 10.351  5.754   17.860 1.00 28.25 ? 85   TYR A CE2 1 
ATOM   687 C  CZ  . TYR A 1 85 ? 10.470  4.441   18.228 1.00 31.11 ? 85   TYR A CZ  1 
ATOM   688 O  OH  . TYR A 1 85 ? 11.250  3.605   17.457 1.00 25.76 ? 85   TYR A OH  1 
ATOM   689 N  N   . HIS A 1 86 ? 7.020   9.236   22.699 1.00 23.39 ? 86   HIS A N   1 
ATOM   690 C  CA  . HIS A 1 86 ? 6.252   10.459  23.025 1.00 22.85 ? 86   HIS A CA  1 
ATOM   691 C  C   . HIS A 1 86 ? 7.191   11.534  23.520 1.00 25.90 ? 86   HIS A C   1 
ATOM   692 O  O   . HIS A 1 86 ? 7.075   12.704  23.061 1.00 25.56 ? 86   HIS A O   1 
ATOM   693 C  CB  . HIS A 1 86 ? 5.147   10.165  24.002 1.00 24.23 ? 86   HIS A CB  1 
ATOM   694 C  CG  . HIS A 1 86 ? 4.399   11.367  24.456 1.00 19.33 ? 86   HIS A CG  1 
ATOM   695 N  ND1 . HIS A 1 86 ? 4.485   11.875  25.726 1.00 26.55 ? 86   HIS A ND1 1 
ATOM   696 C  CD2 . HIS A 1 86 ? 3.565   12.186  23.772 1.00 27.08 ? 86   HIS A CD2 1 
ATOM   697 C  CE1 . HIS A 1 86 ? 3.727   12.959  25.818 1.00 25.72 ? 86   HIS A CE1 1 
ATOM   698 N  NE2 . HIS A 1 86 ? 3.108   13.121  24.663 1.00 22.46 ? 86   HIS A NE2 1 
ATOM   699 N  N   . LYS A 1 87 ? 8.136   11.166  24.386 1.00 27.31 ? 87   LYS A N   1 
ATOM   700 C  CA  . LYS A 1 87 ? 9.098   12.110  25.019 1.00 29.82 ? 87   LYS A CA  1 
ATOM   701 C  C   . LYS A 1 87 ? 10.027  12.770  24.024 1.00 33.15 ? 87   LYS A C   1 
ATOM   702 O  O   . LYS A 1 87 ? 10.184  14.026  24.033 1.00 34.26 ? 87   LYS A O   1 
ATOM   703 C  CB  . LYS A 1 87 ? 9.858   11.483  26.175 1.00 29.38 ? 87   LYS A CB  1 
ATOM   704 C  CG  . LYS A 1 87 ? 8.995   11.389  27.406 1.00 26.95 ? 87   LYS A CG  1 
ATOM   705 C  CD  . LYS A 1 87 ? 9.753   10.737  28.606 1.00 33.38 ? 87   LYS A CD  1 
ATOM   706 C  CE  . LYS A 1 87 ? 8.831   10.600  29.806 1.00 38.07 ? 87   LYS A CE  1 
ATOM   707 N  NZ  . LYS A 1 87 ? 9.371   9.638   30.847 1.00 44.44 ? 87   LYS A NZ  1 
ATOM   708 N  N   . LYS A 1 88 ? 10.551  11.966  23.115 1.00 35.97 ? 88   LYS A N   1 
ATOM   709 C  CA  . LYS A 1 88 ? 11.311  12.497  21.975 1.00 39.39 ? 88   LYS A CA  1 
ATOM   710 C  C   . LYS A 1 88 ? 10.488  13.319  20.923 1.00 40.09 ? 88   LYS A C   1 
ATOM   711 O  O   . LYS A 1 88 ? 11.035  14.228  20.307 1.00 40.78 ? 88   LYS A O   1 
ATOM   712 C  CB  . LYS A 1 88 ? 12.181  11.407  21.309 1.00 40.33 ? 88   LYS A CB  1 
ATOM   713 C  CG  . LYS A 1 88 ? 11.430  10.264  20.646 1.00 44.31 ? 88   LYS A CG  1 
ATOM   714 C  CD  . LYS A 1 88 ? 12.034  9.885   19.254 1.00 49.19 ? 88   LYS A CD  1 
ATOM   715 C  CE  . LYS A 1 88 ? 11.428  10.773  18.136 1.00 51.39 ? 88   LYS A CE  1 
ATOM   716 N  NZ  . LYS A 1 88 ? 10.776  9.990   17.010 1.00 54.34 ? 88   LYS A NZ  1 
ATOM   717 N  N   . SER A 1 89 ? 9.202   13.030  20.712 1.00 41.09 ? 89   SER A N   1 
ATOM   718 C  CA  . SER A 1 89 ? 8.377   13.908  19.842 1.00 42.01 ? 89   SER A CA  1 
ATOM   719 C  C   . SER A 1 89 ? 8.279   15.328  20.442 1.00 42.78 ? 89   SER A C   1 
ATOM   720 O  O   . SER A 1 89 ? 8.014   16.306  19.713 1.00 43.07 ? 89   SER A O   1 
ATOM   721 C  CB  . SER A 1 89 ? 6.974   13.336  19.560 1.00 41.64 ? 89   SER A CB  1 
ATOM   722 O  OG  . SER A 1 89 ? 6.128   13.527  20.675 1.00 40.21 ? 89   SER A OG  1 
ATOM   723 N  N   . HIS A 1 90 ? 8.524   15.423  21.749 1.00 43.97 ? 90   HIS A N   1 
ATOM   724 C  CA  . HIS A 1 90 ? 8.575   16.684  22.478 1.00 45.43 ? 90   HIS A CA  1 
ATOM   725 C  C   . HIS A 1 90 ? 10.014  17.145  22.749 1.00 46.35 ? 90   HIS A C   1 
ATOM   726 O  O   . HIS A 1 90 ? 10.293  17.787  23.772 1.00 47.32 ? 90   HIS A O   1 
ATOM   727 C  CB  . HIS A 1 90 ? 7.750   16.590  23.767 1.00 45.06 ? 90   HIS A CB  1 
ATOM   728 C  CG  . HIS A 1 90 ? 6.273   16.520  23.506 1.00 45.89 ? 90   HIS A CG  1 
ATOM   729 N  ND1 . HIS A 1 90 ? 5.529   17.621  23.115 1.00 45.30 ? 90   HIS A ND1 1 
ATOM   730 C  CD2 . HIS A 1 90 ? 5.417   15.474  23.509 1.00 43.50 ? 90   HIS A CD2 1 
ATOM   731 C  CE1 . HIS A 1 90 ? 4.274   17.256  22.914 1.00 46.16 ? 90   HIS A CE1 1 
ATOM   732 N  NE2 . HIS A 1 90 ? 4.179   15.962  23.164 1.00 42.72 ? 90   HIS A NE2 1 
ATOM   733 N  N   . GLY A 1 91 ? 10.908  16.805  21.817 1.00 47.40 ? 91   GLY A N   1 
ATOM   734 C  CA  . GLY A 1 91 ? 12.353  17.122  21.897 1.00 47.51 ? 91   GLY A CA  1 
ATOM   735 C  C   . GLY A 1 91 ? 13.201  16.575  23.059 1.00 47.26 ? 91   GLY A C   1 
ATOM   736 O  O   . GLY A 1 91 ? 14.307  17.107  23.297 1.00 46.59 ? 91   GLY A O   1 
ATOM   737 N  N   . ALA A 1 92 ? 12.720  15.549  23.798 1.00 46.47 ? 92   ALA A N   1 
ATOM   738 C  CA  . ALA A 1 92 ? 13.626  14.850  24.730 1.00 45.96 ? 92   ALA A CA  1 
ATOM   739 C  C   . ALA A 1 92 ? 14.647  14.084  23.898 1.00 46.20 ? 92   ALA A C   1 
ATOM   740 O  O   . ALA A 1 92 ? 14.417  13.820  22.685 1.00 45.15 ? 92   ALA A O   1 
ATOM   741 C  CB  . ALA A 1 92 ? 12.896  13.919  25.703 1.00 46.17 ? 92   ALA A CB  1 
ATOM   742 N  N   . ALA A 1 93 ? 15.787  13.773  24.518 1.00 46.76 ? 93   ALA A N   1 
ATOM   743 C  CA  . ALA A 1 93 ? 16.737  12.855  23.882 1.00 47.18 ? 93   ALA A CA  1 
ATOM   744 C  C   . ALA A 1 93 ? 16.103  11.449  23.792 1.00 47.63 ? 93   ALA A C   1 
ATOM   745 O  O   . ALA A 1 93 ? 15.344  11.023  24.714 1.00 48.83 ? 93   ALA A O   1 
ATOM   746 C  CB  . ALA A 1 93 ? 18.085  12.821  24.619 1.00 47.76 ? 93   ALA A CB  1 
ATOM   747 N  N   . PRO A 1 94 ? 16.335  10.777  22.638 1.00 47.60 ? 94   PRO A N   1 
ATOM   748 C  CA  . PRO A 1 94 ? 16.180  9.349   22.336 1.00 47.02 ? 94   PRO A CA  1 
ATOM   749 C  C   . PRO A 1 94 ? 16.662  8.484   23.514 1.00 45.72 ? 94   PRO A C   1 
ATOM   750 O  O   . PRO A 1 94 ? 17.713  8.763   24.112 1.00 44.84 ? 94   PRO A O   1 
ATOM   751 C  CB  . PRO A 1 94 ? 17.125  9.169   21.145 1.00 47.93 ? 94   PRO A CB  1 
ATOM   752 C  CG  . PRO A 1 94 ? 17.018  10.468  20.391 1.00 49.04 ? 94   PRO A CG  1 
ATOM   753 C  CD  . PRO A 1 94 ? 16.685  11.547  21.425 1.00 47.58 ? 94   PRO A CD  1 
ATOM   754 N  N   . CYS A 1 95 ? 15.876  7.477   23.877 1.00 44.35 ? 95   CYS A N   1 
ATOM   755 C  CA  . CYS A 1 95 ? 16.256  6.572   24.955 1.00 43.31 ? 95   CYS A CA  1 
ATOM   756 C  C   . CYS A 1 95 ? 16.541  7.268   26.310 1.00 44.16 ? 95   CYS A C   1 
ATOM   757 O  O   . CYS A 1 95 ? 17.593  7.059   26.906 1.00 44.04 ? 95   CYS A O   1 
ATOM   758 C  CB  . CYS A 1 95 ? 17.470  5.742   24.522 1.00 41.58 ? 95   CYS A CB  1 
ATOM   759 S  SG  . CYS A 1 95 ? 17.628  4.264   25.530 1.00 36.59 ? 95   CYS A SG  1 
ATOM   760 N  N   . SER A 1 96 ? 15.579  8.063   26.786 1.00 44.65 ? 96   SER A N   1 
ATOM   761 C  CA  . SER A 1 96 ? 15.688  8.821   28.062 1.00 45.19 ? 96   SER A CA  1 
ATOM   762 C  C   . SER A 1 96 ? 15.284  8.049   29.325 1.00 45.75 ? 96   SER A C   1 
ATOM   763 O  O   . SER A 1 96 ? 14.890  6.874   29.274 1.00 47.62 ? 96   SER A O   1 
ATOM   764 C  CB  . SER A 1 96 ? 14.890  10.157  27.989 1.00 45.18 ? 96   SER A CB  1 
ATOM   765 O  OG  . SER A 1 96 ? 13.519  9.957   27.685 1.00 40.78 ? 96   SER A OG  1 
HETATM 766 CA CA  . CA  B 2 .  ? 5.426   -12.898 34.177 1.00 10.43 ? 102  CA  A CA  1 
HETATM 767 ZN ZN  . ZN  C 3 .  ? 2.440   14.834  23.043 0.50 36.80 ? 103  ZN  A ZN  1 
HETATM 768 O  O   . HOH D 4 .  ? -10.412 2.025   7.543  1.00 62.50 ? 2001 HOH A O   1 
HETATM 769 O  O   . HOH D 4 .  ? -9.147  -4.083  8.009  1.00 50.99 ? 2002 HOH A O   1 
HETATM 770 O  O   . HOH D 4 .  ? 0.000   0.000   7.280  0.50 67.90 ? 2003 HOH A O   1 
HETATM 771 O  O   . HOH D 4 .  ? -5.506  -6.510  10.467 1.00 42.62 ? 2004 HOH A O   1 
HETATM 772 O  O   . HOH D 4 .  ? 3.137   -11.686 12.759 1.00 42.13 ? 2005 HOH A O   1 
HETATM 773 O  O   . HOH D 4 .  ? -1.402  -1.474  10.407 1.00 55.01 ? 2006 HOH A O   1 
HETATM 774 O  O   . HOH D 4 .  ? -0.379  1.316   8.356  0.50 44.01 ? 2007 HOH A O   1 
HETATM 775 O  O   . HOH D 4 .  ? -8.413  4.661   9.801  1.00 42.71 ? 2008 HOH A O   1 
HETATM 776 O  O   . HOH D 4 .  ? 4.435   -9.552  13.926 1.00 39.23 ? 2009 HOH A O   1 
HETATM 777 O  O   . HOH D 4 .  ? 12.425  6.384   32.939 1.00 55.52 ? 2010 HOH A O   1 
HETATM 778 O  O   . HOH D 4 .  ? -3.332  -5.569  11.637 1.00 29.25 ? 2011 HOH A O   1 
HETATM 779 O  O   . HOH D 4 .  ? -2.891  -1.933  8.328  1.00 48.61 ? 2012 HOH A O   1 
HETATM 780 O  O   . HOH D 4 .  ? 2.959   -25.294 28.500 1.00 62.88 ? 2013 HOH A O   1 
HETATM 781 O  O   . HOH D 4 .  ? -2.418  -19.898 23.909 1.00 44.43 ? 2014 HOH A O   1 
HETATM 782 O  O   . HOH D 4 .  ? 2.343   -3.263  35.938 1.00 30.96 ? 2015 HOH A O   1 
HETATM 783 O  O   . HOH D 4 .  ? 18.929  -14.771 24.853 1.00 21.18 ? 2016 HOH A O   1 
HETATM 784 O  O   . HOH D 4 .  ? 2.349   -7.746  13.730 1.00 27.07 ? 2017 HOH A O   1 
HETATM 785 O  O   . HOH D 4 .  ? 11.753  -15.912 18.869 1.00 25.79 ? 2018 HOH A O   1 
HETATM 786 O  O   . HOH D 4 .  ? 19.390  -15.648 18.376 1.00 27.12 ? 2019 HOH A O   1 
HETATM 787 O  O   . HOH D 4 .  ? 10.447  -15.566 15.431 1.00 66.26 ? 2020 HOH A O   1 
HETATM 788 O  O   . HOH D 4 .  ? -5.316  -11.214 15.839 1.00 45.42 ? 2021 HOH A O   1 
HETATM 789 O  O   . HOH D 4 .  ? 1.142   -14.004 14.883 1.00 33.68 ? 2022 HOH A O   1 
HETATM 790 O  O   . HOH D 4 .  ? 14.403  6.210   19.569 1.00 45.37 ? 2023 HOH A O   1 
HETATM 791 O  O   . HOH D 4 .  ? 18.091  7.919   15.990 1.00 58.72 ? 2024 HOH A O   1 
HETATM 792 O  O   . HOH D 4 .  ? 23.101  -0.292  16.515 1.00 28.18 ? 2025 HOH A O   1 
HETATM 793 O  O   . HOH D 4 .  ? 19.978  8.594   18.299 1.00 66.79 ? 2026 HOH A O   1 
HETATM 794 O  O   . HOH D 4 .  ? -2.660  -13.562 16.567 1.00 41.81 ? 2027 HOH A O   1 
HETATM 795 O  O   . HOH D 4 .  ? -0.331  -17.706 17.991 1.00 57.17 ? 2028 HOH A O   1 
HETATM 796 O  O   . HOH D 4 .  ? 5.413   -18.800 16.271 1.00 58.61 ? 2029 HOH A O   1 
HETATM 797 O  O   . HOH D 4 .  ? 7.618   -18.276 19.056 1.00 26.66 ? 2030 HOH A O   1 
HETATM 798 O  O   . HOH D 4 .  ? 12.656  -2.284  31.468 1.00 39.67 ? 2031 HOH A O   1 
HETATM 799 O  O   . HOH D 4 .  ? 13.687  3.015   30.975 1.00 51.66 ? 2032 HOH A O   1 
HETATM 800 O  O   . HOH D 4 .  ? 8.450   -17.722 23.963 1.00 17.80 ? 2033 HOH A O   1 
HETATM 801 O  O   . HOH D 4 .  ? 13.974  -19.704 24.135 1.00 26.44 ? 2034 HOH A O   1 
HETATM 802 O  O   . HOH D 4 .  ? 11.375  -2.287  37.646 1.00 54.40 ? 2035 HOH A O   1 
HETATM 803 O  O   . HOH D 4 .  ? 1.841   -9.346  38.685 1.00 22.48 ? 2036 HOH A O   1 
HETATM 804 O  O   . HOH D 4 .  ? 7.704   -0.348  37.278 1.00 44.92 ? 2037 HOH A O   1 
HETATM 805 O  O   . HOH D 4 .  ? 2.690   -5.303  33.969 1.00 18.11 ? 2038 HOH A O   1 
HETATM 806 O  O   . HOH D 4 .  ? 6.042   -24.481 22.072 1.00 49.74 ? 2039 HOH A O   1 
HETATM 807 O  O   . HOH D 4 .  ? 17.064  -16.567 40.136 1.00 29.88 ? 2040 HOH A O   1 
HETATM 808 O  O   . HOH D 4 .  ? -0.629  -26.883 21.866 1.00 45.52 ? 2041 HOH A O   1 
HETATM 809 O  O   . HOH D 4 .  ? 4.532   -23.777 26.708 1.00 40.33 ? 2042 HOH A O   1 
HETATM 810 O  O   . HOH D 4 .  ? 3.435   -21.680 31.288 1.00 32.57 ? 2043 HOH A O   1 
HETATM 811 O  O   . HOH D 4 .  ? -4.158  -9.681  29.586 1.00 25.28 ? 2044 HOH A O   1 
HETATM 812 O  O   . HOH D 4 .  ? -0.772  -6.461  36.615 1.00 53.39 ? 2045 HOH A O   1 
HETATM 813 O  O   . HOH D 4 .  ? -3.999  -18.755 26.700 1.00 54.43 ? 2046 HOH A O   1 
HETATM 814 O  O   . HOH D 4 .  ? -0.935  -19.117 22.504 1.00 42.13 ? 2047 HOH A O   1 
HETATM 815 O  O   . HOH D 4 .  ? 1.270   1.606   29.855 1.00 29.78 ? 2048 HOH A O   1 
HETATM 816 O  O   . HOH D 4 .  ? 0.188   -16.716 34.730 1.00 35.09 ? 2049 HOH A O   1 
HETATM 817 O  O   . HOH D 4 .  ? 3.761   -19.673 33.595 1.00 32.69 ? 2050 HOH A O   1 
HETATM 818 O  O   . HOH D 4 .  ? 14.053  -20.084 27.991 1.00 34.95 ? 2051 HOH A O   1 
HETATM 819 O  O   . HOH D 4 .  ? 3.136   5.083   31.507 1.00 25.06 ? 2052 HOH A O   1 
HETATM 820 O  O   . HOH D 4 .  ? 6.747   14.631  26.878 1.00 50.87 ? 2053 HOH A O   1 
HETATM 821 O  O   . HOH D 4 .  ? 17.644  -14.119 22.475 1.00 18.78 ? 2054 HOH A O   1 
HETATM 822 O  O   . HOH D 4 .  ? 13.670  -18.027 21.783 1.00 19.70 ? 2055 HOH A O   1 
HETATM 823 O  O   . HOH D 4 .  ? 18.552  4.302   33.550 0.50 37.17 ? 2056 HOH A O   1 
HETATM 824 O  O   . HOH D 4 .  ? 17.887  -13.038 18.363 1.00 21.74 ? 2057 HOH A O   1 
HETATM 825 O  O   . HOH D 4 .  ? 14.414  -16.401 19.734 1.00 20.45 ? 2058 HOH A O   1 
HETATM 826 O  O   . HOH D 4 .  ? 18.710  -12.055 21.080 1.00 21.45 ? 2059 HOH A O   1 
HETATM 827 O  O   . HOH D 4 .  ? 20.833  -9.747  24.454 1.00 34.71 ? 2060 HOH A O   1 
HETATM 828 O  O   . HOH D 4 .  ? 22.168  -7.489  23.301 1.00 41.55 ? 2061 HOH A O   1 
HETATM 829 O  O   . HOH D 4 .  ? 14.249  -5.983  11.673 1.00 20.12 ? 2062 HOH A O   1 
HETATM 830 O  O   . HOH D 4 .  ? 10.487  -6.639  11.726 1.00 55.43 ? 2063 HOH A O   1 
HETATM 831 O  O   . HOH D 4 .  ? 11.361  -12.992 14.744 1.00 30.81 ? 2064 HOH A O   1 
HETATM 832 O  O   . HOH D 4 .  ? 14.606  -14.683 14.671 1.00 27.48 ? 2065 HOH A O   1 
HETATM 833 O  O   . HOH D 4 .  ? 11.694  -10.583 12.344 1.00 31.48 ? 2066 HOH A O   1 
HETATM 834 O  O   . HOH D 4 .  ? 7.835   -5.028  13.158 1.00 24.11 ? 2067 HOH A O   1 
HETATM 835 O  O   . HOH D 4 .  ? 7.369   -9.408  14.315 1.00 28.20 ? 2068 HOH A O   1 
HETATM 836 O  O   . HOH D 4 .  ? 19.410  -1.930  16.781 1.00 19.35 ? 2069 HOH A O   1 
HETATM 837 O  O   . HOH D 4 .  ? 18.464  3.409   13.489 1.00 43.75 ? 2070 HOH A O   1 
HETATM 838 O  O   . HOH D 4 .  ? 14.198  5.480   16.603 1.00 47.95 ? 2071 HOH A O   1 
HETATM 839 O  O   . HOH D 4 .  ? 17.851  5.206   15.747 1.00 28.87 ? 2072 HOH A O   1 
HETATM 840 O  O   . HOH D 4 .  ? 21.668  0.445   13.935 1.00 27.96 ? 2073 HOH A O   1 
HETATM 841 O  O   . HOH D 4 .  ? 24.005  2.257   18.003 1.00 39.40 ? 2074 HOH A O   1 
HETATM 842 O  O   . HOH D 4 .  ? 21.410  8.075   21.091 1.00 34.15 ? 2075 HOH A O   1 
HETATM 843 O  O   . HOH D 4 .  ? 21.512  -1.485  18.352 1.00 29.22 ? 2076 HOH A O   1 
HETATM 844 O  O   . HOH D 4 .  ? 23.796  -2.917  23.975 1.00 47.09 ? 2077 HOH A O   1 
HETATM 845 O  O   . HOH D 4 .  ? 20.067  -0.901  23.821 1.00 27.25 ? 2078 HOH A O   1 
HETATM 846 O  O   . HOH D 4 .  ? 17.965  10.929  27.318 1.00 94.11 ? 2079 HOH A O   1 
HETATM 847 O  O   . HOH D 4 .  ? 22.359  -7.775  26.912 1.00 39.76 ? 2080 HOH A O   1 
HETATM 848 O  O   . HOH D 4 .  ? 21.363  -4.922  23.895 1.00 45.16 ? 2081 HOH A O   1 
HETATM 849 O  O   . HOH D 4 .  ? 19.788  -2.205  31.295 1.00 48.05 ? 2082 HOH A O   1 
HETATM 850 O  O   . HOH D 4 .  ? 12.043  2.945   28.744 1.00 34.49 ? 2083 HOH A O   1 
HETATM 851 O  O   . HOH D 4 .  ? 11.055  -1.194  29.501 1.00 23.64 ? 2084 HOH A O   1 
HETATM 852 O  O   . HOH D 4 .  ? 16.360  -9.083  30.045 1.00 20.93 ? 2085 HOH A O   1 
HETATM 853 O  O   . HOH D 4 .  ? 9.757   -6.633  38.022 1.00 29.64 ? 2086 HOH A O   1 
HETATM 854 O  O   . HOH D 4 .  ? 14.545  -13.970 34.224 1.00 21.06 ? 2087 HOH A O   1 
HETATM 855 O  O   . HOH D 4 .  ? 12.007  -10.536 37.520 1.00 24.79 ? 2088 HOH A O   1 
HETATM 856 O  O   . HOH D 4 .  ? 10.042  -3.885  37.921 1.00 38.30 ? 2089 HOH A O   1 
HETATM 857 O  O   . HOH D 4 .  ? 10.544  -0.782  34.150 1.00 40.38 ? 2090 HOH A O   1 
HETATM 858 O  O   . HOH D 4 .  ? 12.107  -13.115 35.806 1.00 15.48 ? 2091 HOH A O   1 
HETATM 859 O  O   . HOH D 4 .  ? 5.272   -5.429  33.466 1.00 13.56 ? 2092 HOH A O   1 
HETATM 860 O  O   . HOH D 4 .  ? 5.199   -1.043  34.967 1.00 40.96 ? 2093 HOH A O   1 
HETATM 861 O  O   . HOH D 4 .  ? 3.611   -10.296 41.285 1.00 57.28 ? 2094 HOH A O   1 
HETATM 862 O  O   . HOH D 4 .  ? 8.135   -7.934  41.048 1.00 35.78 ? 2095 HOH A O   1 
HETATM 863 O  O   . HOH D 4 .  ? 4.329   -5.921  41.065 1.00 48.95 ? 2096 HOH A O   1 
HETATM 864 O  O   . HOH D 4 .  ? 4.559   -16.126 40.192 1.00 15.93 ? 2097 HOH A O   1 
HETATM 865 O  O   . HOH D 4 .  ? 11.547  -16.749 39.173 1.00 18.20 ? 2098 HOH A O   1 
HETATM 866 O  O   . HOH D 4 .  ? 10.465  -10.549 45.051 1.00 46.25 ? 2099 HOH A O   1 
HETATM 867 O  O   . HOH D 4 .  ? 13.854  -13.158 40.030 1.00 23.65 ? 2100 HOH A O   1 
HETATM 868 O  O   . HOH D 4 .  ? 8.663   -20.576 33.348 1.00 43.73 ? 2101 HOH A O   1 
HETATM 869 O  O   . HOH D 4 .  ? 3.304   -13.888 33.604 1.00 13.72 ? 2102 HOH A O   1 
HETATM 870 O  O   . HOH D 4 .  ? 14.264  -15.997 32.289 1.00 22.09 ? 2103 HOH A O   1 
HETATM 871 O  O   . HOH D 4 .  ? 12.291  -17.036 30.384 1.00 17.78 ? 2104 HOH A O   1 
HETATM 872 O  O   . HOH D 4 .  ? 12.955  -14.773 37.998 1.00 18.74 ? 2105 HOH A O   1 
HETATM 873 O  O   . HOH D 4 .  ? 17.449  -16.810 36.966 1.00 34.57 ? 2106 HOH A O   1 
HETATM 874 O  O   . HOH D 4 .  ? 10.622  -19.365 31.407 1.00 47.29 ? 2107 HOH A O   1 
HETATM 875 O  O   . HOH D 4 .  ? 6.474   -19.475 26.873 1.00 31.06 ? 2108 HOH A O   1 
HETATM 876 O  O   . HOH D 4 .  ? -0.627  -14.795 33.072 1.00 26.33 ? 2109 HOH A O   1 
HETATM 877 O  O   . HOH D 4 .  ? -0.636  -13.987 28.060 1.00 19.71 ? 2110 HOH A O   1 
HETATM 878 O  O   . HOH D 4 .  ? -0.591  -3.979  31.329 1.00 22.29 ? 2111 HOH A O   1 
HETATM 879 O  O   . HOH D 4 .  ? 1.168   -7.498  34.832 1.00 16.49 ? 2112 HOH A O   1 
HETATM 880 O  O   . HOH D 4 .  ? -2.450  -10.751 33.709 1.00 36.68 ? 2113 HOH A O   1 
HETATM 881 O  O   . HOH D 4 .  ? -2.049  -11.146 30.930 1.00 15.96 ? 2114 HOH A O   1 
HETATM 882 O  O   . HOH D 4 .  ? 2.465   -9.550  36.018 1.00 19.62 ? 2115 HOH A O   1 
HETATM 883 O  O   . HOH D 4 .  ? 2.425   -0.690  32.954 1.00 37.77 ? 2116 HOH A O   1 
HETATM 884 O  O   . HOH D 4 .  ? 3.920   1.064   30.333 1.00 20.12 ? 2117 HOH A O   1 
HETATM 885 O  O   . HOH D 4 .  ? 9.881   4.637   28.599 1.00 29.37 ? 2118 HOH A O   1 
HETATM 886 O  O   . HOH D 4 .  ? 7.437   3.885   30.987 1.00 28.16 ? 2119 HOH A O   1 
HETATM 887 O  O   . HOH D 4 .  ? 6.623   0.419   33.039 1.00 31.82 ? 2120 HOH A O   1 
HETATM 888 O  O   . HOH D 4 .  ? 3.721   7.225   29.870 1.00 18.88 ? 2121 HOH A O   1 
HETATM 889 O  O   . HOH D 4 .  ? 4.807   3.588   30.040 1.00 23.79 ? 2122 HOH A O   1 
HETATM 890 O  O   . HOH D 4 .  ? 11.316  6.942   28.279 1.00 33.47 ? 2123 HOH A O   1 
HETATM 891 O  O   . HOH D 4 .  ? 5.388   10.799  27.996 1.00 30.01 ? 2124 HOH A O   1 
HETATM 892 O  O   . HOH D 4 .  ? 9.940   15.350  26.372 1.00 38.83 ? 2125 HOH A O   1 
HETATM 893 O  O   . HOH D 4 .  ? 17.280  16.757  22.376 0.50 34.76 ? 2126 HOH A O   1 
HETATM 894 O  O   . HOH D 4 .  ? 14.403  19.703  24.768 0.50 31.82 ? 2127 HOH A O   1 
HETATM 895 O  O   . HOH D 4 .  ? 18.202  5.423   29.161 1.00 59.94 ? 2128 HOH A O   1 
HETATM 896 O  O   . HOH D 4 .  ? 16.423  3.556   29.272 1.00 40.81 ? 2129 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  1  1  SER SER A . n 
A 1 2  ASN 2  2  2  ASN ASN A . n 
A 1 3  THR 3  3  3  THR THR A . n 
A 1 4  GLN 4  4  4  GLN GLN A . n 
A 1 5  ALA 5  5  5  ALA ALA A . n 
A 1 6  GLU 6  6  6  GLU GLU A . n 
A 1 7  ARG 7  7  7  ARG ARG A . n 
A 1 8  SER 8  8  8  SER SER A . n 
A 1 9  ILE 9  9  9  ILE ILE A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 GLY 11 11 11 GLY GLY A . n 
A 1 12 MET 12 12 12 MET MET A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 MET 15 15 15 MET MET A . n 
A 1 16 PHE 16 16 16 PHE PHE A . n 
A 1 17 HIS 17 17 17 HIS HIS A . n 
A 1 18 LYS 18 18 18 LYS LYS A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 THR 20 20 20 THR THR A . n 
A 1 21 ARG 21 21 21 ARG ARG A . n 
A 1 22 ARG 22 22 22 ARG ARG A . n 
A 1 23 ASP 23 23 23 ASP ASP A . n 
A 1 24 ASP 24 24 24 ASP ASP A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 ILE 26 26 26 ILE ILE A . n 
A 1 27 ASP 27 27 27 ASP ASP A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 PRO 29 29 29 PRO PRO A . n 
A 1 30 SER 30 30 30 SER SER A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
A 1 33 THR 33 33 33 THR THR A . n 
A 1 34 MET 34 34 34 MET MET A . n 
A 1 35 MET 35 35 35 MET MET A . n 
A 1 36 LYS 36 36 36 LYS LYS A . n 
A 1 37 GLU 37 37 37 GLU GLU A . n 
A 1 38 ASN 38 38 38 ASN ASN A . n 
A 1 39 PHE 39 39 39 PHE PHE A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 ASN 41 41 41 ASN ASN A . n 
A 1 42 PHE 42 42 42 PHE PHE A . n 
A 1 43 LEU 43 43 43 LEU LEU A . n 
A 1 44 SER 44 44 44 SER SER A . n 
A 1 45 ALA 45 45 45 ALA ALA A . n 
A 1 46 CYS 46 46 46 CYS CYS A . n 
A 1 47 ASP 47 47 47 ASP ASP A . n 
A 1 48 LYS 48 48 48 LYS LYS A . n 
A 1 49 LYS 49 49 49 LYS LYS A . n 
A 1 50 GLY 50 50 50 GLY GLY A . n 
A 1 51 THR 51 51 51 THR THR A . n 
A 1 52 ASN 52 52 52 ASN ASN A . n 
A 1 53 TYR 53 53 53 TYR TYR A . n 
A 1 54 LEU 54 54 54 LEU LEU A . n 
A 1 55 ALA 55 55 55 ALA ALA A . n 
A 1 56 GLY 56 56 56 GLY GLY A . n 
A 1 57 VAL 57 57 57 VAL VAL A . n 
A 1 58 PHE 58 58 58 PHE PHE A . n 
A 1 59 GLU 59 59 59 GLU GLU A . n 
A 1 60 LYS 60 60 60 LYS LYS A . n 
A 1 61 LYS 61 61 61 LYS LYS A . n 
A 1 62 ASP 62 62 62 ASP ASP A . n 
A 1 63 LYS 63 63 63 LYS LYS A . n 
A 1 64 ASN 64 64 64 ASN ASN A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 ASP 66 66 66 ASP ASP A . n 
A 1 67 LYS 67 67 67 LYS LYS A . n 
A 1 68 LYS 68 68 68 LYS LYS A . n 
A 1 69 ILE 69 69 69 ILE ILE A . n 
A 1 70 ASP 70 70 70 ASP ASP A . n 
A 1 71 PHE 71 71 71 PHE PHE A . n 
A 1 72 SER 72 72 72 SER SER A . n 
A 1 73 GLU 73 73 73 GLU GLU A . n 
A 1 74 PHE 74 74 74 PHE PHE A . n 
A 1 75 LEU 75 75 75 LEU LEU A . n 
A 1 76 SER 76 76 76 SER SER A . n 
A 1 77 LEU 77 77 77 LEU LEU A . n 
A 1 78 MET 78 78 78 MET MET A . n 
A 1 79 GLY 79 79 79 GLY GLY A . n 
A 1 80 ASP 80 80 80 ASP ASP A . n 
A 1 81 ILE 81 81 81 ILE ILE A . n 
A 1 82 ALA 82 82 82 ALA ALA A . n 
A 1 83 THR 83 83 83 THR THR A . n 
A 1 84 ASP 84 84 84 ASP ASP A . n 
A 1 85 TYR 85 85 85 TYR TYR A . n 
A 1 86 HIS 86 86 86 HIS HIS A . n 
A 1 87 LYS 87 87 87 LYS LYS A . n 
A 1 88 LYS 88 88 88 LYS LYS A . n 
A 1 89 SER 89 89 89 SER SER A . n 
A 1 90 HIS 90 90 90 HIS HIS A . n 
A 1 91 GLY 91 91 91 GLY GLY A . n 
A 1 92 ALA 92 92 92 ALA ALA A . n 
A 1 93 ALA 93 93 93 ALA ALA A . n 
A 1 94 PRO 94 94 94 PRO PRO A . n 
A 1 95 CYS 95 95 95 CYS CYS A . n 
A 1 96 SER 96 96 96 SER SER A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   102  102  CA  CA  A . 
C 3 ZN  1   103  103  ZN  ZN  A . 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
D 4 HOH 105 2105 2105 HOH HOH A . 
D 4 HOH 106 2106 2106 HOH HOH A . 
D 4 HOH 107 2107 2107 HOH HOH A . 
D 4 HOH 108 2108 2108 HOH HOH A . 
D 4 HOH 109 2109 2109 HOH HOH A . 
D 4 HOH 110 2110 2110 HOH HOH A . 
D 4 HOH 111 2111 2111 HOH HOH A . 
D 4 HOH 112 2112 2112 HOH HOH A . 
D 4 HOH 113 2113 2113 HOH HOH A . 
D 4 HOH 114 2114 2114 HOH HOH A . 
D 4 HOH 115 2115 2115 HOH HOH A . 
D 4 HOH 116 2116 2116 HOH HOH A . 
D 4 HOH 117 2117 2117 HOH HOH A . 
D 4 HOH 118 2118 2118 HOH HOH A . 
D 4 HOH 119 2119 2119 HOH HOH A . 
D 4 HOH 120 2120 2120 HOH HOH A . 
D 4 HOH 121 2121 2121 HOH HOH A . 
D 4 HOH 122 2122 2122 HOH HOH A . 
D 4 HOH 123 2123 2123 HOH HOH A . 
D 4 HOH 124 2124 2124 HOH HOH A . 
D 4 HOH 125 2125 2125 HOH HOH A . 
D 4 HOH 126 2126 2126 HOH HOH A . 
D 4 HOH 127 2127 2127 HOH HOH A . 
D 4 HOH 128 2128 2128 HOH HOH A . 
D 4 HOH 129 2129 2129 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2850   ? 
1 MORE         -128.9 ? 
1 'SSA (A^2)'  9950   ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 10_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2003 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 66 ? A ASP 66   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 O   ? A LYS 68 ? A LYS 68   ? 1_555  78.3  ? 
2  OD1 ? A ASP 66 ? A ASP 66   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OD1 ? A ASP 62 ? A ASP 62   ? 1_555  82.4  ? 
3  O   ? A LYS 68 ? A LYS 68   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OD1 ? A ASP 62 ? A ASP 62   ? 1_555  84.6  ? 
4  OD1 ? A ASP 66 ? A ASP 66   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OD1 ? A ASN 64 ? A ASN 64   ? 1_555  80.0  ? 
5  O   ? A LYS 68 ? A LYS 68   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OD1 ? A ASN 64 ? A ASN 64   ? 1_555  155.8 ? 
6  OD1 ? A ASP 62 ? A ASP 62   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OD1 ? A ASN 64 ? A ASN 64   ? 1_555  82.0  ? 
7  OD1 ? A ASP 66 ? A ASP 66   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 O   ? D HOH .  ? A HOH 2102 ? 1_555  80.3  ? 
8  O   ? A LYS 68 ? A LYS 68   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 O   ? D HOH .  ? A HOH 2102 ? 1_555  99.4  ? 
9  OD1 ? A ASP 62 ? A ASP 62   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 O   ? D HOH .  ? A HOH 2102 ? 1_555  161.0 ? 
10 OD1 ? A ASN 64 ? A ASN 64   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 O   ? D HOH .  ? A HOH 2102 ? 1_555  87.5  ? 
11 OD1 ? A ASP 66 ? A ASP 66   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73   ? 1_555  148.9 ? 
12 O   ? A LYS 68 ? A LYS 68   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73   ? 1_555  78.5  ? 
13 OD1 ? A ASP 62 ? A ASP 62   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73   ? 1_555  115.6 ? 
14 OD1 ? A ASN 64 ? A ASN 64   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73   ? 1_555  125.6 ? 
15 O   ? D HOH .  ? A HOH 2102 ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73   ? 1_555  83.4  ? 
16 OD1 ? A ASP 66 ? A ASP 66   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73   ? 1_555  156.6 ? 
17 O   ? A LYS 68 ? A LYS 68   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73   ? 1_555  124.7 ? 
18 OD1 ? A ASP 62 ? A ASP 62   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73   ? 1_555  95.0  ? 
19 OD1 ? A ASN 64 ? A ASN 64   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73   ? 1_555  76.6  ? 
20 O   ? D HOH .  ? A HOH 2102 ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73   ? 1_555  97.8  ? 
21 OE1 ? A GLU 73 ? A GLU 73   ? 1_555  CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73   ? 1_555  52.1  ? 
22 NE2 ? A HIS 90 ? A HIS 90   ? 1_555  ZN ? C ZN . ? A ZN 103 ? 1_555 OD1 ? A ASP 24 ? A ASP 24   ? 10_555 102.3 ? 
23 NE2 ? A HIS 90 ? A HIS 90   ? 1_555  ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 86 ? A HIS 86   ? 1_555  96.5  ? 
24 OD1 ? A ASP 24 ? A ASP 24   ? 10_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 86 ? A HIS 86   ? 1_555  115.3 ? 
25 NE2 ? A HIS 90 ? A HIS 90   ? 1_555  ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 17 ? A HIS 17   ? 10_555 103.8 ? 
26 OD1 ? A ASP 24 ? A ASP 24   ? 10_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 17 ? A HIS 17   ? 10_555 107.2 ? 
27 NE2 ? A HIS 86 ? A HIS 86   ? 1_555  ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 17 ? A HIS 17   ? 10_555 127.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-03 
2 'Structure model' 1 1 2011-06-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement       5.5.0088 ? 1 
iMOSFLM 'data reduction' .        ? 2 
SCALA   'data scaling'   .        ? 3 
PHASER  phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2WND 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, ASP  57 TO GLY
ENGINEERED RESIDUE IN CHAIN A, LEU  79 TO MET
ENGINEERED RESIDUE IN CHAIN A, GLN  89 TO LYS
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'E28D IS A NATURAL VARIANT' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 2035 ? ? O A HOH 2089 ? ? 2.10 
2 1 O A HOH 2014 ? ? O A HOH 2047 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CA A ALA 5 ? ? CB  A ALA 5 ? ? 1.663 1.520 0.143  0.021 N 
2 1 CD A GLU 6 ? ? OE2 A GLU 6 ? ? 1.172 1.252 -0.080 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 27 ? ? CG A ASP 27 ? ? OD1 A ASP 27 ? ? 125.46 118.30 7.16  0.90 N 
2 1 CB A ASP 27 ? ? CG A ASP 27 ? ? OD2 A ASP 27 ? ? 109.80 118.30 -8.50 0.90 N 
3 1 CB A ASP 80 ? ? CG A ASP 80 ? ? OD1 A ASP 80 ? ? 126.59 118.30 8.29  0.90 N 
4 1 C  A ALA 93 ? ? N  A PRO 94 ? ? CA  A PRO 94 ? ? 129.75 119.30 10.45 1.50 Y 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ARG 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     21 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -101.08 
_pdbx_validate_torsion.psi             -163.29 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2056 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.97 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 'ZINC ION'    ZN  
4 water         HOH 
#