data_2WOR
# 
_entry.id   2WOR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WOR         
PDBE  EBI-40540    
WWPDB D_1290040540 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2WND unspecified 'STRUCTURE OF AN S100A7 TRIPLE MUTANT'                                
PDB 1PSR unspecified 'HUMAN PSORIASIN (S100A7)'                                            
PDB 3PSR unspecified 'HUMAN PSORIASIN (S100A7) CA2+ BOUND FORM (CRYSTAL FORM I)'           
PDB 2PSR unspecified 'HUMAN PSORIASIN (S100A7) CA2+ AND ZN2+ BOUND FORM (CRYSTAL FORM II)' 
PDB 2WOS unspecified 'STRUCTURE OF HUMAN S100A7 IN COMPLEX WITH 2,6 ANS'                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WOR 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-27 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leon, R.'        1 
'Hof, F.'         2 
'Boulanger, M.J.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Identification and Characterization of Binding Sites on S100A7, a Participant in Cancer and Inflammation Pathways.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            48 
_citation.page_first                10591 
_citation.page_last                 ? 
_citation.year                      2009 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19810752 
_citation.pdbx_database_id_DOI      10.1021/BI901330G 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Leon, R.'        1  
primary 'Murray, J.I.'    2  
primary 'Cragg, G.'       3  
primary 'Farnell, B.'     4  
primary 'West, N.R.'      5  
primary 'Pace, T.C.'      6  
primary 'Watson, P.H.'    7  
primary 'Bohne, C.'       8  
primary 'Boulanger, M.J.' 9  
primary 'Hof, F.'         10 
# 
_cell.entry_id           2WOR 
_cell.length_a           51.660 
_cell.length_b           51.660 
_cell.length_c           117.240 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WOR 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN S100-A7'                   11343.784 1  ? ? 'RESIDUES 2-101' '1,8 ANS' 
2 non-polymer syn 'CALCIUM ION'                       40.078    1  ? ? ?                ?         
3 non-polymer syn '8-ANILINO-1-NAPHTHALENE SULFONATE' 299.344   1  ? ? ?                ?         
4 non-polymer syn 'ZINC ION'                          65.409    1  ? ? ?                ?         
5 water       nat water                               18.015    96 ? ? ?                ?         
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CALCIUM-BINDING PROTEIN A7, PSORIASIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGD
IATDYHKQSHGAAPCSGGSQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGD
IATDYHKQSHGAAPCSGGSQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   THR n 
1 4   GLN n 
1 5   ALA n 
1 6   GLU n 
1 7   ARG n 
1 8   SER n 
1 9   ILE n 
1 10  ILE n 
1 11  GLY n 
1 12  MET n 
1 13  ILE n 
1 14  ASP n 
1 15  MET n 
1 16  PHE n 
1 17  HIS n 
1 18  LYS n 
1 19  TYR n 
1 20  THR n 
1 21  ARG n 
1 22  ARG n 
1 23  ASP n 
1 24  ASP n 
1 25  LYS n 
1 26  ILE n 
1 27  ASP n 
1 28  LYS n 
1 29  PRO n 
1 30  SER n 
1 31  LEU n 
1 32  LEU n 
1 33  THR n 
1 34  MET n 
1 35  MET n 
1 36  LYS n 
1 37  GLU n 
1 38  ASN n 
1 39  PHE n 
1 40  PRO n 
1 41  ASN n 
1 42  PHE n 
1 43  LEU n 
1 44  SER n 
1 45  ALA n 
1 46  CYS n 
1 47  ASP n 
1 48  LYS n 
1 49  LYS n 
1 50  GLY n 
1 51  THR n 
1 52  ASN n 
1 53  TYR n 
1 54  LEU n 
1 55  ALA n 
1 56  ASP n 
1 57  VAL n 
1 58  PHE n 
1 59  GLU n 
1 60  LYS n 
1 61  LYS n 
1 62  ASP n 
1 63  LYS n 
1 64  ASN n 
1 65  GLU n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  ILE n 
1 70  ASP n 
1 71  PHE n 
1 72  SER n 
1 73  GLU n 
1 74  PHE n 
1 75  LEU n 
1 76  SER n 
1 77  LEU n 
1 78  LEU n 
1 79  GLY n 
1 80  ASP n 
1 81  ILE n 
1 82  ALA n 
1 83  THR n 
1 84  ASP n 
1 85  TYR n 
1 86  HIS n 
1 87  LYS n 
1 88  GLN n 
1 89  SER n 
1 90  HIS n 
1 91  GLY n 
1 92  ALA n 
1 93  ALA n 
1 94  PRO n 
1 95  CYS n 
1 96  SER n 
1 97  GLY n 
1 98  GLY n 
1 99  SER n 
1 100 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET28A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10A7_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P31151 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2WOR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 100 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P31151 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  101 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       100 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2WOR 
_struct_ref_seq_dif.mon_id                       ASP 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      27 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P31151 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          28 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            27 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2AN non-polymer         . '8-ANILINO-1-NAPHTHALENE SULFONATE' ? 'C16 H13 N O3 S' 299.344 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                       ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                          ? 'Zn 2'           65.409  
# 
_exptl.entry_id          2WOR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.15 
_exptl_crystal.density_percent_sol   60.60 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2008-04-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             0.976 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WOR 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             47.21 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   18214 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        34.10 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              26.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.74 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.35 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    9.30 
_reflns_shell.pdbx_redundancy        22.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WOR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     17284 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.27 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    99.90 
_refine.ls_R_factor_obs                          0.18800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18673 
_refine.ls_R_factor_R_free                       0.21211 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  930 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               15.814 
_refine.aniso_B[1][1]                            0.28 
_refine.aniso_B[2][2]                            0.28 
_refine.aniso_B[3][3]                            -0.56 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2PSR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.082 
_refine.pdbx_overall_ESU_R_Free                  0.083 
_refine.overall_SU_ML                            0.042 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.191 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        769 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             96 
_refine_hist.number_atoms_total               888 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        47.27 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.033  0.022  ? 807  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.563  1.994  ? 1082 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.596  5.000  ? 95   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.043 25.263 ? 38   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.594 15.000 ? 153  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.591 15.000 ? 3    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.170  0.200  ? 112  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.018  0.021  ? 602  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.502  1.500  ? 480  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.502  2.000  ? 772  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.789  3.000  ? 327  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.046  4.500  ? 310  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.number_reflns_R_work             1232 
_refine_ls_shell.R_factor_R_work                  0.214 
_refine_ls_shell.percent_reflns_obs               99.92 
_refine_ls_shell.R_factor_R_free                  0.273 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             77 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2WOR 
_struct.title                     'co-structure of S100A7 with 1,8 ANS' 
_struct.pdbx_descriptor           'PROTEIN S100-A7' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WOR 
_struct_keywords.pdbx_keywords   'CALCIUM-BINDING PROTEIN' 
_struct_keywords.text            'CALCIUM-BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 3  ? ILE A 10 ? THR A 3  ILE A 10 1 ? 8  
HELX_P HELX_P2 2 MET A 12 ? THR A 20 ? MET A 12 THR A 20 1 ? 9  
HELX_P HELX_P3 3 ASP A 27 ? PHE A 39 ? ASP A 27 PHE A 39 1 ? 13 
HELX_P HELX_P4 4 PHE A 39 ? LYS A 49 ? PHE A 39 LYS A 49 1 ? 11 
HELX_P HELX_P5 5 ASP A 56 ? ASP A 62 ? ASP A 56 ASP A 62 1 ? 7  
HELX_P HELX_P6 6 ASP A 70 ? LEU A 78 ? ASP A 70 LEU A 78 1 ? 9  
HELX_P HELX_P7 7 ASP A 80 ? HIS A 90 ? ASP A 80 HIS A 90 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 95 SG  ? ? A CYS 46   A CYS 95   1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc1  metalc ? ? B CA  .  CA ? ? ? 1_555 A GLU 73 OE1 ? ? A CA  1097 A GLU 73   1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc2  metalc ? ? B CA  .  CA ? ? ? 1_555 A GLU 73 OE2 ? ? A CA  1097 A GLU 73   1_555 ? ? ? ? ? ? ? 2.530 ? 
metalc3  metalc ? ? B CA  .  CA ? ? ? 1_555 A ASN 64 OD1 ? ? A CA  1097 A ASN 64   1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc4  metalc ? ? B CA  .  CA ? ? ? 1_555 A ASP 62 OD1 ? ? A CA  1097 A ASP 62   1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc5  metalc ? ? B CA  .  CA ? ? ? 1_555 A LYS 68 O   ? ? A CA  1097 A LYS 68   1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc6  metalc ? ? B CA  .  CA ? ? ? 1_555 E HOH .  O   ? ? A CA  1097 A HOH 2074 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc7  metalc ? ? B CA  .  CA ? ? ? 1_555 A ASP 66 OD1 ? ? A CA  1097 A ASP 66   1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc8  metalc ? ? D ZN  .  ZN ? ? ? 1_555 A HIS 86 NE2 ? ? A ZN  1099 A HIS 86   1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc9  metalc ? ? D ZN  .  ZN ? ? ? 1_555 A HIS 90 NE2 ? ? A ZN  1099 A HIS 90   1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc10 metalc ? ? D ZN  .  ZN ? ? ? 1_555 A ASP 24 OD1 ? ? A ZN  1099 A ASP 24   7_555 ? ? ? ? ? ? ? 2.009 ? 
metalc11 metalc ? ? D ZN  .  ZN ? ? ? 1_555 A HIS 17 NE2 ? ? A ZN  1099 A HIS 17   7_555 ? ? ? ? ? ? ? 2.032 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1097'  
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE 2AN A 1098' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1099'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 62 ? ASP A 62   . ? 1_555 ? 
2  AC1 6 ASN A 64 ? ASN A 64   . ? 1_555 ? 
3  AC1 6 ASP A 66 ? ASP A 66   . ? 1_555 ? 
4  AC1 6 LYS A 68 ? LYS A 68   . ? 1_555 ? 
5  AC1 6 GLU A 73 ? GLU A 73   . ? 1_555 ? 
6  AC1 6 HOH E .  ? HOH A 2074 . ? 1_555 ? 
7  AC2 8 GLN A 4  ? GLN A 4    . ? 7_555 ? 
8  AC2 8 ARG A 7  ? ARG A 7    . ? 1_555 ? 
9  AC2 8 SER A 8  ? SER A 8    . ? 7_555 ? 
10 AC2 8 GLY A 11 ? GLY A 11   . ? 1_555 ? 
11 AC2 8 ASP A 14 ? ASP A 14   . ? 1_555 ? 
12 AC2 8 MET A 15 ? MET A 15   . ? 1_555 ? 
13 AC2 8 GLU A 65 ? GLU A 65   . ? 6_455 ? 
14 AC2 8 LYS A 67 ? LYS A 67   . ? 6_455 ? 
15 AC3 4 HIS A 17 ? HIS A 17   . ? 7_555 ? 
16 AC3 4 ASP A 24 ? ASP A 24   . ? 7_555 ? 
17 AC3 4 HIS A 86 ? HIS A 86   . ? 1_555 ? 
18 AC3 4 HIS A 90 ? HIS A 90   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2WOR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WOR 
_atom_sites.fract_transf_matrix[1][1]   0.019357 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019357 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008530 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . SER A 1 1  ? -8.019 7.783  -4.559  1.00 31.51 ? 1    SER A N   1 
ATOM   2   C  CA  . SER A 1 1  ? -7.713 8.618  -5.759  1.00 26.96 ? 1    SER A CA  1 
ATOM   3   C  C   . SER A 1 1  ? -6.194 9.027  -5.852  1.00 21.68 ? 1    SER A C   1 
ATOM   4   O  O   . SER A 1 1  ? -5.621 9.041  -6.949  1.00 20.50 ? 1    SER A O   1 
ATOM   5   C  CB  . SER A 1 1  ? -8.700 9.779  -5.895  1.00 32.21 ? 1    SER A CB  1 
ATOM   6   O  OG  . SER A 1 1  ? -8.359 10.652 -6.981  1.00 36.58 ? 1    SER A OG  1 
ATOM   7   N  N   . ASN A 1 2  ? -5.530 9.209  -4.723  1.00 18.68 ? 2    ASN A N   1 
ATOM   8   C  CA  . ASN A 1 2  ? -4.058 9.434  -4.800  1.00 15.15 ? 2    ASN A CA  1 
ATOM   9   C  C   . ASN A 1 2  ? -3.315 8.256  -5.410  1.00 15.60 ? 2    ASN A C   1 
ATOM   10  O  O   . ASN A 1 2  ? -3.641 7.034  -5.199  1.00 17.97 ? 2    ASN A O   1 
ATOM   11  C  CB  . ASN A 1 2  ? -3.522 9.762  -3.426  1.00 13.50 ? 2    ASN A CB  1 
ATOM   12  C  CG  . ASN A 1 2  ? -3.891 11.151 -2.967  1.00 16.47 ? 2    ASN A CG  1 
ATOM   13  O  OD1 . ASN A 1 2  ? -4.051 12.105 -3.762  1.00 21.33 ? 2    ASN A OD1 1 
ATOM   14  N  ND2 . ASN A 1 2  ? -3.967 11.302 -1.621  1.00 21.07 ? 2    ASN A ND2 1 
ATOM   15  N  N   . THR A 1 3  ? -2.248 8.572  -6.167  1.00 11.92 ? 3    THR A N   1 
ATOM   16  C  CA  . THR A 1 3  ? -1.404 7.514  -6.661  1.00 11.44 ? 3    THR A CA  1 
ATOM   17  C  C   . THR A 1 3  ? -0.492 6.934  -5.576  1.00 11.60 ? 3    THR A C   1 
ATOM   18  O  O   . THR A 1 3  ? -0.437 7.501  -4.462  1.00 10.82 ? 3    THR A O   1 
ATOM   19  C  CB  . THR A 1 3  ? -0.399 8.080  -7.720  1.00 10.71 ? 3    THR A CB  1 
ATOM   20  O  OG1 . THR A 1 3  ? 0.410  9.090  -7.098  1.00 10.42 ? 3    THR A OG1 1 
ATOM   21  C  CG2 . THR A 1 3  ? -1.202 8.748  -8.881  1.00 13.52 ? 3    THR A CG2 1 
ATOM   22  N  N   . GLN A 1 4  ? 0.262  5.877  -5.910  1.00 10.10 ? 4    GLN A N   1 
ATOM   23  C  CA  . GLN A 1 4  ? 1.197  5.314  -4.889  1.00 11.52 ? 4    GLN A CA  1 
ATOM   24  C  C   . GLN A 1 4  ? 2.224  6.369  -4.516  1.00 9.14  ? 4    GLN A C   1 
ATOM   25  O  O   . GLN A 1 4  ? 2.594  6.470  -3.353  1.00 9.03  ? 4    GLN A O   1 
ATOM   26  C  CB  . GLN A 1 4  ? 1.955  4.046  -5.297  1.00 12.96 ? 4    GLN A CB  1 
ATOM   27  C  CG  . GLN A 1 4  ? 0.994  2.953  -5.532  1.00 14.80 ? 4    GLN A CG  1 
ATOM   28  C  CD  . GLN A 1 4  ? 1.667  1.731  -6.109  1.00 20.92 ? 4    GLN A CD  1 
ATOM   29  O  OE1 . GLN A 1 4  ? 2.024  1.706  -7.346  1.00 20.66 ? 4    GLN A OE1 1 
ATOM   30  N  NE2 . GLN A 1 4  ? 1.805  0.688  -5.247  1.00 21.11 ? 4    GLN A NE2 1 
ATOM   31  N  N   . ALA A 1 5  ? 2.683  7.142  -5.507  1.00 8.96  ? 5    ALA A N   1 
ATOM   32  C  CA  . ALA A 1 5  ? 3.702  8.191  -5.164  1.00 9.16  ? 5    ALA A CA  1 
ATOM   33  C  C   . ALA A 1 5  ? 3.145  9.295  -4.298  1.00 8.38  ? 5    ALA A C   1 
ATOM   34  O  O   . ALA A 1 5  ? 3.773  9.653  -3.303  1.00 8.36  ? 5    ALA A O   1 
ATOM   35  C  CB  . ALA A 1 5  ? 4.282  8.799  -6.459  1.00 9.78  ? 5    ALA A CB  1 
ATOM   36  N  N   . GLU A 1 6  ? 1.906  9.736  -4.570  1.00 7.51  ? 6    GLU A N   1 
ATOM   37  C  CA  . GLU A 1 6  ? 1.331  10.809 -3.733  1.00 7.86  ? 6    GLU A CA  1 
ATOM   38  C  C   . GLU A 1 6  ? 1.066  10.227 -2.330  1.00 8.39  ? 6    GLU A C   1 
ATOM   39  O  O   . GLU A 1 6  ? 1.355  10.914 -1.346  1.00 10.39 ? 6    GLU A O   1 
ATOM   40  C  CB  . GLU A 1 6  ? -0.025 11.218 -4.343  1.00 8.22  ? 6    GLU A CB  1 
ATOM   41  C  CG  . GLU A 1 6  ? 0.343  12.073 -5.635  1.00 9.09  ? 6    GLU A CG  1 
ATOM   42  C  CD  . GLU A 1 6  ? -0.961 12.240 -6.531  1.00 10.36 ? 6    GLU A CD  1 
ATOM   43  O  OE1 . GLU A 1 6  ? -1.949 11.418 -6.442  1.00 14.17 ? 6    GLU A OE1 1 
ATOM   44  O  OE2 . GLU A 1 6  ? -0.949 13.255 -7.305  1.00 9.98  ? 6    GLU A OE2 1 
ATOM   45  N  N   . ARG A 1 7  ? 0.540  8.972  -2.277  1.00 8.52  ? 7    ARG A N   1 
ATOM   46  C  CA  . ARG A 1 7  ? 0.289  8.347  -0.940  1.00 9.54  ? 7    ARG A CA  1 
ATOM   47  C  C   . ARG A 1 7  ? 1.561  8.187  -0.139  1.00 11.40 ? 7    ARG A C   1 
ATOM   48  O  O   . ARG A 1 7  ? 1.541  8.385  1.103   1.00 12.88 ? 7    ARG A O   1 
ATOM   49  C  CB  . ARG A 1 7  ? -0.388 6.980  -1.141  1.00 10.74 ? 7    ARG A CB  1 
ATOM   50  C  CG  . ARG A 1 7  ? -1.881 7.112  -1.559  1.00 15.74 ? 7    ARG A CG  1 
ATOM   51  C  CD  . ARG A 1 7  ? -2.389 5.623  -1.402  1.00 28.83 ? 7    ARG A CD  1 
ATOM   52  N  NE  . ARG A 1 7  ? -2.090 4.869  -2.606  1.00 40.51 ? 7    ARG A NE  1 
ATOM   53  C  CZ  . ARG A 1 7  ? -3.013 4.605  -3.523  1.00 46.96 ? 7    ARG A CZ  1 
ATOM   54  N  NH1 . ARG A 1 7  ? -4.275 5.005  -3.285  1.00 50.55 ? 7    ARG A NH1 1 
ATOM   55  N  NH2 . ARG A 1 7  ? -2.704 3.932  -4.636  1.00 47.81 ? 7    ARG A NH2 1 
ATOM   56  N  N   . SER A 1 8  ? 2.701  7.921  -0.809  1.00 9.63  ? 8    SER A N   1 
ATOM   57  C  CA  . SER A 1 8  ? 3.983  7.776  -0.090  1.00 10.17 ? 8    SER A CA  1 
ATOM   58  C  C   . SER A 1 8  ? 4.405  9.081  0.492   1.00 10.51 ? 8    SER A C   1 
ATOM   59  O  O   . SER A 1 8  ? 4.840  9.112  1.637   1.00 13.09 ? 8    SER A O   1 
ATOM   60  C  CB  . SER A 1 8  ? 5.070  7.304  -1.081  1.00 11.99 ? 8    SER A CB  1 
ATOM   61  O  OG  . SER A 1 8  ? 4.767  5.988  -1.457  1.00 15.29 ? 8    SER A OG  1 
ATOM   62  N  N   . ILE A 1 9  ? 4.292  10.167 -0.279  1.00 8.81  ? 9    ILE A N   1 
ATOM   63  C  CA  . ILE A 1 9  ? 4.679  11.498 0.295   1.00 10.39 ? 9    ILE A CA  1 
ATOM   64  C  C   . ILE A 1 9  ? 3.788  11.899 1.453   1.00 9.19  ? 9    ILE A C   1 
ATOM   65  O  O   . ILE A 1 9  ? 4.301  12.324 2.543   1.00 9.98  ? 9    ILE A O   1 
ATOM   66  C  CB  . ILE A 1 9  ? 4.662  12.536 -0.826  1.00 12.35 ? 9    ILE A CB  1 
ATOM   67  C  CG1 . ILE A 1 9  ? 5.672  12.144 -1.889  1.00 14.98 ? 9    ILE A CG1 1 
ATOM   68  C  CG2 . ILE A 1 9  ? 4.790  14.014 -0.210  1.00 14.89 ? 9    ILE A CG2 1 
ATOM   69  C  CD1 . ILE A 1 9  ? 6.594  13.184 -2.495  1.00 23.97 ? 9    ILE A CD1 1 
ATOM   70  N  N   . ILE A 1 10 ? 2.457  11.757 1.255   1.00 7.77  ? 10   ILE A N   1 
ATOM   71  C  CA  . ILE A 1 10 ? 1.516  12.122 2.373   1.00 9.05  ? 10   ILE A CA  1 
ATOM   72  C  C   . ILE A 1 10 ? 1.802  11.219 3.585   1.00 9.78  ? 10   ILE A C   1 
ATOM   73  O  O   . ILE A 1 10 ? 1.801  11.709 4.737   1.00 12.27 ? 10   ILE A O   1 
ATOM   74  C  CB  . ILE A 1 10 ? 0.112  11.938 1.903   1.00 10.48 ? 10   ILE A CB  1 
ATOM   75  C  CG1 . ILE A 1 10 ? -0.171 13.046 0.885   1.00 12.45 ? 10   ILE A CG1 1 
ATOM   76  C  CG2 . ILE A 1 10 ? -0.873 12.077 3.080   1.00 12.30 ? 10   ILE A CG2 1 
ATOM   77  C  CD1 . ILE A 1 10 ? -1.441 12.849 0.019   1.00 14.64 ? 10   ILE A CD1 1 
ATOM   78  N  N   . GLY A 1 11 ? 2.086  9.923  3.336   1.00 10.50 ? 11   GLY A N   1 
ATOM   79  C  CA  . GLY A 1 11 ? 2.363  8.997  4.440   1.00 11.15 ? 11   GLY A CA  1 
ATOM   80  C  C   . GLY A 1 11 ? 3.608  9.440  5.207   1.00 11.37 ? 11   GLY A C   1 
ATOM   81  O  O   . GLY A 1 11 ? 3.626  9.286  6.495   1.00 12.59 ? 11   GLY A O   1 
ATOM   82  N  N   . MET A 1 12 ? 4.661  9.865  4.522   1.00 12.60 ? 12   MET A N   1 
ATOM   83  C  CA  . MET A 1 12 ? 5.935  10.258 5.198   1.00 13.80 ? 12   MET A CA  1 
ATOM   84  C  C   . MET A 1 12 ? 5.718  11.530 6.049   1.00 12.54 ? 12   MET A C   1 
ATOM   85  O  O   . MET A 1 12 ? 6.289  11.632 7.146   1.00 12.07 ? 12   MET A O   1 
ATOM   86  C  CB  . MET A 1 12 ? 7.087  10.476 4.169   1.00 15.54 ? 12   MET A CB  1 
ATOM   87  C  CG  . MET A 1 12 ? 7.609  9.177  3.661   1.00 19.20 ? 12   MET A CG  1 
ATOM   88  S  SD  . MET A 1 12 ? 8.153  7.865  4.814   1.00 24.82 ? 12   MET A SD  1 
ATOM   89  C  CE  . MET A 1 12 ? 9.637  7.346  3.911   1.00 21.75 ? 12   MET A CE  1 
ATOM   90  N  N   . ILE A 1 13 ? 4.831  12.413 5.609   1.00 9.54  ? 13   ILE A N   1 
ATOM   91  C  CA  . ILE A 1 13 ? 4.505  13.652 6.385   1.00 9.81  ? 13   ILE A CA  1 
ATOM   92  C  C   . ILE A 1 13 ? 3.726  13.172 7.646   1.00 9.22  ? 13   ILE A C   1 
ATOM   93  O  O   . ILE A 1 13 ? 3.946  13.658 8.784   1.00 9.84  ? 13   ILE A O   1 
ATOM   94  C  CB  . ILE A 1 13 ? 3.748  14.631 5.537   1.00 11.44 ? 13   ILE A CB  1 
ATOM   95  C  CG1 . ILE A 1 13 ? 4.779  15.262 4.503   1.00 14.92 ? 13   ILE A CG1 1 
ATOM   96  C  CG2 . ILE A 1 13 ? 3.045  15.708 6.439   1.00 12.99 ? 13   ILE A CG2 1 
ATOM   97  C  CD1 . ILE A 1 13 ? 4.003  15.706 3.283   1.00 19.56 ? 13   ILE A CD1 1 
ATOM   98  N  N   . ASP A 1 14 ? 2.763  12.311 7.414   1.00 8.53  ? 14   ASP A N   1 
ATOM   99  C  CA  . ASP A 1 14 ? 1.966  11.846 8.578   1.00 8.49  ? 14   ASP A CA  1 
ATOM   100 C  C   . ASP A 1 14 ? 2.852  11.086 9.571   1.00 10.00 ? 14   ASP A C   1 
ATOM   101 O  O   . ASP A 1 14 ? 2.693  11.258 10.823  1.00 9.29  ? 14   ASP A O   1 
ATOM   102 C  CB  . ASP A 1 14 ? 0.784  10.929 8.074   1.00 7.22  ? 14   ASP A CB  1 
ATOM   103 C  CG  . ASP A 1 14 ? -0.267 11.733 7.298   1.00 8.14  ? 14   ASP A CG  1 
ATOM   104 O  OD1 . ASP A 1 14 ? -0.248 12.996 7.369   1.00 12.12 ? 14   ASP A OD1 1 
ATOM   105 O  OD2 . ASP A 1 14 ? -1.074 11.072 6.565   1.00 11.91 ? 14   ASP A OD2 1 
ATOM   106 N  N   . MET A 1 15 ? 3.785  10.257 9.057   1.00 8.68  ? 15   MET A N   1 
ATOM   107 C  CA  . MET A 1 15 ? 4.782  9.617  9.973   1.00 9.26  ? 15   MET A CA  1 
ATOM   108 C  C   . MET A 1 15 ? 5.580  10.674 10.751  1.00 10.65 ? 15   MET A C   1 
ATOM   109 O  O   . MET A 1 15 ? 5.746  10.500 11.994  1.00 10.20 ? 15   MET A O   1 
ATOM   110 C  CB  . MET A 1 15 ? 5.739  8.712  9.134   1.00 9.00  ? 15   MET A CB  1 
ATOM   111 C  CG  . MET A 1 15 ? 6.729  7.892  10.071  1.00 11.14 ? 15   MET A CG  1 
ATOM   112 S  SD  . MET A 1 15 ? 7.999  7.057  9.031   1.00 13.60 ? 15   MET A SD  1 
ATOM   113 C  CE  . MET A 1 15 ? 8.988  8.391  8.469   1.00 11.46 ? 15   MET A CE  1 
ATOM   114 N  N   . PHE A 1 16 ? 6.097  11.742 10.113  1.00 8.55  ? 16   PHE A N   1 
ATOM   115 C  CA  . PHE A 1 16 ? 6.804  12.785 10.822  1.00 8.60  ? 16   PHE A CA  1 
ATOM   116 C  C   . PHE A 1 16 ? 5.951  13.343 11.965  1.00 10.15 ? 16   PHE A C   1 
ATOM   117 O  O   . PHE A 1 16 ? 6.466  13.507 13.084  1.00 9.68  ? 16   PHE A O   1 
ATOM   118 C  CB  . PHE A 1 16 ? 7.040  13.927 9.788   1.00 9.18  ? 16   PHE A CB  1 
ATOM   119 C  CG  . PHE A 1 16 ? 7.735  15.161 10.329  1.00 7.64  ? 16   PHE A CG  1 
ATOM   120 C  CD1 . PHE A 1 16 ? 9.104  15.127 10.682  1.00 10.22 ? 16   PHE A CD1 1 
ATOM   121 C  CD2 . PHE A 1 16 ? 7.015  16.347 10.507  1.00 10.28 ? 16   PHE A CD2 1 
ATOM   122 C  CE1 . PHE A 1 16 ? 9.724  16.311 11.174  1.00 11.74 ? 16   PHE A CE1 1 
ATOM   123 C  CE2 . PHE A 1 16 ? 7.577  17.497 10.967  1.00 10.32 ? 16   PHE A CE2 1 
ATOM   124 C  CZ  . PHE A 1 16 ? 8.961  17.490 11.293  1.00 12.26 ? 16   PHE A CZ  1 
ATOM   125 N  N   . HIS A 1 17 ? 4.671  13.563 11.674  1.00 8.30  ? 17   HIS A N   1 
ATOM   126 C  CA  . HIS A 1 17 ? 3.774  14.131 12.717  1.00 6.34  ? 17   HIS A CA  1 
ATOM   127 C  C   . HIS A 1 17 ? 3.422  13.120 13.819  1.00 9.63  ? 17   HIS A C   1 
ATOM   128 O  O   . HIS A 1 17 ? 2.792  13.583 14.781  1.00 10.06 ? 17   HIS A O   1 
ATOM   129 C  CB  . HIS A 1 17 ? 2.514  14.677 11.998  1.00 7.21  ? 17   HIS A CB  1 
ATOM   130 C  CG  . HIS A 1 17 ? 2.764  15.980 11.346  1.00 6.30  ? 17   HIS A CG  1 
ATOM   131 N  ND1 . HIS A 1 17 ? 2.017  16.391 10.243  1.00 9.99  ? 17   HIS A ND1 1 
ATOM   132 C  CD2 . HIS A 1 17 ? 3.637  16.978 11.651  1.00 7.82  ? 17   HIS A CD2 1 
ATOM   133 C  CE1 . HIS A 1 17 ? 2.419  17.612 9.908   1.00 7.81  ? 17   HIS A CE1 1 
ATOM   134 N  NE2 . HIS A 1 17 ? 3.410  18.004 10.725  1.00 11.04 ? 17   HIS A NE2 1 
ATOM   135 N  N   . LYS A 1 18 ? 3.703  11.815 13.741  1.00 8.03  ? 18   LYS A N   1 
ATOM   136 C  CA  . LYS A 1 18 ? 3.508  10.970 14.936  1.00 9.32  ? 18   LYS A CA  1 
ATOM   137 C  C   . LYS A 1 18 ? 4.551  11.376 15.998  1.00 9.52  ? 18   LYS A C   1 
ATOM   138 O  O   . LYS A 1 18 ? 4.321  11.037 17.196  1.00 11.16 ? 18   LYS A O   1 
ATOM   139 C  CB  . LYS A 1 18 ? 3.757  9.518  14.479  1.00 10.84 ? 18   LYS A CB  1 
ATOM   140 C  CG  . LYS A 1 18 ? 3.747  8.394  15.355  1.00 22.36 ? 18   LYS A CG  1 
ATOM   141 C  CD  . LYS A 1 18 ? 2.849  7.343  14.461  1.00 25.12 ? 18   LYS A CD  1 
ATOM   142 C  CE  . LYS A 1 18 ? 3.618  6.480  13.636  1.00 22.65 ? 18   LYS A CE  1 
ATOM   143 N  NZ  . LYS A 1 18 ? 3.772  4.991  14.290  1.00 18.84 ? 18   LYS A NZ  1 
ATOM   144 N  N   . TYR A 1 19 ? 5.684  11.965 15.574  1.00 10.11 ? 19   TYR A N   1 
ATOM   145 C  CA  . TYR A 1 19 ? 6.835  12.032 16.494  1.00 8.88  ? 19   TYR A CA  1 
ATOM   146 C  C   . TYR A 1 19 ? 7.217  13.446 16.893  1.00 10.31 ? 19   TYR A C   1 
ATOM   147 O  O   . TYR A 1 19 ? 8.139  13.608 17.741  1.00 12.08 ? 19   TYR A O   1 
ATOM   148 C  CB  . TYR A 1 19 ? 8.079  11.336 15.852  1.00 11.61 ? 19   TYR A CB  1 
ATOM   149 C  CG  . TYR A 1 19 ? 7.816  9.908  15.582  1.00 8.85  ? 19   TYR A CG  1 
ATOM   150 C  CD1 . TYR A 1 19 ? 7.916  8.899  16.565  1.00 9.90  ? 19   TYR A CD1 1 
ATOM   151 C  CD2 . TYR A 1 19 ? 7.499  9.452  14.261  1.00 10.12 ? 19   TYR A CD2 1 
ATOM   152 C  CE1 . TYR A 1 19 ? 7.656  7.510  16.274  1.00 11.40 ? 19   TYR A CE1 1 
ATOM   153 C  CE2 . TYR A 1 19 ? 7.178  8.135  13.997  1.00 10.52 ? 19   TYR A CE2 1 
ATOM   154 C  CZ  . TYR A 1 19 ? 7.242  7.165  14.935  1.00 10.43 ? 19   TYR A CZ  1 
ATOM   155 O  OH  . TYR A 1 19 ? 7.056  5.836  14.724  1.00 12.26 ? 19   TYR A OH  1 
ATOM   156 N  N   . THR A 1 20 ? 6.580  14.466 16.313  1.00 8.76  ? 20   THR A N   1 
ATOM   157 C  CA  . THR A 1 20 ? 6.919  15.879 16.612  1.00 9.22  ? 20   THR A CA  1 
ATOM   158 C  C   . THR A 1 20 ? 6.412  16.252 18.019  1.00 11.14 ? 20   THR A C   1 
ATOM   159 O  O   . THR A 1 20 ? 5.428  15.640 18.534  1.00 12.44 ? 20   THR A O   1 
ATOM   160 C  CB  . THR A 1 20 ? 6.230  16.861 15.645  1.00 10.55 ? 20   THR A CB  1 
ATOM   161 O  OG1 . THR A 1 20 ? 4.860  16.394 15.468  1.00 9.59  ? 20   THR A OG1 1 
ATOM   162 C  CG2 . THR A 1 20 ? 6.922  16.773 14.280  1.00 10.66 ? 20   THR A CG2 1 
ATOM   163 N  N   . ARG A 1 21 ? 7.090  17.215 18.616  1.00 13.03 ? 21   ARG A N   1 
ATOM   164 C  CA  . ARG A 1 21 ? 6.525  17.992 19.747  1.00 14.90 ? 21   ARG A CA  1 
ATOM   165 C  C   . ARG A 1 21 ? 5.705  19.153 19.250  1.00 14.06 ? 21   ARG A C   1 
ATOM   166 O  O   . ARG A 1 21 ? 5.447  19.363 18.033  1.00 12.39 ? 21   ARG A O   1 
ATOM   167 C  CB  . ARG A 1 21 ? 7.726  18.545 20.590  1.00 16.51 ? 21   ARG A CB  1 
ATOM   168 C  CG  . ARG A 1 21 ? 8.656  17.445 21.085  1.00 23.11 ? 21   ARG A CG  1 
ATOM   169 C  CD  . ARG A 1 21 ? 8.028  16.579 22.148  1.00 36.17 ? 21   ARG A CD  1 
ATOM   170 N  NE  . ARG A 1 21 ? 8.928  15.494 22.589  1.00 46.50 ? 21   ARG A NE  1 
ATOM   171 C  CZ  . ARG A 1 21 ? 8.601  14.503 23.448  1.00 52.13 ? 21   ARG A CZ  1 
ATOM   172 N  NH1 . ARG A 1 21 ? 7.385  14.450 24.016  1.00 52.51 ? 21   ARG A NH1 1 
ATOM   173 N  NH2 . ARG A 1 21 ? 9.515  13.567 23.771  1.00 51.97 ? 21   ARG A NH2 1 
ATOM   174 N  N   . ARG A 1 22 ? 5.279  20.041 20.199  1.00 14.05 ? 22   ARG A N   1 
ATOM   175 C  CA  . ARG A 1 22 ? 4.420  21.110 19.829  1.00 16.31 ? 22   ARG A CA  1 
ATOM   176 C  C   . ARG A 1 22 ? 5.063  22.158 18.941  1.00 16.19 ? 22   ARG A C   1 
ATOM   177 O  O   . ARG A 1 22 ? 4.356  22.941 18.327  1.00 19.26 ? 22   ARG A O   1 
ATOM   178 C  CB  . ARG A 1 22 ? 3.952  21.822 21.145  1.00 18.19 ? 22   ARG A CB  1 
ATOM   179 C  CG  . ARG A 1 22 ? 2.864  21.055 21.851  1.00 26.28 ? 22   ARG A CG  1 
ATOM   180 C  CD  . ARG A 1 22 ? 2.545  21.647 23.265  1.00 32.83 ? 22   ARG A CD  1 
ATOM   181 N  NE  . ARG A 1 22 ? 2.230  20.625 24.275  1.00 44.71 ? 22   ARG A NE  1 
ATOM   182 C  CZ  . ARG A 1 22 ? 1.024  20.359 24.800  1.00 50.56 ? 22   ARG A CZ  1 
ATOM   183 N  NH1 . ARG A 1 22 ? -0.107 21.005 24.418  1.00 52.00 ? 22   ARG A NH1 1 
ATOM   184 N  NH2 . ARG A 1 22 ? 0.955  19.401 25.728  1.00 51.54 ? 22   ARG A NH2 1 
ATOM   185 N  N   . ASP A 1 23 ? 6.408  22.145 18.793  1.00 14.09 ? 23   ASP A N   1 
ATOM   186 C  CA  . ASP A 1 23 ? 7.028  23.088 17.900  1.00 13.46 ? 23   ASP A CA  1 
ATOM   187 C  C   . ASP A 1 23 ? 7.235  22.468 16.475  1.00 12.46 ? 23   ASP A C   1 
ATOM   188 O  O   . ASP A 1 23 ? 7.958  23.081 15.684  1.00 11.99 ? 23   ASP A O   1 
ATOM   189 C  CB  . ASP A 1 23 ? 8.416  23.433 18.488  1.00 14.90 ? 23   ASP A CB  1 
ATOM   190 C  CG  . ASP A 1 23 ? 9.342  22.214 18.593  1.00 17.09 ? 23   ASP A CG  1 
ATOM   191 O  OD1 . ASP A 1 23 ? 8.951  21.033 18.384  1.00 14.23 ? 23   ASP A OD1 1 
ATOM   192 O  OD2 . ASP A 1 23 ? 10.576 22.397 18.995  1.00 22.85 ? 23   ASP A OD2 1 
ATOM   193 N  N   . ASP A 1 24 ? 6.550  21.359 16.193  1.00 13.99 ? 24   ASP A N   1 
ATOM   194 C  CA  . ASP A 1 24 ? 6.578  20.713 14.856  1.00 10.92 ? 24   ASP A CA  1 
ATOM   195 C  C   . ASP A 1 24 ? 8.016  20.223 14.546  1.00 11.29 ? 24   ASP A C   1 
ATOM   196 O  O   . ASP A 1 24 ? 8.399  20.085 13.347  1.00 10.53 ? 24   ASP A O   1 
ATOM   197 C  CB  . ASP A 1 24 ? 6.150  21.704 13.764  1.00 10.81 ? 24   ASP A CB  1 
ATOM   198 C  CG  . ASP A 1 24 ? 5.809  20.995 12.444  1.00 11.34 ? 24   ASP A CG  1 
ATOM   199 O  OD1 . ASP A 1 24 ? 5.166  19.914 12.452  1.00 10.66 ? 24   ASP A OD1 1 
ATOM   200 O  OD2 . ASP A 1 24 ? 6.196  21.575 11.395  1.00 12.31 ? 24   ASP A OD2 1 
ATOM   201 N  N   . LYS A 1 25 ? 8.796  19.904 15.588  1.00 9.87  ? 25   LYS A N   1 
ATOM   202 C  CA  . LYS A 1 25 ? 10.144 19.304 15.401  1.00 9.85  ? 25   LYS A CA  1 
ATOM   203 C  C   . LYS A 1 25 ? 10.299 18.055 16.249  1.00 9.74  ? 25   LYS A C   1 
ATOM   204 O  O   . LYS A 1 25 ? 9.543  17.837 17.241  1.00 11.50 ? 25   LYS A O   1 
ATOM   205 C  CB  . LYS A 1 25 ? 11.199 20.342 15.696  1.00 9.51  ? 25   LYS A CB  1 
ATOM   206 C  CG  . LYS A 1 25 ? 10.989 21.651 15.056  1.00 11.73 ? 25   LYS A CG  1 
ATOM   207 C  CD  . LYS A 1 25 ? 12.176 22.617 15.430  1.00 15.55 ? 25   LYS A CD  1 
ATOM   208 C  CE  . LYS A 1 25 ? 11.902 23.928 14.775  1.00 21.58 ? 25   LYS A CE  1 
ATOM   209 N  NZ  . LYS A 1 25 ? 12.777 25.036 15.333  1.00 29.28 ? 25   LYS A NZ  1 
ATOM   210 N  N   . ILE A 1 26 ? 11.238 17.170 15.885  1.00 8.99  ? 26   ILE A N   1 
ATOM   211 C  CA  . ILE A 1 26 ? 11.360 15.880 16.575  1.00 9.29  ? 26   ILE A CA  1 
ATOM   212 C  C   . ILE A 1 26 ? 12.615 15.978 17.477  1.00 9.69  ? 26   ILE A C   1 
ATOM   213 O  O   . ILE A 1 26 ? 13.757 16.357 17.047  1.00 10.65 ? 26   ILE A O   1 
ATOM   214 C  CB  . ILE A 1 26 ? 11.580 14.782 15.523  1.00 7.17  ? 26   ILE A CB  1 
ATOM   215 C  CG1 . ILE A 1 26 ? 10.309 14.682 14.634  1.00 10.84 ? 26   ILE A CG1 1 
ATOM   216 C  CG2 . ILE A 1 26 ? 11.824 13.504 16.228  1.00 9.00  ? 26   ILE A CG2 1 
ATOM   217 C  CD1 . ILE A 1 26 ? 10.467 13.578 13.500  1.00 9.28  ? 26   ILE A CD1 1 
ATOM   218 N  N   . ASP A 1 27 ? 12.433 15.592 18.738  1.00 9.70  ? 27   ASP A N   1 
ATOM   219 C  CA  . ASP A 1 27 ? 13.632 15.566 19.637  1.00 11.10 ? 27   ASP A CA  1 
ATOM   220 C  C   . ASP A 1 27 ? 14.433 14.266 19.489  1.00 11.26 ? 27   ASP A C   1 
ATOM   221 O  O   . ASP A 1 27 ? 14.064 13.324 18.757  1.00 11.49 ? 27   ASP A O   1 
ATOM   222 C  CB  . ASP A 1 27 ? 13.194 15.810 21.117  1.00 11.91 ? 27   ASP A CB  1 
ATOM   223 C  CG  . ASP A 1 27 ? 12.386 14.703 21.675  1.00 12.77 ? 27   ASP A CG  1 
ATOM   224 O  OD1 . ASP A 1 27 ? 12.379 13.559 21.244  1.00 13.25 ? 27   ASP A OD1 1 
ATOM   225 O  OD2 . ASP A 1 27 ? 11.773 14.917 22.778  1.00 18.82 ? 27   ASP A OD2 1 
ATOM   226 N  N   . LYS A 1 28 ? 15.603 14.183 20.158  1.00 11.57 ? 28   LYS A N   1 
ATOM   227 C  CA  . LYS A 1 28 ? 16.448 13.001 19.886  1.00 10.74 ? 28   LYS A CA  1 
ATOM   228 C  C   . LYS A 1 28 ? 15.869 11.653 20.236  1.00 9.83  ? 28   LYS A C   1 
ATOM   229 O  O   . LYS A 1 28 ? 15.899 10.718 19.412  1.00 10.64 ? 28   LYS A O   1 
ATOM   230 C  CB  . LYS A 1 28 ? 17.893 13.240 20.528  1.00 10.19 ? 28   LYS A CB  1 
ATOM   231 C  CG  . LYS A 1 28 ? 18.777 12.044 20.282  1.00 10.48 ? 28   LYS A CG  1 
ATOM   232 C  CD  . LYS A 1 28 ? 20.241 12.419 20.669  1.00 9.44  ? 28   LYS A CD  1 
ATOM   233 C  CE  . LYS A 1 28 ? 21.072 11.270 20.479  1.00 11.67 ? 28   LYS A CE  1 
ATOM   234 N  NZ  . LYS A 1 28 ? 22.501 11.679 20.903  1.00 12.71 ? 28   LYS A NZ  1 
ATOM   235 N  N   . PRO A 1 29 ? 15.269 11.467 21.445  1.00 10.59 ? 29   PRO A N   1 
ATOM   236 C  CA  . PRO A 1 29 ? 14.729 10.109 21.713  1.00 12.06 ? 29   PRO A CA  1 
ATOM   237 C  C   . PRO A 1 29 ? 13.572 9.742  20.758  1.00 10.02 ? 29   PRO A C   1 
ATOM   238 O  O   . PRO A 1 29 ? 13.506 8.580  20.385  1.00 10.29 ? 29   PRO A O   1 
ATOM   239 C  CB  . PRO A 1 29 ? 14.251 10.182 23.211  1.00 14.78 ? 29   PRO A CB  1 
ATOM   240 C  CG  . PRO A 1 29 ? 14.906 11.445 23.722  1.00 14.80 ? 29   PRO A CG  1 
ATOM   241 C  CD  . PRO A 1 29 ? 15.172 12.401 22.600  1.00 12.15 ? 29   PRO A CD  1 
ATOM   242 N  N   . SER A 1 30 ? 12.851 10.761 20.305  1.00 10.64 ? 30   SER A N   1 
ATOM   243 C  CA  . SER A 1 30 ? 11.681 10.508 19.405  1.00 10.38 ? 30   SER A CA  1 
ATOM   244 C  C   . SER A 1 30 ? 12.249 10.151 18.020  1.00 9.64  ? 30   SER A C   1 
ATOM   245 O  O   . SER A 1 30 ? 11.670 9.277  17.326  1.00 9.29  ? 30   SER A O   1 
ATOM   246 C  CB  . SER A 1 30 ? 10.794 11.721 19.297  1.00 12.02 ? 30   SER A CB  1 
ATOM   247 O  OG  . SER A 1 30 ? 10.173 11.935 20.647  1.00 17.36 ? 30   SER A OG  1 
ATOM   248 N  N   . LEU A 1 31 ? 13.346 10.787 17.644  1.00 8.94  ? 31   LEU A N   1 
ATOM   249 C  CA  . LEU A 1 31 ? 13.971 10.413 16.303  1.00 10.34 ? 31   LEU A CA  1 
ATOM   250 C  C   . LEU A 1 31 ? 14.428 8.986  16.326  1.00 11.07 ? 31   LEU A C   1 
ATOM   251 O  O   . LEU A 1 31 ? 14.228 8.242  15.321  1.00 9.44  ? 31   LEU A O   1 
ATOM   252 C  CB  . LEU A 1 31 ? 15.055 11.421 15.846  1.00 8.63  ? 31   LEU A CB  1 
ATOM   253 C  CG  . LEU A 1 31 ? 15.628 11.120 14.436  1.00 7.66  ? 31   LEU A CG  1 
ATOM   254 C  CD1 . LEU A 1 31 ? 14.709 11.868 13.538  1.00 11.61 ? 31   LEU A CD1 1 
ATOM   255 C  CD2 . LEU A 1 31 ? 17.105 11.643 14.295  1.00 8.23  ? 31   LEU A CD2 1 
ATOM   256 N  N   . LEU A 1 32 ? 15.111 8.600  17.411  1.00 10.43 ? 32   LEU A N   1 
ATOM   257 C  CA  . LEU A 1 32 ? 15.563 7.259  17.473  1.00 10.72 ? 32   LEU A CA  1 
ATOM   258 C  C   . LEU A 1 32 ? 14.418 6.210  17.496  1.00 8.79  ? 32   LEU A C   1 
ATOM   259 O  O   . LEU A 1 32 ? 14.523 5.182  16.781  1.00 11.32 ? 32   LEU A O   1 
ATOM   260 C  CB  . LEU A 1 32 ? 16.508 7.085  18.716  1.00 11.06 ? 32   LEU A CB  1 
ATOM   261 C  CG  . LEU A 1 32 ? 17.664 8.087  18.711  1.00 16.19 ? 32   LEU A CG  1 
ATOM   262 C  CD1 . LEU A 1 32 ? 18.519 7.686  20.005  1.00 15.64 ? 32   LEU A CD1 1 
ATOM   263 C  CD2 . LEU A 1 32 ? 18.481 8.222  17.420  1.00 17.42 ? 32   LEU A CD2 1 
ATOM   264 N  N   . THR A 1 33 ? 13.349 6.507  18.208  1.00 11.29 ? 33   THR A N   1 
ATOM   265 C  CA  . THR A 1 33 ? 12.148 5.706  18.186  1.00 12.28 ? 33   THR A CA  1 
ATOM   266 C  C   . THR A 1 33 ? 11.572 5.600  16.736  1.00 11.62 ? 33   THR A C   1 
ATOM   267 O  O   . THR A 1 33 ? 11.225 4.495  16.295  1.00 11.18 ? 33   THR A O   1 
ATOM   268 C  CB  . THR A 1 33 ? 11.132 6.195  19.179  1.00 14.79 ? 33   THR A CB  1 
ATOM   269 O  OG1 . THR A 1 33 ? 11.734 6.033  20.520  1.00 15.20 ? 33   THR A OG1 1 
ATOM   270 C  CG2 . THR A 1 33 ? 9.914  5.311  19.080  1.00 14.59 ? 33   THR A CG2 1 
ATOM   271 N  N   . MET A 1 34 ? 11.458 6.723  16.100  1.00 10.90 ? 34   MET A N   1 
ATOM   272 C  CA  . MET A 1 34 ? 10.968 6.775  14.686  1.00 7.57  ? 34   MET A CA  1 
ATOM   273 C  C   . MET A 1 34 ? 11.773 5.833  13.796  1.00 9.34  ? 34   MET A C   1 
ATOM   274 O  O   . MET A 1 34 ? 11.187 5.034  13.015  1.00 9.25  ? 34   MET A O   1 
ATOM   275 C  CB  . MET A 1 34 ? 10.982 8.254  14.142  1.00 8.86  ? 34   MET A CB  1 
ATOM   276 C  CG  . MET A 1 34 ? 10.427 8.331  12.746  1.00 10.65 ? 34   MET A CG  1 
ATOM   277 S  SD  . MET A 1 34 ? 11.655 7.952  11.405  1.00 16.17 ? 34   MET A SD  1 
ATOM   278 C  CE  . MET A 1 34 ? 12.876 9.325  11.630  1.00 13.63 ? 34   MET A CE  1 
ATOM   279 N  N   . MET A 1 35 ? 13.110 5.861  13.943  1.00 9.61  ? 35   MET A N   1 
ATOM   280 C  CA  . MET A 1 35 ? 13.958 4.988  13.122  1.00 11.18 ? 35   MET A CA  1 
ATOM   281 C  C   . MET A 1 35 ? 13.717 3.517  13.422  1.00 9.89  ? 35   MET A C   1 
ATOM   282 O  O   . MET A 1 35 ? 13.622 2.716  12.529  1.00 9.75  ? 35   MET A O   1 
ATOM   283 C  CB  . MET A 1 35 ? 15.451 5.394  13.292  1.00 11.80 ? 35   MET A CB  1 
ATOM   284 C  CG  . MET A 1 35 ? 15.760 6.756  12.689  1.00 10.51 ? 35   MET A CG  1 
ATOM   285 S  SD  . MET A 1 35 ? 15.640 6.770  10.872  1.00 13.95 ? 35   MET A SD  1 
ATOM   286 C  CE  . MET A 1 35 ? 16.852 5.546  10.391  1.00 14.90 ? 35   MET A CE  1 
ATOM   287 N  N   . LYS A 1 36 ? 13.672 3.173  14.724  1.00 10.61 ? 36   LYS A N   1 
ATOM   288 C  CA  . LYS A 1 36 ? 13.507 1.790  15.087  1.00 10.53 ? 36   LYS A CA  1 
ATOM   289 C  C   . LYS A 1 36 ? 12.136 1.242  14.584  1.00 11.47 ? 36   LYS A C   1 
ATOM   290 O  O   . LYS A 1 36 ? 12.063 0.030  14.230  1.00 13.63 ? 36   LYS A O   1 
ATOM   291 C  CB  . LYS A 1 36 ? 13.503 1.729  16.622  1.00 11.43 ? 36   LYS A CB  1 
ATOM   292 C  CG  . LYS A 1 36 ? 14.924 1.715  17.150  1.00 16.68 ? 36   LYS A CG  1 
ATOM   293 C  CD  . LYS A 1 36 ? 14.881 1.828  18.710  1.00 18.99 ? 36   LYS A CD  1 
ATOM   294 C  CE  . LYS A 1 36 ? 16.286 2.197  19.345  1.00 29.79 ? 36   LYS A CE  1 
ATOM   295 N  NZ  . LYS A 1 36 ? 16.212 2.076  20.915  1.00 29.39 ? 36   LYS A NZ  1 
ATOM   296 N  N   . GLU A 1 37 ? 11.104 2.083  14.616  1.00 10.81 ? 37   GLU A N   1 
ATOM   297 C  CA  . GLU A 1 37 ? 9.723  1.654  14.287  1.00 11.54 ? 37   GLU A CA  1 
ATOM   298 C  C   . GLU A 1 37 ? 9.524  1.639  12.796  1.00 12.62 ? 37   GLU A C   1 
ATOM   299 O  O   . GLU A 1 37 ? 8.723  0.832  12.296  1.00 14.89 ? 37   GLU A O   1 
ATOM   300 C  CB  . GLU A 1 37 ? 8.743  2.621  14.893  1.00 11.69 ? 37   GLU A CB  1 
ATOM   301 C  CG  . GLU A 1 37 ? 8.646  2.380  16.427  1.00 13.55 ? 37   GLU A CG  1 
ATOM   302 C  CD  . GLU A 1 37 ? 7.596  3.264  17.149  1.00 15.95 ? 37   GLU A CD  1 
ATOM   303 O  OE1 . GLU A 1 37 ? 7.008  4.257  16.677  1.00 17.06 ? 37   GLU A OE1 1 
ATOM   304 O  OE2 . GLU A 1 37 ? 7.321  2.842  18.344  1.00 23.38 ? 37   GLU A OE2 1 
ATOM   305 N  N   . ASN A 1 38 ? 10.223 2.546  12.101  1.00 8.59  ? 38   ASN A N   1 
ATOM   306 C  CA  . ASN A 1 38 ? 9.903  2.691  10.671  1.00 8.46  ? 38   ASN A CA  1 
ATOM   307 C  C   . ASN A 1 38 ? 10.992 2.243  9.707   1.00 7.28  ? 38   ASN A C   1 
ATOM   308 O  O   . ASN A 1 38 ? 10.693 1.963  8.513   1.00 9.08  ? 38   ASN A O   1 
ATOM   309 C  CB  . ASN A 1 38 ? 9.531  4.141  10.330  1.00 9.13  ? 38   ASN A CB  1 
ATOM   310 C  CG  . ASN A 1 38 ? 8.242  4.545  11.063  1.00 10.51 ? 38   ASN A CG  1 
ATOM   311 O  OD1 . ASN A 1 38 ? 7.131  4.276  10.597  1.00 11.70 ? 38   ASN A OD1 1 
ATOM   312 N  ND2 . ASN A 1 38 ? 8.408  5.150  12.240  1.00 9.62  ? 38   ASN A ND2 1 
ATOM   313 N  N   . PHE A 1 39 ? 12.219 2.067  10.223  1.00 9.46  ? 39   PHE A N   1 
ATOM   314 C  CA  . PHE A 1 39 ? 13.289 1.583  9.361   1.00 8.49  ? 39   PHE A CA  1 
ATOM   315 C  C   . PHE A 1 39 ? 14.061 0.393  9.982   1.00 9.88  ? 39   PHE A C   1 
ATOM   316 O  O   . PHE A 1 39 ? 15.321 0.336  9.880   1.00 11.09 ? 39   PHE A O   1 
ATOM   317 C  CB  . PHE A 1 39 ? 14.275 2.724  9.009   1.00 10.84 ? 39   PHE A CB  1 
ATOM   318 C  CG  . PHE A 1 39 ? 13.612 3.804  8.182   1.00 9.15  ? 39   PHE A CG  1 
ATOM   319 C  CD1 . PHE A 1 39 ? 13.407 3.607  6.794   1.00 11.02 ? 39   PHE A CD1 1 
ATOM   320 C  CD2 . PHE A 1 39 ? 13.146 4.969  8.801   1.00 10.47 ? 39   PHE A CD2 1 
ATOM   321 C  CE1 . PHE A 1 39 ? 12.685 4.655  6.039   1.00 10.95 ? 39   PHE A CE1 1 
ATOM   322 C  CE2 . PHE A 1 39 ? 12.482 5.965  8.015   1.00 10.49 ? 39   PHE A CE2 1 
ATOM   323 C  CZ  . PHE A 1 39 ? 12.255 5.744  6.660   1.00 10.99 ? 39   PHE A CZ  1 
ATOM   324 N  N   . PRO A 1 40 ? 13.287 -0.562 10.560  1.00 11.06 ? 40   PRO A N   1 
ATOM   325 C  CA  . PRO A 1 40 ? 14.009 -1.643 11.233  1.00 12.34 ? 40   PRO A CA  1 
ATOM   326 C  C   . PRO A 1 40 ? 14.882 -2.538 10.296  1.00 13.69 ? 40   PRO A C   1 
ATOM   327 O  O   . PRO A 1 40 ? 15.936 -3.077 10.735  1.00 14.98 ? 40   PRO A O   1 
ATOM   328 C  CB  . PRO A 1 40 ? 12.883 -2.396 11.911  1.00 12.63 ? 40   PRO A CB  1 
ATOM   329 C  CG  . PRO A 1 40 ? 11.690 -2.315 10.910  1.00 11.41 ? 40   PRO A CG  1 
ATOM   330 C  CD  . PRO A 1 40 ? 11.839 -0.786 10.546  1.00 10.27 ? 40   PRO A CD  1 
ATOM   331 N  N   . ASN A 1 41 ? 14.398 -2.796 9.075   1.00 11.27 ? 41   ASN A N   1 
ATOM   332 C  CA  . ASN A 1 41 ? 15.157 -3.592 8.154   1.00 13.13 ? 41   ASN A CA  1 
ATOM   333 C  C   . ASN A 1 41 ? 16.400 -2.867 7.638   1.00 14.21 ? 41   ASN A C   1 
ATOM   334 O  O   . ASN A 1 41 ? 17.481 -3.468 7.501   1.00 13.24 ? 41   ASN A O   1 
ATOM   335 C  CB  . ASN A 1 41 ? 14.220 -4.101 7.014   1.00 13.03 ? 41   ASN A CB  1 
ATOM   336 C  CG  . ASN A 1 41 ? 13.101 -4.935 7.575   1.00 16.53 ? 41   ASN A CG  1 
ATOM   337 O  OD1 . ASN A 1 41 ? 13.353 -6.057 8.160   1.00 18.66 ? 41   ASN A OD1 1 
ATOM   338 N  ND2 . ASN A 1 41 ? 11.913 -4.441 7.534   1.00 13.84 ? 41   ASN A ND2 1 
ATOM   339 N  N   . PHE A 1 42 ? 16.268 -1.537 7.380   1.00 11.08 ? 42   PHE A N   1 
ATOM   340 C  CA  . PHE A 1 42 ? 17.390 -0.756 7.014   1.00 11.47 ? 42   PHE A CA  1 
ATOM   341 C  C   . PHE A 1 42 ? 18.435 -0.786 8.189   1.00 11.48 ? 42   PHE A C   1 
ATOM   342 O  O   . PHE A 1 42 ? 19.632 -0.936 7.978   1.00 12.90 ? 42   PHE A O   1 
ATOM   343 C  CB  . PHE A 1 42 ? 16.873 0.711  6.852   1.00 11.56 ? 42   PHE A CB  1 
ATOM   344 C  CG  . PHE A 1 42 ? 17.994 1.705  6.673   1.00 13.83 ? 42   PHE A CG  1 
ATOM   345 C  CD1 . PHE A 1 42 ? 18.628 1.874  5.433   1.00 16.66 ? 42   PHE A CD1 1 
ATOM   346 C  CD2 . PHE A 1 42 ? 18.365 2.512  7.753   1.00 14.26 ? 42   PHE A CD2 1 
ATOM   347 C  CE1 . PHE A 1 42 ? 19.709 2.782  5.282   1.00 20.34 ? 42   PHE A CE1 1 
ATOM   348 C  CE2 . PHE A 1 42 ? 19.456 3.506  7.573   1.00 13.04 ? 42   PHE A CE2 1 
ATOM   349 C  CZ  . PHE A 1 42 ? 20.073 3.610  6.334   1.00 14.05 ? 42   PHE A CZ  1 
ATOM   350 N  N   . LEU A 1 43 ? 17.960 -0.654 9.423   1.00 11.19 ? 43   LEU A N   1 
ATOM   351 C  CA  . LEU A 1 43 ? 18.841 -0.590 10.625  1.00 13.05 ? 43   LEU A CA  1 
ATOM   352 C  C   . LEU A 1 43 ? 19.509 -1.977 10.819  1.00 14.54 ? 43   LEU A C   1 
ATOM   353 O  O   . LEU A 1 43 ? 20.726 -2.041 11.093  1.00 15.47 ? 43   LEU A O   1 
ATOM   354 C  CB  . LEU A 1 43 ? 18.068 -0.241 11.920  1.00 15.17 ? 43   LEU A CB  1 
ATOM   355 C  CG  . LEU A 1 43 ? 17.658 1.245  12.048  1.00 12.99 ? 43   LEU A CG  1 
ATOM   356 C  CD1 . LEU A 1 43 ? 16.928 1.462  13.395  1.00 14.03 ? 43   LEU A CD1 1 
ATOM   357 C  CD2 . LEU A 1 43 ? 18.991 2.180  11.874  1.00 13.74 ? 43   LEU A CD2 1 
ATOM   358 N  N   . SER A 1 44 ? 18.779 -3.026 10.536  1.00 15.83 ? 44   SER A N   1 
ATOM   359 C  CA  . SER A 1 44 ? 19.375 -4.415 10.636  1.00 17.05 ? 44   SER A CA  1 
ATOM   360 C  C   . SER A 1 44 ? 20.468 -4.605 9.621   1.00 18.60 ? 44   SER A C   1 
ATOM   361 O  O   . SER A 1 44 ? 21.545 -5.241 9.951   1.00 20.49 ? 44   SER A O   1 
ATOM   362 C  CB  . SER A 1 44 ? 18.264 -5.452 10.432  1.00 18.56 ? 44   SER A CB  1 
ATOM   363 O  OG  . SER A 1 44 ? 18.805 -6.764 10.483  1.00 29.81 ? 44   SER A OG  1 
ATOM   364 N  N   . ALA A 1 45 ? 20.291 -4.065 8.392   1.00 14.59 ? 45   ALA A N   1 
ATOM   365 C  CA  . ALA A 1 45 ? 21.305 -4.268 7.361   1.00 15.48 ? 45   ALA A CA  1 
ATOM   366 C  C   . ALA A 1 45 ? 22.569 -3.482 7.785   1.00 16.91 ? 45   ALA A C   1 
ATOM   367 O  O   . ALA A 1 45 ? 23.711 -3.998 7.603   1.00 19.29 ? 45   ALA A O   1 
ATOM   368 C  CB  . ALA A 1 45 ? 20.786 -3.807 6.055   1.00 14.26 ? 45   ALA A CB  1 
ATOM   369 N  N   . CYS A 1 46 ? 22.375 -2.282 8.409   1.00 17.06 ? 46   CYS A N   1 
ATOM   370 C  CA  . CYS A 1 46 ? 23.493 -1.511 8.907   1.00 16.13 ? 46   CYS A CA  1 
ATOM   371 C  C   . CYS A 1 46 ? 24.250 -2.286 9.992   1.00 18.33 ? 46   CYS A C   1 
ATOM   372 O  O   . CYS A 1 46 ? 25.494 -2.380 9.942   1.00 19.79 ? 46   CYS A O   1 
ATOM   373 C  CB  . CYS A 1 46 ? 23.023 -0.176 9.498   1.00 17.12 ? 46   CYS A CB  1 
ATOM   374 S  SG  . CYS A 1 46 ? 22.631 1.022  8.179   1.00 20.66 ? 46   CYS A SG  1 
ATOM   375 N  N   . ASP A 1 47 ? 23.523 -2.802 10.977  1.00 19.50 ? 47   ASP A N   1 
ATOM   376 C  CA  . ASP A 1 47 ? 24.128 -3.565 12.113  1.00 23.05 ? 47   ASP A CA  1 
ATOM   377 C  C   . ASP A 1 47 ? 24.956 -4.704 11.569  1.00 24.99 ? 47   ASP A C   1 
ATOM   378 O  O   . ASP A 1 47 ? 26.039 -4.973 12.122  1.00 25.73 ? 47   ASP A O   1 
ATOM   379 C  CB  . ASP A 1 47 ? 23.045 -4.214 12.994  1.00 23.13 ? 47   ASP A CB  1 
ATOM   380 C  CG  . ASP A 1 47 ? 22.297 -3.227 13.821  1.00 31.54 ? 47   ASP A CG  1 
ATOM   381 O  OD1 . ASP A 1 47 ? 22.807 -2.087 14.039  1.00 32.65 ? 47   ASP A OD1 1 
ATOM   382 O  OD2 . ASP A 1 47 ? 21.223 -3.640 14.318  1.00 35.30 ? 47   ASP A OD2 1 
ATOM   383 N  N   . LYS A 1 48 ? 24.450 -5.391 10.531  1.00 24.95 ? 48   LYS A N   1 
ATOM   384 C  CA  . LYS A 1 48 ? 25.122 -6.591 10.026  1.00 27.79 ? 48   LYS A CA  1 
ATOM   385 C  C   . LYS A 1 48 ? 26.492 -6.251 9.494   1.00 28.03 ? 48   LYS A C   1 
ATOM   386 O  O   . LYS A 1 48 ? 27.371 -7.153 9.498   1.00 29.37 ? 48   LYS A O   1 
ATOM   387 C  CB  . LYS A 1 48 ? 24.349 -7.273 8.919   1.00 27.84 ? 48   LYS A CB  1 
ATOM   388 C  CG  . LYS A 1 48 ? 23.313 -8.297 9.402   1.00 36.42 ? 48   LYS A CG  1 
ATOM   389 C  CD  . LYS A 1 48 ? 22.861 -9.121 8.181   1.00 43.53 ? 48   LYS A CD  1 
ATOM   390 C  CE  . LYS A 1 48 ? 21.299 -9.191 8.039   1.00 47.53 ? 48   LYS A CE  1 
ATOM   391 N  NZ  . LYS A 1 48 ? 20.524 -9.015 9.307   1.00 50.44 ? 48   LYS A NZ  1 
ATOM   392 N  N   . LYS A 1 49 ? 26.674 -4.989 9.029   1.00 27.29 ? 49   LYS A N   1 
ATOM   393 C  CA  . LYS A 1 49 ? 27.914 -4.457 8.467   1.00 27.60 ? 49   LYS A CA  1 
ATOM   394 C  C   . LYS A 1 49 ? 28.788 -3.729 9.507   1.00 27.19 ? 49   LYS A C   1 
ATOM   395 O  O   . LYS A 1 49 ? 29.807 -3.112 9.103   1.00 29.39 ? 49   LYS A O   1 
ATOM   396 C  CB  . LYS A 1 49 ? 27.600 -3.455 7.339   1.00 28.59 ? 49   LYS A CB  1 
ATOM   397 C  CG  . LYS A 1 49 ? 27.169 -4.072 6.037   1.00 33.67 ? 49   LYS A CG  1 
ATOM   398 C  CD  . LYS A 1 49 ? 28.406 -4.732 5.283   1.00 43.03 ? 49   LYS A CD  1 
ATOM   399 C  CE  . LYS A 1 49 ? 27.970 -5.435 4.016   1.00 44.56 ? 49   LYS A CE  1 
ATOM   400 N  NZ  . LYS A 1 49 ? 26.836 -4.572 3.536   1.00 47.21 ? 49   LYS A NZ  1 
ATOM   401 N  N   . GLY A 1 50 ? 28.376 -3.770 10.789  1.00 25.11 ? 50   GLY A N   1 
ATOM   402 C  CA  . GLY A 1 50 ? 29.131 -3.197 11.899  1.00 24.25 ? 50   GLY A CA  1 
ATOM   403 C  C   . GLY A 1 50 ? 28.915 -1.702 12.071  1.00 24.23 ? 50   GLY A C   1 
ATOM   404 O  O   . GLY A 1 50 ? 29.772 -1.028 12.649  1.00 25.56 ? 50   GLY A O   1 
ATOM   405 N  N   . THR A 1 51 ? 27.759 -1.193 11.621  1.00 20.83 ? 51   THR A N   1 
ATOM   406 C  CA  . THR A 1 51 ? 27.415 0.250  11.738  1.00 18.50 ? 51   THR A CA  1 
ATOM   407 C  C   . THR A 1 51 ? 26.182 0.390  12.581  1.00 18.05 ? 51   THR A C   1 
ATOM   408 O  O   . THR A 1 51 ? 25.133 -0.214 12.281  1.00 18.46 ? 51   THR A O   1 
ATOM   409 C  CB  . THR A 1 51 ? 27.175 0.880  10.335  1.00 20.42 ? 51   THR A CB  1 
ATOM   410 O  OG1 . THR A 1 51 ? 28.411 0.893  9.575   1.00 21.98 ? 51   THR A OG1 1 
ATOM   411 C  CG2 . THR A 1 51 ? 26.540 2.342  10.402  1.00 19.43 ? 51   THR A CG2 1 
ATOM   412 N  N   . ASN A 1 52 ? 26.264 1.153  13.655  1.00 16.28 ? 52   ASN A N   1 
ATOM   413 C  CA  . ASN A 1 52 ? 25.115 1.416  14.503  1.00 15.98 ? 52   ASN A CA  1 
ATOM   414 C  C   . ASN A 1 52 ? 24.636 2.770  14.057  1.00 16.18 ? 52   ASN A C   1 
ATOM   415 O  O   . ASN A 1 52 ? 25.131 3.806  14.494  1.00 15.69 ? 52   ASN A O   1 
ATOM   416 C  CB  . ASN A 1 52 ? 25.431 1.478  15.977  1.00 20.58 ? 52   ASN A CB  1 
ATOM   417 C  CG  . ASN A 1 52 ? 24.202 1.648  16.832  1.00 23.38 ? 52   ASN A CG  1 
ATOM   418 O  OD1 . ASN A 1 52 ? 24.205 1.100  17.985  1.00 33.53 ? 52   ASN A OD1 1 
ATOM   419 N  ND2 . ASN A 1 52 ? 23.078 2.354  16.336  1.00 24.04 ? 52   ASN A ND2 1 
ATOM   420 N  N   . TYR A 1 53 ? 23.676 2.764  13.115  1.00 13.16 ? 53   TYR A N   1 
ATOM   421 C  CA  . TYR A 1 53 ? 23.277 4.062  12.569  1.00 12.23 ? 53   TYR A CA  1 
ATOM   422 C  C   . TYR A 1 53 ? 22.674 5.055  13.562  1.00 11.16 ? 53   TYR A C   1 
ATOM   423 O  O   . TYR A 1 53 ? 22.712 6.281  13.261  1.00 13.17 ? 53   TYR A O   1 
ATOM   424 C  CB  . TYR A 1 53 ? 22.163 3.711  11.481  1.00 12.76 ? 53   TYR A CB  1 
ATOM   425 C  CG  . TYR A 1 53 ? 21.926 4.720  10.403  1.00 13.27 ? 53   TYR A CG  1 
ATOM   426 C  CD1 . TYR A 1 53 ? 22.681 4.660  9.227   1.00 12.38 ? 53   TYR A CD1 1 
ATOM   427 C  CD2 . TYR A 1 53 ? 20.842 5.680  10.519  1.00 15.00 ? 53   TYR A CD2 1 
ATOM   428 C  CE1 . TYR A 1 53 ? 22.433 5.573  8.182   1.00 14.77 ? 53   TYR A CE1 1 
ATOM   429 C  CE2 . TYR A 1 53 ? 20.599 6.594  9.468   1.00 12.23 ? 53   TYR A CE2 1 
ATOM   430 C  CZ  . TYR A 1 53 ? 21.382 6.538  8.320   1.00 14.30 ? 53   TYR A CZ  1 
ATOM   431 O  OH  . TYR A 1 53 ? 21.213 7.437  7.241   1.00 18.46 ? 53   TYR A OH  1 
ATOM   432 N  N   . LEU A 1 54 ? 22.075 4.585  14.690  1.00 9.81  ? 54   LEU A N   1 
ATOM   433 C  CA  . LEU A 1 54 ? 21.417 5.478  15.624  1.00 10.22 ? 54   LEU A CA  1 
ATOM   434 C  C   . LEU A 1 54 ? 22.477 6.173  16.515  1.00 9.74  ? 54   LEU A C   1 
ATOM   435 O  O   . LEU A 1 54 ? 22.134 7.069  17.231  1.00 13.51 ? 54   LEU A O   1 
ATOM   436 C  CB  . LEU A 1 54 ? 20.427 4.712  16.455  1.00 12.13 ? 54   LEU A CB  1 
ATOM   437 C  CG  . LEU A 1 54 ? 19.346 3.987  15.642  1.00 16.22 ? 54   LEU A CG  1 
ATOM   438 C  CD1 . LEU A 1 54 ? 18.239 3.467  16.586  1.00 18.43 ? 54   LEU A CD1 1 
ATOM   439 C  CD2 . LEU A 1 54 ? 18.708 4.902  14.601  1.00 18.91 ? 54   LEU A CD2 1 
ATOM   440 N  N   . ALA A 1 55 ? 23.699 5.669  16.510  1.00 10.86 ? 55   ALA A N   1 
ATOM   441 C  CA  . ALA A 1 55 ? 24.687 6.332  17.437  1.00 10.47 ? 55   ALA A CA  1 
ATOM   442 C  C   . ALA A 1 55 ? 24.860 7.808  17.048  1.00 10.09 ? 55   ALA A C   1 
ATOM   443 O  O   . ALA A 1 55 ? 25.015 8.698  17.953  1.00 12.46 ? 55   ALA A O   1 
ATOM   444 C  CB  . ALA A 1 55 ? 26.030 5.575  17.375  1.00 9.01  ? 55   ALA A CB  1 
ATOM   445 N  N   . ASP A 1 56 ? 24.966 8.074  15.725  1.00 9.84  ? 56   ASP A N   1 
ATOM   446 C  CA  . ASP A 1 56 ? 25.258 9.434  15.260  1.00 8.63  ? 56   ASP A CA  1 
ATOM   447 C  C   . ASP A 1 56 ? 24.235 10.155 14.409  1.00 8.31  ? 56   ASP A C   1 
ATOM   448 O  O   . ASP A 1 56 ? 24.470 11.338 14.075  1.00 9.37  ? 56   ASP A O   1 
ATOM   449 C  CB  . ASP A 1 56 ? 26.591 9.452  14.474  1.00 9.16  ? 56   ASP A CB  1 
ATOM   450 C  CG  . ASP A 1 56 ? 26.515 8.655  13.163  1.00 14.07 ? 56   ASP A CG  1 
ATOM   451 O  OD1 . ASP A 1 56 ? 25.642 7.738  13.082  1.00 12.38 ? 56   ASP A OD1 1 
ATOM   452 O  OD2 . ASP A 1 56 ? 27.368 8.901  12.277  1.00 13.28 ? 56   ASP A OD2 1 
ATOM   453 N  N   . VAL A 1 57 ? 23.111 9.452  14.158  1.00 8.37  ? 57   VAL A N   1 
ATOM   454 C  CA  . VAL A 1 57 ? 22.181 10.103 13.175  1.00 8.00  ? 57   VAL A CA  1 
ATOM   455 C  C   . VAL A 1 57 ? 21.701 11.444 13.619  1.00 7.30  ? 57   VAL A C   1 
ATOM   456 O  O   . VAL A 1 57 ? 21.607 12.432 12.790  1.00 8.03  ? 57   VAL A O   1 
ATOM   457 C  CB  . VAL A 1 57 ? 21.047 9.089  12.808  1.00 7.64  ? 57   VAL A CB  1 
ATOM   458 C  CG1 . VAL A 1 57 ? 20.195 8.797  14.020  1.00 9.18  ? 57   VAL A CG1 1 
ATOM   459 C  CG2 . VAL A 1 57 ? 20.125 9.708  11.682  1.00 9.69  ? 57   VAL A CG2 1 
ATOM   460 N  N   . PHE A 1 58 ? 21.373 11.603 14.925  1.00 8.18  ? 58   PHE A N   1 
ATOM   461 C  CA  . PHE A 1 58 ? 20.855 12.890 15.345  1.00 8.85  ? 58   PHE A CA  1 
ATOM   462 C  C   . PHE A 1 58 ? 21.901 14.031 15.193  1.00 7.86  ? 58   PHE A C   1 
ATOM   463 O  O   . PHE A 1 58 ? 21.588 15.129 14.690  1.00 9.69  ? 58   PHE A O   1 
ATOM   464 C  CB  . PHE A 1 58 ? 20.392 12.768 16.821  1.00 7.94  ? 58   PHE A CB  1 
ATOM   465 C  CG  . PHE A 1 58 ? 19.663 13.997 17.285  1.00 10.13 ? 58   PHE A CG  1 
ATOM   466 C  CD1 . PHE A 1 58 ? 18.304 14.117 17.090  1.00 10.14 ? 58   PHE A CD1 1 
ATOM   467 C  CD2 . PHE A 1 58 ? 20.370 15.068 17.872  1.00 10.02 ? 58   PHE A CD2 1 
ATOM   468 C  CE1 . PHE A 1 58 ? 17.571 15.240 17.478  1.00 10.79 ? 58   PHE A CE1 1 
ATOM   469 C  CE2 . PHE A 1 58 ? 19.677 16.313 18.241  1.00 13.07 ? 58   PHE A CE2 1 
ATOM   470 C  CZ  . PHE A 1 58 ? 18.220 16.387 18.042  1.00 13.56 ? 58   PHE A CZ  1 
ATOM   471 N  N   . GLU A 1 59 ? 23.159 13.727 15.557  1.00 10.09 ? 59   GLU A N   1 
ATOM   472 C  CA  . GLU A 1 59 ? 24.166 14.742 15.437  1.00 8.32  ? 59   GLU A CA  1 
ATOM   473 C  C   . GLU A 1 59 ? 24.589 15.085 13.993  1.00 8.82  ? 59   GLU A C   1 
ATOM   474 O  O   . GLU A 1 59 ? 24.864 16.247 13.670  1.00 9.67  ? 59   GLU A O   1 
ATOM   475 C  CB  . GLU A 1 59 ? 25.406 14.278 16.201  1.00 9.47  ? 59   GLU A CB  1 
ATOM   476 C  CG  . GLU A 1 59 ? 25.124 14.306 17.761  1.00 10.81 ? 59   GLU A CG  1 
ATOM   477 C  CD  . GLU A 1 59 ? 24.189 13.251 18.263  1.00 9.08  ? 59   GLU A CD  1 
ATOM   478 O  OE1 . GLU A 1 59 ? 24.269 12.049 17.736  1.00 10.33 ? 59   GLU A OE1 1 
ATOM   479 O  OE2 . GLU A 1 59 ? 23.393 13.592 19.231  1.00 12.58 ? 59   GLU A OE2 1 
ATOM   480 N  N   . LYS A 1 60 ? 24.508 14.069 13.152  1.00 8.44  ? 60   LYS A N   1 
ATOM   481 C  CA  . LYS A 1 60 ? 24.701 14.317 11.769  1.00 8.69  ? 60   LYS A CA  1 
ATOM   482 C  C   . LYS A 1 60 ? 23.614 15.177 11.089  1.00 8.09  ? 60   LYS A C   1 
ATOM   483 O  O   . LYS A 1 60 ? 23.939 15.935 10.112  1.00 10.26 ? 60   LYS A O   1 
ATOM   484 C  CB  . LYS A 1 60 ? 24.864 13.002 11.011  1.00 9.81  ? 60   LYS A CB  1 
ATOM   485 C  CG  . LYS A 1 60 ? 26.156 12.158 11.406  1.00 9.40  ? 60   LYS A CG  1 
ATOM   486 C  CD  . LYS A 1 60 ? 27.440 12.951 11.014  1.00 11.26 ? 60   LYS A CD  1 
ATOM   487 C  CE  . LYS A 1 60 ? 28.633 11.970 10.839  1.00 10.91 ? 60   LYS A CE  1 
ATOM   488 N  NZ  . LYS A 1 60 ? 28.859 11.075 11.975  1.00 11.00 ? 60   LYS A NZ  1 
ATOM   489 N  N   . LYS A 1 61 ? 22.356 14.942 11.519  1.00 8.22  ? 61   LYS A N   1 
ATOM   490 C  CA  . LYS A 1 61 ? 21.268 15.544 10.739  1.00 9.04  ? 61   LYS A CA  1 
ATOM   491 C  C   . LYS A 1 61 ? 20.740 16.835 11.359  1.00 7.82  ? 61   LYS A C   1 
ATOM   492 O  O   . LYS A 1 61 ? 19.979 17.568 10.714  1.00 9.82  ? 61   LYS A O   1 
ATOM   493 C  CB  . LYS A 1 61 ? 20.116 14.591 10.598  1.00 8.63  ? 61   LYS A CB  1 
ATOM   494 C  CG  . LYS A 1 61 ? 20.615 13.344 9.763   1.00 10.59 ? 61   LYS A CG  1 
ATOM   495 C  CD  . LYS A 1 61 ? 21.482 13.642 8.468   1.00 13.52 ? 61   LYS A CD  1 
ATOM   496 C  CE  . LYS A 1 61 ? 20.611 14.384 7.494   1.00 13.02 ? 61   LYS A CE  1 
ATOM   497 N  NZ  . LYS A 1 61 ? 21.695 14.409 6.296   1.00 14.35 ? 61   LYS A NZ  1 
ATOM   498 N  N   . ASP A 1 62 ? 21.089 17.064 12.646  1.00 9.22  ? 62   ASP A N   1 
ATOM   499 C  CA  . ASP A 1 62 ? 20.733 18.335 13.285  1.00 9.96  ? 62   ASP A CA  1 
ATOM   500 C  C   . ASP A 1 62 ? 21.645 19.463 12.830  1.00 11.09 ? 62   ASP A C   1 
ATOM   501 O  O   . ASP A 1 62 ? 22.591 19.866 13.528  1.00 9.69  ? 62   ASP A O   1 
ATOM   502 C  CB  . ASP A 1 62 ? 20.666 18.200 14.825  1.00 9.61  ? 62   ASP A CB  1 
ATOM   503 C  CG  . ASP A 1 62 ? 20.306 19.535 15.510  1.00 11.34 ? 62   ASP A CG  1 
ATOM   504 O  OD1 . ASP A 1 62 ? 19.711 20.470 14.877  1.00 9.16  ? 62   ASP A OD1 1 
ATOM   505 O  OD2 . ASP A 1 62 ? 20.792 19.584 16.685  1.00 10.25 ? 62   ASP A OD2 1 
ATOM   506 N  N   . LYS A 1 63 ? 21.425 19.948 11.619  1.00 8.47  ? 63   LYS A N   1 
ATOM   507 C  CA  . LYS A 1 63 ? 22.415 20.786 10.883  1.00 12.35 ? 63   LYS A CA  1 
ATOM   508 C  C   . LYS A 1 63 ? 22.604 22.108 11.628  1.00 11.92 ? 63   LYS A C   1 
ATOM   509 O  O   . LYS A 1 63 ? 23.745 22.592 11.748  1.00 14.07 ? 63   LYS A O   1 
ATOM   510 C  CB  . LYS A 1 63 ? 21.897 20.985 9.470   1.00 13.37 ? 63   LYS A CB  1 
ATOM   511 C  CG  . LYS A 1 63 ? 22.815 21.823 8.600   1.00 18.74 ? 63   LYS A CG  1 
ATOM   512 C  CD  . LYS A 1 63 ? 22.175 21.838 7.201   1.00 22.33 ? 63   LYS A CD  1 
ATOM   513 C  CE  . LYS A 1 63 ? 22.709 22.966 6.287   1.00 29.88 ? 63   LYS A CE  1 
ATOM   514 N  NZ  . LYS A 1 63 ? 24.035 22.502 5.838   1.00 39.03 ? 63   LYS A NZ  1 
ATOM   515 N  N   . ASN A 1 64 ? 21.490 22.678 12.163  1.00 10.78 ? 64   ASN A N   1 
ATOM   516 C  CA  . ASN A 1 64 ? 21.588 24.016 12.763  1.00 10.56 ? 64   ASN A CA  1 
ATOM   517 C  C   . ASN A 1 64 ? 21.864 23.909 14.294  1.00 10.70 ? 64   ASN A C   1 
ATOM   518 O  O   . ASN A 1 64 ? 21.931 24.983 15.030  1.00 13.35 ? 64   ASN A O   1 
ATOM   519 C  CB  . ASN A 1 64 ? 20.336 24.896 12.479  1.00 11.41 ? 64   ASN A CB  1 
ATOM   520 C  CG  . ASN A 1 64 ? 19.095 24.370 13.156  1.00 12.28 ? 64   ASN A CG  1 
ATOM   521 O  OD1 . ASN A 1 64 ? 19.057 23.255 13.676  1.00 10.16 ? 64   ASN A OD1 1 
ATOM   522 N  ND2 . ASN A 1 64 ? 18.015 25.215 13.170  1.00 19.50 ? 64   ASN A ND2 1 
ATOM   523 N  N   . GLU A 1 65 ? 22.055 22.698 14.795  1.00 9.77  ? 65   GLU A N   1 
ATOM   524 C  CA  . GLU A 1 65 ? 22.449 22.432 16.229  1.00 10.85 ? 65   GLU A CA  1 
ATOM   525 C  C   . GLU A 1 65 ? 21.511 23.057 17.253  1.00 12.65 ? 65   GLU A C   1 
ATOM   526 O  O   . GLU A 1 65 ? 21.957 23.544 18.334  1.00 14.17 ? 65   GLU A O   1 
ATOM   527 C  CB  . GLU A 1 65 ? 23.903 22.884 16.440  1.00 11.57 ? 65   GLU A CB  1 
ATOM   528 C  CG  . GLU A 1 65 ? 24.838 22.162 15.438  1.00 10.43 ? 65   GLU A CG  1 
ATOM   529 C  CD  . GLU A 1 65 ? 26.350 22.359 15.575  1.00 12.82 ? 65   GLU A CD  1 
ATOM   530 O  OE1 . GLU A 1 65 ? 26.715 23.207 16.477  1.00 13.93 ? 65   GLU A OE1 1 
ATOM   531 O  OE2 . GLU A 1 65 ? 27.139 21.763 14.774  1.00 14.37 ? 65   GLU A OE2 1 
ATOM   532 N  N   . ASP A 1 66 ? 20.222 23.085 16.946  1.00 10.12 ? 66   ASP A N   1 
ATOM   533 C  CA  . ASP A 1 66 ? 19.240 23.520 17.923  1.00 13.77 ? 66   ASP A CA  1 
ATOM   534 C  C   . ASP A 1 66 ? 18.681 22.366 18.739  1.00 11.63 ? 66   ASP A C   1 
ATOM   535 O  O   . ASP A 1 66 ? 17.721 22.527 19.512  1.00 13.42 ? 66   ASP A O   1 
ATOM   536 C  CB  . ASP A 1 66 ? 18.129 24.355 17.223  1.00 12.92 ? 66   ASP A CB  1 
ATOM   537 C  CG  . ASP A 1 66 ? 17.241 23.561 16.243  1.00 12.17 ? 66   ASP A CG  1 
ATOM   538 O  OD1 . ASP A 1 66 ? 17.475 22.337 16.092  1.00 10.58 ? 66   ASP A OD1 1 
ATOM   539 O  OD2 . ASP A 1 66 ? 16.262 24.217 15.682  1.00 14.89 ? 66   ASP A OD2 1 
ATOM   540 N  N   . LYS A 1 67 ? 19.242 21.144 18.536  1.00 12.64 ? 67   LYS A N   1 
ATOM   541 C  CA  . LYS A 1 67 ? 18.850 19.916 19.283  1.00 12.98 ? 67   LYS A CA  1 
ATOM   542 C  C   . LYS A 1 67 ? 17.395 19.455 18.994  1.00 12.25 ? 67   LYS A C   1 
ATOM   543 O  O   . LYS A 1 67 ? 16.688 18.822 19.860  1.00 13.89 ? 67   LYS A O   1 
ATOM   544 C  CB  . LYS A 1 67 ? 19.082 20.147 20.837  1.00 12.82 ? 67   LYS A CB  1 
ATOM   545 C  CG  . LYS A 1 67 ? 20.568 20.457 21.076  1.00 15.56 ? 67   LYS A CG  1 
ATOM   546 C  CD  . LYS A 1 67 ? 21.448 19.270 20.666  1.00 22.40 ? 67   LYS A CD  1 
ATOM   547 C  CE  . LYS A 1 67 ? 22.876 19.573 20.911  1.00 22.91 ? 67   LYS A CE  1 
ATOM   548 N  NZ  . LYS A 1 67 ? 23.668 18.526 20.201  1.00 16.53 ? 67   LYS A NZ  1 
ATOM   549 N  N   . LYS A 1 68 ? 16.929 19.769 17.776  1.00 11.77 ? 68   LYS A N   1 
ATOM   550 C  CA  . LYS A 1 68 ? 15.623 19.269 17.303  1.00 12.10 ? 68   LYS A CA  1 
ATOM   551 C  C   . LYS A 1 68 ? 15.827 18.966 15.809  1.00 10.79 ? 68   LYS A C   1 
ATOM   552 O  O   . LYS A 1 68 ? 16.737 19.496 15.204  1.00 13.05 ? 68   LYS A O   1 
ATOM   553 C  CB  . LYS A 1 68 ? 14.530 20.361 17.386  1.00 15.01 ? 68   LYS A CB  1 
ATOM   554 C  CG  . LYS A 1 68 ? 14.323 20.920 18.816  1.00 18.21 ? 68   LYS A CG  1 
ATOM   555 C  CD  . LYS A 1 68 ? 13.747 19.825 19.663  1.00 27.77 ? 68   LYS A CD  1 
ATOM   556 C  CE  . LYS A 1 68 ? 12.901 20.512 20.804  1.00 34.94 ? 68   LYS A CE  1 
ATOM   557 N  NZ  . LYS A 1 68 ? 12.546 19.492 21.777  1.00 30.51 ? 68   LYS A NZ  1 
ATOM   558 N  N   . ILE A 1 69 ? 15.055 18.001 15.292  1.00 10.17 ? 69   ILE A N   1 
ATOM   559 C  CA  . ILE A 1 69 ? 15.086 17.763 13.825  1.00 9.81  ? 69   ILE A CA  1 
ATOM   560 C  C   . ILE A 1 69 ? 13.794 18.400 13.246  1.00 8.92  ? 69   ILE A C   1 
ATOM   561 O  O   . ILE A 1 69 ? 12.651 17.963 13.549  1.00 10.68 ? 69   ILE A O   1 
ATOM   562 C  CB  . ILE A 1 69 ? 15.097 16.253 13.618  1.00 7.79  ? 69   ILE A CB  1 
ATOM   563 C  CG1 . ILE A 1 69 ? 16.430 15.622 14.119  1.00 13.09 ? 69   ILE A CG1 1 
ATOM   564 C  CG2 . ILE A 1 69 ? 14.917 15.899 12.075  1.00 10.26 ? 69   ILE A CG2 1 
ATOM   565 C  CD1 . ILE A 1 69 ? 17.728 16.183 13.454  1.00 13.02 ? 69   ILE A CD1 1 
ATOM   566 N  N   . ASP A 1 70 ? 13.932 19.427 12.400  1.00 8.41  ? 70   ASP A N   1 
ATOM   567 C  CA  . ASP A 1 70 ? 12.773 20.046 11.783  1.00 8.64  ? 70   ASP A CA  1 
ATOM   568 C  C   . ASP A 1 70 ? 12.542 19.337 10.445  1.00 9.90  ? 70   ASP A C   1 
ATOM   569 O  O   . ASP A 1 70 ? 13.232 18.338 10.095  1.00 9.40  ? 70   ASP A O   1 
ATOM   570 C  CB  . ASP A 1 70 ? 12.982 21.569 11.618  1.00 8.82  ? 70   ASP A CB  1 
ATOM   571 C  CG  . ASP A 1 70 ? 14.220 21.923 10.735  1.00 14.50 ? 70   ASP A CG  1 
ATOM   572 O  OD1 . ASP A 1 70 ? 14.501 21.217 9.757   1.00 11.29 ? 70   ASP A OD1 1 
ATOM   573 O  OD2 . ASP A 1 70 ? 14.857 22.985 10.986  1.00 16.04 ? 70   ASP A OD2 1 
ATOM   574 N  N   . PHE A 1 71 ? 11.450 19.766 9.801   1.00 10.14 ? 71   PHE A N   1 
ATOM   575 C  CA  . PHE A 1 71 ? 11.035 19.014 8.592   1.00 8.97  ? 71   PHE A CA  1 
ATOM   576 C  C   . PHE A 1 71 ? 12.125 18.966 7.518   1.00 8.23  ? 71   PHE A C   1 
ATOM   577 O  O   . PHE A 1 71 ? 12.294 17.901 6.904   1.00 7.92  ? 71   PHE A O   1 
ATOM   578 C  CB  . PHE A 1 71 ? 9.736  19.659 8.039   1.00 9.40  ? 71   PHE A CB  1 
ATOM   579 C  CG  . PHE A 1 71 ? 9.088  18.815 6.999   1.00 7.69  ? 71   PHE A CG  1 
ATOM   580 C  CD1 . PHE A 1 71 ? 8.501  17.616 7.299   1.00 8.81  ? 71   PHE A CD1 1 
ATOM   581 C  CD2 . PHE A 1 71 ? 9.181  19.205 5.656   1.00 10.35 ? 71   PHE A CD2 1 
ATOM   582 C  CE1 . PHE A 1 71 ? 7.899  16.733 6.315   1.00 10.13 ? 71   PHE A CE1 1 
ATOM   583 C  CE2 . PHE A 1 71 ? 8.598  18.356 4.641   1.00 9.25  ? 71   PHE A CE2 1 
ATOM   584 C  CZ  . PHE A 1 71 ? 7.971  17.125 4.969   1.00 10.10 ? 71   PHE A CZ  1 
ATOM   585 N  N   . SER A 1 72 ? 12.795 20.074 7.352   1.00 9.17  ? 72   SER A N   1 
ATOM   586 C  CA  . SER A 1 72 ? 13.883 20.100 6.350   1.00 8.01  ? 72   SER A CA  1 
ATOM   587 C  C   . SER A 1 72 ? 14.992 19.072 6.640   1.00 9.29  ? 72   SER A C   1 
ATOM   588 O  O   . SER A 1 72 ? 15.481 18.398 5.719   1.00 8.18  ? 72   SER A O   1 
ATOM   589 C  CB  . SER A 1 72 ? 14.395 21.504 6.152   1.00 8.77  ? 72   SER A CB  1 
ATOM   590 O  OG  . SER A 1 72 ? 15.244 22.006 7.183   1.00 11.72 ? 72   SER A OG  1 
ATOM   591 N  N   . GLU A 1 73 ? 15.338 18.975 7.917   1.00 8.11  ? 73   GLU A N   1 
ATOM   592 C  CA  . GLU A 1 73 ? 16.379 18.017 8.384   1.00 7.64  ? 73   GLU A CA  1 
ATOM   593 C  C   . GLU A 1 73 ? 15.884 16.597 8.265   1.00 7.57  ? 73   GLU A C   1 
ATOM   594 O  O   . GLU A 1 73 ? 16.623 15.690 7.869   1.00 8.72  ? 73   GLU A O   1 
ATOM   595 C  CB  . GLU A 1 73 ? 16.758 18.399 9.824   1.00 7.76  ? 73   GLU A CB  1 
ATOM   596 C  CG  . GLU A 1 73 ? 17.517 19.717 9.884   1.00 9.08  ? 73   GLU A CG  1 
ATOM   597 C  CD  . GLU A 1 73 ? 17.709 20.239 11.302  1.00 8.97  ? 73   GLU A CD  1 
ATOM   598 O  OE1 . GLU A 1 73 ? 16.918 19.816 12.199  1.00 10.17 ? 73   GLU A OE1 1 
ATOM   599 O  OE2 . GLU A 1 73 ? 18.607 21.088 11.554  1.00 10.78 ? 73   GLU A OE2 1 
ATOM   600 N  N   . PHE A 1 74 ? 14.607 16.380 8.575   1.00 6.99  ? 74   PHE A N   1 
ATOM   601 C  CA  . PHE A 1 74 ? 13.984 15.048 8.377   1.00 7.16  ? 74   PHE A CA  1 
ATOM   602 C  C   . PHE A 1 74 ? 14.029 14.675 6.849   1.00 7.25  ? 74   PHE A C   1 
ATOM   603 O  O   . PHE A 1 74 ? 14.323 13.532 6.541   1.00 7.34  ? 74   PHE A O   1 
ATOM   604 C  CB  . PHE A 1 74 ? 12.537 15.206 8.888   1.00 8.79  ? 74   PHE A CB  1 
ATOM   605 C  CG  . PHE A 1 74 ? 11.629 14.016 8.518   1.00 7.34  ? 74   PHE A CG  1 
ATOM   606 C  CD1 . PHE A 1 74 ? 11.741 12.779 9.181   1.00 11.81 ? 74   PHE A CD1 1 
ATOM   607 C  CD2 . PHE A 1 74 ? 10.668 14.153 7.527   1.00 9.69  ? 74   PHE A CD2 1 
ATOM   608 C  CE1 . PHE A 1 74 ? 10.851 11.653 8.864   1.00 11.50 ? 74   PHE A CE1 1 
ATOM   609 C  CE2 . PHE A 1 74 ? 9.759  13.106 7.226   1.00 10.23 ? 74   PHE A CE2 1 
ATOM   610 C  CZ  . PHE A 1 74 ? 9.844  11.842 7.843   1.00 9.64  ? 74   PHE A CZ  1 
ATOM   611 N  N   . LEU A 1 75 ? 13.729 15.640 5.969   1.00 8.45  ? 75   LEU A N   1 
ATOM   612 C  CA  . LEU A 1 75 ? 13.794 15.320 4.534   1.00 7.70  ? 75   LEU A CA  1 
ATOM   613 C  C   . LEU A 1 75 ? 15.247 14.990 4.161   1.00 7.56  ? 75   LEU A C   1 
ATOM   614 O  O   . LEU A 1 75 ? 15.439 13.982 3.395   1.00 8.93  ? 75   LEU A O   1 
ATOM   615 C  CB  . LEU A 1 75 ? 13.299 16.463 3.676   1.00 7.52  ? 75   LEU A CB  1 
ATOM   616 C  CG  . LEU A 1 75 ? 11.832 16.788 3.687   1.00 8.93  ? 75   LEU A CG  1 
ATOM   617 C  CD1 . LEU A 1 75 ? 11.560 17.986 2.668   1.00 10.52 ? 75   LEU A CD1 1 
ATOM   618 C  CD2 . LEU A 1 75 ? 11.019 15.584 3.239   1.00 13.31 ? 75   LEU A CD2 1 
ATOM   619 N  N   . SER A 1 76 ? 16.244 15.658 4.780   1.00 8.12  ? 76   SER A N   1 
ATOM   620 C  CA  . SER A 1 76 ? 17.614 15.270 4.456   1.00 7.84  ? 76   SER A CA  1 
ATOM   621 C  C   . SER A 1 76 ? 17.968 13.845 4.927   1.00 7.57  ? 76   SER A C   1 
ATOM   622 O  O   . SER A 1 76 ? 18.666 13.068 4.219   1.00 8.80  ? 76   SER A O   1 
ATOM   623 C  CB  . SER A 1 76 ? 18.531 16.311 5.131   1.00 9.37  ? 76   SER A CB  1 
ATOM   624 O  OG  . SER A 1 76 ? 19.896 16.061 4.683   1.00 12.26 ? 76   SER A OG  1 
ATOM   625 N  N   . LEU A 1 77 ? 17.395 13.439 6.058   1.00 7.15  ? 77   LEU A N   1 
ATOM   626 C  CA  . LEU A 1 77 ? 17.581 12.071 6.559   1.00 6.62  ? 77   LEU A CA  1 
ATOM   627 C  C   . LEU A 1 77 ? 16.913 11.086 5.567   1.00 7.31  ? 77   LEU A C   1 
ATOM   628 O  O   . LEU A 1 77 ? 17.549 10.078 5.230   1.00 7.84  ? 77   LEU A O   1 
ATOM   629 C  CB  . LEU A 1 77 ? 16.952 12.006 7.995   1.00 6.01  ? 77   LEU A CB  1 
ATOM   630 C  CG  . LEU A 1 77 ? 16.815 10.557 8.536   1.00 9.98  ? 77   LEU A CG  1 
ATOM   631 C  CD1 . LEU A 1 77 ? 18.085 9.761  8.628   1.00 16.60 ? 77   LEU A CD1 1 
ATOM   632 C  CD2 . LEU A 1 77 ? 16.202 10.712 9.952   1.00 12.98 ? 77   LEU A CD2 1 
ATOM   633 N  N   . LEU A 1 78 ? 15.674 11.385 5.127   1.00 6.68  ? 78   LEU A N   1 
ATOM   634 C  CA  . LEU A 1 78 ? 15.021 10.445 4.171   1.00 7.01  ? 78   LEU A CA  1 
ATOM   635 C  C   . LEU A 1 78 ? 15.874 10.395 2.872   1.00 7.47  ? 78   LEU A C   1 
ATOM   636 O  O   . LEU A 1 78 ? 15.988 9.308  2.289   1.00 8.10  ? 78   LEU A O   1 
ATOM   637 C  CB  . LEU A 1 78 ? 13.609 10.917 3.816   1.00 8.59  ? 78   LEU A CB  1 
ATOM   638 C  CG  . LEU A 1 78 ? 12.661 10.925 5.046   1.00 7.65  ? 78   LEU A CG  1 
ATOM   639 C  CD1 . LEU A 1 78 ? 11.343 11.339 4.436   1.00 8.05  ? 78   LEU A CD1 1 
ATOM   640 C  CD2 . LEU A 1 78 ? 12.569 9.491  5.642   1.00 10.29 ? 78   LEU A CD2 1 
ATOM   641 N  N   . GLY A 1 79 ? 16.437 11.528 2.496   1.00 7.89  ? 79   GLY A N   1 
ATOM   642 C  CA  . GLY A 1 79 ? 17.340 11.494 1.277   1.00 8.31  ? 79   GLY A CA  1 
ATOM   643 C  C   . GLY A 1 79 ? 18.557 10.611 1.453   1.00 9.39  ? 79   GLY A C   1 
ATOM   644 O  O   . GLY A 1 79 ? 18.948 9.890  0.540   1.00 9.47  ? 79   GLY A O   1 
ATOM   645 N  N   . ASP A 1 80 ? 19.125 10.625 2.663   1.00 7.99  ? 80   ASP A N   1 
ATOM   646 C  CA  . ASP A 1 80 ? 20.248 9.713  2.921   1.00 7.71  ? 80   ASP A CA  1 
ATOM   647 C  C   . ASP A 1 80 ? 19.850 8.226  2.816   1.00 7.65  ? 80   ASP A C   1 
ATOM   648 O  O   . ASP A 1 80 ? 20.593 7.428  2.245   1.00 9.37  ? 80   ASP A O   1 
ATOM   649 C  CB  . ASP A 1 80 ? 20.869 9.969  4.308   1.00 9.29  ? 80   ASP A CB  1 
ATOM   650 C  CG  . ASP A 1 80 ? 21.538 11.317 4.421   1.00 14.02 ? 80   ASP A CG  1 
ATOM   651 O  OD1 . ASP A 1 80 ? 21.940 11.929 3.421   1.00 12.53 ? 80   ASP A OD1 1 
ATOM   652 O  OD2 . ASP A 1 80 ? 21.795 11.718 5.622   1.00 13.45 ? 80   ASP A OD2 1 
ATOM   653 N  N   . ILE A 1 81 ? 18.694 7.890  3.403   1.00 8.47  ? 81   ILE A N   1 
ATOM   654 C  CA  . ILE A 1 81 ? 18.236 6.492  3.402   1.00 7.25  ? 81   ILE A CA  1 
ATOM   655 C  C   . ILE A 1 81 ? 17.923 6.160  1.945   1.00 8.15  ? 81   ILE A C   1 
ATOM   656 O  O   . ILE A 1 81 ? 18.291 5.042  1.484   1.00 9.09  ? 81   ILE A O   1 
ATOM   657 C  CB  . ILE A 1 81 ? 16.983 6.384  4.258   1.00 9.00  ? 81   ILE A CB  1 
ATOM   658 C  CG1 . ILE A 1 81 ? 17.368 6.595  5.736   1.00 8.98  ? 81   ILE A CG1 1 
ATOM   659 C  CG2 . ILE A 1 81 ? 16.357 4.956  4.148   1.00 10.65 ? 81   ILE A CG2 1 
ATOM   660 C  CD1 . ILE A 1 81 ? 16.095 6.842  6.689   1.00 11.96 ? 81   ILE A CD1 1 
ATOM   661 N  N   . ALA A 1 82 ? 17.259 7.058  1.214   1.00 8.70  ? 82   ALA A N   1 
ATOM   662 C  CA  . ALA A 1 82 ? 16.959 6.747  -0.200  1.00 8.60  ? 82   ALA A CA  1 
ATOM   663 C  C   . ALA A 1 82 ? 18.215 6.578  -0.998  1.00 8.33  ? 82   ALA A C   1 
ATOM   664 O  O   . ALA A 1 82 ? 18.311 5.750  -1.904  1.00 9.09  ? 82   ALA A O   1 
ATOM   665 C  CB  . ALA A 1 82 ? 16.160 7.952  -0.815  1.00 8.52  ? 82   ALA A CB  1 
ATOM   666 N  N   . THR A 1 83 ? 19.234 7.412  -0.728  1.00 8.17  ? 83   THR A N   1 
ATOM   667 C  CA  . THR A 1 83 ? 20.505 7.325  -1.472  1.00 9.30  ? 83   THR A CA  1 
ATOM   668 C  C   . THR A 1 83 ? 21.149 5.940  -1.232  1.00 8.72  ? 83   THR A C   1 
ATOM   669 O  O   . THR A 1 83 ? 21.641 5.319  -2.160  1.00 10.93 ? 83   THR A O   1 
ATOM   670 C  CB  . THR A 1 83 ? 21.396 8.502  -1.099  1.00 9.03  ? 83   THR A CB  1 
ATOM   671 O  OG1 . THR A 1 83 ? 20.786 9.697  -1.614  1.00 9.82  ? 83   THR A OG1 1 
ATOM   672 C  CG2 . THR A 1 83 ? 22.768 8.400  -1.891  1.00 10.73 ? 83   THR A CG2 1 
ATOM   673 N  N   . ASP A 1 84 ? 21.104 5.434  0.000   1.00 9.84  ? 84   ASP A N   1 
ATOM   674 C  CA  . ASP A 1 84 ? 21.611 4.110  0.296   1.00 12.43 ? 84   ASP A CA  1 
ATOM   675 C  C   . ASP A 1 84 ? 20.848 2.991  -0.528  1.00 10.36 ? 84   ASP A C   1 
ATOM   676 O  O   . ASP A 1 84 ? 21.504 2.115  -1.144  1.00 12.68 ? 84   ASP A O   1 
ATOM   677 C  CB  . ASP A 1 84 ? 21.535 3.721  1.752   1.00 12.63 ? 84   ASP A CB  1 
ATOM   678 C  CG  . ASP A 1 84 ? 22.431 2.508  1.962   1.00 22.92 ? 84   ASP A CG  1 
ATOM   679 O  OD1 . ASP A 1 84 ? 23.674 2.791  1.893   1.00 28.43 ? 84   ASP A OD1 1 
ATOM   680 O  OD2 . ASP A 1 84 ? 21.946 1.365  2.019   1.00 21.76 ? 84   ASP A OD2 1 
ATOM   681 N  N   . TYR A 1 85 ? 19.549 3.091  -0.539  1.00 9.83  ? 85   TYR A N   1 
ATOM   682 C  CA  . TYR A 1 85 ? 18.787 2.082  -1.320  1.00 10.14 ? 85   TYR A CA  1 
ATOM   683 C  C   . TYR A 1 85 ? 19.066 2.255  -2.791  1.00 11.05 ? 85   TYR A C   1 
ATOM   684 O  O   . TYR A 1 85 ? 19.118 1.220  -3.506  1.00 11.29 ? 85   TYR A O   1 
ATOM   685 C  CB  . TYR A 1 85 ? 17.295 2.245  -1.056  1.00 10.20 ? 85   TYR A CB  1 
ATOM   686 C  CG  . TYR A 1 85 ? 16.790 1.587  0.282   1.00 13.36 ? 85   TYR A CG  1 
ATOM   687 C  CD1 . TYR A 1 85 ? 16.393 2.377  1.381   1.00 15.32 ? 85   TYR A CD1 1 
ATOM   688 C  CD2 . TYR A 1 85 ? 16.682 0.154  0.398   1.00 16.34 ? 85   TYR A CD2 1 
ATOM   689 C  CE1 . TYR A 1 85 ? 15.901 1.739  2.596   1.00 19.70 ? 85   TYR A CE1 1 
ATOM   690 C  CE2 . TYR A 1 85 ? 16.176 -0.432 1.557   1.00 19.09 ? 85   TYR A CE2 1 
ATOM   691 C  CZ  . TYR A 1 85 ? 15.789 0.342  2.648   1.00 19.19 ? 85   TYR A CZ  1 
ATOM   692 O  OH  . TYR A 1 85 ? 15.259 -0.283 3.766   1.00 20.55 ? 85   TYR A OH  1 
ATOM   693 N  N   . HIS A 1 86 ? 19.259 3.484  -3.274  1.00 8.52  ? 86   HIS A N   1 
ATOM   694 C  CA  . HIS A 1 86 ? 19.579 3.683  -4.689  1.00 10.30 ? 86   HIS A CA  1 
ATOM   695 C  C   . HIS A 1 86 ? 20.957 3.058  -4.989  1.00 11.31 ? 86   HIS A C   1 
ATOM   696 O  O   . HIS A 1 86 ? 21.139 2.361  -6.009  1.00 11.97 ? 86   HIS A O   1 
ATOM   697 C  CB  . HIS A 1 86 ? 19.567 5.193  -5.090  1.00 9.34  ? 86   HIS A CB  1 
ATOM   698 C  CG  . HIS A 1 86 ? 19.825 5.390  -6.579  1.00 9.62  ? 86   HIS A CG  1 
ATOM   699 N  ND1 . HIS A 1 86 ? 20.780 6.259  -7.038  1.00 10.92 ? 86   HIS A ND1 1 
ATOM   700 C  CD2 . HIS A 1 86 ? 19.244 4.842  -7.685  1.00 12.79 ? 86   HIS A CD2 1 
ATOM   701 C  CE1 . HIS A 1 86 ? 20.822 6.226  -8.368  1.00 12.69 ? 86   HIS A CE1 1 
ATOM   702 N  NE2 . HIS A 1 86 ? 19.887 5.415  -8.780  1.00 7.57  ? 86   HIS A NE2 1 
ATOM   703 N  N   . LYS A 1 87 ? 21.920 3.267  -4.098  1.00 10.87 ? 87   LYS A N   1 
ATOM   704 C  CA  . LYS A 1 87 ? 23.272 2.677  -4.410  1.00 12.36 ? 87   LYS A CA  1 
ATOM   705 C  C   . LYS A 1 87 ? 23.172 1.125  -4.389  1.00 13.55 ? 87   LYS A C   1 
ATOM   706 O  O   . LYS A 1 87 ? 23.791 0.427  -5.218  1.00 16.32 ? 87   LYS A O   1 
ATOM   707 C  CB  . LYS A 1 87 ? 24.272 3.190  -3.354  1.00 11.79 ? 87   LYS A CB  1 
ATOM   708 C  CG  . LYS A 1 87 ? 24.652 4.580  -3.558  1.00 16.41 ? 87   LYS A CG  1 
ATOM   709 C  CD  . LYS A 1 87 ? 25.653 4.935  -2.421  1.00 25.76 ? 87   LYS A CD  1 
ATOM   710 C  CE  . LYS A 1 87 ? 25.802 6.404  -2.272  1.00 35.07 ? 87   LYS A CE  1 
ATOM   711 N  NZ  . LYS A 1 87 ? 26.815 6.717  -1.167  1.00 41.93 ? 87   LYS A NZ  1 
ATOM   712 N  N   . GLN A 1 88 ? 22.383 0.557  -3.500  1.00 13.19 ? 88   GLN A N   1 
ATOM   713 C  CA  . GLN A 1 88 ? 22.142 -0.925 -3.442  1.00 14.44 ? 88   GLN A CA  1 
ATOM   714 C  C   . GLN A 1 88 ? 21.506 -1.426 -4.711  1.00 16.01 ? 88   GLN A C   1 
ATOM   715 O  O   . GLN A 1 88 ? 21.923 -2.478 -5.252  1.00 18.61 ? 88   GLN A O   1 
ATOM   716 C  CB  . GLN A 1 88 ? 21.150 -1.273 -2.387  1.00 15.51 ? 88   GLN A CB  1 
ATOM   717 C  CG  . GLN A 1 88 ? 21.743 -1.163 -0.975  1.00 16.49 ? 88   GLN A CG  1 
ATOM   718 C  CD  . GLN A 1 88 ? 20.737 -1.583 0.094   1.00 19.25 ? 88   GLN A CD  1 
ATOM   719 O  OE1 . GLN A 1 88 ? 20.221 -2.710 0.010   1.00 22.74 ? 88   GLN A OE1 1 
ATOM   720 N  NE2 . GLN A 1 88 ? 20.397 -0.691 1.081   1.00 20.65 ? 88   GLN A NE2 1 
ATOM   721 N  N   . SER A 1 89 ? 20.636 -0.579 -5.271  1.00 13.83 ? 89   SER A N   1 
ATOM   722 C  CA  . SER A 1 89 ? 20.049 -0.991 -6.601  1.00 13.01 ? 89   SER A CA  1 
ATOM   723 C  C   . SER A 1 89 ? 21.073 -1.071 -7.732  1.00 15.00 ? 89   SER A C   1 
ATOM   724 O  O   . SER A 1 89 ? 20.803 -1.772 -8.775  1.00 16.54 ? 89   SER A O   1 
ATOM   725 C  CB  . SER A 1 89 ? 18.830 -0.087 -6.928  1.00 15.28 ? 89   SER A CB  1 
ATOM   726 O  OG  . SER A 1 89 ? 19.275 1.149  -7.432  1.00 13.94 ? 89   SER A OG  1 
ATOM   727 N  N   . HIS A 1 90 ? 22.226 -0.406 -7.574  1.00 14.56 ? 90   HIS A N   1 
ATOM   728 C  CA  . HIS A 1 90 ? 23.317 -0.379 -8.547  1.00 14.59 ? 90   HIS A CA  1 
ATOM   729 C  C   . HIS A 1 90 ? 24.435 -1.372 -8.214  1.00 18.89 ? 90   HIS A C   1 
ATOM   730 O  O   . HIS A 1 90 ? 25.525 -1.251 -8.785  1.00 19.66 ? 90   HIS A O   1 
ATOM   731 C  CB  . HIS A 1 90 ? 23.852 0.987  -8.720  1.00 15.48 ? 90   HIS A CB  1 
ATOM   732 C  CG  . HIS A 1 90 ? 22.966 1.855  -9.547  1.00 15.97 ? 90   HIS A CG  1 
ATOM   733 N  ND1 . HIS A 1 90 ? 23.274 2.175  -10.840 1.00 15.07 ? 90   HIS A ND1 1 
ATOM   734 C  CD2 . HIS A 1 90 ? 21.774 2.461  -9.276  1.00 12.64 ? 90   HIS A CD2 1 
ATOM   735 C  CE1 . HIS A 1 90 ? 22.314 2.910  -11.376 1.00 13.63 ? 90   HIS A CE1 1 
ATOM   736 N  NE2 . HIS A 1 90 ? 21.389 3.129  -10.434 1.00 12.60 ? 90   HIS A NE2 1 
ATOM   737 N  N   . GLY A 1 91 ? 24.166 -2.184 -7.212  1.00 20.42 ? 91   GLY A N   1 
ATOM   738 C  CA  . GLY A 1 91 ? 25.072 -3.279 -6.812  1.00 23.30 ? 91   GLY A CA  1 
ATOM   739 C  C   . GLY A 1 91 ? 25.907 -2.947 -5.588  1.00 24.55 ? 91   GLY A C   1 
ATOM   740 O  O   . GLY A 1 91 ? 26.792 -3.746 -5.194  1.00 26.19 ? 91   GLY A O   1 
ATOM   741 N  N   . ALA A 1 92 ? 25.634 -1.852 -4.878  1.00 22.65 ? 92   ALA A N   1 
ATOM   742 C  CA  . ALA A 1 92 ? 26.423 -1.593 -3.626  1.00 21.79 ? 92   ALA A CA  1 
ATOM   743 C  C   . ALA A 1 92 ? 25.904 -2.458 -2.454  1.00 20.61 ? 92   ALA A C   1 
ATOM   744 O  O   . ALA A 1 92 ? 24.734 -2.907 -2.324  1.00 19.79 ? 92   ALA A O   1 
ATOM   745 C  CB  . ALA A 1 92 ? 26.409 -0.106 -3.242  1.00 19.94 ? 92   ALA A CB  1 
ATOM   746 N  N   . ALA A 1 93 ? 26.827 -2.729 -1.502  1.00 21.20 ? 93   ALA A N   1 
ATOM   747 C  CA  . ALA A 1 93 ? 26.418 -3.380 -0.302  1.00 21.69 ? 93   ALA A CA  1 
ATOM   748 C  C   . ALA A 1 93 ? 25.482 -2.406 0.516   1.00 19.32 ? 93   ALA A C   1 
ATOM   749 O  O   . ALA A 1 93 ? 25.620 -1.228 0.338   1.00 21.99 ? 93   ALA A O   1 
ATOM   750 C  CB  . ALA A 1 93 ? 27.704 -3.692 0.552   1.00 22.51 ? 93   ALA A CB  1 
ATOM   751 N  N   . PRO A 1 94 ? 24.531 -2.936 1.304   1.00 21.11 ? 94   PRO A N   1 
ATOM   752 C  CA  . PRO A 1 94 ? 23.710 -2.031 2.182   1.00 20.61 ? 94   PRO A CA  1 
ATOM   753 C  C   . PRO A 1 94 ? 24.559 -1.203 3.113   1.00 22.35 ? 94   PRO A C   1 
ATOM   754 O  O   . PRO A 1 94 ? 25.723 -1.611 3.523   1.00 22.80 ? 94   PRO A O   1 
ATOM   755 C  CB  . PRO A 1 94 ? 22.895 -3.000 3.040   1.00 19.65 ? 94   PRO A CB  1 
ATOM   756 C  CG  . PRO A 1 94 ? 22.854 -4.299 2.253   1.00 23.89 ? 94   PRO A CG  1 
ATOM   757 C  CD  . PRO A 1 94 ? 24.185 -4.343 1.551   1.00 19.87 ? 94   PRO A CD  1 
ATOM   758 N  N   . CYS A 1 95 ? 24.063 0.011  3.358   1.00 22.89 ? 95   CYS A N   1 
ATOM   759 C  CA  . CYS A 1 95 ? 24.666 0.816  4.422   1.00 24.63 ? 95   CYS A CA  1 
ATOM   760 C  C   . CYS A 1 95 ? 26.159 1.155  4.122   1.00 27.37 ? 95   CYS A C   1 
ATOM   761 O  O   . CYS A 1 95 ? 27.048 1.064  4.997   1.00 28.52 ? 95   CYS A O   1 
ATOM   762 C  CB  . CYS A 1 95 ? 24.438 0.050  5.749   1.00 20.33 ? 95   CYS A CB  1 
ATOM   763 S  SG  . CYS A 1 95 ? 24.519 1.267  7.190   1.00 26.13 ? 95   CYS A SG  1 
ATOM   764 N  N   . SER A 1 96 ? 26.450 1.595  2.889   1.00 29.11 ? 96   SER A N   1 
ATOM   765 C  CA  . SER A 1 96 ? 27.835 1.653  2.413   1.00 32.19 ? 96   SER A CA  1 
ATOM   766 C  C   . SER A 1 96 ? 28.453 3.011  2.630   1.00 34.19 ? 96   SER A C   1 
ATOM   767 O  O   . SER A 1 96 ? 28.327 3.896  1.813   1.00 36.69 ? 96   SER A O   1 
ATOM   768 C  CB  . SER A 1 96 ? 27.929 1.258  0.918   1.00 32.41 ? 96   SER A CB  1 
ATOM   769 O  OG  . SER A 1 96 ? 27.108 2.136  0.120   1.00 34.25 ? 96   SER A OG  1 
HETATM 770 CA CA  . CA  B 2 .  ? 17.787 21.254 13.942  1.00 10.45 ? 1097 CA  A CA  1 
HETATM 771 C  C1  . 2AN C 3 .  ? 2.742  5.473  7.017   1.00 10.58 ? 1098 2AN A C1  1 
HETATM 772 C  C2  . 2AN C 3 .  ? 4.079  5.685  7.437   1.00 12.75 ? 1098 2AN A C2  1 
HETATM 773 C  C3  . 2AN C 3 .  ? 5.189  5.866  6.531   1.00 15.41 ? 1098 2AN A C3  1 
HETATM 774 C  C4  . 2AN C 3 .  ? 4.882  5.811  5.189   1.00 14.25 ? 1098 2AN A C4  1 
HETATM 775 C  C5  . 2AN C 3 .  ? 3.589  5.629  4.696   1.00 12.30 ? 1098 2AN A C5  1 
HETATM 776 C  C6  . 2AN C 3 .  ? 3.339  5.616  3.295   1.00 13.62 ? 1098 2AN A C6  1 
HETATM 777 C  C7  . 2AN C 3 .  ? 2.038  5.409  2.808   1.00 9.95  ? 1098 2AN A C7  1 
HETATM 778 C  C8  . 2AN C 3 .  ? 0.844  5.263  3.622   1.00 13.17 ? 1098 2AN A C8  1 
HETATM 779 N  N   . 2AN C 3 .  ? 1.735  5.192  7.983   1.00 12.08 ? 1098 2AN A N   1 
HETATM 780 S  S   . 2AN C 3 .  ? -0.446 5.338  5.899   1.00 16.63 ? 1098 2AN A S   1 
HETATM 781 C  C9  . 2AN C 3 .  ? 1.005  5.326  5.009   1.00 11.28 ? 1098 2AN A C9  1 
HETATM 782 C  C10 . 2AN C 3 .  ? 2.397  5.445  5.591   1.00 13.04 ? 1098 2AN A C10 1 
HETATM 783 C  C11 . 2AN C 3 .  ? 1.410  5.929  9.063   1.00 12.29 ? 1098 2AN A C11 1 
HETATM 784 C  C12 . 2AN C 3 .  ? 0.546  5.247  9.996   1.00 11.83 ? 1098 2AN A C12 1 
HETATM 785 C  C13 . 2AN C 3 .  ? 0.229  6.001  11.200  1.00 13.05 ? 1098 2AN A C13 1 
HETATM 786 C  C14 . 2AN C 3 .  ? 0.659  7.302  11.302  1.00 13.37 ? 1098 2AN A C14 1 
HETATM 787 C  C15 . 2AN C 3 .  ? 1.498  7.974  10.341  1.00 12.31 ? 1098 2AN A C15 1 
HETATM 788 C  C16 . 2AN C 3 .  ? 1.887  7.227  9.194   1.00 11.88 ? 1098 2AN A C16 1 
HETATM 789 O  O1  . 2AN C 3 .  ? -1.595 5.445  4.936   1.00 19.72 ? 1098 2AN A O1  1 
HETATM 790 O  O2  . 2AN C 3 .  ? -0.424 6.594  6.602   1.00 16.22 ? 1098 2AN A O2  1 
HETATM 791 O  O3  . 2AN C 3 .  ? -0.604 4.170  6.798   1.00 17.38 ? 1098 2AN A O3  1 
HETATM 792 ZN ZN  . ZN  D 4 .  ? 19.761 4.423  -10.592 1.00 12.63 ? 1099 ZN  A ZN  1 
HETATM 793 O  O   . HOH E 5 .  ? -6.835 9.030  -1.899  1.00 34.68 ? 2001 HOH A O   1 
HETATM 794 O  O   . HOH E 5 .  ? -6.566 13.260 -4.448  1.00 31.59 ? 2002 HOH A O   1 
HETATM 795 O  O   . HOH E 5 .  ? -5.126 13.655 -0.378  1.00 28.26 ? 2003 HOH A O   1 
HETATM 796 O  O   . HOH E 5 .  ? -6.985 14.316 4.705   1.00 35.58 ? 2004 HOH A O   1 
HETATM 797 O  O   . HOH E 5 .  ? 18.483 9.546  22.956  1.00 24.76 ? 2005 HOH A O   1 
HETATM 798 O  O   . HOH E 5 .  ? 2.236  3.593  -9.066  1.00 24.03 ? 2006 HOH A O   1 
HETATM 799 O  O   . HOH E 5 .  ? -0.261 4.644  -8.523  1.00 23.65 ? 2007 HOH A O   1 
HETATM 800 O  O   . HOH E 5 .  ? 1.932  4.015  -1.289  1.00 29.85 ? 2008 HOH A O   1 
HETATM 801 O  O   . HOH E 5 .  ? -4.251 13.785 3.743   1.00 32.69 ? 2009 HOH A O   1 
HETATM 802 O  O   . HOH E 5 .  ? 20.151 -6.367 2.792   1.00 35.75 ? 2010 HOH A O   1 
HETATM 803 O  O   . HOH E 5 .  ? 3.789  6.808  18.850  1.00 30.68 ? 2011 HOH A O   1 
HETATM 804 O  O   . HOH E 5 .  ? -0.942 8.431  2.429   1.00 17.40 ? 2012 HOH A O   1 
HETATM 805 O  O   . HOH E 5 .  ? -2.434 3.193  -7.317  1.00 46.15 ? 2013 HOH A O   1 
HETATM 806 O  O   . HOH E 5 .  ? 8.910  23.184 9.166   1.00 38.34 ? 2014 HOH A O   1 
HETATM 807 O  O   . HOH E 5 .  ? 3.333  3.528  -0.048  0.50 31.72 ? 2015 HOH A O   1 
HETATM 808 O  O   . HOH E 5 .  ? 16.690 7.391  23.442  1.00 28.98 ? 2016 HOH A O   1 
HETATM 809 O  O   . HOH E 5 .  ? 11.056 1.556  19.581  1.00 37.93 ? 2017 HOH A O   1 
HETATM 810 O  O   . HOH E 5 .  ? -0.067 14.816 9.407   1.00 10.36 ? 2018 HOH A O   1 
HETATM 811 O  O   . HOH E 5 .  ? -1.136 15.324 6.166   1.00 23.73 ? 2019 HOH A O   1 
HETATM 812 O  O   . HOH E 5 .  ? -3.246 12.583 5.948   1.00 17.35 ? 2020 HOH A O   1 
HETATM 813 O  O   . HOH E 5 .  ? 21.666 -7.048 4.768   1.00 28.41 ? 2021 HOH A O   1 
HETATM 814 O  O   . HOH E 5 .  ? 2.679  9.279  18.364  1.00 18.98 ? 2022 HOH A O   1 
HETATM 815 O  O   . HOH E 5 .  ? 9.781  14.710 19.533  1.00 13.10 ? 2023 HOH A O   1 
HETATM 816 O  O   . HOH E 5 .  ? 6.083  13.353 20.661  1.00 29.98 ? 2024 HOH A O   1 
HETATM 817 O  O   . HOH E 5 .  ? 3.640  18.698 14.546  1.00 14.87 ? 2025 HOH A O   1 
HETATM 818 O  O   . HOH E 5 .  ? 20.974 15.764 22.293  1.00 26.13 ? 2026 HOH A O   1 
HETATM 819 O  O   . HOH E 5 .  ? 3.061  20.589 16.378  1.00 31.37 ? 2027 HOH A O   1 
HETATM 820 O  O   . HOH E 5 .  ? 19.194 19.534 6.264   1.00 14.86 ? 2028 HOH A O   1 
HETATM 821 O  O   . HOH E 5 .  ? 22.940 27.380 11.589  1.00 49.12 ? 2029 HOH A O   1 
HETATM 822 O  O   . HOH E 5 .  ? 17.819 13.963 24.507  1.00 29.70 ? 2030 HOH A O   1 
HETATM 823 O  O   . HOH E 5 .  ? 19.037 23.472 5.028   1.00 36.20 ? 2031 HOH A O   1 
HETATM 824 O  O   . HOH E 5 .  ? 18.881 19.507 3.485   1.00 49.53 ? 2032 HOH A O   1 
HETATM 825 O  O   . HOH E 5 .  ? 9.579  21.422 11.226  1.00 10.77 ? 2033 HOH A O   1 
HETATM 826 O  O   . HOH E 5 .  ? 21.221 14.131 -2.458  1.00 22.09 ? 2034 HOH A O   1 
HETATM 827 O  O   . HOH E 5 .  ? 18.136 -5.021 -6.715  1.00 26.31 ? 2035 HOH A O   1 
HETATM 828 O  O   . HOH E 5 .  ? 14.493 6.680  22.249  1.00 20.80 ? 2036 HOH A O   1 
HETATM 829 O  O   . HOH E 5 .  ? 10.080 7.844  22.024  1.00 30.94 ? 2037 HOH A O   1 
HETATM 830 O  O   . HOH E 5 .  ? 11.782 3.523  21.327  1.00 31.11 ? 2038 HOH A O   1 
HETATM 831 O  O   . HOH E 5 .  ? 14.442 -1.549 14.978  1.00 30.59 ? 2039 HOH A O   1 
HETATM 832 O  O   . HOH E 5 .  ? 10.560 -2.154 14.652  1.00 35.94 ? 2040 HOH A O   1 
HETATM 833 O  O   . HOH E 5 .  ? 20.158 3.594  20.631  1.00 42.58 ? 2041 HOH A O   1 
HETATM 834 O  O   . HOH E 5 .  ? 8.777  1.166  19.849  1.00 34.85 ? 2042 HOH A O   1 
HETATM 835 O  O   . HOH E 5 .  ? 8.131  -1.803 12.939  1.00 41.93 ? 2043 HOH A O   1 
HETATM 836 O  O   . HOH E 5 .  ? 4.547  5.021  16.869  1.00 32.01 ? 2044 HOH A O   1 
HETATM 837 O  O   . HOH E 5 .  ? 6.449  2.578  8.354   1.00 10.95 ? 2045 HOH A O   1 
HETATM 838 O  O   . HOH E 5 .  ? 16.307 -3.374 13.434  1.00 23.39 ? 2046 HOH A O   1 
HETATM 839 O  O   . HOH E 5 .  ? 17.638 -6.096 6.632   1.00 27.75 ? 2047 HOH A O   1 
HETATM 840 O  O   . HOH E 5 .  ? 21.003 -0.328 5.033   1.00 23.71 ? 2048 HOH A O   1 
HETATM 841 O  O   . HOH E 5 .  ? 24.083 -5.750 5.404   1.00 30.18 ? 2049 HOH A O   1 
HETATM 842 O  O   . HOH E 5 .  ? 20.467 0.205  15.278  1.00 41.98 ? 2050 HOH A O   1 
HETATM 843 O  O   . HOH E 5 .  ? 22.201 0.360  12.728  1.00 19.47 ? 2051 HOH A O   1 
HETATM 844 O  O   . HOH E 5 .  ? 28.580 -0.082 7.109   1.00 41.95 ? 2052 HOH A O   1 
HETATM 845 O  O   . HOH E 5 .  ? 28.777 2.639  14.145  1.00 21.13 ? 2053 HOH A O   1 
HETATM 846 O  O   . HOH E 5 .  ? 22.593 6.861  5.166   1.00 29.11 ? 2054 HOH A O   1 
HETATM 847 O  O   . HOH E 5 .  ? 23.731 8.993  20.522  1.00 16.61 ? 2055 HOH A O   1 
HETATM 848 O  O   . HOH E 5 .  ? 26.454 5.453  12.325  1.00 23.81 ? 2056 HOH A O   1 
HETATM 849 O  O   . HOH E 5 .  ? 22.178 10.099 17.253  1.00 11.67 ? 2057 HOH A O   1 
HETATM 850 O  O   . HOH E 5 .  ? 23.020 15.865 20.489  1.00 18.80 ? 2058 HOH A O   1 
HETATM 851 O  O   . HOH E 5 .  ? 26.138 17.940 11.854  1.00 18.68 ? 2059 HOH A O   1 
HETATM 852 O  O   . HOH E 5 .  ? 24.334 18.494 15.225  1.00 11.48 ? 2060 HOH A O   1 
HETATM 853 O  O   . HOH E 5 .  ? 23.075 17.828 7.464   1.00 26.63 ? 2061 HOH A O   1 
HETATM 854 O  O   . HOH E 5 .  ? 26.468 15.658 8.722   1.00 30.23 ? 2062 HOH A O   1 
HETATM 855 O  O   . HOH E 5 .  ? 24.126 15.560 6.424   1.00 35.85 ? 2063 HOH A O   1 
HETATM 856 O  O   . HOH E 5 .  ? 20.296 17.651 7.927   1.00 12.76 ? 2064 HOH A O   1 
HETATM 857 O  O   . HOH E 5 .  ? 23.097 25.554 9.951   1.00 25.86 ? 2065 HOH A O   1 
HETATM 858 O  O   . HOH E 5 .  ? 17.161 27.132 10.533  1.00 43.11 ? 2066 HOH A O   1 
HETATM 859 O  O   . HOH E 5 .  ? 18.902 28.167 12.234  1.00 40.62 ? 2067 HOH A O   1 
HETATM 860 O  O   . HOH E 5 .  ? 26.053 20.646 12.446  1.00 21.91 ? 2068 HOH A O   1 
HETATM 861 O  O   . HOH E 5 .  ? 16.123 26.853 15.740  1.00 34.21 ? 2069 HOH A O   1 
HETATM 862 O  O   . HOH E 5 .  ? 16.615 16.550 21.476  1.00 19.08 ? 2070 HOH A O   1 
HETATM 863 O  O   . HOH E 5 .  ? 10.784 19.166 19.626  1.00 34.90 ? 2071 HOH A O   1 
HETATM 864 O  O   . HOH E 5 .  ? 11.821 17.776 23.563  1.00 31.85 ? 2072 HOH A O   1 
HETATM 865 O  O   . HOH E 5 .  ? 14.399 25.156 12.803  1.00 28.91 ? 2073 HOH A O   1 
HETATM 866 O  O   . HOH E 5 .  ? 15.783 22.465 13.516  1.00 13.42 ? 2074 HOH A O   1 
HETATM 867 O  O   . HOH E 5 .  ? 16.458 24.416 9.371   1.00 18.08 ? 2075 HOH A O   1 
HETATM 868 O  O   . HOH E 5 .  ? 11.856 22.796 8.104   1.00 16.58 ? 2076 HOH A O   1 
HETATM 869 O  O   . HOH E 5 .  ? 14.018 24.902 7.363   1.00 33.47 ? 2077 HOH A O   1 
HETATM 870 O  O   . HOH E 5 .  ? 16.100 19.370 3.212   1.00 21.24 ? 2078 HOH A O   1 
HETATM 871 O  O   . HOH E 5 .  ? 18.028 21.995 6.979   1.00 13.70 ? 2079 HOH A O   1 
HETATM 872 O  O   . HOH E 5 .  ? 18.872 23.008 9.514   1.00 13.83 ? 2080 HOH A O   1 
HETATM 873 O  O   . HOH E 5 .  ? 19.808 16.879 1.997   1.00 42.16 ? 2081 HOH A O   1 
HETATM 874 O  O   . HOH E 5 .  ? 19.800 14.039 1.642   1.00 20.19 ? 2082 HOH A O   1 
HETATM 875 O  O   . HOH E 5 .  ? 22.805 14.331 3.379   1.00 32.34 ? 2083 HOH A O   1 
HETATM 876 O  O   . HOH E 5 .  ? 23.262 7.402  2.325   1.00 24.64 ? 2084 HOH A O   1 
HETATM 877 O  O   . HOH E 5 .  ? 22.777 11.342 0.890   1.00 23.32 ? 2085 HOH A O   1 
HETATM 878 O  O   . HOH E 5 .  ? 21.604 11.573 -3.592  1.00 16.72 ? 2086 HOH A O   1 
HETATM 879 O  O   . HOH E 5 .  ? 14.686 -2.940 3.587   1.00 28.00 ? 2087 HOH A O   1 
HETATM 880 O  O   . HOH E 5 .  ? 22.716 7.825  -5.683  1.00 18.04 ? 2088 HOH A O   1 
HETATM 881 O  O   . HOH E 5 .  ? 21.172 -4.955 -1.282  1.00 30.77 ? 2089 HOH A O   1 
HETATM 882 O  O   . HOH E 5 .  ? 19.090 -1.574 3.550   1.00 26.78 ? 2090 HOH A O   1 
HETATM 883 O  O   . HOH E 5 .  ? 19.011 -3.776 -9.170  1.00 19.13 ? 2091 HOH A O   1 
HETATM 884 O  O   . HOH E 5 .  ? 25.798 1.655  -11.801 1.00 29.34 ? 2092 HOH A O   1 
HETATM 885 O  O   . HOH E 5 .  ? 24.865 4.439  -7.827  1.00 39.18 ? 2093 HOH A O   1 
HETATM 886 O  O   . HOH E 5 .  ? 29.590 -1.648 -1.424  1.00 31.77 ? 2094 HOH A O   1 
HETATM 887 O  O   . HOH E 5 .  ? 24.593 1.341  -0.186  1.00 21.47 ? 2095 HOH A O   1 
HETATM 888 O  O   . HOH E 5 .  ? -2.308 5.870  1.935   1.00 28.67 ? 2096 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1  SER SER A . n 
A 1 2   ASN 2   2   2  ASN ASN A . n 
A 1 3   THR 3   3   3  THR THR A . n 
A 1 4   GLN 4   4   4  GLN GLN A . n 
A 1 5   ALA 5   5   5  ALA ALA A . n 
A 1 6   GLU 6   6   6  GLU GLU A . n 
A 1 7   ARG 7   7   7  ARG ARG A . n 
A 1 8   SER 8   8   8  SER SER A . n 
A 1 9   ILE 9   9   9  ILE ILE A . n 
A 1 10  ILE 10  10  10 ILE ILE A . n 
A 1 11  GLY 11  11  11 GLY GLY A . n 
A 1 12  MET 12  12  12 MET MET A . n 
A 1 13  ILE 13  13  13 ILE ILE A . n 
A 1 14  ASP 14  14  14 ASP ASP A . n 
A 1 15  MET 15  15  15 MET MET A . n 
A 1 16  PHE 16  16  16 PHE PHE A . n 
A 1 17  HIS 17  17  17 HIS HIS A . n 
A 1 18  LYS 18  18  18 LYS LYS A . n 
A 1 19  TYR 19  19  19 TYR TYR A . n 
A 1 20  THR 20  20  20 THR THR A . n 
A 1 21  ARG 21  21  21 ARG ARG A . n 
A 1 22  ARG 22  22  22 ARG ARG A . n 
A 1 23  ASP 23  23  23 ASP ASP A . n 
A 1 24  ASP 24  24  24 ASP ASP A . n 
A 1 25  LYS 25  25  25 LYS LYS A . n 
A 1 26  ILE 26  26  26 ILE ILE A . n 
A 1 27  ASP 27  27  27 ASP ASP A . n 
A 1 28  LYS 28  28  28 LYS LYS A . n 
A 1 29  PRO 29  29  29 PRO PRO A . n 
A 1 30  SER 30  30  30 SER SER A . n 
A 1 31  LEU 31  31  31 LEU LEU A . n 
A 1 32  LEU 32  32  32 LEU LEU A . n 
A 1 33  THR 33  33  33 THR THR A . n 
A 1 34  MET 34  34  34 MET MET A . n 
A 1 35  MET 35  35  35 MET MET A . n 
A 1 36  LYS 36  36  36 LYS LYS A . n 
A 1 37  GLU 37  37  37 GLU GLU A . n 
A 1 38  ASN 38  38  38 ASN ASN A . n 
A 1 39  PHE 39  39  39 PHE PHE A . n 
A 1 40  PRO 40  40  40 PRO PRO A . n 
A 1 41  ASN 41  41  41 ASN ASN A . n 
A 1 42  PHE 42  42  42 PHE PHE A . n 
A 1 43  LEU 43  43  43 LEU LEU A . n 
A 1 44  SER 44  44  44 SER SER A . n 
A 1 45  ALA 45  45  45 ALA ALA A . n 
A 1 46  CYS 46  46  46 CYS CYS A . n 
A 1 47  ASP 47  47  47 ASP ASP A . n 
A 1 48  LYS 48  48  48 LYS LYS A . n 
A 1 49  LYS 49  49  49 LYS LYS A . n 
A 1 50  GLY 50  50  50 GLY GLY A . n 
A 1 51  THR 51  51  51 THR THR A . n 
A 1 52  ASN 52  52  52 ASN ASN A . n 
A 1 53  TYR 53  53  53 TYR TYR A . n 
A 1 54  LEU 54  54  54 LEU LEU A . n 
A 1 55  ALA 55  55  55 ALA ALA A . n 
A 1 56  ASP 56  56  56 ASP ASP A . n 
A 1 57  VAL 57  57  57 VAL VAL A . n 
A 1 58  PHE 58  58  58 PHE PHE A . n 
A 1 59  GLU 59  59  59 GLU GLU A . n 
A 1 60  LYS 60  60  60 LYS LYS A . n 
A 1 61  LYS 61  61  61 LYS LYS A . n 
A 1 62  ASP 62  62  62 ASP ASP A . n 
A 1 63  LYS 63  63  63 LYS LYS A . n 
A 1 64  ASN 64  64  64 ASN ASN A . n 
A 1 65  GLU 65  65  65 GLU GLU A . n 
A 1 66  ASP 66  66  66 ASP ASP A . n 
A 1 67  LYS 67  67  67 LYS LYS A . n 
A 1 68  LYS 68  68  68 LYS LYS A . n 
A 1 69  ILE 69  69  69 ILE ILE A . n 
A 1 70  ASP 70  70  70 ASP ASP A . n 
A 1 71  PHE 71  71  71 PHE PHE A . n 
A 1 72  SER 72  72  72 SER SER A . n 
A 1 73  GLU 73  73  73 GLU GLU A . n 
A 1 74  PHE 74  74  74 PHE PHE A . n 
A 1 75  LEU 75  75  75 LEU LEU A . n 
A 1 76  SER 76  76  76 SER SER A . n 
A 1 77  LEU 77  77  77 LEU LEU A . n 
A 1 78  LEU 78  78  78 LEU LEU A . n 
A 1 79  GLY 79  79  79 GLY GLY A . n 
A 1 80  ASP 80  80  80 ASP ASP A . n 
A 1 81  ILE 81  81  81 ILE ILE A . n 
A 1 82  ALA 82  82  82 ALA ALA A . n 
A 1 83  THR 83  83  83 THR THR A . n 
A 1 84  ASP 84  84  84 ASP ASP A . n 
A 1 85  TYR 85  85  85 TYR TYR A . n 
A 1 86  HIS 86  86  86 HIS HIS A . n 
A 1 87  LYS 87  87  87 LYS LYS A . n 
A 1 88  GLN 88  88  88 GLN GLN A . n 
A 1 89  SER 89  89  89 SER SER A . n 
A 1 90  HIS 90  90  90 HIS HIS A . n 
A 1 91  GLY 91  91  91 GLY GLY A . n 
A 1 92  ALA 92  92  92 ALA ALA A . n 
A 1 93  ALA 93  93  93 ALA ALA A . n 
A 1 94  PRO 94  94  94 PRO PRO A . n 
A 1 95  CYS 95  95  95 CYS CYS A . n 
A 1 96  SER 96  96  96 SER SER A . n 
A 1 97  GLY 97  97  ?  ?   ?   A . n 
A 1 98  GLY 98  98  ?  ?   ?   A . n 
A 1 99  SER 99  99  ?  ?   ?   A . n 
A 1 100 GLN 100 100 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1  1097 1097 CA  CA  A . 
C 3 2AN 1  1098 1098 2AN 2AN A . 
D 4 ZN  1  1099 1099 ZN  ZN  A . 
E 5 HOH 1  2001 2001 HOH HOH A . 
E 5 HOH 2  2002 2002 HOH HOH A . 
E 5 HOH 3  2003 2003 HOH HOH A . 
E 5 HOH 4  2004 2004 HOH HOH A . 
E 5 HOH 5  2005 2005 HOH HOH A . 
E 5 HOH 6  2006 2006 HOH HOH A . 
E 5 HOH 7  2007 2007 HOH HOH A . 
E 5 HOH 8  2008 2008 HOH HOH A . 
E 5 HOH 9  2009 2009 HOH HOH A . 
E 5 HOH 10 2010 2010 HOH HOH A . 
E 5 HOH 11 2011 2011 HOH HOH A . 
E 5 HOH 12 2012 2012 HOH HOH A . 
E 5 HOH 13 2013 2013 HOH HOH A . 
E 5 HOH 14 2014 2014 HOH HOH A . 
E 5 HOH 15 2015 2015 HOH HOH A . 
E 5 HOH 16 2016 2016 HOH HOH A . 
E 5 HOH 17 2017 2017 HOH HOH A . 
E 5 HOH 18 2018 2018 HOH HOH A . 
E 5 HOH 19 2019 2019 HOH HOH A . 
E 5 HOH 20 2020 2020 HOH HOH A . 
E 5 HOH 21 2021 2021 HOH HOH A . 
E 5 HOH 22 2022 2022 HOH HOH A . 
E 5 HOH 23 2023 2023 HOH HOH A . 
E 5 HOH 24 2024 2024 HOH HOH A . 
E 5 HOH 25 2025 2025 HOH HOH A . 
E 5 HOH 26 2026 2026 HOH HOH A . 
E 5 HOH 27 2027 2027 HOH HOH A . 
E 5 HOH 28 2028 2028 HOH HOH A . 
E 5 HOH 29 2029 2029 HOH HOH A . 
E 5 HOH 30 2030 2030 HOH HOH A . 
E 5 HOH 31 2031 2031 HOH HOH A . 
E 5 HOH 32 2032 2032 HOH HOH A . 
E 5 HOH 33 2033 2033 HOH HOH A . 
E 5 HOH 34 2034 2034 HOH HOH A . 
E 5 HOH 35 2035 2035 HOH HOH A . 
E 5 HOH 36 2036 2036 HOH HOH A . 
E 5 HOH 37 2037 2037 HOH HOH A . 
E 5 HOH 38 2038 2038 HOH HOH A . 
E 5 HOH 39 2039 2039 HOH HOH A . 
E 5 HOH 40 2040 2040 HOH HOH A . 
E 5 HOH 41 2041 2041 HOH HOH A . 
E 5 HOH 42 2042 2042 HOH HOH A . 
E 5 HOH 43 2043 2043 HOH HOH A . 
E 5 HOH 44 2044 2044 HOH HOH A . 
E 5 HOH 45 2045 2045 HOH HOH A . 
E 5 HOH 46 2046 2046 HOH HOH A . 
E 5 HOH 47 2047 2047 HOH HOH A . 
E 5 HOH 48 2048 2048 HOH HOH A . 
E 5 HOH 49 2049 2049 HOH HOH A . 
E 5 HOH 50 2050 2050 HOH HOH A . 
E 5 HOH 51 2051 2051 HOH HOH A . 
E 5 HOH 52 2052 2052 HOH HOH A . 
E 5 HOH 53 2053 2053 HOH HOH A . 
E 5 HOH 54 2054 2054 HOH HOH A . 
E 5 HOH 55 2055 2055 HOH HOH A . 
E 5 HOH 56 2056 2056 HOH HOH A . 
E 5 HOH 57 2057 2057 HOH HOH A . 
E 5 HOH 58 2058 2058 HOH HOH A . 
E 5 HOH 59 2059 2059 HOH HOH A . 
E 5 HOH 60 2060 2060 HOH HOH A . 
E 5 HOH 61 2061 2061 HOH HOH A . 
E 5 HOH 62 2062 2062 HOH HOH A . 
E 5 HOH 63 2063 2063 HOH HOH A . 
E 5 HOH 64 2064 2064 HOH HOH A . 
E 5 HOH 65 2065 2065 HOH HOH A . 
E 5 HOH 66 2066 2066 HOH HOH A . 
E 5 HOH 67 2067 2067 HOH HOH A . 
E 5 HOH 68 2068 2068 HOH HOH A . 
E 5 HOH 69 2069 2069 HOH HOH A . 
E 5 HOH 70 2070 2070 HOH HOH A . 
E 5 HOH 71 2071 2071 HOH HOH A . 
E 5 HOH 72 2072 2072 HOH HOH A . 
E 5 HOH 73 2073 2073 HOH HOH A . 
E 5 HOH 74 2074 2074 HOH HOH A . 
E 5 HOH 75 2075 2075 HOH HOH A . 
E 5 HOH 76 2076 2076 HOH HOH A . 
E 5 HOH 77 2077 2077 HOH HOH A . 
E 5 HOH 78 2078 2078 HOH HOH A . 
E 5 HOH 79 2079 2079 HOH HOH A . 
E 5 HOH 80 2080 2080 HOH HOH A . 
E 5 HOH 81 2081 2081 HOH HOH A . 
E 5 HOH 82 2082 2082 HOH HOH A . 
E 5 HOH 83 2083 2083 HOH HOH A . 
E 5 HOH 84 2084 2084 HOH HOH A . 
E 5 HOH 85 2085 2085 HOH HOH A . 
E 5 HOH 86 2086 2086 HOH HOH A . 
E 5 HOH 87 2087 2087 HOH HOH A . 
E 5 HOH 88 2088 2088 HOH HOH A . 
E 5 HOH 89 2089 2089 HOH HOH A . 
E 5 HOH 90 2090 2090 HOH HOH A . 
E 5 HOH 91 2091 2091 HOH HOH A . 
E 5 HOH 92 2092 2092 HOH HOH A . 
E 5 HOH 93 2093 2093 HOH HOH A . 
E 5 HOH 94 2094 2094 HOH HOH A . 
E 5 HOH 95 2095 2095 HOH HOH A . 
E 5 HOH 96 2096 2096 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3210   ? 
1 MORE         -118.8 ? 
1 'SSA (A^2)'  10600  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2015 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OE2 ? A GLU 73 ? A GLU 73   ? 1_555 53.0  ? 
2  OE1 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASN 64 ? A ASN 64   ? 1_555 127.5 ? 
3  OE2 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASN 64 ? A ASN 64   ? 1_555 77.1  ? 
4  OE1 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 62 ? A ASP 62   ? 1_555 113.2 ? 
5  OE2 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 62 ? A ASP 62   ? 1_555 95.2  ? 
6  OD1 ? A ASN 64 ? A ASN 64   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 62 ? A ASP 62   ? 1_555 83.4  ? 
7  OE1 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? A LYS 68 ? A LYS 68   ? 1_555 77.7  ? 
8  OE2 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? A LYS 68 ? A LYS 68   ? 1_555 126.1 ? 
9  OD1 ? A ASN 64 ? A ASN 64   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? A LYS 68 ? A LYS 68   ? 1_555 154.7 ? 
10 OD1 ? A ASP 62 ? A ASP 62   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? A LYS 68 ? A LYS 68   ? 1_555 84.4  ? 
11 OE1 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? E HOH .  ? A HOH 2074 ? 1_555 82.6  ? 
12 OE2 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? E HOH .  ? A HOH 2074 ? 1_555 97.9  ? 
13 OD1 ? A ASN 64 ? A ASN 64   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? E HOH .  ? A HOH 2074 ? 1_555 90.1  ? 
14 OD1 ? A ASP 62 ? A ASP 62   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? E HOH .  ? A HOH 2074 ? 1_555 163.7 ? 
15 O   ? A LYS 68 ? A LYS 68   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 O   ? E HOH .  ? A HOH 2074 ? 1_555 95.6  ? 
16 OE1 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 148.9 ? 
17 OE2 ? A GLU 73 ? A GLU 73   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 155.1 ? 
18 OD1 ? A ASN 64 ? A ASN 64   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 78.0  ? 
19 OD1 ? A ASP 62 ? A ASP 62   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 84.2  ? 
20 O   ? A LYS 68 ? A LYS 68   ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 78.8  ? 
21 O   ? E HOH .  ? A HOH 2074 ? 1_555 CA ? B CA . ? A CA 1097 ? 1_555 OD1 ? A ASP 66 ? A ASP 66   ? 1_555 79.8  ? 
22 NE2 ? A HIS 86 ? A HIS 86   ? 1_555 ZN ? D ZN . ? A ZN 1099 ? 1_555 NE2 ? A HIS 90 ? A HIS 90   ? 1_555 100.6 ? 
23 NE2 ? A HIS 86 ? A HIS 86   ? 1_555 ZN ? D ZN . ? A ZN 1099 ? 1_555 OD1 ? A ASP 24 ? A ASP 24   ? 7_555 129.0 ? 
24 NE2 ? A HIS 90 ? A HIS 90   ? 1_555 ZN ? D ZN . ? A ZN 1099 ? 1_555 OD1 ? A ASP 24 ? A ASP 24   ? 7_555 103.9 ? 
25 NE2 ? A HIS 86 ? A HIS 86   ? 1_555 ZN ? D ZN . ? A ZN 1099 ? 1_555 NE2 ? A HIS 17 ? A HIS 17   ? 7_555 110.4 ? 
26 NE2 ? A HIS 90 ? A HIS 90   ? 1_555 ZN ? D ZN . ? A ZN 1099 ? 1_555 NE2 ? A HIS 17 ? A HIS 17   ? 7_555 111.7 ? 
27 OD1 ? A ASP 24 ? A ASP 24   ? 7_555 ZN ? D ZN . ? A ZN 1099 ? 1_555 NE2 ? A HIS 17 ? A HIS 17   ? 7_555 100.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-10-20 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement     5.5.0088 ? 1 
SCALA  'data scaling' .        ? 2 
MOLREP phasing        .        ? 3 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_1             30 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_2             30 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.501 
_pdbx_validate_rmsd_bond.bond_target_value         1.418 
_pdbx_validate_rmsd_bond.bond_deviation            0.083 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 27 ? ? CG A ASP 27 ? ? OD1 A ASP 27 ? ? 124.77 118.30 6.47   0.90 N 
2 1 CD A LYS 61 ? ? CE A LYS 61 ? ? NZ  A LYS 61 ? ? 95.70  111.70 -16.00 2.30 N 
3 1 CB A ASP 62 ? ? CG A ASP 62 ? ? OD2 A ASP 62 ? ? 110.74 118.30 -7.56  0.90 N 
4 1 CB A ASP 84 ? ? CG A ASP 84 ? ? OD1 A ASP 84 ? ? 112.89 118.30 -5.41  0.90 N 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2004 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.99 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 97  ? A GLY 97  
2 1 Y 1 A GLY 98  ? A GLY 98  
3 1 Y 1 A SER 99  ? A SER 99  
4 1 Y 1 A GLN 100 ? A GLN 100 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                       CA  
3 '8-ANILINO-1-NAPHTHALENE SULFONATE' 2AN 
4 'ZINC ION'                          ZN  
5 water                               HOH 
#