data_2WSL
# 
_entry.id   2WSL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WSL         
PDBE  EBI-41066    
WWPDB D_1290041066 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2J4C unspecified 'STRUCTURE OF HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH 10MM HGCL2' 
PDB 1KCJ unspecified 'MODEL OF (-)-COCAINE-BOUND (-)-COCAINE HYDROLASE COMPLEX' 
PDB 2WIK unspecified 'NONAGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA6' 
PDB 1P0P unspecified 
'CRYSTAL STRUCTURE OF SOMAN-AGED HUMAN BUTYRYLCHOLINESTERASE IN COMPLEX WITH THE SUBSTRATE ANALOGBUTYRYLTHIOCHOLINE' 
PDB 1XLU unspecified 'X-RAY STRUCTURE OF DI-ISOPROPYL-PHOSPHORO- FLUORIDATE (DFP)INHIBITED BUTYRYLCHOLINESTERASE AFTER AGING' 
PDB 2WIJ unspecified 'NONAGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA5' 
PDB 1XLV unspecified 'ETHYLPHOSPHORYLATED BUTYRYLCHOLINESTERASE (AGED) OBTAINEDBY REACTION WITH ECHOTHIOPHATE' 
PDB 1EHO unspecified 'MODEL OF (-)-COCAINE-BOUND BCHE COMPLEX.' 
PDB 1P0M unspecified 'CRYSTAL STRUCTURE OF HUMAN BUTYRYL CHOLINESTERASE INCOMPLEX WITH A CHOLINE MOLECULE' 
PDB 1XLW unspecified 'DIETHYLPHOSPHORYLATED BUTYRYLCHOLINESTERASE (NONAGED )OBTAINED BY REACTION WITH ECHOTHIOPHATE' 
PDB 1EHQ unspecified 'MODEL OF (+)-COCAINE-BOUND BCHE COMPLEX' 
PDB 1P0Q unspecified 'CRYSTAL STRUCTURE OF SOMAN-AGED HUMAN BUTYRYL CHOLINESTERASE' 
PDB 2WID unspecified 'AGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA1' 
PDB 2WIL unspecified 'AGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA5' 
PDB 2WIF unspecified 'AGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA1' 
PDB 1P0I unspecified 'CRYSTAL STRUCTURE OF HUMAN BUTYRYL CHOLINESTERASE' 
PDB 2WIG unspecified 'NONAGED FORM OF HUMAN BUTYRYLCHOLINESTERASE INHIBITED BY TABUN ANALOGUE TA4' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WSL 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-08 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Carletti, E.'   1  ? 
'Aurbek, N.'     2  ? 
'Gillon, E.'     3  ? 
'Loiodice, M.'   4  ? 
'Nicolet, Y.'    5  ? 
'Fontecilla, J.' 6  ? 
'Masson, P.'     7  ? 
'Thiermann, H.'  8  ? 
'Nachon, F.'     9  ? 
'Worek, F.'      10 ? 
# 
_citation.id                        primary 
_citation.title                     
'Structure-activity analysis of aging and reactivation of human butyrylcholinesterase inhibited by analogues of tabun.' 
_citation.journal_abbrev            'Biochem. J.' 
_citation.journal_volume            421 
_citation.page_first                97 
_citation.page_last                 106 
_citation.year                      2009 
_citation.journal_id_ASTM           BIJOAK 
_citation.country                   UK 
_citation.journal_id_ISSN           1470-8728 
_citation.journal_id_CSD            0043 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19368529 
_citation.pdbx_database_id_DOI      10.1042/BJ20090091 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Carletti, E.'           1  ? 
primary 'Aurbek, N.'             2  ? 
primary 'Gillon, E.'             3  ? 
primary 'Loiodice, M.'           4  ? 
primary 'Nicolet, Y.'            5  ? 
primary 'Fontecilla-Camps, J.C.' 6  ? 
primary 'Masson, P.'             7  ? 
primary 'Thiermann, H.'          8  ? 
primary 'Nachon, F.'             9  ? 
primary 'Worek, F.'              10 ? 
# 
_cell.entry_id           2WSL 
_cell.length_a           154.860 
_cell.length_b           154.860 
_cell.length_c           126.010 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WSL 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man CHOLINESTERASE 59745.574 1   3.1.1.8 YES ? 'S198 IS PHOSPHORAMIDYLATED' 
2  branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[beta-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose'  570.542   1 
?       ?   ? ?                            
3  branched    man 'alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose' 367.349   1   ?       ?   ? ? 
4  branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   1 
?       ?   ? ?                            
5  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   3   ?       ?   ? ?                            
6  non-polymer syn 'CHLORIDE ION' 35.453    1   ?       ?   ? ?                            
7  non-polymer syn 'SODIUM ION' 22.990    1   ?       ?   ? ?                            
8  non-polymer syn 'SULFATE ION' 96.063    1   ?       ?   ? ?                            
9  non-polymer syn 'ETHYL DIHYDROGEN PHOSPHATE' 126.048   1   ?       ?   ? ?                            
10 non-polymer syn 'FLUORIDE ION' 18.998    1   ?       ?   ? ?                            
11 water       nat water 18.015    397 ?       ?   ? ?                            
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'BUTYRYLCHOLINESTERASE, ACYLCHOLINE ACYLHYDROLASE, CHOLINE ESTERASE II, BUTYRYLCHOLINE ESTERASE, PSEUDOCHOLINESTERASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EDDIIIATKNGKVRGMQLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSC(CSS)QNIDQSFPGF
HGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLAL
PGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSL
YEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQ
ILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDY
NFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDQYTKAEEILSRSIVKRWANFAK
YGNPQETQNQSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EDDIIIATKNGKVRGMQLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSE
MWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNP
EAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEAR
NRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVG
VNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDVVGDYNFIC
PALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDQYTKAEEILSRSIVKRWANFAKYGNP
QETQNQSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   ILE n 
1 6   ILE n 
1 7   ALA n 
1 8   THR n 
1 9   LYS n 
1 10  ASN n 
1 11  GLY n 
1 12  LYS n 
1 13  VAL n 
1 14  ARG n 
1 15  GLY n 
1 16  MET n 
1 17  GLN n 
1 18  LEU n 
1 19  THR n 
1 20  VAL n 
1 21  PHE n 
1 22  GLY n 
1 23  GLY n 
1 24  THR n 
1 25  VAL n 
1 26  THR n 
1 27  ALA n 
1 28  PHE n 
1 29  LEU n 
1 30  GLY n 
1 31  ILE n 
1 32  PRO n 
1 33  TYR n 
1 34  ALA n 
1 35  GLN n 
1 36  PRO n 
1 37  PRO n 
1 38  LEU n 
1 39  GLY n 
1 40  ARG n 
1 41  LEU n 
1 42  ARG n 
1 43  PHE n 
1 44  LYS n 
1 45  LYS n 
1 46  PRO n 
1 47  GLN n 
1 48  SER n 
1 49  LEU n 
1 50  THR n 
1 51  LYS n 
1 52  TRP n 
1 53  SER n 
1 54  ASP n 
1 55  ILE n 
1 56  TRP n 
1 57  ASN n 
1 58  ALA n 
1 59  THR n 
1 60  LYS n 
1 61  TYR n 
1 62  ALA n 
1 63  ASN n 
1 64  SER n 
1 65  CYS n 
1 66  CSS n 
1 67  GLN n 
1 68  ASN n 
1 69  ILE n 
1 70  ASP n 
1 71  GLN n 
1 72  SER n 
1 73  PHE n 
1 74  PRO n 
1 75  GLY n 
1 76  PHE n 
1 77  HIS n 
1 78  GLY n 
1 79  SER n 
1 80  GLU n 
1 81  MET n 
1 82  TRP n 
1 83  ASN n 
1 84  PRO n 
1 85  ASN n 
1 86  THR n 
1 87  ASP n 
1 88  LEU n 
1 89  SER n 
1 90  GLU n 
1 91  ASP n 
1 92  CYS n 
1 93  LEU n 
1 94  TYR n 
1 95  LEU n 
1 96  ASN n 
1 97  VAL n 
1 98  TRP n 
1 99  ILE n 
1 100 PRO n 
1 101 ALA n 
1 102 PRO n 
1 103 LYS n 
1 104 PRO n 
1 105 LYS n 
1 106 ASN n 
1 107 ALA n 
1 108 THR n 
1 109 VAL n 
1 110 LEU n 
1 111 ILE n 
1 112 TRP n 
1 113 ILE n 
1 114 TYR n 
1 115 GLY n 
1 116 GLY n 
1 117 GLY n 
1 118 PHE n 
1 119 GLN n 
1 120 THR n 
1 121 GLY n 
1 122 THR n 
1 123 SER n 
1 124 SER n 
1 125 LEU n 
1 126 HIS n 
1 127 VAL n 
1 128 TYR n 
1 129 ASP n 
1 130 GLY n 
1 131 LYS n 
1 132 PHE n 
1 133 LEU n 
1 134 ALA n 
1 135 ARG n 
1 136 VAL n 
1 137 GLU n 
1 138 ARG n 
1 139 VAL n 
1 140 ILE n 
1 141 VAL n 
1 142 VAL n 
1 143 SER n 
1 144 MET n 
1 145 ASN n 
1 146 TYR n 
1 147 ARG n 
1 148 VAL n 
1 149 GLY n 
1 150 ALA n 
1 151 LEU n 
1 152 GLY n 
1 153 PHE n 
1 154 LEU n 
1 155 ALA n 
1 156 LEU n 
1 157 PRO n 
1 158 GLY n 
1 159 ASN n 
1 160 PRO n 
1 161 GLU n 
1 162 ALA n 
1 163 PRO n 
1 164 GLY n 
1 165 ASN n 
1 166 MET n 
1 167 GLY n 
1 168 LEU n 
1 169 PHE n 
1 170 ASP n 
1 171 GLN n 
1 172 GLN n 
1 173 LEU n 
1 174 ALA n 
1 175 LEU n 
1 176 GLN n 
1 177 TRP n 
1 178 VAL n 
1 179 GLN n 
1 180 LYS n 
1 181 ASN n 
1 182 ILE n 
1 183 ALA n 
1 184 ALA n 
1 185 PHE n 
1 186 GLY n 
1 187 GLY n 
1 188 ASN n 
1 189 PRO n 
1 190 LYS n 
1 191 SER n 
1 192 VAL n 
1 193 THR n 
1 194 LEU n 
1 195 PHE n 
1 196 GLY n 
1 197 GLU n 
1 198 SER n 
1 199 ALA n 
1 200 GLY n 
1 201 ALA n 
1 202 ALA n 
1 203 SER n 
1 204 VAL n 
1 205 SER n 
1 206 LEU n 
1 207 HIS n 
1 208 LEU n 
1 209 LEU n 
1 210 SER n 
1 211 PRO n 
1 212 GLY n 
1 213 SER n 
1 214 HIS n 
1 215 SER n 
1 216 LEU n 
1 217 PHE n 
1 218 THR n 
1 219 ARG n 
1 220 ALA n 
1 221 ILE n 
1 222 LEU n 
1 223 GLN n 
1 224 SER n 
1 225 GLY n 
1 226 SER n 
1 227 PHE n 
1 228 ASN n 
1 229 ALA n 
1 230 PRO n 
1 231 TRP n 
1 232 ALA n 
1 233 VAL n 
1 234 THR n 
1 235 SER n 
1 236 LEU n 
1 237 TYR n 
1 238 GLU n 
1 239 ALA n 
1 240 ARG n 
1 241 ASN n 
1 242 ARG n 
1 243 THR n 
1 244 LEU n 
1 245 ASN n 
1 246 LEU n 
1 247 ALA n 
1 248 LYS n 
1 249 LEU n 
1 250 THR n 
1 251 GLY n 
1 252 CYS n 
1 253 SER n 
1 254 ARG n 
1 255 GLU n 
1 256 ASN n 
1 257 GLU n 
1 258 THR n 
1 259 GLU n 
1 260 ILE n 
1 261 ILE n 
1 262 LYS n 
1 263 CYS n 
1 264 LEU n 
1 265 ARG n 
1 266 ASN n 
1 267 LYS n 
1 268 ASP n 
1 269 PRO n 
1 270 GLN n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 LEU n 
1 275 ASN n 
1 276 GLU n 
1 277 ALA n 
1 278 PHE n 
1 279 VAL n 
1 280 VAL n 
1 281 PRO n 
1 282 TYR n 
1 283 GLY n 
1 284 THR n 
1 285 PRO n 
1 286 LEU n 
1 287 SER n 
1 288 VAL n 
1 289 ASN n 
1 290 PHE n 
1 291 GLY n 
1 292 PRO n 
1 293 THR n 
1 294 VAL n 
1 295 ASP n 
1 296 GLY n 
1 297 ASP n 
1 298 PHE n 
1 299 LEU n 
1 300 THR n 
1 301 ASP n 
1 302 MET n 
1 303 PRO n 
1 304 ASP n 
1 305 ILE n 
1 306 LEU n 
1 307 LEU n 
1 308 GLU n 
1 309 LEU n 
1 310 GLY n 
1 311 GLN n 
1 312 PHE n 
1 313 LYS n 
1 314 LYS n 
1 315 THR n 
1 316 GLN n 
1 317 ILE n 
1 318 LEU n 
1 319 VAL n 
1 320 GLY n 
1 321 VAL n 
1 322 ASN n 
1 323 LYS n 
1 324 ASP n 
1 325 GLU n 
1 326 GLY n 
1 327 THR n 
1 328 ALA n 
1 329 PHE n 
1 330 LEU n 
1 331 VAL n 
1 332 TYR n 
1 333 GLY n 
1 334 ALA n 
1 335 PRO n 
1 336 GLY n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 ASP n 
1 341 ASN n 
1 342 ASN n 
1 343 SER n 
1 344 ILE n 
1 345 ILE n 
1 346 THR n 
1 347 ARG n 
1 348 LYS n 
1 349 GLU n 
1 350 PHE n 
1 351 GLN n 
1 352 GLU n 
1 353 GLY n 
1 354 LEU n 
1 355 LYS n 
1 356 ILE n 
1 357 PHE n 
1 358 PHE n 
1 359 PRO n 
1 360 GLY n 
1 361 VAL n 
1 362 SER n 
1 363 GLU n 
1 364 PHE n 
1 365 GLY n 
1 366 LYS n 
1 367 GLU n 
1 368 SER n 
1 369 ILE n 
1 370 LEU n 
1 371 PHE n 
1 372 HIS n 
1 373 TYR n 
1 374 THR n 
1 375 ASP n 
1 376 TRP n 
1 377 VAL n 
1 378 ASP n 
1 379 ASP n 
1 380 GLN n 
1 381 ARG n 
1 382 PRO n 
1 383 GLU n 
1 384 ASN n 
1 385 TYR n 
1 386 ARG n 
1 387 GLU n 
1 388 ALA n 
1 389 LEU n 
1 390 GLY n 
1 391 ASP n 
1 392 VAL n 
1 393 VAL n 
1 394 GLY n 
1 395 ASP n 
1 396 TYR n 
1 397 ASN n 
1 398 PHE n 
1 399 ILE n 
1 400 CYS n 
1 401 PRO n 
1 402 ALA n 
1 403 LEU n 
1 404 GLU n 
1 405 PHE n 
1 406 THR n 
1 407 LYS n 
1 408 LYS n 
1 409 PHE n 
1 410 SER n 
1 411 GLU n 
1 412 TRP n 
1 413 GLY n 
1 414 ASN n 
1 415 ASN n 
1 416 ALA n 
1 417 PHE n 
1 418 PHE n 
1 419 TYR n 
1 420 TYR n 
1 421 PHE n 
1 422 GLU n 
1 423 HIS n 
1 424 ARG n 
1 425 SER n 
1 426 SER n 
1 427 LYS n 
1 428 LEU n 
1 429 PRO n 
1 430 TRP n 
1 431 PRO n 
1 432 GLU n 
1 433 TRP n 
1 434 MET n 
1 435 GLY n 
1 436 VAL n 
1 437 MET n 
1 438 HIS n 
1 439 GLY n 
1 440 TYR n 
1 441 GLU n 
1 442 ILE n 
1 443 GLU n 
1 444 PHE n 
1 445 VAL n 
1 446 PHE n 
1 447 GLY n 
1 448 LEU n 
1 449 PRO n 
1 450 LEU n 
1 451 GLU n 
1 452 ARG n 
1 453 ARG n 
1 454 ASP n 
1 455 GLN n 
1 456 TYR n 
1 457 THR n 
1 458 LYS n 
1 459 ALA n 
1 460 GLU n 
1 461 GLU n 
1 462 ILE n 
1 463 LEU n 
1 464 SER n 
1 465 ARG n 
1 466 SER n 
1 467 ILE n 
1 468 VAL n 
1 469 LYS n 
1 470 ARG n 
1 471 TRP n 
1 472 ALA n 
1 473 ASN n 
1 474 PHE n 
1 475 ALA n 
1 476 LYS n 
1 477 TYR n 
1 478 GLY n 
1 479 ASN n 
1 480 PRO n 
1 481 GLN n 
1 482 GLU n 
1 483 THR n 
1 484 GLN n 
1 485 ASN n 
1 486 GLN n 
1 487 SER n 
1 488 THR n 
1 489 SER n 
1 490 TRP n 
1 491 PRO n 
1 492 VAL n 
1 493 PHE n 
1 494 LYS n 
1 495 SER n 
1 496 THR n 
1 497 GLU n 
1 498 GLN n 
1 499 LYS n 
1 500 TYR n 
1 501 LEU n 
1 502 THR n 
1 503 LEU n 
1 504 ASN n 
1 505 THR n 
1 506 GLU n 
1 507 SER n 
1 508 THR n 
1 509 ARG n 
1 510 ILE n 
1 511 MET n 
1 512 THR n 
1 513 LYS n 
1 514 LEU n 
1 515 ARG n 
1 516 ALA n 
1 517 GLN n 
1 518 GLN n 
1 519 CYS n 
1 520 ARG n 
1 521 PHE n 
1 522 TRP n 
1 523 THR n 
1 524 SER n 
1 525 PHE n 
1 526 PHE n 
1 527 PRO n 
1 528 LYS n 
1 529 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'CRICETULUS GRISEUS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            CHO-K1 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CHLE_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P06276 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2WSL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 529 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06276 
_struct_ref_seq.db_align_beg                  29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  557 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       529 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2WSL GLN A 17  ? UNP P06276 ASN 45  'engineered mutation' 17  1 
1 2WSL GLN A 455 ? UNP P06276 ASN 483 'engineered mutation' 455 2 
1 2WSL GLN A 481 ? UNP P06276 ASN 509 'engineered mutation' 481 3 
1 2WSL GLN A 486 ? UNP P06276 ASN 514 'engineered mutation' 486 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?                        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?                        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?                        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?                        'C4 H7 N O4'     133.103 
CL  non-polymer                   . 'CHLORIDE ION'                           ?                        'Cl -1'          35.453  
CSS 'L-peptide linking'           n S-MERCAPTOCYSTEINE                       ?                        'C3 H7 N O2 S2'  153.223 
CYS 'L-peptide linking'           y CYSTEINE                                 ?                        'C3 H7 N O2 S'   121.158 
EFS non-polymer                   . 'ETHYL DIHYDROGEN PHOSPHATE'             ?                        'C2 H7 O4 P'     126.048 
F   non-polymer                   . 'FLUORIDE ION'                           ?                        'F -1'           18.998  
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ?                        'C6 H12 O5'      164.156 
FUL 'L-saccharide, beta linking'  . beta-L-fucopyranose                      6-DEOXY-BETA-L-GALACTOSE 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ?                        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?                        'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ?                        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ?                        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ?                        'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?                        'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?                        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?                        'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ?                        'C5 H11 N O2 S'  149.211 
NA  non-polymer                   . 'SODIUM ION'                             ?                        'Na 1'           22.990  
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                        'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?                        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?                        'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ?                        'C3 H7 N O3'     105.093 
SO4 non-polymer                   . 'SULFATE ION'                            ?                        'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE                                ?                        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?                        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?                        'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ?                        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2WSL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   55.7 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M MES BUFFER PH 6.5, 2.1M AMMONIUM SULFATE' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     77 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-04-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9765 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9765 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WSL 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   51418 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.80 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.3 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.10 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.375 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.35 
_reflns_shell.pdbx_redundancy        7.3 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WSL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     49870 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.87 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.18536 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18431 
_refine.ls_R_factor_R_free                       0.21957 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.0 
_refine.ls_number_reflns_R_free                  1543 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.936 
_refine.B_iso_mean                               27.899 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.01 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1P0I' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.148 
_refine.pdbx_overall_ESU_R_Free                  0.138 
_refine.overall_SU_ML                            0.092 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.254 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4204 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         156 
_refine_hist.number_atoms_solvent             397 
_refine_hist.number_atoms_total               4757 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        48.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 4560 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.351  1.982  ? 6213 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.209  5.000  ? 544  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.223 24.095 ? 210  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.542 15.000 ? 721  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.084 15.000 ? 23   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.101  0.200  ? 681  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 3487 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.691  1.500  ? 2652 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.278  2.000  ? 4294 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.786  3.000  ? 1908 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.916  4.500  ? 1911 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.002 
_refine_ls_shell.d_res_low                        2.054 
_refine_ls_shell.number_reflns_R_work             3603 
_refine_ls_shell.R_factor_R_work                  0.234 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.272 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             112 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  2WSL 
_struct.title                     'Aged Form of Human Butyrylcholinesterase Inhibited by Tabun Analogue TA4' 
_struct.pdbx_descriptor           'CHOLINESTERASE (E.C.3.1.1.8)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WSL 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'TABUN, AGING, HYDROLASE, INHIBITION, BUTYRYLCHOLINESTERASE, GLYCOPROTEIN, SERINE ESTERASE, DISEASE MUTATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 5  ? 
H N N 6  ? 
I N N 7  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
M N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 38  ? ARG A 42  ? LEU A 38  ARG A 42  5 ? 5  
HELX_P HELX_P2  2  PHE A 76  ? MET A 81  ? PHE A 76  MET A 81  1 ? 6  
HELX_P HELX_P3  3  LEU A 125 ? ASP A 129 ? LEU A 125 ASP A 129 5 ? 5  
HELX_P HELX_P4  4  GLY A 130 ? ARG A 138 ? GLY A 130 ARG A 138 1 ? 9  
HELX_P HELX_P5  5  VAL A 148 ? LEU A 154 ? VAL A 148 LEU A 154 1 ? 7  
HELX_P HELX_P6  6  ASN A 165 ? ILE A 182 ? ASN A 165 ILE A 182 1 ? 18 
HELX_P HELX_P7  7  ALA A 183 ? PHE A 185 ? ALA A 183 PHE A 185 5 ? 3  
HELX_P HELX_P8  8  SER A 198 ? SER A 210 ? SER A 198 SER A 210 1 ? 13 
HELX_P HELX_P9  9  PRO A 211 ? PHE A 217 ? PRO A 211 PHE A 217 5 ? 7  
HELX_P HELX_P10 10 SER A 235 ? THR A 250 ? SER A 235 THR A 250 1 ? 16 
HELX_P HELX_P11 11 ASN A 256 ? ARG A 265 ? ASN A 256 ARG A 265 1 ? 10 
HELX_P HELX_P12 12 ASP A 268 ? GLU A 276 ? ASP A 268 GLU A 276 1 ? 9  
HELX_P HELX_P13 13 ALA A 277 ? VAL A 280 ? ALA A 277 VAL A 280 5 ? 4  
HELX_P HELX_P14 14 MET A 302 ? LEU A 309 ? MET A 302 LEU A 309 1 ? 8  
HELX_P HELX_P15 15 GLY A 326 ? GLY A 333 ? GLY A 326 GLY A 333 5 ? 8  
HELX_P HELX_P16 16 THR A 346 ? PHE A 358 ? THR A 346 PHE A 358 1 ? 13 
HELX_P HELX_P17 17 SER A 362 ? THR A 374 ? SER A 362 THR A 374 1 ? 13 
HELX_P HELX_P18 18 GLU A 383 ? PHE A 398 ? GLU A 383 PHE A 398 1 ? 16 
HELX_P HELX_P19 19 PHE A 398 ? GLU A 411 ? PHE A 398 GLU A 411 1 ? 14 
HELX_P HELX_P20 20 PRO A 431 ? GLY A 435 ? PRO A 431 GLY A 435 5 ? 5  
HELX_P HELX_P21 21 GLU A 441 ? PHE A 446 ? GLU A 441 PHE A 446 1 ? 6  
HELX_P HELX_P22 22 GLY A 447 ? GLN A 455 ? GLY A 447 GLN A 455 5 ? 9  
HELX_P HELX_P23 23 THR A 457 ? GLY A 478 ? THR A 457 GLY A 478 1 ? 22 
HELX_P HELX_P24 24 ARG A 515 ? PHE A 525 ? ARG A 515 PHE A 525 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 65  SG  ? ? ? 1_555 A CYS 92  SG ? ? A CYS 65  A CYS 92   1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf2  disulf ?    ? A CYS 252 SG  ? ? ? 1_555 A CYS 263 SG ? ? A CYS 252 A CYS 263  1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf3  disulf ?    ? A CYS 400 SG  ? ? ? 1_555 A CYS 519 SG ? ? A CYS 400 A CYS 519  1_555 ? ? ? ? ? ? ? 2.074 ? ?               
covale1  covale one  ? A ASN 57  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 57  A NAG 1535 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale2  covale one  ? A CYS 65  C   ? ? ? 1_555 A CSS 66  N  ? ? A CYS 65  A CSS 66   1_555 ? ? ? ? ? ? ? 1.333 ? ?               
covale3  covale both ? A CSS 66  C   ? ? ? 1_555 A GLN 67  N  ? ? A CSS 66  A GLN 67   1_555 ? ? ? ? ? ? ? 1.328 ? ?               
covale4  covale one  ? A ASN 106 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 106 C NAG 1    1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale5  covale none ? A SER 198 OG  ? ? ? 1_555 K EFS .   P  ? ? A SER 198 A EFS 1544 1_555 ? ? ? ? ? ? ? 1.613 ? ?               
covale6  covale one  ? A ASN 241 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 241 D NAG 1    1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale7  covale one  ? A ASN 256 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 256 A NAG 1537 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale8  covale one  ? A ASN 341 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 341 B NAG 1    1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale9  covale one  ? A ASN 485 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 485 A NAG 1536 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale10 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2    1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale11 covale one  ? B NAG .   O6  ? ? ? 1_555 B FUL .   C1 ? ? B NAG 1   B FUL 3    1_555 ? ? ? ? ? ? ? 1.448 ? ?               
covale12 covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 2    1_555 ? ? ? ? ? ? ? 1.454 ? ?               
covale13 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2    1_555 ? ? ? ? ? ? ? 1.447 ? ?               
covale14 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3    1_555 ? ? ? ? ? ? ? 1.445 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 101 A . ? ALA 101 A PRO 102 A ? PRO 102 A 1 0.37   
2 GLY 360 A . ? GLY 360 A VAL 361 A ? VAL 361 A 1 7.00   
3 VAL 377 A . ? VAL 377 A ASP 378 A ? ASP 378 A 1 -11.92 
4 GLN 380 A . ? GLN 380 A ARG 381 A ? ARG 381 A 1 16.21  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ILE A 5   ? THR A 8   ? ILE A 5   THR A 8   
A 2  GLY A 11  ? ARG A 14  ? GLY A 11  ARG A 14  
A 3  ILE A 55  ? ASN A 57  ? ILE A 55  ASN A 57  
B 1  MET A 16  ? VAL A 20  ? MET A 16  VAL A 20  
B 2  GLY A 23  ? PRO A 32  ? GLY A 23  PRO A 32  
B 3  TYR A 94  ? PRO A 100 ? TYR A 94  PRO A 100 
B 4  ILE A 140 ? MET A 144 ? ILE A 140 MET A 144 
B 5  ALA A 107 ? ILE A 113 ? ALA A 107 ILE A 113 
B 6  GLY A 187 ? GLU A 197 ? GLY A 187 GLU A 197 
B 7  ARG A 219 ? GLN A 223 ? ARG A 219 GLN A 223 
B 8  ILE A 317 ? ASN A 322 ? ILE A 317 ASN A 322 
B 9  ALA A 416 ? PHE A 421 ? ALA A 416 PHE A 421 
B 10 LYS A 499 ? LEU A 503 ? LYS A 499 LEU A 503 
B 11 ILE A 510 ? THR A 512 ? ILE A 510 THR A 512 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N ILE A 6   ? N ILE A 6   O VAL A 13  ? O VAL A 13  
A 2  3  N ARG A 14  ? N ARG A 14  O TRP A 56  ? O TRP A 56  
B 1  2  N LEU A 18  ? N LEU A 18  O VAL A 25  ? O VAL A 25  
B 2  3  N PHE A 28  ? N PHE A 28  O VAL A 97  ? O VAL A 97  
B 3  4  N ASN A 96  ? N ASN A 96  O SER A 143 ? O SER A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N TRP A 112 ? N TRP A 112 
B 5  6  N VAL A 109 ? N VAL A 109 O THR A 193 ? O THR A 193 
B 6  7  N GLY A 196 ? N GLY A 196 O GLN A 223 ? O GLN A 223 
B 7  8  N LEU A 222 ? N LEU A 222 O LEU A 318 ? O LEU A 318 
B 8  9  N VAL A 321 ? N VAL A 321 O PHE A 421 ? O PHE A 421 
B 9  10 N TYR A 420 ? N TYR A 420 O LEU A 503 ? O LEU A 503 
B 10 11 N TYR A 500 ? N TYR A 500 O MET A 511 ? O MET A 511 
# 
_database_PDB_matrix.entry_id          2WSL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WSL 
_atom_sites.fract_transf_matrix[1][1]   0.006457 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006457 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007936 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1  3   ? 18.032 37.984  49.197  1.00 47.69 ? 3    ASP A N   1 
ATOM   2    C  CA  . ASP A 1  3   ? 18.709 36.754  49.704  1.00 47.71 ? 3    ASP A CA  1 
ATOM   3    C  C   . ASP A 1  3   ? 17.917 35.521  49.267  1.00 47.16 ? 3    ASP A C   1 
ATOM   4    O  O   . ASP A 1  3   ? 16.711 35.428  49.520  1.00 47.45 ? 3    ASP A O   1 
ATOM   5    C  CB  . ASP A 1  3   ? 18.837 36.806  51.236  1.00 48.20 ? 3    ASP A CB  1 
ATOM   6    C  CG  . ASP A 1  3   ? 19.812 35.770  51.786  1.00 49.10 ? 3    ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1  3   ? 20.688 35.291  51.037  1.00 51.09 ? 3    ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1  3   ? 19.711 35.440  52.983  1.00 51.05 ? 3    ASP A OD2 1 
ATOM   9    N  N   . ILE A 1  4   ? 18.585 34.591  48.591  1.00 46.01 ? 4    ILE A N   1 
ATOM   10   C  CA  . ILE A 1  4   ? 17.909 33.413  48.047  1.00 44.75 ? 4    ILE A CA  1 
ATOM   11   C  C   . ILE A 1  4   ? 18.491 32.148  48.658  1.00 43.44 ? 4    ILE A C   1 
ATOM   12   O  O   . ILE A 1  4   ? 19.650 31.797  48.408  1.00 43.26 ? 4    ILE A O   1 
ATOM   13   C  CB  . ILE A 1  4   ? 18.004 33.332  46.508  1.00 45.32 ? 4    ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1  4   ? 18.336 34.706  45.893  1.00 46.10 ? 4    ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1  4   ? 16.714 32.725  45.926  1.00 45.21 ? 4    ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1  4   ? 19.826 35.115  45.974  1.00 46.38 ? 4    ILE A CD1 1 
ATOM   17   N  N   . ILE A 1  5   ? 17.684 31.483  49.477  1.00 41.75 ? 5    ILE A N   1 
ATOM   18   C  CA  . ILE A 1  5   ? 18.105 30.278  50.168  1.00 40.25 ? 5    ILE A CA  1 
ATOM   19   C  C   . ILE A 1  5   ? 17.151 29.168  49.805  1.00 39.26 ? 5    ILE A C   1 
ATOM   20   O  O   . ILE A 1  5   ? 15.938 29.333  49.891  1.00 39.55 ? 5    ILE A O   1 
ATOM   21   C  CB  . ILE A 1  5   ? 18.167 30.484  51.700  1.00 40.55 ? 5    ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1  5   ? 19.243 31.519  52.042  1.00 40.31 ? 5    ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1  5   ? 18.443 29.161  52.433  1.00 40.04 ? 5    ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1  5   ? 18.984 32.253  53.344  1.00 40.46 ? 5    ILE A CD1 1 
ATOM   25   N  N   . ILE A 1  6   ? 17.716 28.049  49.365  1.00 37.82 ? 6    ILE A N   1 
ATOM   26   C  CA  . ILE A 1  6   ? 16.948 26.880  48.978  1.00 36.44 ? 6    ILE A CA  1 
ATOM   27   C  C   . ILE A 1  6   ? 17.320 25.746  49.923  1.00 36.25 ? 6    ILE A C   1 
ATOM   28   O  O   . ILE A 1  6   ? 18.499 25.520  50.196  1.00 35.67 ? 6    ILE A O   1 
ATOM   29   C  CB  . ILE A 1  6   ? 17.245 26.463  47.501  1.00 35.91 ? 6    ILE A CB  1 
ATOM   30   C  CG1 . ILE A 1  6   ? 16.920 27.604  46.524  1.00 34.97 ? 6    ILE A CG1 1 
ATOM   31   C  CG2 . ILE A 1  6   ? 16.520 25.176  47.131  1.00 35.31 ? 6    ILE A CG2 1 
ATOM   32   C  CD1 . ILE A 1  6   ? 15.425 27.856  46.236  1.00 33.16 ? 6    ILE A CD1 1 
ATOM   33   N  N   . ALA A 1  7   ? 16.311 25.045  50.429  1.00 35.98 ? 7    ALA A N   1 
ATOM   34   C  CA  . ALA A 1  7   ? 16.540 23.882  51.273  1.00 36.18 ? 7    ALA A CA  1 
ATOM   35   C  C   . ALA A 1  7   ? 16.660 22.617  50.419  1.00 36.30 ? 7    ALA A C   1 
ATOM   36   O  O   . ALA A 1  7   ? 15.687 22.177  49.821  1.00 36.49 ? 7    ALA A O   1 
ATOM   37   C  CB  . ALA A 1  7   ? 15.422 23.746  52.296  1.00 35.87 ? 7    ALA A CB  1 
ATOM   38   N  N   . THR A 1  8   ? 17.860 22.045  50.353  1.00 36.44 ? 8    THR A N   1 
ATOM   39   C  CA  . THR A 1  8   ? 18.083 20.795  49.625  1.00 36.46 ? 8    THR A CA  1 
ATOM   40   C  C   . THR A 1  8   ? 18.010 19.601  50.570  1.00 36.96 ? 8    THR A C   1 
ATOM   41   O  O   . THR A 1  8   ? 17.982 19.772  51.790  1.00 37.05 ? 8    THR A O   1 
ATOM   42   C  CB  . THR A 1  8   ? 19.464 20.768  48.934  1.00 36.40 ? 8    THR A CB  1 
ATOM   43   O  OG1 . THR A 1  8   ? 20.478 20.420  49.888  1.00 35.68 ? 8    THR A OG1 1 
ATOM   44   C  CG2 . THR A 1  8   ? 19.781 22.113  48.309  1.00 36.62 ? 8    THR A CG2 1 
ATOM   45   N  N   . LYS A 1  9   ? 18.020 18.394  50.007  1.00 37.18 ? 9    LYS A N   1 
ATOM   46   C  CA  . LYS A 1  9   ? 18.038 17.152  50.790  1.00 37.85 ? 9    LYS A CA  1 
ATOM   47   C  C   . LYS A 1  9   ? 19.204 17.079  51.781  1.00 37.69 ? 9    LYS A C   1 
ATOM   48   O  O   . LYS A 1  9   ? 19.083 16.453  52.832  1.00 37.87 ? 9    LYS A O   1 
ATOM   49   C  CB  . LYS A 1  9   ? 18.089 15.934  49.860  1.00 37.85 ? 9    LYS A CB  1 
ATOM   50   C  CG  . LYS A 1  9   ? 16.853 15.733  48.997  1.00 39.13 ? 9    LYS A CG  1 
ATOM   51   C  CD  . LYS A 1  9   ? 15.803 14.882  49.689  1.00 40.51 ? 9    LYS A CD  1 
ATOM   52   C  CE  . LYS A 1  9   ? 14.518 14.852  48.887  1.00 41.86 ? 9    LYS A CE  1 
ATOM   53   N  NZ  . LYS A 1  9   ? 13.740 16.097  49.113  1.00 43.30 ? 9    LYS A NZ  1 
ATOM   54   N  N   . ASN A 1  10  ? 20.330 17.706  51.441  1.00 37.88 ? 10   ASN A N   1 
ATOM   55   C  CA  . ASN A 1  10  ? 21.532 17.641  52.279  1.00 38.09 ? 10   ASN A CA  1 
ATOM   56   C  C   . ASN A 1  10  ? 21.861 18.926  53.036  1.00 37.67 ? 10   ASN A C   1 
ATOM   57   O  O   . ASN A 1  10  ? 22.902 19.006  53.689  1.00 38.09 ? 10   ASN A O   1 
ATOM   58   C  CB  . ASN A 1  10  ? 22.748 17.239  51.448  1.00 38.52 ? 10   ASN A CB  1 
ATOM   59   C  CG  . ASN A 1  10  ? 22.582 15.890  50.785  1.00 40.10 ? 10   ASN A CG  1 
ATOM   60   O  OD1 . ASN A 1  10  ? 22.760 14.847  51.418  1.00 41.73 ? 10   ASN A OD1 1 
ATOM   61   N  ND2 . ASN A 1  10  ? 22.252 15.902  49.491  1.00 41.30 ? 10   ASN A ND2 1 
ATOM   62   N  N   . GLY A 1  11  ? 20.986 19.924  52.949  1.00 36.92 ? 11   GLY A N   1 
ATOM   63   C  CA  . GLY A 1  11  ? 21.238 21.201  53.589  1.00 36.32 ? 11   GLY A CA  1 
ATOM   64   C  C   . GLY A 1  11  ? 20.796 22.409  52.795  1.00 35.97 ? 11   GLY A C   1 
ATOM   65   O  O   . GLY A 1  11  ? 20.427 22.303  51.630  1.00 35.87 ? 11   GLY A O   1 
ATOM   66   N  N   . LYS A 1  12  ? 20.830 23.567  53.444  1.00 35.54 ? 12   LYS A N   1 
ATOM   67   C  CA  . LYS A 1  12  ? 20.453 24.820  52.814  1.00 34.97 ? 12   LYS A CA  1 
ATOM   68   C  C   . LYS A 1  12  ? 21.600 25.363  51.971  1.00 34.54 ? 12   LYS A C   1 
ATOM   69   O  O   . LYS A 1  12  ? 22.770 25.252  52.351  1.00 34.60 ? 12   LYS A O   1 
ATOM   70   C  CB  . LYS A 1  12  ? 20.041 25.846  53.876  1.00 35.23 ? 12   LYS A CB  1 
ATOM   71   C  CG  . LYS A 1  12  ? 18.636 25.652  54.416  1.00 36.17 ? 12   LYS A CG  1 
ATOM   72   C  CD  . LYS A 1  12  ? 18.294 26.750  55.410  1.00 38.75 ? 12   LYS A CD  1 
ATOM   73   C  CE  . LYS A 1  12  ? 16.824 26.713  55.798  1.00 40.82 ? 12   LYS A CE  1 
ATOM   74   N  NZ  . LYS A 1  12  ? 16.460 27.911  56.606  1.00 41.77 ? 12   LYS A NZ  1 
ATOM   75   N  N   . VAL A 1  13  ? 21.265 25.925  50.812  1.00 33.70 ? 13   VAL A N   1 
ATOM   76   C  CA  . VAL A 1  13  ? 22.251 26.621  49.991  1.00 32.80 ? 13   VAL A CA  1 
ATOM   77   C  C   . VAL A 1  13  ? 21.801 28.057  49.733  1.00 32.35 ? 13   VAL A C   1 
ATOM   78   O  O   . VAL A 1  13  ? 20.625 28.306  49.465  1.00 32.15 ? 13   VAL A O   1 
ATOM   79   C  CB  . VAL A 1  13  ? 22.562 25.892  48.632  1.00 32.83 ? 13   VAL A CB  1 
ATOM   80   C  CG1 . VAL A 1  13  ? 23.111 24.483  48.873  1.00 32.27 ? 13   VAL A CG1 1 
ATOM   81   C  CG2 . VAL A 1  13  ? 21.334 25.843  47.727  1.00 33.53 ? 13   VAL A CG2 1 
ATOM   82   N  N   . ARG A 1  14  ? 22.744 28.991  49.830  1.00 31.88 ? 14   ARG A N   1 
ATOM   83   C  CA  . ARG A 1  14  ? 22.529 30.371  49.405  1.00 31.59 ? 14   ARG A CA  1 
ATOM   84   C  C   . ARG A 1  14  ? 23.108 30.593  48.003  1.00 31.20 ? 14   ARG A C   1 
ATOM   85   O  O   . ARG A 1  14  ? 24.257 30.226  47.725  1.00 31.16 ? 14   ARG A O   1 
ATOM   86   C  CB  . ARG A 1  14  ? 23.169 31.346  50.399  1.00 31.69 ? 14   ARG A CB  1 
ATOM   87   C  CG  . ARG A 1  14  ? 23.191 32.802  49.946  1.00 33.19 ? 14   ARG A CG  1 
ATOM   88   C  CD  . ARG A 1  14  ? 23.811 33.711  51.003  1.00 36.20 ? 14   ARG A CD  1 
ATOM   89   N  NE  . ARG A 1  14  ? 22.925 33.889  52.159  1.00 38.47 ? 14   ARG A NE  1 
ATOM   90   C  CZ  . ARG A 1  14  ? 23.167 33.432  53.386  1.00 39.05 ? 14   ARG A CZ  1 
ATOM   91   N  NH1 . ARG A 1  14  ? 24.289 32.774  53.656  1.00 38.51 ? 14   ARG A NH1 1 
ATOM   92   N  NH2 . ARG A 1  14  ? 22.284 33.656  54.355  1.00 40.11 ? 14   ARG A NH2 1 
ATOM   93   N  N   . GLY A 1  15  ? 22.303 31.188  47.128  1.00 30.72 ? 15   GLY A N   1 
ATOM   94   C  CA  . GLY A 1  15  ? 22.753 31.581  45.801  1.00 30.46 ? 15   GLY A CA  1 
ATOM   95   C  C   . GLY A 1  15  ? 22.988 33.072  45.704  1.00 30.57 ? 15   GLY A C   1 
ATOM   96   O  O   . GLY A 1  15  ? 23.064 33.757  46.719  1.00 30.67 ? 15   GLY A O   1 
ATOM   97   N  N   . MET A 1  16  ? 23.114 33.573  44.481  1.00 30.34 ? 16   MET A N   1 
ATOM   98   C  CA  . MET A 1  16  ? 23.343 34.988  44.252  1.00 30.52 ? 16   MET A CA  1 
ATOM   99   C  C   . MET A 1  16  ? 22.544 35.467  43.042  1.00 30.13 ? 16   MET A C   1 
ATOM   100  O  O   . MET A 1  16  ? 22.196 34.669  42.166  1.00 29.18 ? 16   MET A O   1 
ATOM   101  C  CB  . MET A 1  16  ? 24.833 35.265  44.060  1.00 30.85 ? 16   MET A CB  1 
ATOM   102  C  CG  . MET A 1  16  ? 25.451 34.564  42.861  1.00 33.95 ? 16   MET A CG  1 
ATOM   103  S  SD  . MET A 1  16  ? 27.216 34.898  42.799  1.00 40.83 ? 16   MET A SD  1 
ATOM   104  C  CE  . MET A 1  16  ? 27.642 34.085  41.271  1.00 37.71 ? 16   MET A CE  1 
ATOM   105  N  N   . GLN A 1  17  ? 22.248 36.763  43.009  1.00 29.51 ? 17   GLN A N   1 
ATOM   106  C  CA  . GLN A 1  17  ? 21.434 37.341  41.942  1.00 29.94 ? 17   GLN A CA  1 
ATOM   107  C  C   . GLN A 1  17  ? 22.344 37.918  40.885  1.00 29.51 ? 17   GLN A C   1 
ATOM   108  O  O   . GLN A 1  17  ? 23.331 38.587  41.190  1.00 29.41 ? 17   GLN A O   1 
ATOM   109  C  CB  . GLN A 1  17  ? 20.501 38.438  42.468  1.00 30.23 ? 17   GLN A CB  1 
ATOM   110  C  CG  . GLN A 1  17  ? 19.547 38.014  43.593  1.00 33.01 ? 17   GLN A CG  1 
ATOM   111  C  CD  . GLN A 1  17  ? 18.425 37.095  43.123  1.00 35.44 ? 17   GLN A CD  1 
ATOM   112  O  OE1 . GLN A 1  17  ? 18.638 35.911  42.866  1.00 38.04 ? 17   GLN A OE1 1 
ATOM   113  N  NE2 . GLN A 1  17  ? 17.218 37.638  43.029  1.00 36.21 ? 17   GLN A NE2 1 
ATOM   114  N  N   . LEU A 1  18  ? 22.022 37.643  39.633  1.00 29.13 ? 18   LEU A N   1 
ATOM   115  C  CA  . LEU A 1  18  ? 22.804 38.165  38.528  1.00 28.82 ? 18   LEU A CA  1 
ATOM   116  C  C   . LEU A 1  18  ? 21.877 39.003  37.678  1.00 29.28 ? 18   LEU A C   1 
ATOM   117  O  O   . LEU A 1  18  ? 20.716 38.639  37.476  1.00 29.86 ? 18   LEU A O   1 
ATOM   118  C  CB  . LEU A 1  18  ? 23.398 37.018  37.691  1.00 28.63 ? 18   LEU A CB  1 
ATOM   119  C  CG  . LEU A 1  18  ? 24.216 35.908  38.374  1.00 27.40 ? 18   LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1  18  ? 24.605 34.809  37.347  1.00 25.03 ? 18   LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1  18  ? 25.465 36.461  39.087  1.00 25.72 ? 18   LEU A CD2 1 
ATOM   122  N  N   . THR A 1  19  ? 22.378 40.124  37.178  1.00 29.30 ? 19   THR A N   1 
ATOM   123  C  CA  . THR A 1  19  ? 21.609 40.917  36.223  1.00 29.82 ? 19   THR A CA  1 
ATOM   124  C  C   . THR A 1  19  ? 21.947 40.442  34.824  1.00 29.46 ? 19   THR A C   1 
ATOM   125  O  O   . THR A 1  19  ? 23.122 40.375  34.445  1.00 29.88 ? 19   THR A O   1 
ATOM   126  C  CB  . THR A 1  19  ? 21.862 42.427  36.387  1.00 29.87 ? 19   THR A CB  1 
ATOM   127  O  OG1 . THR A 1  19  ? 21.452 42.806  37.701  1.00 30.61 ? 19   THR A OG1 1 
ATOM   128  C  CG2 . THR A 1  19  ? 21.051 43.239  35.364  1.00 30.27 ? 19   THR A CG2 1 
ATOM   129  N  N   . VAL A 1  20  ? 20.911 40.065  34.080  1.00 28.96 ? 20   VAL A N   1 
ATOM   130  C  CA  . VAL A 1  20  ? 21.078 39.563  32.716  1.00 28.56 ? 20   VAL A CA  1 
ATOM   131  C  C   . VAL A 1  20  ? 19.960 40.101  31.846  1.00 28.73 ? 20   VAL A C   1 
ATOM   132  O  O   . VAL A 1  20  ? 18.786 39.828  32.108  1.00 28.52 ? 20   VAL A O   1 
ATOM   133  C  CB  . VAL A 1  20  ? 21.019 37.999  32.617  1.00 28.62 ? 20   VAL A CB  1 
ATOM   134  C  CG1 . VAL A 1  20  ? 21.403 37.550  31.183  1.00 26.42 ? 20   VAL A CG1 1 
ATOM   135  C  CG2 . VAL A 1  20  ? 21.881 37.314  33.676  1.00 27.40 ? 20   VAL A CG2 1 
ATOM   136  N  N   . PHE A 1  21  ? 20.332 40.855  30.812  1.00 29.17 ? 21   PHE A N   1 
ATOM   137  C  CA  . PHE A 1  21  ? 19.379 41.396  29.832  1.00 29.97 ? 21   PHE A CA  1 
ATOM   138  C  C   . PHE A 1  21  ? 18.212 42.121  30.504  1.00 30.24 ? 21   PHE A C   1 
ATOM   139  O  O   . PHE A 1  21  ? 17.040 41.830  30.236  1.00 30.52 ? 21   PHE A O   1 
ATOM   140  C  CB  . PHE A 1  21  ? 18.863 40.299  28.873  1.00 29.96 ? 21   PHE A CB  1 
ATOM   141  C  CG  . PHE A 1  21  ? 19.952 39.549  28.144  1.00 30.70 ? 21   PHE A CG  1 
ATOM   142  C  CD1 . PHE A 1  21  ? 19.765 38.218  27.771  1.00 31.01 ? 21   PHE A CD1 1 
ATOM   143  C  CD2 . PHE A 1  21  ? 21.159 40.163  27.830  1.00 31.82 ? 21   PHE A CD2 1 
ATOM   144  C  CE1 . PHE A 1  21  ? 20.763 37.508  27.087  1.00 31.06 ? 21   PHE A CE1 1 
ATOM   145  C  CE2 . PHE A 1  21  ? 22.165 39.460  27.162  1.00 31.27 ? 21   PHE A CE2 1 
ATOM   146  C  CZ  . PHE A 1  21  ? 21.965 38.133  26.788  1.00 31.07 ? 21   PHE A CZ  1 
ATOM   147  N  N   . GLY A 1  22  ? 18.537 43.060  31.387  1.00 30.30 ? 22   GLY A N   1 
ATOM   148  C  CA  . GLY A 1  22  ? 17.521 43.858  32.080  1.00 30.91 ? 22   GLY A CA  1 
ATOM   149  C  C   . GLY A 1  22  ? 16.615 43.023  32.964  1.00 30.73 ? 22   GLY A C   1 
ATOM   150  O  O   . GLY A 1  22  ? 15.500 43.438  33.296  1.00 30.92 ? 22   GLY A O   1 
ATOM   151  N  N   . GLY A 1  23  ? 17.084 41.832  33.327  1.00 30.44 ? 23   GLY A N   1 
ATOM   152  C  CA  . GLY A 1  23  ? 16.310 40.914  34.153  1.00 30.25 ? 23   GLY A CA  1 
ATOM   153  C  C   . GLY A 1  23  ? 17.198 40.331  35.228  1.00 30.20 ? 23   GLY A C   1 
ATOM   154  O  O   . GLY A 1  23  ? 18.275 40.856  35.496  1.00 30.81 ? 23   GLY A O   1 
ATOM   155  N  N   . THR A 1  24  ? 16.737 39.258  35.858  1.00 29.49 ? 24   THR A N   1 
ATOM   156  C  CA  . THR A 1  24  ? 17.478 38.623  36.934  1.00 29.10 ? 24   THR A CA  1 
ATOM   157  C  C   . THR A 1  24  ? 17.531 37.110  36.759  1.00 27.56 ? 24   THR A C   1 
ATOM   158  O  O   . THR A 1  24  ? 16.541 36.493  36.384  1.00 27.21 ? 24   THR A O   1 
ATOM   159  C  CB  . THR A 1  24  ? 16.869 38.950  38.304  1.00 29.30 ? 24   THR A CB  1 
ATOM   160  O  OG1 . THR A 1  24  ? 16.842 40.371  38.482  1.00 32.18 ? 24   THR A OG1 1 
ATOM   161  C  CG2 . THR A 1  24  ? 17.684 38.329  39.429  1.00 30.49 ? 24   THR A CG2 1 
ATOM   162  N  N   . VAL A 1  25  ? 18.698 36.540  37.053  1.00 26.06 ? 25   VAL A N   1 
ATOM   163  C  CA  . VAL A 1  25  ? 18.895 35.101  37.148  1.00 24.98 ? 25   VAL A CA  1 
ATOM   164  C  C   . VAL A 1  25  ? 19.505 34.787  38.518  1.00 24.63 ? 25   VAL A C   1 
ATOM   165  O  O   . VAL A 1  25  ? 20.365 35.520  38.996  1.00 24.28 ? 25   VAL A O   1 
ATOM   166  C  CB  . VAL A 1  25  ? 19.811 34.594  35.985  1.00 25.07 ? 25   VAL A CB  1 
ATOM   167  C  CG1 . VAL A 1  25  ? 20.296 33.142  36.208  1.00 25.10 ? 25   VAL A CG1 1 
ATOM   168  C  CG2 . VAL A 1  25  ? 19.077 34.702  34.647  1.00 22.62 ? 25   VAL A CG2 1 
ATOM   169  N  N   . THR A 1  26  ? 19.051 33.708  39.150  1.00 24.33 ? 26   THR A N   1 
ATOM   170  C  CA  . THR A 1  26  ? 19.658 33.241  40.399  1.00 24.10 ? 26   THR A CA  1 
ATOM   171  C  C   . THR A 1  26  ? 20.639 32.096  40.143  1.00 24.33 ? 26   THR A C   1 
ATOM   172  O  O   . THR A 1  26  ? 20.267 31.031  39.614  1.00 23.72 ? 26   THR A O   1 
ATOM   173  C  CB  . THR A 1  26  ? 18.593 32.820  41.429  1.00 24.51 ? 26   THR A CB  1 
ATOM   174  O  OG1 . THR A 1  26  ? 17.593 33.837  41.512  1.00 24.63 ? 26   THR A OG1 1 
ATOM   175  C  CG2 . THR A 1  26  ? 19.220 32.620  42.792  1.00 22.70 ? 26   THR A CG2 1 
ATOM   176  N  N   . ALA A 1  27  ? 21.899 32.330  40.508  1.00 24.21 ? 27   ALA A N   1 
ATOM   177  C  CA  . ALA A 1  27  ? 22.960 31.355  40.292  1.00 24.04 ? 27   ALA A CA  1 
ATOM   178  C  C   . ALA A 1  27  ? 23.381 30.734  41.621  1.00 24.19 ? 27   ALA A C   1 
ATOM   179  O  O   . ALA A 1  27  ? 23.570 31.450  42.638  1.00 24.98 ? 27   ALA A O   1 
ATOM   180  C  CB  . ALA A 1  27  ? 24.148 32.003  39.599  1.00 23.64 ? 27   ALA A CB  1 
ATOM   181  N  N   . PHE A 1  28  ? 23.474 29.408  41.627  1.00 23.22 ? 28   PHE A N   1 
ATOM   182  C  CA  . PHE A 1  28  ? 24.020 28.660  42.762  1.00 22.64 ? 28   PHE A CA  1 
ATOM   183  C  C   . PHE A 1  28  ? 25.245 27.945  42.222  1.00 22.63 ? 28   PHE A C   1 
ATOM   184  O  O   . PHE A 1  28  ? 25.134 26.874  41.595  1.00 21.38 ? 28   PHE A O   1 
ATOM   185  C  CB  . PHE A 1  28  ? 23.029 27.644  43.315  1.00 22.47 ? 28   PHE A CB  1 
ATOM   186  C  CG  . PHE A 1  28  ? 21.734 28.248  43.783  1.00 23.13 ? 28   PHE A CG  1 
ATOM   187  C  CD1 . PHE A 1  28  ? 20.712 28.513  42.879  1.00 22.62 ? 28   PHE A CD1 1 
ATOM   188  C  CD2 . PHE A 1  28  ? 21.536 28.536  45.129  1.00 24.09 ? 28   PHE A CD2 1 
ATOM   189  C  CE1 . PHE A 1  28  ? 19.516 29.079  43.289  1.00 23.85 ? 28   PHE A CE1 1 
ATOM   190  C  CE2 . PHE A 1  28  ? 20.331 29.091  45.570  1.00 24.54 ? 28   PHE A CE2 1 
ATOM   191  C  CZ  . PHE A 1  28  ? 19.316 29.371  44.642  1.00 25.28 ? 28   PHE A CZ  1 
ATOM   192  N  N   . LEU A 1  29  ? 26.403 28.569  42.425  1.00 21.52 ? 29   LEU A N   1 
ATOM   193  C  CA  . LEU A 1  29  ? 27.648 28.035  41.904  1.00 21.99 ? 29   LEU A CA  1 
ATOM   194  C  C   . LEU A 1  29  ? 28.403 27.237  42.969  1.00 22.35 ? 29   LEU A C   1 
ATOM   195  O  O   . LEU A 1  29  ? 28.530 27.679  44.112  1.00 22.11 ? 29   LEU A O   1 
ATOM   196  C  CB  . LEU A 1  29  ? 28.531 29.162  41.359  1.00 21.04 ? 29   LEU A CB  1 
ATOM   197  C  CG  . LEU A 1  29  ? 27.932 30.179  40.390  1.00 21.56 ? 29   LEU A CG  1 
ATOM   198  C  CD1 . LEU A 1  29  ? 28.993 31.202  40.033  1.00 20.65 ? 29   LEU A CD1 1 
ATOM   199  C  CD2 . LEU A 1  29  ? 27.376 29.494  39.090  1.00 21.31 ? 29   LEU A CD2 1 
ATOM   200  N  N   . GLY A 1  30  ? 28.895 26.061  42.585  1.00 22.39 ? 30   GLY A N   1 
ATOM   201  C  CA  . GLY A 1  30  ? 29.716 25.230  43.457  1.00 23.09 ? 30   GLY A CA  1 
ATOM   202  C  C   . GLY A 1  30  ? 29.005 24.509  44.593  1.00 23.39 ? 30   GLY A C   1 
ATOM   203  O  O   . GLY A 1  30  ? 29.502 24.495  45.725  1.00 24.36 ? 30   GLY A O   1 
ATOM   204  N  N   . ILE A 1  31  ? 27.842 23.920  44.316  1.00 23.21 ? 31   ILE A N   1 
ATOM   205  C  CA  . ILE A 1  31  ? 27.148 23.060  45.289  1.00 22.67 ? 31   ILE A CA  1 
ATOM   206  C  C   . ILE A 1  31  ? 27.834 21.691  45.306  1.00 22.93 ? 31   ILE A C   1 
ATOM   207  O  O   . ILE A 1  31  ? 28.017 21.091  44.243  1.00 23.03 ? 31   ILE A O   1 
ATOM   208  C  CB  . ILE A 1  31  ? 25.636 22.859  44.928  1.00 22.81 ? 31   ILE A CB  1 
ATOM   209  C  CG1 . ILE A 1  31  ? 24.900 24.197  44.809  1.00 22.31 ? 31   ILE A CG1 1 
ATOM   210  C  CG2 . ILE A 1  31  ? 24.932 21.938  45.944  1.00 21.98 ? 31   ILE A CG2 1 
ATOM   211  C  CD1 . ILE A 1  31  ? 23.416 24.047  44.415  1.00 22.19 ? 31   ILE A CD1 1 
ATOM   212  N  N   . PRO A 1  32  ? 28.219 21.183  46.504  1.00 22.95 ? 32   PRO A N   1 
ATOM   213  C  CA  . PRO A 1  32  ? 28.842 19.850  46.517  1.00 22.93 ? 32   PRO A CA  1 
ATOM   214  C  C   . PRO A 1  32  ? 27.795 18.767  46.227  1.00 22.97 ? 32   PRO A C   1 
ATOM   215  O  O   . PRO A 1  32  ? 26.667 18.873  46.709  1.00 22.82 ? 32   PRO A O   1 
ATOM   216  C  CB  . PRO A 1  32  ? 29.391 19.721  47.951  1.00 22.84 ? 32   PRO A CB  1 
ATOM   217  C  CG  . PRO A 1  32  ? 28.481 20.643  48.795  1.00 23.72 ? 32   PRO A CG  1 
ATOM   218  C  CD  . PRO A 1  32  ? 28.083 21.770  47.859  1.00 23.14 ? 32   PRO A CD  1 
ATOM   219  N  N   . TYR A 1  33  ? 28.145 17.744  45.453  1.00 22.45 ? 33   TYR A N   1 
ATOM   220  C  CA  . TYR A 1  33  ? 27.188 16.663  45.206  1.00 22.68 ? 33   TYR A CA  1 
ATOM   221  C  C   . TYR A 1  33  ? 27.710 15.274  45.602  1.00 23.46 ? 33   TYR A C   1 
ATOM   222  O  O   . TYR A 1  33  ? 27.008 14.273  45.471  1.00 23.74 ? 33   TYR A O   1 
ATOM   223  C  CB  . TYR A 1  33  ? 26.679 16.702  43.749  1.00 22.97 ? 33   TYR A CB  1 
ATOM   224  C  CG  . TYR A 1  33  ? 27.709 16.301  42.706  1.00 19.92 ? 33   TYR A CG  1 
ATOM   225  C  CD1 . TYR A 1  33  ? 28.510 17.263  42.081  1.00 18.17 ? 33   TYR A CD1 1 
ATOM   226  C  CD2 . TYR A 1  33  ? 27.874 14.966  42.349  1.00 18.91 ? 33   TYR A CD2 1 
ATOM   227  C  CE1 . TYR A 1  33  ? 29.451 16.895  41.106  1.00 19.64 ? 33   TYR A CE1 1 
ATOM   228  C  CE2 . TYR A 1  33  ? 28.815 14.586  41.376  1.00 20.50 ? 33   TYR A CE2 1 
ATOM   229  C  CZ  . TYR A 1  33  ? 29.596 15.552  40.761  1.00 19.76 ? 33   TYR A CZ  1 
ATOM   230  O  OH  . TYR A 1  33  ? 30.519 15.168  39.806  1.00 22.00 ? 33   TYR A OH  1 
ATOM   231  N  N   . ALA A 1  34  ? 28.941 15.222  46.104  1.00 23.97 ? 34   ALA A N   1 
ATOM   232  C  CA  . ALA A 1  34  ? 29.530 13.982  46.575  1.00 24.37 ? 34   ALA A CA  1 
ATOM   233  C  C   . ALA A 1  34  ? 30.630 14.262  47.588  1.00 24.73 ? 34   ALA A C   1 
ATOM   234  O  O   . ALA A 1  34  ? 31.174 15.380  47.646  1.00 25.24 ? 34   ALA A O   1 
ATOM   235  C  CB  . ALA A 1  34  ? 30.106 13.186  45.407  1.00 23.68 ? 34   ALA A CB  1 
ATOM   236  N  N   . GLN A 1  35  ? 30.960 13.234  48.365  1.00 24.77 ? 35   GLN A N   1 
ATOM   237  C  CA  A GLN A 1  35  ? 32.107 13.259  49.254  0.50 24.84 ? 35   GLN A CA  1 
ATOM   238  C  CA  B GLN A 1  35  ? 32.108 13.290  49.261  0.50 25.07 ? 35   GLN A CA  1 
ATOM   239  C  C   . GLN A 1  35  ? 33.371 13.536  48.440  1.00 24.91 ? 35   GLN A C   1 
ATOM   240  O  O   . GLN A 1  35  ? 33.573 12.907  47.405  1.00 24.73 ? 35   GLN A O   1 
ATOM   241  C  CB  A GLN A 1  35  ? 32.231 11.908  49.959  0.50 24.86 ? 35   GLN A CB  1 
ATOM   242  C  CB  B GLN A 1  35  ? 32.240 12.001  50.087  0.50 25.28 ? 35   GLN A CB  1 
ATOM   243  C  CG  A GLN A 1  35  ? 33.198 11.921  51.112  0.50 25.18 ? 35   GLN A CG  1 
ATOM   244  C  CG  B GLN A 1  35  ? 31.607 12.082  51.487  0.50 26.67 ? 35   GLN A CG  1 
ATOM   245  C  CD  A GLN A 1  35  ? 32.925 10.821  52.116  0.50 26.15 ? 35   GLN A CD  1 
ATOM   246  C  CD  B GLN A 1  35  ? 32.343 13.036  52.415  0.50 28.28 ? 35   GLN A CD  1 
ATOM   247  O  OE1 A GLN A 1  35  ? 31.943 10.079  52.001  0.50 26.08 ? 35   GLN A OE1 1 
ATOM   248  O  OE1 B GLN A 1  35  ? 33.521 12.834  52.742  0.50 28.63 ? 35   GLN A OE1 1 
ATOM   249  N  NE2 A GLN A 1  35  ? 33.802 10.704  53.107  0.50 25.84 ? 35   GLN A NE2 1 
ATOM   250  N  NE2 B GLN A 1  35  ? 31.647 14.085  52.852  0.50 28.70 ? 35   GLN A NE2 1 
ATOM   251  N  N   . PRO A 1  36  ? 34.225 14.480  48.896  1.00 25.07 ? 36   PRO A N   1 
ATOM   252  C  CA  . PRO A 1  36  ? 35.476 14.692  48.156  1.00 25.17 ? 36   PRO A CA  1 
ATOM   253  C  C   . PRO A 1  36  ? 36.240 13.362  47.984  1.00 24.67 ? 36   PRO A C   1 
ATOM   254  O  O   . PRO A 1  36  ? 36.438 12.643  48.965  1.00 25.03 ? 36   PRO A O   1 
ATOM   255  C  CB  . PRO A 1  36  ? 36.247 15.668  49.054  1.00 24.99 ? 36   PRO A CB  1 
ATOM   256  C  CG  . PRO A 1  36  ? 35.201 16.391  49.808  1.00 25.35 ? 36   PRO A CG  1 
ATOM   257  C  CD  . PRO A 1  36  ? 34.091 15.415  50.029  1.00 25.18 ? 36   PRO A CD  1 
ATOM   258  N  N   . PRO A 1  37  ? 36.630 13.017  46.749  1.00 24.72 ? 37   PRO A N   1 
ATOM   259  C  CA  . PRO A 1  37  ? 37.275 11.721  46.490  1.00 25.21 ? 37   PRO A CA  1 
ATOM   260  C  C   . PRO A 1  37  ? 38.777 11.726  46.797  1.00 25.94 ? 37   PRO A C   1 
ATOM   261  O  O   . PRO A 1  37  ? 39.601 11.509  45.891  1.00 26.22 ? 37   PRO A O   1 
ATOM   262  C  CB  . PRO A 1  37  ? 37.047 11.522  44.990  1.00 25.43 ? 37   PRO A CB  1 
ATOM   263  C  CG  . PRO A 1  37  ? 37.036 12.919  44.438  1.00 24.34 ? 37   PRO A CG  1 
ATOM   264  C  CD  . PRO A 1  37  ? 36.387 13.773  45.495  1.00 24.63 ? 37   PRO A CD  1 
ATOM   265  N  N   . LEU A 1  38  ? 39.107 11.970  48.066  1.00 26.78 ? 38   LEU A N   1 
ATOM   266  C  CA  . LEU A 1  38  ? 40.487 12.140  48.554  1.00 27.41 ? 38   LEU A CA  1 
ATOM   267  C  C   . LEU A 1  38  ? 40.978 10.904  49.306  1.00 27.43 ? 38   LEU A C   1 
ATOM   268  O  O   . LEU A 1  38  ? 40.182 10.072  49.739  1.00 27.95 ? 38   LEU A O   1 
ATOM   269  C  CB  . LEU A 1  38  ? 40.566 13.338  49.514  1.00 27.45 ? 38   LEU A CB  1 
ATOM   270  C  CG  . LEU A 1  38  ? 39.853 14.646  49.153  1.00 28.33 ? 38   LEU A CG  1 
ATOM   271  C  CD1 . LEU A 1  38  ? 39.805 15.601  50.362  1.00 30.60 ? 38   LEU A CD1 1 
ATOM   272  C  CD2 . LEU A 1  38  ? 40.514 15.323  47.969  1.00 29.82 ? 38   LEU A CD2 1 
ATOM   273  N  N   . GLY A 1  39  ? 42.293 10.797  49.468  1.00 27.43 ? 39   GLY A N   1 
ATOM   274  C  CA  . GLY A 1  39  ? 42.890 9.718   50.250  1.00 27.06 ? 39   GLY A CA  1 
ATOM   275  C  C   . GLY A 1  39  ? 42.475 8.355   49.740  1.00 26.88 ? 39   GLY A C   1 
ATOM   276  O  O   . GLY A 1  39  ? 42.755 8.008   48.597  1.00 26.98 ? 39   GLY A O   1 
ATOM   277  N  N   . ARG A 1  40  ? 41.802 7.586   50.590  1.00 27.02 ? 40   ARG A N   1 
ATOM   278  C  CA  . ARG A 1  40  ? 41.366 6.228   50.245  1.00 27.19 ? 40   ARG A CA  1 
ATOM   279  C  C   . ARG A 1  40  ? 40.217 6.196   49.211  1.00 27.08 ? 40   ARG A C   1 
ATOM   280  O  O   . ARG A 1  40  ? 39.940 5.148   48.626  1.00 27.13 ? 40   ARG A O   1 
ATOM   281  C  CB  . ARG A 1  40  ? 41.023 5.441   51.524  1.00 27.77 ? 40   ARG A CB  1 
ATOM   282  C  CG  . ARG A 1  40  ? 39.538 5.374   51.887  1.00 29.33 ? 40   ARG A CG  1 
ATOM   283  C  CD  . ARG A 1  40  ? 39.265 5.807   53.322  0.50 30.43 ? 40   ARG A CD  1 
ATOM   284  N  NE  . ARG A 1  40  ? 38.836 7.205   53.385  0.50 31.21 ? 40   ARG A NE  1 
ATOM   285  C  CZ  . ARG A 1  40  ? 37.567 7.606   53.323  0.50 30.56 ? 40   ARG A CZ  1 
ATOM   286  N  NH1 . ARG A 1  40  ? 36.591 6.714   53.196  0.50 30.65 ? 40   ARG A NH1 1 
ATOM   287  N  NH2 . ARG A 1  40  ? 37.271 8.897   53.386  0.50 29.62 ? 40   ARG A NH2 1 
ATOM   288  N  N   . LEU A 1  41  ? 39.578 7.349   48.984  1.00 26.41 ? 41   LEU A N   1 
ATOM   289  C  CA  . LEU A 1  41  ? 38.483 7.479   48.015  1.00 25.88 ? 41   LEU A CA  1 
ATOM   290  C  C   . LEU A 1  41  ? 38.967 7.811   46.604  1.00 25.39 ? 41   LEU A C   1 
ATOM   291  O  O   . LEU A 1  41  ? 38.178 7.768   45.653  1.00 25.59 ? 41   LEU A O   1 
ATOM   292  C  CB  . LEU A 1  41  ? 37.443 8.518   48.481  1.00 25.96 ? 41   LEU A CB  1 
ATOM   293  C  CG  . LEU A 1  41  ? 36.662 8.217   49.774  1.00 25.75 ? 41   LEU A CG  1 
ATOM   294  C  CD1 . LEU A 1  41  ? 35.634 9.305   50.061  1.00 24.74 ? 41   LEU A CD1 1 
ATOM   295  C  CD2 . LEU A 1  41  ? 35.991 6.845   49.747  1.00 26.75 ? 41   LEU A CD2 1 
ATOM   296  N  N   . ARG A 1  42  ? 40.253 8.158   46.476  1.00 24.70 ? 42   ARG A N   1 
ATOM   297  C  CA  . ARG A 1  42  ? 40.874 8.305   45.161  1.00 23.88 ? 42   ARG A CA  1 
ATOM   298  C  C   . ARG A 1  42  ? 40.734 7.024   44.349  1.00 23.70 ? 42   ARG A C   1 
ATOM   299  O  O   . ARG A 1  42  ? 41.000 5.924   44.849  1.00 22.81 ? 42   ARG A O   1 
ATOM   300  C  CB  . ARG A 1  42  ? 42.348 8.695   45.263  1.00 23.92 ? 42   ARG A CB  1 
ATOM   301  C  CG  . ARG A 1  42  ? 42.980 8.936   43.896  1.00 22.88 ? 42   ARG A CG  1 
ATOM   302  C  CD  . ARG A 1  42  ? 44.497 9.100   43.987  1.00 22.78 ? 42   ARG A CD  1 
ATOM   303  N  NE  . ARG A 1  42  ? 44.898 10.416  44.487  1.00 22.19 ? 42   ARG A NE  1 
ATOM   304  C  CZ  . ARG A 1  42  ? 46.152 10.729  44.798  1.00 24.36 ? 42   ARG A CZ  1 
ATOM   305  N  NH1 . ARG A 1  42  ? 47.113 9.815   44.647  1.00 23.92 ? 42   ARG A NH1 1 
ATOM   306  N  NH2 . ARG A 1  42  ? 46.446 11.945  45.257  1.00 23.39 ? 42   ARG A NH2 1 
ATOM   307  N  N   . PHE A 1  43  ? 40.298 7.194   43.097  1.00 23.10 ? 43   PHE A N   1 
ATOM   308  C  CA  . PHE A 1  43  ? 40.043 6.108   42.124  1.00 23.08 ? 43   PHE A CA  1 
ATOM   309  C  C   . PHE A 1  43  ? 38.761 5.315   42.381  1.00 23.41 ? 43   PHE A C   1 
ATOM   310  O  O   . PHE A 1  43  ? 38.444 4.398   41.624  1.00 23.62 ? 43   PHE A O   1 
ATOM   311  C  CB  . PHE A 1  43  ? 41.216 5.123   41.967  1.00 22.59 ? 43   PHE A CB  1 
ATOM   312  C  CG  . PHE A 1  43  ? 42.542 5.762   41.632  1.00 22.33 ? 43   PHE A CG  1 
ATOM   313  C  CD1 . PHE A 1  43  ? 42.718 6.514   40.461  1.00 21.55 ? 43   PHE A CD1 1 
ATOM   314  C  CD2 . PHE A 1  43  ? 43.625 5.579   42.482  1.00 21.73 ? 43   PHE A CD2 1 
ATOM   315  C  CE1 . PHE A 1  43  ? 43.966 7.076   40.155  1.00 22.14 ? 43   PHE A CE1 1 
ATOM   316  C  CE2 . PHE A 1  43  ? 44.870 6.134   42.190  1.00 21.69 ? 43   PHE A CE2 1 
ATOM   317  C  CZ  . PHE A 1  43  ? 45.047 6.880   41.037  1.00 21.63 ? 43   PHE A CZ  1 
ATOM   318  N  N   . LYS A 1  44  ? 38.027 5.646   43.436  1.00 24.04 ? 44   LYS A N   1 
ATOM   319  C  CA  . LYS A 1  44  ? 36.751 4.969   43.689  1.00 24.28 ? 44   LYS A CA  1 
ATOM   320  C  C   . LYS A 1  44  ? 35.591 5.743   43.110  1.00 24.06 ? 44   LYS A C   1 
ATOM   321  O  O   . LYS A 1  44  ? 35.681 6.954   42.903  1.00 23.52 ? 44   LYS A O   1 
ATOM   322  C  CB  . LYS A 1  44  ? 36.506 4.770   45.185  1.00 25.04 ? 44   LYS A CB  1 
ATOM   323  C  CG  . LYS A 1  44  ? 37.610 4.017   45.895  1.00 26.43 ? 44   LYS A CG  1 
ATOM   324  C  CD  . LYS A 1  44  ? 37.167 3.645   47.285  1.00 32.97 ? 44   LYS A CD  1 
ATOM   325  C  CE  . LYS A 1  44  ? 36.751 2.199   47.327  1.00 36.18 ? 44   LYS A CE  1 
ATOM   326  N  NZ  . LYS A 1  44  ? 37.974 1.377   47.177  1.00 39.12 ? 44   LYS A NZ  1 
ATOM   327  N  N   . LYS A 1  45  ? 34.505 5.021   42.853  1.00 23.90 ? 45   LYS A N   1 
ATOM   328  C  CA  . LYS A 1  45  ? 33.212 5.600   42.554  1.00 24.70 ? 45   LYS A CA  1 
ATOM   329  C  C   . LYS A 1  45  ? 32.892 6.681   43.608  1.00 25.08 ? 45   LYS A C   1 
ATOM   330  O  O   . LYS A 1  45  ? 33.322 6.565   44.758  1.00 25.17 ? 45   LYS A O   1 
ATOM   331  C  CB  . LYS A 1  45  ? 32.141 4.494   42.532  1.00 24.59 ? 45   LYS A CB  1 
ATOM   332  C  CG  . LYS A 1  45  ? 32.196 3.612   41.284  1.00 24.90 ? 45   LYS A CG  1 
ATOM   333  C  CD  . LYS A 1  45  ? 31.287 2.372   41.361  1.00 27.75 ? 45   LYS A CD  1 
ATOM   334  C  CE  . LYS A 1  45  ? 29.821 2.716   41.191  1.00 28.25 ? 45   LYS A CE  1 
ATOM   335  N  NZ  . LYS A 1  45  ? 28.947 1.498   41.084  1.00 27.77 ? 45   LYS A NZ  1 
ATOM   336  N  N   . PRO A 1  46  ? 32.177 7.747   43.210  1.00 25.30 ? 46   PRO A N   1 
ATOM   337  C  CA  . PRO A 1  46  ? 31.897 8.815   44.165  1.00 25.82 ? 46   PRO A CA  1 
ATOM   338  C  C   . PRO A 1  46  ? 30.919 8.352   45.238  1.00 27.48 ? 46   PRO A C   1 
ATOM   339  O  O   . PRO A 1  46  ? 29.974 7.616   44.953  1.00 26.38 ? 46   PRO A O   1 
ATOM   340  C  CB  . PRO A 1  46  ? 31.267 9.905   43.292  1.00 25.80 ? 46   PRO A CB  1 
ATOM   341  C  CG  . PRO A 1  46  ? 30.587 9.115   42.173  1.00 23.81 ? 46   PRO A CG  1 
ATOM   342  C  CD  . PRO A 1  46  ? 31.519 7.980   41.907  1.00 24.38 ? 46   PRO A CD  1 
ATOM   343  N  N   . GLN A 1  47  ? 31.163 8.774   46.471  1.00 29.35 ? 47   GLN A N   1 
ATOM   344  C  CA  . GLN A 1  47  ? 30.338 8.362   47.594  1.00 31.89 ? 47   GLN A CA  1 
ATOM   345  C  C   . GLN A 1  47  ? 29.371 9.492   47.918  1.00 33.51 ? 47   GLN A C   1 
ATOM   346  O  O   . GLN A 1  47  ? 29.685 10.665  47.722  1.00 32.98 ? 47   GLN A O   1 
ATOM   347  C  CB  . GLN A 1  47  ? 31.224 8.027   48.810  1.00 31.73 ? 47   GLN A CB  1 
ATOM   348  C  CG  . GLN A 1  47  ? 32.383 7.034   48.526  1.00 32.82 ? 47   GLN A CG  1 
ATOM   349  C  CD  . GLN A 1  47  ? 31.908 5.666   48.044  1.00 35.33 ? 47   GLN A CD  1 
ATOM   350  O  OE1 . GLN A 1  47  ? 30.939 5.123   48.574  1.00 37.83 ? 47   GLN A OE1 1 
ATOM   351  N  NE2 . GLN A 1  47  ? 32.591 5.101   47.029  1.00 35.13 ? 47   GLN A NE2 1 
ATOM   352  N  N   . SER A 1  48  ? 28.192 9.133   48.411  1.00 36.56 ? 48   SER A N   1 
ATOM   353  C  CA  . SER A 1  48  ? 27.145 10.117  48.729  1.00 39.21 ? 48   SER A CA  1 
ATOM   354  C  C   . SER A 1  48  ? 27.515 11.084  49.856  1.00 40.60 ? 48   SER A C   1 
ATOM   355  O  O   . SER A 1  48  ? 28.355 10.784  50.704  1.00 40.72 ? 48   SER A O   1 
ATOM   356  C  CB  . SER A 1  48  ? 25.815 9.418   49.040  1.00 39.50 ? 48   SER A CB  1 
ATOM   357  O  OG  . SER A 1  48  ? 25.957 8.459   50.074  1.00 41.56 ? 48   SER A OG  1 
ATOM   358  N  N   . LEU A 1  49  ? 26.864 12.244  49.851  1.00 42.70 ? 49   LEU A N   1 
ATOM   359  C  CA  . LEU A 1  49  ? 27.215 13.345  50.736  1.00 44.77 ? 49   LEU A CA  1 
ATOM   360  C  C   . LEU A 1  49  ? 26.578 13.222  52.126  1.00 46.26 ? 49   LEU A C   1 
ATOM   361  O  O   . LEU A 1  49  ? 25.436 12.779  52.263  1.00 46.71 ? 49   LEU A O   1 
ATOM   362  C  CB  . LEU A 1  49  ? 26.831 14.664  50.075  1.00 44.78 ? 49   LEU A CB  1 
ATOM   363  C  CG  . LEU A 1  49  ? 27.695 15.887  50.376  1.00 44.80 ? 49   LEU A CG  1 
ATOM   364  C  CD1 . LEU A 1  49  ? 29.163 15.532  50.561  1.00 44.63 ? 49   LEU A CD1 1 
ATOM   365  C  CD2 . LEU A 1  49  ? 27.503 16.912  49.277  1.00 44.58 ? 49   LEU A CD2 1 
ATOM   366  N  N   . THR A 1  50  ? 27.326 13.634  53.146  1.00 47.82 ? 50   THR A N   1 
ATOM   367  C  CA  . THR A 1  50  ? 26.970 13.348  54.541  1.00 49.42 ? 50   THR A CA  1 
ATOM   368  C  C   . THR A 1  50  ? 25.783 14.147  55.097  1.00 49.98 ? 50   THR A C   1 
ATOM   369  O  O   . THR A 1  50  ? 25.139 13.686  56.049  1.00 50.22 ? 50   THR A O   1 
ATOM   370  C  CB  . THR A 1  50  ? 28.204 13.459  55.494  1.00 49.61 ? 50   THR A CB  1 
ATOM   371  O  OG1 . THR A 1  50  ? 29.125 14.437  54.985  1.00 50.84 ? 50   THR A OG1 1 
ATOM   372  C  CG2 . THR A 1  50  ? 28.930 12.109  55.614  1.00 49.71 ? 50   THR A CG2 1 
ATOM   373  N  N   . LYS A 1  51  ? 25.502 15.309  54.487  1.00 50.30 ? 51   LYS A N   1 
ATOM   374  C  CA  . LYS A 1  51  ? 24.488 16.314  54.931  1.00 50.67 ? 51   LYS A CA  1 
ATOM   375  C  C   . LYS A 1  51  ? 25.031 17.317  55.965  1.00 50.47 ? 51   LYS A C   1 
ATOM   376  O  O   . LYS A 1  51  ? 25.850 16.960  56.816  1.00 50.68 ? 51   LYS A O   1 
ATOM   377  C  CB  . LYS A 1  51  ? 23.137 15.695  55.361  1.00 50.77 ? 51   LYS A CB  1 
ATOM   378  C  CG  . LYS A 1  51  ? 23.005 15.303  56.832  1.00 51.99 ? 51   LYS A CG  1 
ATOM   379  C  CD  . LYS A 1  51  ? 21.912 14.246  57.039  1.00 53.45 ? 51   LYS A CD  1 
ATOM   380  C  CE  . LYS A 1  51  ? 22.253 13.276  58.176  1.00 54.03 ? 51   LYS A CE  1 
ATOM   381  N  NZ  . LYS A 1  51  ? 23.438 12.404  57.876  1.00 54.04 ? 51   LYS A NZ  1 
ATOM   382  N  N   . TRP A 1  52  ? 24.584 18.570  55.871  1.00 50.13 ? 52   TRP A N   1 
ATOM   383  C  CA  . TRP A 1  52  ? 25.138 19.655  56.684  1.00 49.69 ? 52   TRP A CA  1 
ATOM   384  C  C   . TRP A 1  52  ? 24.060 20.573  57.262  1.00 49.58 ? 52   TRP A C   1 
ATOM   385  O  O   . TRP A 1  52  ? 23.048 20.835  56.615  1.00 49.72 ? 52   TRP A O   1 
ATOM   386  C  CB  . TRP A 1  52  ? 26.151 20.479  55.866  1.00 49.65 ? 52   TRP A CB  1 
ATOM   387  C  CG  . TRP A 1  52  ? 25.539 21.268  54.724  1.00 49.25 ? 52   TRP A CG  1 
ATOM   388  C  CD1 . TRP A 1  52  ? 24.980 22.517  54.798  1.00 49.34 ? 52   TRP A CD1 1 
ATOM   389  C  CD2 . TRP A 1  52  ? 25.426 20.864  53.350  1.00 48.52 ? 52   TRP A CD2 1 
ATOM   390  N  NE1 . TRP A 1  52  ? 24.521 22.911  53.563  1.00 48.58 ? 52   TRP A NE1 1 
ATOM   391  C  CE2 . TRP A 1  52  ? 24.781 21.917  52.656  1.00 48.49 ? 52   TRP A CE2 1 
ATOM   392  C  CE3 . TRP A 1  52  ? 25.804 19.718  52.637  1.00 47.99 ? 52   TRP A CE3 1 
ATOM   393  C  CZ2 . TRP A 1  52  ? 24.506 21.856  51.283  1.00 47.86 ? 52   TRP A CZ2 1 
ATOM   394  C  CZ3 . TRP A 1  52  ? 25.531 19.661  51.266  1.00 47.27 ? 52   TRP A CZ3 1 
ATOM   395  C  CH2 . TRP A 1  52  ? 24.889 20.723  50.608  1.00 46.86 ? 52   TRP A CH2 1 
ATOM   396  N  N   . SER A 1  53  ? 24.273 21.049  58.489  1.00 49.35 ? 53   SER A N   1 
ATOM   397  C  CA  . SER A 1  53  ? 23.483 22.164  59.011  1.00 48.77 ? 53   SER A CA  1 
ATOM   398  C  C   . SER A 1  53  ? 24.169 23.467  58.581  1.00 48.26 ? 53   SER A C   1 
ATOM   399  O  O   . SER A 1  53  ? 25.238 23.433  57.948  1.00 48.67 ? 53   SER A O   1 
ATOM   400  C  CB  . SER A 1  53  ? 23.292 22.075  60.530  1.00 48.98 ? 53   SER A CB  1 
ATOM   401  O  OG  . SER A 1  53  ? 24.454 22.475  61.238  1.00 49.56 ? 53   SER A OG  1 
ATOM   402  N  N   . ASP A 1  54  ? 23.549 24.601  58.910  1.00 47.23 ? 54   ASP A N   1 
ATOM   403  C  CA  . ASP A 1  54  ? 23.984 25.930  58.440  1.00 45.97 ? 54   ASP A CA  1 
ATOM   404  C  C   . ASP A 1  54  ? 23.797 26.086  56.912  1.00 44.37 ? 54   ASP A C   1 
ATOM   405  O  O   . ASP A 1  54  ? 23.239 25.207  56.252  1.00 44.32 ? 54   ASP A O   1 
ATOM   406  C  CB  . ASP A 1  54  ? 25.422 26.268  58.887  1.00 46.18 ? 54   ASP A CB  1 
ATOM   407  C  CG  . ASP A 1  54  ? 25.587 26.313  60.419  1.00 48.08 ? 54   ASP A CG  1 
ATOM   408  O  OD1 . ASP A 1  54  ? 24.658 25.908  61.166  1.00 49.58 ? 54   ASP A OD1 1 
ATOM   409  O  OD2 . ASP A 1  54  ? 26.668 26.761  60.881  1.00 48.73 ? 54   ASP A OD2 1 
ATOM   410  N  N   . ILE A 1  55  ? 24.244 27.211  56.365  1.00 42.33 ? 55   ILE A N   1 
ATOM   411  C  CA  . ILE A 1  55  ? 23.987 27.539  54.966  1.00 40.43 ? 55   ILE A CA  1 
ATOM   412  C  C   . ILE A 1  55  ? 25.260 27.445  54.135  1.00 38.89 ? 55   ILE A C   1 
ATOM   413  O  O   . ILE A 1  55  ? 26.235 28.154  54.398  1.00 38.41 ? 55   ILE A O   1 
ATOM   414  C  CB  . ILE A 1  55  ? 23.337 28.939  54.827  1.00 40.54 ? 55   ILE A CB  1 
ATOM   415  C  CG1 . ILE A 1  55  ? 21.932 28.928  55.445  1.00 40.93 ? 55   ILE A CG1 1 
ATOM   416  C  CG2 . ILE A 1  55  ? 23.274 29.369  53.368  1.00 41.10 ? 55   ILE A CG2 1 
ATOM   417  C  CD1 . ILE A 1  55  ? 21.272 30.295  55.558  1.00 40.72 ? 55   ILE A CD1 1 
ATOM   418  N  N   . TRP A 1  56  ? 25.252 26.549  53.145  1.00 36.86 ? 56   TRP A N   1 
ATOM   419  C  CA  . TRP A 1  56  ? 26.325 26.507  52.150  1.00 34.76 ? 56   TRP A CA  1 
ATOM   420  C  C   . TRP A 1  56  ? 26.191 27.715  51.233  1.00 33.90 ? 56   TRP A C   1 
ATOM   421  O  O   . TRP A 1  56  ? 25.143 27.921  50.618  1.00 33.77 ? 56   TRP A O   1 
ATOM   422  C  CB  . TRP A 1  56  ? 26.297 25.211  51.327  1.00 34.42 ? 56   TRP A CB  1 
ATOM   423  C  CG  . TRP A 1  56  ? 27.451 25.127  50.370  1.00 33.04 ? 56   TRP A CG  1 
ATOM   424  C  CD1 . TRP A 1  56  ? 27.575 25.767  49.167  1.00 31.54 ? 56   TRP A CD1 1 
ATOM   425  C  CD2 . TRP A 1  56  ? 28.655 24.377  50.551  1.00 32.37 ? 56   TRP A CD2 1 
ATOM   426  N  NE1 . TRP A 1  56  ? 28.789 25.468  48.592  1.00 31.60 ? 56   TRP A NE1 1 
ATOM   427  C  CE2 . TRP A 1  56  ? 29.471 24.615  49.418  1.00 32.00 ? 56   TRP A CE2 1 
ATOM   428  C  CE3 . TRP A 1  56  ? 29.130 23.530  51.566  1.00 33.22 ? 56   TRP A CE3 1 
ATOM   429  C  CZ2 . TRP A 1  56  ? 30.727 24.024  49.261  1.00 32.75 ? 56   TRP A CZ2 1 
ATOM   430  C  CZ3 . TRP A 1  56  ? 30.390 22.943  51.415  1.00 33.43 ? 56   TRP A CZ3 1 
ATOM   431  C  CH2 . TRP A 1  56  ? 31.173 23.197  50.270  1.00 33.59 ? 56   TRP A CH2 1 
ATOM   432  N  N   . ASN A 1  57  ? 27.248 28.517  51.160  1.00 33.17 ? 57   ASN A N   1 
ATOM   433  C  CA  . ASN A 1  57  ? 27.298 29.668  50.257  1.00 32.67 ? 57   ASN A CA  1 
ATOM   434  C  C   . ASN A 1  57  ? 27.744 29.244  48.858  1.00 31.24 ? 57   ASN A C   1 
ATOM   435  O  O   . ASN A 1  57  ? 28.936 29.062  48.611  1.00 31.40 ? 57   ASN A O   1 
ATOM   436  C  CB  . ASN A 1  57  ? 28.244 30.738  50.805  1.00 33.43 ? 57   ASN A CB  1 
ATOM   437  C  CG  . ASN A 1  57  ? 27.622 31.555  51.938  1.00 36.34 ? 57   ASN A CG  1 
ATOM   438  O  OD1 . ASN A 1  57  ? 26.413 31.469  52.216  1.00 36.58 ? 57   ASN A OD1 1 
ATOM   439  N  ND2 . ASN A 1  57  ? 28.452 32.360  52.594  1.00 41.81 ? 57   ASN A ND2 1 
ATOM   440  N  N   . ALA A 1  58  ? 26.783 29.063  47.953  1.00 29.48 ? 58   ALA A N   1 
ATOM   441  C  CA  . ALA A 1  58  ? 27.089 28.674  46.571  1.00 27.60 ? 58   ALA A CA  1 
ATOM   442  C  C   . ALA A 1  58  ? 27.241 29.926  45.695  1.00 26.70 ? 58   ALA A C   1 
ATOM   443  O  O   . ALA A 1  58  ? 26.450 30.178  44.783  1.00 26.00 ? 58   ALA A O   1 
ATOM   444  C  CB  . ALA A 1  58  ? 25.999 27.748  46.033  1.00 27.41 ? 58   ALA A CB  1 
ATOM   445  N  N   . THR A 1  59  ? 28.272 30.714  45.989  1.00 25.98 ? 59   THR A N   1 
ATOM   446  C  CA  . THR A 1  59  ? 28.368 32.064  45.455  1.00 25.39 ? 59   THR A CA  1 
ATOM   447  C  C   . THR A 1  59  ? 29.603 32.247  44.594  1.00 25.30 ? 59   THR A C   1 
ATOM   448  O  O   . THR A 1  59  ? 29.867 33.338  44.092  1.00 25.58 ? 59   THR A O   1 
ATOM   449  C  CB  . THR A 1  59  ? 28.264 33.120  46.591  1.00 25.84 ? 59   THR A CB  1 
ATOM   450  O  OG1 . THR A 1  59  ? 29.152 32.765  47.664  1.00 26.47 ? 59   THR A OG1 1 
ATOM   451  C  CG2 . THR A 1  59  ? 26.835 33.135  47.140  1.00 24.54 ? 59   THR A CG2 1 
ATOM   452  N  N   . LYS A 1  60  ? 30.346 31.167  44.392  1.00 24.68 ? 60   LYS A N   1 
ATOM   453  C  CA  . LYS A 1  60  ? 31.443 31.178  43.429  1.00 24.81 ? 60   LYS A CA  1 
ATOM   454  C  C   . LYS A 1  60  ? 31.678 29.788  42.830  1.00 23.92 ? 60   LYS A C   1 
ATOM   455  O  O   . LYS A 1  60  ? 31.303 28.775  43.410  1.00 23.44 ? 60   LYS A O   1 
ATOM   456  C  CB  . LYS A 1  60  ? 32.737 31.743  44.040  1.00 24.83 ? 60   LYS A CB  1 
ATOM   457  C  CG  . LYS A 1  60  ? 33.308 30.919  45.161  1.00 27.73 ? 60   LYS A CG  1 
ATOM   458  C  CD  . LYS A 1  60  ? 34.738 31.383  45.518  1.00 32.06 ? 60   LYS A CD  1 
ATOM   459  C  CE  . LYS A 1  60  ? 35.051 31.135  46.995  1.00 34.77 ? 60   LYS A CE  1 
ATOM   460  N  NZ  . LYS A 1  60  ? 34.866 29.704  47.382  1.00 37.46 ? 60   LYS A NZ  1 
ATOM   461  N  N   . TYR A 1  61  ? 32.303 29.752  41.662  1.00 23.40 ? 61   TYR A N   1 
ATOM   462  C  CA  . TYR A 1  61  ? 32.615 28.474  41.038  1.00 23.41 ? 61   TYR A CA  1 
ATOM   463  C  C   . TYR A 1  61  ? 33.605 27.699  41.901  1.00 23.23 ? 61   TYR A C   1 
ATOM   464  O  O   . TYR A 1  61  ? 34.538 28.271  42.452  1.00 22.77 ? 61   TYR A O   1 
ATOM   465  C  CB  . TYR A 1  61  ? 33.241 28.703  39.678  1.00 22.59 ? 61   TYR A CB  1 
ATOM   466  C  CG  . TYR A 1  61  ? 32.323 29.145  38.571  1.00 24.21 ? 61   TYR A CG  1 
ATOM   467  C  CD1 . TYR A 1  61  ? 31.341 28.292  38.076  1.00 23.61 ? 61   TYR A CD1 1 
ATOM   468  C  CD2 . TYR A 1  61  ? 32.504 30.388  37.941  1.00 24.56 ? 61   TYR A CD2 1 
ATOM   469  C  CE1 . TYR A 1  61  ? 30.525 28.678  36.997  1.00 23.52 ? 61   TYR A CE1 1 
ATOM   470  C  CE2 . TYR A 1  61  ? 31.703 30.777  36.863  1.00 25.52 ? 61   TYR A CE2 1 
ATOM   471  C  CZ  . TYR A 1  61  ? 30.715 29.906  36.396  1.00 25.24 ? 61   TYR A CZ  1 
ATOM   472  O  OH  . TYR A 1  61  ? 29.911 30.260  35.325  1.00 24.82 ? 61   TYR A OH  1 
ATOM   473  N  N   . ALA A 1  62  ? 33.410 26.392  41.997  1.00 22.69 ? 62   ALA A N   1 
ATOM   474  C  CA  . ALA A 1  62  ? 34.282 25.555  42.804  1.00 22.39 ? 62   ALA A CA  1 
ATOM   475  C  C   . ALA A 1  62  ? 35.585 25.192  42.093  1.00 21.95 ? 62   ALA A C   1 
ATOM   476  O  O   . ALA A 1  62  ? 35.780 25.510  40.906  1.00 21.62 ? 62   ALA A O   1 
ATOM   477  C  CB  . ALA A 1  62  ? 33.543 24.305  43.224  1.00 22.33 ? 62   ALA A CB  1 
ATOM   478  N  N   . ASN A 1  63  ? 36.474 24.521  42.827  1.00 21.67 ? 63   ASN A N   1 
ATOM   479  C  CA  . ASN A 1  63  ? 37.679 23.941  42.246  1.00 21.57 ? 63   ASN A CA  1 
ATOM   480  C  C   . ASN A 1  63  ? 37.380 23.112  40.984  1.00 21.43 ? 63   ASN A C   1 
ATOM   481  O  O   . ASN A 1  63  ? 36.388 22.387  40.952  1.00 21.46 ? 63   ASN A O   1 
ATOM   482  C  CB  . ASN A 1  63  ? 38.327 22.976  43.236  1.00 21.66 ? 63   ASN A CB  1 
ATOM   483  C  CG  . ASN A 1  63  ? 38.847 23.658  44.501  1.00 22.71 ? 63   ASN A CG  1 
ATOM   484  O  OD1 . ASN A 1  63  ? 39.210 24.835  44.505  1.00 23.47 ? 63   ASN A OD1 1 
ATOM   485  N  ND2 . ASN A 1  63  ? 38.887 22.895  45.578  1.00 20.48 ? 63   ASN A ND2 1 
ATOM   486  N  N   . SER A 1  64  ? 38.261 23.189  39.990  1.00 20.64 ? 64   SER A N   1 
ATOM   487  C  CA  . SER A 1  64  ? 38.224 22.279  38.842  1.00 20.72 ? 64   SER A CA  1 
ATOM   488  C  C   . SER A 1  64  ? 38.997 21.020  39.198  1.00 20.64 ? 64   SER A C   1 
ATOM   489  O  O   . SER A 1  64  ? 39.889 21.066  40.061  1.00 19.67 ? 64   SER A O   1 
ATOM   490  C  CB  . SER A 1  64  ? 38.863 22.930  37.615  1.00 20.42 ? 64   SER A CB  1 
ATOM   491  O  OG  . SER A 1  64  ? 38.151 24.095  37.258  1.00 20.49 ? 64   SER A OG  1 
ATOM   492  N  N   . CYS A 1  65  ? 38.655 19.899  38.560  1.00 19.64 ? 65   CYS A N   1 
ATOM   493  C  CA  . CYS A 1  65  ? 39.350 18.644  38.819  1.00 20.23 ? 65   CYS A CA  1 
ATOM   494  C  C   . CYS A 1  65  ? 40.803 18.703  38.329  1.00 20.07 ? 65   CYS A C   1 
ATOM   495  O  O   . CYS A 1  65  ? 41.116 19.446  37.391  1.00 20.75 ? 65   CYS A O   1 
ATOM   496  C  CB  . CYS A 1  65  ? 38.570 17.457  38.204  1.00 20.24 ? 65   CYS A CB  1 
ATOM   497  S  SG  . CYS A 1  65  ? 36.929 17.234  38.987  1.00 21.61 ? 65   CYS A SG  1 
HETATM 498  N  N   . CSS A 1  66  ? 41.684 17.931  38.966  1.00 20.96 ? 66   CSS A N   1 
HETATM 499  C  CA  . CSS A 1  66  ? 43.085 17.841  38.551  1.00 21.35 ? 66   CSS A CA  1 
HETATM 500  C  CB  . CSS A 1  66  ? 43.843 16.792  39.350  1.00 22.05 ? 66   CSS A CB  1 
HETATM 501  S  SG  . CSS A 1  66  ? 43.932 17.126  41.062  1.00 25.66 ? 66   CSS A SG  1 
HETATM 502  S  SD  . CSS A 1  66  ? 44.896 18.887  41.169  0.60 28.63 ? 66   CSS A SD  1 
HETATM 503  C  C   . CSS A 1  66  ? 43.170 17.443  37.101  1.00 21.61 ? 66   CSS A C   1 
HETATM 504  O  O   . CSS A 1  66  ? 42.478 16.527  36.663  1.00 21.04 ? 66   CSS A O   1 
ATOM   505  N  N   . GLN A 1  67  ? 44.043 18.126  36.370  1.00 21.19 ? 67   GLN A N   1 
ATOM   506  C  CA  . GLN A 1  67  ? 44.207 17.892  34.955  1.00 20.72 ? 67   GLN A CA  1 
ATOM   507  C  C   . GLN A 1  67  ? 45.459 18.619  34.483  1.00 21.04 ? 67   GLN A C   1 
ATOM   508  O  O   . GLN A 1  67  ? 45.855 19.653  35.056  1.00 20.90 ? 67   GLN A O   1 
ATOM   509  C  CB  . GLN A 1  67  ? 43.000 18.434  34.181  1.00 19.91 ? 67   GLN A CB  1 
ATOM   510  C  CG  . GLN A 1  67  ? 42.701 19.933  34.428  1.00 18.33 ? 67   GLN A CG  1 
ATOM   511  C  CD  . GLN A 1  67  ? 41.339 20.330  33.839  1.00 21.61 ? 67   GLN A CD  1 
ATOM   512  O  OE1 . GLN A 1  67  ? 41.235 20.699  32.662  1.00 18.70 ? 67   GLN A OE1 1 
ATOM   513  N  NE2 . GLN A 1  67  ? 40.294 20.241  34.661  1.00 21.45 ? 67   GLN A NE2 1 
ATOM   514  N  N   . ASN A 1  68  ? 46.060 18.059  33.436  1.00 21.52 ? 68   ASN A N   1 
ATOM   515  C  CA  . ASN A 1  68  ? 47.077 18.720  32.662  1.00 22.78 ? 68   ASN A CA  1 
ATOM   516  C  C   . ASN A 1  68  ? 46.461 19.860  31.880  1.00 23.24 ? 68   ASN A C   1 
ATOM   517  O  O   . ASN A 1  68  ? 45.257 19.860  31.594  1.00 23.10 ? 68   ASN A O   1 
ATOM   518  C  CB  . ASN A 1  68  ? 47.772 17.701  31.752  1.00 23.07 ? 68   ASN A CB  1 
ATOM   519  C  CG  . ASN A 1  68  ? 48.603 16.693  32.566  1.00 24.76 ? 68   ASN A CG  1 
ATOM   520  O  OD1 . ASN A 1  68  ? 49.434 17.097  33.372  1.00 25.16 ? 68   ASN A OD1 1 
ATOM   521  N  ND2 . ASN A 1  68  ? 48.323 15.395  32.409  1.00 22.55 ? 68   ASN A ND2 1 
ATOM   522  N  N   . ILE A 1  69  ? 47.280 20.846  31.552  1.00 24.03 ? 69   ILE A N   1 
ATOM   523  C  CA  . ILE A 1  69  ? 46.794 22.049  30.898  1.00 25.60 ? 69   ILE A CA  1 
ATOM   524  C  C   . ILE A 1  69  ? 47.417 22.209  29.514  1.00 25.56 ? 69   ILE A C   1 
ATOM   525  O  O   . ILE A 1  69  ? 48.549 21.792  29.301  1.00 26.03 ? 69   ILE A O   1 
ATOM   526  C  CB  . ILE A 1  69  ? 47.054 23.280  31.810  1.00 26.49 ? 69   ILE A CB  1 
ATOM   527  C  CG1 . ILE A 1  69  ? 45.836 23.534  32.699  1.00 27.62 ? 69   ILE A CG1 1 
ATOM   528  C  CG2 . ILE A 1  69  ? 47.303 24.525  31.022  1.00 27.30 ? 69   ILE A CG2 1 
ATOM   529  C  CD1 . ILE A 1  69  ? 45.944 22.941  34.054  1.00 29.37 ? 69   ILE A CD1 1 
ATOM   530  N  N   . ASP A 1  70  ? 46.678 22.809  28.581  1.00 25.77 ? 70   ASP A N   1 
ATOM   531  C  CA  . ASP A 1  70  ? 47.201 23.098  27.246  1.00 25.79 ? 70   ASP A CA  1 
ATOM   532  C  C   . ASP A 1  70  ? 48.150 24.307  27.340  1.00 26.26 ? 70   ASP A C   1 
ATOM   533  O  O   . ASP A 1  70  ? 47.693 25.439  27.546  1.00 26.23 ? 70   ASP A O   1 
ATOM   534  C  CB  . ASP A 1  70  ? 46.035 23.359  26.273  1.00 25.94 ? 70   ASP A CB  1 
ATOM   535  C  CG  . ASP A 1  70  ? 46.498 23.756  24.863  1.00 26.42 ? 70   ASP A CG  1 
ATOM   536  O  OD1 . ASP A 1  70  ? 45.631 24.019  24.011  1.00 25.98 ? 70   ASP A OD1 1 
ATOM   537  O  OD2 . ASP A 1  70  ? 47.715 23.791  24.586  1.00 28.08 ? 70   ASP A OD2 1 
ATOM   538  N  N   . GLN A 1  71  ? 49.460 24.049  27.212  1.00 26.10 ? 71   GLN A N   1 
ATOM   539  C  CA  A GLN A 1  71  ? 50.504 25.078  27.296  0.50 26.57 ? 71   GLN A CA  1 
ATOM   540  C  CA  B GLN A 1  71  ? 50.450 25.132  27.282  0.50 26.55 ? 71   GLN A CA  1 
ATOM   541  C  C   . GLN A 1  71  ? 51.126 25.346  25.930  1.00 26.47 ? 71   GLN A C   1 
ATOM   542  O  O   . GLN A 1  71  ? 52.206 25.942  25.842  1.00 26.56 ? 71   GLN A O   1 
ATOM   543  C  CB  A GLN A 1  71  ? 51.624 24.641  28.253  0.50 26.53 ? 71   GLN A CB  1 
ATOM   544  C  CB  B GLN A 1  71  ? 51.490 24.877  28.387  0.50 26.59 ? 71   GLN A CB  1 
ATOM   545  C  CG  A GLN A 1  71  ? 51.170 24.229  29.643  0.50 27.47 ? 71   GLN A CG  1 
ATOM   546  C  CG  B GLN A 1  71  ? 50.908 24.790  29.806  0.50 27.32 ? 71   GLN A CG  1 
ATOM   547  C  CD  A GLN A 1  71  ? 52.228 23.423  30.363  0.50 29.16 ? 71   GLN A CD  1 
ATOM   548  C  CD  B GLN A 1  71  ? 50.311 26.099  30.302  0.50 29.36 ? 71   GLN A CD  1 
ATOM   549  O  OE1 A GLN A 1  71  ? 53.421 23.713  30.257  0.50 29.48 ? 71   GLN A OE1 1 
ATOM   550  O  OE1 B GLN A 1  71  ? 50.221 27.083  29.565  0.50 31.41 ? 71   GLN A OE1 1 
ATOM   551  N  NE2 A GLN A 1  71  ? 51.798 22.402  31.100  0.50 28.65 ? 71   GLN A NE2 1 
ATOM   552  N  NE2 B GLN A 1  71  ? 49.900 26.116  31.563  0.50 29.16 ? 71   GLN A NE2 1 
ATOM   553  N  N   . SER A 1  72  ? 50.465 24.872  24.875  1.00 25.82 ? 72   SER A N   1 
ATOM   554  C  CA  . SER A 1  72  ? 50.966 25.010  23.516  1.00 25.30 ? 72   SER A CA  1 
ATOM   555  C  C   . SER A 1  72  ? 51.125 26.446  23.042  1.00 24.21 ? 72   SER A C   1 
ATOM   556  O  O   . SER A 1  72  ? 52.071 26.749  22.333  1.00 23.93 ? 72   SER A O   1 
ATOM   557  C  CB  . SER A 1  72  ? 50.079 24.248  22.515  1.00 25.59 ? 72   SER A CB  1 
ATOM   558  O  OG  . SER A 1  72  ? 50.379 22.864  22.527  1.00 26.36 ? 72   SER A OG  1 
ATOM   559  N  N   . PHE A 1  73  ? 50.196 27.319  23.413  1.00 23.34 ? 73   PHE A N   1 
ATOM   560  C  CA  . PHE A 1  73  ? 50.216 28.697  22.928  1.00 23.05 ? 73   PHE A CA  1 
ATOM   561  C  C   . PHE A 1  73  ? 49.981 29.672  24.074  1.00 22.75 ? 73   PHE A C   1 
ATOM   562  O  O   . PHE A 1  73  ? 48.914 30.258  24.182  1.00 22.68 ? 73   PHE A O   1 
ATOM   563  C  CB  . PHE A 1  73  ? 49.164 28.909  21.825  1.00 23.26 ? 73   PHE A CB  1 
ATOM   564  C  CG  . PHE A 1  73  ? 49.218 27.886  20.722  1.00 22.98 ? 73   PHE A CG  1 
ATOM   565  C  CD1 . PHE A 1  73  ? 50.223 27.946  19.746  1.00 23.57 ? 73   PHE A CD1 1 
ATOM   566  C  CD2 . PHE A 1  73  ? 48.271 26.864  20.660  1.00 23.07 ? 73   PHE A CD2 1 
ATOM   567  C  CE1 . PHE A 1  73  ? 50.280 27.009  18.718  1.00 23.85 ? 73   PHE A CE1 1 
ATOM   568  C  CE2 . PHE A 1  73  ? 48.315 25.912  19.639  1.00 22.94 ? 73   PHE A CE2 1 
ATOM   569  C  CZ  . PHE A 1  73  ? 49.331 25.979  18.666  1.00 24.03 ? 73   PHE A CZ  1 
ATOM   570  N  N   . PRO A 1  74  ? 50.988 29.860  24.938  1.00 22.66 ? 74   PRO A N   1 
ATOM   571  C  CA  . PRO A 1  74  ? 50.789 30.784  26.051  1.00 22.16 ? 74   PRO A CA  1 
ATOM   572  C  C   . PRO A 1  74  ? 50.418 32.165  25.544  1.00 21.70 ? 74   PRO A C   1 
ATOM   573  O  O   . PRO A 1  74  ? 50.975 32.629  24.545  1.00 21.24 ? 74   PRO A O   1 
ATOM   574  C  CB  . PRO A 1  74  ? 52.166 30.841  26.701  1.00 22.40 ? 74   PRO A CB  1 
ATOM   575  C  CG  . PRO A 1  74  ? 52.821 29.578  26.315  1.00 22.91 ? 74   PRO A CG  1 
ATOM   576  C  CD  . PRO A 1  74  ? 52.348 29.299  24.921  1.00 22.40 ? 74   PRO A CD  1 
ATOM   577  N  N   . GLY A 1  75  ? 49.476 32.801  26.231  1.00 21.83 ? 75   GLY A N   1 
ATOM   578  C  CA  . GLY A 1  75  ? 49.049 34.150  25.903  1.00 21.69 ? 75   GLY A CA  1 
ATOM   579  C  C   . GLY A 1  75  ? 47.999 34.221  24.822  1.00 22.05 ? 75   GLY A C   1 
ATOM   580  O  O   . GLY A 1  75  ? 47.508 35.301  24.526  1.00 22.49 ? 75   GLY A O   1 
ATOM   581  N  N   . PHE A 1  76  ? 47.664 33.069  24.231  1.00 21.30 ? 76   PHE A N   1 
ATOM   582  C  CA  . PHE A 1  76  ? 46.748 33.010  23.090  1.00 20.78 ? 76   PHE A CA  1 
ATOM   583  C  C   . PHE A 1  76  ? 45.363 32.586  23.549  1.00 20.64 ? 76   PHE A C   1 
ATOM   584  O  O   . PHE A 1  76  ? 45.190 31.508  24.133  1.00 19.89 ? 76   PHE A O   1 
ATOM   585  C  CB  . PHE A 1  76  ? 47.277 32.043  22.017  1.00 20.12 ? 76   PHE A CB  1 
ATOM   586  C  CG  . PHE A 1  76  ? 46.369 31.893  20.813  1.00 20.00 ? 76   PHE A CG  1 
ATOM   587  C  CD1 . PHE A 1  76  ? 45.988 33.001  20.060  1.00 19.21 ? 76   PHE A CD1 1 
ATOM   588  C  CD2 . PHE A 1  76  ? 45.907 30.632  20.434  1.00 19.72 ? 76   PHE A CD2 1 
ATOM   589  C  CE1 . PHE A 1  76  ? 45.164 32.854  18.941  1.00 20.95 ? 76   PHE A CE1 1 
ATOM   590  C  CE2 . PHE A 1  76  ? 45.066 30.472  19.319  1.00 20.61 ? 76   PHE A CE2 1 
ATOM   591  C  CZ  . PHE A 1  76  ? 44.700 31.574  18.570  1.00 18.78 ? 76   PHE A CZ  1 
ATOM   592  N  N   . HIS A 1  77  ? 44.380 33.439  23.273  1.00 20.58 ? 77   HIS A N   1 
ATOM   593  C  CA  . HIS A 1  77  ? 43.016 33.209  23.742  1.00 20.97 ? 77   HIS A CA  1 
ATOM   594  C  C   . HIS A 1  77  ? 42.388 31.927  23.174  1.00 20.86 ? 77   HIS A C   1 
ATOM   595  O  O   . HIS A 1  77  ? 41.654 31.236  23.877  1.00 20.58 ? 77   HIS A O   1 
ATOM   596  C  CB  . HIS A 1  77  ? 42.117 34.436  23.474  1.00 21.27 ? 77   HIS A CB  1 
ATOM   597  C  CG  . HIS A 1  77  ? 40.723 34.263  23.982  1.00 23.72 ? 77   HIS A CG  1 
ATOM   598  N  ND1 . HIS A 1  77  ? 40.434 34.159  25.325  1.00 23.80 ? 77   HIS A ND1 1 
ATOM   599  C  CD2 . HIS A 1  77  ? 39.545 34.114  23.330  1.00 25.47 ? 77   HIS A CD2 1 
ATOM   600  C  CE1 . HIS A 1  77  ? 39.136 33.977  25.482  1.00 25.86 ? 77   HIS A CE1 1 
ATOM   601  N  NE2 . HIS A 1  77  ? 38.575 33.939  24.286  1.00 26.77 ? 77   HIS A NE2 1 
ATOM   602  N  N   . GLY A 1  78  ? 42.693 31.597  21.919  1.00 20.43 ? 78   GLY A N   1 
ATOM   603  C  CA  . GLY A 1  78  ? 42.086 30.418  21.277  1.00 19.80 ? 78   GLY A CA  1 
ATOM   604  C  C   . GLY A 1  78  ? 42.316 29.112  22.001  1.00 19.71 ? 78   GLY A C   1 
ATOM   605  O  O   . GLY A 1  78  ? 41.430 28.252  22.046  1.00 19.21 ? 78   GLY A O   1 
ATOM   606  N  N   . SER A 1  79  ? 43.508 28.948  22.571  1.00 19.64 ? 79   SER A N   1 
ATOM   607  C  CA  . SER A 1  79  ? 43.803 27.764  23.368  1.00 19.83 ? 79   SER A CA  1 
ATOM   608  C  C   . SER A 1  79  ? 43.509 27.967  24.852  1.00 19.75 ? 79   SER A C   1 
ATOM   609  O  O   . SER A 1  79  ? 42.965 27.090  25.513  1.00 17.95 ? 79   SER A O   1 
ATOM   610  C  CB  . SER A 1  79  ? 45.259 27.343  23.183  1.00 20.68 ? 79   SER A CB  1 
ATOM   611  O  OG  . SER A 1  79  ? 46.138 28.391  23.539  1.00 22.74 ? 79   SER A OG  1 
ATOM   612  N  N   . GLU A 1  80  ? 43.899 29.127  25.379  1.00 19.58 ? 80   GLU A N   1 
ATOM   613  C  CA  . GLU A 1  80  ? 43.728 29.382  26.804  1.00 19.20 ? 80   GLU A CA  1 
ATOM   614  C  C   . GLU A 1  80  ? 42.289 29.442  27.273  1.00 19.05 ? 80   GLU A C   1 
ATOM   615  O  O   . GLU A 1  80  ? 42.014 29.151  28.440  1.00 18.66 ? 80   GLU A O   1 
ATOM   616  C  CB  . GLU A 1  80  ? 44.511 30.637  27.239  1.00 19.77 ? 80   GLU A CB  1 
ATOM   617  C  CG  . GLU A 1  80  ? 46.009 30.441  27.068  1.00 20.16 ? 80   GLU A CG  1 
ATOM   618  C  CD  . GLU A 1  80  ? 46.844 31.544  27.714  1.00 25.78 ? 80   GLU A CD  1 
ATOM   619  O  OE1 . GLU A 1  80  ? 47.975 31.225  28.118  1.00 27.06 ? 80   GLU A OE1 1 
ATOM   620  O  OE2 . GLU A 1  80  ? 46.373 32.705  27.819  1.00 23.76 ? 80   GLU A OE2 1 
ATOM   621  N  N   . MET A 1  81  ? 41.361 29.779  26.381  1.00 18.85 ? 81   MET A N   1 
ATOM   622  C  CA  . MET A 1  81  ? 39.951 29.845  26.766  1.00 18.96 ? 81   MET A CA  1 
ATOM   623  C  C   . MET A 1  81  ? 39.406 28.489  27.241  1.00 19.01 ? 81   MET A C   1 
ATOM   624  O  O   . MET A 1  81  ? 38.376 28.442  27.928  1.00 20.09 ? 81   MET A O   1 
ATOM   625  C  CB  . MET A 1  81  ? 39.087 30.389  25.621  1.00 19.37 ? 81   MET A CB  1 
ATOM   626  C  CG  . MET A 1  81  ? 38.983 29.428  24.435  1.00 20.15 ? 81   MET A CG  1 
ATOM   627  S  SD  . MET A 1  81  ? 38.022 30.116  23.083  1.00 24.51 ? 81   MET A SD  1 
ATOM   628  C  CE  . MET A 1  81  ? 36.357 29.732  23.615  1.00 22.35 ? 81   MET A CE  1 
ATOM   629  N  N   . TRP A 1  82  ? 40.099 27.404  26.898  1.00 18.63 ? 82   TRP A N   1 
ATOM   630  C  CA  . TRP A 1  82  ? 39.668 26.035  27.280  1.00 19.15 ? 82   TRP A CA  1 
ATOM   631  C  C   . TRP A 1  82  ? 40.306 25.535  28.577  1.00 19.76 ? 82   TRP A C   1 
ATOM   632  O  O   . TRP A 1  82  ? 39.820 24.575  29.194  1.00 19.66 ? 82   TRP A O   1 
ATOM   633  C  CB  . TRP A 1  82  ? 39.966 25.033  26.137  1.00 18.62 ? 82   TRP A CB  1 
ATOM   634  C  CG  . TRP A 1  82  ? 39.331 25.461  24.878  1.00 18.89 ? 82   TRP A CG  1 
ATOM   635  C  CD1 . TRP A 1  82  ? 39.956 26.008  23.783  1.00 20.01 ? 82   TRP A CD1 1 
ATOM   636  C  CD2 . TRP A 1  82  ? 37.931 25.425  24.566  1.00 19.60 ? 82   TRP A CD2 1 
ATOM   637  N  NE1 . TRP A 1  82  ? 39.026 26.304  22.806  1.00 18.40 ? 82   TRP A NE1 1 
ATOM   638  C  CE2 . TRP A 1  82  ? 37.779 25.951  23.256  1.00 19.92 ? 82   TRP A CE2 1 
ATOM   639  C  CE3 . TRP A 1  82  ? 36.791 24.988  25.260  1.00 21.55 ? 82   TRP A CE3 1 
ATOM   640  C  CZ2 . TRP A 1  82  ? 36.526 26.058  22.624  1.00 19.94 ? 82   TRP A CZ2 1 
ATOM   641  C  CZ3 . TRP A 1  82  ? 35.536 25.099  24.634  1.00 21.54 ? 82   TRP A CZ3 1 
ATOM   642  C  CH2 . TRP A 1  82  ? 35.421 25.628  23.327  1.00 21.96 ? 82   TRP A CH2 1 
ATOM   643  N  N   . ASN A 1  83  ? 41.397 26.187  28.982  1.00 20.27 ? 83   ASN A N   1 
ATOM   644  C  CA  . ASN A 1  83  ? 42.069 25.867  30.239  1.00 20.68 ? 83   ASN A CA  1 
ATOM   645  C  C   . ASN A 1  83  ? 41.220 26.208  31.469  1.00 20.65 ? 83   ASN A C   1 
ATOM   646  O  O   . ASN A 1  83  ? 40.401 27.124  31.429  1.00 20.27 ? 83   ASN A O   1 
ATOM   647  C  CB  . ASN A 1  83  ? 43.459 26.545  30.303  1.00 20.62 ? 83   ASN A CB  1 
ATOM   648  C  CG  . ASN A 1  83  ? 44.447 25.951  29.304  1.00 22.33 ? 83   ASN A CG  1 
ATOM   649  O  OD1 . ASN A 1  83  ? 44.288 24.807  28.844  1.00 22.34 ? 83   ASN A OD1 1 
ATOM   650  N  ND2 . ASN A 1  83  ? 45.475 26.721  28.958  1.00 21.62 ? 83   ASN A ND2 1 
ATOM   651  N  N   . PRO A 1  84  ? 41.405 25.460  32.573  1.00 21.37 ? 84   PRO A N   1 
ATOM   652  C  CA  . PRO A 1  84  ? 40.612 25.711  33.782  1.00 21.66 ? 84   PRO A CA  1 
ATOM   653  C  C   . PRO A 1  84  ? 40.794 27.123  34.309  1.00 22.06 ? 84   PRO A C   1 
ATOM   654  O  O   . PRO A 1  84  ? 41.901 27.676  34.255  1.00 22.26 ? 84   PRO A O   1 
ATOM   655  C  CB  . PRO A 1  84  ? 41.148 24.705  34.802  1.00 22.42 ? 84   PRO A CB  1 
ATOM   656  C  CG  . PRO A 1  84  ? 42.245 23.954  34.130  1.00 22.61 ? 84   PRO A CG  1 
ATOM   657  C  CD  . PRO A 1  84  ? 42.270 24.269  32.685  1.00 21.44 ? 84   PRO A CD  1 
ATOM   658  N  N   . ASN A 1  85  ? 39.706 27.700  34.812  1.00 21.95 ? 85   ASN A N   1 
ATOM   659  C  CA  . ASN A 1  85  ? 39.725 29.054  35.355  1.00 21.75 ? 85   ASN A CA  1 
ATOM   660  C  C   . ASN A 1  85  ? 39.387 29.101  36.849  1.00 21.62 ? 85   ASN A C   1 
ATOM   661  O  O   . ASN A 1  85  ? 39.015 30.147  37.379  1.00 21.59 ? 85   ASN A O   1 
ATOM   662  C  CB  . ASN A 1  85  ? 38.764 29.950  34.554  1.00 22.43 ? 85   ASN A CB  1 
ATOM   663  C  CG  . ASN A 1  85  ? 37.311 29.450  34.607  1.00 22.92 ? 85   ASN A CG  1 
ATOM   664  O  OD1 . ASN A 1  85  ? 37.038 28.293  34.975  1.00 21.33 ? 85   ASN A OD1 1 
ATOM   665  N  ND2 . ASN A 1  85  ? 36.379 30.326  34.252  1.00 22.79 ? 85   ASN A ND2 1 
ATOM   666  N  N   . THR A 1  86  ? 39.485 27.964  37.526  1.00 20.87 ? 86   THR A N   1 
ATOM   667  C  CA  . THR A 1  86  ? 39.468 27.944  38.991  1.00 20.87 ? 86   THR A CA  1 
ATOM   668  C  C   . THR A 1  86  ? 40.596 27.015  39.443  1.00 20.94 ? 86   THR A C   1 
ATOM   669  O  O   . THR A 1  86  ? 41.093 26.221  38.633  1.00 20.19 ? 86   THR A O   1 
ATOM   670  C  CB  . THR A 1  86  ? 38.100 27.500  39.601  1.00 20.83 ? 86   THR A CB  1 
ATOM   671  O  OG1 . THR A 1  86  ? 37.883 26.107  39.364  1.00 20.88 ? 86   THR A OG1 1 
ATOM   672  C  CG2 . THR A 1  86  ? 36.906 28.334  39.064  1.00 20.24 ? 86   THR A CG2 1 
ATOM   673  N  N   . ASP A 1  87  ? 40.999 27.095  40.718  1.00 21.02 ? 87   ASP A N   1 
ATOM   674  C  CA  . ASP A 1  87  ? 42.053 26.213  41.241  1.00 21.84 ? 87   ASP A CA  1 
ATOM   675  C  C   . ASP A 1  87  ? 41.775 24.753  40.932  1.00 21.29 ? 87   ASP A C   1 
ATOM   676  O  O   . ASP A 1  87  ? 40.628 24.321  40.964  1.00 20.79 ? 87   ASP A O   1 
ATOM   677  C  CB  . ASP A 1  87  ? 42.216 26.298  42.758  1.00 21.96 ? 87   ASP A CB  1 
ATOM   678  C  CG  . ASP A 1  87  ? 42.502 27.674  43.228  1.00 24.48 ? 87   ASP A CG  1 
ATOM   679  O  OD1 . ASP A 1  87  ? 43.691 28.009  43.383  1.00 27.84 ? 87   ASP A OD1 1 
ATOM   680  O  OD2 . ASP A 1  87  ? 41.537 28.419  43.470  1.00 27.43 ? 87   ASP A OD2 1 
ATOM   681  N  N   . LEU A 1  88  ? 42.844 24.007  40.680  1.00 20.80 ? 88   LEU A N   1 
ATOM   682  C  CA  . LEU A 1  88  ? 42.744 22.567  40.500  1.00 21.95 ? 88   LEU A CA  1 
ATOM   683  C  C   . LEU A 1  88  ? 42.828 21.891  41.860  1.00 22.03 ? 88   LEU A C   1 
ATOM   684  O  O   . LEU A 1  88  ? 43.632 22.290  42.696  1.00 22.17 ? 88   LEU A O   1 
ATOM   685  C  CB  . LEU A 1  88  ? 43.874 22.064  39.603  1.00 21.65 ? 88   LEU A CB  1 
ATOM   686  C  CG  . LEU A 1  88  ? 44.008 22.704  38.229  1.00 23.07 ? 88   LEU A CG  1 
ATOM   687  C  CD1 . LEU A 1  88  ? 45.012 21.885  37.441  1.00 20.14 ? 88   LEU A CD1 1 
ATOM   688  C  CD2 . LEU A 1  88  ? 42.636 22.719  37.520  1.00 22.42 ? 88   LEU A CD2 1 
ATOM   689  N  N   . SER A 1  89  ? 42.000 20.874  42.076  1.00 22.15 ? 89   SER A N   1 
ATOM   690  C  CA  . SER A 1  89  ? 42.017 20.117  43.321  1.00 22.00 ? 89   SER A CA  1 
ATOM   691  C  C   . SER A 1  89  ? 41.371 18.764  43.102  1.00 22.34 ? 89   SER A C   1 
ATOM   692  O  O   . SER A 1  89  ? 40.482 18.647  42.279  1.00 22.17 ? 89   SER A O   1 
ATOM   693  C  CB  . SER A 1  89  ? 41.221 20.865  44.391  1.00 22.20 ? 89   SER A CB  1 
ATOM   694  O  OG  . SER A 1  89  ? 41.183 20.135  45.609  1.00 21.00 ? 89   SER A OG  1 
ATOM   695  N  N   . GLU A 1  90  ? 41.781 17.743  43.850  1.00 22.27 ? 90   GLU A N   1 
ATOM   696  C  CA  . GLU A 1  90  ? 40.997 16.500  43.819  1.00 21.82 ? 90   GLU A CA  1 
ATOM   697  C  C   . GLU A 1  90  ? 39.623 16.719  44.447  1.00 21.63 ? 90   GLU A C   1 
ATOM   698  O  O   . GLU A 1  90  ? 38.689 15.944  44.215  1.00 20.49 ? 90   GLU A O   1 
ATOM   699  C  CB  . GLU A 1  90  ? 41.704 15.372  44.533  1.00 22.06 ? 90   GLU A CB  1 
ATOM   700  C  CG  . GLU A 1  90  ? 42.913 14.812  43.836  1.00 22.53 ? 90   GLU A CG  1 
ATOM   701  C  CD  . GLU A 1  90  ? 43.481 13.651  44.624  1.00 24.58 ? 90   GLU A CD  1 
ATOM   702  O  OE1 . GLU A 1  90  ? 44.293 13.895  45.538  1.00 27.33 ? 90   GLU A OE1 1 
ATOM   703  O  OE2 . GLU A 1  90  ? 43.101 12.498  44.351  1.00 25.22 ? 90   GLU A OE2 1 
ATOM   704  N  N   . ASP A 1  91  ? 39.516 17.770  45.264  1.00 21.38 ? 91   ASP A N   1 
ATOM   705  C  CA  . ASP A 1  91  ? 38.260 18.133  45.889  1.00 21.64 ? 91   ASP A CA  1 
ATOM   706  C  C   . ASP A 1  91  ? 37.506 19.008  44.885  1.00 21.24 ? 91   ASP A C   1 
ATOM   707  O  O   . ASP A 1  91  ? 37.568 20.237  44.928  1.00 20.65 ? 91   ASP A O   1 
ATOM   708  C  CB  . ASP A 1  91  ? 38.531 18.854  47.220  1.00 22.03 ? 91   ASP A CB  1 
ATOM   709  C  CG  . ASP A 1  91  ? 37.261 19.321  47.905  1.00 23.34 ? 91   ASP A CG  1 
ATOM   710  O  OD1 . ASP A 1  91  ? 36.132 19.021  47.424  1.00 22.28 ? 91   ASP A OD1 1 
ATOM   711  O  OD2 . ASP A 1  91  ? 37.405 20.016  48.924  1.00 24.39 ? 91   ASP A OD2 1 
ATOM   712  N  N   . CYS A 1  92  ? 36.809 18.353  43.956  1.00 21.00 ? 92   CYS A N   1 
ATOM   713  C  CA  . CYS A 1  92  ? 36.267 19.055  42.796  1.00 20.90 ? 92   CYS A CA  1 
ATOM   714  C  C   . CYS A 1  92  ? 34.851 18.628  42.399  1.00 20.43 ? 92   CYS A C   1 
ATOM   715  O  O   . CYS A 1  92  ? 34.335 19.120  41.406  1.00 20.33 ? 92   CYS A O   1 
ATOM   716  C  CB  . CYS A 1  92  ? 37.200 18.894  41.600  1.00 20.67 ? 92   CYS A CB  1 
ATOM   717  S  SG  . CYS A 1  92  ? 37.304 17.176  41.012  1.00 22.57 ? 92   CYS A SG  1 
ATOM   718  N  N   . LEU A 1  93  ? 34.218 17.766  43.190  1.00 19.87 ? 93   LEU A N   1 
ATOM   719  C  CA  . LEU A 1  93  ? 32.878 17.270  42.844  1.00 19.62 ? 93   LEU A CA  1 
ATOM   720  C  C   . LEU A 1  93  ? 31.766 18.222  43.279  1.00 19.50 ? 93   LEU A C   1 
ATOM   721  O  O   . LEU A 1  93  ? 31.117 18.041  44.328  1.00 19.42 ? 93   LEU A O   1 
ATOM   722  C  CB  . LEU A 1  93  ? 32.673 15.831  43.343  1.00 19.22 ? 93   LEU A CB  1 
ATOM   723  C  CG  . LEU A 1  93  ? 33.716 14.834  42.809  1.00 19.07 ? 93   LEU A CG  1 
ATOM   724  C  CD1 . LEU A 1  93  ? 33.411 13.421  43.334  1.00 18.57 ? 93   LEU A CD1 1 
ATOM   725  C  CD2 . LEU A 1  93  ? 33.723 14.847  41.272  1.00 17.79 ? 93   LEU A CD2 1 
ATOM   726  N  N   . TYR A 1  94  ? 31.567 19.227  42.434  1.00 19.43 ? 94   TYR A N   1 
ATOM   727  C  CA  . TYR A 1  94  ? 30.623 20.306  42.643  1.00 19.50 ? 94   TYR A CA  1 
ATOM   728  C  C   . TYR A 1  94  ? 29.830 20.504  41.354  1.00 20.30 ? 94   TYR A C   1 
ATOM   729  O  O   . TYR A 1  94  ? 30.250 20.079  40.282  1.00 19.76 ? 94   TYR A O   1 
ATOM   730  C  CB  . TYR A 1  94  ? 31.355 21.598  43.032  1.00 20.05 ? 94   TYR A CB  1 
ATOM   731  C  CG  . TYR A 1  94  ? 32.151 21.435  44.314  1.00 20.85 ? 94   TYR A CG  1 
ATOM   732  C  CD1 . TYR A 1  94  ? 33.444 20.908  44.288  1.00 21.58 ? 94   TYR A CD1 1 
ATOM   733  C  CD2 . TYR A 1  94  ? 31.596 21.768  45.548  1.00 21.80 ? 94   TYR A CD2 1 
ATOM   734  C  CE1 . TYR A 1  94  ? 34.172 20.715  45.455  1.00 22.09 ? 94   TYR A CE1 1 
ATOM   735  C  CE2 . TYR A 1  94  ? 32.317 21.583  46.728  1.00 23.24 ? 94   TYR A CE2 1 
ATOM   736  C  CZ  . TYR A 1  94  ? 33.606 21.056  46.670  1.00 23.50 ? 94   TYR A CZ  1 
ATOM   737  O  OH  . TYR A 1  94  ? 34.338 20.861  47.819  1.00 24.86 ? 94   TYR A OH  1 
ATOM   738  N  N   . LEU A 1  95  ? 28.664 21.118  41.484  1.00 20.65 ? 95   LEU A N   1 
ATOM   739  C  CA  . LEU A 1  95  ? 27.842 21.428  40.336  1.00 21.04 ? 95   LEU A CA  1 
ATOM   740  C  C   . LEU A 1  95  ? 27.302 22.858  40.477  1.00 21.35 ? 95   LEU A C   1 
ATOM   741  O  O   . LEU A 1  95  ? 27.401 23.481  41.566  1.00 21.82 ? 95   LEU A O   1 
ATOM   742  C  CB  . LEU A 1  95  ? 26.718 20.382  40.175  1.00 20.92 ? 95   LEU A CB  1 
ATOM   743  C  CG  . LEU A 1  95  ? 25.752 20.148  41.343  1.00 22.17 ? 95   LEU A CG  1 
ATOM   744  C  CD1 . LEU A 1  95  ? 24.712 21.258  41.448  1.00 21.36 ? 95   LEU A CD1 1 
ATOM   745  C  CD2 . LEU A 1  95  ? 25.070 18.780  41.180  1.00 22.86 ? 95   LEU A CD2 1 
ATOM   746  N  N   . ASN A 1  96  ? 26.742 23.371  39.390  1.00 20.67 ? 96   ASN A N   1 
ATOM   747  C  CA  . ASN A 1  96  ? 26.207 24.730  39.337  1.00 20.74 ? 96   ASN A CA  1 
ATOM   748  C  C   . ASN A 1  96  ? 24.749 24.648  38.879  1.00 21.22 ? 96   ASN A C   1 
ATOM   749  O  O   . ASN A 1  96  ? 24.413 23.802  38.051  1.00 20.77 ? 96   ASN A O   1 
ATOM   750  C  CB  . ASN A 1  96  ? 27.000 25.579  38.336  1.00 20.10 ? 96   ASN A CB  1 
ATOM   751  C  CG  . ASN A 1  96  ? 28.508 25.470  38.533  1.00 21.97 ? 96   ASN A CG  1 
ATOM   752  O  OD1 . ASN A 1  96  ? 29.028 25.783  39.604  1.00 21.42 ? 96   ASN A OD1 1 
ATOM   753  N  ND2 . ASN A 1  96  ? 29.217 25.025  37.493  1.00 20.68 ? 96   ASN A ND2 1 
ATOM   754  N  N   . VAL A 1  97  ? 23.902 25.521  39.428  1.00 21.46 ? 97   VAL A N   1 
ATOM   755  C  CA  . VAL A 1  97  ? 22.486 25.633  39.053  1.00 21.58 ? 97   VAL A CA  1 
ATOM   756  C  C   . VAL A 1  97  ? 22.164 27.101  38.732  1.00 21.76 ? 97   VAL A C   1 
ATOM   757  O  O   . VAL A 1  97  ? 22.419 27.989  39.557  1.00 21.58 ? 97   VAL A O   1 
ATOM   758  C  CB  . VAL A 1  97  ? 21.546 25.164  40.197  1.00 21.71 ? 97   VAL A CB  1 
ATOM   759  C  CG1 . VAL A 1  97  ? 20.088 25.172  39.738  1.00 21.37 ? 97   VAL A CG1 1 
ATOM   760  C  CG2 . VAL A 1  97  ? 21.928 23.770  40.728  1.00 21.80 ? 97   VAL A CG2 1 
ATOM   761  N  N   . TRP A 1  98  ? 21.646 27.364  37.533  1.00 21.30 ? 98   TRP A N   1 
ATOM   762  C  CA  . TRP A 1  98  ? 21.098 28.681  37.208  1.00 21.90 ? 98   TRP A CA  1 
ATOM   763  C  C   . TRP A 1  98  ? 19.601 28.531  37.032  1.00 22.51 ? 98   TRP A C   1 
ATOM   764  O  O   . TRP A 1  98  ? 19.143 27.649  36.302  1.00 22.98 ? 98   TRP A O   1 
ATOM   765  C  CB  . TRP A 1  98  ? 21.666 29.236  35.902  1.00 21.24 ? 98   TRP A CB  1 
ATOM   766  C  CG  . TRP A 1  98  ? 23.099 29.631  35.925  1.00 20.38 ? 98   TRP A CG  1 
ATOM   767  C  CD1 . TRP A 1  98  ? 23.607 30.885  36.215  1.00 19.51 ? 98   TRP A CD1 1 
ATOM   768  C  CD2 . TRP A 1  98  ? 24.224 28.798  35.624  1.00 18.54 ? 98   TRP A CD2 1 
ATOM   769  N  NE1 . TRP A 1  98  ? 24.969 30.863  36.107  1.00 21.01 ? 98   TRP A NE1 1 
ATOM   770  C  CE2 . TRP A 1  98  ? 25.379 29.603  35.750  1.00 19.69 ? 98   TRP A CE2 1 
ATOM   771  C  CE3 . TRP A 1  98  ? 24.371 27.439  35.284  1.00 16.66 ? 98   TRP A CE3 1 
ATOM   772  C  CZ2 . TRP A 1  98  ? 26.669 29.101  35.539  1.00 20.11 ? 98   TRP A CZ2 1 
ATOM   773  C  CZ3 . TRP A 1  98  ? 25.650 26.940  35.060  1.00 17.29 ? 98   TRP A CZ3 1 
ATOM   774  C  CH2 . TRP A 1  98  ? 26.784 27.773  35.181  1.00 20.93 ? 98   TRP A CH2 1 
ATOM   775  N  N   . ILE A 1  99  ? 18.846 29.408  37.678  1.00 22.91 ? 99   ILE A N   1 
ATOM   776  C  CA  . ILE A 1  99  ? 17.402 29.374  37.611  1.00 23.50 ? 99   ILE A CA  1 
ATOM   777  C  C   . ILE A 1  99  ? 16.917 30.777  37.250  1.00 23.71 ? 99   ILE A C   1 
ATOM   778  O  O   . ILE A 1  99  ? 17.517 31.786  37.677  1.00 23.47 ? 99   ILE A O   1 
ATOM   779  C  CB  . ILE A 1  99  ? 16.732 28.876  38.949  1.00 24.01 ? 99   ILE A CB  1 
ATOM   780  C  CG1 . ILE A 1  99  ? 16.872 29.898  40.072  1.00 24.48 ? 99   ILE A CG1 1 
ATOM   781  C  CG2 . ILE A 1  99  ? 17.308 27.514  39.416  1.00 23.03 ? 99   ILE A CG2 1 
ATOM   782  C  CD1 . ILE A 1  99  ? 15.925 29.621  41.249  1.00 25.81 ? 99   ILE A CD1 1 
ATOM   783  N  N   . PRO A 1  100 ? 15.840 30.855  36.457  1.00 23.67 ? 100  PRO A N   1 
ATOM   784  C  CA  . PRO A 1  100 ? 15.281 32.176  36.179  1.00 24.42 ? 100  PRO A CA  1 
ATOM   785  C  C   . PRO A 1  100 ? 14.696 32.829  37.442  1.00 24.67 ? 100  PRO A C   1 
ATOM   786  O  O   . PRO A 1  100 ? 14.436 32.147  38.440  1.00 24.01 ? 100  PRO A O   1 
ATOM   787  C  CB  . PRO A 1  100 ? 14.169 31.901  35.150  1.00 24.50 ? 100  PRO A CB  1 
ATOM   788  C  CG  . PRO A 1  100 ? 13.953 30.422  35.161  1.00 25.25 ? 100  PRO A CG  1 
ATOM   789  C  CD  . PRO A 1  100 ? 15.169 29.771  35.707  1.00 23.96 ? 100  PRO A CD  1 
ATOM   790  N  N   . ALA A 1  101 ? 14.538 34.148  37.383  1.00 25.41 ? 101  ALA A N   1 
ATOM   791  C  CA  . ALA A 1  101 ? 13.802 34.900  38.377  1.00 26.25 ? 101  ALA A CA  1 
ATOM   792  C  C   . ALA A 1  101 ? 12.698 35.664  37.654  1.00 26.91 ? 101  ALA A C   1 
ATOM   793  O  O   . ALA A 1  101 ? 12.950 36.264  36.614  1.00 26.70 ? 101  ALA A O   1 
ATOM   794  C  CB  . ALA A 1  101 ? 14.719 35.850  39.125  1.00 26.45 ? 101  ALA A CB  1 
ATOM   795  N  N   . PRO A 1  102 ? 11.464 35.635  38.194  1.00 27.68 ? 102  PRO A N   1 
ATOM   796  C  CA  . PRO A 1  102 ? 11.135 34.921  39.431  1.00 27.93 ? 102  PRO A CA  1 
ATOM   797  C  C   . PRO A 1  102 ? 11.271 33.411  39.279  1.00 27.84 ? 102  PRO A C   1 
ATOM   798  O  O   . PRO A 1  102 ? 11.233 32.886  38.157  1.00 28.17 ? 102  PRO A O   1 
ATOM   799  C  CB  . PRO A 1  102 ? 9.680  35.328  39.709  1.00 28.17 ? 102  PRO A CB  1 
ATOM   800  C  CG  . PRO A 1  102 ? 9.155  35.802  38.391  1.00 28.57 ? 102  PRO A CG  1 
ATOM   801  C  CD  . PRO A 1  102 ? 10.314 36.397  37.665  1.00 27.79 ? 102  PRO A CD  1 
ATOM   802  N  N   . LYS A 1  103 ? 11.468 32.737  40.406  1.00 27.61 ? 103  LYS A N   1 
ATOM   803  C  CA  . LYS A 1  103 ? 11.636 31.292  40.454  1.00 27.57 ? 103  LYS A CA  1 
ATOM   804  C  C   . LYS A 1  103 ? 10.551 30.615  39.628  1.00 26.99 ? 103  LYS A C   1 
ATOM   805  O  O   . LYS A 1  103 ? 9.385  30.947  39.761  1.00 25.94 ? 103  LYS A O   1 
ATOM   806  C  CB  . LYS A 1  103 ? 11.545 30.817  41.895  1.00 27.74 ? 103  LYS A CB  1 
ATOM   807  C  CG  . LYS A 1  103 ? 11.778 29.332  42.098  1.00 28.99 ? 103  LYS A CG  1 
ATOM   808  C  CD  . LYS A 1  103 ? 11.323 28.924  43.494  1.00 32.93 ? 103  LYS A CD  1 
ATOM   809  C  CE  . LYS A 1  103 ? 12.220 27.858  44.065  1.00 34.49 ? 103  LYS A CE  1 
ATOM   810  N  NZ  . LYS A 1  103 ? 11.443 26.989  44.977  1.00 38.46 ? 103  LYS A NZ  1 
ATOM   811  N  N   . PRO A 1  104 ? 10.935 29.662  38.768  1.00 26.55 ? 104  PRO A N   1 
ATOM   812  C  CA  . PRO A 1  104 ? 9.920  29.013  37.938  1.00 26.45 ? 104  PRO A CA  1 
ATOM   813  C  C   . PRO A 1  104 ? 9.096  28.005  38.742  1.00 26.20 ? 104  PRO A C   1 
ATOM   814  O  O   . PRO A 1  104 ? 9.495  27.624  39.837  1.00 26.39 ? 104  PRO A O   1 
ATOM   815  C  CB  . PRO A 1  104 ? 10.759 28.303  36.871  1.00 25.78 ? 104  PRO A CB  1 
ATOM   816  C  CG  . PRO A 1  104 ? 12.045 27.996  37.564  1.00 26.44 ? 104  PRO A CG  1 
ATOM   817  C  CD  . PRO A 1  104 ? 12.289 29.123  38.525  1.00 26.48 ? 104  PRO A CD  1 
ATOM   818  N  N   . LYS A 1  105 ? 7.959  27.579  38.196  1.00 26.36 ? 105  LYS A N   1 
ATOM   819  C  CA  . LYS A 1  105 ? 7.085  26.615  38.867  1.00 26.74 ? 105  LYS A CA  1 
ATOM   820  C  C   . LYS A 1  105 ? 7.481  25.156  38.597  1.00 26.73 ? 105  LYS A C   1 
ATOM   821  O  O   . LYS A 1  105 ? 7.479  24.336  39.527  1.00 27.53 ? 105  LYS A O   1 
ATOM   822  C  CB  . LYS A 1  105 ? 5.615  26.855  38.488  1.00 26.96 ? 105  LYS A CB  1 
ATOM   823  C  CG  . LYS A 1  105 ? 4.955  28.000  39.258  1.00 28.81 ? 105  LYS A CG  1 
ATOM   824  C  CD  . LYS A 1  105 ? 4.183  27.490  40.465  1.00 31.47 ? 105  LYS A CD  1 
ATOM   825  C  CE  . LYS A 1  105 ? 3.763  28.636  41.402  1.00 33.60 ? 105  LYS A CE  1 
ATOM   826  N  NZ  . LYS A 1  105 ? 3.360  29.820  40.614  1.00 34.90 ? 105  LYS A NZ  1 
ATOM   827  N  N   . ASN A 1  106 ? 7.825  24.837  37.347  1.00 25.53 ? 106  ASN A N   1 
ATOM   828  C  CA  . ASN A 1  106 ? 8.122  23.458  36.943  1.00 24.75 ? 106  ASN A CA  1 
ATOM   829  C  C   . ASN A 1  106 ? 8.969  23.467  35.672  1.00 23.65 ? 106  ASN A C   1 
ATOM   830  O  O   . ASN A 1  106 ? 8.549  22.955  34.629  1.00 22.66 ? 106  ASN A O   1 
ATOM   831  C  CB  . ASN A 1  106 ? 6.805  22.717  36.672  1.00 25.37 ? 106  ASN A CB  1 
ATOM   832  C  CG  . ASN A 1  106 ? 6.907  21.210  36.864  1.00 27.69 ? 106  ASN A CG  1 
ATOM   833  O  OD1 . ASN A 1  106 ? 7.859  20.684  37.458  1.00 27.58 ? 106  ASN A OD1 1 
ATOM   834  N  ND2 . ASN A 1  106 ? 5.897  20.505  36.361  1.00 30.67 ? 106  ASN A ND2 1 
ATOM   835  N  N   . ALA A 1  107 ? 10.156 24.059  35.753  1.00 22.27 ? 107  ALA A N   1 
ATOM   836  C  CA  . ALA A 1  107 ? 10.929 24.353  34.544  1.00 21.92 ? 107  ALA A CA  1 
ATOM   837  C  C   . ALA A 1  107 ? 11.632 23.124  34.012  1.00 21.31 ? 107  ALA A C   1 
ATOM   838  O  O   . ALA A 1  107 ? 12.078 22.260  34.782  1.00 21.77 ? 107  ALA A O   1 
ATOM   839  C  CB  . ALA A 1  107 ? 11.950 25.464  34.805  1.00 22.02 ? 107  ALA A CB  1 
ATOM   840  N  N   . THR A 1  108 ? 11.737 23.055  32.692  1.00 20.77 ? 108  THR A N   1 
ATOM   841  C  CA  . THR A 1  108 ? 12.611 22.068  32.053  1.00 20.26 ? 108  THR A CA  1 
ATOM   842  C  C   . THR A 1  108 ? 14.071 22.364  32.442  1.00 19.86 ? 108  THR A C   1 
ATOM   843  O  O   . THR A 1  108 ? 14.471 23.539  32.605  1.00 19.00 ? 108  THR A O   1 
ATOM   844  C  CB  . THR A 1  108 ? 12.425 22.074  30.514  1.00 20.63 ? 108  THR A CB  1 
ATOM   845  O  OG1 . THR A 1  108 ? 11.199 21.419  30.194  1.00 21.18 ? 108  THR A OG1 1 
ATOM   846  C  CG2 . THR A 1  108 ? 13.550 21.327  29.801  1.00 19.88 ? 108  THR A CG2 1 
ATOM   847  N  N   . VAL A 1  109 ? 14.842 21.288  32.581  1.00 19.11 ? 109  VAL A N   1 
ATOM   848  C  CA  . VAL A 1  109 ? 16.222 21.332  33.047  1.00 19.80 ? 109  VAL A CA  1 
ATOM   849  C  C   . VAL A 1  109 ? 17.184 20.859  31.939  1.00 19.72 ? 109  VAL A C   1 
ATOM   850  O  O   . VAL A 1  109 ? 16.968 19.818  31.314  1.00 20.37 ? 109  VAL A O   1 
ATOM   851  C  CB  . VAL A 1  109 ? 16.414 20.459  34.325  1.00 19.15 ? 109  VAL A CB  1 
ATOM   852  C  CG1 . VAL A 1  109 ? 17.876 20.513  34.829  1.00 19.06 ? 109  VAL A CG1 1 
ATOM   853  C  CG2 . VAL A 1  109 ? 15.445 20.915  35.447  1.00 19.58 ? 109  VAL A CG2 1 
ATOM   854  N  N   . LEU A 1  110 ? 18.206 21.663  31.682  1.00 19.80 ? 110  LEU A N   1 
ATOM   855  C  CA  . LEU A 1  110 ? 19.297 21.298  30.778  1.00 20.37 ? 110  LEU A CA  1 
ATOM   856  C  C   . LEU A 1  110 ? 20.557 21.025  31.629  1.00 20.51 ? 110  LEU A C   1 
ATOM   857  O  O   . LEU A 1  110 ? 20.977 21.885  32.414  1.00 20.70 ? 110  LEU A O   1 
ATOM   858  C  CB  . LEU A 1  110 ? 19.557 22.443  29.784  1.00 20.62 ? 110  LEU A CB  1 
ATOM   859  C  CG  . LEU A 1  110 ? 18.585 22.674  28.619  1.00 24.16 ? 110  LEU A CG  1 
ATOM   860  C  CD1 . LEU A 1  110 ? 18.995 23.913  27.812  1.00 26.63 ? 110  LEU A CD1 1 
ATOM   861  C  CD2 . LEU A 1  110 ? 18.611 21.496  27.692  1.00 27.22 ? 110  LEU A CD2 1 
ATOM   862  N  N   . ILE A 1  111 ? 21.144 19.831  31.494  1.00 19.51 ? 111  ILE A N   1 
ATOM   863  C  CA  . ILE A 1  111 ? 22.363 19.510  32.215  1.00 18.79 ? 111  ILE A CA  1 
ATOM   864  C  C   . ILE A 1  111 ? 23.546 19.401  31.247  1.00 18.69 ? 111  ILE A C   1 
ATOM   865  O  O   . ILE A 1  111 ? 23.565 18.514  30.388  1.00 18.34 ? 111  ILE A O   1 
ATOM   866  C  CB  . ILE A 1  111 ? 22.235 18.206  33.049  1.00 19.63 ? 111  ILE A CB  1 
ATOM   867  C  CG1 . ILE A 1  111 ? 21.017 18.261  33.988  1.00 18.51 ? 111  ILE A CG1 1 
ATOM   868  C  CG2 . ILE A 1  111 ? 23.541 17.942  33.810  1.00 19.15 ? 111  ILE A CG2 1 
ATOM   869  C  CD1 . ILE A 1  111 ? 20.731 16.980  34.725  1.00 18.01 ? 111  ILE A CD1 1 
ATOM   870  N  N   . TRP A 1  112 ? 24.521 20.296  31.411  1.00 17.25 ? 112  TRP A N   1 
ATOM   871  C  CA  . TRP A 1  112 ? 25.710 20.348  30.562  1.00 17.83 ? 112  TRP A CA  1 
ATOM   872  C  C   . TRP A 1  112 ? 26.817 19.437  31.068  1.00 17.94 ? 112  TRP A C   1 
ATOM   873  O  O   . TRP A 1  112 ? 27.157 19.443  32.288  1.00 17.24 ? 112  TRP A O   1 
ATOM   874  C  CB  . TRP A 1  112 ? 26.262 21.789  30.504  1.00 17.31 ? 112  TRP A CB  1 
ATOM   875  C  CG  . TRP A 1  112 ? 27.506 21.926  29.644  1.00 17.16 ? 112  TRP A CG  1 
ATOM   876  C  CD1 . TRP A 1  112 ? 28.796 22.130  30.074  1.00 17.81 ? 112  TRP A CD1 1 
ATOM   877  C  CD2 . TRP A 1  112 ? 27.566 21.838  28.216  1.00 16.88 ? 112  TRP A CD2 1 
ATOM   878  N  NE1 . TRP A 1  112 ? 29.650 22.189  28.988  1.00 18.27 ? 112  TRP A NE1 1 
ATOM   879  C  CE2 . TRP A 1  112 ? 28.919 22.008  27.836  1.00 17.78 ? 112  TRP A CE2 1 
ATOM   880  C  CE3 . TRP A 1  112 ? 26.598 21.642  27.216  1.00 17.09 ? 112  TRP A CE3 1 
ATOM   881  C  CZ2 . TRP A 1  112 ? 29.333 22.012  26.488  1.00 15.81 ? 112  TRP A CZ2 1 
ATOM   882  C  CZ3 . TRP A 1  112 ? 27.008 21.656  25.852  1.00 15.52 ? 112  TRP A CZ3 1 
ATOM   883  C  CH2 . TRP A 1  112 ? 28.363 21.819  25.515  1.00 14.67 ? 112  TRP A CH2 1 
ATOM   884  N  N   . ILE A 1  113 ? 27.381 18.664  30.146  1.00 17.22 ? 113  ILE A N   1 
ATOM   885  C  CA  . ILE A 1  113 ? 28.544 17.827  30.440  1.00 17.30 ? 113  ILE A CA  1 
ATOM   886  C  C   . ILE A 1  113 ? 29.675 18.290  29.517  1.00 17.72 ? 113  ILE A C   1 
ATOM   887  O  O   . ILE A 1  113 ? 29.581 18.112  28.302  1.00 17.22 ? 113  ILE A O   1 
ATOM   888  C  CB  . ILE A 1  113 ? 28.267 16.299  30.238  1.00 17.66 ? 113  ILE A CB  1 
ATOM   889  C  CG1 . ILE A 1  113 ? 27.012 15.845  31.023  1.00 17.05 ? 113  ILE A CG1 1 
ATOM   890  C  CG2 . ILE A 1  113 ? 29.531 15.462  30.649  1.00 15.97 ? 113  ILE A CG2 1 
ATOM   891  C  CD1 . ILE A 1  113 ? 26.572 14.365  30.773  1.00 17.59 ? 113  ILE A CD1 1 
ATOM   892  N  N   . TYR A 1  114 ? 30.733 18.888  30.079  1.00 17.07 ? 114  TYR A N   1 
ATOM   893  C  CA  . TYR A 1  114 ? 31.825 19.433  29.237  1.00 17.55 ? 114  TYR A CA  1 
ATOM   894  C  C   . TYR A 1  114 ? 32.655 18.350  28.544  1.00 17.21 ? 114  TYR A C   1 
ATOM   895  O  O   . TYR A 1  114 ? 32.726 17.221  29.024  1.00 18.44 ? 114  TYR A O   1 
ATOM   896  C  CB  . TYR A 1  114 ? 32.751 20.358  30.042  1.00 16.60 ? 114  TYR A CB  1 
ATOM   897  C  CG  . TYR A 1  114 ? 33.343 19.734  31.310  1.00 17.05 ? 114  TYR A CG  1 
ATOM   898  C  CD1 . TYR A 1  114 ? 34.400 18.809  31.244  1.00 18.42 ? 114  TYR A CD1 1 
ATOM   899  C  CD2 . TYR A 1  114 ? 32.889 20.119  32.568  1.00 17.71 ? 114  TYR A CD2 1 
ATOM   900  C  CE1 . TYR A 1  114 ? 34.956 18.244  32.416  1.00 17.77 ? 114  TYR A CE1 1 
ATOM   901  C  CE2 . TYR A 1  114 ? 33.431 19.553  33.746  1.00 18.45 ? 114  TYR A CE2 1 
ATOM   902  C  CZ  . TYR A 1  114 ? 34.469 18.640  33.654  1.00 18.83 ? 114  TYR A CZ  1 
ATOM   903  O  OH  . TYR A 1  114 ? 34.983 18.082  34.801  1.00 19.44 ? 114  TYR A OH  1 
ATOM   904  N  N   . GLY A 1  115 ? 33.299 18.726  27.438  1.00 17.23 ? 115  GLY A N   1 
ATOM   905  C  CA  . GLY A 1  115 ? 34.326 17.938  26.821  1.00 17.05 ? 115  GLY A CA  1 
ATOM   906  C  C   . GLY A 1  115 ? 35.738 18.295  27.287  1.00 17.85 ? 115  GLY A C   1 
ATOM   907  O  O   . GLY A 1  115 ? 35.929 19.026  28.261  1.00 17.99 ? 115  GLY A O   1 
ATOM   908  N  N   . GLY A 1  116 ? 36.717 17.763  26.568  1.00 17.86 ? 116  GLY A N   1 
ATOM   909  C  CA  . GLY A 1  116 ? 38.120 17.857  26.931  1.00 18.40 ? 116  GLY A CA  1 
ATOM   910  C  C   . GLY A 1  116 ? 38.813 16.512  26.870  1.00 18.82 ? 116  GLY A C   1 
ATOM   911  O  O   . GLY A 1  116 ? 39.778 16.273  27.603  1.00 19.86 ? 116  GLY A O   1 
ATOM   912  N  N   . GLY A 1  117 ? 38.316 15.611  26.014  1.00 18.48 ? 117  GLY A N   1 
ATOM   913  C  CA  . GLY A 1  117 ? 38.987 14.302  25.782  1.00 18.68 ? 117  GLY A CA  1 
ATOM   914  C  C   . GLY A 1  117 ? 38.984 13.361  26.984  1.00 18.44 ? 117  GLY A C   1 
ATOM   915  O  O   . GLY A 1  117 ? 39.791 12.450  27.054  1.00 19.69 ? 117  GLY A O   1 
ATOM   916  N  N   . PHE A 1  118 ? 38.078 13.592  27.927  1.00 18.25 ? 118  PHE A N   1 
ATOM   917  C  CA  . PHE A 1  118 ? 38.085 12.908  29.226  1.00 19.11 ? 118  PHE A CA  1 
ATOM   918  C  C   . PHE A 1  118 ? 39.365 13.157  30.047  1.00 18.59 ? 118  PHE A C   1 
ATOM   919  O  O   . PHE A 1  118 ? 39.588 12.480  31.032  1.00 18.73 ? 118  PHE A O   1 
ATOM   920  C  CB  . PHE A 1  118 ? 37.853 11.385  29.064  1.00 19.61 ? 118  PHE A CB  1 
ATOM   921  C  CG  . PHE A 1  118 ? 36.546 11.026  28.383  1.00 19.33 ? 118  PHE A CG  1 
ATOM   922  C  CD1 . PHE A 1  118 ? 35.339 11.095  29.090  1.00 19.19 ? 118  PHE A CD1 1 
ATOM   923  C  CD2 . PHE A 1  118 ? 36.531 10.603  27.052  1.00 18.83 ? 118  PHE A CD2 1 
ATOM   924  C  CE1 . PHE A 1  118 ? 34.115 10.741  28.482  1.00 19.45 ? 118  PHE A CE1 1 
ATOM   925  C  CE2 . PHE A 1  118 ? 35.314 10.237  26.430  1.00 18.27 ? 118  PHE A CE2 1 
ATOM   926  C  CZ  . PHE A 1  118 ? 34.099 10.321  27.154  1.00 16.31 ? 118  PHE A CZ  1 
ATOM   927  N  N   . GLN A 1  119 ? 40.215 14.091  29.623  1.00 19.06 ? 119  GLN A N   1 
ATOM   928  C  CA  . GLN A 1  119 ? 41.505 14.333  30.303  1.00 19.27 ? 119  GLN A CA  1 
ATOM   929  C  C   . GLN A 1  119 ? 41.534 15.696  30.959  1.00 19.49 ? 119  GLN A C   1 
ATOM   930  O  O   . GLN A 1  119 ? 42.374 15.961  31.819  1.00 19.56 ? 119  GLN A O   1 
ATOM   931  C  CB  . GLN A 1  119 ? 42.693 14.279  29.326  1.00 19.62 ? 119  GLN A CB  1 
ATOM   932  C  CG  . GLN A 1  119 ? 42.820 13.038  28.429  1.00 20.45 ? 119  GLN A CG  1 
ATOM   933  C  CD  . GLN A 1  119 ? 42.607 11.725  29.166  1.00 21.22 ? 119  GLN A CD  1 
ATOM   934  O  OE1 . GLN A 1  119 ? 43.428 11.313  29.996  1.00 21.32 ? 119  GLN A OE1 1 
ATOM   935  N  NE2 . GLN A 1  119 ? 41.499 11.057  28.862  1.00 18.81 ? 119  GLN A NE2 1 
ATOM   936  N  N   . THR A 1  120 ? 40.649 16.571  30.495  1.00 19.42 ? 120  THR A N   1 
ATOM   937  C  CA  . THR A 1  120 ? 40.611 17.970  30.877  1.00 19.57 ? 120  THR A CA  1 
ATOM   938  C  C   . THR A 1  120 ? 39.157 18.458  30.939  1.00 19.42 ? 120  THR A C   1 
ATOM   939  O  O   . THR A 1  120 ? 38.212 17.754  30.511  1.00 20.21 ? 120  THR A O   1 
ATOM   940  C  CB  . THR A 1  120 ? 41.381 18.877  29.838  1.00 19.31 ? 120  THR A CB  1 
ATOM   941  O  OG1 . THR A 1  120 ? 40.695 18.845  28.562  1.00 18.81 ? 120  THR A OG1 1 
ATOM   942  C  CG2 . THR A 1  120 ? 42.857 18.444  29.685  1.00 18.55 ? 120  THR A CG2 1 
ATOM   943  N  N   . GLY A 1  121 ? 38.983 19.676  31.429  1.00 18.74 ? 121  GLY A N   1 
ATOM   944  C  CA  . GLY A 1  121 ? 37.696 20.356  31.321  1.00 18.52 ? 121  GLY A CA  1 
ATOM   945  C  C   . GLY A 1  121 ? 37.206 20.843  32.661  1.00 18.58 ? 121  GLY A C   1 
ATOM   946  O  O   . GLY A 1  121 ? 37.637 20.346  33.713  1.00 18.04 ? 121  GLY A O   1 
ATOM   947  N  N   . THR A 1  122 ? 36.281 21.800  32.621  1.00 18.65 ? 122  THR A N   1 
ATOM   948  C  CA  . THR A 1  122 ? 35.635 22.267  33.835  1.00 19.53 ? 122  THR A CA  1 
ATOM   949  C  C   . THR A 1  122 ? 34.314 22.941  33.468  1.00 19.93 ? 122  THR A C   1 
ATOM   950  O  O   . THR A 1  122 ? 34.162 23.452  32.363  1.00 19.45 ? 122  THR A O   1 
ATOM   951  C  CB  . THR A 1  122 ? 36.553 23.204  34.664  1.00 18.96 ? 122  THR A CB  1 
ATOM   952  O  OG1 . THR A 1  122 ? 35.902 23.524  35.893  1.00 19.97 ? 122  THR A OG1 1 
ATOM   953  C  CG2 . THR A 1  122 ? 36.868 24.490  33.915  1.00 20.05 ? 122  THR A CG2 1 
ATOM   954  N  N   . SER A 1  123 ? 33.348 22.929  34.381  1.00 20.55 ? 123  SER A N   1 
ATOM   955  C  CA  . SER A 1  123 ? 32.050 23.533  34.071  1.00 20.85 ? 123  SER A CA  1 
ATOM   956  C  C   . SER A 1  123 ? 32.037 25.066  34.226  1.00 20.74 ? 123  SER A C   1 
ATOM   957  O  O   . SER A 1  123 ? 31.036 25.729  33.911  1.00 19.53 ? 123  SER A O   1 
ATOM   958  C  CB  . SER A 1  123 ? 30.961 22.895  34.931  1.00 21.21 ? 123  SER A CB  1 
ATOM   959  O  OG  . SER A 1  123 ? 31.249 23.073  36.296  1.00 23.92 ? 123  SER A OG  1 
ATOM   960  N  N   . SER A 1  124 ? 33.148 25.628  34.712  1.00 20.89 ? 124  SER A N   1 
ATOM   961  C  CA  . SER A 1  124 ? 33.210 27.065  35.034  1.00 21.17 ? 124  SER A CA  1 
ATOM   962  C  C   . SER A 1  124 ? 33.685 27.940  33.887  1.00 21.13 ? 124  SER A C   1 
ATOM   963  O  O   . SER A 1  124 ? 33.767 29.155  34.044  1.00 21.98 ? 124  SER A O   1 
ATOM   964  C  CB  . SER A 1  124 ? 34.073 27.338  36.299  1.00 20.84 ? 124  SER A CB  1 
ATOM   965  O  OG  . SER A 1  124 ? 35.324 26.702  36.185  1.00 22.36 ? 124  SER A OG  1 
ATOM   966  N  N   . LEU A 1  125 ? 33.989 27.350  32.735  1.00 20.36 ? 125  LEU A N   1 
ATOM   967  C  CA  . LEU A 1  125 ? 34.395 28.131  31.564  1.00 20.05 ? 125  LEU A CA  1 
ATOM   968  C  C   . LEU A 1  125 ? 33.319 29.116  31.199  1.00 20.53 ? 125  LEU A C   1 
ATOM   969  O  O   . LEU A 1  125 ? 32.124 28.869  31.421  1.00 20.27 ? 125  LEU A O   1 
ATOM   970  C  CB  . LEU A 1  125 ? 34.734 27.249  30.340  1.00 19.23 ? 125  LEU A CB  1 
ATOM   971  C  CG  . LEU A 1  125 ? 35.849 26.217  30.513  1.00 18.54 ? 125  LEU A CG  1 
ATOM   972  C  CD1 . LEU A 1  125 ? 36.176 25.572  29.176  1.00 18.40 ? 125  LEU A CD1 1 
ATOM   973  C  CD2 . LEU A 1  125 ? 37.125 26.868  31.109  1.00 20.60 ? 125  LEU A CD2 1 
ATOM   974  N  N   . HIS A 1  126 ? 33.764 30.244  30.650  1.00 20.32 ? 126  HIS A N   1 
ATOM   975  C  CA  . HIS A 1  126 ? 32.885 31.313  30.236  1.00 21.20 ? 126  HIS A CA  1 
ATOM   976  C  C   . HIS A 1  126 ? 31.915 30.871  29.095  1.00 20.97 ? 126  HIS A C   1 
ATOM   977  O  O   . HIS A 1  126 ? 30.764 31.332  29.024  1.00 20.36 ? 126  HIS A O   1 
ATOM   978  C  CB  . HIS A 1  126 ? 33.763 32.511  29.835  1.00 22.66 ? 126  HIS A CB  1 
ATOM   979  C  CG  . HIS A 1  126 ? 32.993 33.690  29.341  1.00 27.04 ? 126  HIS A CG  1 
ATOM   980  N  ND1 . HIS A 1  126 ? 33.183 34.225  28.084  1.00 31.09 ? 126  HIS A ND1 1 
ATOM   981  C  CD2 . HIS A 1  126 ? 32.015 34.425  29.924  1.00 30.30 ? 126  HIS A CD2 1 
ATOM   982  C  CE1 . HIS A 1  126 ? 32.371 35.257  27.924  1.00 31.43 ? 126  HIS A CE1 1 
ATOM   983  N  NE2 . HIS A 1  126 ? 31.654 35.399  29.024  1.00 33.23 ? 126  HIS A NE2 1 
ATOM   984  N  N   . VAL A 1  127 ? 32.353 29.955  28.232  1.00 20.47 ? 127  VAL A N   1 
ATOM   985  C  CA  . VAL A 1  127 ? 31.469 29.476  27.150  1.00 20.52 ? 127  VAL A CA  1 
ATOM   986  C  C   . VAL A 1  127 ? 30.385 28.486  27.651  1.00 20.76 ? 127  VAL A C   1 
ATOM   987  O  O   . VAL A 1  127 ? 29.500 28.107  26.896  1.00 21.77 ? 127  VAL A O   1 
ATOM   988  C  CB  . VAL A 1  127 ? 32.263 28.931  25.921  1.00 21.02 ? 127  VAL A CB  1 
ATOM   989  C  CG1 . VAL A 1  127 ? 32.993 30.101  25.196  1.00 20.96 ? 127  VAL A CG1 1 
ATOM   990  C  CG2 . VAL A 1  127 ? 33.225 27.797  26.319  1.00 18.83 ? 127  VAL A CG2 1 
ATOM   991  N  N   . TYR A 1  128 ? 30.454 28.078  28.920  1.00 20.42 ? 128  TYR A N   1 
ATOM   992  C  CA  . TYR A 1  128 ? 29.407 27.215  29.523  1.00 19.90 ? 128  TYR A CA  1 
ATOM   993  C  C   . TYR A 1  128 ? 28.535 27.940  30.546  1.00 20.17 ? 128  TYR A C   1 
ATOM   994  O  O   . TYR A 1  128 ? 27.838 27.320  31.349  1.00 20.05 ? 128  TYR A O   1 
ATOM   995  C  CB  . TYR A 1  128 ? 30.017 25.991  30.198  1.00 19.49 ? 128  TYR A CB  1 
ATOM   996  C  CG  . TYR A 1  128 ? 31.051 25.220  29.412  1.00 18.89 ? 128  TYR A CG  1 
ATOM   997  C  CD1 . TYR A 1  128 ? 30.993 25.114  28.014  1.00 18.76 ? 128  TYR A CD1 1 
ATOM   998  C  CD2 . TYR A 1  128 ? 32.097 24.565  30.078  1.00 18.51 ? 128  TYR A CD2 1 
ATOM   999  C  CE1 . TYR A 1  128 ? 31.973 24.383  27.300  1.00 17.52 ? 128  TYR A CE1 1 
ATOM   1000 C  CE2 . TYR A 1  128 ? 33.052 23.827  29.376  1.00 17.38 ? 128  TYR A CE2 1 
ATOM   1001 C  CZ  . TYR A 1  128 ? 32.979 23.743  27.993  1.00 18.89 ? 128  TYR A CZ  1 
ATOM   1002 O  OH  . TYR A 1  128 ? 33.931 23.016  27.312  1.00 19.06 ? 128  TYR A OH  1 
ATOM   1003 N  N   . ASP A 1  129 ? 28.590 29.264  30.537  1.00 20.67 ? 129  ASP A N   1 
ATOM   1004 C  CA  . ASP A 1  129 ? 27.854 30.041  31.522  1.00 20.73 ? 129  ASP A CA  1 
ATOM   1005 C  C   . ASP A 1  129 ? 26.353 29.931  31.232  1.00 20.70 ? 129  ASP A C   1 
ATOM   1006 O  O   . ASP A 1  129 ? 25.869 30.442  30.218  1.00 21.36 ? 129  ASP A O   1 
ATOM   1007 C  CB  . ASP A 1  129 ? 28.332 31.495  31.475  1.00 21.26 ? 129  ASP A CB  1 
ATOM   1008 C  CG  . ASP A 1  129 ? 27.792 32.332  32.616  1.00 22.03 ? 129  ASP A CG  1 
ATOM   1009 O  OD1 . ASP A 1  129 ? 26.761 31.960  33.208  1.00 21.06 ? 129  ASP A OD1 1 
ATOM   1010 O  OD2 . ASP A 1  129 ? 28.401 33.383  32.903  1.00 23.43 ? 129  ASP A OD2 1 
ATOM   1011 N  N   . GLY A 1  130 ? 25.621 29.261  32.117  1.00 19.83 ? 130  GLY A N   1 
ATOM   1012 C  CA  . GLY A 1  130 ? 24.196 28.959  31.871  1.00 19.78 ? 130  GLY A CA  1 
ATOM   1013 C  C   . GLY A 1  130 ? 23.204 30.090  32.148  1.00 20.31 ? 130  GLY A C   1 
ATOM   1014 O  O   . GLY A 1  130 ? 21.984 29.892  32.029  1.00 19.63 ? 130  GLY A O   1 
ATOM   1015 N  N   . LYS A 1  131 ? 23.707 31.285  32.480  1.00 20.48 ? 131  LYS A N   1 
ATOM   1016 C  CA  . LYS A 1  131 ? 22.815 32.393  32.892  1.00 21.71 ? 131  LYS A CA  1 
ATOM   1017 C  C   . LYS A 1  131 ? 21.958 32.951  31.740  1.00 21.60 ? 131  LYS A C   1 
ATOM   1018 O  O   . LYS A 1  131 ? 20.840 33.420  31.969  1.00 21.67 ? 131  LYS A O   1 
ATOM   1019 C  CB  . LYS A 1  131 ? 23.592 33.535  33.603  1.00 21.49 ? 131  LYS A CB  1 
ATOM   1020 C  CG  . LYS A 1  131 ? 24.483 34.372  32.686  1.00 22.04 ? 131  LYS A CG  1 
ATOM   1021 C  CD  . LYS A 1  131 ? 25.389 35.301  33.490  1.00 25.51 ? 131  LYS A CD  1 
ATOM   1022 C  CE  . LYS A 1  131 ? 26.007 36.389  32.622  1.00 24.72 ? 131  LYS A CE  1 
ATOM   1023 N  NZ  . LYS A 1  131 ? 27.028 37.147  33.418  1.00 27.39 ? 131  LYS A NZ  1 
ATOM   1024 N  N   . PHE A 1  132 ? 22.475 32.907  30.514  1.00 21.67 ? 132  PHE A N   1 
ATOM   1025 C  CA  . PHE A 1  132 ? 21.716 33.420  29.368  1.00 22.02 ? 132  PHE A CA  1 
ATOM   1026 C  C   . PHE A 1  132 ? 20.538 32.497  29.047  1.00 21.71 ? 132  PHE A C   1 
ATOM   1027 O  O   . PHE A 1  132 ? 19.434 32.963  28.777  1.00 21.43 ? 132  PHE A O   1 
ATOM   1028 C  CB  . PHE A 1  132 ? 22.624 33.621  28.134  1.00 22.63 ? 132  PHE A CB  1 
ATOM   1029 C  CG  . PHE A 1  132 ? 23.870 34.429  28.423  1.00 25.17 ? 132  PHE A CG  1 
ATOM   1030 C  CD1 . PHE A 1  132 ? 23.774 35.793  28.735  1.00 25.56 ? 132  PHE A CD1 1 
ATOM   1031 C  CD2 . PHE A 1  132 ? 25.127 33.828  28.419  1.00 24.77 ? 132  PHE A CD2 1 
ATOM   1032 C  CE1 . PHE A 1  132 ? 24.923 36.545  29.028  1.00 27.37 ? 132  PHE A CE1 1 
ATOM   1033 C  CE2 . PHE A 1  132 ? 26.288 34.577  28.693  1.00 27.77 ? 132  PHE A CE2 1 
ATOM   1034 C  CZ  . PHE A 1  132 ? 26.175 35.948  28.999  1.00 27.05 ? 132  PHE A CZ  1 
ATOM   1035 N  N   . LEU A 1  133 ? 20.781 31.187  29.066  1.00 21.15 ? 133  LEU A N   1 
ATOM   1036 C  CA  . LEU A 1  133 ? 19.726 30.212  28.814  1.00 21.29 ? 133  LEU A CA  1 
ATOM   1037 C  C   . LEU A 1  133 ? 18.585 30.341  29.829  1.00 21.86 ? 133  LEU A C   1 
ATOM   1038 O  O   . LEU A 1  133 ? 17.401 30.366  29.447  1.00 21.48 ? 133  LEU A O   1 
ATOM   1039 C  CB  . LEU A 1  133 ? 20.292 28.790  28.815  1.00 20.93 ? 133  LEU A CB  1 
ATOM   1040 C  CG  . LEU A 1  133 ? 21.036 28.389  27.544  1.00 21.66 ? 133  LEU A CG  1 
ATOM   1041 C  CD1 . LEU A 1  133 ? 21.974 27.198  27.828  1.00 19.86 ? 133  LEU A CD1 1 
ATOM   1042 C  CD2 . LEU A 1  133 ? 20.008 28.047  26.456  1.00 20.47 ? 133  LEU A CD2 1 
ATOM   1043 N  N   . ALA A 1  134 ? 18.949 30.451  31.107  1.00 21.96 ? 134  ALA A N   1 
ATOM   1044 C  CA  . ALA A 1  134 ? 17.972 30.622  32.168  1.00 23.28 ? 134  ALA A CA  1 
ATOM   1045 C  C   . ALA A 1  134 ? 17.146 31.882  31.910  1.00 23.83 ? 134  ALA A C   1 
ATOM   1046 O  O   . ALA A 1  134 ? 15.914 31.832  31.900  1.00 23.99 ? 134  ALA A O   1 
ATOM   1047 C  CB  . ALA A 1  134 ? 18.663 30.664  33.562  1.00 22.80 ? 134  ALA A CB  1 
ATOM   1048 N  N   . ARG A 1  135 ? 17.831 32.993  31.633  1.00 24.46 ? 135  ARG A N   1 
ATOM   1049 C  CA  . ARG A 1  135 ? 17.163 34.272  31.409  1.00 24.76 ? 135  ARG A CA  1 
ATOM   1050 C  C   . ARG A 1  135 ? 16.229 34.247  30.191  1.00 24.96 ? 135  ARG A C   1 
ATOM   1051 O  O   . ARG A 1  135 ? 15.061 34.667  30.268  1.00 25.96 ? 135  ARG A O   1 
ATOM   1052 C  CB  . ARG A 1  135 ? 18.214 35.378  31.241  1.00 24.75 ? 135  ARG A CB  1 
ATOM   1053 C  CG  . ARG A 1  135 ? 17.671 36.737  30.821  1.00 26.01 ? 135  ARG A CG  1 
ATOM   1054 C  CD  . ARG A 1  135 ? 16.843 37.410  31.924  1.00 29.70 ? 135  ARG A CD  1 
ATOM   1055 N  NE  . ARG A 1  135 ? 16.405 38.740  31.508  1.00 31.44 ? 135  ARG A NE  1 
ATOM   1056 C  CZ  . ARG A 1  135 ? 15.131 39.115  31.385  1.00 36.63 ? 135  ARG A CZ  1 
ATOM   1057 N  NH1 . ARG A 1  135 ? 14.144 38.272  31.678  1.00 37.17 ? 135  ARG A NH1 1 
ATOM   1058 N  NH2 . ARG A 1  135 ? 14.833 40.355  30.996  1.00 37.08 ? 135  ARG A NH2 1 
ATOM   1059 N  N   . VAL A 1  136 ? 16.759 33.768  29.070  1.00 24.13 ? 136  VAL A N   1 
ATOM   1060 C  CA  . VAL A 1  136 ? 16.100 33.892  27.788  1.00 23.82 ? 136  VAL A CA  1 
ATOM   1061 C  C   . VAL A 1  136 ? 15.007 32.845  27.594  1.00 23.30 ? 136  VAL A C   1 
ATOM   1062 O  O   . VAL A 1  136 ? 13.936 33.175  27.112  1.00 22.25 ? 136  VAL A O   1 
ATOM   1063 C  CB  . VAL A 1  136 ? 17.127 33.876  26.631  1.00 23.81 ? 136  VAL A CB  1 
ATOM   1064 C  CG1 . VAL A 1  136 ? 16.441 33.706  25.276  1.00 24.41 ? 136  VAL A CG1 1 
ATOM   1065 C  CG2 . VAL A 1  136 ? 17.948 35.158  26.659  1.00 23.41 ? 136  VAL A CG2 1 
ATOM   1066 N  N   . GLU A 1  137 ? 15.276 31.597  27.984  1.00 22.47 ? 137  GLU A N   1 
ATOM   1067 C  CA  . GLU A 1  137 ? 14.327 30.503  27.754  1.00 22.18 ? 137  GLU A CA  1 
ATOM   1068 C  C   . GLU A 1  137 ? 13.568 30.015  28.987  1.00 22.53 ? 137  GLU A C   1 
ATOM   1069 O  O   . GLU A 1  137 ? 12.683 29.148  28.880  1.00 21.59 ? 137  GLU A O   1 
ATOM   1070 C  CB  . GLU A 1  137 ? 15.036 29.332  27.052  1.00 22.13 ? 137  GLU A CB  1 
ATOM   1071 C  CG  . GLU A 1  137 ? 15.458 29.680  25.619  1.00 21.20 ? 137  GLU A CG  1 
ATOM   1072 C  CD  . GLU A 1  137 ? 14.275 29.948  24.675  1.00 23.36 ? 137  GLU A CD  1 
ATOM   1073 O  OE1 . GLU A 1  137 ? 13.193 29.367  24.893  1.00 24.38 ? 137  GLU A OE1 1 
ATOM   1074 O  OE2 . GLU A 1  137 ? 14.421 30.751  23.718  1.00 22.57 ? 137  GLU A OE2 1 
ATOM   1075 N  N   . ARG A 1  138 ? 13.914 30.571  30.152  1.00 22.19 ? 138  ARG A N   1 
ATOM   1076 C  CA  . ARG A 1  138 ? 13.316 30.179  31.434  1.00 22.80 ? 138  ARG A CA  1 
ATOM   1077 C  C   . ARG A 1  138 ? 13.451 28.674  31.683  1.00 22.53 ? 138  ARG A C   1 
ATOM   1078 O  O   . ARG A 1  138 ? 12.536 28.033  32.207  1.00 22.42 ? 138  ARG A O   1 
ATOM   1079 C  CB  . ARG A 1  138 ? 11.837 30.623  31.562  1.00 23.39 ? 138  ARG A CB  1 
ATOM   1080 C  CG  . ARG A 1  138 ? 11.479 31.971  30.923  1.00 27.64 ? 138  ARG A CG  1 
ATOM   1081 C  CD  . ARG A 1  138 ? 11.406 33.130  31.888  1.00 33.99 ? 138  ARG A CD  1 
ATOM   1082 N  NE  . ARG A 1  138 ? 10.769 32.787  33.164  1.00 38.60 ? 138  ARG A NE  1 
ATOM   1083 C  CZ  . ARG A 1  138 ? 10.952 33.471  34.297  1.00 38.69 ? 138  ARG A CZ  1 
ATOM   1084 N  NH1 . ARG A 1  138 ? 11.735 34.553  34.303  1.00 36.53 ? 138  ARG A NH1 1 
ATOM   1085 N  NH2 . ARG A 1  138 ? 10.355 33.074  35.421  1.00 36.90 ? 138  ARG A NH2 1 
ATOM   1086 N  N   . VAL A 1  139 ? 14.604 28.121  31.313  1.00 21.42 ? 139  VAL A N   1 
ATOM   1087 C  CA  . VAL A 1  139 ? 14.960 26.753  31.664  1.00 21.08 ? 139  VAL A CA  1 
ATOM   1088 C  C   . VAL A 1  139 ? 15.906 26.855  32.859  1.00 21.50 ? 139  VAL A C   1 
ATOM   1089 O  O   . VAL A 1  139 ? 16.484 27.912  33.085  1.00 21.60 ? 139  VAL A O   1 
ATOM   1090 C  CB  . VAL A 1  139 ? 15.652 26.002  30.478  1.00 21.26 ? 139  VAL A CB  1 
ATOM   1091 C  CG1 . VAL A 1  139 ? 14.658 25.819  29.310  1.00 21.00 ? 139  VAL A CG1 1 
ATOM   1092 C  CG2 . VAL A 1  139 ? 16.893 26.739  29.996  1.00 19.92 ? 139  VAL A CG2 1 
ATOM   1093 N  N   . ILE A 1  140 ? 16.036 25.777  33.627  1.00 21.08 ? 140  ILE A N   1 
ATOM   1094 C  CA  . ILE A 1  140 ? 17.081 25.669  34.629  1.00 20.92 ? 140  ILE A CA  1 
ATOM   1095 C  C   . ILE A 1  140 ? 18.294 25.019  33.952  1.00 20.96 ? 140  ILE A C   1 
ATOM   1096 O  O   . ILE A 1  140 ? 18.141 24.058  33.192  1.00 21.15 ? 140  ILE A O   1 
ATOM   1097 C  CB  . ILE A 1  140 ? 16.567 24.856  35.837  1.00 21.14 ? 140  ILE A CB  1 
ATOM   1098 C  CG1 . ILE A 1  140 ? 15.501 25.684  36.591  1.00 21.18 ? 140  ILE A CG1 1 
ATOM   1099 C  CG2 . ILE A 1  140 ? 17.733 24.360  36.728  1.00 21.15 ? 140  ILE A CG2 1 
ATOM   1100 C  CD1 . ILE A 1  140 ? 14.930 25.029  37.811  1.00 20.95 ? 140  ILE A CD1 1 
ATOM   1101 N  N   . VAL A 1  141 ? 19.488 25.564  34.179  1.00 20.94 ? 141  VAL A N   1 
ATOM   1102 C  CA  . VAL A 1  141 ? 20.713 24.954  33.652  1.00 20.59 ? 141  VAL A CA  1 
ATOM   1103 C  C   . VAL A 1  141 ? 21.563 24.415  34.813  1.00 20.93 ? 141  VAL A C   1 
ATOM   1104 O  O   . VAL A 1  141 ? 21.773 25.113  35.816  1.00 20.40 ? 141  VAL A O   1 
ATOM   1105 C  CB  . VAL A 1  141 ? 21.528 25.960  32.808  1.00 20.70 ? 141  VAL A CB  1 
ATOM   1106 C  CG1 . VAL A 1  141 ? 22.804 25.304  32.209  1.00 20.70 ? 141  VAL A CG1 1 
ATOM   1107 C  CG2 . VAL A 1  141 ? 20.656 26.528  31.695  1.00 20.67 ? 141  VAL A CG2 1 
ATOM   1108 N  N   . VAL A 1  142 ? 22.028 23.173  34.671  1.00 20.32 ? 142  VAL A N   1 
ATOM   1109 C  CA  . VAL A 1  142 ? 22.903 22.524  35.657  1.00 19.93 ? 142  VAL A CA  1 
ATOM   1110 C  C   . VAL A 1  142 ? 24.163 22.081  34.916  1.00 20.29 ? 142  VAL A C   1 
ATOM   1111 O  O   . VAL A 1  142 ? 24.100 21.707  33.738  1.00 19.01 ? 142  VAL A O   1 
ATOM   1112 C  CB  . VAL A 1  142 ? 22.221 21.306  36.350  1.00 19.74 ? 142  VAL A CB  1 
ATOM   1113 C  CG1 . VAL A 1  142 ? 23.165 20.626  37.397  1.00 19.61 ? 142  VAL A CG1 1 
ATOM   1114 C  CG2 . VAL A 1  142 ? 20.924 21.723  37.022  1.00 20.10 ? 142  VAL A CG2 1 
ATOM   1115 N  N   . SER A 1  143 ? 25.312 22.184  35.588  1.00 19.91 ? 143  SER A N   1 
ATOM   1116 C  CA  . SER A 1  143 ? 26.544 21.626  35.054  1.00 20.31 ? 143  SER A CA  1 
ATOM   1117 C  C   . SER A 1  143 ? 27.370 21.113  36.232  1.00 20.43 ? 143  SER A C   1 
ATOM   1118 O  O   . SER A 1  143 ? 27.266 21.649  37.321  1.00 20.89 ? 143  SER A O   1 
ATOM   1119 C  CB  . SER A 1  143 ? 27.304 22.667  34.231  1.00 19.38 ? 143  SER A CB  1 
ATOM   1120 O  OG  . SER A 1  143 ? 27.682 23.790  35.025  1.00 21.20 ? 143  SER A OG  1 
ATOM   1121 N  N   . MET A 1  144 ? 28.158 20.061  36.015  1.00 20.53 ? 144  MET A N   1 
ATOM   1122 C  CA  . MET A 1  144 ? 28.975 19.492  37.085  1.00 19.95 ? 144  MET A CA  1 
ATOM   1123 C  C   . MET A 1  144 ? 30.435 19.360  36.672  1.00 20.03 ? 144  MET A C   1 
ATOM   1124 O  O   . MET A 1  144 ? 30.751 19.245  35.479  1.00 19.59 ? 144  MET A O   1 
ATOM   1125 C  CB  . MET A 1  144 ? 28.444 18.118  37.536  1.00 19.64 ? 144  MET A CB  1 
ATOM   1126 C  CG  . MET A 1  144 ? 28.885 16.910  36.669  1.00 19.20 ? 144  MET A CG  1 
ATOM   1127 S  SD  . MET A 1  144 ? 28.321 16.976  34.942  1.00 18.74 ? 144  MET A SD  1 
ATOM   1128 C  CE  . MET A 1  144 ? 26.575 16.542  35.062  1.00 18.13 ? 144  MET A CE  1 
ATOM   1129 N  N   . ASN A 1  145 ? 31.315 19.364  37.679  1.00 19.38 ? 145  ASN A N   1 
ATOM   1130 C  CA  . ASN A 1  145 ? 32.687 18.916  37.472  1.00 19.85 ? 145  ASN A CA  1 
ATOM   1131 C  C   . ASN A 1  145 ? 32.719 17.437  37.734  1.00 19.56 ? 145  ASN A C   1 
ATOM   1132 O  O   . ASN A 1  145 ? 32.077 16.964  38.676  1.00 20.01 ? 145  ASN A O   1 
ATOM   1133 C  CB  . ASN A 1  145 ? 33.662 19.674  38.387  1.00 18.72 ? 145  ASN A CB  1 
ATOM   1134 C  CG  . ASN A 1  145 ? 33.784 21.123  37.999  1.00 19.11 ? 145  ASN A CG  1 
ATOM   1135 O  OD1 . ASN A 1  145 ? 33.268 21.527  36.955  1.00 18.73 ? 145  ASN A OD1 1 
ATOM   1136 N  ND2 . ASN A 1  145 ? 34.434 21.926  38.839  1.00 20.04 ? 145  ASN A ND2 1 
ATOM   1137 N  N   . TYR A 1  146 ? 33.406 16.708  36.856  1.00 19.48 ? 146  TYR A N   1 
ATOM   1138 C  CA  . TYR A 1  146 ? 33.602 15.275  37.023  1.00 19.24 ? 146  TYR A CA  1 
ATOM   1139 C  C   . TYR A 1  146 ? 35.096 14.985  36.848  1.00 19.19 ? 146  TYR A C   1 
ATOM   1140 O  O   . TYR A 1  146 ? 35.788 15.715  36.146  1.00 18.85 ? 146  TYR A O   1 
ATOM   1141 C  CB  . TYR A 1  146 ? 32.742 14.476  36.032  1.00 18.81 ? 146  TYR A CB  1 
ATOM   1142 C  CG  . TYR A 1  146 ? 33.064 14.716  34.564  1.00 17.73 ? 146  TYR A CG  1 
ATOM   1143 C  CD1 . TYR A 1  146 ? 34.027 13.950  33.914  1.00 17.78 ? 146  TYR A CD1 1 
ATOM   1144 C  CD2 . TYR A 1  146 ? 32.406 15.711  33.835  1.00 19.24 ? 146  TYR A CD2 1 
ATOM   1145 C  CE1 . TYR A 1  146 ? 34.338 14.161  32.577  1.00 18.66 ? 146  TYR A CE1 1 
ATOM   1146 C  CE2 . TYR A 1  146 ? 32.700 15.926  32.464  1.00 19.60 ? 146  TYR A CE2 1 
ATOM   1147 C  CZ  . TYR A 1  146 ? 33.662 15.142  31.855  1.00 18.07 ? 146  TYR A CZ  1 
ATOM   1148 O  OH  . TYR A 1  146 ? 33.992 15.342  30.533  1.00 20.98 ? 146  TYR A OH  1 
ATOM   1149 N  N   . ARG A 1  147 ? 35.589 13.941  37.514  1.00 18.99 ? 147  ARG A N   1 
ATOM   1150 C  CA  . ARG A 1  147 ? 37.009 13.597  37.447  1.00 18.62 ? 147  ARG A CA  1 
ATOM   1151 C  C   . ARG A 1  147 ? 37.426 13.223  36.023  1.00 19.07 ? 147  ARG A C   1 
ATOM   1152 O  O   . ARG A 1  147 ? 36.673 12.566  35.292  1.00 18.35 ? 147  ARG A O   1 
ATOM   1153 C  CB  . ARG A 1  147 ? 37.340 12.463  38.422  1.00 17.93 ? 147  ARG A CB  1 
ATOM   1154 C  CG  . ARG A 1  147 ? 37.299 12.883  39.886  1.00 18.96 ? 147  ARG A CG  1 
ATOM   1155 C  CD  . ARG A 1  147 ? 37.436 11.661  40.790  1.00 16.87 ? 147  ARG A CD  1 
ATOM   1156 N  NE  . ARG A 1  147 ? 36.153 10.976  40.957  1.00 18.12 ? 147  ARG A NE  1 
ATOM   1157 C  CZ  . ARG A 1  147 ? 35.981 9.818   41.606  1.00 19.45 ? 147  ARG A CZ  1 
ATOM   1158 N  NH1 . ARG A 1  147 ? 37.017 9.174   42.173  1.00 19.79 ? 147  ARG A NH1 1 
ATOM   1159 N  NH2 . ARG A 1  147 ? 34.759 9.312   41.716  1.00 16.33 ? 147  ARG A NH2 1 
ATOM   1160 N  N   . VAL A 1  148 ? 38.629 13.662  35.648  1.00 18.55 ? 148  VAL A N   1 
ATOM   1161 C  CA  . VAL A 1  148 ? 39.190 13.437  34.332  1.00 18.24 ? 148  VAL A CA  1 
ATOM   1162 C  C   . VAL A 1  148 ? 40.584 12.802  34.457  1.00 18.71 ? 148  VAL A C   1 
ATOM   1163 O  O   . VAL A 1  148 ? 41.139 12.731  35.560  1.00 17.57 ? 148  VAL A O   1 
ATOM   1164 C  CB  . VAL A 1  148 ? 39.239 14.743  33.484  1.00 17.91 ? 148  VAL A CB  1 
ATOM   1165 C  CG1 . VAL A 1  148 ? 37.827 15.155  33.037  1.00 17.34 ? 148  VAL A CG1 1 
ATOM   1166 C  CG2 . VAL A 1  148 ? 39.962 15.891  34.242  1.00 18.10 ? 148  VAL A CG2 1 
ATOM   1167 N  N   . GLY A 1  149 ? 41.136 12.341  33.331  1.00 18.55 ? 149  GLY A N   1 
ATOM   1168 C  CA  . GLY A 1  149 ? 42.409 11.626  33.336  1.00 19.03 ? 149  GLY A CA  1 
ATOM   1169 C  C   . GLY A 1  149 ? 42.418 10.348  34.154  1.00 19.45 ? 149  GLY A C   1 
ATOM   1170 O  O   . GLY A 1  149 ? 41.365 9.729   34.366  1.00 19.68 ? 149  GLY A O   1 
ATOM   1171 N  N   . ALA A 1  150 ? 43.602 9.953   34.633  1.00 18.99 ? 150  ALA A N   1 
ATOM   1172 C  CA  . ALA A 1  150 ? 43.730 8.759   35.464  1.00 19.28 ? 150  ALA A CA  1 
ATOM   1173 C  C   . ALA A 1  150 ? 42.856 8.852   36.714  1.00 19.17 ? 150  ALA A C   1 
ATOM   1174 O  O   . ALA A 1  150 ? 42.263 7.867   37.136  1.00 18.92 ? 150  ALA A O   1 
ATOM   1175 C  CB  . ALA A 1  150 ? 45.210 8.507   35.858  1.00 18.94 ? 150  ALA A CB  1 
ATOM   1176 N  N   . LEU A 1  151 ? 42.777 10.033  37.311  1.00 19.07 ? 151  LEU A N   1 
ATOM   1177 C  CA  . LEU A 1  151 ? 41.991 10.183  38.537  1.00 19.72 ? 151  LEU A CA  1 
ATOM   1178 C  C   . LEU A 1  151 ? 40.509 9.896   38.311  1.00 19.93 ? 151  LEU A C   1 
ATOM   1179 O  O   . LEU A 1  151 ? 39.800 9.510   39.236  1.00 20.06 ? 151  LEU A O   1 
ATOM   1180 C  CB  . LEU A 1  151 ? 42.186 11.580  39.154  1.00 19.45 ? 151  LEU A CB  1 
ATOM   1181 C  CG  . LEU A 1  151 ? 43.552 11.832  39.805  1.00 20.01 ? 151  LEU A CG  1 
ATOM   1182 C  CD1 . LEU A 1  151 ? 43.690 13.302  40.137  1.00 19.76 ? 151  LEU A CD1 1 
ATOM   1183 C  CD2 . LEU A 1  151 ? 43.753 10.983  41.059  1.00 18.75 ? 151  LEU A CD2 1 
ATOM   1184 N  N   . GLY A 1  152 ? 40.047 10.087  37.076  1.00 19.90 ? 152  GLY A N   1 
ATOM   1185 C  CA  . GLY A 1  152 ? 38.649 9.810   36.717  1.00 19.72 ? 152  GLY A CA  1 
ATOM   1186 C  C   . GLY A 1  152 ? 38.424 8.498   35.981  1.00 20.23 ? 152  GLY A C   1 
ATOM   1187 O  O   . GLY A 1  152 ? 37.308 7.993   35.936  1.00 20.21 ? 152  GLY A O   1 
ATOM   1188 N  N   . PHE A 1  153 ? 39.464 7.946   35.376  1.00 20.41 ? 153  PHE A N   1 
ATOM   1189 C  CA  . PHE A 1  153 ? 39.232 6.837   34.446  1.00 21.17 ? 153  PHE A CA  1 
ATOM   1190 C  C   . PHE A 1  153 ? 40.202 5.657   34.522  1.00 21.81 ? 153  PHE A C   1 
ATOM   1191 O  O   . PHE A 1  153 ? 40.058 4.686   33.780  1.00 22.10 ? 153  PHE A O   1 
ATOM   1192 C  CB  . PHE A 1  153 ? 39.077 7.377   33.013  1.00 20.65 ? 153  PHE A CB  1 
ATOM   1193 C  CG  . PHE A 1  153 ? 37.811 8.182   32.815  1.00 19.93 ? 153  PHE A CG  1 
ATOM   1194 C  CD1 . PHE A 1  153 ? 36.600 7.538   32.567  1.00 18.61 ? 153  PHE A CD1 1 
ATOM   1195 C  CD2 . PHE A 1  153 ? 37.824 9.582   32.920  1.00 19.47 ? 153  PHE A CD2 1 
ATOM   1196 C  CE1 . PHE A 1  153 ? 35.403 8.280   32.412  1.00 18.99 ? 153  PHE A CE1 1 
ATOM   1197 C  CE2 . PHE A 1  153 ? 36.624 10.347  32.768  1.00 18.60 ? 153  PHE A CE2 1 
ATOM   1198 C  CZ  . PHE A 1  153 ? 35.419 9.690   32.517  1.00 18.15 ? 153  PHE A CZ  1 
ATOM   1199 N  N   . LEU A 1  154 ? 41.189 5.735   35.415  1.00 23.08 ? 154  LEU A N   1 
ATOM   1200 C  CA  . LEU A 1  154 ? 42.080 4.597   35.648  1.00 24.04 ? 154  LEU A CA  1 
ATOM   1201 C  C   . LEU A 1  154 ? 41.254 3.318   35.878  1.00 25.30 ? 154  LEU A C   1 
ATOM   1202 O  O   . LEU A 1  154 ? 40.283 3.322   36.643  1.00 24.41 ? 154  LEU A O   1 
ATOM   1203 C  CB  . LEU A 1  154 ? 42.970 4.853   36.868  1.00 24.33 ? 154  LEU A CB  1 
ATOM   1204 C  CG  . LEU A 1  154 ? 44.051 3.817   37.167  1.00 24.30 ? 154  LEU A CG  1 
ATOM   1205 C  CD1 . LEU A 1  154 ? 45.382 4.321   36.655  1.00 25.65 ? 154  LEU A CD1 1 
ATOM   1206 C  CD2 . LEU A 1  154 ? 44.125 3.578   38.667  1.00 26.19 ? 154  LEU A CD2 1 
ATOM   1207 N  N   . ALA A 1  155 ? 41.642 2.234   35.211  1.00 26.49 ? 155  ALA A N   1 
ATOM   1208 C  CA  . ALA A 1  155 ? 40.882 0.995   35.274  1.00 28.80 ? 155  ALA A CA  1 
ATOM   1209 C  C   . ALA A 1  155 ? 41.783 -0.218  35.418  1.00 30.64 ? 155  ALA A C   1 
ATOM   1210 O  O   . ALA A 1  155 ? 42.740 -0.396  34.655  1.00 30.28 ? 155  ALA A O   1 
ATOM   1211 C  CB  . ALA A 1  155 ? 39.976 0.835   34.045  1.00 28.41 ? 155  ALA A CB  1 
ATOM   1212 N  N   . LEU A 1  156 ? 41.464 -1.011  36.437  1.00 33.30 ? 156  LEU A N   1 
ATOM   1213 C  CA  . LEU A 1  156 ? 41.992 -2.344  36.634  1.00 36.21 ? 156  LEU A CA  1 
ATOM   1214 C  C   . LEU A 1  156 ? 40.704 -3.165  36.766  1.00 38.06 ? 156  LEU A C   1 
ATOM   1215 O  O   . LEU A 1  156 ? 40.206 -3.372  37.874  1.00 38.64 ? 156  LEU A O   1 
ATOM   1216 C  CB  . LEU A 1  156 ? 42.832 -2.359  37.912  1.00 36.70 ? 156  LEU A CB  1 
ATOM   1217 C  CG  . LEU A 1  156 ? 44.204 -3.028  37.885  1.00 37.42 ? 156  LEU A CG  1 
ATOM   1218 C  CD1 . LEU A 1  156 ? 44.895 -2.828  36.549  1.00 38.63 ? 156  LEU A CD1 1 
ATOM   1219 C  CD2 . LEU A 1  156 ? 45.044 -2.478  39.017  1.00 39.45 ? 156  LEU A CD2 1 
ATOM   1220 N  N   . PRO A 1  157 ? 40.137 -3.603  35.618  1.00 39.54 ? 157  PRO A N   1 
ATOM   1221 C  CA  . PRO A 1  157 ? 38.722 -4.017  35.494  1.00 40.35 ? 157  PRO A CA  1 
ATOM   1222 C  C   . PRO A 1  157 ? 38.251 -5.063  36.513  1.00 40.73 ? 157  PRO A C   1 
ATOM   1223 O  O   . PRO A 1  157 ? 38.920 -6.081  36.722  1.00 40.70 ? 157  PRO A O   1 
ATOM   1224 C  CB  . PRO A 1  157 ? 38.640 -4.582  34.066  1.00 40.71 ? 157  PRO A CB  1 
ATOM   1225 C  CG  . PRO A 1  157 ? 39.820 -3.971  33.347  1.00 40.73 ? 157  PRO A CG  1 
ATOM   1226 C  CD  . PRO A 1  157 ? 40.896 -3.873  34.382  1.00 39.77 ? 157  PRO A CD  1 
ATOM   1227 N  N   . GLY A 1  158 ? 37.104 -4.792  37.135  1.00 40.83 ? 158  GLY A N   1 
ATOM   1228 C  CA  . GLY A 1  158 ? 36.513 -5.693  38.123  1.00 40.99 ? 158  GLY A CA  1 
ATOM   1229 C  C   . GLY A 1  158 ? 36.928 -5.438  39.563  1.00 40.91 ? 158  GLY A C   1 
ATOM   1230 O  O   . GLY A 1  158 ? 36.352 -6.016  40.488  1.00 41.17 ? 158  GLY A O   1 
ATOM   1231 N  N   . ASN A 1  159 ? 37.915 -4.559  39.745  1.00 40.60 ? 159  ASN A N   1 
ATOM   1232 C  CA  . ASN A 1  159 ? 38.478 -4.231  41.057  1.00 39.81 ? 159  ASN A CA  1 
ATOM   1233 C  C   . ASN A 1  159 ? 37.904 -2.915  41.602  1.00 39.22 ? 159  ASN A C   1 
ATOM   1234 O  O   . ASN A 1  159 ? 38.217 -1.839  41.081  1.00 39.26 ? 159  ASN A O   1 
ATOM   1235 C  CB  . ASN A 1  159 ? 40.000 -4.145  40.933  1.00 40.03 ? 159  ASN A CB  1 
ATOM   1236 C  CG  . ASN A 1  159 ? 40.690 -3.838  42.245  1.00 40.44 ? 159  ASN A CG  1 
ATOM   1237 O  OD1 . ASN A 1  159 ? 40.088 -3.307  43.180  1.00 40.90 ? 159  ASN A OD1 1 
ATOM   1238 N  ND2 . ASN A 1  159 ? 41.975 -4.158  42.314  1.00 40.65 ? 159  ASN A ND2 1 
ATOM   1239 N  N   . PRO A 1  160 ? 37.083 -2.990  42.671  1.00 38.29 ? 160  PRO A N   1 
ATOM   1240 C  CA  . PRO A 1  160 ? 36.397 -1.795  43.187  1.00 37.45 ? 160  PRO A CA  1 
ATOM   1241 C  C   . PRO A 1  160 ? 37.336 -0.680  43.703  1.00 36.41 ? 160  PRO A C   1 
ATOM   1242 O  O   . PRO A 1  160 ? 36.873 0.441   43.982  1.00 36.40 ? 160  PRO A O   1 
ATOM   1243 C  CB  . PRO A 1  160 ? 35.520 -2.350  44.316  1.00 37.49 ? 160  PRO A CB  1 
ATOM   1244 C  CG  . PRO A 1  160 ? 36.216 -3.591  44.757  1.00 38.11 ? 160  PRO A CG  1 
ATOM   1245 C  CD  . PRO A 1  160 ? 36.848 -4.173  43.522  1.00 38.30 ? 160  PRO A CD  1 
ATOM   1246 N  N   . GLU A 1  161 ? 38.631 -0.978  43.817  1.00 35.14 ? 161  GLU A N   1 
ATOM   1247 C  CA  . GLU A 1  161 ? 39.627 0.038   44.189  1.00 34.04 ? 161  GLU A CA  1 
ATOM   1248 C  C   . GLU A 1  161 ? 39.962 0.963   43.015  1.00 32.38 ? 161  GLU A C   1 
ATOM   1249 O  O   . GLU A 1  161 ? 40.330 2.117   43.226  1.00 31.75 ? 161  GLU A O   1 
ATOM   1250 C  CB  . GLU A 1  161 ? 40.909 -0.597  44.758  1.00 34.47 ? 161  GLU A CB  1 
ATOM   1251 C  CG  . GLU A 1  161 ? 40.671 -1.602  45.887  1.00 36.72 ? 161  GLU A CG  1 
ATOM   1252 C  CD  . GLU A 1  161 ? 39.996 -0.983  47.108  1.00 41.43 ? 161  GLU A CD  1 
ATOM   1253 O  OE1 . GLU A 1  161 ? 40.268 0.196   47.422  1.00 43.30 ? 161  GLU A OE1 1 
ATOM   1254 O  OE2 . GLU A 1  161 ? 39.195 -1.679  47.771  1.00 43.78 ? 161  GLU A OE2 1 
ATOM   1255 N  N   . ALA A 1  162 ? 39.829 0.440   41.796  1.00 30.76 ? 162  ALA A N   1 
ATOM   1256 C  CA  . ALA A 1  162 ? 40.000 1.213   40.555  1.00 29.49 ? 162  ALA A CA  1 
ATOM   1257 C  C   . ALA A 1  162 ? 39.189 0.564   39.418  1.00 27.85 ? 162  ALA A C   1 
ATOM   1258 O  O   . ALA A 1  162 ? 39.752 -0.059  38.513  1.00 27.54 ? 162  ALA A O   1 
ATOM   1259 C  CB  . ALA A 1  162 ? 41.493 1.303   40.178  1.00 29.82 ? 162  ALA A CB  1 
ATOM   1260 N  N   . PRO A 1  163 ? 37.857 0.695   39.470  1.00 26.76 ? 163  PRO A N   1 
ATOM   1261 C  CA  . PRO A 1  163 ? 37.039 -0.091  38.555  1.00 25.75 ? 163  PRO A CA  1 
ATOM   1262 C  C   . PRO A 1  163 ? 36.890 0.530   37.160  1.00 25.14 ? 163  PRO A C   1 
ATOM   1263 O  O   . PRO A 1  163 ? 36.329 -0.112  36.274  1.00 25.49 ? 163  PRO A O   1 
ATOM   1264 C  CB  . PRO A 1  163 ? 35.693 -0.134  39.267  1.00 25.56 ? 163  PRO A CB  1 
ATOM   1265 C  CG  . PRO A 1  163 ? 35.604 1.193   39.935  1.00 26.58 ? 163  PRO A CG  1 
ATOM   1266 C  CD  . PRO A 1  163 ? 37.029 1.529   40.366  1.00 26.81 ? 163  PRO A CD  1 
ATOM   1267 N  N   . GLY A 1  164 ? 37.386 1.754   36.967  1.00 23.54 ? 164  GLY A N   1 
ATOM   1268 C  CA  . GLY A 1  164 ? 37.146 2.485   35.725  1.00 22.15 ? 164  GLY A CA  1 
ATOM   1269 C  C   . GLY A 1  164 ? 35.853 3.287   35.775  1.00 21.14 ? 164  GLY A C   1 
ATOM   1270 O  O   . GLY A 1  164 ? 35.029 3.103   36.681  1.00 21.15 ? 164  GLY A O   1 
ATOM   1271 N  N   . ASN A 1  165 ? 35.706 4.214   34.831  1.00 20.08 ? 165  ASN A N   1 
ATOM   1272 C  CA  . ASN A 1  165 ? 34.484 5.004   34.656  1.00 19.60 ? 165  ASN A CA  1 
ATOM   1273 C  C   . ASN A 1  165 ? 34.081 5.891   35.830  1.00 18.94 ? 165  ASN A C   1 
ATOM   1274 O  O   . ASN A 1  165 ? 32.933 6.284   35.927  1.00 17.13 ? 165  ASN A O   1 
ATOM   1275 C  CB  . ASN A 1  165 ? 33.301 4.090   34.277  1.00 19.35 ? 165  ASN A CB  1 
ATOM   1276 C  CG  . ASN A 1  165 ? 33.480 3.481   32.934  1.00 20.20 ? 165  ASN A CG  1 
ATOM   1277 O  OD1 . ASN A 1  165 ? 34.315 3.949   32.143  1.00 18.93 ? 165  ASN A OD1 1 
ATOM   1278 N  ND2 . ASN A 1  165 ? 32.711 2.432   32.644  1.00 18.28 ? 165  ASN A ND2 1 
ATOM   1279 N  N   . MET A 1  166 ? 35.015 6.207   36.720  1.00 18.92 ? 166  MET A N   1 
ATOM   1280 C  CA  . MET A 1  166 ? 34.657 7.007   37.893  1.00 19.16 ? 166  MET A CA  1 
ATOM   1281 C  C   . MET A 1  166 ? 34.080 8.371   37.499  1.00 18.66 ? 166  MET A C   1 
ATOM   1282 O  O   . MET A 1  166 ? 33.126 8.845   38.107  1.00 19.19 ? 166  MET A O   1 
ATOM   1283 C  CB  . MET A 1  166 ? 35.870 7.160   38.830  1.00 19.39 ? 166  MET A CB  1 
ATOM   1284 C  CG  . MET A 1  166 ? 36.391 5.825   39.360  1.00 20.01 ? 166  MET A CG  1 
ATOM   1285 S  SD  . MET A 1  166 ? 37.472 4.929   38.207  1.00 22.12 ? 166  MET A SD  1 
ATOM   1286 C  CE  . MET A 1  166 ? 39.016 5.857   38.336  1.00 17.94 ? 166  MET A CE  1 
ATOM   1287 N  N   . GLY A 1  167 ? 34.665 8.995   36.478  1.00 19.10 ? 167  GLY A N   1 
ATOM   1288 C  CA  . GLY A 1  167 ? 34.196 10.302  35.990  1.00 18.35 ? 167  GLY A CA  1 
ATOM   1289 C  C   . GLY A 1  167 ? 32.768 10.217  35.455  1.00 18.62 ? 167  GLY A C   1 
ATOM   1290 O  O   . GLY A 1  167 ? 31.986 11.150  35.603  1.00 17.79 ? 167  GLY A O   1 
ATOM   1291 N  N   . LEU A 1  168 ? 32.427 9.084   34.841  1.00 18.63 ? 168  LEU A N   1 
ATOM   1292 C  CA  . LEU A 1  168 ? 31.047 8.857   34.388  1.00 18.87 ? 168  LEU A CA  1 
ATOM   1293 C  C   . LEU A 1  168 ? 30.070 8.653   35.558  1.00 19.09 ? 168  LEU A C   1 
ATOM   1294 O  O   . LEU A 1  168 ? 28.928 9.117   35.491  1.00 17.80 ? 168  LEU A O   1 
ATOM   1295 C  CB  . LEU A 1  168 ? 30.977 7.686   33.403  1.00 18.90 ? 168  LEU A CB  1 
ATOM   1296 C  CG  . LEU A 1  168 ? 31.566 7.981   32.014  1.00 19.50 ? 168  LEU A CG  1 
ATOM   1297 C  CD1 . LEU A 1  168 ? 31.789 6.673   31.240  1.00 18.34 ? 168  LEU A CD1 1 
ATOM   1298 C  CD2 . LEU A 1  168 ? 30.672 8.915   31.208  1.00 19.01 ? 168  LEU A CD2 1 
ATOM   1299 N  N   . PHE A 1  169 ? 30.518 7.947   36.611  1.00 18.76 ? 169  PHE A N   1 
ATOM   1300 C  CA  . PHE A 1  169 ? 29.744 7.854   37.847  1.00 19.52 ? 169  PHE A CA  1 
ATOM   1301 C  C   . PHE A 1  169 ? 29.618 9.188   38.605  1.00 19.25 ? 169  PHE A C   1 
ATOM   1302 O  O   . PHE A 1  169 ? 28.602 9.434   39.258  1.00 19.38 ? 169  PHE A O   1 
ATOM   1303 C  CB  . PHE A 1  169 ? 30.299 6.762   38.763  1.00 19.61 ? 169  PHE A CB  1 
ATOM   1304 C  CG  . PHE A 1  169 ? 29.863 5.382   38.374  1.00 21.00 ? 169  PHE A CG  1 
ATOM   1305 C  CD1 . PHE A 1  169 ? 30.784 4.466   37.871  1.00 22.69 ? 169  PHE A CD1 1 
ATOM   1306 C  CD2 . PHE A 1  169 ? 28.524 5.002   38.498  1.00 20.71 ? 169  PHE A CD2 1 
ATOM   1307 C  CE1 . PHE A 1  169 ? 30.369 3.172   37.506  1.00 24.64 ? 169  PHE A CE1 1 
ATOM   1308 C  CE2 . PHE A 1  169 ? 28.101 3.712   38.133  1.00 23.26 ? 169  PHE A CE2 1 
ATOM   1309 C  CZ  . PHE A 1  169 ? 29.031 2.802   37.634  1.00 23.17 ? 169  PHE A CZ  1 
ATOM   1310 N  N   . ASP A 1  170 ? 30.644 10.039  38.523  1.00 18.43 ? 170  ASP A N   1 
ATOM   1311 C  CA  . ASP A 1  170 ? 30.508 11.420  39.009  1.00 18.04 ? 170  ASP A CA  1 
ATOM   1312 C  C   . ASP A 1  170 ? 29.333 12.091  38.299  1.00 17.80 ? 170  ASP A C   1 
ATOM   1313 O  O   . ASP A 1  170 ? 28.432 12.629  38.937  1.00 17.52 ? 170  ASP A O   1 
ATOM   1314 C  CB  . ASP A 1  170 ? 31.791 12.239  38.782  1.00 16.74 ? 170  ASP A CB  1 
ATOM   1315 C  CG  . ASP A 1  170 ? 32.976 11.714  39.583  1.00 17.54 ? 170  ASP A CG  1 
ATOM   1316 O  OD1 . ASP A 1  170 ? 32.796 10.904  40.518  1.00 18.44 ? 170  ASP A OD1 1 
ATOM   1317 O  OD2 . ASP A 1  170 ? 34.104 12.116  39.279  1.00 16.33 ? 170  ASP A OD2 1 
ATOM   1318 N  N   . GLN A 1  171 ? 29.346 12.058  36.967  1.00 18.17 ? 171  GLN A N   1 
ATOM   1319 C  CA  . GLN A 1  171 ? 28.240 12.625  36.210  1.00 18.58 ? 171  GLN A CA  1 
ATOM   1320 C  C   . GLN A 1  171 ? 26.909 12.030  36.653  1.00 18.36 ? 171  GLN A C   1 
ATOM   1321 O  O   . GLN A 1  171 ? 25.929 12.749  36.851  1.00 18.62 ? 171  GLN A O   1 
ATOM   1322 C  CB  . GLN A 1  171 ? 28.409 12.390  34.717  1.00 18.48 ? 171  GLN A CB  1 
ATOM   1323 C  CG  . GLN A 1  171 ? 29.591 13.116  34.092  1.00 19.49 ? 171  GLN A CG  1 
ATOM   1324 C  CD  . GLN A 1  171 ? 29.884 12.584  32.720  1.00 20.16 ? 171  GLN A CD  1 
ATOM   1325 O  OE1 . GLN A 1  171 ? 29.008 11.972  32.086  1.00 19.54 ? 171  GLN A OE1 1 
ATOM   1326 N  NE2 . GLN A 1  171 ? 31.114 12.805  32.240  1.00 18.81 ? 171  GLN A NE2 1 
ATOM   1327 N  N   . GLN A 1  172 ? 26.870 10.720  36.786  1.00 18.79 ? 172  GLN A N   1 
ATOM   1328 C  CA  . GLN A 1  172 ? 25.617 10.049  37.104  1.00 19.56 ? 172  GLN A CA  1 
ATOM   1329 C  C   . GLN A 1  172 ? 25.097 10.468  38.478  1.00 19.74 ? 172  GLN A C   1 
ATOM   1330 O  O   . GLN A 1  172 ? 23.886 10.651  38.678  1.00 19.28 ? 172  GLN A O   1 
ATOM   1331 C  CB  . GLN A 1  172 ? 25.805 8.532   37.033  1.00 19.50 ? 172  GLN A CB  1 
ATOM   1332 C  CG  . GLN A 1  172 ? 24.483 7.780   37.045  1.00 20.68 ? 172  GLN A CG  1 
ATOM   1333 C  CD  . GLN A 1  172 ? 24.687 6.284   37.040  1.00 22.68 ? 172  GLN A CD  1 
ATOM   1334 O  OE1 . GLN A 1  172 ? 24.606 5.624   35.987  1.00 23.45 ? 172  GLN A OE1 1 
ATOM   1335 N  NE2 . GLN A 1  172 ? 24.982 5.745   38.192  1.00 20.81 ? 172  GLN A NE2 1 
ATOM   1336 N  N   . LEU A 1  173 ? 26.019 10.650  39.425  1.00 19.90 ? 173  LEU A N   1 
ATOM   1337 C  CA  . LEU A 1  173 ? 25.628 11.080  40.756  1.00 19.44 ? 173  LEU A CA  1 
ATOM   1338 C  C   . LEU A 1  173 ? 25.113 12.519  40.750  1.00 19.35 ? 173  LEU A C   1 
ATOM   1339 O  O   . LEU A 1  173 ? 24.194 12.847  41.505  1.00 19.48 ? 173  LEU A O   1 
ATOM   1340 C  CB  . LEU A 1  173 ? 26.772 10.882  41.767  1.00 19.63 ? 173  LEU A CB  1 
ATOM   1341 C  CG  . LEU A 1  173 ? 26.483 11.114  43.256  1.00 20.12 ? 173  LEU A CG  1 
ATOM   1342 C  CD1 . LEU A 1  173 ? 25.313 10.246  43.799  1.00 21.35 ? 173  LEU A CD1 1 
ATOM   1343 C  CD2 . LEU A 1  173 ? 27.742 10.859  44.053  1.00 19.89 ? 173  LEU A CD2 1 
ATOM   1344 N  N   . ALA A 1  174 ? 25.696 13.391  39.925  1.00 18.96 ? 174  ALA A N   1 
ATOM   1345 C  CA  . ALA A 1  174 ? 25.091 14.718  39.696  1.00 18.83 ? 174  ALA A CA  1 
ATOM   1346 C  C   . ALA A 1  174 ? 23.681 14.638  39.080  1.00 19.04 ? 174  ALA A C   1 
ATOM   1347 O  O   . ALA A 1  174 ? 22.797 15.426  39.425  1.00 18.27 ? 174  ALA A O   1 
ATOM   1348 C  CB  . ALA A 1  174 ? 25.997 15.608  38.836  1.00 19.05 ? 174  ALA A CB  1 
ATOM   1349 N  N   . LEU A 1  175 ? 23.470 13.719  38.144  1.00 19.82 ? 175  LEU A N   1 
ATOM   1350 C  CA  . LEU A 1  175 ? 22.108 13.524  37.601  1.00 20.53 ? 175  LEU A CA  1 
ATOM   1351 C  C   . LEU A 1  175 ? 21.138 13.089  38.720  1.00 20.52 ? 175  LEU A C   1 
ATOM   1352 O  O   . LEU A 1  175 ? 20.014 13.564  38.782  1.00 20.35 ? 175  LEU A O   1 
ATOM   1353 C  CB  . LEU A 1  175 ? 22.102 12.513  36.448  1.00 20.87 ? 175  LEU A CB  1 
ATOM   1354 C  CG  . LEU A 1  175 ? 23.065 12.712  35.262  1.00 22.46 ? 175  LEU A CG  1 
ATOM   1355 C  CD1 . LEU A 1  175 ? 22.722 11.741  34.136  1.00 20.10 ? 175  LEU A CD1 1 
ATOM   1356 C  CD2 . LEU A 1  175 ? 23.115 14.166  34.763  1.00 21.69 ? 175  LEU A CD2 1 
ATOM   1357 N  N   . GLN A 1  176 ? 21.596 12.204  39.605  1.00 21.50 ? 176  GLN A N   1 
ATOM   1358 C  CA  . GLN A 1  176 ? 20.817 11.772  40.767  1.00 22.79 ? 176  GLN A CA  1 
ATOM   1359 C  C   . GLN A 1  176 ? 20.473 12.960  41.677  1.00 22.25 ? 176  GLN A C   1 
ATOM   1360 O  O   . GLN A 1  176 ? 19.324 13.084  42.101  1.00 22.38 ? 176  GLN A O   1 
ATOM   1361 C  CB  . GLN A 1  176 ? 21.568 10.712  41.582  1.00 24.35 ? 176  GLN A CB  1 
ATOM   1362 C  CG  . GLN A 1  176 ? 21.629 9.329   40.960  1.00 29.32 ? 176  GLN A CG  1 
ATOM   1363 C  CD  . GLN A 1  176 ? 22.249 8.285   41.882  1.00 36.67 ? 176  GLN A CD  1 
ATOM   1364 O  OE1 . GLN A 1  176 ? 22.128 8.363   43.115  1.00 41.11 ? 176  GLN A OE1 1 
ATOM   1365 N  NE2 . GLN A 1  176 ? 22.904 7.293   41.290  1.00 38.46 ? 176  GLN A NE2 1 
ATOM   1366 N  N   . TRP A 1  177 ? 21.462 13.823  41.954  1.00 21.59 ? 177  TRP A N   1 
ATOM   1367 C  CA  . TRP A 1  177 ? 21.262 15.042  42.759  1.00 21.47 ? 177  TRP A CA  1 
ATOM   1368 C  C   . TRP A 1  177 ? 20.115 15.877  42.166  1.00 21.73 ? 177  TRP A C   1 
ATOM   1369 O  O   . TRP A 1  177 ? 19.214 16.323  42.884  1.00 21.49 ? 177  TRP A O   1 
ATOM   1370 C  CB  . TRP A 1  177 ? 22.553 15.877  42.860  1.00 21.83 ? 177  TRP A CB  1 
ATOM   1371 C  CG  . TRP A 1  177 ? 22.415 17.097  43.753  1.00 21.83 ? 177  TRP A CG  1 
ATOM   1372 C  CD1 . TRP A 1  177 ? 22.738 17.179  45.077  1.00 23.03 ? 177  TRP A CD1 1 
ATOM   1373 C  CD2 . TRP A 1  177 ? 21.906 18.387  43.384  1.00 21.54 ? 177  TRP A CD2 1 
ATOM   1374 N  NE1 . TRP A 1  177 ? 22.456 18.434  45.559  1.00 22.84 ? 177  TRP A NE1 1 
ATOM   1375 C  CE2 . TRP A 1  177 ? 21.946 19.198  44.543  1.00 22.68 ? 177  TRP A CE2 1 
ATOM   1376 C  CE3 . TRP A 1  177 ? 21.419 18.938  42.185  1.00 21.30 ? 177  TRP A CE3 1 
ATOM   1377 C  CZ2 . TRP A 1  177 ? 21.505 20.527  44.548  1.00 21.56 ? 177  TRP A CZ2 1 
ATOM   1378 C  CZ3 . TRP A 1  177 ? 20.993 20.256  42.177  1.00 21.53 ? 177  TRP A CZ3 1 
ATOM   1379 C  CH2 . TRP A 1  177 ? 21.032 21.043  43.364  1.00 22.48 ? 177  TRP A CH2 1 
ATOM   1380 N  N   . VAL A 1  178 ? 20.161 16.084  40.855  1.00 21.65 ? 178  VAL A N   1 
ATOM   1381 C  CA  . VAL A 1  178 ? 19.088 16.763  40.139  1.00 21.75 ? 178  VAL A CA  1 
ATOM   1382 C  C   . VAL A 1  178 ? 17.735 16.076  40.351  1.00 22.02 ? 178  VAL A C   1 
ATOM   1383 O  O   . VAL A 1  178 ? 16.775 16.729  40.754  1.00 22.65 ? 178  VAL A O   1 
ATOM   1384 C  CB  . VAL A 1  178 ? 19.427 16.951  38.621  1.00 21.58 ? 178  VAL A CB  1 
ATOM   1385 C  CG1 . VAL A 1  178 ? 18.213 17.448  37.857  1.00 20.12 ? 178  VAL A CG1 1 
ATOM   1386 C  CG2 . VAL A 1  178 ? 20.548 17.967  38.458  1.00 20.25 ? 178  VAL A CG2 1 
ATOM   1387 N  N   . GLN A 1  179 ? 17.659 14.765  40.138  1.00 22.79 ? 179  GLN A N   1 
ATOM   1388 C  CA  . GLN A 1  179 ? 16.394 14.048  40.377  1.00 23.22 ? 179  GLN A CA  1 
ATOM   1389 C  C   . GLN A 1  179 ? 15.836 14.345  41.774  1.00 24.05 ? 179  GLN A C   1 
ATOM   1390 O  O   . GLN A 1  179 ? 14.645 14.656  41.929  1.00 23.88 ? 179  GLN A O   1 
ATOM   1391 C  CB  . GLN A 1  179 ? 16.555 12.535  40.153  1.00 23.05 ? 179  GLN A CB  1 
ATOM   1392 C  CG  . GLN A 1  179 ? 16.639 12.137  38.664  1.00 23.01 ? 179  GLN A CG  1 
ATOM   1393 C  CD  . GLN A 1  179 ? 15.426 12.621  37.869  1.00 23.39 ? 179  GLN A CD  1 
ATOM   1394 O  OE1 . GLN A 1  179 ? 14.331 12.091  38.014  1.00 24.24 ? 179  GLN A OE1 1 
ATOM   1395 N  NE2 . GLN A 1  179 ? 15.616 13.645  37.051  1.00 22.16 ? 179  GLN A NE2 1 
ATOM   1396 N  N   . LYS A 1  180 ? 16.718 14.286  42.771  1.00 24.37 ? 180  LYS A N   1 
ATOM   1397 C  CA  . LYS A 1  180 ? 16.343 14.425  44.174  1.00 25.25 ? 180  LYS A CA  1 
ATOM   1398 C  C   . LYS A 1  180 ? 16.092 15.867  44.634  1.00 24.74 ? 180  LYS A C   1 
ATOM   1399 O  O   . LYS A 1  180 ? 15.296 16.095  45.557  1.00 23.91 ? 180  LYS A O   1 
ATOM   1400 C  CB  . LYS A 1  180 ? 17.420 13.794  45.055  1.00 25.91 ? 180  LYS A CB  1 
ATOM   1401 C  CG  . LYS A 1  180 ? 17.560 12.277  44.905  1.00 28.51 ? 180  LYS A CG  1 
ATOM   1402 C  CD  . LYS A 1  180 ? 18.443 11.745  46.040  1.00 34.34 ? 180  LYS A CD  1 
ATOM   1403 C  CE  . LYS A 1  180 ? 18.924 10.314  45.793  1.00 37.80 ? 180  LYS A CE  1 
ATOM   1404 N  NZ  . LYS A 1  180 ? 19.413 9.668   47.059  1.00 39.63 ? 180  LYS A NZ  1 
ATOM   1405 N  N   . ASN A 1  181 ? 16.748 16.833  43.987  1.00 24.01 ? 181  ASN A N   1 
ATOM   1406 C  CA  . ASN A 1  181 ? 16.790 18.199  44.516  1.00 23.96 ? 181  ASN A CA  1 
ATOM   1407 C  C   . ASN A 1  181 ? 16.210 19.298  43.644  1.00 23.60 ? 181  ASN A C   1 
ATOM   1408 O  O   . ASN A 1  181 ? 15.872 20.362  44.153  1.00 23.59 ? 181  ASN A O   1 
ATOM   1409 C  CB  . ASN A 1  181 ? 18.223 18.579  44.918  1.00 23.76 ? 181  ASN A CB  1 
ATOM   1410 C  CG  . ASN A 1  181 ? 18.734 17.737  46.061  1.00 25.52 ? 181  ASN A CG  1 
ATOM   1411 O  OD1 . ASN A 1  181 ? 18.330 17.925  47.215  1.00 26.80 ? 181  ASN A OD1 1 
ATOM   1412 N  ND2 . ASN A 1  181 ? 19.600 16.780  45.750  1.00 25.23 ? 181  ASN A ND2 1 
ATOM   1413 N  N   . ILE A 1  182 ? 16.075 19.061  42.344  1.00 23.11 ? 182  ILE A N   1 
ATOM   1414 C  CA  . ILE A 1  182 ? 15.750 20.178  41.447  1.00 22.63 ? 182  ILE A CA  1 
ATOM   1415 C  C   . ILE A 1  182 ? 14.342 20.771  41.638  1.00 22.91 ? 182  ILE A C   1 
ATOM   1416 O  O   . ILE A 1  182 ? 14.120 21.935  41.311  1.00 22.99 ? 182  ILE A O   1 
ATOM   1417 C  CB  . ILE A 1  182 ? 16.046 19.854  39.963  1.00 22.49 ? 182  ILE A CB  1 
ATOM   1418 C  CG1 . ILE A 1  182 ? 16.496 21.112  39.199  1.00 21.85 ? 182  ILE A CG1 1 
ATOM   1419 C  CG2 . ILE A 1  182 ? 14.858 19.148  39.302  1.00 21.58 ? 182  ILE A CG2 1 
ATOM   1420 C  CD1 . ILE A 1  182 ? 17.912 21.555  39.535  1.00 22.78 ? 182  ILE A CD1 1 
ATOM   1421 N  N   . ALA A 1  183 ? 13.403 19.973  42.149  1.00 23.03 ? 183  ALA A N   1 
ATOM   1422 C  CA  . ALA A 1  183 ? 12.044 20.465  42.415  1.00 23.38 ? 183  ALA A CA  1 
ATOM   1423 C  C   . ALA A 1  183 ? 12.112 21.612  43.413  1.00 23.66 ? 183  ALA A C   1 
ATOM   1424 O  O   . ALA A 1  183 ? 11.391 22.599  43.281  1.00 24.02 ? 183  ALA A O   1 
ATOM   1425 C  CB  . ALA A 1  183 ? 11.126 19.347  42.930  1.00 22.81 ? 183  ALA A CB  1 
ATOM   1426 N  N   . ALA A 1  184 ? 13.011 21.498  44.384  1.00 23.76 ? 184  ALA A N   1 
ATOM   1427 C  CA  . ALA A 1  184 ? 13.214 22.559  45.375  1.00 23.99 ? 184  ALA A CA  1 
ATOM   1428 C  C   . ALA A 1  184 ? 13.575 23.900  44.724  1.00 23.92 ? 184  ALA A C   1 
ATOM   1429 O  O   . ALA A 1  184 ? 13.279 24.960  45.276  1.00 24.50 ? 184  ALA A O   1 
ATOM   1430 C  CB  . ALA A 1  184 ? 14.263 22.144  46.385  1.00 23.96 ? 184  ALA A CB  1 
ATOM   1431 N  N   . PHE A 1  185 ? 14.169 23.842  43.532  1.00 23.74 ? 185  PHE A N   1 
ATOM   1432 C  CA  . PHE A 1  185 ? 14.648 25.027  42.808  1.00 23.60 ? 185  PHE A CA  1 
ATOM   1433 C  C   . PHE A 1  185 ? 13.662 25.456  41.725  1.00 23.54 ? 185  PHE A C   1 
ATOM   1434 O  O   . PHE A 1  185 ? 13.921 26.403  40.988  1.00 23.36 ? 185  PHE A O   1 
ATOM   1435 C  CB  . PHE A 1  185 ? 15.989 24.731  42.127  1.00 23.80 ? 185  PHE A CB  1 
ATOM   1436 C  CG  . PHE A 1  185 ? 17.130 24.539  43.075  1.00 23.44 ? 185  PHE A CG  1 
ATOM   1437 C  CD1 . PHE A 1  185 ? 17.335 23.312  43.701  1.00 19.99 ? 185  PHE A CD1 1 
ATOM   1438 C  CD2 . PHE A 1  185 ? 18.016 25.591  43.330  1.00 24.44 ? 185  PHE A CD2 1 
ATOM   1439 C  CE1 . PHE A 1  185 ? 18.409 23.119  44.570  1.00 20.96 ? 185  PHE A CE1 1 
ATOM   1440 C  CE2 . PHE A 1  185 ? 19.085 25.421  44.223  1.00 24.03 ? 185  PHE A CE2 1 
ATOM   1441 C  CZ  . PHE A 1  185 ? 19.284 24.178  44.841  1.00 22.63 ? 185  PHE A CZ  1 
ATOM   1442 N  N   . GLY A 1  186 ? 12.542 24.747  41.636  1.00 23.25 ? 186  GLY A N   1 
ATOM   1443 C  CA  . GLY A 1  186 ? 11.492 25.068  40.684  1.00 22.94 ? 186  GLY A CA  1 
ATOM   1444 C  C   . GLY A 1  186 ? 11.642 24.260  39.409  1.00 23.13 ? 186  GLY A C   1 
ATOM   1445 O  O   . GLY A 1  186 ? 11.038 24.587  38.393  1.00 23.43 ? 186  GLY A O   1 
ATOM   1446 N  N   . GLY A 1  187 ? 12.462 23.212  39.465  1.00 22.84 ? 187  GLY A N   1 
ATOM   1447 C  CA  . GLY A 1  187 ? 12.750 22.402  38.286  1.00 22.10 ? 187  GLY A CA  1 
ATOM   1448 C  C   . GLY A 1  187 ? 11.870 21.180  38.221  1.00 22.07 ? 187  GLY A C   1 
ATOM   1449 O  O   . GLY A 1  187 ? 11.370 20.716  39.233  1.00 21.88 ? 187  GLY A O   1 
ATOM   1450 N  N   . ASN A 1  188 ? 11.672 20.674  37.010  1.00 21.72 ? 188  ASN A N   1 
ATOM   1451 C  CA  . ASN A 1  188 ? 10.932 19.443  36.770  1.00 21.73 ? 188  ASN A CA  1 
ATOM   1452 C  C   . ASN A 1  188 ? 11.884 18.267  36.557  1.00 21.75 ? 188  ASN A C   1 
ATOM   1453 O  O   . ASN A 1  188 ? 12.464 18.139  35.474  1.00 21.75 ? 188  ASN A O   1 
ATOM   1454 C  CB  . ASN A 1  188 ? 10.071 19.618  35.515  1.00 21.62 ? 188  ASN A CB  1 
ATOM   1455 C  CG  . ASN A 1  188 ? 9.139  18.439  35.264  1.00 21.29 ? 188  ASN A CG  1 
ATOM   1456 O  OD1 . ASN A 1  188 ? 9.104  17.478  36.027  1.00 20.70 ? 188  ASN A OD1 1 
ATOM   1457 N  ND2 . ASN A 1  188 ? 8.373  18.523  34.191  1.00 20.65 ? 188  ASN A ND2 1 
ATOM   1458 N  N   . PRO A 1  189 ? 12.033 17.387  37.570  1.00 21.62 ? 189  PRO A N   1 
ATOM   1459 C  CA  . PRO A 1  189 ? 12.909 16.227  37.354  1.00 22.03 ? 189  PRO A CA  1 
ATOM   1460 C  C   . PRO A 1  189 ? 12.427 15.294  36.227  1.00 22.12 ? 189  PRO A C   1 
ATOM   1461 O  O   . PRO A 1  189 ? 13.224 14.530  35.699  1.00 22.12 ? 189  PRO A O   1 
ATOM   1462 C  CB  . PRO A 1  189 ? 12.912 15.510  38.721  1.00 21.87 ? 189  PRO A CB  1 
ATOM   1463 C  CG  . PRO A 1  189 ? 11.654 15.919  39.377  1.00 21.73 ? 189  PRO A CG  1 
ATOM   1464 C  CD  . PRO A 1  189 ? 11.329 17.319  38.865  1.00 21.78 ? 189  PRO A CD  1 
ATOM   1465 N  N   . LYS A 1  190 ? 11.149 15.384  35.838  1.00 22.32 ? 190  LYS A N   1 
ATOM   1466 C  CA  . LYS A 1  190 ? 10.634 14.581  34.728  1.00 21.72 ? 190  LYS A CA  1 
ATOM   1467 C  C   . LYS A 1  190 ? 10.922 15.207  33.358  1.00 21.57 ? 190  LYS A C   1 
ATOM   1468 O  O   . LYS A 1  190 ? 10.559 14.641  32.321  1.00 20.54 ? 190  LYS A O   1 
ATOM   1469 C  CB  . LYS A 1  190 ? 9.130  14.334  34.886  1.00 22.61 ? 190  LYS A CB  1 
ATOM   1470 C  CG  . LYS A 1  190 ? 8.776  13.508  36.127  1.00 23.63 ? 190  LYS A CG  1 
ATOM   1471 C  CD  . LYS A 1  190 ? 7.257  13.252  36.182  1.00 26.55 ? 190  LYS A CD  1 
ATOM   1472 C  CE  . LYS A 1  190 ? 6.857  12.751  37.562  1.00 30.27 ? 190  LYS A CE  1 
ATOM   1473 N  NZ  . LYS A 1  190 ? 5.372  12.573  37.683  1.00 33.80 ? 190  LYS A NZ  1 
ATOM   1474 N  N   . SER A 1  191 ? 11.557 16.379  33.348  1.00 20.30 ? 191  SER A N   1 
ATOM   1475 C  CA  . SER A 1  191 ? 11.897 17.015  32.080  1.00 19.86 ? 191  SER A CA  1 
ATOM   1476 C  C   . SER A 1  191 ? 13.345 17.471  32.105  1.00 19.73 ? 191  SER A C   1 
ATOM   1477 O  O   . SER A 1  191 ? 13.640 18.654  32.313  1.00 19.99 ? 191  SER A O   1 
ATOM   1478 C  CB  . SER A 1  191 ? 10.974 18.193  31.806  1.00 19.66 ? 191  SER A CB  1 
ATOM   1479 O  OG  . SER A 1  191 ? 11.170 18.678  30.487  1.00 18.63 ? 191  SER A OG  1 
ATOM   1480 N  N   . VAL A 1  192 ? 14.241 16.512  31.912  1.00 18.96 ? 192  VAL A N   1 
ATOM   1481 C  CA  . VAL A 1  192 ? 15.675 16.764  32.024  1.00 18.75 ? 192  VAL A CA  1 
ATOM   1482 C  C   . VAL A 1  192 ? 16.328 16.358  30.716  1.00 18.30 ? 192  VAL A C   1 
ATOM   1483 O  O   . VAL A 1  192 ? 16.192 15.223  30.271  1.00 18.24 ? 192  VAL A O   1 
ATOM   1484 C  CB  . VAL A 1  192 ? 16.307 15.967  33.218  1.00 18.69 ? 192  VAL A CB  1 
ATOM   1485 C  CG1 . VAL A 1  192 ? 17.854 16.031  33.175  1.00 18.02 ? 192  VAL A CG1 1 
ATOM   1486 C  CG2 . VAL A 1  192 ? 15.811 16.506  34.521  1.00 18.75 ? 192  VAL A CG2 1 
ATOM   1487 N  N   . THR A 1  193 ? 17.047 17.291  30.107  1.00 18.35 ? 193  THR A N   1 
ATOM   1488 C  CA  . THR A 1  193 ? 17.787 17.005  28.881  1.00 17.73 ? 193  THR A CA  1 
ATOM   1489 C  C   . THR A 1  193 ? 19.291 17.117  29.141  1.00 17.62 ? 193  THR A C   1 
ATOM   1490 O  O   . THR A 1  193 ? 19.756 18.147  29.632  1.00 16.69 ? 193  THR A O   1 
ATOM   1491 C  CB  . THR A 1  193 ? 17.352 17.993  27.776  1.00 17.82 ? 193  THR A CB  1 
ATOM   1492 O  OG1 . THR A 1  193 ? 16.005 17.691  27.399  1.00 19.10 ? 193  THR A OG1 1 
ATOM   1493 C  CG2 . THR A 1  193 ? 18.244 17.913  26.541  1.00 16.76 ? 193  THR A CG2 1 
ATOM   1494 N  N   . LEU A 1  194 ? 20.043 16.059  28.820  1.00 17.51 ? 194  LEU A N   1 
ATOM   1495 C  CA  . LEU A 1  194 ? 21.503 16.124  28.896  1.00 17.33 ? 194  LEU A CA  1 
ATOM   1496 C  C   . LEU A 1  194 ? 22.005 16.760  27.619  1.00 17.51 ? 194  LEU A C   1 
ATOM   1497 O  O   . LEU A 1  194 ? 21.447 16.508  26.539  1.00 17.35 ? 194  LEU A O   1 
ATOM   1498 C  CB  . LEU A 1  194 ? 22.142 14.730  29.065  1.00 17.00 ? 194  LEU A CB  1 
ATOM   1499 C  CG  . LEU A 1  194 ? 21.551 13.798  30.132  1.00 16.64 ? 194  LEU A CG  1 
ATOM   1500 C  CD1 . LEU A 1  194 ? 22.345 12.492  30.156  1.00 16.87 ? 194  LEU A CD1 1 
ATOM   1501 C  CD2 . LEU A 1  194 ? 21.530 14.470  31.503  1.00 16.53 ? 194  LEU A CD2 1 
ATOM   1502 N  N   . PHE A 1  195 ? 23.013 17.624  27.740  1.00 17.02 ? 195  PHE A N   1 
ATOM   1503 C  CA  . PHE A 1  195 ? 23.727 18.121  26.540  1.00 17.42 ? 195  PHE A CA  1 
ATOM   1504 C  C   . PHE A 1  195 ? 25.193 18.239  26.843  1.00 17.80 ? 195  PHE A C   1 
ATOM   1505 O  O   . PHE A 1  195 ? 25.567 18.440  28.001  1.00 18.08 ? 195  PHE A O   1 
ATOM   1506 C  CB  . PHE A 1  195 ? 23.098 19.378  25.875  1.00 16.80 ? 195  PHE A CB  1 
ATOM   1507 C  CG  . PHE A 1  195 ? 23.202 20.705  26.665  1.00 17.89 ? 195  PHE A CG  1 
ATOM   1508 C  CD1 . PHE A 1  195 ? 22.947 20.785  28.024  1.00 18.22 ? 195  PHE A CD1 1 
ATOM   1509 C  CD2 . PHE A 1  195 ? 23.476 21.896  25.968  1.00 17.26 ? 195  PHE A CD2 1 
ATOM   1510 C  CE1 . PHE A 1  195 ? 23.000 22.038  28.700  1.00 19.01 ? 195  PHE A CE1 1 
ATOM   1511 C  CE2 . PHE A 1  195 ? 23.543 23.136  26.615  1.00 17.57 ? 195  PHE A CE2 1 
ATOM   1512 C  CZ  . PHE A 1  195 ? 23.302 23.211  27.996  1.00 17.75 ? 195  PHE A CZ  1 
ATOM   1513 N  N   . GLY A 1  196 ? 26.023 18.029  25.820  1.00 18.04 ? 196  GLY A N   1 
ATOM   1514 C  CA  . GLY A 1  196 ? 27.469 18.022  26.003  1.00 17.54 ? 196  GLY A CA  1 
ATOM   1515 C  C   . GLY A 1  196 ? 28.150 18.099  24.657  1.00 18.20 ? 196  GLY A C   1 
ATOM   1516 O  O   . GLY A 1  196 ? 27.511 17.880  23.612  1.00 17.32 ? 196  GLY A O   1 
ATOM   1517 N  N   . GLU A 1  197 ? 29.441 18.416  24.672  1.00 17.03 ? 197  GLU A N   1 
ATOM   1518 C  CA  . GLU A 1  197 ? 30.177 18.571  23.444  1.00 17.20 ? 197  GLU A CA  1 
ATOM   1519 C  C   . GLU A 1  197 ? 31.449 17.742  23.513  1.00 17.51 ? 197  GLU A C   1 
ATOM   1520 O  O   . GLU A 1  197 ? 32.058 17.628  24.584  1.00 18.75 ? 197  GLU A O   1 
ATOM   1521 C  CB  . GLU A 1  197 ? 30.447 20.071  23.137  1.00 16.81 ? 197  GLU A CB  1 
ATOM   1522 C  CG  . GLU A 1  197 ? 31.221 20.329  21.807  1.00 16.94 ? 197  GLU A CG  1 
ATOM   1523 C  CD  . GLU A 1  197 ? 32.743 20.333  21.966  1.00 20.48 ? 197  GLU A CD  1 
ATOM   1524 O  OE1 . GLU A 1  197 ? 33.213 20.228  23.119  1.00 20.12 ? 197  GLU A OE1 1 
ATOM   1525 O  OE2 . GLU A 1  197 ? 33.458 20.476  20.949  1.00 22.14 ? 197  GLU A OE2 1 
ATOM   1526 N  N   . SER A 1  198 ? 31.819 17.146  22.379  1.00 17.61 ? 198  SER A N   1 
ATOM   1527 C  CA  . SER A 1  198 ? 33.020 16.316  22.259  1.00 17.53 ? 198  SER A CA  1 
ATOM   1528 C  C   . SER A 1  198 ? 32.966 15.151  23.263  1.00 17.93 ? 198  SER A C   1 
ATOM   1529 O  O   . SER A 1  198 ? 32.012 14.339  23.213  1.00 17.63 ? 198  SER A O   1 
ATOM   1530 C  CB  . SER A 1  198 ? 34.282 17.187  22.385  1.00 17.73 ? 198  SER A CB  1 
ATOM   1531 O  OG  . SER A 1  198 ? 35.408 16.503  21.854  1.00 20.25 ? 198  SER A OG  1 
ATOM   1532 N  N   . ALA A 1  199 ? 33.916 15.071  24.202  1.00 16.75 ? 199  ALA A N   1 
ATOM   1533 C  CA  . ALA A 1  199 ? 33.844 14.033  25.255  1.00 17.17 ? 199  ALA A CA  1 
ATOM   1534 C  C   . ALA A 1  199 ? 32.571 14.121  26.136  1.00 16.70 ? 199  ALA A C   1 
ATOM   1535 O  O   . ALA A 1  199 ? 32.098 13.109  26.692  1.00 16.08 ? 199  ALA A O   1 
ATOM   1536 C  CB  . ALA A 1  199 ? 35.112 14.070  26.144  1.00 16.91 ? 199  ALA A CB  1 
ATOM   1537 N  N   . GLY A 1  200 ? 32.051 15.340  26.287  1.00 16.82 ? 200  GLY A N   1 
ATOM   1538 C  CA  . GLY A 1  200 ? 30.764 15.560  26.954  1.00 16.86 ? 200  GLY A CA  1 
ATOM   1539 C  C   . GLY A 1  200 ? 29.626 14.894  26.170  1.00 16.86 ? 200  GLY A C   1 
ATOM   1540 O  O   . GLY A 1  200 ? 28.700 14.324  26.752  1.00 16.72 ? 200  GLY A O   1 
ATOM   1541 N  N   . ALA A 1  201 ? 29.686 15.000  24.851  1.00 16.93 ? 201  ALA A N   1 
ATOM   1542 C  CA  . ALA A 1  201 ? 28.685 14.375  23.948  1.00 16.74 ? 201  ALA A CA  1 
ATOM   1543 C  C   . ALA A 1  201 ? 28.844 12.863  23.950  1.00 17.21 ? 201  ALA A C   1 
ATOM   1544 O  O   . ALA A 1  201 ? 27.844 12.125  23.989  1.00 17.44 ? 201  ALA A O   1 
ATOM   1545 C  CB  . ALA A 1  201 ? 28.832 14.934  22.511  1.00 16.21 ? 201  ALA A CB  1 
ATOM   1546 N  N   . ALA A 1  202 ? 30.095 12.392  23.947  1.00 17.02 ? 202  ALA A N   1 
ATOM   1547 C  CA  . ALA A 1  202 ? 30.351 10.963  24.094  1.00 17.78 ? 202  ALA A CA  1 
ATOM   1548 C  C   . ALA A 1  202 ? 29.738 10.483  25.421  1.00 18.31 ? 202  ALA A C   1 
ATOM   1549 O  O   . ALA A 1  202 ? 29.076 9.438   25.470  1.00 17.67 ? 202  ALA A O   1 
ATOM   1550 C  CB  . ALA A 1  202 ? 31.853 10.677  24.059  1.00 18.18 ? 202  ALA A CB  1 
ATOM   1551 N  N   . SER A 1  203 ? 29.934 11.269  26.482  1.00 18.06 ? 203  SER A N   1 
ATOM   1552 C  CA  . SER A 1  203 ? 29.393 10.942  27.802  1.00 18.33 ? 203  SER A CA  1 
ATOM   1553 C  C   . SER A 1  203 ? 27.859 10.843  27.760  1.00 18.59 ? 203  SER A C   1 
ATOM   1554 O  O   . SER A 1  203 ? 27.288 9.886   28.273  1.00 18.54 ? 203  SER A O   1 
ATOM   1555 C  CB  . SER A 1  203 ? 29.798 12.014  28.838  1.00 18.31 ? 203  SER A CB  1 
ATOM   1556 O  OG  . SER A 1  203 ? 31.192 12.008  29.073  1.00 18.84 ? 203  SER A OG  1 
ATOM   1557 N  N   . VAL A 1  204 ? 27.211 11.849  27.168  1.00 18.38 ? 204  VAL A N   1 
ATOM   1558 C  CA  . VAL A 1  204 ? 25.753 11.851  27.023  1.00 18.72 ? 204  VAL A CA  1 
ATOM   1559 C  C   . VAL A 1  204 ? 25.312 10.538  26.333  1.00 19.07 ? 204  VAL A C   1 
ATOM   1560 O  O   . VAL A 1  204 ? 24.377 9.875   26.811  1.00 19.16 ? 204  VAL A O   1 
ATOM   1561 C  CB  . VAL A 1  204 ? 25.241 13.088  26.215  1.00 18.98 ? 204  VAL A CB  1 
ATOM   1562 C  CG1 . VAL A 1  204 ? 23.783 12.900  25.774  1.00 18.39 ? 204  VAL A CG1 1 
ATOM   1563 C  CG2 . VAL A 1  204 ? 25.405 14.394  26.999  1.00 18.91 ? 204  VAL A CG2 1 
ATOM   1564 N  N   . SER A 1  205 ? 25.991 10.170  25.236  1.00 17.96 ? 205  SER A N   1 
ATOM   1565 C  CA  . SER A 1  205 ? 25.654 8.937   24.511  1.00 18.44 ? 205  SER A CA  1 
ATOM   1566 C  C   . SER A 1  205 ? 25.795 7.678   25.372  1.00 18.47 ? 205  SER A C   1 
ATOM   1567 O  O   . SER A 1  205 ? 25.025 6.719   25.192  1.00 18.33 ? 205  SER A O   1 
ATOM   1568 C  CB  . SER A 1  205 ? 26.445 8.817   23.198  1.00 17.54 ? 205  SER A CB  1 
ATOM   1569 O  OG  . SER A 1  205 ? 27.813 8.508   23.418  1.00 19.14 ? 205  SER A OG  1 
ATOM   1570 N  N   . LEU A 1  206 ? 26.740 7.692   26.324  1.00 18.08 ? 206  LEU A N   1 
ATOM   1571 C  CA  . LEU A 1  206 ? 26.952 6.541   27.224  1.00 18.54 ? 206  LEU A CA  1 
ATOM   1572 C  C   . LEU A 1  206 ? 25.891 6.468   28.312  1.00 18.02 ? 206  LEU A C   1 
ATOM   1573 O  O   . LEU A 1  206 ? 25.501 5.376   28.726  1.00 18.27 ? 206  LEU A O   1 
ATOM   1574 C  CB  . LEU A 1  206 ? 28.367 6.533   27.829  1.00 18.50 ? 206  LEU A CB  1 
ATOM   1575 C  CG  . LEU A 1  206 ? 29.524 6.264   26.848  1.00 20.00 ? 206  LEU A CG  1 
ATOM   1576 C  CD1 . LEU A 1  206 ? 30.878 6.556   27.499  1.00 21.68 ? 206  LEU A CD1 1 
ATOM   1577 C  CD2 . LEU A 1  206 ? 29.497 4.846   26.291  1.00 19.46 ? 206  LEU A CD2 1 
ATOM   1578 N  N   . HIS A 1  207 ? 25.400 7.626   28.750  1.00 17.93 ? 207  HIS A N   1 
ATOM   1579 C  CA  . HIS A 1  207 ? 24.245 7.648   29.653  1.00 18.37 ? 207  HIS A CA  1 
ATOM   1580 C  C   . HIS A 1  207 ? 23.004 7.076   28.964  1.00 18.92 ? 207  HIS A C   1 
ATOM   1581 O  O   . HIS A 1  207 ? 22.162 6.476   29.638  1.00 18.84 ? 207  HIS A O   1 
ATOM   1582 C  CB  . HIS A 1  207 ? 23.971 9.059   30.178  1.00 17.89 ? 207  HIS A CB  1 
ATOM   1583 C  CG  . HIS A 1  207 ? 24.999 9.541   31.160  1.00 18.13 ? 207  HIS A CG  1 
ATOM   1584 N  ND1 . HIS A 1  207 ? 25.103 9.035   32.440  1.00 15.36 ? 207  HIS A ND1 1 
ATOM   1585 C  CD2 . HIS A 1  207 ? 25.960 10.489  31.047  1.00 17.02 ? 207  HIS A CD2 1 
ATOM   1586 C  CE1 . HIS A 1  207 ? 26.096 9.642   33.067  1.00 19.78 ? 207  HIS A CE1 1 
ATOM   1587 N  NE2 . HIS A 1  207 ? 26.634 10.530  32.243  1.00 19.10 ? 207  HIS A NE2 1 
ATOM   1588 N  N   . LEU A 1  208 ? 22.888 7.271   27.644  1.00 18.70 ? 208  LEU A N   1 
ATOM   1589 C  CA  . LEU A 1  208 ? 21.830 6.617   26.853  1.00 20.01 ? 208  LEU A CA  1 
ATOM   1590 C  C   . LEU A 1  208 ? 21.928 5.092   26.921  1.00 20.31 ? 208  LEU A C   1 
ATOM   1591 O  O   . LEU A 1  208 ? 20.904 4.395   26.930  1.00 19.90 ? 208  LEU A O   1 
ATOM   1592 C  CB  . LEU A 1  208 ? 21.855 7.079   25.384  1.00 19.20 ? 208  LEU A CB  1 
ATOM   1593 C  CG  . LEU A 1  208 ? 21.289 8.474   25.086  1.00 20.30 ? 208  LEU A CG  1 
ATOM   1594 C  CD1 . LEU A 1  208 ? 21.605 8.883   23.655  1.00 20.34 ? 208  LEU A CD1 1 
ATOM   1595 C  CD2 . LEU A 1  208 ? 19.780 8.508   25.310  1.00 19.48 ? 208  LEU A CD2 1 
ATOM   1596 N  N   . LEU A 1  209 ? 23.163 4.588   26.971  1.00 21.28 ? 209  LEU A N   1 
ATOM   1597 C  CA  . LEU A 1  209 ? 23.433 3.152   27.077  1.00 22.70 ? 209  LEU A CA  1 
ATOM   1598 C  C   . LEU A 1  209 ? 23.449 2.566   28.489  1.00 23.71 ? 209  LEU A C   1 
ATOM   1599 O  O   . LEU A 1  209 ? 23.372 1.338   28.666  1.00 24.85 ? 209  LEU A O   1 
ATOM   1600 C  CB  . LEU A 1  209 ? 24.772 2.846   26.407  1.00 22.94 ? 209  LEU A CB  1 
ATOM   1601 C  CG  . LEU A 1  209 ? 24.703 2.471   24.921  1.00 23.82 ? 209  LEU A CG  1 
ATOM   1602 C  CD1 . LEU A 1  209 ? 23.885 3.407   24.106  1.00 25.17 ? 209  LEU A CD1 1 
ATOM   1603 C  CD2 . LEU A 1  209 ? 26.124 2.408   24.408  1.00 26.33 ? 209  LEU A CD2 1 
ATOM   1604 N  N   . SER A 1  210 ? 23.574 3.414   29.500  1.00 23.79 ? 210  SER A N   1 
ATOM   1605 C  CA  . SER A 1  210 ? 23.736 2.915   30.859  1.00 24.47 ? 210  SER A CA  1 
ATOM   1606 C  C   . SER A 1  210 ? 22.413 2.672   31.594  1.00 24.98 ? 210  SER A C   1 
ATOM   1607 O  O   . SER A 1  210 ? 21.634 3.601   31.789  1.00 24.15 ? 210  SER A O   1 
ATOM   1608 C  CB  . SER A 1  210 ? 24.611 3.876   31.666  1.00 24.68 ? 210  SER A CB  1 
ATOM   1609 O  OG  . SER A 1  210 ? 24.914 3.299   32.909  1.00 24.52 ? 210  SER A OG  1 
ATOM   1610 N  N   . PRO A 1  211 ? 22.166 1.420   32.048  1.00 25.71 ? 211  PRO A N   1 
ATOM   1611 C  CA  . PRO A 1  211 ? 20.886 1.217   32.737  1.00 25.77 ? 211  PRO A CA  1 
ATOM   1612 C  C   . PRO A 1  211 ? 20.738 2.077   33.997  1.00 24.85 ? 211  PRO A C   1 
ATOM   1613 O  O   . PRO A 1  211 ? 19.645 2.547   34.273  1.00 25.31 ? 211  PRO A O   1 
ATOM   1614 C  CB  . PRO A 1  211 ? 20.899 -0.286  33.067  1.00 26.04 ? 211  PRO A CB  1 
ATOM   1615 C  CG  . PRO A 1  211 ? 21.789 -0.866  31.967  1.00 27.51 ? 211  PRO A CG  1 
ATOM   1616 C  CD  . PRO A 1  211 ? 22.910 0.155   31.912  1.00 25.78 ? 211  PRO A CD  1 
ATOM   1617 N  N   . GLY A 1  212 ? 21.829 2.324   34.712  1.00 24.04 ? 212  GLY A N   1 
ATOM   1618 C  CA  . GLY A 1  212 ? 21.796 3.170   35.904  1.00 23.78 ? 212  GLY A CA  1 
ATOM   1619 C  C   . GLY A 1  212 ? 21.400 4.619   35.632  1.00 23.70 ? 212  GLY A C   1 
ATOM   1620 O  O   . GLY A 1  212 ? 20.866 5.285   36.510  1.00 24.38 ? 212  GLY A O   1 
ATOM   1621 N  N   . SER A 1  213 ? 21.651 5.109   34.423  1.00 22.63 ? 213  SER A N   1 
ATOM   1622 C  CA  . SER A 1  213 ? 21.285 6.478   34.054  1.00 23.21 ? 213  SER A CA  1 
ATOM   1623 C  C   . SER A 1  213 ? 19.880 6.613   33.456  1.00 23.33 ? 213  SER A C   1 
ATOM   1624 O  O   . SER A 1  213 ? 19.399 7.726   33.289  1.00 23.20 ? 213  SER A O   1 
ATOM   1625 C  CB  . SER A 1  213 ? 22.318 7.062   33.071  1.00 22.73 ? 213  SER A CB  1 
ATOM   1626 O  OG  . SER A 1  213 ? 23.608 7.113   33.692  1.00 23.02 ? 213  SER A OG  1 
ATOM   1627 N  N   . HIS A 1  214 ? 19.235 5.483   33.144  1.00 23.84 ? 214  HIS A N   1 
ATOM   1628 C  CA  . HIS A 1  214 ? 17.957 5.462   32.399  1.00 24.60 ? 214  HIS A CA  1 
ATOM   1629 C  C   . HIS A 1  214 ? 16.877 6.382   32.973  1.00 24.69 ? 214  HIS A C   1 
ATOM   1630 O  O   . HIS A 1  214 ? 16.258 7.141   32.230  1.00 24.45 ? 214  HIS A O   1 
ATOM   1631 C  CB  . HIS A 1  214 ? 17.426 4.021   32.292  1.00 25.75 ? 214  HIS A CB  1 
ATOM   1632 C  CG  . HIS A 1  214 ? 16.195 3.875   31.444  0.80 28.20 ? 214  HIS A CG  1 
ATOM   1633 N  ND1 . HIS A 1  214 ? 16.232 3.348   30.170  0.80 29.70 ? 214  HIS A ND1 1 
ATOM   1634 C  CD2 . HIS A 1  214 ? 14.891 4.146   31.700  0.80 29.32 ? 214  HIS A CD2 1 
ATOM   1635 C  CE1 . HIS A 1  214 ? 15.008 3.319   29.669  0.80 28.75 ? 214  HIS A CE1 1 
ATOM   1636 N  NE2 . HIS A 1  214 ? 14.176 3.804   30.573  0.80 30.09 ? 214  HIS A NE2 1 
ATOM   1637 N  N   . SER A 1  215 ? 16.659 6.324   34.289  1.00 24.24 ? 215  SER A N   1 
ATOM   1638 C  CA  . SER A 1  215 ? 15.564 7.072   34.897  1.00 24.79 ? 215  SER A CA  1 
ATOM   1639 C  C   . SER A 1  215 ? 16.021 8.445   35.371  1.00 23.95 ? 215  SER A C   1 
ATOM   1640 O  O   . SER A 1  215 ? 15.257 9.152   36.018  1.00 23.59 ? 215  SER A O   1 
ATOM   1641 C  CB  . SER A 1  215 ? 14.986 6.304   36.087  1.00 25.06 ? 215  SER A CB  1 
ATOM   1642 O  OG  . SER A 1  215 ? 15.904 6.389   37.162  1.00 28.31 ? 215  SER A OG  1 
ATOM   1643 N  N   . LEU A 1  216 ? 17.261 8.818   35.044  1.00 22.75 ? 216  LEU A N   1 
ATOM   1644 C  CA  . LEU A 1  216 ? 17.814 10.090  35.503  1.00 22.12 ? 216  LEU A CA  1 
ATOM   1645 C  C   . LEU A 1  216 ? 17.716 11.247  34.501  1.00 21.71 ? 216  LEU A C   1 
ATOM   1646 O  O   . LEU A 1  216 ? 18.151 12.367  34.811  1.00 21.95 ? 216  LEU A O   1 
ATOM   1647 C  CB  . LEU A 1  216 ? 19.262 9.900   35.952  1.00 22.22 ? 216  LEU A CB  1 
ATOM   1648 C  CG  . LEU A 1  216 ? 19.483 8.780   36.974  1.00 21.73 ? 216  LEU A CG  1 
ATOM   1649 C  CD1 . LEU A 1  216 ? 20.964 8.723   37.359  1.00 22.76 ? 216  LEU A CD1 1 
ATOM   1650 C  CD2 . LEU A 1  216 ? 18.573 8.901   38.226  1.00 22.86 ? 216  LEU A CD2 1 
ATOM   1651 N  N   . PHE A 1  217 ? 17.147 10.996  33.316  1.00 20.09 ? 217  PHE A N   1 
ATOM   1652 C  CA  . PHE A 1  217 ? 16.981 12.061  32.318  1.00 19.37 ? 217  PHE A CA  1 
ATOM   1653 C  C   . PHE A 1  217 ? 15.926 11.709  31.304  1.00 19.42 ? 217  PHE A C   1 
ATOM   1654 O  O   . PHE A 1  217 ? 15.488 10.568  31.251  1.00 20.44 ? 217  PHE A O   1 
ATOM   1655 C  CB  . PHE A 1  217 ? 18.306 12.424  31.615  1.00 19.06 ? 217  PHE A CB  1 
ATOM   1656 C  CG  . PHE A 1  217 ? 18.855 11.355  30.702  1.00 17.18 ? 217  PHE A CG  1 
ATOM   1657 C  CD1 . PHE A 1  217 ? 19.467 10.213  31.217  1.00 18.22 ? 217  PHE A CD1 1 
ATOM   1658 C  CD2 . PHE A 1  217 ? 18.813 11.530  29.313  1.00 17.63 ? 217  PHE A CD2 1 
ATOM   1659 C  CE1 . PHE A 1  217 ? 20.013 9.246   30.367  1.00 16.24 ? 217  PHE A CE1 1 
ATOM   1660 C  CE2 . PHE A 1  217 ? 19.360 10.584  28.455  1.00 15.66 ? 217  PHE A CE2 1 
ATOM   1661 C  CZ  . PHE A 1  217 ? 19.964 9.440   28.980  1.00 16.55 ? 217  PHE A CZ  1 
ATOM   1662 N  N   . THR A 1  218 ? 15.511 12.691  30.519  1.00 18.52 ? 218  THR A N   1 
ATOM   1663 C  CA  . THR A 1  218 ? 14.435 12.489  29.552  1.00 19.36 ? 218  THR A CA  1 
ATOM   1664 C  C   . THR A 1  218 ? 14.982 12.359  28.128  1.00 18.78 ? 218  THR A C   1 
ATOM   1665 O  O   . THR A 1  218 ? 14.679 11.385  27.434  1.00 19.09 ? 218  THR A O   1 
ATOM   1666 C  CB  . THR A 1  218 ? 13.438 13.655  29.606  1.00 19.96 ? 218  THR A CB  1 
ATOM   1667 O  OG1 . THR A 1  218 ? 13.163 13.958  30.972  1.00 20.02 ? 218  THR A OG1 1 
ATOM   1668 C  CG2 . THR A 1  218 ? 12.123 13.297  28.890  1.00 19.68 ? 218  THR A CG2 1 
ATOM   1669 N  N   . ARG A 1  219 ? 15.785 13.341  27.714  1.00 18.32 ? 219  ARG A N   1 
ATOM   1670 C  CA  . ARG A 1  219 ? 16.262 13.471  26.333  1.00 19.06 ? 219  ARG A CA  1 
ATOM   1671 C  C   . ARG A 1  219 ? 17.743 13.857  26.284  1.00 18.46 ? 219  ARG A C   1 
ATOM   1672 O  O   . ARG A 1  219 ? 18.328 14.195  27.315  1.00 18.87 ? 219  ARG A O   1 
ATOM   1673 C  CB  . ARG A 1  219 ? 15.443 14.543  25.611  1.00 20.06 ? 219  ARG A CB  1 
ATOM   1674 C  CG  . ARG A 1  219 ? 14.315 13.977  24.808  1.00 24.16 ? 219  ARG A CG  1 
ATOM   1675 C  CD  . ARG A 1  219 ? 13.501 15.076  24.095  1.00 25.97 ? 219  ARG A CD  1 
ATOM   1676 N  NE  . ARG A 1  219 ? 12.804 15.900  25.059  1.00 27.55 ? 219  ARG A NE  1 
ATOM   1677 C  CZ  . ARG A 1  219 ? 11.600 15.651  25.567  1.00 27.14 ? 219  ARG A CZ  1 
ATOM   1678 N  NH1 . ARG A 1  219 ? 11.110 16.488  26.460  1.00 27.43 ? 219  ARG A NH1 1 
ATOM   1679 N  NH2 . ARG A 1  219 ? 10.891 14.582  25.203  1.00 26.67 ? 219  ARG A NH2 1 
ATOM   1680 N  N   . ALA A 1  220 ? 18.334 13.833  25.086  1.00 17.71 ? 220  ALA A N   1 
ATOM   1681 C  CA  . ALA A 1  220 ? 19.788 13.964  24.929  1.00 17.11 ? 220  ALA A CA  1 
ATOM   1682 C  C   . ALA A 1  220 ? 20.186 14.760  23.684  1.00 17.20 ? 220  ALA A C   1 
ATOM   1683 O  O   . ALA A 1  220 ? 19.594 14.613  22.610  1.00 17.14 ? 220  ALA A O   1 
ATOM   1684 C  CB  . ALA A 1  220 ? 20.429 12.580  24.877  1.00 16.46 ? 220  ALA A CB  1 
ATOM   1685 N  N   . ILE A 1  221 ? 21.210 15.592  23.850  1.00 17.32 ? 221  ILE A N   1 
ATOM   1686 C  CA  . ILE A 1  221 ? 21.768 16.422  22.789  1.00 16.03 ? 221  ILE A CA  1 
ATOM   1687 C  C   . ILE A 1  221 ? 23.267 16.131  22.718  1.00 17.04 ? 221  ILE A C   1 
ATOM   1688 O  O   . ILE A 1  221 ? 23.977 16.236  23.738  1.00 16.46 ? 221  ILE A O   1 
ATOM   1689 C  CB  . ILE A 1  221 ? 21.578 17.961  23.095  1.00 16.32 ? 221  ILE A CB  1 
ATOM   1690 C  CG1 . ILE A 1  221 ? 20.088 18.334  23.190  1.00 14.32 ? 221  ILE A CG1 1 
ATOM   1691 C  CG2 . ILE A 1  221 ? 22.299 18.844  22.009  1.00 15.32 ? 221  ILE A CG2 1 
ATOM   1692 C  CD1 . ILE A 1  221 ? 19.820 19.840  23.425  1.00 15.05 ? 221  ILE A CD1 1 
ATOM   1693 N  N   . LEU A 1  222 ? 23.743 15.789  21.517  1.00 17.04 ? 222  LEU A N   1 
ATOM   1694 C  CA  . LEU A 1  222 ? 25.132 15.389  21.307  1.00 17.84 ? 222  LEU A CA  1 
ATOM   1695 C  C   . LEU A 1  222 ? 25.825 16.324  20.322  1.00 17.65 ? 222  LEU A C   1 
ATOM   1696 O  O   . LEU A 1  222 ? 25.614 16.216  19.112  1.00 18.15 ? 222  LEU A O   1 
ATOM   1697 C  CB  . LEU A 1  222 ? 25.190 13.939  20.777  1.00 17.50 ? 222  LEU A CB  1 
ATOM   1698 C  CG  . LEU A 1  222 ? 24.740 12.793  21.701  1.00 19.12 ? 222  LEU A CG  1 
ATOM   1699 C  CD1 . LEU A 1  222 ? 23.226 12.755  21.884  1.00 19.35 ? 222  LEU A CD1 1 
ATOM   1700 C  CD2 . LEU A 1  222 ? 25.200 11.462  21.111  1.00 20.91 ? 222  LEU A CD2 1 
ATOM   1701 N  N   . GLN A 1  223 ? 26.659 17.233  20.828  1.00 17.16 ? 223  GLN A N   1 
ATOM   1702 C  CA  . GLN A 1  223 ? 27.379 18.179  19.946  1.00 17.13 ? 223  GLN A CA  1 
ATOM   1703 C  C   . GLN A 1  223 ? 28.807 17.682  19.684  1.00 17.33 ? 223  GLN A C   1 
ATOM   1704 O  O   . GLN A 1  223 ? 29.596 17.519  20.629  1.00 17.37 ? 223  GLN A O   1 
ATOM   1705 C  CB  . GLN A 1  223 ? 27.396 19.586  20.585  1.00 17.36 ? 223  GLN A CB  1 
ATOM   1706 C  CG  . GLN A 1  223 ? 25.969 20.209  20.811  1.00 17.36 ? 223  GLN A CG  1 
ATOM   1707 C  CD  . GLN A 1  223 ? 25.950 21.390  21.791  1.00 20.66 ? 223  GLN A CD  1 
ATOM   1708 O  OE1 . GLN A 1  223 ? 24.937 21.650  22.455  1.00 20.76 ? 223  GLN A OE1 1 
ATOM   1709 N  NE2 . GLN A 1  223 ? 27.064 22.097  21.893  1.00 19.89 ? 223  GLN A NE2 1 
ATOM   1710 N  N   . SER A 1  224 ? 29.134 17.395  18.423  1.00 17.56 ? 224  SER A N   1 
ATOM   1711 C  CA  . SER A 1  224 ? 30.501 16.966  18.049  1.00 18.38 ? 224  SER A CA  1 
ATOM   1712 C  C   . SER A 1  224 ? 31.068 15.782  18.878  1.00 19.25 ? 224  SER A C   1 
ATOM   1713 O  O   . SER A 1  224 ? 32.196 15.850  19.398  1.00 19.05 ? 224  SER A O   1 
ATOM   1714 C  CB  . SER A 1  224 ? 31.467 18.167  18.137  1.00 18.79 ? 224  SER A CB  1 
ATOM   1715 O  OG  . SER A 1  224 ? 31.023 19.241  17.294  1.00 18.59 ? 224  SER A OG  1 
ATOM   1716 N  N   . GLY A 1  225 ? 30.289 14.714  19.034  1.00 18.79 ? 225  GLY A N   1 
ATOM   1717 C  CA  . GLY A 1  225 ? 30.796 13.543  19.761  1.00 18.78 ? 225  GLY A CA  1 
ATOM   1718 C  C   . GLY A 1  225 ? 29.761 12.454  20.028  1.00 18.84 ? 225  GLY A C   1 
ATOM   1719 O  O   . GLY A 1  225 ? 28.560 12.729  20.100  1.00 18.10 ? 225  GLY A O   1 
ATOM   1720 N  N   . SER A 1  226 ? 30.243 11.222  20.180  1.00 18.69 ? 226  SER A N   1 
ATOM   1721 C  CA  . SER A 1  226 ? 29.409 10.062  20.481  1.00 18.78 ? 226  SER A CA  1 
ATOM   1722 C  C   . SER A 1  226 ? 30.363 8.921   20.819  1.00 19.18 ? 226  SER A C   1 
ATOM   1723 O  O   . SER A 1  226 ? 31.532 8.923   20.379  1.00 18.84 ? 226  SER A O   1 
ATOM   1724 C  CB  . SER A 1  226 ? 28.518 9.720   19.267  1.00 18.91 ? 226  SER A CB  1 
ATOM   1725 O  OG  . SER A 1  226 ? 29.326 9.615   18.104  1.00 18.17 ? 226  SER A OG  1 
ATOM   1726 N  N   . PHE A 1  227 ? 29.885 7.947   21.586  1.00 19.20 ? 227  PHE A N   1 
ATOM   1727 C  CA  A PHE A 1  227 ? 30.760 6.906   22.132  0.50 20.23 ? 227  PHE A CA  1 
ATOM   1728 C  CA  B PHE A 1  227 ? 30.767 6.913   22.122  0.50 20.15 ? 227  PHE A CA  1 
ATOM   1729 C  C   . PHE A 1  227 ? 31.483 6.100   21.046  1.00 20.33 ? 227  PHE A C   1 
ATOM   1730 O  O   . PHE A 1  227 ? 32.556 5.550   21.299  1.00 21.28 ? 227  PHE A O   1 
ATOM   1731 C  CB  A PHE A 1  227 ? 29.968 5.923   22.998  0.50 20.15 ? 227  PHE A CB  1 
ATOM   1732 C  CB  B PHE A 1  227 ? 30.023 5.984   23.099  0.50 20.00 ? 227  PHE A CB  1 
ATOM   1733 C  CG  A PHE A 1  227 ? 29.383 4.800   22.202  0.50 21.38 ? 227  PHE A CG  1 
ATOM   1734 C  CG  B PHE A 1  227 ? 28.928 5.161   22.456  0.50 20.97 ? 227  PHE A CG  1 
ATOM   1735 C  CD1 A PHE A 1  227 ? 30.176 3.731   21.818  0.50 21.59 ? 227  PHE A CD1 1 
ATOM   1736 C  CD1 B PHE A 1  227 ? 29.241 4.085   21.637  0.50 22.66 ? 227  PHE A CD1 1 
ATOM   1737 C  CD2 A PHE A 1  227 ? 28.074 4.849   21.766  0.50 20.59 ? 227  PHE A CD2 1 
ATOM   1738 C  CD2 B PHE A 1  227 ? 27.600 5.444   22.697  0.50 20.33 ? 227  PHE A CD2 1 
ATOM   1739 C  CE1 A PHE A 1  227 ? 29.672 2.721   21.022  0.50 21.94 ? 227  PHE A CE1 1 
ATOM   1740 C  CE1 B PHE A 1  227 ? 28.249 3.335   21.044  0.50 23.65 ? 227  PHE A CE1 1 
ATOM   1741 C  CE2 A PHE A 1  227 ? 27.554 3.831   20.991  0.50 22.03 ? 227  PHE A CE2 1 
ATOM   1742 C  CE2 B PHE A 1  227 ? 26.603 4.693   22.113  0.50 22.96 ? 227  PHE A CE2 1 
ATOM   1743 C  CZ  A PHE A 1  227 ? 28.356 2.763   20.618  0.50 22.60 ? 227  PHE A CZ  1 
ATOM   1744 C  CZ  B PHE A 1  227 ? 26.929 3.636   21.285  0.50 23.03 ? 227  PHE A CZ  1 
ATOM   1745 N  N   . ASN A 1  228 ? 30.890 6.010   19.853  1.00 19.77 ? 228  ASN A N   1 
ATOM   1746 C  CA  . ASN A 1  228 ? 31.477 5.209   18.771  1.00 19.42 ? 228  ASN A CA  1 
ATOM   1747 C  C   . ASN A 1  228 ? 32.589 5.927   18.014  1.00 19.74 ? 228  ASN A C   1 
ATOM   1748 O  O   . ASN A 1  228 ? 33.153 5.375   17.053  1.00 20.05 ? 228  ASN A O   1 
ATOM   1749 C  CB  . ASN A 1  228 ? 30.394 4.717   17.792  1.00 19.14 ? 228  ASN A CB  1 
ATOM   1750 C  CG  . ASN A 1  228 ? 29.643 5.873   17.140  1.00 19.61 ? 228  ASN A CG  1 
ATOM   1751 O  OD1 . ASN A 1  228 ? 29.371 6.886   17.780  1.00 22.03 ? 228  ASN A OD1 1 
ATOM   1752 N  ND2 . ASN A 1  228 ? 29.311 5.727   15.872  1.00 21.48 ? 228  ASN A ND2 1 
ATOM   1753 N  N   . ALA A 1  229 ? 32.900 7.155   18.411  1.00 18.69 ? 229  ALA A N   1 
ATOM   1754 C  CA  . ALA A 1  229 ? 34.101 7.813   17.902  1.00 19.16 ? 229  ALA A CA  1 
ATOM   1755 C  C   . ALA A 1  229 ? 35.322 6.992   18.311  1.00 19.17 ? 229  ALA A C   1 
ATOM   1756 O  O   . ALA A 1  229 ? 35.336 6.388   19.381  1.00 19.73 ? 229  ALA A O   1 
ATOM   1757 C  CB  . ALA A 1  229 ? 34.207 9.262   18.418  1.00 18.11 ? 229  ALA A CB  1 
ATOM   1758 N  N   . PRO A 1  230 ? 36.342 6.939   17.444  1.00 19.66 ? 230  PRO A N   1 
ATOM   1759 C  CA  . PRO A 1  230 ? 37.478 6.052   17.708  1.00 19.69 ? 230  PRO A CA  1 
ATOM   1760 C  C   . PRO A 1  230 ? 38.260 6.429   18.978  1.00 19.67 ? 230  PRO A C   1 
ATOM   1761 O  O   . PRO A 1  230 ? 38.950 5.571   19.531  1.00 20.23 ? 230  PRO A O   1 
ATOM   1762 C  CB  . PRO A 1  230 ? 38.368 6.219   16.476  1.00 19.54 ? 230  PRO A CB  1 
ATOM   1763 C  CG  . PRO A 1  230 ? 37.954 7.525   15.851  1.00 19.85 ? 230  PRO A CG  1 
ATOM   1764 C  CD  . PRO A 1  230 ? 36.500 7.719   16.203  1.00 18.47 ? 230  PRO A CD  1 
ATOM   1765 N  N   . TRP A 1  231 ? 38.133 7.674   19.447  1.00 19.20 ? 231  TRP A N   1 
ATOM   1766 C  CA  . TRP A 1  231 ? 38.837 8.134   20.672  1.00 18.42 ? 231  TRP A CA  1 
ATOM   1767 C  C   . TRP A 1  231 ? 38.049 7.918   21.974  1.00 19.30 ? 231  TRP A C   1 
ATOM   1768 O  O   . TRP A 1  231 ? 38.587 8.144   23.069  1.00 18.89 ? 231  TRP A O   1 
ATOM   1769 C  CB  . TRP A 1  231 ? 39.191 9.636   20.562  1.00 18.00 ? 231  TRP A CB  1 
ATOM   1770 C  CG  . TRP A 1  231 ? 38.004 10.479  20.091  1.00 16.13 ? 231  TRP A CG  1 
ATOM   1771 C  CD1 . TRP A 1  231 ? 37.749 10.889  18.802  1.00 16.98 ? 231  TRP A CD1 1 
ATOM   1772 C  CD2 . TRP A 1  231 ? 36.920 10.974  20.888  1.00 15.87 ? 231  TRP A CD2 1 
ATOM   1773 N  NE1 . TRP A 1  231 ? 36.569 11.619  18.750  1.00 16.44 ? 231  TRP A NE1 1 
ATOM   1774 C  CE2 . TRP A 1  231 ? 36.036 11.672  20.017  1.00 17.86 ? 231  TRP A CE2 1 
ATOM   1775 C  CE3 . TRP A 1  231 ? 36.602 10.902  22.259  1.00 19.02 ? 231  TRP A CE3 1 
ATOM   1776 C  CZ2 . TRP A 1  231 ? 34.865 12.300  20.479  1.00 18.55 ? 231  TRP A CZ2 1 
ATOM   1777 C  CZ3 . TRP A 1  231 ? 35.426 11.520  22.721  1.00 16.71 ? 231  TRP A CZ3 1 
ATOM   1778 C  CH2 . TRP A 1  231 ? 34.575 12.208  21.835  1.00 17.73 ? 231  TRP A CH2 1 
ATOM   1779 N  N   . ALA A 1  232 ? 36.784 7.491   21.870  1.00 19.50 ? 232  ALA A N   1 
ATOM   1780 C  CA  . ALA A 1  232 ? 35.843 7.574   23.008  1.00 20.18 ? 232  ALA A CA  1 
ATOM   1781 C  C   . ALA A 1  232 ? 35.835 6.419   24.015  1.00 20.97 ? 232  ALA A C   1 
ATOM   1782 O  O   . ALA A 1  232 ? 35.413 6.590   25.152  1.00 21.50 ? 232  ALA A O   1 
ATOM   1783 C  CB  . ALA A 1  232 ? 34.413 7.854   22.510  1.00 19.95 ? 232  ALA A CB  1 
ATOM   1784 N  N   . VAL A 1  233 ? 36.272 5.236   23.617  1.00 21.66 ? 233  VAL A N   1 
ATOM   1785 C  CA  . VAL A 1  233 ? 36.250 4.120   24.552  1.00 23.29 ? 233  VAL A CA  1 
ATOM   1786 C  C   . VAL A 1  233 ? 37.582 3.386   24.504  1.00 24.86 ? 233  VAL A C   1 
ATOM   1787 O  O   . VAL A 1  233 ? 38.050 3.001   23.431  1.00 24.87 ? 233  VAL A O   1 
ATOM   1788 C  CB  . VAL A 1  233 ? 35.093 3.114   24.267  1.00 23.78 ? 233  VAL A CB  1 
ATOM   1789 C  CG1 . VAL A 1  233 ? 35.055 2.000   25.348  1.00 22.58 ? 233  VAL A CG1 1 
ATOM   1790 C  CG2 . VAL A 1  233 ? 33.731 3.836   24.157  1.00 23.09 ? 233  VAL A CG2 1 
ATOM   1791 N  N   . THR A 1  234 ? 38.182 3.227   25.676  1.00 26.41 ? 234  THR A N   1 
ATOM   1792 C  CA  . THR A 1  234 ? 39.435 2.494   25.859  1.00 28.52 ? 234  THR A CA  1 
ATOM   1793 C  C   . THR A 1  234 ? 39.112 1.003   26.001  1.00 29.31 ? 234  THR A C   1 
ATOM   1794 O  O   . THR A 1  234 ? 38.199 0.629   26.743  1.00 29.62 ? 234  THR A O   1 
ATOM   1795 C  CB  . THR A 1  234 ? 40.136 2.972   27.151  1.00 28.37 ? 234  THR A CB  1 
ATOM   1796 O  OG1 . THR A 1  234 ? 40.195 4.407   27.171  1.00 28.58 ? 234  THR A OG1 1 
ATOM   1797 C  CG2 . THR A 1  234 ? 41.557 2.387   27.283  1.00 29.23 ? 234  THR A CG2 1 
ATOM   1798 N  N   . SER A 1  235 ? 39.846 0.154   25.285  1.00 30.71 ? 235  SER A N   1 
ATOM   1799 C  CA  . SER A 1  235 ? 39.692 -1.295  25.418  1.00 32.00 ? 235  SER A CA  1 
ATOM   1800 C  C   . SER A 1  235 ? 40.238 -1.741  26.765  1.00 32.85 ? 235  SER A C   1 
ATOM   1801 O  O   . SER A 1  235 ? 41.097 -1.067  27.341  1.00 33.27 ? 235  SER A O   1 
ATOM   1802 C  CB  . SER A 1  235 ? 40.494 -2.011  24.336  1.00 32.50 ? 235  SER A CB  1 
ATOM   1803 O  OG  . SER A 1  235 ? 41.878 -1.944  24.651  1.00 33.31 ? 235  SER A OG  1 
ATOM   1804 N  N   . LEU A 1  236 ? 39.766 -2.888  27.247  1.00 33.86 ? 236  LEU A N   1 
ATOM   1805 C  CA  . LEU A 1  236 ? 40.308 -3.495  28.469  1.00 34.94 ? 236  LEU A CA  1 
ATOM   1806 C  C   . LEU A 1  236 ? 41.801 -3.792  28.370  1.00 35.00 ? 236  LEU A C   1 
ATOM   1807 O  O   . LEU A 1  236 ? 42.533 -3.596  29.338  1.00 35.21 ? 236  LEU A O   1 
ATOM   1808 C  CB  . LEU A 1  236 ? 39.517 -4.746  28.864  1.00 35.32 ? 236  LEU A CB  1 
ATOM   1809 C  CG  . LEU A 1  236 ? 38.497 -4.530  29.999  1.00 36.83 ? 236  LEU A CG  1 
ATOM   1810 C  CD1 . LEU A 1  236 ? 38.017 -3.077  30.089  1.00 36.30 ? 236  LEU A CD1 1 
ATOM   1811 C  CD2 . LEU A 1  236 ? 37.314 -5.485  29.929  1.00 37.64 ? 236  LEU A CD2 1 
ATOM   1812 N  N   . TYR A 1  237 ? 42.246 -4.239  27.197  1.00 35.45 ? 237  TYR A N   1 
ATOM   1813 C  CA  . TYR A 1  237 ? 43.669 -4.456  26.938  1.00 35.86 ? 237  TYR A CA  1 
ATOM   1814 C  C   . TYR A 1  237 ? 44.476 -3.167  27.094  1.00 35.48 ? 237  TYR A C   1 
ATOM   1815 O  O   . TYR A 1  237 ? 45.482 -3.150  27.808  1.00 35.43 ? 237  TYR A O   1 
ATOM   1816 C  CB  . TYR A 1  237 ? 43.911 -5.066  25.548  1.00 36.05 ? 237  TYR A CB  1 
ATOM   1817 C  CG  . TYR A 1  237 ? 45.342 -5.531  25.353  0.50 37.13 ? 237  TYR A CG  1 
ATOM   1818 C  CD1 . TYR A 1  237 ? 45.789 -6.730  25.914  0.50 37.88 ? 237  TYR A CD1 1 
ATOM   1819 C  CD2 . TYR A 1  237 ? 46.252 -4.770  24.626  0.50 37.67 ? 237  TYR A CD2 1 
ATOM   1820 C  CE1 . TYR A 1  237 ? 47.093 -7.157  25.749  0.50 37.96 ? 237  TYR A CE1 1 
ATOM   1821 C  CE2 . TYR A 1  237 ? 47.561 -5.191  24.456  0.50 38.21 ? 237  TYR A CE2 1 
ATOM   1822 C  CZ  . TYR A 1  237 ? 47.975 -6.383  25.020  0.50 38.66 ? 237  TYR A CZ  1 
ATOM   1823 O  OH  . TYR A 1  237 ? 49.276 -6.806  24.856  0.50 38.94 ? 237  TYR A OH  1 
ATOM   1824 N  N   . GLU A 1  238 ? 44.040 -2.101  26.419  1.00 34.94 ? 238  GLU A N   1 
ATOM   1825 C  CA  . GLU A 1  238 ? 44.714 -0.804  26.512  1.00 34.77 ? 238  GLU A CA  1 
ATOM   1826 C  C   . GLU A 1  238 ? 44.743 -0.290  27.948  1.00 34.20 ? 238  GLU A C   1 
ATOM   1827 O  O   . GLU A 1  238 ? 45.772 0.183   28.405  1.00 34.36 ? 238  GLU A O   1 
ATOM   1828 C  CB  . GLU A 1  238 ? 44.023 0.248   25.639  1.00 34.99 ? 238  GLU A CB  1 
ATOM   1829 C  CG  . GLU A 1  238 ? 44.274 0.156   24.145  1.00 36.46 ? 238  GLU A CG  1 
ATOM   1830 C  CD  . GLU A 1  238 ? 43.265 0.987   23.357  1.00 38.76 ? 238  GLU A CD  1 
ATOM   1831 O  OE1 . GLU A 1  238 ? 42.150 1.232   23.884  1.00 37.88 ? 238  GLU A OE1 1 
ATOM   1832 O  OE2 . GLU A 1  238 ? 43.579 1.392   22.212  1.00 39.60 ? 238  GLU A OE2 1 
ATOM   1833 N  N   . ALA A 1  239 ? 43.603 -0.369  28.634  1.00 33.73 ? 239  ALA A N   1 
ATOM   1834 C  CA  . ALA A 1  239 ? 43.453 0.142   30.001  1.00 33.60 ? 239  ALA A CA  1 
ATOM   1835 C  C   . ALA A 1  239 ? 44.418 -0.533  30.959  1.00 33.59 ? 239  ALA A C   1 
ATOM   1836 O  O   . ALA A 1  239 ? 45.168 0.143   31.658  1.00 33.67 ? 239  ALA A O   1 
ATOM   1837 C  CB  . ALA A 1  239 ? 42.013 -0.030  30.483  1.00 33.65 ? 239  ALA A CB  1 
ATOM   1838 N  N   . ARG A 1  240 ? 44.405 -1.866  30.975  1.00 33.86 ? 240  ARG A N   1 
ATOM   1839 C  CA  . ARG A 1  240 ? 45.357 -2.653  31.772  1.00 34.04 ? 240  ARG A CA  1 
ATOM   1840 C  C   . ARG A 1  240 ? 46.802 -2.246  31.487  1.00 33.73 ? 240  ARG A C   1 
ATOM   1841 O  O   . ARG A 1  240 ? 47.557 -1.966  32.415  1.00 33.38 ? 240  ARG A O   1 
ATOM   1842 C  CB  . ARG A 1  240 ? 45.175 -4.143  31.486  1.00 34.60 ? 240  ARG A CB  1 
ATOM   1843 C  CG  . ARG A 1  240 ? 43.918 -4.782  32.103  1.00 37.07 ? 240  ARG A CG  1 
ATOM   1844 C  CD  . ARG A 1  240 ? 44.257 -5.592  33.362  1.00 40.64 ? 240  ARG A CD  1 
ATOM   1845 N  NE  . ARG A 1  240 ? 45.584 -6.201  33.263  1.00 42.53 ? 240  ARG A NE  1 
ATOM   1846 C  CZ  . ARG A 1  240 ? 46.128 -6.971  34.198  1.00 42.90 ? 240  ARG A CZ  1 
ATOM   1847 N  NH1 . ARG A 1  240 ? 45.450 -7.233  35.300  1.00 43.67 ? 240  ARG A NH1 1 
ATOM   1848 N  NH2 . ARG A 1  240 ? 47.341 -7.484  34.025  1.00 42.19 ? 240  ARG A NH2 1 
ATOM   1849 N  N   . ASN A 1  241 ? 47.180 -2.186  30.209  1.00 33.43 ? 241  ASN A N   1 
ATOM   1850 C  CA  . ASN A 1  241 ? 48.541 -1.795  29.845  1.00 33.86 ? 241  ASN A CA  1 
ATOM   1851 C  C   . ASN A 1  241 ? 48.869 -0.403  30.375  1.00 33.06 ? 241  ASN A C   1 
ATOM   1852 O  O   . ASN A 1  241 ? 49.969 -0.165  30.876  1.00 32.78 ? 241  ASN A O   1 
ATOM   1853 C  CB  . ASN A 1  241 ? 48.748 -1.829  28.326  1.00 34.88 ? 241  ASN A CB  1 
ATOM   1854 C  CG  . ASN A 1  241 ? 50.199 -2.160  27.919  1.00 38.92 ? 241  ASN A CG  1 
ATOM   1855 O  OD1 . ASN A 1  241 ? 50.758 -3.182  28.328  1.00 39.23 ? 241  ASN A OD1 1 
ATOM   1856 N  ND2 . ASN A 1  241 ? 50.802 -1.293  27.096  1.00 45.00 ? 241  ASN A ND2 1 
ATOM   1857 N  N   . ARG A 1  242 ? 47.901 0.506   30.272  1.00 31.82 ? 242  ARG A N   1 
ATOM   1858 C  CA  . ARG A 1  242 ? 48.112 1.899   30.651  1.00 30.74 ? 242  ARG A CA  1 
ATOM   1859 C  C   . ARG A 1  242 ? 48.161 2.093   32.168  1.00 30.17 ? 242  ARG A C   1 
ATOM   1860 O  O   . ARG A 1  242 ? 48.967 2.877   32.672  1.00 29.89 ? 242  ARG A O   1 
ATOM   1861 C  CB  . ARG A 1  242 ? 47.062 2.799   29.987  1.00 30.70 ? 242  ARG A CB  1 
ATOM   1862 C  CG  . ARG A 1  242 ? 47.248 2.914   28.484  1.00 29.85 ? 242  ARG A CG  1 
ATOM   1863 C  CD  . ARG A 1  242 ? 46.042 3.563   27.811  1.00 30.43 ? 242  ARG A CD  1 
ATOM   1864 N  NE  . ARG A 1  242 ? 46.042 3.348   26.362  1.00 29.05 ? 242  ARG A NE  1 
ATOM   1865 C  CZ  . ARG A 1  242 ? 45.214 3.946   25.506  1.00 29.81 ? 242  ARG A CZ  1 
ATOM   1866 N  NH1 . ARG A 1  242 ? 44.292 4.814   25.929  1.00 27.26 ? 242  ARG A NH1 1 
ATOM   1867 N  NH2 . ARG A 1  242 ? 45.309 3.678   24.208  1.00 29.17 ? 242  ARG A NH2 1 
ATOM   1868 N  N   . THR A 1  243 ? 47.304 1.371   32.886  1.00 29.80 ? 243  THR A N   1 
ATOM   1869 C  CA  . THR A 1  243 ? 47.372 1.312   34.345  1.00 29.92 ? 243  THR A CA  1 
ATOM   1870 C  C   . THR A 1  243 ? 48.735 0.767   34.805  1.00 29.79 ? 243  THR A C   1 
ATOM   1871 O  O   . THR A 1  243 ? 49.384 1.364   35.667  1.00 29.44 ? 243  THR A O   1 
ATOM   1872 C  CB  . THR A 1  243 ? 46.217 0.469   34.941  1.00 29.98 ? 243  THR A CB  1 
ATOM   1873 O  OG1 . THR A 1  243 ? 44.967 1.103   34.651  1.00 30.29 ? 243  THR A OG1 1 
ATOM   1874 C  CG2 . THR A 1  243 ? 46.348 0.341   36.467  1.00 30.02 ? 243  THR A CG2 1 
ATOM   1875 N  N   . LEU A 1  244 ? 49.166 -0.352  34.224  1.00 29.99 ? 244  LEU A N   1 
ATOM   1876 C  CA  . LEU A 1  244 ? 50.474 -0.931  34.556  1.00 30.82 ? 244  LEU A CA  1 
ATOM   1877 C  C   . LEU A 1  244 ? 51.633 -0.011  34.189  1.00 30.87 ? 244  LEU A C   1 
ATOM   1878 O  O   . LEU A 1  244 ? 52.623 0.075   34.925  1.00 30.92 ? 244  LEU A O   1 
ATOM   1879 C  CB  . LEU A 1  244 ? 50.671 -2.309  33.910  1.00 31.12 ? 244  LEU A CB  1 
ATOM   1880 C  CG  . LEU A 1  244 ? 49.733 -3.451  34.323  1.00 32.08 ? 244  LEU A CG  1 
ATOM   1881 C  CD1 . LEU A 1  244 ? 50.237 -4.773  33.748  1.00 32.84 ? 244  LEU A CD1 1 
ATOM   1882 C  CD2 . LEU A 1  244 ? 49.582 -3.537  35.840  1.00 33.28 ? 244  LEU A CD2 1 
ATOM   1883 N  N   . ASN A 1  245 ? 51.516 0.675   33.056  1.00 30.97 ? 245  ASN A N   1 
ATOM   1884 C  CA  . ASN A 1  245 ? 52.531 1.661   32.676  1.00 31.04 ? 245  ASN A CA  1 
ATOM   1885 C  C   . ASN A 1  245 ? 52.621 2.811   33.657  1.00 30.86 ? 245  ASN A C   1 
ATOM   1886 O  O   . ASN A 1  245 ? 53.722 3.224   34.026  1.00 30.87 ? 245  ASN A O   1 
ATOM   1887 C  CB  . ASN A 1  245 ? 52.301 2.182   31.259  1.00 31.25 ? 245  ASN A CB  1 
ATOM   1888 C  CG  . ASN A 1  245 ? 52.677 1.169   30.215  1.00 32.22 ? 245  ASN A CG  1 
ATOM   1889 O  OD1 . ASN A 1  245 ? 53.401 0.220   30.506  1.00 33.39 ? 245  ASN A OD1 1 
ATOM   1890 N  ND2 . ASN A 1  245 ? 52.192 1.356   28.993  1.00 31.61 ? 245  ASN A ND2 1 
ATOM   1891 N  N   . LEU A 1  246 ? 51.465 3.316   34.087  1.00 30.50 ? 246  LEU A N   1 
ATOM   1892 C  CA  . LEU A 1  246 ? 51.428 4.370   35.094  1.00 30.56 ? 246  LEU A CA  1 
ATOM   1893 C  C   . LEU A 1  246 ? 52.099 3.901   36.381  1.00 30.89 ? 246  LEU A C   1 
ATOM   1894 O  O   . LEU A 1  246 ? 52.858 4.652   36.993  1.00 30.82 ? 246  LEU A O   1 
ATOM   1895 C  CB  . LEU A 1  246 ? 49.990 4.834   35.377  1.00 29.92 ? 246  LEU A CB  1 
ATOM   1896 C  CG  . LEU A 1  246 ? 49.885 6.120   36.202  1.00 29.42 ? 246  LEU A CG  1 
ATOM   1897 C  CD1 . LEU A 1  246 ? 50.479 7.306   35.456  1.00 28.89 ? 246  LEU A CD1 1 
ATOM   1898 C  CD2 . LEU A 1  246 ? 48.445 6.399   36.572  1.00 27.68 ? 246  LEU A CD2 1 
ATOM   1899 N  N   . ALA A 1  247 ? 51.807 2.660   36.777  1.00 31.51 ? 247  ALA A N   1 
ATOM   1900 C  CA  . ALA A 1  247 ? 52.428 2.027   37.940  1.00 32.27 ? 247  ALA A CA  1 
ATOM   1901 C  C   . ALA A 1  247 ? 53.949 2.012   37.809  1.00 33.02 ? 247  ALA A C   1 
ATOM   1902 O  O   . ALA A 1  247 ? 54.656 2.491   38.700  1.00 33.04 ? 247  ALA A O   1 
ATOM   1903 C  CB  . ALA A 1  247 ? 51.896 0.614   38.126  1.00 31.95 ? 247  ALA A CB  1 
ATOM   1904 N  N   . LYS A 1  248 ? 54.442 1.482   36.689  1.00 33.53 ? 248  LYS A N   1 
ATOM   1905 C  CA  . LYS A 1  248 ? 55.876 1.445   36.410  1.00 34.22 ? 248  LYS A CA  1 
ATOM   1906 C  C   . LYS A 1  248 ? 56.507 2.835   36.494  1.00 34.16 ? 248  LYS A C   1 
ATOM   1907 O  O   . LYS A 1  248 ? 57.525 3.018   37.158  1.00 34.57 ? 248  LYS A O   1 
ATOM   1908 C  CB  . LYS A 1  248 ? 56.151 0.795   35.048  1.00 34.23 ? 248  LYS A CB  1 
ATOM   1909 C  CG  . LYS A 1  248 ? 57.630 0.693   34.701  1.00 36.62 ? 248  LYS A CG  1 
ATOM   1910 C  CD  . LYS A 1  248 ? 57.919 -0.481  33.769  1.00 39.66 ? 248  LYS A CD  1 
ATOM   1911 C  CE  . LYS A 1  248 ? 59.424 -0.701  33.621  1.00 41.70 ? 248  LYS A CE  1 
ATOM   1912 N  NZ  . LYS A 1  248 ? 59.760 -1.961  32.882  1.00 42.45 ? 248  LYS A NZ  1 
ATOM   1913 N  N   . LEU A 1  249 ? 55.877 3.811   35.849  1.00 34.21 ? 249  LEU A N   1 
ATOM   1914 C  CA  . LEU A 1  249 ? 56.385 5.181   35.777  1.00 34.09 ? 249  LEU A CA  1 
ATOM   1915 C  C   . LEU A 1  249 ? 56.426 5.917   37.111  1.00 33.98 ? 249  LEU A C   1 
ATOM   1916 O  O   . LEU A 1  249 ? 57.182 6.884   37.266  1.00 34.12 ? 249  LEU A O   1 
ATOM   1917 C  CB  . LEU A 1  249 ? 55.554 6.001   34.782  1.00 34.28 ? 249  LEU A CB  1 
ATOM   1918 C  CG  . LEU A 1  249 ? 55.789 5.782   33.286  1.00 35.21 ? 249  LEU A CG  1 
ATOM   1919 C  CD1 . LEU A 1  249 ? 54.592 6.290   32.486  1.00 35.34 ? 249  LEU A CD1 1 
ATOM   1920 C  CD2 . LEU A 1  249 ? 57.079 6.450   32.820  1.00 35.21 ? 249  LEU A CD2 1 
ATOM   1921 N  N   . THR A 1  250 ? 55.622 5.476   38.072  1.00 33.71 ? 250  THR A N   1 
ATOM   1922 C  CA  . THR A 1  250 ? 55.539 6.174   39.359  1.00 33.78 ? 250  THR A CA  1 
ATOM   1923 C  C   . THR A 1  250 ? 56.169 5.379   40.498  1.00 34.43 ? 250  THR A C   1 
ATOM   1924 O  O   . THR A 1  250 ? 56.050 5.757   41.668  1.00 34.50 ? 250  THR A O   1 
ATOM   1925 C  CB  . THR A 1  250 ? 54.082 6.517   39.742  1.00 33.52 ? 250  THR A CB  1 
ATOM   1926 O  OG1 . THR A 1  250 ? 53.326 5.307   39.879  1.00 31.88 ? 250  THR A OG1 1 
ATOM   1927 C  CG2 . THR A 1  250 ? 53.439 7.433   38.698  1.00 32.61 ? 250  THR A CG2 1 
ATOM   1928 N  N   . GLY A 1  251 ? 56.830 4.277   40.152  1.00 34.87 ? 251  GLY A N   1 
ATOM   1929 C  CA  . GLY A 1  251 ? 57.478 3.427   41.148  1.00 35.45 ? 251  GLY A CA  1 
ATOM   1930 C  C   . GLY A 1  251 ? 56.485 2.558   41.894  1.00 36.05 ? 251  GLY A C   1 
ATOM   1931 O  O   . GLY A 1  251 ? 56.768 2.088   43.002  1.00 36.01 ? 251  GLY A O   1 
ATOM   1932 N  N   . CYS A 1  252 ? 55.336 2.312   41.272  1.00 36.05 ? 252  CYS A N   1 
ATOM   1933 C  CA  . CYS A 1  252 ? 54.241 1.619   41.931  1.00 36.71 ? 252  CYS A CA  1 
ATOM   1934 C  C   . CYS A 1  252 ? 53.980 0.212   41.428  1.00 37.61 ? 252  CYS A C   1 
ATOM   1935 O  O   . CYS A 1  252 ? 52.976 -0.398  41.821  1.00 37.63 ? 252  CYS A O   1 
ATOM   1936 C  CB  . CYS A 1  252 ? 52.949 2.441   41.836  1.00 36.61 ? 252  CYS A CB  1 
ATOM   1937 S  SG  . CYS A 1  252 ? 52.819 3.724   43.078  1.00 35.60 ? 252  CYS A SG  1 
ATOM   1938 N  N   . SER A 1  253 ? 54.857 -0.305  40.565  1.00 38.76 ? 253  SER A N   1 
ATOM   1939 C  CA  . SER A 1  253 ? 54.751 -1.700  40.118  1.00 40.16 ? 253  SER A CA  1 
ATOM   1940 C  C   . SER A 1  253 ? 54.745 -2.636  41.324  1.00 40.98 ? 253  SER A C   1 
ATOM   1941 O  O   . SER A 1  253 ? 55.556 -2.485  42.234  1.00 41.20 ? 253  SER A O   1 
ATOM   1942 C  CB  . SER A 1  253 ? 55.891 -2.073  39.167  1.00 40.27 ? 253  SER A CB  1 
ATOM   1943 O  OG  . SER A 1  253 ? 55.768 -1.385  37.934  1.00 40.78 ? 253  SER A OG  1 
ATOM   1944 N  N   . ARG A 1  254 ? 53.806 -3.578  41.325  1.00 42.09 ? 254  ARG A N   1 
ATOM   1945 C  CA  . ARG A 1  254 ? 53.605 -4.541  42.415  1.00 42.95 ? 254  ARG A CA  1 
ATOM   1946 C  C   . ARG A 1  254 ? 53.175 -5.878  41.805  1.00 43.79 ? 254  ARG A C   1 
ATOM   1947 O  O   . ARG A 1  254 ? 52.731 -5.933  40.659  1.00 43.93 ? 254  ARG A O   1 
ATOM   1948 C  CB  . ARG A 1  254 ? 52.510 -4.044  43.384  1.00 42.84 ? 254  ARG A CB  1 
ATOM   1949 C  CG  . ARG A 1  254 ? 52.945 -3.524  44.775  1.00 42.76 ? 254  ARG A CG  1 
ATOM   1950 C  CD  . ARG A 1  254 ? 54.303 -2.846  44.774  1.00 41.98 ? 254  ARG A CD  1 
ATOM   1951 N  NE  . ARG A 1  254 ? 54.432 -1.761  45.744  1.00 40.45 ? 254  ARG A NE  1 
ATOM   1952 C  CZ  . ARG A 1  254 ? 55.168 -0.672  45.530  1.00 39.17 ? 254  ARG A CZ  1 
ATOM   1953 N  NH1 . ARG A 1  254 ? 55.246 0.280   46.449  1.00 37.40 ? 254  ARG A NH1 1 
ATOM   1954 N  NH2 . ARG A 1  254 ? 55.815 -0.527  44.381  1.00 37.78 ? 254  ARG A NH2 1 
ATOM   1955 N  N   . GLU A 1  255 ? 53.301 -6.951  42.576  1.00 44.73 ? 255  GLU A N   1 
ATOM   1956 C  CA  . GLU A 1  255 ? 52.732 -8.242  42.194  1.00 45.65 ? 255  GLU A CA  1 
ATOM   1957 C  C   . GLU A 1  255 ? 51.205 -8.232  42.376  1.00 45.88 ? 255  GLU A C   1 
ATOM   1958 O  O   . GLU A 1  255 ? 50.454 -8.683  41.507  1.00 46.14 ? 255  GLU A O   1 
ATOM   1959 C  CB  . GLU A 1  255 ? 53.395 -9.378  42.997  1.00 45.89 ? 255  GLU A CB  1 
ATOM   1960 C  CG  . GLU A 1  255 ? 53.280 -9.276  44.539  1.00 47.29 ? 255  GLU A CG  1 
ATOM   1961 C  CD  . GLU A 1  255 ? 53.812 -7.958  45.125  1.00 49.33 ? 255  GLU A CD  1 
ATOM   1962 O  OE1 . GLU A 1  255 ? 53.042 -7.274  45.843  1.00 49.82 ? 255  GLU A OE1 1 
ATOM   1963 O  OE2 . GLU A 1  255 ? 54.990 -7.603  44.865  1.00 49.63 ? 255  GLU A OE2 1 
ATOM   1964 N  N   . ASN A 1  256 ? 50.765 -7.684  43.505  1.00 46.11 ? 256  ASN A N   1 
ATOM   1965 C  CA  . ASN A 1  256 ? 49.358 -7.610  43.881  1.00 46.37 ? 256  ASN A CA  1 
ATOM   1966 C  C   . ASN A 1  256 ? 48.736 -6.321  43.340  1.00 45.73 ? 256  ASN A C   1 
ATOM   1967 O  O   . ASN A 1  256 ? 49.229 -5.224  43.620  1.00 45.52 ? 256  ASN A O   1 
ATOM   1968 C  CB  . ASN A 1  256 ? 49.273 -7.644  45.408  1.00 47.09 ? 256  ASN A CB  1 
ATOM   1969 C  CG  . ASN A 1  256 ? 47.878 -7.914  45.928  1.00 49.72 ? 256  ASN A CG  1 
ATOM   1970 O  OD1 . ASN A 1  256 ? 46.931 -7.166  45.659  1.00 51.16 ? 256  ASN A OD1 1 
ATOM   1971 N  ND2 . ASN A 1  256 ? 47.752 -8.993  46.701  1.00 53.97 ? 256  ASN A ND2 1 
ATOM   1972 N  N   . GLU A 1  257 ? 47.657 -6.459  42.569  1.00 45.12 ? 257  GLU A N   1 
ATOM   1973 C  CA  . GLU A 1  257 ? 47.017 -5.319  41.897  1.00 44.40 ? 257  GLU A CA  1 
ATOM   1974 C  C   . GLU A 1  257 ? 46.372 -4.329  42.859  1.00 43.78 ? 257  GLU A C   1 
ATOM   1975 O  O   . GLU A 1  257 ? 46.418 -3.121  42.624  1.00 43.63 ? 257  GLU A O   1 
ATOM   1976 C  CB  . GLU A 1  257 ? 45.973 -5.787  40.886  1.00 44.70 ? 257  GLU A CB  1 
ATOM   1977 C  CG  . GLU A 1  257 ? 46.517 -6.677  39.790  1.00 45.15 ? 257  GLU A CG  1 
ATOM   1978 C  CD  . GLU A 1  257 ? 45.599 -6.725  38.590  1.00 44.91 ? 257  GLU A CD  1 
ATOM   1979 O  OE1 . GLU A 1  257 ? 44.360 -6.726  38.770  1.00 44.25 ? 257  GLU A OE1 1 
ATOM   1980 O  OE2 . GLU A 1  257 ? 46.128 -6.759  37.464  1.00 45.12 ? 257  GLU A OE2 1 
ATOM   1981 N  N   . THR A 1  258 ? 45.762 -4.838  43.929  1.00 42.90 ? 258  THR A N   1 
ATOM   1982 C  CA  . THR A 1  258 ? 45.210 -3.971  44.966  1.00 41.88 ? 258  THR A CA  1 
ATOM   1983 C  C   . THR A 1  258 ? 46.319 -3.172  45.650  0.50 41.13 ? 258  THR A C   1 
ATOM   1984 O  O   . THR A 1  258 ? 46.093 -2.052  46.111  0.50 40.71 ? 258  THR A O   1 
ATOM   1985 C  CB  . THR A 1  258 ? 44.395 -4.764  45.997  0.50 41.91 ? 258  THR A CB  1 
ATOM   1986 O  OG1 . THR A 1  258 ? 43.253 -5.336  45.348  0.50 41.87 ? 258  THR A OG1 1 
ATOM   1987 C  CG2 . THR A 1  258 ? 43.924 -3.851  47.118  0.50 41.66 ? 258  THR A CG2 1 
ATOM   1988 N  N   . GLU A 1  259 ? 47.518 -3.754  45.689  1.00 40.26 ? 259  GLU A N   1 
ATOM   1989 C  CA  . GLU A 1  259 ? 48.704 -3.072  46.202  1.00 39.71 ? 259  GLU A CA  1 
ATOM   1990 C  C   . GLU A 1  259 ? 49.200 -1.978  45.247  1.00 38.46 ? 259  GLU A C   1 
ATOM   1991 O  O   . GLU A 1  259 ? 49.683 -0.938  45.698  1.00 38.49 ? 259  GLU A O   1 
ATOM   1992 C  CB  . GLU A 1  259 ? 49.832 -4.064  46.503  0.05 40.14 ? 259  GLU A CB  1 
ATOM   1993 C  CG  . GLU A 1  259 ? 49.589 -4.959  47.709  0.05 42.68 ? 259  GLU A CG  1 
ATOM   1994 C  CD  . GLU A 1  259 ? 49.433 -4.188  49.005  1.00 46.78 ? 259  GLU A CD  1 
ATOM   1995 O  OE1 . GLU A 1  259 ? 48.573 -4.585  49.822  1.00 48.90 ? 259  GLU A OE1 1 
ATOM   1996 O  OE2 . GLU A 1  259 ? 50.162 -3.191  49.217  1.00 48.07 ? 259  GLU A OE2 1 
ATOM   1997 N  N   . ILE A 1  260 ? 49.096 -2.213  43.939  1.00 36.96 ? 260  ILE A N   1 
ATOM   1998 C  CA  . ILE A 1  260 ? 49.400 -1.165  42.960  1.00 36.03 ? 260  ILE A CA  1 
ATOM   1999 C  C   . ILE A 1  260 ? 48.563 0.080   43.260  1.00 35.18 ? 260  ILE A C   1 
ATOM   2000 O  O   . ILE A 1  260 ? 49.090 1.190   43.333  1.00 34.81 ? 260  ILE A O   1 
ATOM   2001 C  CB  . ILE A 1  260 ? 49.150 -1.616  41.485  1.00 35.97 ? 260  ILE A CB  1 
ATOM   2002 C  CG1 . ILE A 1  260 ? 50.072 -2.777  41.104  1.00 35.94 ? 260  ILE A CG1 1 
ATOM   2003 C  CG2 . ILE A 1  260 ? 49.350 -0.431  40.517  1.00 35.84 ? 260  ILE A CG2 1 
ATOM   2004 C  CD1 . ILE A 1  260 ? 49.669 -3.506  39.835  1.00 36.44 ? 260  ILE A CD1 1 
ATOM   2005 N  N   . ILE A 1  261 ? 47.261 -0.126  43.453  1.00 34.53 ? 261  ILE A N   1 
ATOM   2006 C  CA  . ILE A 1  261 ? 46.318 0.973   43.633  1.00 33.83 ? 261  ILE A CA  1 
ATOM   2007 C  C   . ILE A 1  261 ? 46.594 1.693   44.948  1.00 33.66 ? 261  ILE A C   1 
ATOM   2008 O  O   . ILE A 1  261 ? 46.546 2.924   45.005  1.00 33.12 ? 261  ILE A O   1 
ATOM   2009 C  CB  . ILE A 1  261 ? 44.831 0.502   43.515  1.00 33.81 ? 261  ILE A CB  1 
ATOM   2010 C  CG1 . ILE A 1  261 ? 44.585 -0.179  42.163  1.00 33.66 ? 261  ILE A CG1 1 
ATOM   2011 C  CG2 . ILE A 1  261 ? 43.859 1.661   43.690  1.00 32.68 ? 261  ILE A CG2 1 
ATOM   2012 C  CD1 . ILE A 1  261 ? 44.928 0.689   40.936  1.00 34.69 ? 261  ILE A CD1 1 
ATOM   2013 N  N   . LYS A 1  262 ? 46.910 0.922   45.988  1.00 33.37 ? 262  LYS A N   1 
ATOM   2014 C  CA  . LYS A 1  262 ? 47.278 1.484   47.281  1.00 33.58 ? 262  LYS A CA  1 
ATOM   2015 C  C   . LYS A 1  262 ? 48.474 2.433   47.121  1.00 32.96 ? 262  LYS A C   1 
ATOM   2016 O  O   . LYS A 1  262 ? 48.435 3.575   47.601  1.00 32.94 ? 262  LYS A O   1 
ATOM   2017 C  CB  . LYS A 1  262 ? 47.590 0.360   48.278  1.00 34.10 ? 262  LYS A CB  1 
ATOM   2018 C  CG  . LYS A 1  262 ? 47.398 0.735   49.747  1.00 36.09 ? 262  LYS A CG  1 
ATOM   2019 C  CD  . LYS A 1  262 ? 48.634 1.392   50.345  1.00 39.43 ? 262  LYS A CD  1 
ATOM   2020 C  CE  . LYS A 1  262 ? 49.640 0.372   50.864  1.00 41.24 ? 262  LYS A CE  1 
ATOM   2021 N  NZ  . LYS A 1  262 ? 49.323 -0.045  52.267  1.00 43.45 ? 262  LYS A NZ  1 
ATOM   2022 N  N   . CYS A 1  263 ? 49.514 1.964   46.430  1.00 32.17 ? 263  CYS A N   1 
ATOM   2023 C  CA  . CYS A 1  263 ? 50.689 2.780   46.116  1.00 31.82 ? 263  CYS A CA  1 
ATOM   2024 C  C   . CYS A 1  263 ? 50.302 4.063   45.360  1.00 31.28 ? 263  CYS A C   1 
ATOM   2025 O  O   . CYS A 1  263 ? 50.766 5.158   45.697  1.00 30.41 ? 263  CYS A O   1 
ATOM   2026 C  CB  . CYS A 1  263 ? 51.707 1.963   45.311  1.00 32.02 ? 263  CYS A CB  1 
ATOM   2027 S  SG  . CYS A 1  263 ? 53.264 2.816   44.864  1.00 33.94 ? 263  CYS A SG  1 
ATOM   2028 N  N   . LEU A 1  264 ? 49.434 3.929   44.359  1.00 30.55 ? 264  LEU A N   1 
ATOM   2029 C  CA  . LEU A 1  264 ? 49.026 5.087   43.561  1.00 30.37 ? 264  LEU A CA  1 
ATOM   2030 C  C   . LEU A 1  264 ? 48.269 6.121   44.384  1.00 30.42 ? 264  LEU A C   1 
ATOM   2031 O  O   . LEU A 1  264 ? 48.392 7.314   44.133  1.00 30.60 ? 264  LEU A O   1 
ATOM   2032 C  CB  . LEU A 1  264 ? 48.233 4.661   42.321  1.00 29.86 ? 264  LEU A CB  1 
ATOM   2033 C  CG  . LEU A 1  264 ? 49.030 4.032   41.172  1.00 30.39 ? 264  LEU A CG  1 
ATOM   2034 C  CD1 . LEU A 1  264 ? 48.087 3.529   40.083  1.00 29.99 ? 264  LEU A CD1 1 
ATOM   2035 C  CD2 . LEU A 1  264 ? 50.038 5.007   40.573  1.00 30.29 ? 264  LEU A CD2 1 
ATOM   2036 N  N   . ARG A 1  265 ? 47.516 5.666   45.383  1.00 30.58 ? 265  ARG A N   1 
ATOM   2037 C  CA  . ARG A 1  265 ? 46.788 6.563   46.276  1.00 31.13 ? 265  ARG A CA  1 
ATOM   2038 C  C   . ARG A 1  265 ? 47.708 7.357   47.201  1.00 31.34 ? 265  ARG A C   1 
ATOM   2039 O  O   . ARG A 1  265 ? 47.281 8.314   47.840  1.00 31.33 ? 265  ARG A O   1 
ATOM   2040 C  CB  . ARG A 1  265 ? 45.798 5.780   47.125  1.00 31.56 ? 265  ARG A CB  1 
ATOM   2041 C  CG  . ARG A 1  265 ? 44.585 5.258   46.377  1.00 32.94 ? 265  ARG A CG  1 
ATOM   2042 C  CD  . ARG A 1  265 ? 43.483 4.958   47.363  1.00 36.60 ? 265  ARG A CD  1 
ATOM   2043 N  NE  . ARG A 1  265 ? 42.933 3.629   47.128  1.00 39.86 ? 265  ARG A NE  1 
ATOM   2044 C  CZ  . ARG A 1  265 ? 43.314 2.531   47.771  1.00 39.97 ? 265  ARG A CZ  1 
ATOM   2045 N  NH1 . ARG A 1  265 ? 42.751 1.379   47.466  1.00 40.07 ? 265  ARG A NH1 1 
ATOM   2046 N  NH2 . ARG A 1  265 ? 44.246 2.583   48.723  1.00 41.04 ? 265  ARG A NH2 1 
ATOM   2047 N  N   . ASN A 1  266 ? 48.967 6.940   47.288  1.00 31.64 ? 266  ASN A N   1 
ATOM   2048 C  CA  . ASN A 1  266 ? 49.948 7.661   48.086  1.00 31.91 ? 266  ASN A CA  1 
ATOM   2049 C  C   . ASN A 1  266 ? 50.704 8.702   47.299  1.00 31.68 ? 266  ASN A C   1 
ATOM   2050 O  O   . ASN A 1  266 ? 51.346 9.571   47.891  1.00 32.47 ? 266  ASN A O   1 
ATOM   2051 C  CB  . ASN A 1  266 ? 50.922 6.682   48.737  1.00 32.49 ? 266  ASN A CB  1 
ATOM   2052 C  CG  . ASN A 1  266 ? 50.240 5.784   49.719  1.00 34.78 ? 266  ASN A CG  1 
ATOM   2053 O  OD1 . ASN A 1  266 ? 49.325 6.210   50.432  1.00 38.16 ? 266  ASN A OD1 1 
ATOM   2054 N  ND2 . ASN A 1  266 ? 50.664 4.526   49.767  1.00 38.44 ? 266  ASN A ND2 1 
ATOM   2055 N  N   . LYS A 1  267 ? 50.636 8.622   45.971  1.00 31.00 ? 267  LYS A N   1 
ATOM   2056 C  CA  . LYS A 1  267 ? 51.331 9.584   45.124  1.00 30.56 ? 267  LYS A CA  1 
ATOM   2057 C  C   . LYS A 1  267 ? 50.650 10.937  45.158  1.00 29.99 ? 267  LYS A C   1 
ATOM   2058 O  O   . LYS A 1  267 ? 49.427 11.014  45.239  1.00 30.07 ? 267  LYS A O   1 
ATOM   2059 C  CB  . LYS A 1  267 ? 51.431 9.091   43.671  1.00 30.54 ? 267  LYS A CB  1 
ATOM   2060 C  CG  . LYS A 1  267 ? 52.105 7.723   43.492  1.00 30.75 ? 267  LYS A CG  1 
ATOM   2061 C  CD  . LYS A 1  267 ? 53.443 7.623   44.217  1.00 33.05 ? 267  LYS A CD  1 
ATOM   2062 C  CE  . LYS A 1  267 ? 54.587 8.015   43.322  1.00 34.37 ? 267  LYS A CE  1 
ATOM   2063 N  NZ  . LYS A 1  267 ? 55.915 7.824   43.993  1.00 35.76 ? 267  LYS A NZ  1 
ATOM   2064 N  N   . ASP A 1  268 ? 51.445 12.007  45.121  1.00 29.76 ? 268  ASP A N   1 
ATOM   2065 C  CA  A ASP A 1  268 ? 50.895 13.346  44.956  0.60 29.79 ? 268  ASP A CA  1 
ATOM   2066 C  CA  B ASP A 1  268 ? 50.897 13.352  44.952  0.40 29.34 ? 268  ASP A CA  1 
ATOM   2067 C  C   . ASP A 1  268 ? 50.139 13.385  43.621  1.00 29.22 ? 268  ASP A C   1 
ATOM   2068 O  O   . ASP A 1  268 ? 50.604 12.805  42.631  1.00 28.70 ? 268  ASP A O   1 
ATOM   2069 C  CB  A ASP A 1  268 ? 52.010 14.387  44.969  0.60 30.13 ? 268  ASP A CB  1 
ATOM   2070 C  CB  B ASP A 1  268 ? 52.007 14.405  44.948  0.40 29.28 ? 268  ASP A CB  1 
ATOM   2071 C  CG  A ASP A 1  268 ? 51.537 15.748  44.517  0.60 31.50 ? 268  ASP A CG  1 
ATOM   2072 C  CG  B ASP A 1  268 ? 52.742 14.492  46.276  0.40 28.93 ? 268  ASP A CG  1 
ATOM   2073 O  OD1 A ASP A 1  268 ? 50.828 16.440  45.279  0.60 33.45 ? 268  ASP A OD1 1 
ATOM   2074 O  OD1 B ASP A 1  268 ? 52.086 14.538  47.338  0.40 27.69 ? 268  ASP A OD1 1 
ATOM   2075 O  OD2 A ASP A 1  268 ? 51.876 16.131  43.385  0.60 33.65 ? 268  ASP A OD2 1 
ATOM   2076 O  OD2 B ASP A 1  268 ? 53.986 14.519  46.250  0.40 29.55 ? 268  ASP A OD2 1 
ATOM   2077 N  N   . PRO A 1  269 ? 48.968 14.060  43.582  1.00 29.16 ? 269  PRO A N   1 
ATOM   2078 C  CA  . PRO A 1  269 ? 48.230 14.031  42.309  1.00 28.89 ? 269  PRO A CA  1 
ATOM   2079 C  C   . PRO A 1  269 ? 49.070 14.561  41.153  1.00 29.07 ? 269  PRO A C   1 
ATOM   2080 O  O   . PRO A 1  269 ? 48.946 14.074  40.033  1.00 28.95 ? 269  PRO A O   1 
ATOM   2081 C  CB  . PRO A 1  269 ? 47.013 14.922  42.574  1.00 29.01 ? 269  PRO A CB  1 
ATOM   2082 C  CG  . PRO A 1  269 ? 47.354 15.721  43.783  1.00 28.56 ? 269  PRO A CG  1 
ATOM   2083 C  CD  . PRO A 1  269 ? 48.258 14.861  44.599  1.00 28.92 ? 269  PRO A CD  1 
ATOM   2084 N  N   . GLN A 1  270 ? 49.971 15.500  41.440  1.00 29.31 ? 270  GLN A N   1 
ATOM   2085 C  CA  . GLN A 1  270 ? 50.866 16.064  40.427  1.00 29.84 ? 270  GLN A CA  1 
ATOM   2086 C  C   . GLN A 1  270 ? 51.786 15.012  39.784  1.00 29.36 ? 270  GLN A C   1 
ATOM   2087 O  O   . GLN A 1  270 ? 52.076 15.094  38.591  1.00 28.92 ? 270  GLN A O   1 
ATOM   2088 C  CB  . GLN A 1  270 ? 51.678 17.239  41.025  1.00 30.63 ? 270  GLN A CB  1 
ATOM   2089 C  CG  . GLN A 1  270 ? 52.327 18.176  40.012  1.00 33.51 ? 270  GLN A CG  1 
ATOM   2090 C  CD  . GLN A 1  270 ? 51.316 18.789  39.036  1.00 37.86 ? 270  GLN A CD  1 
ATOM   2091 O  OE1 . GLN A 1  270 ? 51.477 18.676  37.815  1.00 40.54 ? 270  GLN A OE1 1 
ATOM   2092 N  NE2 . GLN A 1  270 ? 50.264 19.423  39.571  1.00 36.98 ? 270  GLN A NE2 1 
ATOM   2093 N  N   . GLU A 1  271 ? 52.233 14.024  40.560  1.00 28.95 ? 271  GLU A N   1 
ATOM   2094 C  CA  . GLU A 1  271 ? 53.036 12.931  40.005  1.00 29.37 ? 271  GLU A CA  1 
ATOM   2095 C  C   . GLU A 1  271 ? 52.218 12.076  39.033  1.00 28.68 ? 271  GLU A C   1 
ATOM   2096 O  O   . GLU A 1  271 ? 52.732 11.582  38.031  1.00 28.77 ? 271  GLU A O   1 
ATOM   2097 C  CB  . GLU A 1  271 ? 53.561 11.997  41.096  1.00 29.41 ? 271  GLU A CB  1 
ATOM   2098 C  CG  . GLU A 1  271 ? 54.388 12.638  42.193  1.00 33.30 ? 271  GLU A CG  1 
ATOM   2099 C  CD  . GLU A 1  271 ? 54.854 11.598  43.202  1.00 37.09 ? 271  GLU A CD  1 
ATOM   2100 O  OE1 . GLU A 1  271 ? 55.543 10.632  42.771  1.00 38.09 ? 271  GLU A OE1 1 
ATOM   2101 O  OE2 . GLU A 1  271 ? 54.527 11.744  44.409  1.00 38.80 ? 271  GLU A OE2 1 
ATOM   2102 N  N   . ILE A 1  272 ? 50.952 11.870  39.359  1.00 28.41 ? 272  ILE A N   1 
ATOM   2103 C  CA  . ILE A 1  272 ? 50.058 11.129  38.459  1.00 28.45 ? 272  ILE A CA  1 
ATOM   2104 C  C   . ILE A 1  272 ? 49.865 11.882  37.143  1.00 28.03 ? 272  ILE A C   1 
ATOM   2105 O  O   . ILE A 1  272 ? 50.071 11.305  36.075  1.00 28.12 ? 272  ILE A O   1 
ATOM   2106 C  CB  . ILE A 1  272 ? 48.742 10.770  39.148  1.00 28.15 ? 272  ILE A CB  1 
ATOM   2107 C  CG1 . ILE A 1  272 ? 49.023 9.681   40.179  1.00 28.95 ? 272  ILE A CG1 1 
ATOM   2108 C  CG2 . ILE A 1  272 ? 47.675 10.293  38.120  1.00 28.52 ? 272  ILE A CG2 1 
ATOM   2109 C  CD1 . ILE A 1  272 ? 48.059 9.647   41.335  1.00 30.03 ? 272  ILE A CD1 1 
ATOM   2110 N  N   . LEU A 1  273 ? 49.528 13.172  37.225  1.00 27.80 ? 273  LEU A N   1 
ATOM   2111 C  CA  . LEU A 1  273 ? 49.276 13.994  36.025  1.00 27.78 ? 273  LEU A CA  1 
ATOM   2112 C  C   . LEU A 1  273 ? 50.468 14.017  35.082  1.00 28.53 ? 273  LEU A C   1 
ATOM   2113 O  O   . LEU A 1  273 ? 50.323 13.878  33.850  1.00 28.39 ? 273  LEU A O   1 
ATOM   2114 C  CB  . LEU A 1  273 ? 48.913 15.430  36.416  1.00 27.10 ? 273  LEU A CB  1 
ATOM   2115 C  CG  . LEU A 1  273 ? 47.547 15.690  37.070  1.00 26.26 ? 273  LEU A CG  1 
ATOM   2116 C  CD1 . LEU A 1  273 ? 47.460 17.160  37.453  1.00 22.90 ? 273  LEU A CD1 1 
ATOM   2117 C  CD2 . LEU A 1  273 ? 46.372 15.308  36.142  1.00 22.45 ? 273  LEU A CD2 1 
ATOM   2118 N  N   . LEU A 1  274 ? 51.644 14.180  35.691  1.00 28.88 ? 274  LEU A N   1 
ATOM   2119 C  CA  . LEU A 1  274 ? 52.916 14.286  35.003  1.00 30.08 ? 274  LEU A CA  1 
ATOM   2120 C  C   . LEU A 1  274 ? 53.199 13.061  34.142  1.00 29.82 ? 274  LEU A C   1 
ATOM   2121 O  O   . LEU A 1  274 ? 53.781 13.170  33.065  1.00 30.62 ? 274  LEU A O   1 
ATOM   2122 C  CB  . LEU A 1  274 ? 54.023 14.440  36.048  1.00 30.69 ? 274  LEU A CB  1 
ATOM   2123 C  CG  . LEU A 1  274 ? 55.057 15.557  35.920  1.00 33.51 ? 274  LEU A CG  1 
ATOM   2124 C  CD1 . LEU A 1  274 ? 54.430 16.949  36.112  1.00 35.15 ? 274  LEU A CD1 1 
ATOM   2125 C  CD2 . LEU A 1  274 ? 56.185 15.320  36.941  1.00 34.22 ? 274  LEU A CD2 1 
ATOM   2126 N  N   . ASN A 1  275 ? 52.771 11.897  34.608  1.00 29.90 ? 275  ASN A N   1 
ATOM   2127 C  CA  . ASN A 1  275 ? 53.078 10.639  33.921  1.00 30.22 ? 275  ASN A CA  1 
ATOM   2128 C  C   . ASN A 1  275 ? 52.017 10.126  32.923  1.00 30.22 ? 275  ASN A C   1 
ATOM   2129 O  O   . ASN A 1  275 ? 52.290 9.213   32.138  1.00 29.95 ? 275  ASN A O   1 
ATOM   2130 C  CB  . ASN A 1  275 ? 53.461 9.581   34.961  1.00 29.82 ? 275  ASN A CB  1 
ATOM   2131 C  CG  . ASN A 1  275 ? 54.880 9.781   35.489  1.00 30.27 ? 275  ASN A CG  1 
ATOM   2132 O  OD1 . ASN A 1  275 ? 55.091 10.234  36.619  1.00 29.98 ? 275  ASN A OD1 1 
ATOM   2133 N  ND2 . ASN A 1  275 ? 55.853 9.478   34.655  1.00 27.56 ? 275  ASN A ND2 1 
ATOM   2134 N  N   . GLU A 1  276 ? 50.826 10.734  32.948  1.00 30.95 ? 276  GLU A N   1 
ATOM   2135 C  CA  . GLU A 1  276 ? 49.703 10.368  32.065  1.00 31.17 ? 276  GLU A CA  1 
ATOM   2136 C  C   . GLU A 1  276 ? 50.060 10.332  30.579  1.00 31.67 ? 276  GLU A C   1 
ATOM   2137 O  O   . GLU A 1  276 ? 49.676 9.392   29.882  1.00 31.84 ? 276  GLU A O   1 
ATOM   2138 C  CB  . GLU A 1  276 ? 48.503 11.318  32.270  1.00 31.16 ? 276  GLU A CB  1 
ATOM   2139 C  CG  . GLU A 1  276 ? 47.832 11.200  33.615  1.00 30.19 ? 276  GLU A CG  1 
ATOM   2140 C  CD  . GLU A 1  276 ? 46.521 11.967  33.718  1.00 30.16 ? 276  GLU A CD  1 
ATOM   2141 O  OE1 . GLU A 1  276 ? 46.229 12.863  32.887  1.00 31.11 ? 276  GLU A OE1 1 
ATOM   2142 O  OE2 . GLU A 1  276 ? 45.771 11.672  34.659  1.00 31.44 ? 276  GLU A OE2 1 
ATOM   2143 N  N   . ALA A 1  277 ? 50.773 11.351  30.090  1.00 32.21 ? 277  ALA A N   1 
ATOM   2144 C  CA  . ALA A 1  277 ? 51.128 11.417  28.662  1.00 32.84 ? 277  ALA A CA  1 
ATOM   2145 C  C   . ALA A 1  277 ? 51.956 10.219  28.204  1.00 33.73 ? 277  ALA A C   1 
ATOM   2146 O  O   . ALA A 1  277 ? 51.864 9.787   27.049  1.00 33.76 ? 277  ALA A O   1 
ATOM   2147 C  CB  . ALA A 1  277 ? 51.846 12.700  28.337  1.00 32.88 ? 277  ALA A CB  1 
ATOM   2148 N  N   . PHE A 1  278 ? 52.735 9.665   29.130  1.00 34.51 ? 278  PHE A N   1 
ATOM   2149 C  CA  . PHE A 1  278 ? 53.697 8.607   28.818  1.00 35.06 ? 278  PHE A CA  1 
ATOM   2150 C  C   . PHE A 1  278 ? 53.166 7.176   28.904  1.00 35.08 ? 278  PHE A C   1 
ATOM   2151 O  O   . PHE A 1  278 ? 53.886 6.227   28.558  1.00 34.98 ? 278  PHE A O   1 
ATOM   2152 C  CB  . PHE A 1  278 ? 54.952 8.786   29.688  1.00 35.53 ? 278  PHE A CB  1 
ATOM   2153 C  CG  . PHE A 1  278 ? 55.483 10.179  29.659  1.00 37.34 ? 278  PHE A CG  1 
ATOM   2154 C  CD1 . PHE A 1  278 ? 56.113 10.666  28.522  1.00 39.58 ? 278  PHE A CD1 1 
ATOM   2155 C  CD2 . PHE A 1  278 ? 55.303 11.027  30.741  1.00 39.91 ? 278  PHE A CD2 1 
ATOM   2156 C  CE1 . PHE A 1  278 ? 56.587 11.981  28.473  1.00 40.83 ? 278  PHE A CE1 1 
ATOM   2157 C  CE2 . PHE A 1  278 ? 55.770 12.338  30.704  1.00 41.48 ? 278  PHE A CE2 1 
ATOM   2158 C  CZ  . PHE A 1  278 ? 56.414 12.813  29.564  1.00 41.69 ? 278  PHE A CZ  1 
ATOM   2159 N  N   . VAL A 1  279 ? 51.910 7.001   29.316  1.00 34.84 ? 279  VAL A N   1 
ATOM   2160 C  CA  . VAL A 1  279 ? 51.376 5.638   29.467  1.00 34.97 ? 279  VAL A CA  1 
ATOM   2161 C  C   . VAL A 1  279 ? 51.178 4.895   28.141  1.00 35.94 ? 279  VAL A C   1 
ATOM   2162 O  O   . VAL A 1  279 ? 50.891 3.704   28.141  1.00 35.81 ? 279  VAL A O   1 
ATOM   2163 C  CB  . VAL A 1  279 ? 50.079 5.568   30.318  1.00 34.96 ? 279  VAL A CB  1 
ATOM   2164 C  CG1 . VAL A 1  279 ? 50.339 6.080   31.729  1.00 33.00 ? 279  VAL A CG1 1 
ATOM   2165 C  CG2 . VAL A 1  279 ? 48.935 6.321   29.643  1.00 32.86 ? 279  VAL A CG2 1 
ATOM   2166 N  N   . VAL A 1  280 ? 51.323 5.609   27.027  1.00 37.16 ? 280  VAL A N   1 
ATOM   2167 C  CA  . VAL A 1  280 ? 51.267 5.018   25.685  1.00 38.47 ? 280  VAL A CA  1 
ATOM   2168 C  C   . VAL A 1  280 ? 52.575 5.257   24.917  1.00 39.30 ? 280  VAL A C   1 
ATOM   2169 O  O   . VAL A 1  280 ? 53.203 6.306   25.084  1.00 39.64 ? 280  VAL A O   1 
ATOM   2170 C  CB  . VAL A 1  280 ? 50.060 5.565   24.863  1.00 38.46 ? 280  VAL A CB  1 
ATOM   2171 C  CG1 . VAL A 1  280 ? 48.772 4.953   25.359  1.00 38.64 ? 280  VAL A CG1 1 
ATOM   2172 C  CG2 . VAL A 1  280 ? 49.996 7.086   24.920  1.00 38.33 ? 280  VAL A CG2 1 
ATOM   2173 N  N   . PRO A 1  281 ? 52.991 4.291   24.071  1.00 40.42 ? 281  PRO A N   1 
ATOM   2174 C  CA  . PRO A 1  281 ? 54.292 4.435   23.393  1.00 41.15 ? 281  PRO A CA  1 
ATOM   2175 C  C   . PRO A 1  281 ? 54.283 5.625   22.435  1.00 41.66 ? 281  PRO A C   1 
ATOM   2176 O  O   . PRO A 1  281 ? 55.242 6.396   22.397  1.00 41.89 ? 281  PRO A O   1 
ATOM   2177 C  CB  . PRO A 1  281 ? 54.448 3.112   22.629  1.00 41.17 ? 281  PRO A CB  1 
ATOM   2178 C  CG  . PRO A 1  281 ? 53.045 2.625   22.414  1.00 41.21 ? 281  PRO A CG  1 
ATOM   2179 C  CD  . PRO A 1  281 ? 52.258 3.092   23.620  1.00 40.68 ? 281  PRO A CD  1 
ATOM   2180 N  N   . TYR A 1  282 ? 53.191 5.773   21.687  1.00 42.20 ? 282  TYR A N   1 
ATOM   2181 C  CA  . TYR A 1  282 ? 52.981 6.935   20.832  1.00 42.67 ? 282  TYR A CA  1 
ATOM   2182 C  C   . TYR A 1  282 ? 51.572 7.468   21.051  1.00 42.21 ? 282  TYR A C   1 
ATOM   2183 O  O   . TYR A 1  282 ? 50.645 6.702   21.322  1.00 42.81 ? 282  TYR A O   1 
ATOM   2184 C  CB  . TYR A 1  282 ? 53.219 6.601   19.350  1.00 43.46 ? 282  TYR A CB  1 
ATOM   2185 C  CG  . TYR A 1  282 ? 52.735 5.229   18.907  1.00 45.43 ? 282  TYR A CG  1 
ATOM   2186 C  CD1 . TYR A 1  282 ? 51.369 4.933   18.828  1.00 47.25 ? 282  TYR A CD1 1 
ATOM   2187 C  CD2 . TYR A 1  282 ? 53.647 4.227   18.558  1.00 47.75 ? 282  TYR A CD2 1 
ATOM   2188 C  CE1 . TYR A 1  282 ? 50.915 3.672   18.415  1.00 48.11 ? 282  TYR A CE1 1 
ATOM   2189 C  CE2 . TYR A 1  282 ? 53.203 2.960   18.141  1.00 48.86 ? 282  TYR A CE2 1 
ATOM   2190 C  CZ  . TYR A 1  282 ? 51.834 2.695   18.075  1.00 48.83 ? 282  TYR A CZ  1 
ATOM   2191 O  OH  . TYR A 1  282 ? 51.387 1.457   17.670  1.00 49.82 ? 282  TYR A OH  1 
ATOM   2192 N  N   . GLY A 1  283 ? 51.426 8.783   20.969  1.00 41.07 ? 283  GLY A N   1 
ATOM   2193 C  CA  . GLY A 1  283 ? 50.134 9.422   21.142  1.00 39.55 ? 283  GLY A CA  1 
ATOM   2194 C  C   . GLY A 1  283 ? 49.833 10.303  19.948  1.00 38.26 ? 283  GLY A C   1 
ATOM   2195 O  O   . GLY A 1  283 ? 50.693 10.527  19.097  1.00 38.19 ? 283  GLY A O   1 
ATOM   2196 N  N   . THR A 1  284 ? 48.605 10.799  19.884  1.00 36.69 ? 284  THR A N   1 
ATOM   2197 C  CA  . THR A 1  284 ? 48.209 11.729  18.837  1.00 34.77 ? 284  THR A CA  1 
ATOM   2198 C  C   . THR A 1  284 ? 47.634 12.961  19.523  1.00 33.86 ? 284  THR A C   1 
ATOM   2199 O  O   . THR A 1  284 ? 47.348 12.908  20.718  1.00 33.22 ? 284  THR A O   1 
ATOM   2200 C  CB  . THR A 1  284 ? 47.140 11.101  17.892  1.00 34.79 ? 284  THR A CB  1 
ATOM   2201 O  OG1 . THR A 1  284 ? 45.903 10.964  18.592  1.00 33.92 ? 284  THR A OG1 1 
ATOM   2202 C  CG2 . THR A 1  284 ? 47.573 9.737   17.398  1.00 33.75 ? 284  THR A CG2 1 
ATOM   2203 N  N   . PRO A 1  285 ? 47.455 14.071  18.774  1.00 33.13 ? 285  PRO A N   1 
ATOM   2204 C  CA  . PRO A 1  285 ? 46.744 15.232  19.301  1.00 32.82 ? 285  PRO A CA  1 
ATOM   2205 C  C   . PRO A 1  285 ? 45.324 14.891  19.760  1.00 32.45 ? 285  PRO A C   1 
ATOM   2206 O  O   . PRO A 1  285 ? 44.662 15.732  20.365  1.00 32.39 ? 285  PRO A O   1 
ATOM   2207 C  CB  . PRO A 1  285 ? 46.672 16.169  18.101  1.00 32.85 ? 285  PRO A CB  1 
ATOM   2208 C  CG  . PRO A 1  285 ? 47.844 15.795  17.266  1.00 33.23 ? 285  PRO A CG  1 
ATOM   2209 C  CD  . PRO A 1  285 ? 47.979 14.322  17.415  1.00 33.21 ? 285  PRO A CD  1 
ATOM   2210 N  N   . LEU A 1  286 ? 44.856 13.681  19.456  1.00 31.68 ? 286  LEU A N   1 
ATOM   2211 C  CA  . LEU A 1  286 ? 43.527 13.244  19.891  1.00 31.57 ? 286  LEU A CA  1 
ATOM   2212 C  C   . LEU A 1  286 ? 43.565 12.140  20.928  1.00 31.08 ? 286  LEU A C   1 
ATOM   2213 O  O   . LEU A 1  286 ? 42.537 11.510  21.172  1.00 31.24 ? 286  LEU A O   1 
ATOM   2214 C  CB  . LEU A 1  286 ? 42.710 12.760  18.698  1.00 31.62 ? 286  LEU A CB  1 
ATOM   2215 C  CG  . LEU A 1  286 ? 42.053 13.892  17.936  1.00 32.65 ? 286  LEU A CG  1 
ATOM   2216 C  CD1 . LEU A 1  286 ? 42.274 13.667  16.465  1.00 33.73 ? 286  LEU A CD1 1 
ATOM   2217 C  CD2 . LEU A 1  286 ? 40.571 13.934  18.295  1.00 32.87 ? 286  LEU A CD2 1 
ATOM   2218 N  N   . SER A 1  287 ? 44.736 11.903  21.530  1.00 29.90 ? 287  SER A N   1 
ATOM   2219 C  CA  . SER A 1  287 ? 44.886 10.835  22.535  1.00 29.08 ? 287  SER A CA  1 
ATOM   2220 C  C   . SER A 1  287 ? 43.957 10.991  23.728  1.00 27.65 ? 287  SER A C   1 
ATOM   2221 O  O   . SER A 1  287 ? 43.864 12.043  24.327  1.00 28.01 ? 287  SER A O   1 
ATOM   2222 C  CB  . SER A 1  287 ? 46.320 10.763  23.071  1.00 28.95 ? 287  SER A CB  1 
ATOM   2223 O  OG  . SER A 1  287 ? 47.155 10.070  22.168  1.00 30.65 ? 287  SER A OG  1 
ATOM   2224 N  N   . VAL A 1  288 ? 43.322 9.893   24.091  1.00 26.51 ? 288  VAL A N   1 
ATOM   2225 C  CA  . VAL A 1  288 ? 42.506 9.822   25.283  1.00 24.49 ? 288  VAL A CA  1 
ATOM   2226 C  C   . VAL A 1  288 ? 43.162 8.710   26.092  1.00 24.63 ? 288  VAL A C   1 
ATOM   2227 O  O   . VAL A 1  288 ? 42.838 7.529   25.956  1.00 23.62 ? 288  VAL A O   1 
ATOM   2228 C  CB  . VAL A 1  288 ? 41.045 9.524   24.906  1.00 24.04 ? 288  VAL A CB  1 
ATOM   2229 C  CG1 . VAL A 1  288 ? 40.201 9.198   26.126  1.00 23.00 ? 288  VAL A CG1 1 
ATOM   2230 C  CG2 . VAL A 1  288 ? 40.475 10.729  24.146  1.00 21.40 ? 288  VAL A CG2 1 
ATOM   2231 N  N   . ASN A 1  289 ? 44.125 9.091   26.919  1.00 24.50 ? 289  ASN A N   1 
ATOM   2232 C  CA  . ASN A 1  289 ? 44.916 8.068   27.582  1.00 24.60 ? 289  ASN A CA  1 
ATOM   2233 C  C   . ASN A 1  289 ? 44.121 7.265   28.582  1.00 23.57 ? 289  ASN A C   1 
ATOM   2234 O  O   . ASN A 1  289 ? 44.237 6.051   28.607  1.00 22.89 ? 289  ASN A O   1 
ATOM   2235 C  CB  . ASN A 1  289 ? 46.204 8.647   28.140  1.00 25.55 ? 289  ASN A CB  1 
ATOM   2236 C  CG  . ASN A 1  289 ? 47.254 8.820   27.035  1.00 27.59 ? 289  ASN A CG  1 
ATOM   2237 O  OD1 . ASN A 1  289 ? 48.212 9.569   27.166  1.00 31.26 ? 289  ASN A OD1 1 
ATOM   2238 N  ND2 . ASN A 1  289 ? 47.037 8.131   25.923  1.00 29.48 ? 289  ASN A ND2 1 
ATOM   2239 N  N   . PHE A 1  290 ? 43.286 7.967   29.345  1.00 22.38 ? 290  PHE A N   1 
ATOM   2240 C  CA  . PHE A 1  290 ? 42.389 7.371   30.326  1.00 22.17 ? 290  PHE A CA  1 
ATOM   2241 C  C   . PHE A 1  290 ? 40.955 7.744   30.010  1.00 21.58 ? 290  PHE A C   1 
ATOM   2242 O  O   . PHE A 1  290 ? 40.520 8.869   30.279  1.00 22.13 ? 290  PHE A O   1 
ATOM   2243 C  CB  . PHE A 1  290 ? 42.800 7.808   31.737  1.00 21.66 ? 290  PHE A CB  1 
ATOM   2244 C  CG  . PHE A 1  290 ? 44.166 7.335   32.095  1.00 22.69 ? 290  PHE A CG  1 
ATOM   2245 C  CD1 . PHE A 1  290 ? 44.362 6.030   32.531  1.00 22.69 ? 290  PHE A CD1 1 
ATOM   2246 C  CD2 . PHE A 1  290 ? 45.273 8.152   31.883  1.00 23.35 ? 290  PHE A CD2 1 
ATOM   2247 C  CE1 . PHE A 1  290 ? 45.645 5.562   32.810  1.00 24.71 ? 290  PHE A CE1 1 
ATOM   2248 C  CE2 . PHE A 1  290 ? 46.558 7.686   32.164  1.00 23.74 ? 290  PHE A CE2 1 
ATOM   2249 C  CZ  . PHE A 1  290 ? 46.740 6.397   32.625  1.00 22.82 ? 290  PHE A CZ  1 
ATOM   2250 N  N   . GLY A 1  291 ? 40.222 6.800   29.428  1.00 21.32 ? 291  GLY A N   1 
ATOM   2251 C  CA  . GLY A 1  291 ? 38.833 7.056   29.025  1.00 20.06 ? 291  GLY A CA  1 
ATOM   2252 C  C   . GLY A 1  291 ? 37.861 6.009   29.530  1.00 20.13 ? 291  GLY A C   1 
ATOM   2253 O  O   . GLY A 1  291 ? 38.231 5.138   30.330  1.00 19.78 ? 291  GLY A O   1 
ATOM   2254 N  N   . PRO A 1  292 ? 36.599 6.092   29.077  1.00 19.64 ? 292  PRO A N   1 
ATOM   2255 C  CA  . PRO A 1  292 ? 35.592 5.092   29.434  1.00 20.08 ? 292  PRO A CA  1 
ATOM   2256 C  C   . PRO A 1  292 ? 36.012 3.696   29.019  1.00 20.06 ? 292  PRO A C   1 
ATOM   2257 O  O   . PRO A 1  292 ? 36.710 3.523   28.016  1.00 20.62 ? 292  PRO A O   1 
ATOM   2258 C  CB  . PRO A 1  292 ? 34.362 5.534   28.627  1.00 19.78 ? 292  PRO A CB  1 
ATOM   2259 C  CG  . PRO A 1  292 ? 34.524 7.041   28.529  1.00 19.34 ? 292  PRO A CG  1 
ATOM   2260 C  CD  . PRO A 1  292 ? 36.016 7.209   28.312  1.00 19.70 ? 292  PRO A CD  1 
ATOM   2261 N  N   . THR A 1  293 ? 35.613 2.708   29.804  1.00 20.66 ? 293  THR A N   1 
ATOM   2262 C  CA  . THR A 1  293 ? 35.931 1.322   29.500  1.00 21.16 ? 293  THR A CA  1 
ATOM   2263 C  C   . THR A 1  293 ? 34.680 0.499   29.768  1.00 21.37 ? 293  THR A C   1 
ATOM   2264 O  O   . THR A 1  293 ? 33.730 0.984   30.412  1.00 21.08 ? 293  THR A O   1 
ATOM   2265 C  CB  . THR A 1  293 ? 37.045 0.769   30.421  1.00 21.80 ? 293  THR A CB  1 
ATOM   2266 O  OG1 . THR A 1  293 ? 36.676 0.993   31.790  1.00 21.88 ? 293  THR A OG1 1 
ATOM   2267 C  CG2 . THR A 1  293 ? 38.369 1.431   30.140  1.00 22.21 ? 293  THR A CG2 1 
ATOM   2268 N  N   . VAL A 1  294 ? 34.686 -0.740  29.298  1.00 21.58 ? 294  VAL A N   1 
ATOM   2269 C  CA  . VAL A 1  294 ? 33.620 -1.687  29.632  1.00 22.39 ? 294  VAL A CA  1 
ATOM   2270 C  C   . VAL A 1  294 ? 33.924 -2.249  31.014  1.00 22.88 ? 294  VAL A C   1 
ATOM   2271 O  O   . VAL A 1  294 ? 34.783 -3.113  31.185  1.00 23.20 ? 294  VAL A O   1 
ATOM   2272 C  CB  . VAL A 1  294 ? 33.485 -2.817  28.570  1.00 22.38 ? 294  VAL A CB  1 
ATOM   2273 C  CG1 . VAL A 1  294 ? 32.298 -3.755  28.915  1.00 23.38 ? 294  VAL A CG1 1 
ATOM   2274 C  CG2 . VAL A 1  294 ? 33.288 -2.212  27.196  1.00 22.28 ? 294  VAL A CG2 1 
ATOM   2275 N  N   . ASP A 1  295 ? 33.231 -1.726  32.009  1.00 23.33 ? 295  ASP A N   1 
ATOM   2276 C  CA  . ASP A 1  295 ? 33.534 -2.055  33.383  1.00 23.66 ? 295  ASP A CA  1 
ATOM   2277 C  C   . ASP A 1  295 ? 32.577 -3.112  33.942  1.00 23.92 ? 295  ASP A C   1 
ATOM   2278 O  O   . ASP A 1  295 ? 32.753 -3.569  35.064  1.00 23.83 ? 295  ASP A O   1 
ATOM   2279 C  CB  . ASP A 1  295 ? 33.466 -0.784  34.224  1.00 23.60 ? 295  ASP A CB  1 
ATOM   2280 C  CG  . ASP A 1  295 ? 32.092 -0.143  34.203  1.00 23.20 ? 295  ASP A CG  1 
ATOM   2281 O  OD1 . ASP A 1  295 ? 31.312 -0.406  33.252  1.00 22.19 ? 295  ASP A OD1 1 
ATOM   2282 O  OD2 . ASP A 1  295 ? 31.807 0.642   35.134  1.00 21.51 ? 295  ASP A OD2 1 
ATOM   2283 N  N   . GLY A 1  296 ? 31.549 -3.460  33.170  1.00 23.38 ? 296  GLY A N   1 
ATOM   2284 C  CA  . GLY A 1  296 ? 30.502 -4.371  33.635  1.00 23.99 ? 296  GLY A CA  1 
ATOM   2285 C  C   . GLY A 1  296 ? 29.622 -3.759  34.713  1.00 24.05 ? 296  GLY A C   1 
ATOM   2286 O  O   . GLY A 1  296 ? 28.960 -4.474  35.462  1.00 24.36 ? 296  GLY A O   1 
ATOM   2287 N  N   . ASP A 1  297 ? 29.621 -2.432  34.801  1.00 23.47 ? 297  ASP A N   1 
ATOM   2288 C  CA  . ASP A 1  297 ? 28.834 -1.734  35.807  1.00 23.46 ? 297  ASP A CA  1 
ATOM   2289 C  C   . ASP A 1  297 ? 28.106 -0.598  35.089  1.00 23.56 ? 297  ASP A C   1 
ATOM   2290 O  O   . ASP A 1  297 ? 26.921 -0.737  34.764  1.00 23.42 ? 297  ASP A O   1 
ATOM   2291 C  CB  . ASP A 1  297 ? 29.745 -1.245  36.951  1.00 23.04 ? 297  ASP A CB  1 
ATOM   2292 C  CG  . ASP A 1  297 ? 28.974 -0.687  38.129  1.00 24.29 ? 297  ASP A CG  1 
ATOM   2293 O  OD1 . ASP A 1  297 ? 27.730 -0.600  38.074  1.00 23.06 ? 297  ASP A OD1 1 
ATOM   2294 O  OD2 . ASP A 1  297 ? 29.624 -0.337  39.140  1.00 25.95 ? 297  ASP A OD2 1 
ATOM   2295 N  N   . PHE A 1  298 ? 28.811 0.507   34.829  1.00 22.90 ? 298  PHE A N   1 
ATOM   2296 C  CA  . PHE A 1  298 ? 28.245 1.607   34.049  1.00 23.40 ? 298  PHE A CA  1 
ATOM   2297 C  C   . PHE A 1  298 ? 27.955 1.154   32.610  1.00 23.18 ? 298  PHE A C   1 
ATOM   2298 O  O   . PHE A 1  298 ? 26.919 1.494   32.052  1.00 23.31 ? 298  PHE A O   1 
ATOM   2299 C  CB  . PHE A 1  298 ? 29.172 2.831   34.033  1.00 22.49 ? 298  PHE A CB  1 
ATOM   2300 C  CG  . PHE A 1  298 ? 28.539 4.061   33.418  1.00 23.17 ? 298  PHE A CG  1 
ATOM   2301 C  CD1 . PHE A 1  298 ? 28.672 4.327   32.060  1.00 22.47 ? 298  PHE A CD1 1 
ATOM   2302 C  CD2 . PHE A 1  298 ? 27.802 4.944   34.197  1.00 24.80 ? 298  PHE A CD2 1 
ATOM   2303 C  CE1 . PHE A 1  298 ? 28.091 5.455   31.486  1.00 22.14 ? 298  PHE A CE1 1 
ATOM   2304 C  CE2 . PHE A 1  298 ? 27.207 6.088   33.629  1.00 23.79 ? 298  PHE A CE2 1 
ATOM   2305 C  CZ  . PHE A 1  298 ? 27.354 6.335   32.266  1.00 22.23 ? 298  PHE A CZ  1 
ATOM   2306 N  N   . LEU A 1  299 ? 28.885 0.397   32.041  1.00 23.88 ? 299  LEU A N   1 
ATOM   2307 C  CA  . LEU A 1  299 ? 28.750 -0.186  30.721  1.00 25.31 ? 299  LEU A CA  1 
ATOM   2308 C  C   . LEU A 1  299 ? 28.798 -1.693  30.844  1.00 25.49 ? 299  LEU A C   1 
ATOM   2309 O  O   . LEU A 1  299 ? 29.828 -2.248  31.236  1.00 25.14 ? 299  LEU A O   1 
ATOM   2310 C  CB  . LEU A 1  299 ? 29.919 0.218   29.837  1.00 25.57 ? 299  LEU A CB  1 
ATOM   2311 C  CG  . LEU A 1  299 ? 29.920 1.558   29.143  1.00 29.14 ? 299  LEU A CG  1 
ATOM   2312 C  CD1 . LEU A 1  299 ? 30.993 1.512   28.042  1.00 29.12 ? 299  LEU A CD1 1 
ATOM   2313 C  CD2 . LEU A 1  299 ? 28.523 1.888   28.583  1.00 32.28 ? 299  LEU A CD2 1 
ATOM   2314 N  N   . THR A 1  300 ? 27.703 -2.349  30.460  1.00 25.99 ? 300  THR A N   1 
ATOM   2315 C  CA  . THR A 1  300 ? 27.540 -3.796  30.645  1.00 25.92 ? 300  THR A CA  1 
ATOM   2316 C  C   . THR A 1  300 ? 28.174 -4.650  29.540  1.00 25.59 ? 300  THR A C   1 
ATOM   2317 O  O   . THR A 1  300 ? 28.384 -5.852  29.712  1.00 25.75 ? 300  THR A O   1 
ATOM   2318 C  CB  . THR A 1  300 ? 26.047 -4.153  30.731  1.00 26.20 ? 300  THR A CB  1 
ATOM   2319 O  OG1 . THR A 1  300 ? 25.425 -3.855  29.474  1.00 26.86 ? 300  THR A OG1 1 
ATOM   2320 C  CG2 . THR A 1  300 ? 25.353 -3.330  31.829  1.00 27.20 ? 300  THR A CG2 1 
ATOM   2321 N  N   . ASP A 1  301 ? 28.452 -4.047  28.395  1.00 24.75 ? 301  ASP A N   1 
ATOM   2322 C  CA  . ASP A 1  301 ? 28.946 -4.796  27.234  1.00 24.81 ? 301  ASP A CA  1 
ATOM   2323 C  C   . ASP A 1  301 ? 29.613 -3.764  26.358  1.00 24.79 ? 301  ASP A C   1 
ATOM   2324 O  O   . ASP A 1  301 ? 29.493 -2.566  26.624  1.00 24.43 ? 301  ASP A O   1 
ATOM   2325 C  CB  . ASP A 1  301 ? 27.774 -5.472  26.484  1.00 23.97 ? 301  ASP A CB  1 
ATOM   2326 C  CG  . ASP A 1  301 ? 28.222 -6.619  25.531  1.00 25.75 ? 301  ASP A CG  1 
ATOM   2327 O  OD1 . ASP A 1  301 ? 27.340 -7.369  25.031  1.00 24.25 ? 301  ASP A OD1 1 
ATOM   2328 O  OD2 . ASP A 1  301 ? 29.433 -6.774  25.259  1.00 22.93 ? 301  ASP A OD2 1 
ATOM   2329 N  N   . MET A 1  302 ? 30.309 -4.216  25.319  1.00 25.10 ? 302  MET A N   1 
ATOM   2330 C  CA  . MET A 1  302 ? 30.881 -3.311  24.338  1.00 25.75 ? 302  MET A CA  1 
ATOM   2331 C  C   . MET A 1  302 ? 29.798 -2.432  23.722  1.00 25.40 ? 302  MET A C   1 
ATOM   2332 O  O   . MET A 1  302 ? 28.815 -2.941  23.149  1.00 25.71 ? 302  MET A O   1 
ATOM   2333 C  CB  . MET A 1  302 ? 31.649 -4.090  23.270  1.00 26.29 ? 302  MET A CB  1 
ATOM   2334 C  CG  . MET A 1  302 ? 32.818 -4.875  23.853  1.00 28.68 ? 302  MET A CG  1 
ATOM   2335 S  SD  . MET A 1  302 ? 33.712 -5.830  22.615  1.00 38.52 ? 302  MET A SD  1 
ATOM   2336 C  CE  . MET A 1  302 ? 34.587 -4.510  21.740  1.00 37.98 ? 302  MET A CE  1 
ATOM   2337 N  N   . PRO A 1  303 ? 29.966 -1.106  23.844  1.00 24.96 ? 303  PRO A N   1 
ATOM   2338 C  CA  . PRO A 1  303 ? 28.871 -0.210  23.492  1.00 24.39 ? 303  PRO A CA  1 
ATOM   2339 C  C   . PRO A 1  303 ? 28.449 -0.308  22.014  1.00 24.48 ? 303  PRO A C   1 
ATOM   2340 O  O   . PRO A 1  303 ? 27.278 -0.083  21.711  1.00 23.25 ? 303  PRO A O   1 
ATOM   2341 C  CB  . PRO A 1  303 ? 29.406 1.183   23.879  1.00 24.77 ? 303  PRO A CB  1 
ATOM   2342 C  CG  . PRO A 1  303 ? 30.902 1.018   23.996  1.00 24.12 ? 303  PRO A CG  1 
ATOM   2343 C  CD  . PRO A 1  303 ? 31.107 -0.386  24.451  1.00 24.69 ? 303  PRO A CD  1 
ATOM   2344 N  N   . ASP A 1  304 ? 29.368 -0.678  21.121  1.00 23.41 ? 304  ASP A N   1 
ATOM   2345 C  CA  . ASP A 1  304 ? 28.992 -0.929  19.722  1.00 24.38 ? 304  ASP A CA  1 
ATOM   2346 C  C   . ASP A 1  304 ? 27.912 -2.023  19.607  1.00 23.66 ? 304  ASP A C   1 
ATOM   2347 O  O   . ASP A 1  304 ? 26.955 -1.911  18.817  1.00 23.76 ? 304  ASP A O   1 
ATOM   2348 C  CB  . ASP A 1  304 ? 30.219 -1.264  18.839  1.00 24.46 ? 304  ASP A CB  1 
ATOM   2349 C  CG  . ASP A 1  304 ? 31.084 -2.416  19.397  1.00 29.10 ? 304  ASP A CG  1 
ATOM   2350 O  OD1 . ASP A 1  304 ? 31.535 -2.331  20.570  1.00 31.93 ? 304  ASP A OD1 1 
ATOM   2351 O  OD2 . ASP A 1  304 ? 31.352 -3.391  18.641  1.00 31.13 ? 304  ASP A OD2 1 
ATOM   2352 N  N   . ILE A 1  305 ? 28.070 -3.080  20.393  1.00 22.15 ? 305  ILE A N   1 
ATOM   2353 C  CA  . ILE A 1  305 ? 27.093 -4.170  20.386  1.00 21.27 ? 305  ILE A CA  1 
ATOM   2354 C  C   . ILE A 1  305 ? 25.733 -3.675  20.873  1.00 20.80 ? 305  ILE A C   1 
ATOM   2355 O  O   . ILE A 1  305 ? 24.704 -3.944  20.231  1.00 20.31 ? 305  ILE A O   1 
ATOM   2356 C  CB  . ILE A 1  305 ? 27.571 -5.381  21.226  1.00 20.84 ? 305  ILE A CB  1 
ATOM   2357 C  CG1 . ILE A 1  305 ? 28.970 -5.807  20.770  1.00 20.85 ? 305  ILE A CG1 1 
ATOM   2358 C  CG2 . ILE A 1  305 ? 26.557 -6.525  21.151  1.00 20.48 ? 305  ILE A CG2 1 
ATOM   2359 C  CD1 . ILE A 1  305 ? 29.575 -6.940  21.567  1.00 21.08 ? 305  ILE A CD1 1 
ATOM   2360 N  N   . LEU A 1  306 ? 25.748 -2.934  21.986  1.00 20.05 ? 306  LEU A N   1 
ATOM   2361 C  CA  . LEU A 1  306 ? 24.535 -2.362  22.586  1.00 20.60 ? 306  LEU A CA  1 
ATOM   2362 C  C   . LEU A 1  306 ? 23.776 -1.485  21.581  1.00 21.18 ? 306  LEU A C   1 
ATOM   2363 O  O   . LEU A 1  306 ? 22.558 -1.616  21.415  1.00 21.22 ? 306  LEU A O   1 
ATOM   2364 C  CB  . LEU A 1  306 ? 24.884 -1.562  23.864  1.00 19.43 ? 306  LEU A CB  1 
ATOM   2365 C  CG  . LEU A 1  306 ? 25.435 -2.401  25.039  1.00 19.68 ? 306  LEU A CG  1 
ATOM   2366 C  CD1 . LEU A 1  306 ? 25.958 -1.527  26.205  1.00 17.21 ? 306  LEU A CD1 1 
ATOM   2367 C  CD2 . LEU A 1  306 ? 24.389 -3.394  25.554  1.00 19.29 ? 306  LEU A CD2 1 
ATOM   2368 N  N   . LEU A 1  307 ? 24.517 -0.614  20.900  1.00 21.69 ? 307  LEU A N   1 
ATOM   2369 C  CA  . LEU A 1  307 ? 23.936 0.263   19.875  1.00 22.04 ? 307  LEU A CA  1 
ATOM   2370 C  C   . LEU A 1  307 ? 23.331 -0.526  18.706  1.00 21.78 ? 307  LEU A C   1 
ATOM   2371 O  O   . LEU A 1  307 ? 22.160 -0.317  18.341  1.00 22.08 ? 307  LEU A O   1 
ATOM   2372 C  CB  . LEU A 1  307 ? 24.993 1.261   19.375  1.00 21.88 ? 307  LEU A CB  1 
ATOM   2373 C  CG  . LEU A 1  307 ? 24.556 2.229   18.253  1.00 21.87 ? 307  LEU A CG  1 
ATOM   2374 C  CD1 . LEU A 1  307 ? 23.391 3.117   18.688  1.00 22.81 ? 307  LEU A CD1 1 
ATOM   2375 C  CD2 . LEU A 1  307 ? 25.729 3.086   17.771  1.00 21.28 ? 307  LEU A CD2 1 
ATOM   2376 N  N   . GLU A 1  308 ? 24.135 -1.417  18.119  1.00 21.10 ? 308  GLU A N   1 
ATOM   2377 C  CA  . GLU A 1  308 ? 23.682 -2.286  17.043  1.00 21.34 ? 308  GLU A CA  1 
ATOM   2378 C  C   . GLU A 1  308 ? 22.391 -3.017  17.407  1.00 20.88 ? 308  GLU A C   1 
ATOM   2379 O  O   . GLU A 1  308 ? 21.470 -3.094  16.601  1.00 21.14 ? 308  GLU A O   1 
ATOM   2380 C  CB  . GLU A 1  308 ? 24.789 -3.276  16.617  1.00 21.54 ? 308  GLU A CB  1 
ATOM   2381 C  CG  . GLU A 1  308 ? 24.384 -4.251  15.486  1.00 22.78 ? 308  GLU A CG  1 
ATOM   2382 C  CD  . GLU A 1  308 ? 24.144 -3.560  14.138  1.00 27.25 ? 308  GLU A CD  1 
ATOM   2383 O  OE1 . GLU A 1  308 ? 23.497 -4.164  13.259  1.00 29.65 ? 308  GLU A OE1 1 
ATOM   2384 O  OE2 . GLU A 1  308 ? 24.597 -2.419  13.940  1.00 27.87 ? 308  GLU A OE2 1 
ATOM   2385 N  N   . LEU A 1  309 ? 22.304 -3.511  18.636  1.00 20.59 ? 309  LEU A N   1 
ATOM   2386 C  CA  . LEU A 1  309 ? 21.188 -4.376  19.015  1.00 19.85 ? 309  LEU A CA  1 
ATOM   2387 C  C   . LEU A 1  309 ? 20.059 -3.691  19.782  1.00 20.19 ? 309  LEU A C   1 
ATOM   2388 O  O   . LEU A 1  309 ? 19.204 -4.365  20.373  1.00 19.65 ? 309  LEU A O   1 
ATOM   2389 C  CB  . LEU A 1  309 ? 21.716 -5.634  19.727  1.00 18.90 ? 309  LEU A CB  1 
ATOM   2390 C  CG  . LEU A 1  309 ? 22.708 -6.453  18.889  1.00 17.15 ? 309  LEU A CG  1 
ATOM   2391 C  CD1 . LEU A 1  309 ? 23.211 -7.670  19.704  1.00 19.99 ? 309  LEU A CD1 1 
ATOM   2392 C  CD2 . LEU A 1  309 ? 22.099 -6.923  17.543  1.00 17.07 ? 309  LEU A CD2 1 
ATOM   2393 N  N   . GLY A 1  310 ? 20.048 -2.353  19.746  1.00 21.01 ? 310  GLY A N   1 
ATOM   2394 C  CA  . GLY A 1  310 ? 18.929 -1.557  20.273  1.00 21.64 ? 310  GLY A CA  1 
ATOM   2395 C  C   . GLY A 1  310 ? 18.826 -1.494  21.781  1.00 22.18 ? 310  GLY A C   1 
ATOM   2396 O  O   . GLY A 1  310 ? 17.747 -1.260  22.317  1.00 22.71 ? 310  GLY A O   1 
ATOM   2397 N  N   . GLN A 1  311 ? 19.946 -1.708  22.472  1.00 22.38 ? 311  GLN A N   1 
ATOM   2398 C  CA  . GLN A 1  311 ? 19.954 -1.780  23.939  1.00 22.16 ? 311  GLN A CA  1 
ATOM   2399 C  C   . GLN A 1  311 ? 20.315 -0.414  24.508  1.00 22.32 ? 311  GLN A C   1 
ATOM   2400 O  O   . GLN A 1  311 ? 21.465 -0.166  24.917  1.00 21.84 ? 311  GLN A O   1 
ATOM   2401 C  CB  . GLN A 1  311 ? 20.951 -2.838  24.417  1.00 23.10 ? 311  GLN A CB  1 
ATOM   2402 C  CG  . GLN A 1  311 ? 20.705 -4.199  23.814  1.00 24.53 ? 311  GLN A CG  1 
ATOM   2403 C  CD  . GLN A 1  311 ? 19.294 -4.721  24.100  1.00 27.83 ? 311  GLN A CD  1 
ATOM   2404 O  OE1 . GLN A 1  311 ? 18.519 -4.982  23.176  1.00 28.64 ? 311  GLN A OE1 1 
ATOM   2405 N  NE2 . GLN A 1  311 ? 18.953 -4.856  25.385  1.00 27.10 ? 311  GLN A NE2 1 
ATOM   2406 N  N   . PHE A 1  312 ? 19.345 0.493   24.469  1.00 21.54 ? 312  PHE A N   1 
ATOM   2407 C  CA  . PHE A 1  312 ? 19.573 1.862   24.911  1.00 21.10 ? 312  PHE A CA  1 
ATOM   2408 C  C   . PHE A 1  312 ? 18.246 2.534   25.214  1.00 21.03 ? 312  PHE A C   1 
ATOM   2409 O  O   . PHE A 1  312 ? 17.173 2.050   24.802  1.00 20.26 ? 312  PHE A O   1 
ATOM   2410 C  CB  . PHE A 1  312 ? 20.380 2.675   23.880  1.00 21.08 ? 312  PHE A CB  1 
ATOM   2411 C  CG  . PHE A 1  312 ? 19.854 2.600   22.482  1.00 21.66 ? 312  PHE A CG  1 
ATOM   2412 C  CD1 . PHE A 1  312 ? 18.772 3.375   22.089  1.00 21.46 ? 312  PHE A CD1 1 
ATOM   2413 C  CD2 . PHE A 1  312 ? 20.464 1.767   21.537  1.00 21.83 ? 312  PHE A CD2 1 
ATOM   2414 C  CE1 . PHE A 1  312 ? 18.283 3.316   20.781  1.00 21.72 ? 312  PHE A CE1 1 
ATOM   2415 C  CE2 . PHE A 1  312 ? 19.985 1.703   20.236  1.00 21.93 ? 312  PHE A CE2 1 
ATOM   2416 C  CZ  . PHE A 1  312 ? 18.889 2.485   19.853  1.00 20.85 ? 312  PHE A CZ  1 
ATOM   2417 N  N   . LYS A 1  313 ? 18.328 3.646   25.932  1.00 20.19 ? 313  LYS A N   1 
ATOM   2418 C  CA  . LYS A 1  313 ? 17.139 4.394   26.312  1.00 20.47 ? 313  LYS A CA  1 
ATOM   2419 C  C   . LYS A 1  313 ? 16.411 4.872   25.060  1.00 20.19 ? 313  LYS A C   1 
ATOM   2420 O  O   . LYS A 1  313 ? 17.014 5.450   24.152  1.00 20.96 ? 313  LYS A O   1 
ATOM   2421 C  CB  . LYS A 1  313 ? 17.530 5.578   27.227  1.00 20.38 ? 313  LYS A CB  1 
ATOM   2422 C  CG  . LYS A 1  313 ? 16.370 6.480   27.647  1.00 19.16 ? 313  LYS A CG  1 
ATOM   2423 C  CD  . LYS A 1  313 ? 16.932 7.672   28.445  1.00 22.82 ? 313  LYS A CD  1 
ATOM   2424 C  CE  . LYS A 1  313 ? 15.820 8.603   28.886  1.00 23.31 ? 313  LYS A CE  1 
ATOM   2425 N  NZ  . LYS A 1  313 ? 14.951 7.955   29.906  1.00 20.82 ? 313  LYS A NZ  1 
ATOM   2426 N  N   . LYS A 1  314 ? 15.113 4.615   25.019  1.00 19.46 ? 314  LYS A N   1 
ATOM   2427 C  CA  . LYS A 1  314 ? 14.280 4.974   23.883  1.00 19.34 ? 314  LYS A CA  1 
ATOM   2428 C  C   . LYS A 1  314 ? 13.710 6.373   24.089  1.00 19.01 ? 314  LYS A C   1 
ATOM   2429 O  O   . LYS A 1  314 ? 12.797 6.581   24.882  1.00 18.82 ? 314  LYS A O   1 
ATOM   2430 C  CB  . LYS A 1  314 ? 13.153 3.928   23.689  1.00 20.19 ? 314  LYS A CB  1 
ATOM   2431 C  CG  . LYS A 1  314 ? 13.680 2.520   23.337  1.00 21.11 ? 314  LYS A CG  1 
ATOM   2432 C  CD  . LYS A 1  314 ? 14.346 2.534   21.943  1.00 24.90 ? 314  LYS A CD  1 
ATOM   2433 C  CE  . LYS A 1  314 ? 15.496 1.548   21.794  1.00 25.52 ? 314  LYS A CE  1 
ATOM   2434 N  NZ  . LYS A 1  314 ? 15.403 0.332   22.617  1.00 26.36 ? 314  LYS A NZ  1 
ATOM   2435 N  N   . THR A 1  315 ? 14.284 7.345   23.398  1.00 18.22 ? 315  THR A N   1 
ATOM   2436 C  CA  . THR A 1  315 ? 13.898 8.733   23.567  1.00 18.09 ? 315  THR A CA  1 
ATOM   2437 C  C   . THR A 1  315 ? 14.389 9.506   22.351  1.00 17.98 ? 315  THR A C   1 
ATOM   2438 O  O   . THR A 1  315 ? 15.022 8.920   21.470  1.00 18.21 ? 315  THR A O   1 
ATOM   2439 C  CB  . THR A 1  315 ? 14.482 9.324   24.879  1.00 17.87 ? 315  THR A CB  1 
ATOM   2440 O  OG1 . THR A 1  315 ? 13.957 10.641  25.062  1.00 18.49 ? 315  THR A OG1 1 
ATOM   2441 C  CG2 . THR A 1  315 ? 16.034 9.414   24.822  1.00 16.66 ? 315  THR A CG2 1 
ATOM   2442 N  N   . GLN A 1  316 ? 14.119 10.807  22.297  1.00 18.05 ? 316  GLN A N   1 
ATOM   2443 C  CA  . GLN A 1  316 ? 14.560 11.632  21.168  1.00 18.21 ? 316  GLN A CA  1 
ATOM   2444 C  C   . GLN A 1  316 ? 16.004 12.095  21.357  1.00 18.87 ? 316  GLN A C   1 
ATOM   2445 O  O   . GLN A 1  316 ? 16.452 12.283  22.484  1.00 18.70 ? 316  GLN A O   1 
ATOM   2446 C  CB  . GLN A 1  316 ? 13.669 12.868  20.980  1.00 18.87 ? 316  GLN A CB  1 
ATOM   2447 C  CG  . GLN A 1  316 ? 12.163 12.586  20.795  1.00 19.99 ? 316  GLN A CG  1 
ATOM   2448 C  CD  . GLN A 1  316 ? 11.500 12.184  22.085  1.00 22.83 ? 316  GLN A CD  1 
ATOM   2449 O  OE1 . GLN A 1  316 ? 11.809 12.714  23.155  1.00 22.70 ? 316  GLN A OE1 1 
ATOM   2450 N  NE2 . GLN A 1  316 ? 10.594 11.222  22.000  1.00 25.75 ? 316  GLN A NE2 1 
ATOM   2451 N  N   . ILE A 1  317 ? 16.718 12.293  20.249  1.00 18.44 ? 317  ILE A N   1 
ATOM   2452 C  CA  . ILE A 1  317 ? 18.079 12.803  20.294  1.00 18.80 ? 317  ILE A CA  1 
ATOM   2453 C  C   . ILE A 1  317 ? 18.260 13.936  19.275  1.00 18.39 ? 317  ILE A C   1 
ATOM   2454 O  O   . ILE A 1  317 ? 17.617 13.952  18.230  1.00 17.42 ? 317  ILE A O   1 
ATOM   2455 C  CB  . ILE A 1  317 ? 19.139 11.712  20.032  1.00 18.69 ? 317  ILE A CB  1 
ATOM   2456 C  CG1 . ILE A 1  317 ? 18.871 11.011  18.694  1.00 20.08 ? 317  ILE A CG1 1 
ATOM   2457 C  CG2 . ILE A 1  317 ? 19.151 10.700  21.207  1.00 19.62 ? 317  ILE A CG2 1 
ATOM   2458 C  CD1 . ILE A 1  317 ? 20.066 10.143  18.180  1.00 21.79 ? 317  ILE A CD1 1 
ATOM   2459 N  N   . LEU A 1  318 ? 19.125 14.881  19.624  1.00 18.31 ? 318  LEU A N   1 
ATOM   2460 C  CA  . LEU A 1  318 ? 19.537 15.942  18.731  1.00 18.36 ? 318  LEU A CA  1 
ATOM   2461 C  C   . LEU A 1  318 ? 21.047 15.809  18.650  1.00 18.57 ? 318  LEU A C   1 
ATOM   2462 O  O   . LEU A 1  318 ? 21.733 15.823  19.687  1.00 18.99 ? 318  LEU A O   1 
ATOM   2463 C  CB  . LEU A 1  318 ? 19.149 17.296  19.347  1.00 19.09 ? 318  LEU A CB  1 
ATOM   2464 C  CG  . LEU A 1  318 ? 19.356 18.581  18.514  1.00 20.79 ? 318  LEU A CG  1 
ATOM   2465 C  CD1 . LEU A 1  318 ? 18.692 19.741  19.219  1.00 22.17 ? 318  LEU A CD1 1 
ATOM   2466 C  CD2 . LEU A 1  318 ? 20.815 18.926  18.369  1.00 24.36 ? 318  LEU A CD2 1 
ATOM   2467 N  N   . VAL A 1  319 ? 21.572 15.655  17.440  1.00 17.86 ? 319  VAL A N   1 
ATOM   2468 C  CA  . VAL A 1  319 ? 22.997 15.369  17.238  1.00 17.32 ? 319  VAL A CA  1 
ATOM   2469 C  C   . VAL A 1  319 ? 23.531 16.287  16.128  1.00 17.43 ? 319  VAL A C   1 
ATOM   2470 O  O   . VAL A 1  319 ? 22.813 16.615  15.193  1.00 17.43 ? 319  VAL A O   1 
ATOM   2471 C  CB  . VAL A 1  319 ? 23.206 13.893  16.765  1.00 17.64 ? 319  VAL A CB  1 
ATOM   2472 C  CG1 . VAL A 1  319 ? 24.689 13.553  16.631  1.00 15.04 ? 319  VAL A CG1 1 
ATOM   2473 C  CG2 . VAL A 1  319 ? 22.493 12.907  17.726  1.00 17.57 ? 319  VAL A CG2 1 
ATOM   2474 N  N   . GLY A 1  320 ? 24.785 16.707  16.225  1.00 17.26 ? 320  GLY A N   1 
ATOM   2475 C  CA  . GLY A 1  320 ? 25.335 17.511  15.168  1.00 17.50 ? 320  GLY A CA  1 
ATOM   2476 C  C   . GLY A 1  320 ? 26.828 17.655  15.240  1.00 18.22 ? 320  GLY A C   1 
ATOM   2477 O  O   . GLY A 1  320 ? 27.447 17.210  16.205  1.00 18.21 ? 320  GLY A O   1 
ATOM   2478 N  N   . VAL A 1  321 ? 27.390 18.269  14.191  1.00 18.34 ? 321  VAL A N   1 
ATOM   2479 C  CA  . VAL A 1  321 ? 28.825 18.461  14.045  1.00 17.70 ? 321  VAL A CA  1 
ATOM   2480 C  C   . VAL A 1  321 ? 29.053 19.796  13.366  1.00 18.23 ? 321  VAL A C   1 
ATOM   2481 O  O   . VAL A 1  321 ? 28.114 20.389  12.817  1.00 17.22 ? 321  VAL A O   1 
ATOM   2482 C  CB  . VAL A 1  321 ? 29.481 17.333  13.186  1.00 17.15 ? 321  VAL A CB  1 
ATOM   2483 C  CG1 . VAL A 1  321 ? 29.392 15.971  13.912  1.00 16.73 ? 321  VAL A CG1 1 
ATOM   2484 C  CG2 . VAL A 1  321 ? 28.809 17.237  11.784  1.00 15.82 ? 321  VAL A CG2 1 
ATOM   2485 N  N   . ASN A 1  322 ? 30.317 20.233  13.393  1.00 17.94 ? 322  ASN A N   1 
ATOM   2486 C  CA  . ASN A 1  322 ? 30.753 21.474  12.791  1.00 18.51 ? 322  ASN A CA  1 
ATOM   2487 C  C   . ASN A 1  322 ? 31.468 21.205  11.483  1.00 18.75 ? 322  ASN A C   1 
ATOM   2488 O  O   . ASN A 1  322 ? 32.052 20.138  11.296  1.00 19.27 ? 322  ASN A O   1 
ATOM   2489 C  CB  . ASN A 1  322 ? 31.672 22.232  13.758  1.00 18.76 ? 322  ASN A CB  1 
ATOM   2490 C  CG  . ASN A 1  322 ? 30.957 22.628  15.025  1.00 18.69 ? 322  ASN A CG  1 
ATOM   2491 O  OD1 . ASN A 1  322 ? 29.740 22.413  15.151  1.00 19.95 ? 322  ASN A OD1 1 
ATOM   2492 N  ND2 . ASN A 1  322 ? 31.690 23.203  15.973  1.00 18.67 ? 322  ASN A ND2 1 
ATOM   2493 N  N   . LYS A 1  323 ? 31.414 22.175  10.577  1.00 19.04 ? 323  LYS A N   1 
ATOM   2494 C  CA  . LYS A 1  323 ? 31.968 22.003  9.231   1.00 19.76 ? 323  LYS A CA  1 
ATOM   2495 C  C   . LYS A 1  323 ? 33.447 21.602  9.232   1.00 19.79 ? 323  LYS A C   1 
ATOM   2496 O  O   . LYS A 1  323 ? 33.873 20.761  8.419   1.00 19.76 ? 323  LYS A O   1 
ATOM   2497 C  CB  . LYS A 1  323 ? 31.751 23.280  8.398   1.00 19.94 ? 323  LYS A CB  1 
ATOM   2498 C  CG  . LYS A 1  323 ? 32.367 23.247  7.003   1.00 22.81 ? 323  LYS A CG  1 
ATOM   2499 C  CD  . LYS A 1  323 ? 32.082 24.560  6.271   1.00 28.75 ? 323  LYS A CD  1 
ATOM   2500 C  CE  . LYS A 1  323 ? 32.784 24.593  4.925   1.00 32.02 ? 323  LYS A CE  1 
ATOM   2501 N  NZ  . LYS A 1  323 ? 32.933 26.002  4.425   1.00 36.88 ? 323  LYS A NZ  1 
ATOM   2502 N  N   . ASP A 1  324 ? 34.241 22.218  10.106  1.00 19.45 ? 324  ASP A N   1 
ATOM   2503 C  CA  . ASP A 1  324 ? 35.680 21.888  10.133  1.00 20.43 ? 324  ASP A CA  1 
ATOM   2504 C  C   . ASP A 1  324 ? 36.160 21.280  11.459  1.00 20.19 ? 324  ASP A C   1 
ATOM   2505 O  O   . ASP A 1  324 ? 37.140 21.751  12.047  1.00 20.82 ? 324  ASP A O   1 
ATOM   2506 C  CB  . ASP A 1  324 ? 36.540 23.112  9.750   1.00 20.05 ? 324  ASP A CB  1 
ATOM   2507 C  CG  . ASP A 1  324 ? 36.182 23.667  8.376   1.00 21.01 ? 324  ASP A CG  1 
ATOM   2508 O  OD1 . ASP A 1  324 ? 36.507 23.028  7.356   1.00 22.36 ? 324  ASP A OD1 1 
ATOM   2509 O  OD2 . ASP A 1  324 ? 35.537 24.725  8.327   1.00 20.66 ? 324  ASP A OD2 1 
ATOM   2510 N  N   . GLU A 1  325 ? 35.498 20.216  11.916  1.00 20.13 ? 325  GLU A N   1 
ATOM   2511 C  CA  . GLU A 1  325 ? 35.928 19.511  13.132  1.00 19.48 ? 325  GLU A CA  1 
ATOM   2512 C  C   . GLU A 1  325 ? 37.456 19.264  13.252  1.00 20.07 ? 325  GLU A C   1 
ATOM   2513 O  O   . GLU A 1  325 ? 38.031 19.410  14.343  1.00 19.77 ? 325  GLU A O   1 
ATOM   2514 C  CB  . GLU A 1  325 ? 35.209 18.165  13.278  1.00 19.61 ? 325  GLU A CB  1 
ATOM   2515 C  CG  . GLU A 1  325 ? 33.669 18.264  13.447  1.00 18.98 ? 325  GLU A CG  1 
ATOM   2516 C  CD  . GLU A 1  325 ? 33.262 18.703  14.847  1.00 19.25 ? 325  GLU A CD  1 
ATOM   2517 O  OE1 . GLU A 1  325 ? 34.163 18.867  15.696  1.00 18.22 ? 325  GLU A OE1 1 
ATOM   2518 O  OE2 . GLU A 1  325 ? 32.051 18.896  15.100  1.00 16.01 ? 325  GLU A OE2 1 
ATOM   2519 N  N   . GLY A 1  326 ? 38.096 18.877  12.157  1.00 19.45 ? 326  GLY A N   1 
ATOM   2520 C  CA  . GLY A 1  326 ? 39.465 18.370  12.254  1.00 19.83 ? 326  GLY A CA  1 
ATOM   2521 C  C   . GLY A 1  326 ? 40.576 19.405  12.371  1.00 20.12 ? 326  GLY A C   1 
ATOM   2522 O  O   . GLY A 1  326 ? 41.663 19.074  12.852  1.00 20.73 ? 326  GLY A O   1 
ATOM   2523 N  N   . THR A 1  327 ? 40.324 20.641  11.929  1.00 19.55 ? 327  THR A N   1 
ATOM   2524 C  CA  . THR A 1  327 ? 41.407 21.624  11.796  1.00 19.91 ? 327  THR A CA  1 
ATOM   2525 C  C   . THR A 1  327 ? 42.141 21.970  13.098  1.00 20.38 ? 327  THR A C   1 
ATOM   2526 O  O   . THR A 1  327 ? 43.363 22.156  13.074  1.00 20.57 ? 327  THR A O   1 
ATOM   2527 C  CB  . THR A 1  327 ? 40.956 22.920  11.093  1.00 19.82 ? 327  THR A CB  1 
ATOM   2528 O  OG1 . THR A 1  327 ? 39.904 23.536  11.841  1.00 18.79 ? 327  THR A OG1 1 
ATOM   2529 C  CG2 . THR A 1  327 ? 40.508 22.634  9.612   1.00 18.29 ? 327  THR A CG2 1 
ATOM   2530 N  N   . ALA A 1  328 ? 41.407 22.020  14.218  1.00 20.76 ? 328  ALA A N   1 
ATOM   2531 C  CA  . ALA A 1  328 ? 41.961 22.430  15.531  1.00 21.26 ? 328  ALA A CA  1 
ATOM   2532 C  C   . ALA A 1  328 ? 43.135 21.568  15.950  1.00 21.90 ? 328  ALA A C   1 
ATOM   2533 O  O   . ALA A 1  328 ? 44.070 22.041  16.593  1.00 21.64 ? 328  ALA A O   1 
ATOM   2534 C  CB  . ALA A 1  328 ? 40.883 22.376  16.615  1.00 20.87 ? 328  ALA A CB  1 
ATOM   2535 N  N   . PHE A 1  329 ? 43.093 20.293  15.572  1.00 21.62 ? 329  PHE A N   1 
ATOM   2536 C  CA  . PHE A 1  329 ? 44.082 19.351  16.062  1.00 22.02 ? 329  PHE A CA  1 
ATOM   2537 C  C   . PHE A 1  329 ? 45.359 19.398  15.237  1.00 21.43 ? 329  PHE A C   1 
ATOM   2538 O  O   . PHE A 1  329 ? 46.398 18.959  15.685  1.00 21.23 ? 329  PHE A O   1 
ATOM   2539 C  CB  . PHE A 1  329 ? 43.466 17.935  16.133  1.00 21.89 ? 329  PHE A CB  1 
ATOM   2540 C  CG  . PHE A 1  329 ? 42.183 17.904  16.919  1.00 23.87 ? 329  PHE A CG  1 
ATOM   2541 C  CD1 . PHE A 1  329 ? 40.946 18.063  16.278  1.00 24.34 ? 329  PHE A CD1 1 
ATOM   2542 C  CD2 . PHE A 1  329 ? 42.209 17.776  18.294  1.00 24.34 ? 329  PHE A CD2 1 
ATOM   2543 C  CE1 . PHE A 1  329 ? 39.765 18.087  17.013  1.00 23.83 ? 329  PHE A CE1 1 
ATOM   2544 C  CE2 . PHE A 1  329 ? 41.040 17.791  19.033  1.00 26.06 ? 329  PHE A CE2 1 
ATOM   2545 C  CZ  . PHE A 1  329 ? 39.810 17.946  18.388  1.00 24.79 ? 329  PHE A CZ  1 
ATOM   2546 N  N   . LEU A 1  330 ? 45.268 19.929  14.025  1.00 22.22 ? 330  LEU A N   1 
ATOM   2547 C  CA  . LEU A 1  330 ? 46.402 19.905  13.093  1.00 23.11 ? 330  LEU A CA  1 
ATOM   2548 C  C   . LEU A 1  330 ? 47.618 20.727  13.547  1.00 23.71 ? 330  LEU A C   1 
ATOM   2549 O  O   . LEU A 1  330 ? 48.750 20.442  13.143  1.00 23.02 ? 330  LEU A O   1 
ATOM   2550 C  CB  . LEU A 1  330 ? 45.958 20.357  11.701  1.00 23.48 ? 330  LEU A CB  1 
ATOM   2551 C  CG  . LEU A 1  330 ? 44.813 19.575  11.030  1.00 23.58 ? 330  LEU A CG  1 
ATOM   2552 C  CD1 . LEU A 1  330 ? 44.561 20.155  9.632   1.00 22.40 ? 330  LEU A CD1 1 
ATOM   2553 C  CD2 . LEU A 1  330 ? 45.138 18.095  10.951  1.00 23.85 ? 330  LEU A CD2 1 
ATOM   2554 N  N   . VAL A 1  331 ? 47.382 21.734  14.384  1.00 24.17 ? 331  VAL A N   1 
ATOM   2555 C  CA  . VAL A 1  331 ? 48.492 22.564  14.870  1.00 25.23 ? 331  VAL A CA  1 
ATOM   2556 C  C   . VAL A 1  331 ? 49.117 22.009  16.133  1.00 25.85 ? 331  VAL A C   1 
ATOM   2557 O  O   . VAL A 1  331 ? 50.021 22.637  16.700  1.00 26.35 ? 331  VAL A O   1 
ATOM   2558 C  CB  . VAL A 1  331 ? 48.077 24.031  15.117  1.00 25.39 ? 331  VAL A CB  1 
ATOM   2559 C  CG1 . VAL A 1  331 ? 47.696 24.699  13.796  1.00 25.82 ? 331  VAL A CG1 1 
ATOM   2560 C  CG2 . VAL A 1  331 ? 46.938 24.121  16.164  1.00 23.65 ? 331  VAL A CG2 1 
ATOM   2561 N  N   . TYR A 1  332 ? 48.625 20.856  16.587  1.00 25.95 ? 332  TYR A N   1 
ATOM   2562 C  CA  . TYR A 1  332 ? 49.207 20.164  17.737  1.00 26.03 ? 332  TYR A CA  1 
ATOM   2563 C  C   . TYR A 1  332 ? 50.092 18.983  17.304  1.00 26.95 ? 332  TYR A C   1 
ATOM   2564 O  O   . TYR A 1  332 ? 50.185 17.967  18.001  1.00 27.49 ? 332  TYR A O   1 
ATOM   2565 C  CB  . TYR A 1  332 ? 48.118 19.719  18.735  1.00 25.50 ? 332  TYR A CB  1 
ATOM   2566 C  CG  . TYR A 1  332 ? 47.452 20.877  19.465  1.00 25.04 ? 332  TYR A CG  1 
ATOM   2567 C  CD1 . TYR A 1  332 ? 46.421 21.617  18.865  1.00 23.33 ? 332  TYR A CD1 1 
ATOM   2568 C  CD2 . TYR A 1  332 ? 47.858 21.232  20.754  1.00 25.11 ? 332  TYR A CD2 1 
ATOM   2569 C  CE1 . TYR A 1  332 ? 45.808 22.693  19.538  1.00 23.90 ? 332  TYR A CE1 1 
ATOM   2570 C  CE2 . TYR A 1  332 ? 47.250 22.302  21.448  1.00 24.00 ? 332  TYR A CE2 1 
ATOM   2571 C  CZ  . TYR A 1  332 ? 46.236 23.026  20.831  1.00 24.78 ? 332  TYR A CZ  1 
ATOM   2572 O  OH  . TYR A 1  332 ? 45.664 24.073  21.501  1.00 24.35 ? 332  TYR A OH  1 
ATOM   2573 N  N   . GLY A 1  333 ? 50.758 19.114  16.161  1.00 27.50 ? 333  GLY A N   1 
ATOM   2574 C  CA  . GLY A 1  333 ? 51.776 18.140  15.817  1.00 28.41 ? 333  GLY A CA  1 
ATOM   2575 C  C   . GLY A 1  333 ? 51.924 17.743  14.363  1.00 29.03 ? 333  GLY A C   1 
ATOM   2576 O  O   . GLY A 1  333 ? 52.873 17.049  14.031  1.00 29.48 ? 333  GLY A O   1 
ATOM   2577 N  N   . ALA A 1  334 ? 51.006 18.157  13.492  1.00 28.85 ? 334  ALA A N   1 
ATOM   2578 C  CA  . ALA A 1  334 ? 51.153 17.826  12.072  1.00 28.99 ? 334  ALA A CA  1 
ATOM   2579 C  C   . ALA A 1  334 ? 52.201 18.756  11.455  1.00 29.23 ? 334  ALA A C   1 
ATOM   2580 O  O   . ALA A 1  334 ? 52.140 19.980  11.660  1.00 29.41 ? 334  ALA A O   1 
ATOM   2581 C  CB  . ALA A 1  334 ? 49.817 17.912  11.327  1.00 28.46 ? 334  ALA A CB  1 
ATOM   2582 N  N   . PRO A 1  335 ? 53.178 18.181  10.722  1.00 29.04 ? 335  PRO A N   1 
ATOM   2583 C  CA  . PRO A 1  335 ? 54.261 19.003  10.186  1.00 29.10 ? 335  PRO A CA  1 
ATOM   2584 C  C   . PRO A 1  335 ? 53.749 19.962  9.120   1.00 28.89 ? 335  PRO A C   1 
ATOM   2585 O  O   . PRO A 1  335 ? 52.864 19.602  8.354   1.00 28.87 ? 335  PRO A O   1 
ATOM   2586 C  CB  . PRO A 1  335 ? 55.233 17.983  9.574   1.00 29.08 ? 335  PRO A CB  1 
ATOM   2587 C  CG  . PRO A 1  335 ? 54.735 16.611  10.020  1.00 29.89 ? 335  PRO A CG  1 
ATOM   2588 C  CD  . PRO A 1  335 ? 53.286 16.770  10.307  1.00 29.26 ? 335  PRO A CD  1 
ATOM   2589 N  N   . GLY A 1  336 ? 54.277 21.185  9.112   1.00 28.70 ? 336  GLY A N   1 
ATOM   2590 C  CA  . GLY A 1  336 ? 53.898 22.197  8.131   1.00 28.49 ? 336  GLY A CA  1 
ATOM   2591 C  C   . GLY A 1  336 ? 52.723 23.067  8.540   1.00 28.49 ? 336  GLY A C   1 
ATOM   2592 O  O   . GLY A 1  336 ? 52.395 24.040  7.849   1.00 29.09 ? 336  GLY A O   1 
ATOM   2593 N  N   . PHE A 1  337 ? 52.091 22.723  9.660   1.00 27.72 ? 337  PHE A N   1 
ATOM   2594 C  CA  . PHE A 1  337 ? 50.917 23.439  10.134  1.00 27.30 ? 337  PHE A CA  1 
ATOM   2595 C  C   . PHE A 1  337 ? 51.281 24.468  11.175  1.00 27.15 ? 337  PHE A C   1 
ATOM   2596 O  O   . PHE A 1  337 ? 52.174 24.243  11.995  1.00 27.65 ? 337  PHE A O   1 
ATOM   2597 C  CB  . PHE A 1  337 ? 49.871 22.472  10.699  1.00 26.94 ? 337  PHE A CB  1 
ATOM   2598 C  CG  . PHE A 1  337 ? 49.096 21.768  9.638   1.00 27.51 ? 337  PHE A CG  1 
ATOM   2599 C  CD1 . PHE A 1  337 ? 49.544 20.564  9.123   1.00 26.80 ? 337  PHE A CD1 1 
ATOM   2600 C  CD2 . PHE A 1  337 ? 47.943 22.342  9.111   1.00 27.98 ? 337  PHE A CD2 1 
ATOM   2601 C  CE1 . PHE A 1  337 ? 48.846 19.924  8.118   1.00 27.50 ? 337  PHE A CE1 1 
ATOM   2602 C  CE2 . PHE A 1  337 ? 47.238 21.708  8.096   1.00 28.03 ? 337  PHE A CE2 1 
ATOM   2603 C  CZ  . PHE A 1  337 ? 47.691 20.495  7.600   1.00 27.47 ? 337  PHE A CZ  1 
ATOM   2604 N  N   . SER A 1  338 ? 50.594 25.603  11.117  1.00 26.57 ? 338  SER A N   1 
ATOM   2605 C  CA  . SER A 1  338 ? 50.801 26.684  12.080  1.00 26.09 ? 338  SER A CA  1 
ATOM   2606 C  C   . SER A 1  338 ? 49.567 27.543  12.121  1.00 25.52 ? 338  SER A C   1 
ATOM   2607 O  O   . SER A 1  338 ? 49.013 27.878  11.075  1.00 24.75 ? 338  SER A O   1 
ATOM   2608 C  CB  . SER A 1  338 ? 51.992 27.562  11.681  1.00 25.97 ? 338  SER A CB  1 
ATOM   2609 O  OG  . SER A 1  338 ? 52.034 28.734  12.483  1.00 26.82 ? 338  SER A OG  1 
ATOM   2610 N  N   . LYS A 1  339 ? 49.150 27.931  13.321  1.00 25.38 ? 339  LYS A N   1 
ATOM   2611 C  CA  . LYS A 1  339 ? 48.054 28.876  13.438  1.00 25.52 ? 339  LYS A CA  1 
ATOM   2612 C  C   . LYS A 1  339 ? 48.479 30.258  12.931  1.00 26.49 ? 339  LYS A C   1 
ATOM   2613 O  O   . LYS A 1  339 ? 47.629 31.120  12.733  1.00 26.65 ? 339  LYS A O   1 
ATOM   2614 C  CB  . LYS A 1  339 ? 47.558 28.981  14.882  1.00 25.11 ? 339  LYS A CB  1 
ATOM   2615 C  CG  . LYS A 1  339 ? 48.494 29.810  15.798  1.00 24.86 ? 339  LYS A CG  1 
ATOM   2616 C  CD  . LYS A 1  339 ? 47.877 30.013  17.165  1.00 22.88 ? 339  LYS A CD  1 
ATOM   2617 C  CE  . LYS A 1  339 ? 48.706 30.974  18.022  1.00 23.89 ? 339  LYS A CE  1 
ATOM   2618 N  NZ  . LYS A 1  339 ? 48.581 32.372  17.530  1.00 23.73 ? 339  LYS A NZ  1 
ATOM   2619 N  N   . ASP A 1  340 ? 49.787 30.459  12.724  1.00 27.17 ? 340  ASP A N   1 
ATOM   2620 C  CA  . ASP A 1  340 ? 50.326 31.775  12.381  1.00 28.22 ? 340  ASP A CA  1 
ATOM   2621 C  C   . ASP A 1  340 ? 50.712 31.934  10.904  1.00 28.82 ? 340  ASP A C   1 
ATOM   2622 O  O   . ASP A 1  340 ? 51.327 32.934  10.527  1.00 28.24 ? 340  ASP A O   1 
ATOM   2623 C  CB  . ASP A 1  340 ? 51.513 32.125  13.301  1.00 28.50 ? 340  ASP A CB  1 
ATOM   2624 C  CG  . ASP A 1  340 ? 51.118 32.149  14.762  1.00 28.72 ? 340  ASP A CG  1 
ATOM   2625 O  OD1 . ASP A 1  340 ? 51.768 31.463  15.577  1.00 31.64 ? 340  ASP A OD1 1 
ATOM   2626 O  OD2 . ASP A 1  340 ? 50.127 32.823  15.099  1.00 28.59 ? 340  ASP A OD2 1 
ATOM   2627 N  N   . ASN A 1  341 ? 50.340 30.953  10.079  1.00 29.17 ? 341  ASN A N   1 
ATOM   2628 C  CA  . ASN A 1  341 ? 50.440 31.063  8.610   1.00 30.22 ? 341  ASN A CA  1 
ATOM   2629 C  C   . ASN A 1  341 ? 49.368 30.208  7.910   1.00 30.59 ? 341  ASN A C   1 
ATOM   2630 O  O   . ASN A 1  341 ? 48.607 29.500  8.576   1.00 30.13 ? 341  ASN A O   1 
ATOM   2631 C  CB  . ASN A 1  341 ? 51.865 30.775  8.089   1.00 30.33 ? 341  ASN A CB  1 
ATOM   2632 C  CG  . ASN A 1  341 ? 52.318 29.338  8.326   1.00 32.03 ? 341  ASN A CG  1 
ATOM   2633 O  OD1 . ASN A 1  341 ? 51.513 28.390  8.326   1.00 29.66 ? 341  ASN A OD1 1 
ATOM   2634 N  ND2 . ASN A 1  341 ? 53.628 29.173  8.534   1.00 33.38 ? 341  ASN A ND2 1 
ATOM   2635 N  N   . ASN A 1  342 ? 49.287 30.289  6.583   1.00 31.16 ? 342  ASN A N   1 
ATOM   2636 C  CA  . ASN A 1  342 ? 48.173 29.663  5.866   1.00 31.47 ? 342  ASN A CA  1 
ATOM   2637 C  C   . ASN A 1  342 ? 48.322 28.142  5.686   1.00 31.02 ? 342  ASN A C   1 
ATOM   2638 O  O   . ASN A 1  342 ? 47.447 27.504  5.115   1.00 31.09 ? 342  ASN A O   1 
ATOM   2639 C  CB  . ASN A 1  342 ? 47.886 30.372  4.536   1.00 31.89 ? 342  ASN A CB  1 
ATOM   2640 C  CG  . ASN A 1  342 ? 49.000 30.200  3.534   1.00 33.99 ? 342  ASN A CG  1 
ATOM   2641 O  OD1 . ASN A 1  342 ? 50.064 29.656  3.851   1.00 36.72 ? 342  ASN A OD1 1 
ATOM   2642 N  ND2 . ASN A 1  342 ? 48.774 30.680  2.316   1.00 37.55 ? 342  ASN A ND2 1 
ATOM   2643 N  N   . SER A 1  343 ? 49.438 27.598  6.170   1.00 30.64 ? 343  SER A N   1 
ATOM   2644 C  CA  . SER A 1  343 ? 49.638 26.163  6.360   1.00 30.47 ? 343  SER A CA  1 
ATOM   2645 C  C   . SER A 1  343 ? 49.510 25.355  5.069   1.00 30.81 ? 343  SER A C   1 
ATOM   2646 O  O   . SER A 1  343 ? 48.961 24.252  5.064   1.00 30.42 ? 343  SER A O   1 
ATOM   2647 C  CB  . SER A 1  343 ? 48.693 25.619  7.452   1.00 30.35 ? 343  SER A CB  1 
ATOM   2648 O  OG  . SER A 1  343 ? 49.042 26.116  8.733   1.00 28.82 ? 343  SER A OG  1 
ATOM   2649 N  N   . ILE A 1  344 ? 50.030 25.907  3.974   1.00 31.05 ? 344  ILE A N   1 
ATOM   2650 C  CA  . ILE A 1  344 ? 50.077 25.178  2.715   1.00 30.93 ? 344  ILE A CA  1 
ATOM   2651 C  C   . ILE A 1  344 ? 51.087 24.063  2.897   1.00 30.68 ? 344  ILE A C   1 
ATOM   2652 O  O   . ILE A 1  344 ? 52.268 24.319  3.073   1.00 31.28 ? 344  ILE A O   1 
ATOM   2653 C  CB  . ILE A 1  344 ? 50.466 26.103  1.530   1.00 31.39 ? 344  ILE A CB  1 
ATOM   2654 C  CG1 . ILE A 1  344 ? 49.448 27.244  1.384   1.00 32.10 ? 344  ILE A CG1 1 
ATOM   2655 C  CG2 . ILE A 1  344 ? 50.623 25.301  0.220   1.00 31.00 ? 344  ILE A CG2 1 
ATOM   2656 C  CD1 . ILE A 1  344 ? 47.997 26.801  1.293   1.00 32.19 ? 344  ILE A CD1 1 
ATOM   2657 N  N   . ILE A 1  345 ? 50.618 22.824  2.909   1.00 30.14 ? 345  ILE A N   1 
ATOM   2658 C  CA  . ILE A 1  345 ? 51.527 21.700  3.074   1.00 29.21 ? 345  ILE A CA  1 
ATOM   2659 C  C   . ILE A 1  345 ? 51.686 20.921  1.763   1.00 29.45 ? 345  ILE A C   1 
ATOM   2660 O  O   . ILE A 1  345 ? 50.836 21.006  0.873   1.00 29.02 ? 345  ILE A O   1 
ATOM   2661 C  CB  . ILE A 1  345 ? 51.095 20.762  4.218   1.00 29.48 ? 345  ILE A CB  1 
ATOM   2662 C  CG1 . ILE A 1  345 ? 49.650 20.267  4.021   1.00 28.19 ? 345  ILE A CG1 1 
ATOM   2663 C  CG2 . ILE A 1  345 ? 51.248 21.451  5.566   1.00 28.79 ? 345  ILE A CG2 1 
ATOM   2664 C  CD1 . ILE A 1  345 ? 49.378 18.937  4.697   1.00 26.21 ? 345  ILE A CD1 1 
ATOM   2665 N  N   . THR A 1  346 ? 52.785 20.177  1.656   1.00 29.55 ? 346  THR A N   1 
ATOM   2666 C  CA  . THR A 1  346 ? 53.061 19.341  0.484   1.00 29.81 ? 346  THR A CA  1 
ATOM   2667 C  C   . THR A 1  346 ? 52.462 17.928  0.640   1.00 29.82 ? 346  THR A C   1 
ATOM   2668 O  O   . THR A 1  346 ? 51.952 17.580  1.707   1.00 29.24 ? 346  THR A O   1 
ATOM   2669 C  CB  . THR A 1  346 ? 54.564 19.200  0.272   1.00 29.62 ? 346  THR A CB  1 
ATOM   2670 O  OG1 . THR A 1  346 ? 55.139 18.563  1.422   1.00 30.86 ? 346  THR A OG1 1 
ATOM   2671 C  CG2 . THR A 1  346 ? 55.208 20.570  0.065   1.00 29.29 ? 346  THR A CG2 1 
ATOM   2672 N  N   . ARG A 1  347 ? 52.554 17.120  -0.421  1.00 29.79 ? 347  ARG A N   1 
ATOM   2673 C  CA  . ARG A 1  347 ? 52.120 15.727  -0.380  1.00 29.95 ? 347  ARG A CA  1 
ATOM   2674 C  C   . ARG A 1  347 ? 52.848 14.954  0.729   1.00 29.85 ? 347  ARG A C   1 
ATOM   2675 O  O   . ARG A 1  347 ? 52.229 14.210  1.496   1.00 29.40 ? 347  ARG A O   1 
ATOM   2676 C  CB  . ARG A 1  347 ? 52.341 15.060  -1.743  1.00 30.10 ? 347  ARG A CB  1 
ATOM   2677 C  CG  . ARG A 1  347 ? 51.872 13.607  -1.822  1.00 31.18 ? 347  ARG A CG  1 
ATOM   2678 C  CD  . ARG A 1  347 ? 52.098 13.035  -3.220  1.00 32.25 ? 347  ARG A CD  1 
ATOM   2679 N  NE  . ARG A 1  347 ? 51.614 11.659  -3.340  1.00 34.66 ? 347  ARG A NE  1 
ATOM   2680 C  CZ  . ARG A 1  347 ? 50.338 11.306  -3.508  1.00 34.96 ? 347  ARG A CZ  1 
ATOM   2681 N  NH1 . ARG A 1  347 ? 50.030 10.024  -3.618  1.00 36.74 ? 347  ARG A NH1 1 
ATOM   2682 N  NH2 . ARG A 1  347 ? 49.368 12.212  -3.562  1.00 35.08 ? 347  ARG A NH2 1 
ATOM   2683 N  N   . LYS A 1  348 ? 54.160 15.167  0.818   1.00 30.06 ? 348  LYS A N   1 
ATOM   2684 C  CA  . LYS A 1  348 ? 55.016 14.497  1.797   1.00 30.30 ? 348  LYS A CA  1 
ATOM   2685 C  C   . LYS A 1  348 ? 54.625 14.853  3.232   1.00 29.61 ? 348  LYS A C   1 
ATOM   2686 O  O   . LYS A 1  348 ? 54.559 13.985  4.114   1.00 29.85 ? 348  LYS A O   1 
ATOM   2687 C  CB  . LYS A 1  348 ? 56.501 14.822  1.505   1.00 30.74 ? 348  LYS A CB  1 
ATOM   2688 C  CG  . LYS A 1  348 ? 57.526 13.928  2.221   1.00 33.74 ? 348  LYS A CG  1 
ATOM   2689 C  CD  . LYS A 1  348 ? 57.295 12.428  1.953   1.00 38.96 ? 348  LYS A CD  1 
ATOM   2690 C  CE  . LYS A 1  348 ? 57.323 11.624  3.268   1.00 41.19 ? 348  LYS A CE  1 
ATOM   2691 N  NZ  . LYS A 1  348 ? 56.637 10.286  3.148   1.00 42.54 ? 348  LYS A NZ  1 
ATOM   2692 N  N   . GLU A 1  349 ? 54.354 16.136  3.454   1.00 29.06 ? 349  GLU A N   1 
ATOM   2693 C  CA  . GLU A 1  349 ? 53.853 16.621  4.740   1.00 28.56 ? 349  GLU A CA  1 
ATOM   2694 C  C   . GLU A 1  349 ? 52.486 16.009  5.087   1.00 27.39 ? 349  GLU A C   1 
ATOM   2695 O  O   . GLU A 1  349 ? 52.273 15.569  6.222   1.00 26.86 ? 349  GLU A O   1 
ATOM   2696 C  CB  . GLU A 1  349 ? 53.802 18.152  4.745   1.00 28.86 ? 349  GLU A CB  1 
ATOM   2697 C  CG  . GLU A 1  349 ? 55.198 18.787  4.742   1.00 31.93 ? 349  GLU A CG  1 
ATOM   2698 C  CD  . GLU A 1  349 ? 55.169 20.288  4.599   1.00 34.78 ? 349  GLU A CD  1 
ATOM   2699 O  OE1 . GLU A 1  349 ? 55.813 20.967  5.421   1.00 37.68 ? 349  GLU A OE1 1 
ATOM   2700 O  OE2 . GLU A 1  349 ? 54.510 20.789  3.665   1.00 36.48 ? 349  GLU A OE2 1 
ATOM   2701 N  N   . PHE A 1  350 ? 51.583 15.953  4.104   1.00 26.35 ? 350  PHE A N   1 
ATOM   2702 C  CA  . PHE A 1  350 ? 50.300 15.247  4.285   1.00 25.27 ? 350  PHE A CA  1 
ATOM   2703 C  C   . PHE A 1  350 ? 50.531 13.806  4.756   1.00 24.72 ? 350  PHE A C   1 
ATOM   2704 O  O   . PHE A 1  350 ? 49.925 13.353  5.730   1.00 24.40 ? 350  PHE A O   1 
ATOM   2705 C  CB  . PHE A 1  350 ? 49.472 15.281  3.000   1.00 25.28 ? 350  PHE A CB  1 
ATOM   2706 C  CG  . PHE A 1  350 ? 48.157 14.551  3.104   1.00 24.80 ? 350  PHE A CG  1 
ATOM   2707 C  CD1 . PHE A 1  350 ? 47.009 15.216  3.528   1.00 23.55 ? 350  PHE A CD1 1 
ATOM   2708 C  CD2 . PHE A 1  350 ? 48.064 13.198  2.779   1.00 24.18 ? 350  PHE A CD2 1 
ATOM   2709 C  CE1 . PHE A 1  350 ? 45.786 14.547  3.627   1.00 22.10 ? 350  PHE A CE1 1 
ATOM   2710 C  CE2 . PHE A 1  350 ? 46.833 12.519  2.875   1.00 24.07 ? 350  PHE A CE2 1 
ATOM   2711 C  CZ  . PHE A 1  350 ? 45.699 13.200  3.295   1.00 22.27 ? 350  PHE A CZ  1 
ATOM   2712 N  N   . GLN A 1  351 ? 51.433 13.098  4.076   1.00 24.61 ? 351  GLN A N   1 
ATOM   2713 C  CA  . GLN A 1  351 ? 51.785 11.723  4.436   1.00 24.74 ? 351  GLN A CA  1 
ATOM   2714 C  C   . GLN A 1  351 ? 52.349 11.621  5.857   1.00 24.41 ? 351  GLN A C   1 
ATOM   2715 O  O   . GLN A 1  351 ? 52.029 10.697  6.602   1.00 23.62 ? 351  GLN A O   1 
ATOM   2716 C  CB  . GLN A 1  351 ? 52.780 11.143  3.413   1.00 24.87 ? 351  GLN A CB  1 
ATOM   2717 C  CG  . GLN A 1  351 ? 52.126 10.753  2.080   1.00 25.56 ? 351  GLN A CG  1 
ATOM   2718 C  CD  . GLN A 1  351 ? 53.148 10.460  1.002   1.00 28.83 ? 351  GLN A CD  1 
ATOM   2719 O  OE1 . GLN A 1  351 ? 54.074 11.244  0.778   1.00 27.70 ? 351  GLN A OE1 1 
ATOM   2720 N  NE2 . GLN A 1  351 ? 52.976 9.343   0.316   1.00 28.69 ? 351  GLN A NE2 1 
ATOM   2721 N  N   . GLU A 1  352 ? 53.178 12.589  6.229   1.00 25.38 ? 352  GLU A N   1 
ATOM   2722 C  CA  . GLU A 1  352 ? 53.727 12.636  7.585   1.00 25.77 ? 352  GLU A CA  1 
ATOM   2723 C  C   . GLU A 1  352 ? 52.616 12.934  8.594   1.00 25.42 ? 352  GLU A C   1 
ATOM   2724 O  O   . GLU A 1  352 ? 52.592 12.361  9.682   1.00 25.48 ? 352  GLU A O   1 
ATOM   2725 C  CB  . GLU A 1  352 ? 54.879 13.648  7.702   1.00 26.60 ? 352  GLU A CB  1 
ATOM   2726 C  CG  . GLU A 1  352 ? 56.142 13.323  6.873   1.00 29.94 ? 352  GLU A CG  1 
ATOM   2727 C  CD  . GLU A 1  352 ? 56.912 12.082  7.349   1.00 35.44 ? 352  GLU A CD  1 
ATOM   2728 O  OE1 . GLU A 1  352 ? 57.750 11.573  6.565   1.00 39.10 ? 352  GLU A OE1 1 
ATOM   2729 O  OE2 . GLU A 1  352 ? 56.698 11.604  8.490   1.00 37.86 ? 352  GLU A OE2 1 
ATOM   2730 N  N   . GLY A 1  353 ? 51.703 13.825  8.224   1.00 24.93 ? 353  GLY A N   1 
ATOM   2731 C  CA  . GLY A 1  353 ? 50.515 14.095  9.032   1.00 25.34 ? 353  GLY A CA  1 
ATOM   2732 C  C   . GLY A 1  353 ? 49.706 12.854  9.386   1.00 25.13 ? 353  GLY A C   1 
ATOM   2733 O  O   . GLY A 1  353 ? 49.216 12.725  10.516  1.00 25.29 ? 353  GLY A O   1 
ATOM   2734 N  N   . LEU A 1  354 ? 49.563 11.945  8.422   1.00 25.16 ? 354  LEU A N   1 
ATOM   2735 C  CA  . LEU A 1  354 ? 48.811 10.708  8.636   1.00 25.85 ? 354  LEU A CA  1 
ATOM   2736 C  C   . LEU A 1  354 ? 49.528 9.829   9.647   1.00 26.35 ? 354  LEU A C   1 
ATOM   2737 O  O   . LEU A 1  354 ? 48.883 9.147   10.449  1.00 26.27 ? 354  LEU A O   1 
ATOM   2738 C  CB  . LEU A 1  354 ? 48.583 9.935   7.323   1.00 25.18 ? 354  LEU A CB  1 
ATOM   2739 C  CG  . LEU A 1  354 ? 47.673 10.524  6.239   1.00 26.26 ? 354  LEU A CG  1 
ATOM   2740 C  CD1 . LEU A 1  354 ? 47.604 9.589   5.038   1.00 26.29 ? 354  LEU A CD1 1 
ATOM   2741 C  CD2 . LEU A 1  354 ? 46.262 10.838  6.742   1.00 24.99 ? 354  LEU A CD2 1 
ATOM   2742 N  N   . LYS A 1  355 ? 50.863 9.859   9.617   1.00 27.03 ? 355  LYS A N   1 
ATOM   2743 C  CA  . LYS A 1  355 ? 51.659 9.133   10.603  1.00 28.19 ? 355  LYS A CA  1 
ATOM   2744 C  C   . LYS A 1  355 ? 51.376 9.668   12.004  1.00 28.53 ? 355  LYS A C   1 
ATOM   2745 O  O   . LYS A 1  355 ? 51.172 8.882   12.934  1.00 29.00 ? 355  LYS A O   1 
ATOM   2746 C  CB  . LYS A 1  355 ? 53.155 9.187   10.267  1.00 28.80 ? 355  LYS A CB  1 
ATOM   2747 C  CG  . LYS A 1  355 ? 53.554 8.195   9.194   1.00 30.71 ? 355  LYS A CG  1 
ATOM   2748 C  CD  . LYS A 1  355 ? 54.969 8.443   8.636   1.00 36.25 ? 355  LYS A CD  1 
ATOM   2749 C  CE  . LYS A 1  355 ? 54.884 9.070   7.238   1.00 39.14 ? 355  LYS A CE  1 
ATOM   2750 N  NZ  . LYS A 1  355 ? 56.181 9.147   6.512   1.00 41.79 ? 355  LYS A NZ  1 
ATOM   2751 N  N   . ILE A 1  356 ? 51.318 10.997  12.131  1.00 28.55 ? 356  ILE A N   1 
ATOM   2752 C  CA  . ILE A 1  356 ? 50.965 11.659  13.392  1.00 28.98 ? 356  ILE A CA  1 
ATOM   2753 C  C   . ILE A 1  356 ? 49.589 11.194  13.893  1.00 28.64 ? 356  ILE A C   1 
ATOM   2754 O  O   . ILE A 1  356 ? 49.455 10.753  15.034  1.00 28.19 ? 356  ILE A O   1 
ATOM   2755 C  CB  . ILE A 1  356 ? 50.995 13.219  13.263  1.00 29.27 ? 356  ILE A CB  1 
ATOM   2756 C  CG1 . ILE A 1  356 ? 52.382 13.737  12.817  1.00 30.48 ? 356  ILE A CG1 1 
ATOM   2757 C  CG2 . ILE A 1  356 ? 50.470 13.912  14.552  1.00 30.03 ? 356  ILE A CG2 1 
ATOM   2758 C  CD1 . ILE A 1  356 ? 53.560 13.409  13.755  1.00 31.80 ? 356  ILE A CD1 1 
ATOM   2759 N  N   . PHE A 1  357 ? 48.578 11.250  13.030  1.00 28.14 ? 357  PHE A N   1 
ATOM   2760 C  CA  . PHE A 1  357 ? 47.219 10.923  13.458  1.00 27.53 ? 357  PHE A CA  1 
ATOM   2761 C  C   . PHE A 1  357 ? 46.834 9.451   13.444  1.00 27.92 ? 357  PHE A C   1 
ATOM   2762 O  O   . PHE A 1  357 ? 45.854 9.075   14.088  1.00 28.12 ? 357  PHE A O   1 
ATOM   2763 C  CB  . PHE A 1  357 ? 46.203 11.752  12.671  1.00 28.00 ? 357  PHE A CB  1 
ATOM   2764 C  CG  . PHE A 1  357 ? 46.153 13.169  13.107  1.00 26.94 ? 357  PHE A CG  1 
ATOM   2765 C  CD1 . PHE A 1  357 ? 45.393 13.532  14.225  1.00 27.61 ? 357  PHE A CD1 1 
ATOM   2766 C  CD2 . PHE A 1  357 ? 46.886 14.137  12.437  1.00 26.61 ? 357  PHE A CD2 1 
ATOM   2767 C  CE1 . PHE A 1  357 ? 45.371 14.852  14.678  1.00 26.60 ? 357  PHE A CE1 1 
ATOM   2768 C  CE2 . PHE A 1  357 ? 46.869 15.469  12.874  1.00 28.78 ? 357  PHE A CE2 1 
ATOM   2769 C  CZ  . PHE A 1  357 ? 46.105 15.823  14.003  1.00 26.54 ? 357  PHE A CZ  1 
ATOM   2770 N  N   . PHE A 1  358 ? 47.586 8.625   12.715  1.00 27.88 ? 358  PHE A N   1 
ATOM   2771 C  CA  . PHE A 1  358 ? 47.304 7.185   12.626  1.00 28.51 ? 358  PHE A CA  1 
ATOM   2772 C  C   . PHE A 1  358 ? 48.557 6.328   12.924  1.00 30.56 ? 358  PHE A C   1 
ATOM   2773 O  O   . PHE A 1  358 ? 48.947 5.490   12.107  1.00 29.98 ? 358  PHE A O   1 
ATOM   2774 C  CB  . PHE A 1  358 ? 46.708 6.848   11.238  1.00 27.43 ? 358  PHE A CB  1 
ATOM   2775 C  CG  . PHE A 1  358 ? 45.421 7.594   10.931  1.00 24.94 ? 358  PHE A CG  1 
ATOM   2776 C  CD1 . PHE A 1  358 ? 44.180 7.015   11.214  1.00 21.52 ? 358  PHE A CD1 1 
ATOM   2777 C  CD2 . PHE A 1  358 ? 45.455 8.888   10.406  1.00 22.79 ? 358  PHE A CD2 1 
ATOM   2778 C  CE1 . PHE A 1  358 ? 42.985 7.691   10.949  1.00 20.30 ? 358  PHE A CE1 1 
ATOM   2779 C  CE2 . PHE A 1  358 ? 44.258 9.594   10.135  1.00 20.14 ? 358  PHE A CE2 1 
ATOM   2780 C  CZ  . PHE A 1  358 ? 43.024 8.986   10.410  1.00 20.14 ? 358  PHE A CZ  1 
ATOM   2781 N  N   . PRO A 1  359 ? 49.162 6.502   14.125  1.00 32.61 ? 359  PRO A N   1 
ATOM   2782 C  CA  . PRO A 1  359 ? 50.532 6.013   14.416  1.00 33.93 ? 359  PRO A CA  1 
ATOM   2783 C  C   . PRO A 1  359 ? 50.776 4.510   14.229  1.00 35.24 ? 359  PRO A C   1 
ATOM   2784 O  O   . PRO A 1  359 ? 51.929 4.059   14.174  1.00 36.01 ? 359  PRO A O   1 
ATOM   2785 C  CB  . PRO A 1  359 ? 50.794 6.460   15.861  1.00 34.39 ? 359  PRO A CB  1 
ATOM   2786 C  CG  . PRO A 1  359 ? 49.497 6.899   16.424  1.00 33.70 ? 359  PRO A CG  1 
ATOM   2787 C  CD  . PRO A 1  359 ? 48.439 6.913   15.343  1.00 32.88 ? 359  PRO A CD  1 
ATOM   2788 N  N   . GLY A 1  360 ? 49.713 3.735   14.126  1.00 36.43 ? 360  GLY A N   1 
ATOM   2789 C  CA  . GLY A 1  360 ? 49.820 2.464   13.407  1.00 37.50 ? 360  GLY A CA  1 
ATOM   2790 C  C   . GLY A 1  360 ? 48.657 1.583   13.754  1.00 37.45 ? 360  GLY A C   1 
ATOM   2791 O  O   . GLY A 1  360 ? 48.587 1.127   14.898  1.00 38.91 ? 360  GLY A O   1 
ATOM   2792 N  N   . VAL A 1  361 ? 47.722 1.328   12.833  1.00 36.61 ? 361  VAL A N   1 
ATOM   2793 C  CA  . VAL A 1  361 ? 47.692 1.684   11.373  1.00 34.15 ? 361  VAL A CA  1 
ATOM   2794 C  C   . VAL A 1  361 ? 48.855 1.284   10.441  1.00 33.22 ? 361  VAL A C   1 
ATOM   2795 O  O   . VAL A 1  361 ? 49.879 1.978   10.352  1.00 32.88 ? 361  VAL A O   1 
ATOM   2796 C  CB  . VAL A 1  361 ? 47.048 3.050   11.016  1.00 33.96 ? 361  VAL A CB  1 
ATOM   2797 C  CG1 . VAL A 1  361 ? 46.544 2.984   9.573   1.00 33.79 ? 361  VAL A CG1 1 
ATOM   2798 C  CG2 . VAL A 1  361 ? 45.879 3.346   11.945  1.00 31.64 ? 361  VAL A CG2 1 
ATOM   2799 N  N   . SER A 1  362 ? 48.624 0.210   9.692   1.00 31.78 ? 362  SER A N   1 
ATOM   2800 C  CA  . SER A 1  362 ? 49.532 -0.254  8.649   1.00 30.72 ? 362  SER A CA  1 
ATOM   2801 C  C   . SER A 1  362 ? 49.767 0.790   7.560   1.00 30.02 ? 362  SER A C   1 
ATOM   2802 O  O   . SER A 1  362 ? 48.990 1.751   7.411   1.00 29.46 ? 362  SER A O   1 
ATOM   2803 C  CB  . SER A 1  362 ? 48.950 -1.502  8.001   1.00 30.69 ? 362  SER A CB  1 
ATOM   2804 O  OG  . SER A 1  362 ? 47.782 -1.166  7.271   1.00 31.08 ? 362  SER A OG  1 
ATOM   2805 N  N   . GLU A 1  363 ? 50.836 0.588   6.797   1.00 28.92 ? 363  GLU A N   1 
ATOM   2806 C  CA  . GLU A 1  363 ? 51.143 1.420   5.634   1.00 28.86 ? 363  GLU A CA  1 
ATOM   2807 C  C   . GLU A 1  363 ? 49.998 1.392   4.625   1.00 27.44 ? 363  GLU A C   1 
ATOM   2808 O  O   . GLU A 1  363 ? 49.664 2.418   4.017   1.00 26.73 ? 363  GLU A O   1 
ATOM   2809 C  CB  . GLU A 1  363 ? 52.426 0.934   4.953   1.00 29.40 ? 363  GLU A CB  1 
ATOM   2810 C  CG  . GLU A 1  363 ? 53.220 2.058   4.321   1.00 34.23 ? 363  GLU A CG  1 
ATOM   2811 C  CD  . GLU A 1  363 ? 53.676 3.104   5.349   1.00 39.72 ? 363  GLU A CD  1 
ATOM   2812 O  OE1 . GLU A 1  363 ? 53.859 2.763   6.546   1.00 42.44 ? 363  GLU A OE1 1 
ATOM   2813 O  OE2 . GLU A 1  363 ? 53.848 4.276   4.958   1.00 42.36 ? 363  GLU A OE2 1 
ATOM   2814 N  N   . PHE A 1  364 ? 49.408 0.208   4.462   1.00 26.21 ? 364  PHE A N   1 
ATOM   2815 C  CA  . PHE A 1  364 ? 48.255 0.032   3.582   1.00 25.36 ? 364  PHE A CA  1 
ATOM   2816 C  C   . PHE A 1  364 ? 47.085 0.909   4.034   1.00 24.60 ? 364  PHE A C   1 
ATOM   2817 O  O   . PHE A 1  364 ? 46.499 1.618   3.226   1.00 24.49 ? 364  PHE A O   1 
ATOM   2818 C  CB  . PHE A 1  364 ? 47.833 -1.441  3.501   1.00 25.35 ? 364  PHE A CB  1 
ATOM   2819 C  CG  . PHE A 1  364 ? 46.578 -1.648  2.730   1.00 25.58 ? 364  PHE A CG  1 
ATOM   2820 C  CD1 . PHE A 1  364 ? 45.403 -2.006  3.374   1.00 24.50 ? 364  PHE A CD1 1 
ATOM   2821 C  CD2 . PHE A 1  364 ? 46.555 -1.437  1.353   1.00 25.88 ? 364  PHE A CD2 1 
ATOM   2822 C  CE1 . PHE A 1  364 ? 44.222 -2.171  2.660   1.00 24.61 ? 364  PHE A CE1 1 
ATOM   2823 C  CE2 . PHE A 1  364 ? 45.378 -1.606  0.638   1.00 27.26 ? 364  PHE A CE2 1 
ATOM   2824 C  CZ  . PHE A 1  364 ? 44.203 -1.962  1.307   1.00 24.20 ? 364  PHE A CZ  1 
ATOM   2825 N  N   . GLY A 1  365 ? 46.770 0.857   5.328   1.00 24.29 ? 365  GLY A N   1 
ATOM   2826 C  CA  . GLY A 1  365 ? 45.744 1.702   5.941   1.00 23.19 ? 365  GLY A CA  1 
ATOM   2827 C  C   . GLY A 1  365 ? 45.952 3.174   5.644   1.00 22.99 ? 365  GLY A C   1 
ATOM   2828 O  O   . GLY A 1  365 ? 45.025 3.869   5.198   1.00 22.13 ? 365  GLY A O   1 
ATOM   2829 N  N   . LYS A 1  366 ? 47.175 3.654   5.877   1.00 22.29 ? 366  LYS A N   1 
ATOM   2830 C  CA  . LYS A 1  366 ? 47.496 5.050   5.604   1.00 22.41 ? 366  LYS A CA  1 
ATOM   2831 C  C   . LYS A 1  366 ? 47.400 5.378   4.111   1.00 22.27 ? 366  LYS A C   1 
ATOM   2832 O  O   . LYS A 1  366 ? 46.907 6.466   3.742   1.00 21.23 ? 366  LYS A O   1 
ATOM   2833 C  CB  . LYS A 1  366 ? 48.872 5.430   6.163   1.00 22.20 ? 366  LYS A CB  1 
ATOM   2834 C  CG  . LYS A 1  366 ? 48.910 5.506   7.698   1.00 24.66 ? 366  LYS A CG  1 
ATOM   2835 C  CD  . LYS A 1  366 ? 50.247 6.061   8.223   1.00 26.83 ? 366  LYS A CD  1 
ATOM   2836 C  CE  . LYS A 1  366 ? 51.394 5.079   8.012   1.00 29.50 ? 366  LYS A CE  1 
ATOM   2837 N  NZ  . LYS A 1  366 ? 51.194 3.868   8.853   1.00 32.33 ? 366  LYS A NZ  1 
ATOM   2838 N  N   . GLU A 1  367 ? 47.857 4.448   3.259   1.00 21.94 ? 367  GLU A N   1 
ATOM   2839 C  CA  . GLU A 1  367 ? 47.731 4.623   1.798   1.00 22.71 ? 367  GLU A CA  1 
ATOM   2840 C  C   . GLU A 1  367 ? 46.265 4.737   1.368   1.00 21.70 ? 367  GLU A C   1 
ATOM   2841 O  O   . GLU A 1  367 ? 45.926 5.559   0.507   1.00 21.77 ? 367  GLU A O   1 
ATOM   2842 C  CB  . GLU A 1  367 ? 48.434 3.501   1.009   1.00 22.88 ? 367  GLU A CB  1 
ATOM   2843 C  CG  . GLU A 1  367 ? 49.942 3.750   0.778   1.00 28.04 ? 367  GLU A CG  1 
ATOM   2844 C  CD  . GLU A 1  367 ? 50.706 2.552   0.167   1.00 32.99 ? 367  GLU A CD  1 
ATOM   2845 O  OE1 . GLU A 1  367 ? 50.092 1.535   -0.241  1.00 35.42 ? 367  GLU A OE1 1 
ATOM   2846 O  OE2 . GLU A 1  367 ? 51.951 2.632   0.098   1.00 37.37 ? 367  GLU A OE2 1 
ATOM   2847 N  N   . SER A 1  368 ? 45.396 3.951   1.996   1.00 21.65 ? 368  SER A N   1 
ATOM   2848 C  CA  . SER A 1  368 ? 43.977 3.957   1.621   1.00 21.55 ? 368  SER A CA  1 
ATOM   2849 C  C   . SER A 1  368 ? 43.337 5.309   1.945   1.00 21.69 ? 368  SER A C   1 
ATOM   2850 O  O   . SER A 1  368 ? 42.502 5.819   1.173   1.00 20.63 ? 368  SER A O   1 
ATOM   2851 C  CB  . SER A 1  368 ? 43.225 2.806   2.287   1.00 22.17 ? 368  SER A CB  1 
ATOM   2852 O  OG  . SER A 1  368 ? 42.974 3.071   3.658   1.00 22.48 ? 368  SER A OG  1 
ATOM   2853 N  N   . ILE A 1  369 ? 43.757 5.894   3.067   1.00 20.95 ? 369  ILE A N   1 
ATOM   2854 C  CA  . ILE A 1  369 ? 43.308 7.227   3.441   1.00 21.64 ? 369  ILE A CA  1 
ATOM   2855 C  C   . ILE A 1  369 ? 43.755 8.217   2.376   1.00 21.93 ? 369  ILE A C   1 
ATOM   2856 O  O   . ILE A 1  369 ? 42.940 8.989   1.874   1.00 21.87 ? 369  ILE A O   1 
ATOM   2857 C  CB  . ILE A 1  369 ? 43.841 7.691   4.830   1.00 21.70 ? 369  ILE A CB  1 
ATOM   2858 C  CG1 . ILE A 1  369 ? 43.392 6.737   5.939   1.00 21.73 ? 369  ILE A CG1 1 
ATOM   2859 C  CG2 . ILE A 1  369 ? 43.377 9.115   5.122   1.00 21.64 ? 369  ILE A CG2 1 
ATOM   2860 C  CD1 . ILE A 1  369 ? 44.073 6.995   7.285   1.00 23.59 ? 369  ILE A CD1 1 
ATOM   2861 N  N   . LEU A 1  370 ? 45.047 8.187   2.039   1.00 22.65 ? 370  LEU A N   1 
ATOM   2862 C  CA  . LEU A 1  370 ? 45.600 9.028   0.988   1.00 23.42 ? 370  LEU A CA  1 
ATOM   2863 C  C   . LEU A 1  370 ? 44.838 8.890   -0.332  1.00 23.36 ? 370  LEU A C   1 
ATOM   2864 O  O   . LEU A 1  370 ? 44.454 9.890   -0.931  1.00 23.03 ? 370  LEU A O   1 
ATOM   2865 C  CB  . LEU A 1  370 ? 47.096 8.727   0.790   1.00 24.11 ? 370  LEU A CB  1 
ATOM   2866 C  CG  . LEU A 1  370 ? 47.898 9.461   -0.300  1.00 26.36 ? 370  LEU A CG  1 
ATOM   2867 C  CD1 . LEU A 1  370 ? 47.968 10.945  -0.029  1.00 28.75 ? 370  LEU A CD1 1 
ATOM   2868 C  CD2 . LEU A 1  370 ? 49.313 8.916   -0.383  1.00 29.28 ? 370  LEU A CD2 1 
ATOM   2869 N  N   . PHE A 1  371 ? 44.623 7.657   -0.781  1.00 23.69 ? 371  PHE A N   1 
ATOM   2870 C  CA  . PHE A 1  371 ? 43.894 7.419   -2.021  1.00 24.43 ? 371  PHE A CA  1 
ATOM   2871 C  C   . PHE A 1  371 ? 42.498 8.045   -2.003  1.00 24.29 ? 371  PHE A C   1 
ATOM   2872 O  O   . PHE A 1  371 ? 42.104 8.708   -2.959  1.00 23.82 ? 371  PHE A O   1 
ATOM   2873 C  CB  . PHE A 1  371 ? 43.788 5.928   -2.346  1.00 24.84 ? 371  PHE A CB  1 
ATOM   2874 C  CG  . PHE A 1  371 ? 43.100 5.650   -3.654  1.00 27.96 ? 371  PHE A CG  1 
ATOM   2875 C  CD1 . PHE A 1  371 ? 41.755 5.260   -3.682  1.00 30.75 ? 371  PHE A CD1 1 
ATOM   2876 C  CD2 . PHE A 1  371 ? 43.786 5.799   -4.861  1.00 30.11 ? 371  PHE A CD2 1 
ATOM   2877 C  CE1 . PHE A 1  371 ? 41.104 5.003   -4.906  1.00 31.80 ? 371  PHE A CE1 1 
ATOM   2878 C  CE2 . PHE A 1  371 ? 43.150 5.553   -6.094  1.00 32.46 ? 371  PHE A CE2 1 
ATOM   2879 C  CZ  . PHE A 1  371 ? 41.806 5.151   -6.114  1.00 32.02 ? 371  PHE A CZ  1 
ATOM   2880 N  N   . HIS A 1  372 ? 41.753 7.847   -0.921  1.00 24.29 ? 372  HIS A N   1 
ATOM   2881 C  CA  A HIS A 1  372 ? 40.377 8.351   -0.821  0.50 25.03 ? 372  HIS A CA  1 
ATOM   2882 C  CA  B HIS A 1  372 ? 40.392 8.351   -0.907  0.50 25.10 ? 372  HIS A CA  1 
ATOM   2883 C  C   . HIS A 1  372 ? 40.280 9.874   -0.759  1.00 25.48 ? 372  HIS A C   1 
ATOM   2884 O  O   . HIS A 1  372 ? 39.335 10.470  -1.272  1.00 25.92 ? 372  HIS A O   1 
ATOM   2885 C  CB  A HIS A 1  372 ? 39.636 7.761   0.384   0.50 24.65 ? 372  HIS A CB  1 
ATOM   2886 C  CB  B HIS A 1  372 ? 39.528 7.549   0.069   0.50 25.05 ? 372  HIS A CB  1 
ATOM   2887 C  CG  A HIS A 1  372 ? 38.172 8.075   0.381   0.50 25.08 ? 372  HIS A CG  1 
ATOM   2888 C  CG  B HIS A 1  372 ? 39.226 6.170   -0.434  0.50 25.09 ? 372  HIS A CG  1 
ATOM   2889 N  ND1 A HIS A 1  372 ? 37.258 7.343   -0.346  0.50 24.33 ? 372  HIS A ND1 1 
ATOM   2890 N  ND1 B HIS A 1  372 ? 40.174 5.169   -0.467  0.50 24.98 ? 372  HIS A ND1 1 
ATOM   2891 C  CD2 A HIS A 1  372 ? 37.470 9.070   0.977   0.50 24.74 ? 372  HIS A CD2 1 
ATOM   2892 C  CD2 B HIS A 1  372 ? 38.106 5.644   -0.985  0.50 24.78 ? 372  HIS A CD2 1 
ATOM   2893 C  CE1 A HIS A 1  372 ? 36.053 7.863   -0.184  0.50 24.03 ? 372  HIS A CE1 1 
ATOM   2894 C  CE1 B HIS A 1  372 ? 39.642 4.077   -0.987  0.50 24.87 ? 372  HIS A CE1 1 
ATOM   2895 N  NE2 A HIS A 1  372 ? 36.155 8.914   0.610   0.50 24.27 ? 372  HIS A NE2 1 
ATOM   2896 N  NE2 B HIS A 1  372 ? 38.390 4.340   -1.313  0.50 23.84 ? 372  HIS A NE2 1 
ATOM   2897 N  N   . TYR A 1  373 ? 41.257 10.506  -0.124  1.00 25.65 ? 373  TYR A N   1 
ATOM   2898 C  CA  . TYR A 1  373 ? 41.153 11.936  0.120   1.00 27.04 ? 373  TYR A CA  1 
ATOM   2899 C  C   . TYR A 1  373 ? 41.958 12.843  -0.810  1.00 28.50 ? 373  TYR A C   1 
ATOM   2900 O  O   . TYR A 1  373 ? 41.872 14.065  -0.704  1.00 28.52 ? 373  TYR A O   1 
ATOM   2901 C  CB  . TYR A 1  373 ? 41.498 12.236  1.584   1.00 26.28 ? 373  TYR A CB  1 
ATOM   2902 C  CG  . TYR A 1  373 ? 40.321 12.053  2.523   1.00 24.31 ? 373  TYR A CG  1 
ATOM   2903 C  CD1 . TYR A 1  373 ? 39.443 13.115  2.785   1.00 22.42 ? 373  TYR A CD1 1 
ATOM   2904 C  CD2 . TYR A 1  373 ? 40.100 10.831  3.170   1.00 22.48 ? 373  TYR A CD2 1 
ATOM   2905 C  CE1 . TYR A 1  373 ? 38.346 12.958  3.668   1.00 21.81 ? 373  TYR A CE1 1 
ATOM   2906 C  CE2 . TYR A 1  373 ? 39.020 10.664  4.062   1.00 21.26 ? 373  TYR A CE2 1 
ATOM   2907 C  CZ  . TYR A 1  373 ? 38.145 11.731  4.296   1.00 20.54 ? 373  TYR A CZ  1 
ATOM   2908 O  OH  . TYR A 1  373 ? 37.079 11.569  5.159   1.00 20.81 ? 373  TYR A OH  1 
ATOM   2909 N  N   . THR A 1  374 ? 42.754 12.268  -1.701  1.00 30.32 ? 374  THR A N   1 
ATOM   2910 C  CA  . THR A 1  374 ? 43.616 13.111  -2.536  1.00 33.38 ? 374  THR A CA  1 
ATOM   2911 C  C   . THR A 1  374 ? 43.417 12.920  -4.033  1.00 35.44 ? 374  THR A C   1 
ATOM   2912 O  O   . THR A 1  374 ? 44.301 13.238  -4.828  1.00 34.88 ? 374  THR A O   1 
ATOM   2913 C  CB  . THR A 1  374 ? 45.125 12.989  -2.170  1.00 33.07 ? 374  THR A CB  1 
ATOM   2914 O  OG1 . THR A 1  374 ? 45.575 11.653  -2.415  1.00 33.10 ? 374  THR A OG1 1 
ATOM   2915 C  CG2 . THR A 1  374 ? 45.357 13.356  -0.712  1.00 33.96 ? 374  THR A CG2 1 
ATOM   2916 N  N   . ASP A 1  375 ? 42.252 12.409  -4.412  1.00 38.59 ? 375  ASP A N   1 
ATOM   2917 C  CA  . ASP A 1  375 ? 41.858 12.404  -5.815  1.00 42.20 ? 375  ASP A CA  1 
ATOM   2918 C  C   . ASP A 1  375 ? 41.410 13.817  -6.209  1.00 43.78 ? 375  ASP A C   1 
ATOM   2919 O  O   . ASP A 1  375 ? 40.210 14.104  -6.325  1.00 44.72 ? 375  ASP A O   1 
ATOM   2920 C  CB  . ASP A 1  375 ? 40.738 11.396  -6.061  1.00 42.42 ? 375  ASP A CB  1 
ATOM   2921 C  CG  . ASP A 1  375 ? 40.376 11.289  -7.527  1.00 45.42 ? 375  ASP A CG  1 
ATOM   2922 O  OD1 . ASP A 1  375 ? 41.305 11.234  -8.364  1.00 47.20 ? 375  ASP A OD1 1 
ATOM   2923 O  OD2 . ASP A 1  375 ? 39.166 11.259  -7.844  1.00 48.48 ? 375  ASP A OD2 1 
ATOM   2924 N  N   . TRP A 1  376 ? 42.383 14.705  -6.390  1.00 45.73 ? 376  TRP A N   1 
ATOM   2925 C  CA  . TRP A 1  376 ? 42.094 16.095  -6.706  1.00 47.31 ? 376  TRP A CA  1 
ATOM   2926 C  C   . TRP A 1  376 ? 41.276 16.186  -7.974  1.00 48.91 ? 376  TRP A C   1 
ATOM   2927 O  O   . TRP A 1  376 ? 41.678 15.710  -9.051  1.00 48.89 ? 376  TRP A O   1 
ATOM   2928 C  CB  . TRP A 1  376 ? 43.370 16.920  -6.853  1.00 47.03 ? 376  TRP A CB  1 
ATOM   2929 C  CG  . TRP A 1  376 ? 44.311 16.757  -5.735  1.00 46.55 ? 376  TRP A CG  1 
ATOM   2930 C  CD1 . TRP A 1  376 ? 45.647 16.527  -5.827  1.00 46.02 ? 376  TRP A CD1 1 
ATOM   2931 C  CD2 . TRP A 1  376 ? 43.998 16.785  -4.336  1.00 46.06 ? 376  TRP A CD2 1 
ATOM   2932 N  NE1 . TRP A 1  376 ? 46.197 16.425  -4.572  1.00 46.61 ? 376  TRP A NE1 1 
ATOM   2933 C  CE2 . TRP A 1  376 ? 45.205 16.577  -3.638  1.00 45.59 ? 376  TRP A CE2 1 
ATOM   2934 C  CE3 . TRP A 1  376 ? 42.816 16.971  -3.605  1.00 45.57 ? 376  TRP A CE3 1 
ATOM   2935 C  CZ2 . TRP A 1  376 ? 45.269 16.556  -2.245  1.00 45.46 ? 376  TRP A CZ2 1 
ATOM   2936 C  CZ3 . TRP A 1  376 ? 42.880 16.943  -2.223  1.00 44.79 ? 376  TRP A CZ3 1 
ATOM   2937 C  CH2 . TRP A 1  376 ? 44.099 16.735  -1.557  1.00 44.59 ? 376  TRP A CH2 1 
ATOM   2938 N  N   . VAL A 1  377 ? 40.105 16.779  -7.806  1.00 50.62 ? 377  VAL A N   1 
ATOM   2939 C  CA  . VAL A 1  377 ? 39.225 17.095  -8.903  1.00 52.15 ? 377  VAL A CA  1 
ATOM   2940 C  C   . VAL A 1  377 ? 38.895 18.580  -8.747  1.00 52.86 ? 377  VAL A C   1 
ATOM   2941 O  O   . VAL A 1  377 ? 37.862 18.928  -8.174  1.00 53.24 ? 377  VAL A O   1 
ATOM   2942 C  CB  . VAL A 1  377 ? 37.968 16.145  -8.950  1.00 52.24 ? 377  VAL A CB  1 
ATOM   2943 C  CG1 . VAL A 1  377 ? 37.256 16.084  -7.596  1.00 52.59 ? 377  VAL A CG1 1 
ATOM   2944 C  CG2 . VAL A 1  377 ? 37.004 16.514  -10.102 1.00 52.49 ? 377  VAL A CG2 1 
ATOM   2945 N  N   . ASP A 1  378 ? 39.813 19.460  -9.173  1.00 53.80 ? 378  ASP A N   1 
ATOM   2946 C  CA  . ASP A 1  378 ? 41.197 19.110  -9.541  1.00 54.44 ? 378  ASP A CA  1 
ATOM   2947 C  C   . ASP A 1  378 ? 42.118 20.280  -9.222  1.00 54.63 ? 378  ASP A C   1 
ATOM   2948 O  O   . ASP A 1  378 ? 42.883 20.244  -8.247  1.00 54.87 ? 378  ASP A O   1 
ATOM   2949 C  CB  . ASP A 1  378 ? 41.314 18.749  -11.024 1.00 54.76 ? 378  ASP A CB  1 
ATOM   2950 C  CG  . ASP A 1  378 ? 42.466 17.805  -11.315 1.00 55.60 ? 378  ASP A CG  1 
ATOM   2951 O  OD1 . ASP A 1  378 ? 43.641 18.181  -11.098 1.00 57.26 ? 378  ASP A OD1 1 
ATOM   2952 O  OD2 . ASP A 1  378 ? 42.188 16.683  -11.786 1.00 56.56 ? 378  ASP A OD2 1 
ATOM   2953 N  N   . ASP A 1  379 ? 42.041 21.298  -10.079 1.00 54.50 ? 379  ASP A N   1 
ATOM   2954 C  CA  . ASP A 1  379 ? 42.687 22.594  -9.909  1.00 54.20 ? 379  ASP A CA  1 
ATOM   2955 C  C   . ASP A 1  379 ? 44.203 22.582  -9.636  1.00 53.73 ? 379  ASP A C   1 
ATOM   2956 O  O   . ASP A 1  379 ? 44.993 22.907  -10.531 1.00 53.53 ? 379  ASP A O   1 
ATOM   2957 C  CB  . ASP A 1  379 ? 41.924 23.427  -8.866  1.00 54.90 ? 379  ASP A CB  1 
ATOM   2958 C  CG  . ASP A 1  379 ? 42.307 24.916  -8.891  1.00 56.41 ? 379  ASP A CG  1 
ATOM   2959 O  OD1 . ASP A 1  379 ? 43.326 25.277  -9.527  1.00 58.06 ? 379  ASP A OD1 1 
ATOM   2960 O  OD2 . ASP A 1  379 ? 41.573 25.733  -8.282  1.00 58.49 ? 379  ASP A OD2 1 
ATOM   2961 N  N   . GLN A 1  380 ? 44.591 22.204  -8.412  1.00 53.00 ? 380  GLN A N   1 
ATOM   2962 C  CA  . GLN A 1  380 ? 45.950 22.422  -7.887  1.00 52.00 ? 380  GLN A CA  1 
ATOM   2963 C  C   . GLN A 1  380 ? 46.300 23.911  -8.010  1.00 51.10 ? 380  GLN A C   1 
ATOM   2964 O  O   . GLN A 1  380 ? 47.076 24.261  -8.901  1.00 51.56 ? 380  GLN A O   1 
ATOM   2965 C  CB  . GLN A 1  380 ? 46.994 21.559  -8.634  1.00 51.67 ? 380  GLN A CB  1 
ATOM   2966 C  CG  . GLN A 1  380 ? 47.155 20.140  -8.112  1.00 51.54 ? 380  GLN A CG  1 
ATOM   2967 C  CD  . GLN A 1  380 ? 46.178 19.140  -8.733  1.00 52.64 ? 380  GLN A CD  1 
ATOM   2968 O  OE1 . GLN A 1  380 ? 46.328 17.929  -8.560  1.00 53.40 ? 380  GLN A OE1 1 
ATOM   2969 N  NE2 . GLN A 1  380 ? 45.196 19.635  -9.476  1.00 51.53 ? 380  GLN A NE2 1 
ATOM   2970 N  N   . ARG A 1  381 ? 45.794 24.804  -7.145  1.00 49.76 ? 381  ARG A N   1 
ATOM   2971 C  CA  . ARG A 1  381 ? 45.154 24.566  -5.821  1.00 48.01 ? 381  ARG A CA  1 
ATOM   2972 C  C   . ARG A 1  381 ? 46.109 24.095  -4.725  1.00 46.42 ? 381  ARG A C   1 
ATOM   2973 O  O   . ARG A 1  381 ? 46.070 22.930  -4.316  1.00 46.36 ? 381  ARG A O   1 
ATOM   2974 C  CB  . ARG A 1  381 ? 43.864 23.739  -5.873  1.00 48.28 ? 381  ARG A CB  1 
ATOM   2975 C  CG  . ARG A 1  381 ? 42.648 24.525  -5.429  1.00 49.14 ? 381  ARG A CG  1 
ATOM   2976 C  CD  . ARG A 1  381 ? 41.452 23.634  -5.168  1.00 50.76 ? 381  ARG A CD  1 
ATOM   2977 N  NE  . ARG A 1  381 ? 40.489 24.276  -4.270  1.00 52.54 ? 381  ARG A NE  1 
ATOM   2978 C  CZ  . ARG A 1  381 ? 40.413 24.068  -2.953  1.00 52.74 ? 381  ARG A CZ  1 
ATOM   2979 N  NH1 . ARG A 1  381 ? 41.245 23.224  -2.343  1.00 52.34 ? 381  ARG A NH1 1 
ATOM   2980 N  NH2 . ARG A 1  381 ? 39.499 24.711  -2.240  1.00 52.42 ? 381  ARG A NH2 1 
ATOM   2981 N  N   . PRO A 1  382 ? 46.955 25.021  -4.231  1.00 44.80 ? 382  PRO A N   1 
ATOM   2982 C  CA  . PRO A 1  382 ? 47.981 24.755  -3.226  1.00 43.17 ? 382  PRO A CA  1 
ATOM   2983 C  C   . PRO A 1  382 ? 47.424 24.301  -1.878  1.00 41.46 ? 382  PRO A C   1 
ATOM   2984 O  O   . PRO A 1  382 ? 48.151 23.685  -1.106  1.00 41.22 ? 382  PRO A O   1 
ATOM   2985 C  CB  . PRO A 1  382 ? 48.663 26.118  -3.050  1.00 43.17 ? 382  PRO A CB  1 
ATOM   2986 C  CG  . PRO A 1  382 ? 48.291 26.906  -4.250  1.00 44.16 ? 382  PRO A CG  1 
ATOM   2987 C  CD  . PRO A 1  382 ? 46.916 26.452  -4.585  1.00 44.86 ? 382  PRO A CD  1 
ATOM   2988 N  N   . GLU A 1  383 ? 46.161 24.607  -1.599  1.00 39.42 ? 383  GLU A N   1 
ATOM   2989 C  CA  . GLU A 1  383 ? 45.571 24.300  -0.289  1.00 38.26 ? 383  GLU A CA  1 
ATOM   2990 C  C   . GLU A 1  383 ? 44.943 22.903  -0.241  1.00 36.67 ? 383  GLU A C   1 
ATOM   2991 O  O   . GLU A 1  383 ? 44.366 22.498  0.774   1.00 35.86 ? 383  GLU A O   1 
ATOM   2992 C  CB  . GLU A 1  383 ? 44.585 25.403  0.149   1.00 38.50 ? 383  GLU A CB  1 
ATOM   2993 C  CG  . GLU A 1  383 ? 43.264 25.471  -0.623  1.00 40.37 ? 383  GLU A CG  1 
ATOM   2994 C  CD  . GLU A 1  383 ? 43.346 26.220  -1.958  1.00 43.47 ? 383  GLU A CD  1 
ATOM   2995 O  OE1 . GLU A 1  383 ? 42.289 26.366  -2.611  1.00 45.87 ? 383  GLU A OE1 1 
ATOM   2996 O  OE2 . GLU A 1  383 ? 44.440 26.658  -2.368  1.00 43.37 ? 383  GLU A OE2 1 
ATOM   2997 N  N   . ASN A 1  384 ? 45.082 22.174  -1.352  1.00 34.80 ? 384  ASN A N   1 
ATOM   2998 C  CA  . ASN A 1  384 ? 44.594 20.802  -1.490  1.00 33.28 ? 384  ASN A CA  1 
ATOM   2999 C  C   . ASN A 1  384 ? 44.942 19.898  -0.316  1.00 31.34 ? 384  ASN A C   1 
ATOM   3000 O  O   . ASN A 1  384 ? 44.051 19.373  0.349   1.00 30.74 ? 384  ASN A O   1 
ATOM   3001 C  CB  . ASN A 1  384 ? 45.119 20.176  -2.790  1.00 33.49 ? 384  ASN A CB  1 
ATOM   3002 C  CG  . ASN A 1  384 ? 44.216 20.450  -3.981  1.00 35.83 ? 384  ASN A CG  1 
ATOM   3003 O  OD1 . ASN A 1  384 ? 43.065 20.891  -3.824  1.00 37.07 ? 384  ASN A OD1 1 
ATOM   3004 N  ND2 . ASN A 1  384 ? 44.731 20.180  -5.191  1.00 36.56 ? 384  ASN A ND2 1 
ATOM   3005 N  N   . TYR A 1  385 ? 46.235 19.719  -0.062  1.00 29.91 ? 385  TYR A N   1 
ATOM   3006 C  CA  . TYR A 1  385 ? 46.665 18.811  1.004   1.00 28.89 ? 385  TYR A CA  1 
ATOM   3007 C  C   . TYR A 1  385 ? 46.281 19.293  2.395   1.00 27.44 ? 385  TYR A C   1 
ATOM   3008 O  O   . TYR A 1  385 ? 45.894 18.486  3.245   1.00 26.42 ? 385  TYR A O   1 
ATOM   3009 C  CB  . TYR A 1  385 ? 48.158 18.508  0.921   1.00 29.04 ? 385  TYR A CB  1 
ATOM   3010 C  CG  . TYR A 1  385 ? 48.485 17.586  -0.226  1.00 30.47 ? 385  TYR A CG  1 
ATOM   3011 C  CD1 . TYR A 1  385 ? 48.147 16.229  -0.171  1.00 30.97 ? 385  TYR A CD1 1 
ATOM   3012 C  CD2 . TYR A 1  385 ? 49.111 18.069  -1.377  1.00 30.83 ? 385  TYR A CD2 1 
ATOM   3013 C  CE1 . TYR A 1  385 ? 48.427 15.377  -1.229  1.00 31.62 ? 385  TYR A CE1 1 
ATOM   3014 C  CE2 . TYR A 1  385 ? 49.401 17.224  -2.443  1.00 32.40 ? 385  TYR A CE2 1 
ATOM   3015 C  CZ  . TYR A 1  385 ? 49.055 15.881  -2.358  1.00 32.23 ? 385  TYR A CZ  1 
ATOM   3016 O  OH  . TYR A 1  385 ? 49.336 15.051  -3.403  1.00 33.61 ? 385  TYR A OH  1 
ATOM   3017 N  N   . ARG A 1  386 ? 46.387 20.605  2.612   1.00 26.33 ? 386  ARG A N   1 
ATOM   3018 C  CA  . ARG A 1  386 ? 46.011 21.217  3.905   1.00 25.11 ? 386  ARG A CA  1 
ATOM   3019 C  C   . ARG A 1  386 ? 44.552 20.889  4.262   1.00 24.36 ? 386  ARG A C   1 
ATOM   3020 O  O   . ARG A 1  386 ? 44.266 20.437  5.372   1.00 23.79 ? 386  ARG A O   1 
ATOM   3021 C  CB  . ARG A 1  386 ? 46.231 22.733  3.863   1.00 25.07 ? 386  ARG A CB  1 
ATOM   3022 C  CG  . ARG A 1  386 ? 45.839 23.485  5.144   1.00 23.65 ? 386  ARG A CG  1 
ATOM   3023 C  CD  . ARG A 1  386 ? 45.775 24.981  4.887   1.00 23.21 ? 386  ARG A CD  1 
ATOM   3024 N  NE  . ARG A 1  386 ? 44.511 25.397  4.301   1.00 23.20 ? 386  ARG A NE  1 
ATOM   3025 C  CZ  . ARG A 1  386 ? 44.328 26.532  3.616   1.00 24.64 ? 386  ARG A CZ  1 
ATOM   3026 N  NH1 . ARG A 1  386 ? 45.329 27.373  3.426   1.00 25.19 ? 386  ARG A NH1 1 
ATOM   3027 N  NH2 . ARG A 1  386 ? 43.134 26.833  3.119   1.00 22.00 ? 386  ARG A NH2 1 
ATOM   3028 N  N   . GLU A 1  387 ? 43.648 21.104  3.308   1.00 23.99 ? 387  GLU A N   1 
ATOM   3029 C  CA  . GLU A 1  387 ? 42.216 20.870  3.513   1.00 24.26 ? 387  GLU A CA  1 
ATOM   3030 C  C   . GLU A 1  387 ? 41.905 19.400  3.678   1.00 22.82 ? 387  GLU A C   1 
ATOM   3031 O  O   . GLU A 1  387 ? 41.092 19.033  4.538   1.00 22.12 ? 387  GLU A O   1 
ATOM   3032 C  CB  . GLU A 1  387 ? 41.378 21.465  2.377   1.00 25.07 ? 387  GLU A CB  1 
ATOM   3033 C  CG  . GLU A 1  387 ? 41.642 22.949  2.197   1.00 30.51 ? 387  GLU A CG  1 
ATOM   3034 C  CD  . GLU A 1  387 ? 40.508 23.706  1.543   1.00 35.70 ? 387  GLU A CD  1 
ATOM   3035 O  OE1 . GLU A 1  387 ? 40.488 24.946  1.695   1.00 39.48 ? 387  GLU A OE1 1 
ATOM   3036 O  OE2 . GLU A 1  387 ? 39.648 23.086  0.882   1.00 38.15 ? 387  GLU A OE2 1 
ATOM   3037 N  N   . ALA A 1  388 ? 42.588 18.568  2.884   1.00 21.45 ? 388  ALA A N   1 
ATOM   3038 C  CA  . ALA A 1  388 ? 42.418 17.121  2.962   1.00 20.69 ? 388  ALA A CA  1 
ATOM   3039 C  C   . ALA A 1  388 ? 42.741 16.580  4.357   1.00 20.58 ? 388  ALA A C   1 
ATOM   3040 O  O   . ALA A 1  388 ? 41.969 15.788  4.893   1.00 19.80 ? 388  ALA A O   1 
ATOM   3041 C  CB  . ALA A 1  388 ? 43.248 16.388  1.863   1.00 20.73 ? 388  ALA A CB  1 
ATOM   3042 N  N   . LEU A 1  389 ? 43.843 17.029  4.974   1.00 19.94 ? 389  LEU A N   1 
ATOM   3043 C  CA  . LEU A 1  389 ? 44.203 16.475  6.281   1.00 19.82 ? 389  LEU A CA  1 
ATOM   3044 C  C   . LEU A 1  389 ? 43.187 16.839  7.386   1.00 19.53 ? 389  LEU A C   1 
ATOM   3045 O  O   . LEU A 1  389 ? 42.859 16.008  8.235   1.00 19.53 ? 389  LEU A O   1 
ATOM   3046 C  CB  . LEU A 1  389 ? 45.618 16.868  6.695   1.00 19.64 ? 389  LEU A CB  1 
ATOM   3047 C  CG  . LEU A 1  389 ? 46.193 16.105  7.897   1.00 20.21 ? 389  LEU A CG  1 
ATOM   3048 C  CD1 . LEU A 1  389 ? 46.209 14.579  7.698   1.00 20.82 ? 389  LEU A CD1 1 
ATOM   3049 C  CD2 . LEU A 1  389 ? 47.600 16.632  8.202   1.00 21.17 ? 389  LEU A CD2 1 
ATOM   3050 N  N   . GLY A 1  390 ? 42.710 18.082  7.351   1.00 19.22 ? 390  GLY A N   1 
ATOM   3051 C  CA  . GLY A 1  390 ? 41.630 18.542  8.233   1.00 19.40 ? 390  GLY A CA  1 
ATOM   3052 C  C   . GLY A 1  390 ? 40.380 17.698  8.111   1.00 18.90 ? 390  GLY A C   1 
ATOM   3053 O  O   . GLY A 1  390 ? 39.811 17.271  9.113   1.00 18.75 ? 390  GLY A O   1 
ATOM   3054 N  N   . ASP A 1  391 ? 39.958 17.446  6.875   1.00 19.81 ? 391  ASP A N   1 
ATOM   3055 C  CA  . ASP A 1  391 ? 38.781 16.604  6.620   1.00 20.30 ? 391  ASP A CA  1 
ATOM   3056 C  C   . ASP A 1  391 ? 38.991 15.156  7.066   1.00 19.89 ? 391  ASP A C   1 
ATOM   3057 O  O   . ASP A 1  391 ? 38.100 14.578  7.670   1.00 19.97 ? 391  ASP A O   1 
ATOM   3058 C  CB  . ASP A 1  391 ? 38.344 16.691  5.135   1.00 20.47 ? 391  ASP A CB  1 
ATOM   3059 C  CG  . ASP A 1  391 ? 37.723 18.055  4.791   1.00 23.81 ? 391  ASP A CG  1 
ATOM   3060 O  OD1 . ASP A 1  391 ? 36.936 18.606  5.609   1.00 26.14 ? 391  ASP A OD1 1 
ATOM   3061 O  OD2 . ASP A 1  391 ? 38.025 18.585  3.705   1.00 24.42 ? 391  ASP A OD2 1 
ATOM   3062 N  N   . VAL A 1  392 ? 40.157 14.563  6.767   1.00 19.30 ? 392  VAL A N   1 
ATOM   3063 C  CA  . VAL A 1  392 ? 40.485 13.221  7.290   1.00 18.28 ? 392  VAL A CA  1 
ATOM   3064 C  C   . VAL A 1  392 ? 40.248 13.175  8.800   1.00 18.19 ? 392  VAL A C   1 
ATOM   3065 O  O   . VAL A 1  392 ? 39.533 12.308  9.312   1.00 17.90 ? 392  VAL A O   1 
ATOM   3066 C  CB  . VAL A 1  392 ? 41.977 12.821  6.983   1.00 19.12 ? 392  VAL A CB  1 
ATOM   3067 C  CG1 . VAL A 1  392 ? 42.398 11.557  7.763   1.00 19.45 ? 392  VAL A CG1 1 
ATOM   3068 C  CG2 . VAL A 1  392 ? 42.191 12.618  5.498   1.00 17.84 ? 392  VAL A CG2 1 
ATOM   3069 N  N   . VAL A 1  393 ? 40.866 14.113  9.514   1.00 17.07 ? 393  VAL A N   1 
ATOM   3070 C  CA  . VAL A 1  393 ? 40.804 14.102  10.968  1.00 17.74 ? 393  VAL A CA  1 
ATOM   3071 C  C   . VAL A 1  393 ? 39.369 14.354  11.453  1.00 17.01 ? 393  VAL A C   1 
ATOM   3072 O  O   . VAL A 1  393 ? 38.901 13.649  12.330  1.00 16.91 ? 393  VAL A O   1 
ATOM   3073 C  CB  . VAL A 1  393 ? 41.813 15.100  11.594  1.00 16.93 ? 393  VAL A CB  1 
ATOM   3074 C  CG1 . VAL A 1  393 ? 41.610 15.203  13.106  1.00 17.73 ? 393  VAL A CG1 1 
ATOM   3075 C  CG2 . VAL A 1  393 ? 43.274 14.676  11.252  1.00 17.71 ? 393  VAL A CG2 1 
ATOM   3076 N  N   . GLY A 1  394 ? 38.666 15.310  10.854  1.00 16.84 ? 394  GLY A N   1 
ATOM   3077 C  CA  . GLY A 1  394 ? 37.294 15.618  11.307  1.00 17.47 ? 394  GLY A CA  1 
ATOM   3078 C  C   . GLY A 1  394 ? 36.300 14.493  10.986  1.00 17.59 ? 394  GLY A C   1 
ATOM   3079 O  O   . GLY A 1  394 ? 35.426 14.153  11.805  1.00 17.03 ? 394  GLY A O   1 
ATOM   3080 N  N   . ASP A 1  395 ? 36.456 13.902  9.807   1.00 16.45 ? 395  ASP A N   1 
ATOM   3081 C  CA  . ASP A 1  395 ? 35.517 12.859  9.342   1.00 17.77 ? 395  ASP A CA  1 
ATOM   3082 C  C   . ASP A 1  395 ? 35.685 11.572  10.153  1.00 17.26 ? 395  ASP A C   1 
ATOM   3083 O  O   . ASP A 1  395 ? 34.709 10.981  10.583  1.00 17.12 ? 395  ASP A O   1 
ATOM   3084 C  CB  . ASP A 1  395 ? 35.707 12.543  7.844   1.00 16.66 ? 395  ASP A CB  1 
ATOM   3085 C  CG  . ASP A 1  395 ? 35.301 13.709  6.918   1.00 18.32 ? 395  ASP A CG  1 
ATOM   3086 O  OD1 . ASP A 1  395 ? 35.649 13.637  5.712   1.00 17.25 ? 395  ASP A OD1 1 
ATOM   3087 O  OD2 . ASP A 1  395 ? 34.636 14.680  7.356   1.00 17.02 ? 395  ASP A OD2 1 
ATOM   3088 N  N   . TYR A 1  396 ? 36.928 11.153  10.370  1.00 17.35 ? 396  TYR A N   1 
ATOM   3089 C  CA  . TYR A 1  396 ? 37.209 9.906   11.085  1.00 17.98 ? 396  TYR A CA  1 
ATOM   3090 C  C   . TYR A 1  396 ? 36.836 10.038  12.564  1.00 17.76 ? 396  TYR A C   1 
ATOM   3091 O  O   . TYR A 1  396 ? 36.231 9.143   13.156  1.00 17.29 ? 396  TYR A O   1 
ATOM   3092 C  CB  . TYR A 1  396 ? 38.710 9.578   10.956  1.00 18.71 ? 396  TYR A CB  1 
ATOM   3093 C  CG  . TYR A 1  396 ? 39.209 8.429   11.800  1.00 20.80 ? 396  TYR A CG  1 
ATOM   3094 C  CD1 . TYR A 1  396 ? 38.678 7.149   11.649  1.00 23.05 ? 396  TYR A CD1 1 
ATOM   3095 C  CD2 . TYR A 1  396 ? 40.234 8.615   12.723  1.00 23.48 ? 396  TYR A CD2 1 
ATOM   3096 C  CE1 . TYR A 1  396 ? 39.145 6.091   12.398  1.00 23.18 ? 396  TYR A CE1 1 
ATOM   3097 C  CE2 . TYR A 1  396 ? 40.721 7.555   13.482  1.00 23.85 ? 396  TYR A CE2 1 
ATOM   3098 C  CZ  . TYR A 1  396 ? 40.168 6.300   13.296  1.00 23.89 ? 396  TYR A CZ  1 
ATOM   3099 O  OH  . TYR A 1  396 ? 40.615 5.251   14.022  1.00 24.35 ? 396  TYR A OH  1 
ATOM   3100 N  N   . ASN A 1  397 ? 37.242 11.157  13.164  1.00 17.59 ? 397  ASN A N   1 
ATOM   3101 C  CA  . ASN A 1  397 ? 37.083 11.344  14.599  1.00 17.54 ? 397  ASN A CA  1 
ATOM   3102 C  C   . ASN A 1  397 ? 35.725 11.826  15.092  1.00 17.21 ? 397  ASN A C   1 
ATOM   3103 O  O   . ASN A 1  397 ? 35.334 11.505  16.235  1.00 17.78 ? 397  ASN A O   1 
ATOM   3104 C  CB  . ASN A 1  397 ? 38.188 12.259  15.136  1.00 17.57 ? 397  ASN A CB  1 
ATOM   3105 C  CG  . ASN A 1  397 ? 39.502 11.547  15.231  1.00 18.51 ? 397  ASN A CG  1 
ATOM   3106 O  OD1 . ASN A 1  397 ? 39.680 10.676  16.083  1.00 17.61 ? 397  ASN A OD1 1 
ATOM   3107 N  ND2 . ASN A 1  397 ? 40.415 11.854  14.305  1.00 18.09 ? 397  ASN A ND2 1 
ATOM   3108 N  N   . PHE A 1  398 ? 35.012 12.595  14.272  1.00 16.40 ? 398  PHE A N   1 
ATOM   3109 C  CA  . PHE A 1  398 ? 33.788 13.248  14.746  1.00 16.50 ? 398  PHE A CA  1 
ATOM   3110 C  C   . PHE A 1  398 ? 32.552 13.051  13.840  1.00 16.61 ? 398  PHE A C   1 
ATOM   3111 O  O   . PHE A 1  398 ? 31.491 12.612  14.306  1.00 15.61 ? 398  PHE A O   1 
ATOM   3112 C  CB  . PHE A 1  398 ? 34.050 14.748  15.000  1.00 16.04 ? 398  PHE A CB  1 
ATOM   3113 C  CG  . PHE A 1  398 ? 35.091 15.008  16.067  1.00 18.39 ? 398  PHE A CG  1 
ATOM   3114 C  CD1 . PHE A 1  398 ? 36.412 15.275  15.713  1.00 19.12 ? 398  PHE A CD1 1 
ATOM   3115 C  CD2 . PHE A 1  398 ? 34.751 14.967  17.418  1.00 16.22 ? 398  PHE A CD2 1 
ATOM   3116 C  CE1 . PHE A 1  398 ? 37.404 15.486  16.689  1.00 20.04 ? 398  PHE A CE1 1 
ATOM   3117 C  CE2 . PHE A 1  398 ? 35.744 15.178  18.422  1.00 18.82 ? 398  PHE A CE2 1 
ATOM   3118 C  CZ  . PHE A 1  398 ? 37.068 15.450  18.043  1.00 20.11 ? 398  PHE A CZ  1 
ATOM   3119 N  N   . ILE A 1  399 ? 32.684 13.400  12.564  1.00 16.71 ? 399  ILE A N   1 
ATOM   3120 C  CA  . ILE A 1  399 ? 31.499 13.480  11.687  1.00 17.24 ? 399  ILE A CA  1 
ATOM   3121 C  C   . ILE A 1  399 ? 30.929 12.094  11.356  1.00 17.82 ? 399  ILE A C   1 
ATOM   3122 O  O   . ILE A 1  399 ? 29.752 11.842  11.618  1.00 18.20 ? 399  ILE A O   1 
ATOM   3123 C  CB  . ILE A 1  399 ? 31.769 14.308  10.426  1.00 17.04 ? 399  ILE A CB  1 
ATOM   3124 C  CG1 . ILE A 1  399 ? 32.169 15.745  10.820  1.00 17.49 ? 399  ILE A CG1 1 
ATOM   3125 C  CG2 . ILE A 1  399 ? 30.533 14.312  9.474   1.00 17.80 ? 399  ILE A CG2 1 
ATOM   3126 C  CD1 . ILE A 1  399 ? 32.509 16.628  9.619   1.00 18.57 ? 399  ILE A CD1 1 
ATOM   3127 N  N   . CYS A 1  400 ? 31.753 11.196  10.818  1.00 17.42 ? 400  CYS A N   1 
ATOM   3128 C  CA  . CYS A 1  400 ? 31.242 9.887   10.463  1.00 18.37 ? 400  CYS A CA  1 
ATOM   3129 C  C   . CYS A 1  400 ? 30.739 9.113   11.699  1.00 17.67 ? 400  CYS A C   1 
ATOM   3130 O  O   . CYS A 1  400 ? 29.709 8.470   11.615  1.00 17.65 ? 400  CYS A O   1 
ATOM   3131 C  CB  . CYS A 1  400 ? 32.248 9.088   9.629   1.00 18.38 ? 400  CYS A CB  1 
ATOM   3132 S  SG  . CYS A 1  400 ? 32.688 9.939   8.106   1.00 22.74 ? 400  CYS A SG  1 
ATOM   3133 N  N   . PRO A 1  401 ? 31.443 9.198   12.852  1.00 17.31 ? 401  PRO A N   1 
ATOM   3134 C  CA  . PRO A 1  401 ? 30.856 8.516   14.016  1.00 17.13 ? 401  PRO A CA  1 
ATOM   3135 C  C   . PRO A 1  401 ? 29.525 9.112   14.479  1.00 16.66 ? 401  PRO A C   1 
ATOM   3136 O  O   . PRO A 1  401 ? 28.628 8.358   14.854  1.00 16.84 ? 401  PRO A O   1 
ATOM   3137 C  CB  . PRO A 1  401 ? 31.929 8.678   15.093  1.00 16.93 ? 401  PRO A CB  1 
ATOM   3138 C  CG  . PRO A 1  401 ? 33.215 8.756   14.295  1.00 18.15 ? 401  PRO A CG  1 
ATOM   3139 C  CD  . PRO A 1  401 ? 32.843 9.594   13.111  1.00 17.08 ? 401  PRO A CD  1 
ATOM   3140 N  N   . ALA A 1  402 ? 29.381 10.441  14.427  1.00 16.77 ? 402  ALA A N   1 
ATOM   3141 C  CA  . ALA A 1  402 ? 28.120 11.076  14.841  1.00 16.50 ? 402  ALA A CA  1 
ATOM   3142 C  C   . ALA A 1  402 ? 26.990 10.627  13.900  1.00 17.14 ? 402  ALA A C   1 
ATOM   3143 O  O   . ALA A 1  402 ? 25.871 10.324  14.352  1.00 16.88 ? 402  ALA A O   1 
ATOM   3144 C  CB  . ALA A 1  402 ? 28.242 12.614  14.855  1.00 15.74 ? 402  ALA A CB  1 
ATOM   3145 N  N   . LEU A 1  403 ? 27.286 10.586  12.600  1.00 16.61 ? 403  LEU A N   1 
ATOM   3146 C  CA  . LEU A 1  403 ? 26.288 10.130  11.628  1.00 17.97 ? 403  LEU A CA  1 
ATOM   3147 C  C   . LEU A 1  403 ? 25.908 8.664   11.818  1.00 18.26 ? 403  LEU A C   1 
ATOM   3148 O  O   . LEU A 1  403 ? 24.715 8.348   11.771  1.00 18.04 ? 403  LEU A O   1 
ATOM   3149 C  CB  . LEU A 1  403 ? 26.744 10.365  10.195  1.00 17.10 ? 403  LEU A CB  1 
ATOM   3150 C  CG  . LEU A 1  403 ? 26.743 11.847  9.804   1.00 18.17 ? 403  LEU A CG  1 
ATOM   3151 C  CD1 . LEU A 1  403 ? 27.702 12.057  8.620   1.00 14.93 ? 403  LEU A CD1 1 
ATOM   3152 C  CD2 . LEU A 1  403 ? 25.331 12.313  9.469   1.00 17.12 ? 403  LEU A CD2 1 
ATOM   3153 N  N   . GLU A 1  404 ? 26.902 7.789   12.053  1.00 18.49 ? 404  GLU A N   1 
ATOM   3154 C  CA  A GLU A 1  404 ? 26.600 6.374   12.266  0.50 19.02 ? 404  GLU A CA  1 
ATOM   3155 C  CA  B GLU A 1  404 ? 26.659 6.353   12.313  0.50 18.96 ? 404  GLU A CA  1 
ATOM   3156 C  C   . GLU A 1  404 ? 25.798 6.202   13.558  1.00 18.80 ? 404  GLU A C   1 
ATOM   3157 O  O   . GLU A 1  404 ? 24.847 5.413   13.594  1.00 19.42 ? 404  GLU A O   1 
ATOM   3158 C  CB  A GLU A 1  404 ? 27.878 5.520   12.258  0.50 19.32 ? 404  GLU A CB  1 
ATOM   3159 C  CB  B GLU A 1  404 ? 27.986 5.566   12.482  0.50 19.20 ? 404  GLU A CB  1 
ATOM   3160 C  CG  A GLU A 1  404 ? 27.632 4.008   12.299  0.50 20.75 ? 404  GLU A CG  1 
ATOM   3161 C  CG  B GLU A 1  404 ? 27.813 4.105   12.994  0.50 20.29 ? 404  GLU A CG  1 
ATOM   3162 C  CD  A GLU A 1  404 ? 27.142 3.439   10.973  0.50 22.93 ? 404  GLU A CD  1 
ATOM   3163 C  CD  B GLU A 1  404 ? 29.120 3.319   13.127  0.50 21.88 ? 404  GLU A CD  1 
ATOM   3164 O  OE1 A GLU A 1  404 ? 26.728 4.210   10.076  0.50 20.86 ? 404  GLU A OE1 1 
ATOM   3165 O  OE1 B GLU A 1  404 ? 29.418 2.523   12.209  0.50 22.62 ? 404  GLU A OE1 1 
ATOM   3166 O  OE2 A GLU A 1  404 ? 27.189 2.203   10.833  0.50 25.76 ? 404  GLU A OE2 1 
ATOM   3167 O  OE2 B GLU A 1  404 ? 29.841 3.482   14.145  0.50 21.09 ? 404  GLU A OE2 1 
ATOM   3168 N  N   . PHE A 1  405 ? 26.153 6.952   14.603  1.00 18.39 ? 405  PHE A N   1 
ATOM   3169 C  CA  . PHE A 1  405 ? 25.402 6.894   15.860  1.00 17.57 ? 405  PHE A CA  1 
ATOM   3170 C  C   . PHE A 1  405 ? 23.923 7.241   15.606  1.00 17.49 ? 405  PHE A C   1 
ATOM   3171 O  O   . PHE A 1  405 ? 23.030 6.537   16.062  1.00 16.66 ? 405  PHE A O   1 
ATOM   3172 C  CB  . PHE A 1  405 ? 25.985 7.830   16.933  1.00 17.05 ? 405  PHE A CB  1 
ATOM   3173 C  CG  . PHE A 1  405 ? 25.175 7.833   18.205  1.00 18.61 ? 405  PHE A CG  1 
ATOM   3174 C  CD1 . PHE A 1  405 ? 25.393 6.871   19.189  1.00 18.49 ? 405  PHE A CD1 1 
ATOM   3175 C  CD2 . PHE A 1  405 ? 24.133 8.745   18.379  1.00 18.03 ? 405  PHE A CD2 1 
ATOM   3176 C  CE1 . PHE A 1  405 ? 24.601 6.866   20.358  1.00 20.50 ? 405  PHE A CE1 1 
ATOM   3177 C  CE2 . PHE A 1  405 ? 23.332 8.731   19.539  1.00 19.10 ? 405  PHE A CE2 1 
ATOM   3178 C  CZ  . PHE A 1  405 ? 23.574 7.807   20.519  1.00 16.81 ? 405  PHE A CZ  1 
ATOM   3179 N  N   . THR A 1  406 ? 23.692 8.329   14.866  1.00 17.46 ? 406  THR A N   1 
ATOM   3180 C  CA  . THR A 1  406 ? 22.344 8.839   14.610  1.00 17.87 ? 406  THR A CA  1 
ATOM   3181 C  C   . THR A 1  406 ? 21.536 7.839   13.769  1.00 18.14 ? 406  THR A C   1 
ATOM   3182 O  O   . THR A 1  406 ? 20.366 7.610   14.033  1.00 18.61 ? 406  THR A O   1 
ATOM   3183 C  CB  . THR A 1  406 ? 22.388 10.233  13.927  1.00 17.36 ? 406  THR A CB  1 
ATOM   3184 O  OG1 . THR A 1  406 ? 23.281 11.082  14.650  1.00 16.30 ? 406  THR A OG1 1 
ATOM   3185 C  CG2 . THR A 1  406 ? 21.006 10.902  13.945  1.00 17.85 ? 406  THR A CG2 1 
ATOM   3186 N  N   . LYS A 1  407 ? 22.171 7.242   12.777  1.00 19.14 ? 407  LYS A N   1 
ATOM   3187 C  CA  . LYS A 1  407 ? 21.522 6.240   11.928  1.00 20.64 ? 407  LYS A CA  1 
ATOM   3188 C  C   . LYS A 1  407 ? 21.074 5.035   12.764  1.00 20.44 ? 407  LYS A C   1 
ATOM   3189 O  O   . LYS A 1  407 ? 19.892 4.672   12.774  1.00 19.80 ? 407  LYS A O   1 
ATOM   3190 C  CB  . LYS A 1  407 ? 22.499 5.747   10.879  1.00 20.86 ? 407  LYS A CB  1 
ATOM   3191 C  CG  . LYS A 1  407 ? 22.792 6.719   9.787   1.00 25.74 ? 407  LYS A CG  1 
ATOM   3192 C  CD  . LYS A 1  407 ? 23.706 6.073   8.735   1.00 32.13 ? 407  LYS A CD  1 
ATOM   3193 C  CE  . LYS A 1  407 ? 24.298 7.152   7.825   1.00 35.03 ? 407  LYS A CE  1 
ATOM   3194 N  NZ  . LYS A 1  407 ? 25.092 6.540   6.711   1.00 36.46 ? 407  LYS A NZ  1 
ATOM   3195 N  N   . LYS A 1  408 ? 22.030 4.445   13.478  1.00 20.23 ? 408  LYS A N   1 
ATOM   3196 C  CA  . LYS A 1  408 ? 21.783 3.243   14.291  1.00 20.90 ? 408  LYS A CA  1 
ATOM   3197 C  C   . LYS A 1  408 ? 20.758 3.501   15.411  1.00 20.62 ? 408  LYS A C   1 
ATOM   3198 O  O   . LYS A 1  408 ? 19.920 2.637   15.702  1.00 20.34 ? 408  LYS A O   1 
ATOM   3199 C  CB  . LYS A 1  408 ? 23.092 2.696   14.885  1.00 20.81 ? 408  LYS A CB  1 
ATOM   3200 C  CG  . LYS A 1  408 ? 24.131 2.155   13.892  1.00 24.47 ? 408  LYS A CG  1 
ATOM   3201 C  CD  . LYS A 1  408 ? 23.719 0.835   13.262  1.00 30.32 ? 408  LYS A CD  1 
ATOM   3202 C  CE  . LYS A 1  408 ? 24.779 0.315   12.287  1.00 33.89 ? 408  LYS A CE  1 
ATOM   3203 N  NZ  . LYS A 1  408 ? 24.284 -0.939  11.614  1.00 36.43 ? 408  LYS A NZ  1 
ATOM   3204 N  N   . PHE A 1  409 ? 20.819 4.687   16.019  1.00 20.28 ? 409  PHE A N   1 
ATOM   3205 C  CA  . PHE A 1  409 ? 19.864 5.062   17.077  1.00 20.08 ? 409  PHE A CA  1 
ATOM   3206 C  C   . PHE A 1  409 ? 18.464 5.211   16.506  1.00 20.55 ? 409  PHE A C   1 
ATOM   3207 O  O   . PHE A 1  409 ? 17.510 4.677   17.069  1.00 21.32 ? 409  PHE A O   1 
ATOM   3208 C  CB  . PHE A 1  409 ? 20.279 6.372   17.807  1.00 19.77 ? 409  PHE A CB  1 
ATOM   3209 C  CG  . PHE A 1  409 ? 19.546 6.603   19.133  1.00 18.34 ? 409  PHE A CG  1 
ATOM   3210 C  CD1 . PHE A 1  409 ? 20.137 6.234   20.334  1.00 20.73 ? 409  PHE A CD1 1 
ATOM   3211 C  CD2 . PHE A 1  409 ? 18.298 7.218   19.163  1.00 18.86 ? 409  PHE A CD2 1 
ATOM   3212 C  CE1 . PHE A 1  409 ? 19.464 6.442   21.570  1.00 20.64 ? 409  PHE A CE1 1 
ATOM   3213 C  CE2 . PHE A 1  409 ? 17.624 7.435   20.377  1.00 18.97 ? 409  PHE A CE2 1 
ATOM   3214 C  CZ  . PHE A 1  409 ? 18.212 7.037   21.575  1.00 20.41 ? 409  PHE A CZ  1 
ATOM   3215 N  N   . SER A 1  410 ? 18.335 5.917   15.383  1.00 21.03 ? 410  SER A N   1 
ATOM   3216 C  CA  . SER A 1  410 ? 17.025 6.195   14.812  1.00 22.01 ? 410  SER A CA  1 
ATOM   3217 C  C   . SER A 1  410 ? 16.351 4.920   14.274  1.00 22.36 ? 410  SER A C   1 
ATOM   3218 O  O   . SER A 1  410 ? 15.131 4.869   14.133  1.00 21.09 ? 410  SER A O   1 
ATOM   3219 C  CB  . SER A 1  410 ? 17.135 7.243   13.689  1.00 22.35 ? 410  SER A CB  1 
ATOM   3220 O  OG  . SER A 1  410 ? 17.840 6.697   12.588  1.00 24.72 ? 410  SER A OG  1 
ATOM   3221 N  N   . GLU A 1  411 ? 17.156 3.896   13.988  1.00 23.41 ? 411  GLU A N   1 
ATOM   3222 C  CA  . GLU A 1  411 ? 16.623 2.647   13.436  1.00 25.07 ? 411  GLU A CA  1 
ATOM   3223 C  C   . GLU A 1  411 ? 15.711 1.928   14.398  1.00 24.91 ? 411  GLU A C   1 
ATOM   3224 O  O   . GLU A 1  411 ? 14.886 1.111   13.976  1.00 24.91 ? 411  GLU A O   1 
ATOM   3225 C  CB  . GLU A 1  411 ? 17.736 1.735   12.931  1.00 25.77 ? 411  GLU A CB  1 
ATOM   3226 C  CG  . GLU A 1  411 ? 18.025 2.024   11.459  1.00 30.70 ? 411  GLU A CG  1 
ATOM   3227 C  CD  . GLU A 1  411 ? 19.373 1.522   11.002  1.00 37.49 ? 411  GLU A CD  1 
ATOM   3228 O  OE1 . GLU A 1  411 ? 20.014 0.724   11.732  1.00 38.35 ? 411  GLU A OE1 1 
ATOM   3229 O  OE2 . GLU A 1  411 ? 19.794 1.934   9.897   1.00 40.47 ? 411  GLU A OE2 1 
ATOM   3230 N  N   . TRP A 1  412 ? 15.816 2.265   15.680  1.00 24.54 ? 412  TRP A N   1 
ATOM   3231 C  CA  . TRP A 1  412 ? 14.963 1.640   16.686  1.00 24.63 ? 412  TRP A CA  1 
ATOM   3232 C  C   . TRP A 1  412 ? 13.697 2.426   16.961  1.00 24.68 ? 412  TRP A C   1 
ATOM   3233 O  O   . TRP A 1  412 ? 13.025 2.203   17.944  1.00 25.42 ? 412  TRP A O   1 
ATOM   3234 C  CB  . TRP A 1  412 ? 15.771 1.276   17.946  1.00 25.08 ? 412  TRP A CB  1 
ATOM   3235 C  CG  . TRP A 1  412 ? 16.741 0.190   17.613  1.00 24.79 ? 412  TRP A CG  1 
ATOM   3236 C  CD1 . TRP A 1  412 ? 17.980 0.340   17.053  1.00 25.35 ? 412  TRP A CD1 1 
ATOM   3237 C  CD2 . TRP A 1  412 ? 16.518 -1.225  17.727  1.00 26.41 ? 412  TRP A CD2 1 
ATOM   3238 N  NE1 . TRP A 1  412 ? 18.559 -0.895  16.845  1.00 25.95 ? 412  TRP A NE1 1 
ATOM   3239 C  CE2 . TRP A 1  412 ? 17.680 -1.871  17.245  1.00 26.09 ? 412  TRP A CE2 1 
ATOM   3240 C  CE3 . TRP A 1  412 ? 15.453 -2.010  18.211  1.00 27.33 ? 412  TRP A CE3 1 
ATOM   3241 C  CZ2 . TRP A 1  412 ? 17.812 -3.269  17.232  1.00 27.85 ? 412  TRP A CZ2 1 
ATOM   3242 C  CZ3 . TRP A 1  412 ? 15.587 -3.410  18.196  1.00 28.07 ? 412  TRP A CZ3 1 
ATOM   3243 C  CH2 . TRP A 1  412 ? 16.755 -4.017  17.709  1.00 27.82 ? 412  TRP A CH2 1 
ATOM   3244 N  N   . GLY A 1  413 ? 13.361 3.349   16.069  1.00 25.07 ? 413  GLY A N   1 
ATOM   3245 C  CA  . GLY A 1  413 ? 12.060 3.974   16.105  1.00 25.32 ? 413  GLY A CA  1 
ATOM   3246 C  C   . GLY A 1  413 ? 11.981 5.375   16.671  1.00 25.55 ? 413  GLY A C   1 
ATOM   3247 O  O   . GLY A 1  413 ? 10.936 6.002   16.583  1.00 26.78 ? 413  GLY A O   1 
ATOM   3248 N  N   . ASN A 1  414 ? 13.052 5.892   17.252  1.00 24.58 ? 414  ASN A N   1 
ATOM   3249 C  CA  . ASN A 1  414 ? 12.948 7.224   17.857  1.00 24.32 ? 414  ASN A CA  1 
ATOM   3250 C  C   . ASN A 1  414 ? 13.253 8.354   16.894  1.00 23.14 ? 414  ASN A C   1 
ATOM   3251 O  O   . ASN A 1  414 ? 14.002 8.181   15.938  1.00 23.10 ? 414  ASN A O   1 
ATOM   3252 C  CB  . ASN A 1  414 ? 13.823 7.352   19.095  1.00 24.29 ? 414  ASN A CB  1 
ATOM   3253 C  CG  . ASN A 1  414 ? 13.282 6.558   20.276  1.00 25.40 ? 414  ASN A CG  1 
ATOM   3254 O  OD1 . ASN A 1  414 ? 13.868 5.543   20.626  1.00 21.12 ? 414  ASN A OD1 1 
ATOM   3255 N  ND2 . ASN A 1  414 ? 12.160 7.032   20.911  1.00 24.28 ? 414  ASN A ND2 1 
ATOM   3256 N  N   . ASN A 1  415 ? 12.648 9.502   17.164  1.00 22.53 ? 415  ASN A N   1 
ATOM   3257 C  CA  . ASN A 1  415 ? 12.926 10.734  16.437  1.00 21.48 ? 415  ASN A CA  1 
ATOM   3258 C  C   . ASN A 1  415 ? 14.348 11.225  16.737  1.00 20.70 ? 415  ASN A C   1 
ATOM   3259 O  O   . ASN A 1  415 ? 14.730 11.349  17.898  1.00 20.77 ? 415  ASN A O   1 
ATOM   3260 C  CB  . ASN A 1  415 ? 11.905 11.808  16.847  1.00 21.57 ? 415  ASN A CB  1 
ATOM   3261 C  CG  . ASN A 1  415 ? 10.585 11.662  16.111  1.00 22.02 ? 415  ASN A CG  1 
ATOM   3262 O  OD1 . ASN A 1  415 ? 10.439 10.773  15.293  1.00 22.61 ? 415  ASN A OD1 1 
ATOM   3263 N  ND2 . ASN A 1  415 ? 9.631  12.540  16.394  1.00 20.82 ? 415  ASN A ND2 1 
ATOM   3264 N  N   . ALA A 1  416 ? 15.127 11.475  15.685  1.00 19.57 ? 416  ALA A N   1 
ATOM   3265 C  CA  . ALA A 1  416 ? 16.472 12.018  15.810  1.00 18.09 ? 416  ALA A CA  1 
ATOM   3266 C  C   . ALA A 1  416 ? 16.502 13.227  14.905  1.00 17.62 ? 416  ALA A C   1 
ATOM   3267 O  O   . ALA A 1  416 ? 15.837 13.236  13.860  1.00 18.34 ? 416  ALA A O   1 
ATOM   3268 C  CB  . ALA A 1  416 ? 17.521 11.002  15.369  1.00 17.58 ? 416  ALA A CB  1 
ATOM   3269 N  N   . PHE A 1  417 ? 17.260 14.244  15.295  1.00 16.42 ? 417  PHE A N   1 
ATOM   3270 C  CA  . PHE A 1  417 ? 17.415 15.442  14.484  1.00 16.93 ? 417  PHE A CA  1 
ATOM   3271 C  C   . PHE A 1  417 ? 18.917 15.712  14.353  1.00 17.85 ? 417  PHE A C   1 
ATOM   3272 O  O   . PHE A 1  417 ? 19.634 15.724  15.369  1.00 18.42 ? 417  PHE A O   1 
ATOM   3273 C  CB  . PHE A 1  417 ? 16.713 16.632  15.190  1.00 17.10 ? 417  PHE A CB  1 
ATOM   3274 C  CG  . PHE A 1  417 ? 15.237 16.407  15.426  1.00 17.04 ? 417  PHE A CG  1 
ATOM   3275 C  CD1 . PHE A 1  417 ? 14.792 15.808  16.606  1.00 16.38 ? 417  PHE A CD1 1 
ATOM   3276 C  CD2 . PHE A 1  417 ? 14.297 16.747  14.436  1.00 18.08 ? 417  PHE A CD2 1 
ATOM   3277 C  CE1 . PHE A 1  417 ? 13.412 15.569  16.818  1.00 17.30 ? 417  PHE A CE1 1 
ATOM   3278 C  CE2 . PHE A 1  417 ? 12.910 16.514  14.635  1.00 17.33 ? 417  PHE A CE2 1 
ATOM   3279 C  CZ  . PHE A 1  417 ? 12.474 15.928  15.822  1.00 15.91 ? 417  PHE A CZ  1 
ATOM   3280 N  N   . PHE A 1  418 ? 19.397 15.940  13.137  1.00 16.60 ? 418  PHE A N   1 
ATOM   3281 C  CA  . PHE A 1  418 ? 20.844 16.125  12.926  1.00 17.04 ? 418  PHE A CA  1 
ATOM   3282 C  C   . PHE A 1  418 ? 21.117 17.522  12.366  1.00 17.23 ? 418  PHE A C   1 
ATOM   3283 O  O   . PHE A 1  418 ? 20.386 17.978  11.456  1.00 16.43 ? 418  PHE A O   1 
ATOM   3284 C  CB  . PHE A 1  418 ? 21.396 15.046  11.962  1.00 15.63 ? 418  PHE A CB  1 
ATOM   3285 C  CG  . PHE A 1  418 ? 22.888 14.891  12.024  1.00 16.82 ? 418  PHE A CG  1 
ATOM   3286 C  CD1 . PHE A 1  418 ? 23.729 15.764  11.325  1.00 16.27 ? 418  PHE A CD1 1 
ATOM   3287 C  CD2 . PHE A 1  418 ? 23.463 13.899  12.842  1.00 17.26 ? 418  PHE A CD2 1 
ATOM   3288 C  CE1 . PHE A 1  418 ? 25.114 15.629  11.405  1.00 16.18 ? 418  PHE A CE1 1 
ATOM   3289 C  CE2 . PHE A 1  418 ? 24.835 13.761  12.928  1.00 17.60 ? 418  PHE A CE2 1 
ATOM   3290 C  CZ  . PHE A 1  418 ? 25.667 14.617  12.204  1.00 17.90 ? 418  PHE A CZ  1 
ATOM   3291 N  N   . TYR A 1  419 ? 22.136 18.207  12.912  1.00 16.64 ? 419  TYR A N   1 
ATOM   3292 C  CA  . TYR A 1  419 ? 22.559 19.509  12.353  1.00 16.55 ? 419  TYR A CA  1 
ATOM   3293 C  C   . TYR A 1  419 ? 23.989 19.496  11.823  1.00 16.87 ? 419  TYR A C   1 
ATOM   3294 O  O   . TYR A 1  419 ? 24.827 18.713  12.264  1.00 16.59 ? 419  TYR A O   1 
ATOM   3295 C  CB  . TYR A 1  419 ? 22.416 20.682  13.349  1.00 16.31 ? 419  TYR A CB  1 
ATOM   3296 C  CG  . TYR A 1  419 ? 23.398 20.614  14.499  1.00 16.37 ? 419  TYR A CG  1 
ATOM   3297 C  CD1 . TYR A 1  419 ? 23.033 20.040  15.724  1.00 16.88 ? 419  TYR A CD1 1 
ATOM   3298 C  CD2 . TYR A 1  419 ? 24.694 21.109  14.362  1.00 16.69 ? 419  TYR A CD2 1 
ATOM   3299 C  CE1 . TYR A 1  419 ? 23.953 19.941  16.795  1.00 17.19 ? 419  TYR A CE1 1 
ATOM   3300 C  CE2 . TYR A 1  419 ? 25.615 21.042  15.424  1.00 16.03 ? 419  TYR A CE2 1 
ATOM   3301 C  CZ  . TYR A 1  419 ? 25.238 20.455  16.627  1.00 18.24 ? 419  TYR A CZ  1 
ATOM   3302 O  OH  . TYR A 1  419 ? 26.161 20.354  17.630  1.00 16.18 ? 419  TYR A OH  1 
ATOM   3303 N  N   . TYR A 1  420 ? 24.258 20.437  10.927  1.00 16.65 ? 420  TYR A N   1 
ATOM   3304 C  CA  . TYR A 1  420 ? 25.599 20.711  10.431  1.00 17.50 ? 420  TYR A CA  1 
ATOM   3305 C  C   . TYR A 1  420 ? 25.833 22.204  10.636  1.00 17.43 ? 420  TYR A C   1 
ATOM   3306 O  O   . TYR A 1  420 ? 25.215 23.043  9.976   1.00 17.29 ? 420  TYR A O   1 
ATOM   3307 C  CB  . TYR A 1  420 ? 25.656 20.386  8.951   1.00 16.87 ? 420  TYR A CB  1 
ATOM   3308 C  CG  . TYR A 1  420 ? 27.028 20.418  8.321   1.00 17.87 ? 420  TYR A CG  1 
ATOM   3309 C  CD1 . TYR A 1  420 ? 28.051 19.590  8.776   1.00 15.69 ? 420  TYR A CD1 1 
ATOM   3310 C  CD2 . TYR A 1  420 ? 27.282 21.234  7.222   1.00 18.91 ? 420  TYR A CD2 1 
ATOM   3311 C  CE1 . TYR A 1  420 ? 29.314 19.576  8.154   1.00 17.72 ? 420  TYR A CE1 1 
ATOM   3312 C  CE2 . TYR A 1  420 ? 28.544 21.233  6.589   1.00 21.17 ? 420  TYR A CE2 1 
ATOM   3313 C  CZ  . TYR A 1  420 ? 29.545 20.389  7.062   1.00 19.63 ? 420  TYR A CZ  1 
ATOM   3314 O  OH  . TYR A 1  420 ? 30.775 20.373  6.451   1.00 21.85 ? 420  TYR A OH  1 
ATOM   3315 N  N   . PHE A 1  421 ? 26.693 22.516  11.594  1.00 18.53 ? 421  PHE A N   1 
ATOM   3316 C  CA  . PHE A 1  421 ? 26.963 23.892  11.993  1.00 18.87 ? 421  PHE A CA  1 
ATOM   3317 C  C   . PHE A 1  421 ? 28.080 24.450  11.093  1.00 19.33 ? 421  PHE A C   1 
ATOM   3318 O  O   . PHE A 1  421 ? 29.196 23.926  11.064  1.00 18.54 ? 421  PHE A O   1 
ATOM   3319 C  CB  . PHE A 1  421 ? 27.355 23.913  13.474  1.00 19.11 ? 421  PHE A CB  1 
ATOM   3320 C  CG  . PHE A 1  421 ? 27.630 25.292  14.023  1.00 20.55 ? 421  PHE A CG  1 
ATOM   3321 C  CD1 . PHE A 1  421 ? 26.583 26.112  14.440  1.00 22.37 ? 421  PHE A CD1 1 
ATOM   3322 C  CD2 . PHE A 1  421 ? 28.945 25.763  14.132  1.00 20.82 ? 421  PHE A CD2 1 
ATOM   3323 C  CE1 . PHE A 1  421 ? 26.846 27.405  14.931  1.00 23.76 ? 421  PHE A CE1 1 
ATOM   3324 C  CE2 . PHE A 1  421 ? 29.218 27.044  14.647  1.00 20.25 ? 421  PHE A CE2 1 
ATOM   3325 C  CZ  . PHE A 1  421 ? 28.173 27.858  15.046  1.00 21.46 ? 421  PHE A CZ  1 
ATOM   3326 N  N   . GLU A 1  422 ? 27.777 25.501  10.337  1.00 19.94 ? 422  GLU A N   1 
ATOM   3327 C  CA  . GLU A 1  422 ? 28.755 25.967  9.371   1.00 21.41 ? 422  GLU A CA  1 
ATOM   3328 C  C   . GLU A 1  422 ? 29.078 27.467  9.505   1.00 21.76 ? 422  GLU A C   1 
ATOM   3329 O  O   . GLU A 1  422 ? 29.582 28.086  8.568   1.00 22.00 ? 422  GLU A O   1 
ATOM   3330 C  CB  . GLU A 1  422 ? 28.374 25.521  7.940   1.00 22.48 ? 422  GLU A CB  1 
ATOM   3331 C  CG  . GLU A 1  422 ? 27.030 26.005  7.509   1.00 25.84 ? 422  GLU A CG  1 
ATOM   3332 C  CD  . GLU A 1  422 ? 26.489 25.360  6.237   1.00 26.96 ? 422  GLU A CD  1 
ATOM   3333 O  OE1 . GLU A 1  422 ? 27.013 24.331  5.743   1.00 28.57 ? 422  GLU A OE1 1 
ATOM   3334 O  OE2 . GLU A 1  422 ? 25.492 25.919  5.737   1.00 27.32 ? 422  GLU A OE2 1 
ATOM   3335 N  N   . HIS A 1  423 ? 28.849 28.019  10.698  1.00 20.87 ? 423  HIS A N   1 
ATOM   3336 C  CA  . HIS A 1  423 ? 29.150 29.427  10.950  1.00 20.99 ? 423  HIS A CA  1 
ATOM   3337 C  C   . HIS A 1  423 ? 30.448 29.613  11.714  1.00 20.81 ? 423  HIS A C   1 
ATOM   3338 O  O   . HIS A 1  423 ? 30.627 29.055  12.792  1.00 20.20 ? 423  HIS A O   1 
ATOM   3339 C  CB  . HIS A 1  423 ? 28.055 30.131  11.761  1.00 20.79 ? 423  HIS A CB  1 
ATOM   3340 C  CG  . HIS A 1  423 ? 28.383 31.568  12.030  1.00 20.84 ? 423  HIS A CG  1 
ATOM   3341 N  ND1 . HIS A 1  423 ? 28.441 32.510  11.025  1.00 22.15 ? 423  HIS A ND1 1 
ATOM   3342 C  CD2 . HIS A 1  423 ? 28.750 32.207  13.169  1.00 21.12 ? 423  HIS A CD2 1 
ATOM   3343 C  CE1 . HIS A 1  423 ? 28.798 33.677  11.539  1.00 22.65 ? 423  HIS A CE1 1 
ATOM   3344 N  NE2 . HIS A 1  423 ? 28.982 33.522  12.837  1.00 20.25 ? 423  HIS A NE2 1 
ATOM   3345 N  N   . ARG A 1  424 ? 31.330 30.434  11.170  1.00 21.14 ? 424  ARG A N   1 
ATOM   3346 C  CA  . ARG A 1  424 ? 32.573 30.776  11.851  1.00 21.80 ? 424  ARG A CA  1 
ATOM   3347 C  C   . ARG A 1  424 ? 32.409 32.101  12.623  1.00 22.00 ? 424  ARG A C   1 
ATOM   3348 O  O   . ARG A 1  424 ? 32.062 33.137  12.038  1.00 21.45 ? 424  ARG A O   1 
ATOM   3349 C  CB  . ARG A 1  424 ? 33.724 30.883  10.833  1.00 22.17 ? 424  ARG A CB  1 
ATOM   3350 C  CG  . ARG A 1  424 ? 34.979 31.498  11.424  1.00 23.95 ? 424  ARG A CG  1 
ATOM   3351 C  CD  . ARG A 1  424 ? 36.050 31.599  10.375  1.00 26.63 ? 424  ARG A CD  1 
ATOM   3352 N  NE  . ARG A 1  424 ? 37.190 32.385  10.857  1.00 29.04 ? 424  ARG A NE  1 
ATOM   3353 C  CZ  . ARG A 1  424 ? 38.349 31.875  11.262  1.00 30.67 ? 424  ARG A CZ  1 
ATOM   3354 N  NH1 . ARG A 1  424 ? 38.553 30.547  11.271  1.00 28.85 ? 424  ARG A NH1 1 
ATOM   3355 N  NH2 . ARG A 1  424 ? 39.314 32.701  11.657  1.00 28.31 ? 424  ARG A NH2 1 
ATOM   3356 N  N   . SER A 1  425 ? 32.663 32.053  13.928  1.00 21.65 ? 425  SER A N   1 
ATOM   3357 C  CA  . SER A 1  425 ? 32.570 33.229  14.783  1.00 22.69 ? 425  SER A CA  1 
ATOM   3358 C  C   . SER A 1  425 ? 33.380 34.408  14.215  1.00 22.74 ? 425  SER A C   1 
ATOM   3359 O  O   . SER A 1  425 ? 34.544 34.249  13.831  1.00 22.65 ? 425  SER A O   1 
ATOM   3360 C  CB  . SER A 1  425 ? 33.069 32.894  16.188  1.00 22.47 ? 425  SER A CB  1 
ATOM   3361 O  OG  . SER A 1  425 ? 32.984 34.032  17.030  1.00 24.74 ? 425  SER A OG  1 
ATOM   3362 N  N   . SER A 1  426 ? 32.754 35.579  14.174  1.00 22.71 ? 426  SER A N   1 
ATOM   3363 C  CA  . SER A 1  426 ? 33.401 36.807  13.725  1.00 23.96 ? 426  SER A CA  1 
ATOM   3364 C  C   . SER A 1  426 ? 34.578 37.142  14.649  1.00 24.53 ? 426  SER A C   1 
ATOM   3365 O  O   . SER A 1  426 ? 35.489 37.855  14.259  1.00 25.14 ? 426  SER A O   1 
ATOM   3366 C  CB  . SER A 1  426 ? 32.394 37.975  13.713  1.00 23.63 ? 426  SER A CB  1 
ATOM   3367 O  OG  . SER A 1  426 ? 31.860 38.192  15.012  1.00 23.23 ? 426  SER A OG  1 
ATOM   3368 N  N   . LYS A 1  427 ? 34.558 36.584  15.854  1.00 25.56 ? 427  LYS A N   1 
ATOM   3369 C  CA  . LYS A 1  427 ? 35.568 36.845  16.872  1.00 26.96 ? 427  LYS A CA  1 
ATOM   3370 C  C   . LYS A 1  427 ? 36.650 35.763  16.964  1.00 27.21 ? 427  LYS A C   1 
ATOM   3371 O  O   . LYS A 1  427 ? 37.593 35.915  17.740  1.00 28.24 ? 427  LYS A O   1 
ATOM   3372 C  CB  . LYS A 1  427 ? 34.892 36.991  18.240  1.00 26.96 ? 427  LYS A CB  1 
ATOM   3373 C  CG  . LYS A 1  427 ? 33.918 38.171  18.323  1.00 29.08 ? 427  LYS A CG  1 
ATOM   3374 C  CD  . LYS A 1  427 ? 33.242 38.274  19.697  1.00 31.78 ? 427  LYS A CD  1 
ATOM   3375 C  CE  . LYS A 1  427 ? 34.266 38.518  20.822  1.00 34.48 ? 427  LYS A CE  1 
ATOM   3376 N  NZ  . LYS A 1  427 ? 33.681 38.298  22.178  1.00 35.85 ? 427  LYS A NZ  1 
ATOM   3377 N  N   . LEU A 1  428 ? 36.523 34.681  16.191  1.00 26.81 ? 428  LEU A N   1 
ATOM   3378 C  CA  . LEU A 1  428 ? 37.455 33.540  16.274  1.00 26.28 ? 428  LEU A CA  1 
ATOM   3379 C  C   . LEU A 1  428 ? 38.911 34.017  16.259  1.00 25.38 ? 428  LEU A C   1 
ATOM   3380 O  O   . LEU A 1  428 ? 39.310 34.754  15.364  1.00 24.99 ? 428  LEU A O   1 
ATOM   3381 C  CB  . LEU A 1  428 ? 37.210 32.578  15.105  1.00 26.22 ? 428  LEU A CB  1 
ATOM   3382 C  CG  . LEU A 1  428 ? 37.194 31.042  15.255  1.00 29.00 ? 428  LEU A CG  1 
ATOM   3383 C  CD1 . LEU A 1  428 ? 38.285 30.352  14.467  1.00 28.95 ? 428  LEU A CD1 1 
ATOM   3384 C  CD2 . LEU A 1  428 ? 37.151 30.524  16.669  1.00 27.22 ? 428  LEU A CD2 1 
ATOM   3385 N  N   . PRO A 1  429 ? 39.711 33.620  17.266  1.00 25.11 ? 429  PRO A N   1 
ATOM   3386 C  CA  . PRO A 1  429 ? 41.102 34.105  17.258  1.00 24.64 ? 429  PRO A CA  1 
ATOM   3387 C  C   . PRO A 1  429 ? 42.039 33.211  16.435  1.00 23.79 ? 429  PRO A C   1 
ATOM   3388 O  O   . PRO A 1  429 ? 43.180 33.582  16.176  1.00 23.14 ? 429  PRO A O   1 
ATOM   3389 C  CB  . PRO A 1  429 ? 41.478 34.093  18.744  1.00 24.34 ? 429  PRO A CB  1 
ATOM   3390 C  CG  . PRO A 1  429 ? 40.668 33.024  19.310  1.00 25.23 ? 429  PRO A CG  1 
ATOM   3391 C  CD  . PRO A 1  429 ? 39.366 32.974  18.544  1.00 25.22 ? 429  PRO A CD  1 
ATOM   3392 N  N   . TRP A 1  430 ? 41.549 32.041  16.032  1.00 23.42 ? 430  TRP A N   1 
ATOM   3393 C  CA  . TRP A 1  430 ? 42.308 31.138  15.176  1.00 22.98 ? 430  TRP A CA  1 
ATOM   3394 C  C   . TRP A 1  430 ? 42.274 31.636  13.727  1.00 22.68 ? 430  TRP A C   1 
ATOM   3395 O  O   . TRP A 1  430 ? 41.361 32.374  13.357  1.00 22.66 ? 430  TRP A O   1 
ATOM   3396 C  CB  . TRP A 1  430 ? 41.720 29.729  15.263  1.00 22.12 ? 430  TRP A CB  1 
ATOM   3397 C  CG  . TRP A 1  430 ? 41.770 29.117  16.638  1.00 22.71 ? 430  TRP A CG  1 
ATOM   3398 C  CD1 . TRP A 1  430 ? 40.763 29.102  17.581  1.00 20.60 ? 430  TRP A CD1 1 
ATOM   3399 C  CD2 . TRP A 1  430 ? 42.873 28.414  17.221  1.00 21.11 ? 430  TRP A CD2 1 
ATOM   3400 N  NE1 . TRP A 1  430 ? 41.183 28.429  18.706  1.00 20.91 ? 430  TRP A NE1 1 
ATOM   3401 C  CE2 . TRP A 1  430 ? 42.472 27.997  18.512  1.00 20.09 ? 430  TRP A CE2 1 
ATOM   3402 C  CE3 . TRP A 1  430 ? 44.161 28.083  16.772  1.00 21.34 ? 430  TRP A CE3 1 
ATOM   3403 C  CZ2 . TRP A 1  430 ? 43.306 27.255  19.352  1.00 19.29 ? 430  TRP A CZ2 1 
ATOM   3404 C  CZ3 . TRP A 1  430 ? 44.996 27.342  17.622  1.00 19.57 ? 430  TRP A CZ3 1 
ATOM   3405 C  CH2 . TRP A 1  430 ? 44.564 26.944  18.887  1.00 18.02 ? 430  TRP A CH2 1 
ATOM   3406 N  N   . PRO A 1  431 ? 43.270 31.252  12.902  1.00 22.64 ? 431  PRO A N   1 
ATOM   3407 C  CA  . PRO A 1  431 ? 43.313 31.774  11.529  1.00 22.89 ? 431  PRO A CA  1 
ATOM   3408 C  C   . PRO A 1  431 ? 42.183 31.262  10.629  1.00 23.11 ? 431  PRO A C   1 
ATOM   3409 O  O   . PRO A 1  431 ? 41.537 30.250  10.930  1.00 23.03 ? 431  PRO A O   1 
ATOM   3410 C  CB  . PRO A 1  431 ? 44.660 31.278  11.006  1.00 22.99 ? 431  PRO A CB  1 
ATOM   3411 C  CG  . PRO A 1  431 ? 44.905 30.025  11.771  1.00 23.28 ? 431  PRO A CG  1 
ATOM   3412 C  CD  . PRO A 1  431 ? 44.391 30.332  13.164  1.00 22.50 ? 431  PRO A CD  1 
ATOM   3413 N  N   . GLU A 1  432 ? 41.966 31.968  9.530   1.00 22.80 ? 432  GLU A N   1 
ATOM   3414 C  CA  . GLU A 1  432 ? 40.863 31.702  8.617   1.00 23.80 ? 432  GLU A CA  1 
ATOM   3415 C  C   . GLU A 1  432 ? 40.892 30.300  8.026   1.00 23.62 ? 432  GLU A C   1 
ATOM   3416 O  O   . GLU A 1  432 ? 39.837 29.707  7.798   1.00 24.40 ? 432  GLU A O   1 
ATOM   3417 C  CB  . GLU A 1  432 ? 40.858 32.738  7.490   1.00 24.01 ? 432  GLU A CB  1 
ATOM   3418 C  CG  . GLU A 1  432 ? 40.349 34.095  7.912   0.50 25.37 ? 432  GLU A CG  1 
ATOM   3419 C  CD  . GLU A 1  432 ? 38.903 34.321  7.526   0.50 28.12 ? 432  GLU A CD  1 
ATOM   3420 O  OE1 . GLU A 1  432 ? 38.055 33.436  7.775   0.50 27.88 ? 432  GLU A OE1 1 
ATOM   3421 O  OE2 . GLU A 1  432 ? 38.610 35.405  6.974   0.50 30.56 ? 432  GLU A OE2 1 
ATOM   3422 N  N   . TRP A 1  433 ? 42.084 29.761  7.788   1.00 23.43 ? 433  TRP A N   1 
ATOM   3423 C  CA  . TRP A 1  433 ? 42.182 28.438  7.164   1.00 23.23 ? 433  TRP A CA  1 
ATOM   3424 C  C   . TRP A 1  433 ? 41.563 27.347  8.040   1.00 23.34 ? 433  TRP A C   1 
ATOM   3425 O  O   . TRP A 1  433 ? 41.208 26.277  7.537   1.00 22.62 ? 433  TRP A O   1 
ATOM   3426 C  CB  . TRP A 1  433 ? 43.628 28.084  6.781   1.00 23.58 ? 433  TRP A CB  1 
ATOM   3427 C  CG  . TRP A 1  433 ? 44.578 27.761  7.930   1.00 23.82 ? 433  TRP A CG  1 
ATOM   3428 C  CD1 . TRP A 1  433 ? 45.522 28.592  8.470   1.00 24.23 ? 433  TRP A CD1 1 
ATOM   3429 C  CD2 . TRP A 1  433 ? 44.699 26.508  8.632   1.00 23.63 ? 433  TRP A CD2 1 
ATOM   3430 N  NE1 . TRP A 1  433 ? 46.219 27.938  9.471   1.00 24.17 ? 433  TRP A NE1 1 
ATOM   3431 C  CE2 . TRP A 1  433 ? 45.723 26.665  9.599   1.00 23.27 ? 433  TRP A CE2 1 
ATOM   3432 C  CE3 . TRP A 1  433 ? 44.031 25.274  8.545   1.00 24.25 ? 433  TRP A CE3 1 
ATOM   3433 C  CZ2 . TRP A 1  433 ? 46.107 25.633  10.459  1.00 23.27 ? 433  TRP A CZ2 1 
ATOM   3434 C  CZ3 . TRP A 1  433 ? 44.409 24.243  9.413   1.00 23.31 ? 433  TRP A CZ3 1 
ATOM   3435 C  CH2 . TRP A 1  433 ? 45.432 24.432  10.362  1.00 23.01 ? 433  TRP A CH2 1 
ATOM   3436 N  N   . MET A 1  434 ? 41.428 27.612  9.341   1.00 22.29 ? 434  MET A N   1 
ATOM   3437 C  CA  . MET A 1  434 ? 40.851 26.606  10.240  1.00 22.42 ? 434  MET A CA  1 
ATOM   3438 C  C   . MET A 1  434 ? 39.335 26.522  10.177  1.00 21.67 ? 434  MET A C   1 
ATOM   3439 O  O   . MET A 1  434 ? 38.744 25.552  10.668  1.00 22.00 ? 434  MET A O   1 
ATOM   3440 C  CB  . MET A 1  434 ? 41.351 26.786  11.680  1.00 22.94 ? 434  MET A CB  1 
ATOM   3441 C  CG  . MET A 1  434 ? 42.866 26.584  11.769  1.00 24.62 ? 434  MET A CG  1 
ATOM   3442 S  SD  . MET A 1  434 ? 43.576 26.868  13.394  1.00 29.11 ? 434  MET A SD  1 
ATOM   3443 C  CE  . MET A 1  434 ? 43.263 25.404  14.319  1.00 27.03 ? 434  MET A CE  1 
ATOM   3444 N  N   . GLY A 1  435 ? 38.710 27.537  9.589   1.00 21.01 ? 435  GLY A N   1 
ATOM   3445 C  CA  . GLY A 1  435 ? 37.273 27.527  9.299   1.00 20.24 ? 435  GLY A CA  1 
ATOM   3446 C  C   . GLY A 1  435 ? 36.353 27.455  10.508  1.00 20.29 ? 435  GLY A C   1 
ATOM   3447 O  O   . GLY A 1  435 ? 36.560 28.158  11.519  1.00 19.67 ? 435  GLY A O   1 
ATOM   3448 N  N   . VAL A 1  436 ? 35.351 26.576  10.404  1.00 19.91 ? 436  VAL A N   1 
ATOM   3449 C  CA  . VAL A 1  436 ? 34.309 26.421  11.416  1.00 19.78 ? 436  VAL A CA  1 
ATOM   3450 C  C   . VAL A 1  436 ? 34.730 25.312  12.375  1.00 19.80 ? 436  VAL A C   1 
ATOM   3451 O  O   . VAL A 1  436 ? 34.433 24.109  12.186  1.00 19.73 ? 436  VAL A O   1 
ATOM   3452 C  CB  . VAL A 1  436 ? 32.924 26.104  10.772  1.00 20.24 ? 436  VAL A CB  1 
ATOM   3453 C  CG1 . VAL A 1  436 ? 31.839 26.073  11.851  1.00 17.54 ? 436  VAL A CG1 1 
ATOM   3454 C  CG2 . VAL A 1  436 ? 32.589 27.139  9.667   1.00 18.18 ? 436  VAL A CG2 1 
ATOM   3455 N  N   . MET A 1  437 ? 35.427 25.730  13.413  1.00 19.46 ? 437  MET A N   1 
ATOM   3456 C  CA  . MET A 1  437 ? 36.197 24.802  14.241  1.00 19.15 ? 437  MET A CA  1 
ATOM   3457 C  C   . MET A 1  437 ? 35.391 24.005  15.250  1.00 18.69 ? 437  MET A C   1 
ATOM   3458 O  O   . MET A 1  437 ? 34.339 24.432  15.724  1.00 18.61 ? 437  MET A O   1 
ATOM   3459 C  CB  . MET A 1  437 ? 37.282 25.575  14.997  1.00 19.16 ? 437  MET A CB  1 
ATOM   3460 C  CG  . MET A 1  437 ? 38.484 25.969  14.147  1.00 19.74 ? 437  MET A CG  1 
ATOM   3461 S  SD  . MET A 1  437 ? 39.640 27.074  15.032  1.00 19.97 ? 437  MET A SD  1 
ATOM   3462 C  CE  . MET A 1  437 ? 40.308 25.962  16.259  1.00 17.74 ? 437  MET A CE  1 
ATOM   3463 N  N   . HIS A 1  438 ? 35.923 22.831  15.573  1.00 18.42 ? 438  HIS A N   1 
ATOM   3464 C  CA  . HIS A 1  438 ? 35.546 22.066  16.763  1.00 18.16 ? 438  HIS A CA  1 
ATOM   3465 C  C   . HIS A 1  438 ? 35.471 22.980  17.985  1.00 18.30 ? 438  HIS A C   1 
ATOM   3466 O  O   . HIS A 1  438 ? 36.425 23.705  18.276  1.00 17.33 ? 438  HIS A O   1 
ATOM   3467 C  CB  . HIS A 1  438 ? 36.634 21.021  17.007  1.00 17.99 ? 438  HIS A CB  1 
ATOM   3468 C  CG  . HIS A 1  438 ? 36.349 20.090  18.146  1.00 18.34 ? 438  HIS A CG  1 
ATOM   3469 N  ND1 . HIS A 1  438 ? 35.373 19.124  18.087  1.00 18.16 ? 438  HIS A ND1 1 
ATOM   3470 C  CD2 . HIS A 1  438 ? 36.928 19.968  19.362  1.00 18.25 ? 438  HIS A CD2 1 
ATOM   3471 C  CE1 . HIS A 1  438 ? 35.368 18.435  19.216  1.00 19.87 ? 438  HIS A CE1 1 
ATOM   3472 N  NE2 . HIS A 1  438 ? 36.299 18.934  20.010  1.00 20.48 ? 438  HIS A NE2 1 
ATOM   3473 N  N   . GLY A 1  439 ? 34.334 22.953  18.676  1.00 17.79 ? 439  GLY A N   1 
ATOM   3474 C  CA  . GLY A 1  439 ? 34.205 23.667  19.951  1.00 19.16 ? 439  GLY A CA  1 
ATOM   3475 C  C   . GLY A 1  439 ? 33.533 25.013  19.802  1.00 19.04 ? 439  GLY A C   1 
ATOM   3476 O  O   . GLY A 1  439 ? 33.118 25.613  20.794  1.00 19.57 ? 439  GLY A O   1 
ATOM   3477 N  N   . TYR A 1  440 ? 33.442 25.511  18.570  1.00 19.31 ? 440  TYR A N   1 
ATOM   3478 C  CA  . TYR A 1  440 ? 33.024 26.892  18.382  1.00 18.70 ? 440  TYR A CA  1 
ATOM   3479 C  C   . TYR A 1  440 ? 31.541 27.077  18.029  1.00 19.09 ? 440  TYR A C   1 
ATOM   3480 O  O   . TYR A 1  440 ? 31.126 28.151  17.603  1.00 18.91 ? 440  TYR A O   1 
ATOM   3481 C  CB  . TYR A 1  440 ? 34.027 27.663  17.489  1.00 18.72 ? 440  TYR A CB  1 
ATOM   3482 C  CG  . TYR A 1  440 ? 35.323 27.872  18.255  1.00 19.11 ? 440  TYR A CG  1 
ATOM   3483 C  CD1 . TYR A 1  440 ? 36.359 26.931  18.189  1.00 18.13 ? 440  TYR A CD1 1 
ATOM   3484 C  CD2 . TYR A 1  440 ? 35.466 28.961  19.127  1.00 19.87 ? 440  TYR A CD2 1 
ATOM   3485 C  CE1 . TYR A 1  440 ? 37.534 27.091  18.952  1.00 19.34 ? 440  TYR A CE1 1 
ATOM   3486 C  CE2 . TYR A 1  440 ? 36.627 29.133  19.903  1.00 18.75 ? 440  TYR A CE2 1 
ATOM   3487 C  CZ  . TYR A 1  440 ? 37.652 28.203  19.805  1.00 19.22 ? 440  TYR A CZ  1 
ATOM   3488 O  OH  . TYR A 1  440 ? 38.799 28.375  20.543  1.00 18.34 ? 440  TYR A OH  1 
ATOM   3489 N  N   . GLU A 1  441 ? 30.734 26.039  18.256  1.00 18.95 ? 441  GLU A N   1 
ATOM   3490 C  CA  . GLU A 1  441 ? 29.268 26.219  18.234  1.00 18.78 ? 441  GLU A CA  1 
ATOM   3491 C  C   . GLU A 1  441 ? 28.788 26.481  19.662  1.00 18.66 ? 441  GLU A C   1 
ATOM   3492 O  O   . GLU A 1  441 ? 27.692 27.017  19.883  1.00 18.99 ? 441  GLU A O   1 
ATOM   3493 C  CB  . GLU A 1  441 ? 28.561 24.984  17.650  1.00 18.38 ? 441  GLU A CB  1 
ATOM   3494 C  CG  . GLU A 1  441 ? 28.233 23.860  18.662  1.00 17.94 ? 441  GLU A CG  1 
ATOM   3495 C  CD  . GLU A 1  441 ? 29.464 23.136  19.216  1.00 19.44 ? 441  GLU A CD  1 
ATOM   3496 O  OE1 . GLU A 1  441 ? 30.607 23.386  18.735  1.00 20.99 ? 441  GLU A OE1 1 
ATOM   3497 O  OE2 . GLU A 1  441 ? 29.284 22.299  20.139  1.00 20.11 ? 441  GLU A OE2 1 
ATOM   3498 N  N   . ILE A 1  442 ? 29.614 26.084  20.633  1.00 18.24 ? 442  ILE A N   1 
ATOM   3499 C  CA  . ILE A 1  442 ? 29.187 26.063  22.050  1.00 18.35 ? 442  ILE A CA  1 
ATOM   3500 C  C   . ILE A 1  442 ? 28.715 27.430  22.501  1.00 18.53 ? 442  ILE A C   1 
ATOM   3501 O  O   . ILE A 1  442 ? 27.622 27.560  23.070  1.00 18.31 ? 442  ILE A O   1 
ATOM   3502 C  CB  . ILE A 1  442 ? 30.310 25.540  22.997  1.00 18.49 ? 442  ILE A CB  1 
ATOM   3503 C  CG1 . ILE A 1  442 ? 30.681 24.093  22.637  1.00 17.35 ? 442  ILE A CG1 1 
ATOM   3504 C  CG2 . ILE A 1  442 ? 29.864 25.618  24.470  1.00 17.30 ? 442  ILE A CG2 1 
ATOM   3505 C  CD1 . ILE A 1  442 ? 31.906 23.578  23.459  1.00 15.26 ? 442  ILE A CD1 1 
ATOM   3506 N  N   . GLU A 1  443 ? 29.522 28.456  22.222  1.00 18.61 ? 443  GLU A N   1 
ATOM   3507 C  CA  . GLU A 1  443 ? 29.161 29.817  22.595  1.00 19.86 ? 443  GLU A CA  1 
ATOM   3508 C  C   . GLU A 1  443 ? 27.807 30.288  22.013  1.00 19.56 ? 443  GLU A C   1 
ATOM   3509 O  O   . GLU A 1  443 ? 27.073 31.048  22.657  1.00 19.53 ? 443  GLU A O   1 
ATOM   3510 C  CB  . GLU A 1  443 ? 30.285 30.803  22.252  1.00 19.87 ? 443  GLU A CB  1 
ATOM   3511 C  CG  . GLU A 1  443 ? 30.666 30.862  20.806  1.00 20.38 ? 443  GLU A CG  1 
ATOM   3512 C  CD  . GLU A 1  443 ? 32.042 31.461  20.621  1.00 23.61 ? 443  GLU A CD  1 
ATOM   3513 O  OE1 . GLU A 1  443 ? 33.032 30.716  20.810  1.00 21.20 ? 443  GLU A OE1 1 
ATOM   3514 O  OE2 . GLU A 1  443 ? 32.123 32.673  20.291  1.00 23.48 ? 443  GLU A OE2 1 
ATOM   3515 N  N   . PHE A 1  444 ? 27.472 29.795  20.822  1.00 19.40 ? 444  PHE A N   1 
ATOM   3516 C  CA  . PHE A 1  444 ? 26.169 30.055  20.207  1.00 19.50 ? 444  PHE A CA  1 
ATOM   3517 C  C   . PHE A 1  444 ? 25.017 29.347  20.929  1.00 19.14 ? 444  PHE A C   1 
ATOM   3518 O  O   . PHE A 1  444 ? 23.948 29.939  21.141  1.00 19.68 ? 444  PHE A O   1 
ATOM   3519 C  CB  . PHE A 1  444 ? 26.222 29.702  18.705  1.00 19.86 ? 444  PHE A CB  1 
ATOM   3520 C  CG  . PHE A 1  444 ? 27.011 30.714  17.900  1.00 22.13 ? 444  PHE A CG  1 
ATOM   3521 C  CD1 . PHE A 1  444 ? 28.412 30.665  17.857  1.00 21.91 ? 444  PHE A CD1 1 
ATOM   3522 C  CD2 . PHE A 1  444 ? 26.355 31.745  17.229  1.00 22.98 ? 444  PHE A CD2 1 
ATOM   3523 C  CE1 . PHE A 1  444 ? 29.135 31.629  17.146  1.00 20.79 ? 444  PHE A CE1 1 
ATOM   3524 C  CE2 . PHE A 1  444 ? 27.069 32.701  16.530  1.00 21.13 ? 444  PHE A CE2 1 
ATOM   3525 C  CZ  . PHE A 1  444 ? 28.452 32.654  16.503  1.00 20.34 ? 444  PHE A CZ  1 
ATOM   3526 N  N   . VAL A 1  445 ? 25.240 28.095  21.314  1.00 18.25 ? 445  VAL A N   1 
ATOM   3527 C  CA  . VAL A 1  445 ? 24.263 27.315  22.088  1.00 17.74 ? 445  VAL A CA  1 
ATOM   3528 C  C   . VAL A 1  445 ? 23.970 27.989  23.436  1.00 18.44 ? 445  VAL A C   1 
ATOM   3529 O  O   . VAL A 1  445 ? 22.817 28.049  23.865  1.00 17.61 ? 445  VAL A O   1 
ATOM   3530 C  CB  . VAL A 1  445 ? 24.755 25.848  22.304  1.00 18.21 ? 445  VAL A CB  1 
ATOM   3531 C  CG1 . VAL A 1  445 ? 23.890 25.099  23.361  1.00 17.24 ? 445  VAL A CG1 1 
ATOM   3532 C  CG2 . VAL A 1  445 ? 24.761 25.083  20.965  1.00 17.74 ? 445  VAL A CG2 1 
ATOM   3533 N  N   . PHE A 1  446 ? 25.016 28.508  24.092  1.00 17.77 ? 446  PHE A N   1 
ATOM   3534 C  CA  . PHE A 1  446 ? 24.846 29.103  25.421  1.00 18.65 ? 446  PHE A CA  1 
ATOM   3535 C  C   . PHE A 1  446 ? 24.389 30.559  25.374  1.00 18.68 ? 446  PHE A C   1 
ATOM   3536 O  O   . PHE A 1  446 ? 24.151 31.175  26.402  1.00 19.52 ? 446  PHE A O   1 
ATOM   3537 C  CB  . PHE A 1  446 ? 26.115 28.942  26.276  1.00 17.86 ? 446  PHE A CB  1 
ATOM   3538 C  CG  . PHE A 1  446 ? 26.210 27.605  26.978  1.00 16.97 ? 446  PHE A CG  1 
ATOM   3539 C  CD1 . PHE A 1  446 ? 26.755 26.497  26.322  1.00 17.73 ? 446  PHE A CD1 1 
ATOM   3540 C  CD2 . PHE A 1  446 ? 25.768 27.461  28.294  1.00 17.35 ? 446  PHE A CD2 1 
ATOM   3541 C  CE1 . PHE A 1  446 ? 26.837 25.254  26.969  1.00 18.23 ? 446  PHE A CE1 1 
ATOM   3542 C  CE2 . PHE A 1  446 ? 25.857 26.236  28.973  1.00 16.32 ? 446  PHE A CE2 1 
ATOM   3543 C  CZ  . PHE A 1  446 ? 26.400 25.128  28.316  1.00 17.45 ? 446  PHE A CZ  1 
ATOM   3544 N  N   . GLY A 1  447 ? 24.260 31.114  24.180  1.00 19.10 ? 447  GLY A N   1 
ATOM   3545 C  CA  . GLY A 1  447 ? 23.647 32.436  24.041  1.00 19.18 ? 447  GLY A CA  1 
ATOM   3546 C  C   . GLY A 1  447 ? 24.580 33.614  24.270  1.00 19.43 ? 447  GLY A C   1 
ATOM   3547 O  O   . GLY A 1  447 ? 24.115 34.712  24.522  1.00 19.15 ? 447  GLY A O   1 
ATOM   3548 N  N   . LEU A 1  448 ? 25.888 33.407  24.172  1.00 20.25 ? 448  LEU A N   1 
ATOM   3549 C  CA  . LEU A 1  448 ? 26.808 34.530  24.403  1.00 22.14 ? 448  LEU A CA  1 
ATOM   3550 C  C   . LEU A 1  448 ? 26.629 35.677  23.387  1.00 22.50 ? 448  LEU A C   1 
ATOM   3551 O  O   . LEU A 1  448 ? 26.756 36.850  23.764  1.00 22.37 ? 448  LEU A O   1 
ATOM   3552 C  CB  . LEU A 1  448 ? 28.283 34.095  24.485  1.00 21.45 ? 448  LEU A CB  1 
ATOM   3553 C  CG  . LEU A 1  448 ? 28.837 32.962  25.353  1.00 25.06 ? 448  LEU A CG  1 
ATOM   3554 C  CD1 . LEU A 1  448 ? 30.257 33.290  25.825  1.00 22.90 ? 448  LEU A CD1 1 
ATOM   3555 C  CD2 . LEU A 1  448 ? 27.975 32.446  26.507  1.00 25.69 ? 448  LEU A CD2 1 
ATOM   3556 N  N   . PRO A 1  449 ? 26.319 35.355  22.107  1.00 23.07 ? 449  PRO A N   1 
ATOM   3557 C  CA  . PRO A 1  449 ? 26.091 36.444  21.141  1.00 23.65 ? 449  PRO A CA  1 
ATOM   3558 C  C   . PRO A 1  449 ? 24.803 37.241  21.371  1.00 24.24 ? 449  PRO A C   1 
ATOM   3559 O  O   . PRO A 1  449 ? 24.566 38.225  20.673  1.00 24.27 ? 449  PRO A O   1 
ATOM   3560 C  CB  . PRO A 1  449 ? 26.025 35.714  19.790  1.00 23.84 ? 449  PRO A CB  1 
ATOM   3561 C  CG  . PRO A 1  449 ? 26.832 34.444  20.014  1.00 23.31 ? 449  PRO A CG  1 
ATOM   3562 C  CD  . PRO A 1  449 ? 26.423 34.049  21.420  1.00 23.42 ? 449  PRO A CD  1 
ATOM   3563 N  N   . LEU A 1  450 ? 23.975 36.806  22.315  1.00 25.18 ? 450  LEU A N   1 
ATOM   3564 C  CA  . LEU A 1  450 ? 22.793 37.577  22.717  1.00 26.68 ? 450  LEU A CA  1 
ATOM   3565 C  C   . LEU A 1  450 ? 23.184 38.811  23.515  1.00 28.55 ? 450  LEU A C   1 
ATOM   3566 O  O   . LEU A 1  450 ? 22.412 39.765  23.621  1.00 28.88 ? 450  LEU A O   1 
ATOM   3567 C  CB  . LEU A 1  450 ? 21.799 36.707  23.496  1.00 26.12 ? 450  LEU A CB  1 
ATOM   3568 C  CG  . LEU A 1  450 ? 21.336 35.440  22.748  1.00 25.02 ? 450  LEU A CG  1 
ATOM   3569 C  CD1 . LEU A 1  450 ? 20.351 34.611  23.596  1.00 24.81 ? 450  LEU A CD1 1 
ATOM   3570 C  CD2 . LEU A 1  450 ? 20.725 35.806  21.390  1.00 23.00 ? 450  LEU A CD2 1 
ATOM   3571 N  N   . GLU A 1  451 ? 24.394 38.795  24.070  1.00 30.64 ? 451  GLU A N   1 
ATOM   3572 C  CA  . GLU A 1  451 ? 24.930 39.963  24.749  1.00 32.90 ? 451  GLU A CA  1 
ATOM   3573 C  C   . GLU A 1  451 ? 25.433 40.983  23.718  1.00 33.92 ? 451  GLU A C   1 
ATOM   3574 O  O   . GLU A 1  451 ? 26.483 40.789  23.104  1.00 33.31 ? 451  GLU A O   1 
ATOM   3575 C  CB  . GLU A 1  451 ? 26.049 39.541  25.708  1.00 32.93 ? 451  GLU A CB  1 
ATOM   3576 C  CG  . GLU A 1  451 ? 26.726 40.708  26.405  1.00 35.40 ? 451  GLU A CG  1 
ATOM   3577 C  CD  . GLU A 1  451 ? 25.810 41.384  27.392  1.00 37.50 ? 451  GLU A CD  1 
ATOM   3578 O  OE1 . GLU A 1  451 ? 25.134 42.364  27.008  1.00 37.29 ? 451  GLU A OE1 1 
ATOM   3579 O  OE2 . GLU A 1  451 ? 25.744 40.906  28.547  1.00 39.98 ? 451  GLU A OE2 1 
ATOM   3580 N  N   . ARG A 1  452 ? 24.679 42.065  23.526  1.00 36.08 ? 452  ARG A N   1 
ATOM   3581 C  CA  . ARG A 1  452 ? 25.070 43.101  22.554  1.00 38.40 ? 452  ARG A CA  1 
ATOM   3582 C  C   . ARG A 1  452 ? 26.394 43.810  22.875  1.00 39.31 ? 452  ARG A C   1 
ATOM   3583 O  O   . ARG A 1  452 ? 27.105 44.245  21.962  1.00 39.91 ? 452  ARG A O   1 
ATOM   3584 C  CB  . ARG A 1  452 ? 23.938 44.101  22.295  1.00 38.61 ? 452  ARG A CB  1 
ATOM   3585 C  CG  . ARG A 1  452 ? 22.852 43.512  21.401  1.00 40.54 ? 452  ARG A CG  1 
ATOM   3586 C  CD  . ARG A 1  452 ? 21.749 44.507  21.041  1.00 44.54 ? 452  ARG A CD  1 
ATOM   3587 N  NE  . ARG A 1  452 ? 20.630 43.819  20.386  1.00 45.45 ? 452  ARG A NE  1 
ATOM   3588 C  CZ  . ARG A 1  452 ? 19.382 43.790  20.848  1.00 45.90 ? 452  ARG A CZ  1 
ATOM   3589 N  NH1 . ARG A 1  452 ? 19.065 44.441  21.963  1.00 46.12 ? 452  ARG A NH1 1 
ATOM   3590 N  NH2 . ARG A 1  452 ? 18.443 43.124  20.182  1.00 44.78 ? 452  ARG A NH2 1 
ATOM   3591 N  N   . ARG A 1  453 ? 26.736 43.893  24.157  1.00 39.98 ? 453  ARG A N   1 
ATOM   3592 C  CA  . ARG A 1  453 ? 27.989 44.521  24.587  1.00 41.07 ? 453  ARG A CA  1 
ATOM   3593 C  C   . ARG A 1  453 ? 29.248 43.803  24.069  1.00 40.87 ? 453  ARG A C   1 
ATOM   3594 O  O   . ARG A 1  453 ? 30.362 44.298  24.241  1.00 40.85 ? 453  ARG A O   1 
ATOM   3595 C  CB  . ARG A 1  453 ? 28.033 44.596  26.117  1.00 41.26 ? 453  ARG A CB  1 
ATOM   3596 C  CG  . ARG A 1  453 ? 26.757 45.154  26.759  1.00 44.13 ? 453  ARG A CG  1 
ATOM   3597 C  CD  . ARG A 1  453 ? 26.789 46.669  26.883  1.00 46.74 ? 453  ARG A CD  1 
ATOM   3598 N  NE  . ARG A 1  453 ? 27.742 47.102  27.906  1.00 50.25 ? 453  ARG A NE  1 
ATOM   3599 C  CZ  . ARG A 1  453 ? 27.854 48.350  28.358  1.00 51.04 ? 453  ARG A CZ  1 
ATOM   3600 N  NH1 . ARG A 1  453 ? 27.073 49.314  27.882  1.00 52.04 ? 453  ARG A NH1 1 
ATOM   3601 N  NH2 . ARG A 1  453 ? 28.749 48.635  29.294  1.00 51.42 ? 453  ARG A NH2 1 
ATOM   3602 N  N   . ASP A 1  454 ? 29.062 42.666  23.399  1.00 40.67 ? 454  ASP A N   1 
ATOM   3603 C  CA  . ASP A 1  454 ? 30.146 41.708  23.190  1.00 40.39 ? 454  ASP A CA  1 
ATOM   3604 C  C   . ASP A 1  454 ? 30.819 41.729  21.810  1.00 39.60 ? 454  ASP A C   1 
ATOM   3605 O  O   . ASP A 1  454 ? 31.770 40.981  21.572  1.00 40.18 ? 454  ASP A O   1 
ATOM   3606 C  CB  . ASP A 1  454 ? 29.627 40.299  23.488  1.00 41.10 ? 454  ASP A CB  1 
ATOM   3607 C  CG  . ASP A 1  454 ? 30.503 39.540  24.465  1.00 43.04 ? 454  ASP A CG  1 
ATOM   3608 O  OD1 . ASP A 1  454 ? 31.019 40.153  25.430  1.00 45.87 ? 454  ASP A OD1 1 
ATOM   3609 O  OD2 . ASP A 1  454 ? 30.649 38.312  24.284  1.00 46.12 ? 454  ASP A OD2 1 
ATOM   3610 N  N   . GLN A 1  455 ? 30.327 42.571  20.908  1.00 38.12 ? 455  GLN A N   1 
ATOM   3611 C  CA  . GLN A 1  455 ? 30.888 42.704  19.550  1.00 36.78 ? 455  GLN A CA  1 
ATOM   3612 C  C   . GLN A 1  455 ? 30.740 41.511  18.596  1.00 34.53 ? 455  GLN A C   1 
ATOM   3613 O  O   . GLN A 1  455 ? 31.478 41.422  17.622  1.00 34.58 ? 455  GLN A O   1 
ATOM   3614 C  CB  . GLN A 1  455 ? 32.358 43.146  19.569  1.00 37.69 ? 455  GLN A CB  1 
ATOM   3615 C  CG  . GLN A 1  455 ? 32.567 44.622  19.271  1.00 39.97 ? 455  GLN A CG  1 
ATOM   3616 C  CD  . GLN A 1  455 ? 32.849 45.426  20.522  1.00 43.21 ? 455  GLN A CD  1 
ATOM   3617 O  OE1 . GLN A 1  455 ? 33.125 44.860  21.590  1.00 44.80 ? 455  GLN A OE1 1 
ATOM   3618 N  NE2 . GLN A 1  455 ? 32.801 46.753  20.399  1.00 42.75 ? 455  GLN A NE2 1 
ATOM   3619 N  N   . TYR A 1  456 ? 29.809 40.602  18.868  1.00 31.56 ? 456  TYR A N   1 
ATOM   3620 C  CA  . TYR A 1  456 ? 29.350 39.682  17.836  1.00 28.63 ? 456  TYR A CA  1 
ATOM   3621 C  C   . TYR A 1  456 ? 28.527 40.503  16.836  1.00 27.49 ? 456  TYR A C   1 
ATOM   3622 O  O   . TYR A 1  456 ? 28.028 41.579  17.180  1.00 26.09 ? 456  TYR A O   1 
ATOM   3623 C  CB  . TYR A 1  456 ? 28.474 38.606  18.450  1.00 27.81 ? 456  TYR A CB  1 
ATOM   3624 C  CG  . TYR A 1  456 ? 29.204 37.572  19.280  1.00 26.80 ? 456  TYR A CG  1 
ATOM   3625 C  CD1 . TYR A 1  456 ? 29.260 37.674  20.674  1.00 24.22 ? 456  TYR A CD1 1 
ATOM   3626 C  CD2 . TYR A 1  456 ? 29.803 36.470  18.673  1.00 25.29 ? 456  TYR A CD2 1 
ATOM   3627 C  CE1 . TYR A 1  456 ? 29.909 36.692  21.447  1.00 24.27 ? 456  TYR A CE1 1 
ATOM   3628 C  CE2 . TYR A 1  456 ? 30.456 35.482  19.430  1.00 25.02 ? 456  TYR A CE2 1 
ATOM   3629 C  CZ  . TYR A 1  456 ? 30.502 35.598  20.811  1.00 24.61 ? 456  TYR A CZ  1 
ATOM   3630 O  OH  . TYR A 1  456 ? 31.135 34.628  21.545  1.00 24.95 ? 456  TYR A OH  1 
ATOM   3631 N  N   . THR A 1  457 ? 28.382 40.017  15.606  1.00 26.11 ? 457  THR A N   1 
ATOM   3632 C  CA  . THR A 1  457 ? 27.546 40.717  14.642  1.00 25.08 ? 457  THR A CA  1 
ATOM   3633 C  C   . THR A 1  457 ? 26.067 40.554  14.987  1.00 24.83 ? 457  THR A C   1 
ATOM   3634 O  O   . THR A 1  457 ? 25.690 39.711  15.821  1.00 24.34 ? 457  THR A O   1 
ATOM   3635 C  CB  . THR A 1  457 ? 27.781 40.231  13.205  1.00 25.67 ? 457  THR A CB  1 
ATOM   3636 O  OG1 . THR A 1  457 ? 27.336 38.872  13.081  1.00 23.82 ? 457  THR A OG1 1 
ATOM   3637 C  CG2 . THR A 1  457 ? 29.268 40.349  12.804  1.00 25.40 ? 457  THR A CG2 1 
ATOM   3638 N  N   . LYS A 1  458 ? 25.231 41.373  14.355  1.00 24.48 ? 458  LYS A N   1 
ATOM   3639 C  CA  . LYS A 1  458 ? 23.778 41.234  14.466  1.00 24.88 ? 458  LYS A CA  1 
ATOM   3640 C  C   . LYS A 1  458 ? 23.295 39.890  13.906  1.00 24.20 ? 458  LYS A C   1 
ATOM   3641 O  O   . LYS A 1  458 ? 22.389 39.271  14.469  1.00 24.35 ? 458  LYS A O   1 
ATOM   3642 C  CB  . LYS A 1  458 ? 23.059 42.385  13.738  1.00 24.98 ? 458  LYS A CB  1 
ATOM   3643 C  CG  . LYS A 1  458 ? 21.554 42.351  13.908  1.00 27.01 ? 458  LYS A CG  1 
ATOM   3644 C  CD  . LYS A 1  458 ? 21.138 43.006  15.211  1.00 31.11 ? 458  LYS A CD  1 
ATOM   3645 C  CE  . LYS A 1  458 ? 19.767 42.533  15.632  1.00 33.69 ? 458  LYS A CE  1 
ATOM   3646 N  NZ  . LYS A 1  458 ? 19.343 43.218  16.895  1.00 34.91 ? 458  LYS A NZ  1 
ATOM   3647 N  N   . ALA A 1  459 ? 23.904 39.444  12.808  1.00 23.17 ? 459  ALA A N   1 
ATOM   3648 C  CA  . ALA A 1  459 ? 23.547 38.156  12.229  1.00 22.97 ? 459  ALA A CA  1 
ATOM   3649 C  C   . ALA A 1  459 ? 23.834 37.027  13.210  1.00 22.85 ? 459  ALA A C   1 
ATOM   3650 O  O   . ALA A 1  459 ? 23.109 36.031  13.239  1.00 22.41 ? 459  ALA A O   1 
ATOM   3651 C  CB  . ALA A 1  459 ? 24.254 37.928  10.892  1.00 22.96 ? 459  ALA A CB  1 
ATOM   3652 N  N   . GLU A 1  460 ? 24.870 37.201  14.027  1.00 22.01 ? 460  GLU A N   1 
ATOM   3653 C  CA  . GLU A 1  460 ? 25.239 36.209  15.047  1.00 22.18 ? 460  GLU A CA  1 
ATOM   3654 C  C   . GLU A 1  460 ? 24.286 36.180  16.225  1.00 21.94 ? 460  GLU A C   1 
ATOM   3655 O  O   . GLU A 1  460 ? 23.913 35.106  16.700  1.00 21.68 ? 460  GLU A O   1 
ATOM   3656 C  CB  . GLU A 1  460 ? 26.686 36.427  15.493  1.00 21.71 ? 460  GLU A CB  1 
ATOM   3657 C  CG  . GLU A 1  460 ? 27.655 36.019  14.379  1.00 22.02 ? 460  GLU A CG  1 
ATOM   3658 C  CD  . GLU A 1  460 ? 29.111 36.258  14.724  1.00 24.00 ? 460  GLU A CD  1 
ATOM   3659 O  OE1 . GLU A 1  460 ? 29.413 37.303  15.343  1.00 21.99 ? 460  GLU A OE1 1 
ATOM   3660 O  OE2 . GLU A 1  460 ? 29.959 35.412  14.337  1.00 23.96 ? 460  GLU A OE2 1 
ATOM   3661 N  N   . GLU A 1  461 ? 23.872 37.363  16.687  1.00 21.78 ? 461  GLU A N   1 
ATOM   3662 C  CA  . GLU A 1  461 ? 22.810 37.465  17.681  1.00 22.40 ? 461  GLU A CA  1 
ATOM   3663 C  C   . GLU A 1  461 ? 21.570 36.667  17.221  1.00 22.33 ? 461  GLU A C   1 
ATOM   3664 O  O   . GLU A 1  461 ? 21.006 35.871  17.992  1.00 22.29 ? 461  GLU A O   1 
ATOM   3665 C  CB  . GLU A 1  461 ? 22.454 38.942  17.913  1.00 22.43 ? 461  GLU A CB  1 
ATOM   3666 C  CG  . GLU A 1  461 ? 21.416 39.191  19.008  1.00 25.52 ? 461  GLU A CG  1 
ATOM   3667 C  CD  . GLU A 1  461 ? 20.863 40.631  18.994  1.00 29.36 ? 461  GLU A CD  1 
ATOM   3668 O  OE1 . GLU A 1  461 ? 19.629 40.805  19.027  1.00 32.31 ? 461  GLU A OE1 1 
ATOM   3669 O  OE2 . GLU A 1  461 ? 21.656 41.590  18.936  1.00 31.12 ? 461  GLU A OE2 1 
ATOM   3670 N  N   A ILE A 1  462 ? 21.158 36.888  15.972  0.40 22.01 ? 462  ILE A N   1 
ATOM   3671 N  N   B ILE A 1  462 ? 21.163 36.885  15.969  0.60 21.91 ? 462  ILE A N   1 
ATOM   3672 C  CA  A ILE A 1  462 ? 19.978 36.224  15.415  0.40 21.97 ? 462  ILE A CA  1 
ATOM   3673 C  CA  B ILE A 1  462 ? 19.978 36.229  15.409  0.60 21.91 ? 462  ILE A CA  1 
ATOM   3674 C  C   A ILE A 1  462 ? 20.165 34.708  15.317  0.40 21.41 ? 462  ILE A C   1 
ATOM   3675 C  C   B ILE A 1  462 ? 20.178 34.708  15.352  0.60 21.31 ? 462  ILE A C   1 
ATOM   3676 O  O   A ILE A 1  462 ? 19.259 33.941  15.663  0.40 21.11 ? 462  ILE A O   1 
ATOM   3677 O  O   B ILE A 1  462 ? 19.299 33.942  15.770  0.60 20.79 ? 462  ILE A O   1 
ATOM   3678 C  CB  A ILE A 1  462 ? 19.591 36.806  14.037  0.40 22.09 ? 462  ILE A CB  1 
ATOM   3679 C  CB  B ILE A 1  462 ? 19.610 36.800  14.004  0.60 21.95 ? 462  ILE A CB  1 
ATOM   3680 C  CG1 A ILE A 1  462 ? 18.883 38.154  14.214  0.40 22.49 ? 462  ILE A CG1 1 
ATOM   3681 C  CG1 B ILE A 1  462 ? 19.286 38.297  14.103  0.60 22.14 ? 462  ILE A CG1 1 
ATOM   3682 C  CG2 A ILE A 1  462 ? 18.712 35.829  13.269  0.40 22.62 ? 462  ILE A CG2 1 
ATOM   3683 C  CG2 B ILE A 1  462 ? 18.426 36.043  13.390  0.60 22.77 ? 462  ILE A CG2 1 
ATOM   3684 C  CD1 A ILE A 1  462 ? 17.756 38.127  15.226  0.40 22.66 ? 462  ILE A CD1 1 
ATOM   3685 C  CD1 B ILE A 1  462 ? 19.500 39.057  12.813  0.60 20.22 ? 462  ILE A CD1 1 
ATOM   3686 N  N   . LEU A 1  463 ? 21.347 34.286  14.869  1.00 20.96 ? 463  LEU A N   1 
ATOM   3687 C  CA  . LEU A 1  463 ? 21.676 32.856  14.771  1.00 20.61 ? 463  LEU A CA  1 
ATOM   3688 C  C   . LEU A 1  463 ? 21.671 32.206  16.152  1.00 19.98 ? 463  LEU A C   1 
ATOM   3689 O  O   . LEU A 1  463 ? 21.070 31.143  16.342  1.00 18.82 ? 463  LEU A O   1 
ATOM   3690 C  CB  . LEU A 1  463 ? 23.024 32.629  14.067  1.00 20.47 ? 463  LEU A CB  1 
ATOM   3691 C  CG  . LEU A 1  463 ? 23.486 31.157  14.021  1.00 20.60 ? 463  LEU A CG  1 
ATOM   3692 C  CD1 . LEU A 1  463 ? 22.473 30.263  13.312  1.00 21.39 ? 463  LEU A CD1 1 
ATOM   3693 C  CD2 . LEU A 1  463 ? 24.842 31.076  13.353  1.00 20.63 ? 463  LEU A CD2 1 
ATOM   3694 N  N   . SER A 1  464 ? 22.310 32.866  17.118  1.00 19.39 ? 464  SER A N   1 
ATOM   3695 C  CA  . SER A 1  464 ? 22.336 32.338  18.464  1.00 19.53 ? 464  SER A CA  1 
ATOM   3696 C  C   . SER A 1  464 ? 20.916 32.243  19.032  1.00 19.44 ? 464  SER A C   1 
ATOM   3697 O  O   . SER A 1  464 ? 20.553 31.232  19.619  1.00 18.86 ? 464  SER A O   1 
ATOM   3698 C  CB  . SER A 1  464 ? 23.229 33.179  19.389  1.00 19.35 ? 464  SER A CB  1 
ATOM   3699 O  OG  . SER A 1  464 ? 23.297 32.568  20.667  1.00 19.28 ? 464  SER A OG  1 
ATOM   3700 N  N   . ARG A 1  465 ? 20.114 33.287  18.833  1.00 19.75 ? 465  ARG A N   1 
ATOM   3701 C  CA  . ARG A 1  465 ? 18.754 33.310  19.377  1.00 20.57 ? 465  ARG A CA  1 
ATOM   3702 C  C   . ARG A 1  465 ? 17.967 32.124  18.818  1.00 20.70 ? 465  ARG A C   1 
ATOM   3703 O  O   . ARG A 1  465 ? 17.215 31.454  19.545  1.00 20.49 ? 465  ARG A O   1 
ATOM   3704 C  CB  . ARG A 1  465 ? 18.033 34.633  19.036  1.00 20.71 ? 465  ARG A CB  1 
ATOM   3705 C  CG  . ARG A 1  465 ? 16.606 34.753  19.605  1.00 21.98 ? 465  ARG A CG  1 
ATOM   3706 C  CD  . ARG A 1  465 ? 16.636 35.007  21.101  1.00 23.89 ? 465  ARG A CD  1 
ATOM   3707 N  NE  . ARG A 1  465 ? 15.378 34.712  21.803  1.00 24.62 ? 465  ARG A NE  1 
ATOM   3708 C  CZ  . ARG A 1  465 ? 15.005 33.507  22.243  1.00 25.08 ? 465  ARG A CZ  1 
ATOM   3709 N  NH1 . ARG A 1  465 ? 15.770 32.424  22.032  1.00 20.59 ? 465  ARG A NH1 1 
ATOM   3710 N  NH2 . ARG A 1  465 ? 13.856 33.388  22.907  1.00 24.72 ? 465  ARG A NH2 1 
ATOM   3711 N  N   . SER A 1  466 ? 18.133 31.888  17.520  1.00 20.17 ? 466  SER A N   1 
ATOM   3712 C  CA  . SER A 1  466 ? 17.442 30.792  16.855  1.00 21.02 ? 466  SER A CA  1 
ATOM   3713 C  C   . SER A 1  466 ? 17.903 29.430  17.419  1.00 20.49 ? 466  SER A C   1 
ATOM   3714 O  O   . SER A 1  466 ? 17.079 28.582  17.803  1.00 20.63 ? 466  SER A O   1 
ATOM   3715 C  CB  . SER A 1  466 ? 17.657 30.875  15.345  1.00 21.15 ? 466  SER A CB  1 
ATOM   3716 O  OG  . SER A 1  466 ? 16.980 29.813  14.704  1.00 24.62 ? 466  SER A OG  1 
ATOM   3717 N  N   . ILE A 1  467 ? 19.211 29.241  17.498  1.00 19.68 ? 467  ILE A N   1 
ATOM   3718 C  CA  . ILE A 1  467 ? 19.772 28.000  18.082  1.00 19.50 ? 467  ILE A CA  1 
ATOM   3719 C  C   . ILE A 1  467 ? 19.274 27.766  19.500  1.00 19.13 ? 467  ILE A C   1 
ATOM   3720 O  O   . ILE A 1  467 ? 18.830 26.661  19.843  1.00 18.69 ? 467  ILE A O   1 
ATOM   3721 C  CB  . ILE A 1  467 ? 21.317 27.966  18.001  1.00 18.96 ? 467  ILE A CB  1 
ATOM   3722 C  CG1 . ILE A 1  467 ? 21.756 27.852  16.529  1.00 19.01 ? 467  ILE A CG1 1 
ATOM   3723 C  CG2 . ILE A 1  467 ? 21.901 26.829  18.880  1.00 17.47 ? 467  ILE A CG2 1 
ATOM   3724 C  CD1 . ILE A 1  467 ? 23.286 27.992  16.304  1.00 16.48 ? 467  ILE A CD1 1 
ATOM   3725 N  N   . VAL A 1  468 ? 19.315 28.819  20.314  1.00 19.47 ? 468  VAL A N   1 
ATOM   3726 C  CA  . VAL A 1  468 ? 18.853 28.737  21.698  1.00 18.91 ? 468  VAL A CA  1 
ATOM   3727 C  C   . VAL A 1  468 ? 17.373 28.306  21.793  1.00 18.87 ? 468  VAL A C   1 
ATOM   3728 O  O   . VAL A 1  468 ? 17.007 27.456  22.623  1.00 18.73 ? 468  VAL A O   1 
ATOM   3729 C  CB  . VAL A 1  468 ? 19.093 30.087  22.436  1.00 19.52 ? 468  VAL A CB  1 
ATOM   3730 C  CG1 . VAL A 1  468 ? 18.227 30.194  23.653  1.00 18.27 ? 468  VAL A CG1 1 
ATOM   3731 C  CG2 . VAL A 1  468 ? 20.606 30.276  22.775  1.00 18.79 ? 468  VAL A CG2 1 
ATOM   3732 N  N   . LYS A 1  469 ? 16.527 28.889  20.943  1.00 18.32 ? 469  LYS A N   1 
ATOM   3733 C  CA  . LYS A 1  469 ? 15.112 28.495  20.904  1.00 17.83 ? 469  LYS A CA  1 
ATOM   3734 C  C   . LYS A 1  469 ? 14.941 27.023  20.500  1.00 18.01 ? 469  LYS A C   1 
ATOM   3735 O  O   . LYS A 1  469 ? 14.156 26.286  21.110  1.00 18.41 ? 469  LYS A O   1 
ATOM   3736 C  CB  . LYS A 1  469 ? 14.308 29.429  19.979  1.00 17.85 ? 469  LYS A CB  1 
ATOM   3737 C  CG  . LYS A 1  469 ? 12.819 29.068  19.824  1.00 17.39 ? 469  LYS A CG  1 
ATOM   3738 C  CD  . LYS A 1  469 ? 12.106 28.952  21.169  1.00 18.68 ? 469  LYS A CD  1 
ATOM   3739 C  CE  . LYS A 1  469 ? 11.841 30.327  21.788  1.00 20.73 ? 469  LYS A CE  1 
ATOM   3740 N  NZ  . LYS A 1  469 ? 11.107 30.115  23.067  1.00 18.39 ? 469  LYS A NZ  1 
ATOM   3741 N  N   . ARG A 1  470 ? 15.687 26.586  19.485  1.00 17.46 ? 470  ARG A N   1 
ATOM   3742 C  CA  . ARG A 1  470 ? 15.550 25.220  18.990  1.00 17.11 ? 470  ARG A CA  1 
ATOM   3743 C  C   . ARG A 1  470 ? 16.008 24.199  20.037  1.00 17.35 ? 470  ARG A C   1 
ATOM   3744 O  O   . ARG A 1  470 ? 15.360 23.177  20.195  1.00 17.23 ? 470  ARG A O   1 
ATOM   3745 C  CB  . ARG A 1  470 ? 16.305 25.008  17.658  1.00 16.38 ? 470  ARG A CB  1 
ATOM   3746 C  CG  . ARG A 1  470 ? 15.757 25.800  16.470  1.00 15.70 ? 470  ARG A CG  1 
ATOM   3747 C  CD  . ARG A 1  470 ? 16.535 25.389  15.177  1.00 17.41 ? 470  ARG A CD  1 
ATOM   3748 N  NE  . ARG A 1  470 ? 16.090 26.092  13.978  1.00 19.45 ? 470  ARG A NE  1 
ATOM   3749 C  CZ  . ARG A 1  470 ? 15.100 25.701  13.168  1.00 20.96 ? 470  ARG A CZ  1 
ATOM   3750 N  NH1 . ARG A 1  470 ? 14.809 26.415  12.083  1.00 20.56 ? 470  ARG A NH1 1 
ATOM   3751 N  NH2 . ARG A 1  470 ? 14.390 24.613  13.431  1.00 21.00 ? 470  ARG A NH2 1 
ATOM   3752 N  N   . TRP A 1  471 ? 17.119 24.481  20.729  1.00 16.96 ? 471  TRP A N   1 
ATOM   3753 C  CA  . TRP A 1  471 ? 17.616 23.615  21.803  1.00 17.13 ? 471  TRP A CA  1 
ATOM   3754 C  C   . TRP A 1  471 ? 16.613 23.528  22.965  1.00 17.22 ? 471  TRP A C   1 
ATOM   3755 O  O   . TRP A 1  471 ? 16.343 22.437  23.486  1.00 17.61 ? 471  TRP A O   1 
ATOM   3756 C  CB  . TRP A 1  471 ? 18.986 24.124  22.312  1.00 16.44 ? 471  TRP A CB  1 
ATOM   3757 C  CG  . TRP A 1  471 ? 20.273 23.452  21.710  1.00 16.62 ? 471  TRP A CG  1 
ATOM   3758 C  CD1 . TRP A 1  471 ? 21.333 22.946  22.427  1.00 16.47 ? 471  TRP A CD1 1 
ATOM   3759 C  CD2 . TRP A 1  471 ? 20.627 23.284  20.316  1.00 17.75 ? 471  TRP A CD2 1 
ATOM   3760 N  NE1 . TRP A 1  471 ? 22.310 22.471  21.570  1.00 17.80 ? 471  TRP A NE1 1 
ATOM   3761 C  CE2 . TRP A 1  471 ? 21.893 22.648  20.275  1.00 16.79 ? 471  TRP A CE2 1 
ATOM   3762 C  CE3 . TRP A 1  471 ? 19.994 23.607  19.099  1.00 17.39 ? 471  TRP A CE3 1 
ATOM   3763 C  CZ2 . TRP A 1  471 ? 22.548 22.339  19.067  1.00 18.61 ? 471  TRP A CZ2 1 
ATOM   3764 C  CZ3 . TRP A 1  471 ? 20.634 23.276  17.898  1.00 18.00 ? 471  TRP A CZ3 1 
ATOM   3765 C  CH2 . TRP A 1  471 ? 21.906 22.658  17.891  1.00 16.78 ? 471  TRP A CH2 1 
ATOM   3766 N  N   . ALA A 1  472 ? 16.082 24.680  23.374  1.00 17.23 ? 472  ALA A N   1 
ATOM   3767 C  CA  . ALA A 1  472 ? 15.064 24.762  24.411  1.00 18.05 ? 472  ALA A CA  1 
ATOM   3768 C  C   . ALA A 1  472 ? 13.772 24.038  24.041  1.00 18.42 ? 472  ALA A C   1 
ATOM   3769 O  O   . ALA A 1  472 ? 13.207 23.321  24.865  1.00 18.79 ? 472  ALA A O   1 
ATOM   3770 C  CB  . ALA A 1  472 ? 14.760 26.227  24.746  1.00 18.24 ? 472  ALA A CB  1 
ATOM   3771 N  N   . ASN A 1  473 ? 13.301 24.239  22.812  1.00 18.63 ? 473  ASN A N   1 
ATOM   3772 C  CA  . ASN A 1  473 ? 12.138 23.512  22.333  1.00 18.85 ? 473  ASN A CA  1 
ATOM   3773 C  C   . ASN A 1  473 ? 12.412 22.021  22.262  1.00 18.43 ? 473  ASN A C   1 
ATOM   3774 O  O   . ASN A 1  473 ? 11.527 21.214  22.556  1.00 18.45 ? 473  ASN A O   1 
ATOM   3775 C  CB  . ASN A 1  473 ? 11.639 24.050  20.978  1.00 18.79 ? 473  ASN A CB  1 
ATOM   3776 C  CG  . ASN A 1  473 ? 10.765 25.296  21.121  1.00 19.62 ? 473  ASN A CG  1 
ATOM   3777 O  OD1 . ASN A 1  473 ? 10.405 25.696  22.228  1.00 21.24 ? 473  ASN A OD1 1 
ATOM   3778 N  ND2 . ASN A 1  473 ? 10.445 25.929  19.992  1.00 20.08 ? 473  ASN A ND2 1 
ATOM   3779 N  N   . PHE A 1  474 ? 13.642 21.638  21.910  1.00 18.63 ? 474  PHE A N   1 
ATOM   3780 C  CA  . PHE A 1  474 ? 13.982 20.217  21.955  1.00 18.45 ? 474  PHE A CA  1 
ATOM   3781 C  C   . PHE A 1  474 ? 13.910 19.683  23.385  1.00 18.62 ? 474  PHE A C   1 
ATOM   3782 O  O   . PHE A 1  474 ? 13.278 18.648  23.645  1.00 18.93 ? 474  PHE A O   1 
ATOM   3783 C  CB  . PHE A 1  474 ? 15.342 19.891  21.289  1.00 18.52 ? 474  PHE A CB  1 
ATOM   3784 C  CG  . PHE A 1  474 ? 15.711 18.427  21.396  1.00 17.54 ? 474  PHE A CG  1 
ATOM   3785 C  CD1 . PHE A 1  474 ? 15.132 17.483  20.541  1.00 16.07 ? 474  PHE A CD1 1 
ATOM   3786 C  CD2 . PHE A 1  474 ? 16.592 17.986  22.382  1.00 16.26 ? 474  PHE A CD2 1 
ATOM   3787 C  CE1 . PHE A 1  474 ? 15.436 16.123  20.651  1.00 16.81 ? 474  PHE A CE1 1 
ATOM   3788 C  CE2 . PHE A 1  474 ? 16.915 16.628  22.506  1.00 18.32 ? 474  PHE A CE2 1 
ATOM   3789 C  CZ  . PHE A 1  474 ? 16.326 15.684  21.637  1.00 16.55 ? 474  PHE A CZ  1 
ATOM   3790 N  N   . ALA A 1  475 ? 14.515 20.403  24.324  1.00 18.72 ? 475  ALA A N   1 
ATOM   3791 C  CA  . ALA A 1  475 ? 14.486 19.976  25.716  1.00 18.82 ? 475  ALA A CA  1 
ATOM   3792 C  C   . ALA A 1  475 ? 13.041 19.912  26.262  1.00 19.06 ? 475  ALA A C   1 
ATOM   3793 O  O   . ALA A 1  475 ? 12.655 18.929  26.870  1.00 19.58 ? 475  ALA A O   1 
ATOM   3794 C  CB  . ALA A 1  475 ? 15.329 20.879  26.564  1.00 18.19 ? 475  ALA A CB  1 
ATOM   3795 N  N   . LYS A 1  476 ? 12.251 20.949  26.036  1.00 18.96 ? 476  LYS A N   1 
ATOM   3796 C  CA  . LYS A 1  476 ? 10.888 20.988  26.596  1.00 20.04 ? 476  LYS A CA  1 
ATOM   3797 C  C   . LYS A 1  476 ? 9.918  20.030  25.890  1.00 19.76 ? 476  LYS A C   1 
ATOM   3798 O  O   . LYS A 1  476 ? 9.084  19.394  26.551  1.00 20.04 ? 476  LYS A O   1 
ATOM   3799 C  CB  . LYS A 1  476 ? 10.307 22.406  26.532  1.00 20.24 ? 476  LYS A CB  1 
ATOM   3800 C  CG  . LYS A 1  476 ? 11.088 23.483  27.319  1.00 22.60 ? 476  LYS A CG  1 
ATOM   3801 C  CD  . LYS A 1  476 ? 10.596 24.898  26.946  1.00 25.16 ? 476  LYS A CD  1 
ATOM   3802 C  CE  . LYS A 1  476 ? 11.213 25.939  27.877  1.00 29.88 ? 476  LYS A CE  1 
ATOM   3803 N  NZ  . LYS A 1  476 ? 11.135 27.329  27.313  1.00 32.61 ? 476  LYS A NZ  1 
ATOM   3804 N  N   . TYR A 1  477 ? 10.024 19.944  24.562  1.00 19.39 ? 477  TYR A N   1 
ATOM   3805 C  CA  . TYR A 1  477 ? 8.977  19.322  23.750  1.00 19.98 ? 477  TYR A CA  1 
ATOM   3806 C  C   . TYR A 1  477 ? 9.450  18.170  22.863  1.00 19.99 ? 477  TYR A C   1 
ATOM   3807 O  O   . TYR A 1  477 ? 8.634  17.546  22.198  1.00 20.36 ? 477  TYR A O   1 
ATOM   3808 C  CB  . TYR A 1  477 ? 8.255  20.385  22.907  1.00 19.12 ? 477  TYR A CB  1 
ATOM   3809 C  CG  . TYR A 1  477 ? 7.872  21.619  23.710  1.00 20.33 ? 477  TYR A CG  1 
ATOM   3810 C  CD1 . TYR A 1  477 ? 8.296  22.888  23.311  1.00 19.72 ? 477  TYR A CD1 1 
ATOM   3811 C  CD2 . TYR A 1  477 ? 7.114  21.511  24.889  1.00 20.44 ? 477  TYR A CD2 1 
ATOM   3812 C  CE1 . TYR A 1  477 ? 7.964  24.019  24.039  1.00 19.07 ? 477  TYR A CE1 1 
ATOM   3813 C  CE2 . TYR A 1  477 ? 6.775  22.643  25.643  1.00 20.69 ? 477  TYR A CE2 1 
ATOM   3814 C  CZ  . TYR A 1  477 ? 7.211  23.890  25.213  1.00 22.47 ? 477  TYR A CZ  1 
ATOM   3815 O  OH  . TYR A 1  477 ? 6.902  25.005  25.937  1.00 20.22 ? 477  TYR A OH  1 
ATOM   3816 N  N   . GLY A 1  478 ? 10.759 17.918  22.844  1.00 19.56 ? 478  GLY A N   1 
ATOM   3817 C  CA  . GLY A 1  478 ? 11.329 16.861  22.013  1.00 19.16 ? 478  GLY A CA  1 
ATOM   3818 C  C   . GLY A 1  478 ? 11.392 17.202  20.540  1.00 19.43 ? 478  GLY A C   1 
ATOM   3819 O  O   . GLY A 1  478 ? 11.496 16.308  19.689  1.00 19.01 ? 478  GLY A O   1 
ATOM   3820 N  N   . ASN A 1  479 ? 11.348 18.492  20.218  1.00 18.85 ? 479  ASN A N   1 
ATOM   3821 C  CA  . ASN A 1  479 ? 11.181 18.892  18.822  1.00 19.34 ? 479  ASN A CA  1 
ATOM   3822 C  C   . ASN A 1  479 ? 11.860 20.240  18.560  1.00 19.01 ? 479  ASN A C   1 
ATOM   3823 O  O   . ASN A 1  479 ? 11.338 21.263  18.985  1.00 19.32 ? 479  ASN A O   1 
ATOM   3824 C  CB  . ASN A 1  479 ? 9.670  18.957  18.496  1.00 19.28 ? 479  ASN A CB  1 
ATOM   3825 C  CG  . ASN A 1  479 ? 9.372  18.737  17.019  1.00 20.60 ? 479  ASN A CG  1 
ATOM   3826 O  OD1 . ASN A 1  479 ? 10.245 18.871  16.165  1.00 23.34 ? 479  ASN A OD1 1 
ATOM   3827 N  ND2 . ASN A 1  479 ? 8.127  18.406  16.718  1.00 23.13 ? 479  ASN A ND2 1 
ATOM   3828 N  N   . PRO A 1  480 ? 13.026 20.246  17.865  1.00 18.64 ? 480  PRO A N   1 
ATOM   3829 C  CA  . PRO A 1  480 ? 13.889 21.438  17.825  1.00 18.57 ? 480  PRO A CA  1 
ATOM   3830 C  C   . PRO A 1  480 ? 13.462 22.465  16.788  1.00 18.96 ? 480  PRO A C   1 
ATOM   3831 O  O   . PRO A 1  480 ? 14.257 22.888  15.926  1.00 18.67 ? 480  PRO A O   1 
ATOM   3832 C  CB  . PRO A 1  480 ? 15.272 20.858  17.496  1.00 18.34 ? 480  PRO A CB  1 
ATOM   3833 C  CG  . PRO A 1  480 ? 14.956 19.686  16.606  1.00 17.93 ? 480  PRO A CG  1 
ATOM   3834 C  CD  . PRO A 1  480 ? 13.661 19.098  17.189  1.00 18.91 ? 480  PRO A CD  1 
ATOM   3835 N  N   . GLN A 1  481 ? 12.208 22.869  16.876  1.00 19.18 ? 481  GLN A N   1 
ATOM   3836 C  CA  . GLN A 1  481 ? 11.652 23.815  15.922  1.00 19.50 ? 481  GLN A CA  1 
ATOM   3837 C  C   . GLN A 1  481 ? 11.771 25.228  16.448  1.00 20.18 ? 481  GLN A C   1 
ATOM   3838 O  O   . GLN A 1  481 ? 11.874 25.452  17.652  1.00 20.74 ? 481  GLN A O   1 
ATOM   3839 C  CB  . GLN A 1  481 ? 10.178 23.487  15.580  1.00 18.85 ? 481  GLN A CB  1 
ATOM   3840 C  CG  . GLN A 1  481 ? 9.915  22.023  15.186  1.00 19.44 ? 481  GLN A CG  1 
ATOM   3841 C  CD  . GLN A 1  481 ? 10.738 21.567  13.967  1.00 20.14 ? 481  GLN A CD  1 
ATOM   3842 O  OE1 . GLN A 1  481 ? 11.116 22.385  13.118  1.00 19.71 ? 481  GLN A OE1 1 
ATOM   3843 N  NE2 . GLN A 1  481 ? 11.021 20.257  13.887  1.00 16.01 ? 481  GLN A NE2 1 
ATOM   3844 N  N   . GLU A 1  482 ? 11.791 26.177  15.527  1.00 21.13 ? 482  GLU A N   1 
ATOM   3845 C  CA  . GLU A 1  482 ? 11.555 27.568  15.857  1.00 22.98 ? 482  GLU A CA  1 
ATOM   3846 C  C   . GLU A 1  482 ? 10.262 27.884  15.112  1.00 23.05 ? 482  GLU A C   1 
ATOM   3847 O  O   . GLU A 1  482 ? 10.245 27.918  13.883  1.00 24.11 ? 482  GLU A O   1 
ATOM   3848 C  CB  . GLU A 1  482 ? 12.732 28.456  15.413  1.00 23.20 ? 482  GLU A CB  1 
ATOM   3849 C  CG  . GLU A 1  482 ? 12.647 29.886  15.965  1.00 24.70 ? 482  GLU A CG  1 
ATOM   3850 C  CD  . GLU A 1  482 ? 11.436 30.644  15.419  1.00 26.86 ? 482  GLU A CD  1 
ATOM   3851 O  OE1 . GLU A 1  482 ? 10.574 31.053  16.219  1.00 26.08 ? 482  GLU A OE1 1 
ATOM   3852 O  OE2 . GLU A 1  482 ? 11.329 30.793  14.175  1.00 29.73 ? 482  GLU A OE2 1 
ATOM   3853 N  N   . THR A 1  483 ? 9.173  28.049  15.854  1.00 23.11 ? 483  THR A N   1 
ATOM   3854 C  CA  . THR A 1  483 ? 7.823  27.995  15.262  1.00 23.37 ? 483  THR A CA  1 
ATOM   3855 C  C   . THR A 1  483 ? 7.228  29.366  14.897  1.00 24.78 ? 483  THR A C   1 
ATOM   3856 O  O   . THR A 1  483 ? 6.170  29.429  14.275  1.00 24.22 ? 483  THR A O   1 
ATOM   3857 C  CB  . THR A 1  483 ? 6.825  27.307  16.228  1.00 23.06 ? 483  THR A CB  1 
ATOM   3858 O  OG1 . THR A 1  483 ? 6.718  28.087  17.429  1.00 20.22 ? 483  THR A OG1 1 
ATOM   3859 C  CG2 . THR A 1  483 ? 7.283  25.887  16.589  1.00 21.65 ? 483  THR A CG2 1 
ATOM   3860 N  N   . GLN A 1  484 ? 7.896  30.451  15.288  1.00 26.10 ? 484  GLN A N   1 
ATOM   3861 C  CA  . GLN A 1  484 ? 7.271  31.783  15.221  1.00 28.34 ? 484  GLN A CA  1 
ATOM   3862 C  C   . GLN A 1  484 ? 7.747  32.699  14.099  1.00 29.48 ? 484  GLN A C   1 
ATOM   3863 O  O   . GLN A 1  484 ? 7.027  33.614  13.705  1.00 29.44 ? 484  GLN A O   1 
ATOM   3864 C  CB  . GLN A 1  484 ? 7.404  32.498  16.571  1.00 28.18 ? 484  GLN A CB  1 
ATOM   3865 C  CG  . GLN A 1  484 ? 6.648  31.794  17.687  1.00 29.29 ? 484  GLN A CG  1 
ATOM   3866 C  CD  . GLN A 1  484 ? 6.862  32.419  19.048  1.00 30.60 ? 484  GLN A CD  1 
ATOM   3867 O  OE1 . GLN A 1  484 ? 7.995  32.612  19.493  1.00 32.22 ? 484  GLN A OE1 1 
ATOM   3868 N  NE2 . GLN A 1  484 ? 5.765  32.715  19.733  1.00 31.43 ? 484  GLN A NE2 1 
ATOM   3869 N  N   . ASN A 1  485 ? 8.950  32.462  13.582  1.00 31.01 ? 485  ASN A N   1 
ATOM   3870 C  CA  . ASN A 1  485 ? 9.554  33.416  12.654  1.00 32.67 ? 485  ASN A CA  1 
ATOM   3871 C  C   . ASN A 1  485 ? 9.740  32.882  11.228  1.00 33.42 ? 485  ASN A C   1 
ATOM   3872 O  O   . ASN A 1  485 ? 10.740 33.184  10.559  1.00 33.83 ? 485  ASN A O   1 
ATOM   3873 C  CB  . ASN A 1  485 ? 10.855 33.980  13.255  1.00 33.19 ? 485  ASN A CB  1 
ATOM   3874 C  CG  . ASN A 1  485 ? 10.605 34.848  14.499  1.00 35.47 ? 485  ASN A CG  1 
ATOM   3875 O  OD1 . ASN A 1  485 ? 9.460  35.181  14.823  1.00 36.53 ? 485  ASN A OD1 1 
ATOM   3876 N  ND2 . ASN A 1  485 ? 11.679 35.215  15.196  1.00 39.42 ? 485  ASN A ND2 1 
ATOM   3877 N  N   . GLN A 1  486 ? 8.746  32.114  10.763  1.00 33.81 ? 486  GLN A N   1 
ATOM   3878 C  CA  . GLN A 1  486 ? 8.769  31.457  9.443   1.00 34.23 ? 486  GLN A CA  1 
ATOM   3879 C  C   . GLN A 1  486 ? 10.114 30.796  9.178   1.00 33.47 ? 486  GLN A C   1 
ATOM   3880 O  O   . GLN A 1  486 ? 10.742 31.016  8.141   1.00 34.27 ? 486  GLN A O   1 
ATOM   3881 C  CB  . GLN A 1  486 ? 8.446  32.435  8.310   1.00 34.68 ? 486  GLN A CB  1 
ATOM   3882 C  CG  . GLN A 1  486 ? 7.212  33.268  8.524   1.00 37.65 ? 486  GLN A CG  1 
ATOM   3883 C  CD  . GLN A 1  486 ? 7.499  34.724  8.244   1.00 42.14 ? 486  GLN A CD  1 
ATOM   3884 O  OE1 . GLN A 1  486 ? 7.950  35.455  9.127   1.00 44.43 ? 486  GLN A OE1 1 
ATOM   3885 N  NE2 . GLN A 1  486 ? 7.259  35.153  7.005   1.00 42.88 ? 486  GLN A NE2 1 
ATOM   3886 N  N   . SER A 1  487 ? 10.555 29.996  10.131  1.00 31.89 ? 487  SER A N   1 
ATOM   3887 C  CA  . SER A 1  487 ? 11.817 29.291  9.991   1.00 30.99 ? 487  SER A CA  1 
ATOM   3888 C  C   . SER A 1  487 ? 11.617 27.985  9.248   1.00 29.74 ? 487  SER A C   1 
ATOM   3889 O  O   . SER A 1  487 ? 10.509 27.460  9.189   1.00 29.76 ? 487  SER A O   1 
ATOM   3890 C  CB  . SER A 1  487 ? 12.424 29.015  11.364  1.00 30.43 ? 487  SER A CB  1 
ATOM   3891 O  OG  . SER A 1  487 ? 12.749 30.236  11.995  1.00 31.45 ? 487  SER A OG  1 
ATOM   3892 N  N   . THR A 1  488 ? 12.706 27.489  8.674   1.00 28.30 ? 488  THR A N   1 
ATOM   3893 C  CA  . THR A 1  488 ? 12.790 26.140  8.138   1.00 27.00 ? 488  THR A CA  1 
ATOM   3894 C  C   . THR A 1  488 ? 12.445 25.125  9.231   1.00 25.99 ? 488  THR A C   1 
ATOM   3895 O  O   . THR A 1  488 ? 12.951 25.223  10.365  1.00 26.24 ? 488  THR A O   1 
ATOM   3896 C  CB  . THR A 1  488 ? 14.226 25.876  7.638   1.00 27.31 ? 488  THR A CB  1 
ATOM   3897 O  OG1 . THR A 1  488 ? 14.610 26.919  6.736   1.00 27.20 ? 488  THR A OG1 1 
ATOM   3898 C  CG2 . THR A 1  488 ? 14.341 24.541  6.929   1.00 27.31 ? 488  THR A CG2 1 
ATOM   3899 N  N   . SER A 1  489 ? 11.573 24.175  8.899   1.00 24.39 ? 489  SER A N   1 
ATOM   3900 C  CA  . SER A 1  489 ? 11.248 23.072  9.799   1.00 24.22 ? 489  SER A CA  1 
ATOM   3901 C  C   . SER A 1  489 ? 12.375 22.073  9.779   1.00 22.94 ? 489  SER A C   1 
ATOM   3902 O  O   . SER A 1  489 ? 12.922 21.753  8.736   1.00 22.48 ? 489  SER A O   1 
ATOM   3903 C  CB  . SER A 1  489 ? 9.951  22.370  9.404   1.00 24.34 ? 489  SER A CB  1 
ATOM   3904 O  OG  . SER A 1  489 ? 8.882  23.297  9.494   1.00 28.73 ? 489  SER A OG  1 
ATOM   3905 N  N   . TRP A 1  490 ? 12.753 21.604  10.957  1.00 21.60 ? 490  TRP A N   1 
ATOM   3906 C  CA  . TRP A 1  490 ? 13.852 20.687  11.035  1.00 20.04 ? 490  TRP A CA  1 
ATOM   3907 C  C   . TRP A 1  490 ? 13.251 19.290  10.884  1.00 19.65 ? 490  TRP A C   1 
ATOM   3908 O  O   . TRP A 1  490 ? 12.479 18.862  11.740  1.00 19.05 ? 490  TRP A O   1 
ATOM   3909 C  CB  . TRP A 1  490 ? 14.536 20.870  12.390  1.00 19.91 ? 490  TRP A CB  1 
ATOM   3910 C  CG  . TRP A 1  490 ? 15.846 20.167  12.557  1.00 18.15 ? 490  TRP A CG  1 
ATOM   3911 C  CD1 . TRP A 1  490 ? 16.317 19.061  11.872  1.00 17.13 ? 490  TRP A CD1 1 
ATOM   3912 C  CD2 . TRP A 1  490 ? 16.853 20.515  13.506  1.00 16.79 ? 490  TRP A CD2 1 
ATOM   3913 N  NE1 . TRP A 1  490 ? 17.580 18.723  12.344  1.00 17.25 ? 490  TRP A NE1 1 
ATOM   3914 C  CE2 . TRP A 1  490 ? 17.929 19.605  13.340  1.00 17.52 ? 490  TRP A CE2 1 
ATOM   3915 C  CE3 . TRP A 1  490 ? 16.968 21.534  14.454  1.00 16.05 ? 490  TRP A CE3 1 
ATOM   3916 C  CZ2 . TRP A 1  490 ? 19.087 19.661  14.138  1.00 16.80 ? 490  TRP A CZ2 1 
ATOM   3917 C  CZ3 . TRP A 1  490 ? 18.123 21.604  15.235  1.00 16.77 ? 490  TRP A CZ3 1 
ATOM   3918 C  CH2 . TRP A 1  490 ? 19.159 20.666  15.078  1.00 17.20 ? 490  TRP A CH2 1 
ATOM   3919 N  N   . PRO A 1  491 ? 13.564 18.585  9.772   1.00 20.23 ? 491  PRO A N   1 
ATOM   3920 C  CA  . PRO A 1  491 ? 12.961 17.265  9.624   1.00 20.70 ? 491  PRO A CA  1 
ATOM   3921 C  C   . PRO A 1  491 ? 13.679 16.228  10.462  1.00 21.34 ? 491  PRO A C   1 
ATOM   3922 O  O   . PRO A 1  491 ? 14.867 16.374  10.781  1.00 19.86 ? 491  PRO A O   1 
ATOM   3923 C  CB  . PRO A 1  491 ? 13.175 16.947  8.147   1.00 21.26 ? 491  PRO A CB  1 
ATOM   3924 C  CG  . PRO A 1  491 ? 14.489 17.604  7.836   1.00 20.05 ? 491  PRO A CG  1 
ATOM   3925 C  CD  . PRO A 1  491 ? 14.475 18.891  8.652   1.00 19.86 ? 491  PRO A CD  1 
ATOM   3926 N  N   . VAL A 1  492 ? 12.939 15.178  10.800  1.00 21.89 ? 492  VAL A N   1 
ATOM   3927 C  CA  . VAL A 1  492 ? 13.489 14.028  11.467  1.00 23.07 ? 492  VAL A CA  1 
ATOM   3928 C  C   . VAL A 1  492 ? 14.525 13.360  10.546  1.00 23.22 ? 492  VAL A C   1 
ATOM   3929 O  O   . VAL A 1  492 ? 14.362 13.327  9.306   1.00 22.02 ? 492  VAL A O   1 
ATOM   3930 C  CB  . VAL A 1  492 ? 12.336 13.076  11.890  1.00 23.85 ? 492  VAL A CB  1 
ATOM   3931 C  CG1 . VAL A 1  492 ? 12.820 11.691  12.107  1.00 26.37 ? 492  VAL A CG1 1 
ATOM   3932 C  CG2 . VAL A 1  492 ? 11.643 13.604  13.162  1.00 23.62 ? 492  VAL A CG2 1 
ATOM   3933 N  N   . PHE A 1  493 ? 15.614 12.896  11.159  1.00 23.14 ? 493  PHE A N   1 
ATOM   3934 C  CA  . PHE A 1  493 ? 16.653 12.129  10.483  1.00 23.92 ? 493  PHE A CA  1 
ATOM   3935 C  C   . PHE A 1  493 ? 16.254 10.666  10.554  1.00 25.49 ? 493  PHE A C   1 
ATOM   3936 O  O   . PHE A 1  493 ? 16.026 10.125  11.647  1.00 25.18 ? 493  PHE A O   1 
ATOM   3937 C  CB  . PHE A 1  493 ? 18.001 12.328  11.206  1.00 23.17 ? 493  PHE A CB  1 
ATOM   3938 C  CG  . PHE A 1  493 ? 19.175 11.603  10.587  1.00 22.31 ? 493  PHE A CG  1 
ATOM   3939 C  CD1 . PHE A 1  493 ? 19.370 10.230  10.795  1.00 21.39 ? 493  PHE A CD1 1 
ATOM   3940 C  CD2 . PHE A 1  493 ? 20.139 12.316  9.872   1.00 20.76 ? 493  PHE A CD2 1 
ATOM   3941 C  CE1 . PHE A 1  493 ? 20.489 9.562   10.246  1.00 21.69 ? 493  PHE A CE1 1 
ATOM   3942 C  CE2 . PHE A 1  493 ? 21.266 11.674  9.334   1.00 21.36 ? 493  PHE A CE2 1 
ATOM   3943 C  CZ  . PHE A 1  493 ? 21.442 10.293  9.511   1.00 19.96 ? 493  PHE A CZ  1 
ATOM   3944 N  N   . LYS A 1  494 ? 16.187 10.040  9.388   1.00 27.24 ? 494  LYS A N   1 
ATOM   3945 C  CA  . LYS A 1  494 ? 15.827 8.636   9.254   1.00 29.57 ? 494  LYS A CA  1 
ATOM   3946 C  C   . LYS A 1  494 ? 16.924 7.952   8.454   1.00 30.57 ? 494  LYS A C   1 
ATOM   3947 O  O   . LYS A 1  494 ? 17.594 8.586   7.632   1.00 30.19 ? 494  LYS A O   1 
ATOM   3948 C  CB  . LYS A 1  494 ? 14.495 8.503   8.509   1.00 30.12 ? 494  LYS A CB  1 
ATOM   3949 C  CG  . LYS A 1  494 ? 13.280 9.040   9.259   1.00 33.58 ? 494  LYS A CG  1 
ATOM   3950 C  CD  . LYS A 1  494 ? 12.148 9.419   8.295   1.00 37.88 ? 494  LYS A CD  1 
ATOM   3951 C  CE  . LYS A 1  494 ? 10.795 9.409   9.013   1.00 40.14 ? 494  LYS A CE  1 
ATOM   3952 N  NZ  . LYS A 1  494 ? 9.910  10.575  8.666   1.00 40.74 ? 494  LYS A NZ  1 
ATOM   3953 N  N   . SER A 1  495 ? 17.088 6.652   8.666   1.00 31.74 ? 495  SER A N   1 
ATOM   3954 C  CA  . SER A 1  495 ? 18.188 5.902   8.049   1.00 33.66 ? 495  SER A CA  1 
ATOM   3955 C  C   . SER A 1  495 ? 18.150 5.927   6.523   1.00 33.59 ? 495  SER A C   1 
ATOM   3956 O  O   . SER A 1  495 ? 19.183 5.922   5.862   1.00 33.78 ? 495  SER A O   1 
ATOM   3957 C  CB  . SER A 1  495 ? 18.180 4.452   8.518   1.00 34.35 ? 495  SER A CB  1 
ATOM   3958 O  OG  . SER A 1  495 ? 19.508 3.962   8.483   1.00 37.15 ? 495  SER A OG  1 
ATOM   3959 N  N   . THR A 1  496 ? 16.947 5.951   5.977   1.00 33.82 ? 496  THR A N   1 
ATOM   3960 C  CA  . THR A 1  496 ? 16.751 6.136   4.553   1.00 34.43 ? 496  THR A CA  1 
ATOM   3961 C  C   . THR A 1  496 ? 16.643 7.645   4.330   1.00 33.80 ? 496  THR A C   1 
ATOM   3962 O  O   . THR A 1  496 ? 15.778 8.301   4.906   1.00 35.71 ? 496  THR A O   1 
ATOM   3963 C  CB  . THR A 1  496 ? 15.403 5.546   4.145   1.00 34.83 ? 496  THR A CB  1 
ATOM   3964 O  OG1 . THR A 1  496 ? 14.383 6.175   4.937   1.00 37.59 ? 496  THR A OG1 1 
ATOM   3965 C  CG2 . THR A 1  496 ? 15.360 4.036   4.396   1.00 34.73 ? 496  THR A CG2 1 
ATOM   3966 N  N   . GLU A 1  497 ? 17.485 8.241   3.525   1.00 32.37 ? 497  GLU A N   1 
ATOM   3967 C  CA  . GLU A 1  497 ? 17.232 9.681   3.285   1.00 30.89 ? 497  GLU A CA  1 
ATOM   3968 C  C   . GLU A 1  497 ? 18.117 10.600  4.070   1.00 27.56 ? 497  GLU A C   1 
ATOM   3969 O  O   . GLU A 1  497 ? 18.694 11.505  3.485   1.00 26.75 ? 497  GLU A O   1 
ATOM   3970 C  CB  . GLU A 1  497 ? 15.796 10.074  3.617   1.00 31.55 ? 497  GLU A CB  1 
ATOM   3971 C  CG  . GLU A 1  497 ? 14.969 10.347  2.415   1.00 36.12 ? 497  GLU A CG  1 
ATOM   3972 C  CD  . GLU A 1  497 ? 13.509 10.187  2.687   1.00 41.17 ? 497  GLU A CD  1 
ATOM   3973 O  OE1 . GLU A 1  497 ? 12.725 11.013  2.171   1.00 42.68 ? 497  GLU A OE1 1 
ATOM   3974 O  OE2 . GLU A 1  497 ? 13.155 9.232   3.419   1.00 45.42 ? 497  GLU A OE2 1 
ATOM   3975 N  N   . GLN A 1  498 ? 18.166 10.405  5.390   1.00 24.11 ? 498  GLN A N   1 
ATOM   3976 C  CA  . GLN A 1  498 ? 19.203 11.045  6.203   1.00 22.56 ? 498  GLN A CA  1 
ATOM   3977 C  C   . GLN A 1  498 ? 19.229 12.560  6.034   1.00 20.89 ? 498  GLN A C   1 
ATOM   3978 O  O   . GLN A 1  498 ? 20.285 13.143  5.767   1.00 21.20 ? 498  GLN A O   1 
ATOM   3979 C  CB  . GLN A 1  498 ? 20.565 10.440  5.844   1.00 22.65 ? 498  GLN A CB  1 
ATOM   3980 C  CG  . GLN A 1  498 ? 20.579 8.933   6.025   1.00 25.30 ? 498  GLN A CG  1 
ATOM   3981 C  CD  . GLN A 1  498 ? 21.660 8.217   5.232   1.00 28.45 ? 498  GLN A CD  1 
ATOM   3982 O  OE1 . GLN A 1  498 ? 21.423 7.121   4.726   1.00 34.48 ? 498  GLN A OE1 1 
ATOM   3983 N  NE2 . GLN A 1  498 ? 22.827 8.816   5.115   1.00 23.96 ? 498  GLN A NE2 1 
ATOM   3984 N  N   . LYS A 1  499 ? 18.062 13.186  6.186   1.00 19.01 ? 499  LYS A N   1 
ATOM   3985 C  CA  . LYS A 1  499 ? 17.945 14.648  6.175   1.00 18.72 ? 499  LYS A CA  1 
ATOM   3986 C  C   . LYS A 1  499 ? 18.586 15.284  7.398   1.00 18.02 ? 499  LYS A C   1 
ATOM   3987 O  O   . LYS A 1  499 ? 18.444 14.785  8.526   1.00 17.90 ? 499  LYS A O   1 
ATOM   3988 C  CB  . LYS A 1  499 ? 16.473 15.099  6.106   1.00 18.08 ? 499  LYS A CB  1 
ATOM   3989 C  CG  . LYS A 1  499 ? 15.728 14.575  4.884   1.00 19.06 ? 499  LYS A CG  1 
ATOM   3990 C  CD  . LYS A 1  499 ? 14.283 15.057  4.858   1.00 18.80 ? 499  LYS A CD  1 
ATOM   3991 C  CE  . LYS A 1  499 ? 13.556 14.410  3.667   1.00 21.24 ? 499  LYS A CE  1 
ATOM   3992 N  NZ  . LYS A 1  499 ? 12.164 14.880  3.679   1.00 22.24 ? 499  LYS A NZ  1 
ATOM   3993 N  N   . TYR A 1  500 ? 19.246 16.411  7.168   1.00 17.46 ? 500  TYR A N   1 
ATOM   3994 C  CA  . TYR A 1  500 ? 19.832 17.222  8.241   1.00 17.93 ? 500  TYR A CA  1 
ATOM   3995 C  C   . TYR A 1  500 ? 19.632 18.706  7.956   1.00 18.50 ? 500  TYR A C   1 
ATOM   3996 O  O   . TYR A 1  500 ? 19.327 19.089  6.814   1.00 18.94 ? 500  TYR A O   1 
ATOM   3997 C  CB  . TYR A 1  500 ? 21.326 16.900  8.418   1.00 16.97 ? 500  TYR A CB  1 
ATOM   3998 C  CG  . TYR A 1  500 ? 22.215 17.253  7.241   1.00 18.02 ? 500  TYR A CG  1 
ATOM   3999 C  CD1 . TYR A 1  500 ? 22.326 16.389  6.132   1.00 16.40 ? 500  TYR A CD1 1 
ATOM   4000 C  CD2 . TYR A 1  500 ? 23.001 18.420  7.256   1.00 17.17 ? 500  TYR A CD2 1 
ATOM   4001 C  CE1 . TYR A 1  500 ? 23.178 16.689  5.069   1.00 17.91 ? 500  TYR A CE1 1 
ATOM   4002 C  CE2 . TYR A 1  500 ? 23.846 18.735  6.185   1.00 18.02 ? 500  TYR A CE2 1 
ATOM   4003 C  CZ  . TYR A 1  500 ? 23.932 17.860  5.096   1.00 18.82 ? 500  TYR A CZ  1 
ATOM   4004 O  OH  . TYR A 1  500 ? 24.759 18.163  4.039   1.00 16.05 ? 500  TYR A OH  1 
ATOM   4005 N  N   . LEU A 1  501 ? 19.809 19.520  8.992   1.00 18.43 ? 501  LEU A N   1 
ATOM   4006 C  CA  . LEU A 1  501 ? 19.589 20.962  8.930   1.00 18.87 ? 501  LEU A CA  1 
ATOM   4007 C  C   . LEU A 1  501 ? 20.931 21.690  9.057   1.00 18.84 ? 501  LEU A C   1 
ATOM   4008 O  O   . LEU A 1  501 ? 21.711 21.421  9.971   1.00 18.04 ? 501  LEU A O   1 
ATOM   4009 C  CB  . LEU A 1  501 ? 18.627 21.415  10.058  1.00 19.46 ? 501  LEU A CB  1 
ATOM   4010 C  CG  . LEU A 1  501 ? 18.308 22.921  10.139  1.00 21.50 ? 501  LEU A CG  1 
ATOM   4011 C  CD1 . LEU A 1  501 ? 17.587 23.347  8.894   1.00 23.91 ? 501  LEU A CD1 1 
ATOM   4012 C  CD2 . LEU A 1  501 ? 17.499 23.328  11.363  1.00 23.57 ? 501  LEU A CD2 1 
ATOM   4013 N  N   . THR A 1  502 ? 21.215 22.605  8.137   1.00 18.64 ? 502  THR A N   1 
ATOM   4014 C  CA  . THR A 1  502 ? 22.449 23.392  8.235   1.00 19.17 ? 502  THR A CA  1 
ATOM   4015 C  C   . THR A 1  502 ? 22.199 24.643  9.079   1.00 19.40 ? 502  THR A C   1 
ATOM   4016 O  O   . THR A 1  502 ? 21.104 25.214  9.048   1.00 19.92 ? 502  THR A O   1 
ATOM   4017 C  CB  . THR A 1  502 ? 23.024 23.785  6.850   1.00 19.14 ? 502  THR A CB  1 
ATOM   4018 O  OG1 . THR A 1  502 ? 22.166 24.751  6.232   1.00 19.64 ? 502  THR A OG1 1 
ATOM   4019 C  CG2 . THR A 1  502 ? 23.154 22.548  5.955   1.00 19.66 ? 502  THR A CG2 1 
ATOM   4020 N  N   . LEU A 1  503 ? 23.195 25.047  9.860   1.00 19.20 ? 503  LEU A N   1 
ATOM   4021 C  CA  . LEU A 1  503 ? 23.027 26.183  10.760  1.00 19.99 ? 503  LEU A CA  1 
ATOM   4022 C  C   . LEU A 1  503 ? 24.058 27.209  10.376  1.00 20.91 ? 503  LEU A C   1 
ATOM   4023 O  O   . LEU A 1  503 ? 25.252 26.951  10.466  1.00 21.12 ? 503  LEU A O   1 
ATOM   4024 C  CB  . LEU A 1  503 ? 23.201 25.763  12.235  1.00 19.50 ? 503  LEU A CB  1 
ATOM   4025 C  CG  . LEU A 1  503 ? 22.202 24.760  12.832  1.00 18.73 ? 503  LEU A CG  1 
ATOM   4026 C  CD1 . LEU A 1  503 ? 22.615 24.378  14.263  1.00 15.66 ? 503  LEU A CD1 1 
ATOM   4027 C  CD2 . LEU A 1  503 ? 20.799 25.331  12.830  1.00 19.67 ? 503  LEU A CD2 1 
ATOM   4028 N  N   . ASN A 1  504 ? 23.590 28.370  9.935   1.00 23.19 ? 504  ASN A N   1 
ATOM   4029 C  CA  . ASN A 1  504 ? 24.465 29.437  9.469   1.00 25.46 ? 504  ASN A CA  1 
ATOM   4030 C  C   . ASN A 1  504 ? 23.691 30.758  9.458   1.00 26.76 ? 504  ASN A C   1 
ATOM   4031 O  O   . ASN A 1  504 ? 22.467 30.752  9.640   1.00 26.58 ? 504  ASN A O   1 
ATOM   4032 C  CB  . ASN A 1  504 ? 24.977 29.112  8.072   1.00 25.15 ? 504  ASN A CB  1 
ATOM   4033 C  CG  . ASN A 1  504 ? 23.858 28.991  7.071   1.00 27.38 ? 504  ASN A CG  1 
ATOM   4034 O  OD1 . ASN A 1  504 ? 23.225 29.987  6.729   1.00 27.75 ? 504  ASN A OD1 1 
ATOM   4035 N  ND2 . ASN A 1  504 ? 23.590 27.764  6.601   1.00 27.50 ? 504  ASN A ND2 1 
ATOM   4036 N  N   . THR A 1  505 ? 24.386 31.873  9.216   1.00 28.15 ? 505  THR A N   1 
ATOM   4037 C  CA  . THR A 1  505 ? 23.733 33.203  9.278   1.00 30.24 ? 505  THR A CA  1 
ATOM   4038 C  C   . THR A 1  505 ? 22.911 33.577  8.036   1.00 32.33 ? 505  THR A C   1 
ATOM   4039 O  O   . THR A 1  505 ? 22.025 34.443  8.126   1.00 33.19 ? 505  THR A O   1 
ATOM   4040 C  CB  . THR A 1  505 ? 24.723 34.343  9.579   1.00 29.30 ? 505  THR A CB  1 
ATOM   4041 O  OG1 . THR A 1  505 ? 25.724 34.377  8.567   1.00 29.22 ? 505  THR A OG1 1 
ATOM   4042 C  CG2 . THR A 1  505 ? 25.387 34.151  10.955  1.00 28.87 ? 505  THR A CG2 1 
ATOM   4043 N  N   . GLU A 1  506 ? 23.194 32.953  6.892   1.00 34.00 ? 506  GLU A N   1 
ATOM   4044 C  CA  . GLU A 1  506 ? 22.483 33.320  5.650   1.00 36.47 ? 506  GLU A CA  1 
ATOM   4045 C  C   . GLU A 1  506 ? 21.174 32.562  5.455   1.00 36.60 ? 506  GLU A C   1 
ATOM   4046 O  O   . GLU A 1  506 ? 20.102 33.160  5.533   1.00 37.61 ? 506  GLU A O   1 
ATOM   4047 C  CB  . GLU A 1  506 ? 23.341 33.165  4.389   1.00 37.09 ? 506  GLU A CB  1 
ATOM   4048 C  CG  . GLU A 1  506 ? 24.767 33.669  4.491   1.00 41.08 ? 506  GLU A CG  1 
ATOM   4049 C  CD  . GLU A 1  506 ? 25.757 32.530  4.637   1.00 46.38 ? 506  GLU A CD  1 
ATOM   4050 O  OE1 . GLU A 1  506 ? 25.430 31.524  5.321   1.00 49.01 ? 506  GLU A OE1 1 
ATOM   4051 O  OE2 . GLU A 1  506 ? 26.864 32.641  4.063   1.00 48.26 ? 506  GLU A OE2 1 
ATOM   4052 N  N   . SER A 1  507 ? 21.251 31.260  5.181   1.00 35.99 ? 507  SER A N   1 
ATOM   4053 C  CA  . SER A 1  507 ? 20.034 30.499  4.906   1.00 35.76 ? 507  SER A CA  1 
ATOM   4054 C  C   . SER A 1  507 ? 20.131 29.067  5.371   1.00 34.47 ? 507  SER A C   1 
ATOM   4055 O  O   . SER A 1  507 ? 20.958 28.296  4.881   1.00 34.64 ? 507  SER A O   1 
ATOM   4056 C  CB  . SER A 1  507 ? 19.656 30.554  3.416   1.00 36.17 ? 507  SER A CB  1 
ATOM   4057 O  OG  . SER A 1  507 ? 20.610 29.853  2.628   1.00 39.48 ? 507  SER A OG  1 
ATOM   4058 N  N   . THR A 1  508 ? 19.276 28.759  6.340   1.00 32.75 ? 508  THR A N   1 
ATOM   4059 C  CA  . THR A 1  508 ? 19.053 27.435  6.897   1.00 32.15 ? 508  THR A CA  1 
ATOM   4060 C  C   . THR A 1  508 ? 18.527 26.484  5.826   1.00 29.62 ? 508  THR A C   1 
ATOM   4061 O  O   . THR A 1  508 ? 17.447 26.725  5.287   1.00 29.56 ? 508  THR A O   1 
ATOM   4062 C  CB  . THR A 1  508 ? 17.992 27.575  8.020   1.00 32.30 ? 508  THR A CB  1 
ATOM   4063 O  OG1 . THR A 1  508 ? 18.598 28.200  9.154   1.00 36.64 ? 508  THR A OG1 1 
ATOM   4064 C  CG2 . THR A 1  508 ? 17.481 26.267  8.447   1.00 33.12 ? 508  THR A CG2 1 
ATOM   4065 N  N   . ARG A 1  509 ? 19.271 25.412  5.531   1.00 27.31 ? 509  ARG A N   1 
ATOM   4066 C  CA  A ARG A 1  509 ? 18.889 24.481  4.470   0.50 26.23 ? 509  ARG A CA  1 
ATOM   4067 C  CA  B ARG A 1  509 ? 18.881 24.485  4.467   0.50 26.15 ? 509  ARG A CA  1 
ATOM   4068 C  C   . ARG A 1  509 ? 18.656 23.061  4.974   1.00 25.12 ? 509  ARG A C   1 
ATOM   4069 O  O   . ARG A 1  509 ? 19.353 22.592  5.877   1.00 24.20 ? 509  ARG A O   1 
ATOM   4070 C  CB  A ARG A 1  509 ? 19.950 24.442  3.363   0.50 26.46 ? 509  ARG A CB  1 
ATOM   4071 C  CB  B ARG A 1  509 ? 19.927 24.453  3.339   0.50 26.32 ? 509  ARG A CB  1 
ATOM   4072 C  CG  A ARG A 1  509 ? 20.103 25.740  2.578   0.50 27.75 ? 509  ARG A CG  1 
ATOM   4073 C  CG  B ARG A 1  509 ? 20.018 25.718  2.464   0.50 27.29 ? 509  ARG A CG  1 
ATOM   4074 C  CD  A ARG A 1  509 ? 18.753 26.424  2.420   0.50 30.95 ? 509  ARG A CD  1 
ATOM   4075 C  CD  B ARG A 1  509 ? 18.832 25.837  1.498   0.50 29.56 ? 509  ARG A CD  1 
ATOM   4076 N  NE  A ARG A 1  509 ? 18.591 27.003  1.095   0.50 32.76 ? 509  ARG A NE  1 
ATOM   4077 N  NE  B ARG A 1  509 ? 19.151 26.655  0.321   0.50 31.76 ? 509  ARG A NE  1 
ATOM   4078 C  CZ  A ARG A 1  509 ? 18.099 26.326  0.065   0.50 33.71 ? 509  ARG A CZ  1 
ATOM   4079 C  CZ  B ARG A 1  509 ? 20.223 27.435  0.223   0.50 32.49 ? 509  ARG A CZ  1 
ATOM   4080 N  NH1 A ARG A 1  509 ? 17.713 25.063  0.228   0.50 32.43 ? 509  ARG A NH1 1 
ATOM   4081 N  NH1 B ARG A 1  509 ? 21.074 27.519  1.232   0.50 32.24 ? 509  ARG A NH1 1 
ATOM   4082 N  NH2 A ARG A 1  509 ? 17.987 26.909  -1.116  0.50 34.37 ? 509  ARG A NH2 1 
ATOM   4083 N  NH2 B ARG A 1  509 ? 20.445 28.131  -0.881  0.50 33.30 ? 509  ARG A NH2 1 
ATOM   4084 N  N   . ILE A 1  510 ? 17.681 22.389  4.367   1.00 23.12 ? 510  ILE A N   1 
ATOM   4085 C  CA  . ILE A 1  510 ? 17.509 20.955  4.535   1.00 21.48 ? 510  ILE A CA  1 
ATOM   4086 C  C   . ILE A 1  510 ? 18.338 20.251  3.451   1.00 20.68 ? 510  ILE A C   1 
ATOM   4087 O  O   . ILE A 1  510 ? 18.131 20.458  2.247   1.00 19.64 ? 510  ILE A O   1 
ATOM   4088 C  CB  . ILE A 1  510 ? 16.026 20.523  4.453   1.00 21.35 ? 510  ILE A CB  1 
ATOM   4089 C  CG1 . ILE A 1  510 ? 15.186 21.294  5.483   1.00 21.15 ? 510  ILE A CG1 1 
ATOM   4090 C  CG2 . ILE A 1  510 ? 15.910 19.012  4.685   1.00 21.73 ? 510  ILE A CG2 1 
ATOM   4091 C  CD1 A ILE A 1  510 ? 13.653 21.201  5.272   0.50 20.84 ? 510  ILE A CD1 1 
ATOM   4092 C  CD1 B ILE A 1  510 ? 15.754 21.208  6.901   0.50 22.49 ? 510  ILE A CD1 1 
ATOM   4093 N  N   . MET A 1  511 ? 19.288 19.437  3.902   1.00 19.52 ? 511  MET A N   1 
ATOM   4094 C  CA  A MET A 1  511 ? 20.198 18.704  3.039   0.50 19.24 ? 511  MET A CA  1 
ATOM   4095 C  CA  B MET A 1  511 ? 20.133 18.687  2.987   0.50 19.60 ? 511  MET A CA  1 
ATOM   4096 C  C   . MET A 1  511 ? 20.129 17.209  3.384   1.00 19.17 ? 511  MET A C   1 
ATOM   4097 O  O   . MET A 1  511 ? 19.529 16.833  4.402   1.00 18.02 ? 511  MET A O   1 
ATOM   4098 C  CB  A MET A 1  511 ? 21.622 19.237  3.240   0.50 19.31 ? 511  MET A CB  1 
ATOM   4099 C  CB  B MET A 1  511 ? 21.551 19.280  2.949   0.50 20.04 ? 511  MET A CB  1 
ATOM   4100 C  CG  A MET A 1  511 ? 21.767 20.743  3.027   0.50 19.37 ? 511  MET A CG  1 
ATOM   4101 C  CG  B MET A 1  511 ? 21.607 20.734  2.444   0.50 21.69 ? 511  MET A CG  1 
ATOM   4102 S  SD  A MET A 1  511 ? 21.623 21.152  1.283   0.50 18.77 ? 511  MET A SD  1 
ATOM   4103 S  SD  B MET A 1  511 ? 23.268 21.427  2.432   0.50 24.47 ? 511  MET A SD  1 
ATOM   4104 C  CE  A MET A 1  511 ? 23.254 20.606  0.750   0.50 18.82 ? 511  MET A CE  1 
ATOM   4105 C  CE  B MET A 1  511 ? 22.940 23.175  2.229   0.50 25.63 ? 511  MET A CE  1 
ATOM   4106 N  N   . THR A 1  512 ? 20.754 16.368  2.565   1.00 18.08 ? 512  THR A N   1 
ATOM   4107 C  CA  . THR A 1  512 ? 20.708 14.914  2.764   1.00 17.73 ? 512  THR A CA  1 
ATOM   4108 C  C   . THR A 1  512 ? 22.079 14.257  2.648   1.00 17.99 ? 512  THR A C   1 
ATOM   4109 O  O   . THR A 1  512 ? 22.918 14.670  1.824   1.00 16.50 ? 512  THR A O   1 
ATOM   4110 C  CB  . THR A 1  512 ? 19.789 14.211  1.698   1.00 18.06 ? 512  THR A CB  1 
ATOM   4111 O  OG1 . THR A 1  512 ? 20.218 14.599  0.387   1.00 18.81 ? 512  THR A OG1 1 
ATOM   4112 C  CG2 . THR A 1  512 ? 18.313 14.618  1.872   1.00 18.36 ? 512  THR A CG2 1 
ATOM   4113 N  N   . LYS A 1  513 ? 22.284 13.210  3.454   1.00 17.69 ? 513  LYS A N   1 
ATOM   4114 C  CA  . LYS A 1  513 ? 23.412 12.293  3.278   1.00 18.55 ? 513  LYS A CA  1 
ATOM   4115 C  C   . LYS A 1  513 ? 24.753 13.016  3.384   1.00 18.15 ? 513  LYS A C   1 
ATOM   4116 O  O   . LYS A 1  513 ? 25.594 12.981  2.479   1.00 18.08 ? 513  LYS A O   1 
ATOM   4117 C  CB  . LYS A 1  513 ? 23.251 11.500  1.954   1.00 18.63 ? 513  LYS A CB  1 
ATOM   4118 C  CG  . LYS A 1  513 ? 22.045 10.553  2.000   1.00 20.01 ? 513  LYS A CG  1 
ATOM   4119 C  CD  . LYS A 1  513 ? 21.784 9.901   0.634   1.00 25.72 ? 513  LYS A CD  1 
ATOM   4120 C  CE  . LYS A 1  513 ? 20.594 8.926   0.715   1.00 29.13 ? 513  LYS A CE  1 
ATOM   4121 N  NZ  . LYS A 1  513 ? 20.458 8.136   -0.559  1.00 32.74 ? 513  LYS A NZ  1 
ATOM   4122 N  N   . LEU A 1  514 ? 24.938 13.680  4.518   1.00 18.52 ? 514  LEU A N   1 
ATOM   4123 C  CA  . LEU A 1  514 ? 26.183 14.389  4.815   1.00 18.87 ? 514  LEU A CA  1 
ATOM   4124 C  C   . LEU A 1  514 ? 27.412 13.470  4.668   1.00 19.40 ? 514  LEU A C   1 
ATOM   4125 O  O   . LEU A 1  514 ? 27.435 12.369  5.209   1.00 19.30 ? 514  LEU A O   1 
ATOM   4126 C  CB  . LEU A 1  514 ? 26.112 14.946  6.235   1.00 18.12 ? 514  LEU A CB  1 
ATOM   4127 C  CG  . LEU A 1  514 ? 27.322 15.712  6.781   1.00 17.94 ? 514  LEU A CG  1 
ATOM   4128 C  CD1 . LEU A 1  514 ? 27.541 16.985  5.951   1.00 18.72 ? 514  LEU A CD1 1 
ATOM   4129 C  CD2 . LEU A 1  514 ? 27.091 16.057  8.254   1.00 19.29 ? 514  LEU A CD2 1 
ATOM   4130 N  N   . ARG A 1  515 ? 28.420 13.920  3.925   1.00 20.84 ? 515  ARG A N   1 
ATOM   4131 C  CA  . ARG A 1  515 ? 29.682 13.165  3.777   1.00 22.19 ? 515  ARG A CA  1 
ATOM   4132 C  C   . ARG A 1  515 ? 29.466 11.713  3.374   1.00 22.54 ? 515  ARG A C   1 
ATOM   4133 O  O   . ARG A 1  515 ? 30.192 10.821  3.840   1.00 22.80 ? 515  ARG A O   1 
ATOM   4134 C  CB  . ARG A 1  515 ? 30.496 13.177  5.081   1.00 22.91 ? 515  ARG A CB  1 
ATOM   4135 C  CG  . ARG A 1  515 ? 30.896 14.526  5.601   1.00 23.94 ? 515  ARG A CG  1 
ATOM   4136 C  CD  . ARG A 1  515 ? 32.229 15.019  5.005   1.00 25.93 ? 515  ARG A CD  1 
ATOM   4137 N  NE  . ARG A 1  515 ? 32.782 16.111  5.807   1.00 25.35 ? 515  ARG A NE  1 
ATOM   4138 C  CZ  . ARG A 1  515 ? 32.272 17.344  5.864   1.00 28.24 ? 515  ARG A CZ  1 
ATOM   4139 N  NH1 . ARG A 1  515 ? 32.845 18.278  6.630   1.00 25.78 ? 515  ARG A NH1 1 
ATOM   4140 N  NH2 . ARG A 1  515 ? 31.194 17.662  5.144   1.00 28.18 ? 515  ARG A NH2 1 
ATOM   4141 N  N   . ALA A 1  516 ? 28.461 11.467  2.532   1.00 22.90 ? 516  ALA A N   1 
ATOM   4142 C  CA  . ALA A 1  516 ? 28.086 10.101  2.163   1.00 23.46 ? 516  ALA A CA  1 
ATOM   4143 C  C   . ALA A 1  516 ? 29.298 9.273   1.714   1.00 23.61 ? 516  ALA A C   1 
ATOM   4144 O  O   . ALA A 1  516 ? 29.549 8.209   2.266   1.00 23.73 ? 516  ALA A O   1 
ATOM   4145 C  CB  . ALA A 1  516 ? 27.001 10.103  1.089   1.00 23.56 ? 516  ALA A CB  1 
ATOM   4146 N  N   . GLN A 1  517 ? 30.047 9.776   0.741   1.00 24.58 ? 517  GLN A N   1 
ATOM   4147 C  CA  . GLN A 1  517 ? 31.209 9.054   0.189   1.00 25.54 ? 517  GLN A CA  1 
ATOM   4148 C  C   . GLN A 1  517 ? 32.317 8.846   1.229   1.00 25.02 ? 517  GLN A C   1 
ATOM   4149 O  O   . GLN A 1  517 ? 32.871 7.755   1.358   1.00 24.37 ? 517  GLN A O   1 
ATOM   4150 C  CB  . GLN A 1  517 ? 31.794 9.821   -0.995  1.00 26.58 ? 517  GLN A CB  1 
ATOM   4151 C  CG  . GLN A 1  517 ? 31.313 9.374   -2.381  1.00 29.43 ? 517  GLN A CG  1 
ATOM   4152 C  CD  . GLN A 1  517 ? 32.157 9.959   -3.513  0.50 30.55 ? 517  GLN A CD  1 
ATOM   4153 O  OE1 . GLN A 1  517 ? 32.056 9.527   -4.662  0.50 31.74 ? 517  GLN A OE1 1 
ATOM   4154 N  NE2 . GLN A 1  517 ? 32.997 10.939  -3.189  0.50 31.88 ? 517  GLN A NE2 1 
ATOM   4155 N  N   . GLN A 1  518 ? 32.642 9.914   1.958   1.00 24.39 ? 518  GLN A N   1 
ATOM   4156 C  CA  . GLN A 1  518 ? 33.697 9.854   2.968   1.00 23.78 ? 518  GLN A CA  1 
ATOM   4157 C  C   . GLN A 1  518 ? 33.361 8.849   4.058   1.00 23.84 ? 518  GLN A C   1 
ATOM   4158 O  O   . GLN A 1  518 ? 34.206 8.025   4.440   1.00 23.29 ? 518  GLN A O   1 
ATOM   4159 C  CB  . GLN A 1  518 ? 33.955 11.248  3.562   1.00 24.11 ? 518  GLN A CB  1 
ATOM   4160 C  CG  . GLN A 1  518 ? 34.524 12.237  2.542   1.00 24.12 ? 518  GLN A CG  1 
ATOM   4161 C  CD  . GLN A 1  518 ? 33.464 13.164  1.927   1.00 27.32 ? 518  GLN A CD  1 
ATOM   4162 O  OE1 . GLN A 1  518 ? 33.771 14.297  1.559   1.00 31.11 ? 518  GLN A OE1 1 
ATOM   4163 N  NE2 . GLN A 1  518 ? 32.232 12.697  1.823   1.00 24.15 ? 518  GLN A NE2 1 
ATOM   4164 N  N   . CYS A 1  519 ? 32.126 8.889   4.554   1.00 23.67 ? 519  CYS A N   1 
ATOM   4165 C  CA  . CYS A 1  519 ? 31.744 7.987   5.633   1.00 24.80 ? 519  CYS A CA  1 
ATOM   4166 C  C   . CYS A 1  519 ? 31.619 6.529   5.200   1.00 25.53 ? 519  CYS A C   1 
ATOM   4167 O  O   . CYS A 1  519 ? 31.866 5.635   6.008   1.00 26.16 ? 519  CYS A O   1 
ATOM   4168 C  CB  . CYS A 1  519 ? 30.495 8.488   6.372   1.00 24.88 ? 519  CYS A CB  1 
ATOM   4169 S  SG  . CYS A 1  519 ? 30.825 10.058  7.202   1.00 26.17 ? 519  CYS A SG  1 
ATOM   4170 N  N   . ARG A 1  520 ? 31.270 6.279   3.935   1.00 26.31 ? 520  ARG A N   1 
ATOM   4171 C  CA  . ARG A 1  520 ? 31.340 4.917   3.401   1.00 26.87 ? 520  ARG A CA  1 
ATOM   4172 C  C   . ARG A 1  520 ? 32.765 4.377   3.561   1.00 26.36 ? 520  ARG A C   1 
ATOM   4173 O  O   . ARG A 1  520 ? 32.958 3.239   3.985   1.00 26.05 ? 520  ARG A O   1 
ATOM   4174 C  CB  . ARG A 1  520 ? 30.876 4.856   1.938   1.00 27.47 ? 520  ARG A CB  1 
ATOM   4175 C  CG  . ARG A 1  520 ? 29.351 4.771   1.795   1.00 30.63 ? 520  ARG A CG  1 
ATOM   4176 C  CD  . ARG A 1  520 ? 28.861 4.517   0.330   1.00 34.13 ? 520  ARG A CD  1 
ATOM   4177 N  NE  . ARG A 1  520 ? 28.198 5.704   -0.230  1.00 37.27 ? 520  ARG A NE  1 
ATOM   4178 C  CZ  . ARG A 1  520 ? 28.688 6.472   -1.204  1.00 38.76 ? 520  ARG A CZ  1 
ATOM   4179 N  NH1 . ARG A 1  520 ? 28.001 7.520   -1.616  1.00 39.11 ? 520  ARG A NH1 1 
ATOM   4180 N  NH2 . ARG A 1  520 ? 29.857 6.197   -1.783  1.00 41.66 ? 520  ARG A NH2 1 
ATOM   4181 N  N   . PHE A 1  521 ? 33.755 5.213   3.267   1.00 25.91 ? 521  PHE A N   1 
ATOM   4182 C  CA  . PHE A 1  521 ? 35.152 4.838   3.482   1.00 26.49 ? 521  PHE A CA  1 
ATOM   4183 C  C   . PHE A 1  521 ? 35.497 4.510   4.957   1.00 27.12 ? 521  PHE A C   1 
ATOM   4184 O  O   . PHE A 1  521 ? 36.036 3.433   5.248   1.00 27.83 ? 521  PHE A O   1 
ATOM   4185 C  CB  . PHE A 1  521 ? 36.117 5.900   2.911   1.00 25.52 ? 521  PHE A CB  1 
ATOM   4186 C  CG  . PHE A 1  521 ? 37.560 5.668   3.303   1.00 25.98 ? 521  PHE A CG  1 
ATOM   4187 C  CD1 . PHE A 1  521 ? 38.332 4.696   2.645   1.00 22.60 ? 521  PHE A CD1 1 
ATOM   4188 C  CD2 . PHE A 1  521 ? 38.134 6.386   4.349   1.00 24.92 ? 521  PHE A CD2 1 
ATOM   4189 C  CE1 . PHE A 1  521 ? 39.655 4.459   3.028   1.00 23.80 ? 521  PHE A CE1 1 
ATOM   4190 C  CE2 . PHE A 1  521 ? 39.472 6.163   4.733   1.00 24.87 ? 521  PHE A CE2 1 
ATOM   4191 C  CZ  . PHE A 1  521 ? 40.230 5.204   4.075   1.00 23.99 ? 521  PHE A CZ  1 
ATOM   4192 N  N   . TRP A 1  522 ? 35.216 5.433   5.875   1.00 27.87 ? 522  TRP A N   1 
ATOM   4193 C  CA  . TRP A 1  522 ? 35.542 5.228   7.297   1.00 29.64 ? 522  TRP A CA  1 
ATOM   4194 C  C   . TRP A 1  522 ? 34.715 4.126   7.944   1.00 32.15 ? 522  TRP A C   1 
ATOM   4195 O  O   . TRP A 1  522 ? 35.225 3.326   8.726   1.00 32.14 ? 522  TRP A O   1 
ATOM   4196 C  CB  . TRP A 1  522 ? 35.354 6.524   8.104   1.00 28.29 ? 522  TRP A CB  1 
ATOM   4197 C  CG  . TRP A 1  522 ? 36.317 7.581   7.705   1.00 25.28 ? 522  TRP A CG  1 
ATOM   4198 C  CD1 . TRP A 1  522 ? 36.031 8.736   7.038   1.00 23.67 ? 522  TRP A CD1 1 
ATOM   4199 C  CD2 . TRP A 1  522 ? 37.743 7.555   7.885   1.00 22.37 ? 522  TRP A CD2 1 
ATOM   4200 N  NE1 . TRP A 1  522 ? 37.194 9.453   6.804   1.00 21.85 ? 522  TRP A NE1 1 
ATOM   4201 C  CE2 . TRP A 1  522 ? 38.257 8.744   7.316   1.00 22.43 ? 522  TRP A CE2 1 
ATOM   4202 C  CE3 . TRP A 1  522 ? 38.639 6.636   8.470   1.00 21.23 ? 522  TRP A CE3 1 
ATOM   4203 C  CZ2 . TRP A 1  522 ? 39.625 9.046   7.327   1.00 20.83 ? 522  TRP A CZ2 1 
ATOM   4204 C  CZ3 . TRP A 1  522 ? 40.003 6.944   8.491   1.00 19.25 ? 522  TRP A CZ3 1 
ATOM   4205 C  CH2 . TRP A 1  522 ? 40.479 8.135   7.920   1.00 18.81 ? 522  TRP A CH2 1 
ATOM   4206 N  N   . THR A 1  523 ? 33.429 4.106   7.612   1.00 34.81 ? 523  THR A N   1 
ATOM   4207 C  CA  . THR A 1  523 ? 32.468 3.306   8.343   1.00 37.90 ? 523  THR A CA  1 
ATOM   4208 C  C   . THR A 1  523 ? 32.467 1.873   7.855   1.00 39.58 ? 523  THR A C   1 
ATOM   4209 O  O   . THR A 1  523 ? 32.518 0.945   8.664   1.00 40.53 ? 523  THR A O   1 
ATOM   4210 C  CB  . THR A 1  523 ? 31.064 3.964   8.287   1.00 37.77 ? 523  THR A CB  1 
ATOM   4211 O  OG1 . THR A 1  523 ? 31.113 5.214   9.005   1.00 38.84 ? 523  THR A OG1 1 
ATOM   4212 C  CG2 . THR A 1  523 ? 29.999 3.072   8.894   1.00 38.48 ? 523  THR A CG2 1 
ATOM   4213 N  N   . SER A 1  524 ? 32.437 1.690   6.541   1.00 41.81 ? 524  SER A N   1 
ATOM   4214 C  CA  . SER A 1  524 ? 32.329 0.351   5.966   1.00 43.73 ? 524  SER A CA  1 
ATOM   4215 C  C   . SER A 1  524 ? 33.686 -0.295  5.802   1.00 44.55 ? 524  SER A C   1 
ATOM   4216 O  O   . SER A 1  524 ? 33.853 -1.474  6.124   1.00 45.29 ? 524  SER A O   1 
ATOM   4217 C  CB  . SER A 1  524 ? 31.616 0.368   4.607   1.00 43.83 ? 524  SER A CB  1 
ATOM   4218 O  OG  . SER A 1  524 ? 30.284 0.833   4.731   1.00 45.74 ? 524  SER A OG  1 
ATOM   4219 N  N   . PHE A 1  525 ? 34.650 0.458   5.281   1.00 45.08 ? 525  PHE A N   1 
ATOM   4220 C  CA  . PHE A 1  525 ? 35.940 -0.137  4.975   1.00 45.51 ? 525  PHE A CA  1 
ATOM   4221 C  C   . PHE A 1  525 ? 36.984 -0.063  6.108   1.00 45.68 ? 525  PHE A C   1 
ATOM   4222 O  O   . PHE A 1  525 ? 37.513 -1.098  6.520   1.00 46.17 ? 525  PHE A O   1 
ATOM   4223 C  CB  . PHE A 1  525 ? 36.537 0.413   3.680   1.00 45.36 ? 525  PHE A CB  1 
ATOM   4224 C  CG  . PHE A 1  525 ? 38.008 0.173   3.582   1.00 46.77 ? 525  PHE A CG  1 
ATOM   4225 C  CD1 . PHE A 1  525 ? 38.500 -1.122  3.387   1.00 48.76 ? 525  PHE A CD1 1 
ATOM   4226 C  CD2 . PHE A 1  525 ? 38.903 1.214   3.748   1.00 47.06 ? 525  PHE A CD2 1 
ATOM   4227 C  CE1 . PHE A 1  525 ? 39.867 -1.366  3.333   1.00 48.64 ? 525  PHE A CE1 1 
ATOM   4228 C  CE2 . PHE A 1  525 ? 40.268 0.988   3.687   1.00 48.49 ? 525  PHE A CE2 1 
ATOM   4229 C  CZ  . PHE A 1  525 ? 40.753 -0.306  3.480   1.00 48.75 ? 525  PHE A CZ  1 
ATOM   4230 N  N   . PHE A 1  526 ? 37.280 1.148   6.593   1.00 45.52 ? 526  PHE A N   1 
ATOM   4231 C  CA  . PHE A 1  526 ? 38.433 1.386   7.487   1.00 45.30 ? 526  PHE A CA  1 
ATOM   4232 C  C   . PHE A 1  526 ? 38.471 0.610   8.832   1.00 46.46 ? 526  PHE A C   1 
ATOM   4233 O  O   . PHE A 1  526 ? 39.564 0.341   9.331   1.00 46.45 ? 526  PHE A O   1 
ATOM   4234 C  CB  . PHE A 1  526 ? 38.665 2.899   7.703   1.00 44.17 ? 526  PHE A CB  1 
ATOM   4235 C  CG  . PHE A 1  526 ? 40.022 3.244   8.293   1.00 40.32 ? 526  PHE A CG  1 
ATOM   4236 C  CD1 . PHE A 1  526 ? 41.138 3.407   7.471   1.00 36.67 ? 526  PHE A CD1 1 
ATOM   4237 C  CD2 . PHE A 1  526 ? 40.177 3.421   9.667   1.00 36.21 ? 526  PHE A CD2 1 
ATOM   4238 C  CE1 . PHE A 1  526 ? 42.392 3.721   8.013   1.00 35.03 ? 526  PHE A CE1 1 
ATOM   4239 C  CE2 . PHE A 1  526 ? 41.427 3.746   10.214  1.00 35.58 ? 526  PHE A CE2 1 
ATOM   4240 C  CZ  . PHE A 1  526 ? 42.533 3.897   9.381   1.00 33.30 ? 526  PHE A CZ  1 
ATOM   4241 N  N   . PRO A 1  527 ? 37.302 0.231   9.416   1.00 47.59 ? 527  PRO A N   1 
ATOM   4242 C  CA  . PRO A 1  527 ? 37.373 -0.619  10.628  1.00 48.73 ? 527  PRO A CA  1 
ATOM   4243 C  C   . PRO A 1  527 ? 38.122 -1.938  10.409  1.00 49.73 ? 527  PRO A C   1 
ATOM   4244 O  O   . PRO A 1  527 ? 38.637 -2.524  11.361  1.00 49.96 ? 527  PRO A O   1 
ATOM   4245 C  CB  . PRO A 1  527 ? 35.900 -0.904  10.951  1.00 48.71 ? 527  PRO A CB  1 
ATOM   4246 C  CG  . PRO A 1  527 ? 35.171 0.256   10.384  1.00 48.44 ? 527  PRO A CG  1 
ATOM   4247 C  CD  . PRO A 1  527 ? 35.909 0.608   9.115   1.00 47.65 ? 527  PRO A CD  1 
ATOM   4248 N  N   . LYS A 1  528 ? 38.165 -2.390  9.158   1.00 51.02 ? 528  LYS A N   1 
ATOM   4249 C  CA  . LYS A 1  528 ? 38.932 -3.566  8.763   1.00 52.13 ? 528  LYS A CA  1 
ATOM   4250 C  C   . LYS A 1  528 ? 40.434 -3.268  8.752   1.00 52.72 ? 528  LYS A C   1 
ATOM   4251 O  O   . LYS A 1  528 ? 41.241 -4.134  9.107   1.00 52.82 ? 528  LYS A O   1 
ATOM   4252 C  CB  . LYS A 1  528 ? 38.472 -4.050  7.385   1.00 52.03 ? 528  LYS A CB  1 
ATOM   4253 C  CG  . LYS A 1  528 ? 36.987 -4.363  7.328   1.00 53.17 ? 528  LYS A CG  1 
ATOM   4254 C  CD  . LYS A 1  528 ? 36.445 -4.313  5.908   1.00 54.38 ? 528  LYS A CD  1 
ATOM   4255 C  CE  . LYS A 1  528 ? 34.924 -4.332  5.926   1.00 54.58 ? 528  LYS A CE  1 
ATOM   4256 N  NZ  . LYS A 1  528 ? 34.327 -4.384  4.571   1.00 55.44 ? 528  LYS A NZ  1 
ATOM   4257 N  N   . VAL A 1  529 ? 40.786 -2.044  8.342   1.00 53.35 ? 529  VAL A N   1 
ATOM   4258 C  CA  . VAL A 1  529 ? 42.180 -1.580  8.258   1.00 54.03 ? 529  VAL A CA  1 
ATOM   4259 C  C   . VAL A 1  529 ? 42.530 -0.586  9.370   1.00 54.59 ? 529  VAL A C   1 
ATOM   4260 O  O   . VAL A 1  529 ? 43.477 0.200   9.240   1.00 54.86 ? 529  VAL A O   1 
ATOM   4261 C  CB  . VAL A 1  529 ? 42.502 -0.911  6.890   1.00 53.89 ? 529  VAL A CB  1 
ATOM   4262 C  CG1 . VAL A 1  529 ? 42.483 -1.919  5.782   1.00 54.40 ? 529  VAL A CG1 1 
ATOM   4263 C  CG2 . VAL A 1  529 ? 41.541 0.212   6.597   1.00 53.69 ? 529  VAL A CG2 1 
ATOM   4264 O  OXT . VAL A 1  529 ? 41.886 -0.538  10.427  1.00 55.07 ? 529  VAL A OXT 1 
HETATM 4265 C  C1  . NAG B 2  .   ? 54.257 27.903  8.745   1.00 36.63 ? 1    NAG B C1  1 
HETATM 4266 C  C2  . NAG B 2  .   ? 55.213 27.619  7.589   1.00 39.78 ? 1    NAG B C2  1 
HETATM 4267 C  C3  . NAG B 2  .   ? 55.892 26.270  7.803   1.00 41.24 ? 1    NAG B C3  1 
HETATM 4268 C  C4  . NAG B 2  .   ? 56.459 26.114  9.213   1.00 44.13 ? 1    NAG B C4  1 
HETATM 4269 C  C5  . NAG B 2  .   ? 55.339 26.432  10.210  1.00 43.42 ? 1    NAG B C5  1 
HETATM 4270 C  C6  . NAG B 2  .   ? 55.615 26.185  11.709  1.00 46.59 ? 1    NAG B C6  1 
HETATM 4271 C  C7  . NAG B 2  .   ? 54.271 28.496  5.449   1.00 40.53 ? 1    NAG B C7  1 
HETATM 4272 C  C8  . NAG B 2  .   ? 55.011 29.801  5.535   1.00 40.62 ? 1    NAG B C8  1 
HETATM 4273 N  N2  . NAG B 2  .   ? 54.420 27.562  6.385   1.00 39.60 ? 1    NAG B N2  1 
HETATM 4274 O  O3  . NAG B 2  .   ? 56.908 26.096  6.855   1.00 40.39 ? 1    NAG B O3  1 
HETATM 4275 O  O4  . NAG B 2  .   ? 56.867 24.777  9.351   1.00 49.23 ? 1    NAG B O4  1 
HETATM 4276 O  O5  . NAG B 2  .   ? 54.909 27.766  9.982   1.00 39.43 ? 1    NAG B O5  1 
HETATM 4277 O  O6  . NAG B 2  .   ? 56.906 26.514  12.212  1.00 50.60 ? 1    NAG B O6  1 
HETATM 4278 O  O7  . NAG B 2  .   ? 53.531 28.281  4.491   1.00 42.48 ? 1    NAG B O7  1 
HETATM 4279 C  C1  . NAG B 2  .   ? 58.266 24.661  9.677   1.00 53.62 ? 2    NAG B C1  1 
HETATM 4280 C  C2  . NAG B 2  .   ? 58.482 23.325  10.406  1.00 55.59 ? 2    NAG B C2  1 
HETATM 4281 C  C3  . NAG B 2  .   ? 59.966 23.086  10.694  1.00 56.98 ? 2    NAG B C3  1 
HETATM 4282 C  C4  . NAG B 2  .   ? 60.755 23.210  9.393   1.00 57.12 ? 2    NAG B C4  1 
HETATM 4283 C  C5  . NAG B 2  .   ? 60.490 24.604  8.811   1.00 56.97 ? 2    NAG B C5  1 
HETATM 4284 C  C6  . NAG B 2  .   ? 61.318 24.867  7.562   1.00 57.14 ? 2    NAG B C6  1 
HETATM 4285 C  C7  . NAG B 2  .   ? 56.731 22.328  11.822  1.00 57.40 ? 2    NAG B C7  1 
HETATM 4286 C  C8  . NAG B 2  .   ? 56.012 22.374  13.138  1.00 57.61 ? 2    NAG B C8  1 
HETATM 4287 N  N2  . NAG B 2  .   ? 57.695 23.238  11.630  1.00 57.06 ? 2    NAG B N2  1 
HETATM 4288 O  O3  . NAG B 2  .   ? 60.164 21.814  11.275  1.00 57.51 ? 2    NAG B O3  1 
HETATM 4289 O  O4  . NAG B 2  .   ? 62.134 22.994  9.623   1.00 58.38 ? 2    NAG B O4  1 
HETATM 4290 O  O5  . NAG B 2  .   ? 59.105 24.769  8.529   1.00 55.53 ? 2    NAG B O5  1 
HETATM 4291 O  O6  . NAG B 2  .   ? 62.322 25.780  7.935   1.00 58.39 ? 2    NAG B O6  1 
HETATM 4292 O  O7  . NAG B 2  .   ? 56.412 21.479  10.989  1.00 58.11 ? 2    NAG B O7  1 
HETATM 4293 C  C1  . FUL B 2  .   ? 57.220 27.923  12.097  1.00 52.38 ? 3    FUL B C1  1 
HETATM 4294 C  C2  . FUL B 2  .   ? 58.538 28.337  12.744  1.00 53.08 ? 3    FUL B C2  1 
HETATM 4295 O  O2  . FUL B 2  .   ? 59.522 27.336  12.631  1.00 53.60 ? 3    FUL B O2  1 
HETATM 4296 C  C3  . FUL B 2  .   ? 58.928 29.623  12.014  1.00 53.44 ? 3    FUL B C3  1 
HETATM 4297 O  O3  . FUL B 2  .   ? 60.155 30.118  12.495  1.00 54.00 ? 3    FUL B O3  1 
HETATM 4298 C  C4  . FUL B 2  .   ? 57.811 30.675  12.151  1.00 53.74 ? 3    FUL B C4  1 
HETATM 4299 O  O4  . FUL B 2  .   ? 57.840 31.204  13.464  1.00 54.11 ? 3    FUL B O4  1 
HETATM 4300 C  C5  . FUL B 2  .   ? 56.427 30.067  11.816  1.00 53.33 ? 3    FUL B C5  1 
HETATM 4301 C  C6  . FUL B 2  .   ? 55.226 30.998  12.019  1.00 52.43 ? 3    FUL B C6  1 
HETATM 4302 O  O5  . FUL B 2  .   ? 56.242 28.854  12.535  1.00 53.28 ? 3    FUL B O5  1 
HETATM 4303 C  C1  . NAG C 3  .   ? 5.797  19.081  36.487  1.00 33.99 ? 1    NAG C C1  1 
HETATM 4304 C  C2  . NAG C 3  .   ? 4.783  18.836  37.624  1.00 37.00 ? 1    NAG C C2  1 
HETATM 4305 C  C3  . NAG C 3  .   ? 4.570  17.332  37.810  1.00 37.68 ? 1    NAG C C3  1 
HETATM 4306 C  C4  . NAG C 3  .   ? 4.207  16.666  36.476  1.00 37.21 ? 1    NAG C C4  1 
HETATM 4307 C  C5  . NAG C 3  .   ? 5.217  17.102  35.383  1.00 36.12 ? 1    NAG C C5  1 
HETATM 4308 C  C6  . NAG C 3  .   ? 4.953  16.583  33.970  1.00 34.03 ? 1    NAG C C6  1 
HETATM 4309 C  C7  . NAG C 3  .   ? 4.613  20.549  39.420  1.00 39.52 ? 1    NAG C C7  1 
HETATM 4310 C  C8  . NAG C 3  .   ? 3.544  21.283  38.658  1.00 39.62 ? 1    NAG C C8  1 
HETATM 4311 N  N2  . NAG C 3  .   ? 5.156  19.437  38.900  1.00 38.31 ? 1    NAG C N2  1 
HETATM 4312 O  O3  . NAG C 3  .   ? 3.608  17.068  38.817  1.00 38.18 ? 1    NAG C O3  1 
HETATM 4313 O  O4  . NAG C 3  .   ? 4.217  15.271  36.704  1.00 38.96 ? 1    NAG C O4  1 
HETATM 4314 O  O5  . NAG C 3  .   ? 5.271  18.519  35.303  1.00 34.81 ? 1    NAG C O5  1 
HETATM 4315 O  O6  . NAG C 3  .   ? 6.070  16.891  33.152  1.00 34.92 ? 1    NAG C O6  1 
HETATM 4316 O  O7  . NAG C 3  .   ? 4.970  20.995  40.512  1.00 41.07 ? 1    NAG C O7  1 
HETATM 4317 C  C1  . FUC C 3  .   ? 5.766  16.728  31.740  0.50 31.23 ? 2    FUC C C1  1 
HETATM 4318 C  C2  . FUC C 3  .   ? 6.805  17.388  30.821  0.50 29.79 ? 2    FUC C C2  1 
HETATM 4319 C  C3  . FUC C 3  .   ? 8.092  16.575  30.670  0.50 29.56 ? 2    FUC C C3  1 
HETATM 4320 C  C4  . FUC C 3  .   ? 7.807  15.097  30.470  0.50 30.24 ? 2    FUC C C4  1 
HETATM 4321 C  C5  . FUC C 3  .   ? 6.765  14.602  31.462  0.50 30.32 ? 2    FUC C C5  1 
HETATM 4322 C  C6  . FUC C 3  .   ? 6.421  13.145  31.187  0.50 29.82 ? 2    FUC C C6  1 
HETATM 4323 O  O2  . FUC C 3  .   ? 7.136  18.685  31.266  0.50 27.04 ? 2    FUC C O2  1 
HETATM 4324 O  O3  . FUC C 3  .   ? 8.853  17.069  29.576  0.50 28.31 ? 2    FUC C O3  1 
HETATM 4325 O  O4  . FUC C 3  .   ? 7.349  14.881  29.153  0.50 29.72 ? 2    FUC C O4  1 
HETATM 4326 O  O5  . FUC C 3  .   ? 5.590  15.382  31.351  0.50 31.47 ? 2    FUC C O5  1 
HETATM 4327 C  C1  . NAG D 4  .   ? 52.155 -1.517  26.614  1.00 52.60 ? 1    NAG D C1  1 
HETATM 4328 C  C2  . NAG D 4  .   ? 52.175 -1.205  25.119  1.00 56.62 ? 1    NAG D C2  1 
HETATM 4329 C  C3  . NAG D 4  .   ? 53.528 -1.539  24.493  1.00 57.03 ? 1    NAG D C3  1 
HETATM 4330 C  C4  . NAG D 4  .   ? 54.693 -0.971  25.310  1.00 57.96 ? 1    NAG D C4  1 
HETATM 4331 C  C5  . NAG D 4  .   ? 54.502 -1.286  26.802  1.00 56.32 ? 1    NAG D C5  1 
HETATM 4332 C  C6  . NAG D 4  .   ? 55.603 -0.674  27.663  1.00 56.03 ? 1    NAG D C6  1 
HETATM 4333 C  C7  . NAG D 4  .   ? 50.177 -1.467  23.682  1.00 59.05 ? 1    NAG D C7  1 
HETATM 4334 C  C8  . NAG D 4  .   ? 50.222 -0.011  23.299  1.00 59.31 ? 1    NAG D C8  1 
HETATM 4335 N  N2  . NAG D 4  .   ? 51.100 -1.961  24.506  1.00 57.82 ? 1    NAG D N2  1 
HETATM 4336 O  O3  . NAG D 4  .   ? 53.567 -0.997  23.194  1.00 57.53 ? 1    NAG D O3  1 
HETATM 4337 O  O4  . NAG D 4  .   ? 55.919 -1.531  24.864  1.00 60.86 ? 1    NAG D O4  1 
HETATM 4338 O  O5  . NAG D 4  .   ? 53.225 -0.859  27.275  1.00 54.63 ? 1    NAG D O5  1 
HETATM 4339 O  O6  . NAG D 4  .   ? 55.505 0.729   27.574  1.00 55.97 ? 1    NAG D O6  1 
HETATM 4340 O  O7  . NAG D 4  .   ? 49.295 -2.198  23.232  1.00 60.82 ? 1    NAG D O7  1 
HETATM 4341 C  C1  . NAG D 4  .   ? 56.699 -0.630  24.043  1.00 63.15 ? 2    NAG D C1  1 
HETATM 4342 C  C2  . NAG D 4  .   ? 58.188 -0.974  24.211  1.00 64.23 ? 2    NAG D C2  1 
HETATM 4343 C  C3  . NAG D 4  .   ? 59.066 -0.243  23.192  1.00 64.66 ? 2    NAG D C3  1 
HETATM 4344 C  C4  . NAG D 4  .   ? 58.526 -0.452  21.781  1.00 65.15 ? 2    NAG D C4  1 
HETATM 4345 C  C5  . NAG D 4  .   ? 57.064 0.007   21.727  1.00 65.01 ? 2    NAG D C5  1 
HETATM 4346 C  C6  . NAG D 4  .   ? 56.456 -0.212  20.344  1.00 65.44 ? 2    NAG D C6  1 
HETATM 4347 C  C7  . NAG D 4  .   ? 58.912 -1.685  26.442  1.00 65.12 ? 2    NAG D C7  1 
HETATM 4348 C  C8  . NAG D 4  .   ? 59.434 -1.265  27.785  1.00 65.03 ? 2    NAG D C8  1 
HETATM 4349 N  N2  . NAG D 4  .   ? 58.681 -0.709  25.556  1.00 64.75 ? 2    NAG D N2  1 
HETATM 4350 O  O3  . NAG D 4  .   ? 60.392 -0.720  23.255  1.00 64.89 ? 2    NAG D O3  1 
HETATM 4351 O  O4  . NAG D 4  .   ? 59.339 0.242   20.856  1.00 65.25 ? 2    NAG D O4  1 
HETATM 4352 O  O5  . NAG D 4  .   ? 56.294 -0.715  22.680  1.00 64.28 ? 2    NAG D O5  1 
HETATM 4353 O  O6  . NAG D 4  .   ? 56.114 1.030   19.767  1.00 66.72 ? 2    NAG D O6  1 
HETATM 4354 O  O7  . NAG D 4  .   ? 58.715 -2.880  26.212  1.00 64.95 ? 2    NAG D O7  1 
HETATM 4355 C  C1  . FUC D 4  .   ? 56.766 1.353   27.902  1.00 56.55 ? 3    FUC D C1  1 
HETATM 4356 C  C2  . FUC D 4  .   ? 56.866 2.694   27.175  1.00 56.67 ? 3    FUC D C2  1 
HETATM 4357 C  C3  . FUC D 4  .   ? 55.836 3.669   27.753  1.00 56.66 ? 3    FUC D C3  1 
HETATM 4358 C  C4  . FUC D 4  .   ? 55.941 3.766   29.286  1.00 56.77 ? 3    FUC D C4  1 
HETATM 4359 C  C5  . FUC D 4  .   ? 55.993 2.369   29.923  1.00 56.45 ? 3    FUC D C5  1 
HETATM 4360 C  C6  . FUC D 4  .   ? 56.243 2.398   31.428  1.00 56.54 ? 3    FUC D C6  1 
HETATM 4361 O  O2  . FUC D 4  .   ? 56.659 2.515   25.788  1.00 56.72 ? 3    FUC D O2  1 
HETATM 4362 O  O3  . FUC D 4  .   ? 55.979 4.933   27.143  1.00 56.46 ? 3    FUC D O3  1 
HETATM 4363 O  O4  . FUC D 4  .   ? 57.072 4.527   29.660  1.00 57.27 ? 3    FUC D O4  1 
HETATM 4364 O  O5  . FUC D 4  .   ? 56.976 1.558   29.295  1.00 56.11 ? 3    FUC D O5  1 
HETATM 4365 C  C1  . NAG E 5  .   ? 27.998 33.215  53.664  1.00 48.65 ? 1535 NAG A C1  1 
HETATM 4366 C  C2  . NAG E 5  .   ? 28.740 33.287  54.993  1.00 51.21 ? 1535 NAG A C2  1 
HETATM 4367 C  C3  . NAG E 5  .   ? 27.864 34.032  56.000  1.00 52.29 ? 1535 NAG A C3  1 
HETATM 4368 C  C4  . NAG E 5  .   ? 27.539 35.430  55.464  1.00 52.57 ? 1535 NAG A C4  1 
HETATM 4369 C  C5  . NAG E 5  .   ? 27.075 35.428  53.998  1.00 52.44 ? 1535 NAG A C5  1 
HETATM 4370 C  C6  . NAG E 5  .   ? 27.197 36.829  53.402  1.00 52.55 ? 1535 NAG A C6  1 
HETATM 4371 C  C7  . NAG E 5  .   ? 30.404 31.514  55.312  1.00 51.57 ? 1535 NAG A C7  1 
HETATM 4372 C  C8  . NAG E 5  .   ? 31.469 32.416  54.742  1.00 51.51 ? 1535 NAG A C8  1 
HETATM 4373 N  N2  . NAG E 5  .   ? 29.144 31.958  55.417  1.00 51.07 ? 1535 NAG A N2  1 
HETATM 4374 O  O3  . NAG E 5  .   ? 28.517 34.141  57.248  1.00 53.21 ? 1535 NAG A O3  1 
HETATM 4375 O  O4  . NAG E 5  .   ? 26.527 35.999  56.266  1.00 53.72 ? 1535 NAG A O4  1 
HETATM 4376 O  O5  . NAG E 5  .   ? 27.836 34.544  53.184  1.00 51.48 ? 1535 NAG A O5  1 
HETATM 4377 O  O6  . NAG E 5  .   ? 25.911 37.326  53.113  1.00 53.65 ? 1535 NAG A O6  1 
HETATM 4378 O  O7  . NAG E 5  .   ? 30.723 30.384  55.673  1.00 52.72 ? 1535 NAG A O7  1 
HETATM 4379 C  C1  . NAG F 5  .   ? 11.556 36.038  16.375  1.00 43.66 ? 1536 NAG A C1  1 
HETATM 4380 C  C2  . NAG F 5  .   ? 12.857 35.997  17.190  1.00 45.47 ? 1536 NAG A C2  1 
HETATM 4381 C  C3  . NAG F 5  .   ? 13.115 37.211  18.089  1.00 45.50 ? 1536 NAG A C3  1 
HETATM 4382 C  C4  . NAG F 5  .   ? 12.548 38.526  17.539  1.00 47.75 ? 1536 NAG A C4  1 
HETATM 4383 C  C5  . NAG F 5  .   ? 11.106 38.309  17.067  1.00 48.08 ? 1536 NAG A C5  1 
HETATM 4384 C  C6  . NAG F 5  .   ? 10.438 39.594  16.569  1.00 49.56 ? 1536 NAG A C6  1 
HETATM 4385 C  C7  . NAG F 5  .   ? 13.596 33.732  17.841  1.00 45.20 ? 1536 NAG A C7  1 
HETATM 4386 C  C8  . NAG F 5  .   ? 13.340 32.615  18.812  1.00 43.27 ? 1536 NAG A C8  1 
HETATM 4387 N  N2  . NAG F 5  .   ? 12.811 34.799  18.008  1.00 44.38 ? 1536 NAG A N2  1 
HETATM 4388 O  O3  . NAG F 5  .   ? 14.511 37.345  18.226  1.00 46.51 ? 1536 NAG A O3  1 
HETATM 4389 O  O4  . NAG F 5  .   ? 12.622 39.550  18.516  1.00 46.66 ? 1536 NAG A O4  1 
HETATM 4390 O  O5  . NAG F 5  .   ? 11.142 37.348  16.022  1.00 46.96 ? 1536 NAG A O5  1 
HETATM 4391 O  O6  . NAG F 5  .   ? 10.908 39.910  15.271  1.00 51.59 ? 1536 NAG A O6  1 
HETATM 4392 O  O7  . NAG F 5  .   ? 14.477 33.622  16.976  1.00 44.99 ? 1536 NAG A O7  1 
HETATM 4393 C  C1  . NAG G 5  .   ? 46.534 -9.450  47.327  1.00 58.61 ? 1537 NAG A C1  1 
HETATM 4394 C  C2  . NAG G 5  .   ? 45.022 -9.551  47.099  1.00 61.06 ? 1537 NAG A C2  1 
HETATM 4395 C  C3  . NAG G 5  .   ? 44.192 -9.104  48.324  1.00 61.14 ? 1537 NAG A C3  1 
HETATM 4396 C  C4  . NAG G 5  .   ? 44.939 -8.393  49.472  1.00 61.07 ? 1537 NAG A C4  1 
HETATM 4397 C  C5  . NAG G 5  .   ? 46.452 -8.665  49.535  1.00 61.12 ? 1537 NAG A C5  1 
HETATM 4398 C  C6  . NAG G 5  .   ? 46.946 -8.982  50.950  1.00 61.64 ? 1537 NAG A C6  1 
HETATM 4399 C  C7  . NAG G 5  .   ? 43.600 -9.105  45.090  1.00 62.65 ? 1537 NAG A C7  1 
HETATM 4400 C  C8  . NAG G 5  .   ? 43.405 -8.214  43.897  1.00 62.04 ? 1537 NAG A C8  1 
HETATM 4401 N  N2  . NAG G 5  .   ? 44.644 -8.816  45.886  1.00 62.53 ? 1537 NAG A N2  1 
HETATM 4402 O  O3  . NAG G 5  .   ? 43.542 -10.235 48.867  1.00 61.13 ? 1537 NAG A O3  1 
HETATM 4403 O  O4  . NAG G 5  .   ? 44.696 -7.003  49.402  1.00 60.76 ? 1537 NAG A O4  1 
HETATM 4404 O  O5  . NAG G 5  .   ? 46.798 -9.744  48.684  1.00 60.25 ? 1537 NAG A O5  1 
HETATM 4405 O  O6  . NAG G 5  .   ? 46.520 -8.010  51.883  1.00 62.00 ? 1537 NAG A O6  1 
HETATM 4406 O  O7  . NAG G 5  .   ? 42.814 -10.035 45.290  1.00 62.84 ? 1537 NAG A O7  1 
HETATM 4407 CL CL  . CL  H 6  .   ? 54.308 8.767   -2.863  1.00 52.26 ? 1541 CL  A CL  1 
HETATM 4408 NA NA  . NA  I 7  .   ? 40.522 0.709   0.087   0.50 47.94 ? 1542 NA  A NA  1 
HETATM 4409 S  S   . SO4 J 8  .   ? 9.487  9.392   19.198  0.80 33.03 ? 1543 SO4 A S   1 
HETATM 4410 O  O1  . SO4 J 8  .   ? 8.626  9.757   20.314  0.80 32.67 ? 1543 SO4 A O1  1 
HETATM 4411 O  O2  . SO4 J 8  .   ? 10.909 9.541   19.550  0.80 27.58 ? 1543 SO4 A O2  1 
HETATM 4412 O  O3  . SO4 J 8  .   ? 9.158  10.220  18.040  0.80 32.46 ? 1543 SO4 A O3  1 
HETATM 4413 O  O4  . SO4 J 8  .   ? 9.219  8.009   18.811  0.80 31.46 ? 1543 SO4 A O4  1 
HETATM 4414 C  C12 . EFS K 9  .   ? 39.078 13.614  21.820  1.00 24.86 ? 1544 EFS A C12 1 
HETATM 4415 C  C11 . EFS K 9  .   ? 37.677 14.149  22.018  1.00 25.43 ? 1544 EFS A C11 1 
HETATM 4416 O  O2  . EFS K 9  .   ? 37.739 15.548  21.914  1.00 25.48 ? 1544 EFS A O2  1 
HETATM 4417 P  P   . EFS K 9  .   ? 36.795 16.608  22.670  1.00 22.22 ? 1544 EFS A P   1 
HETATM 4418 O  O4  . EFS K 9  .   ? 37.365 17.917  22.250  1.00 24.05 ? 1544 EFS A O4  1 
HETATM 4419 O  O1  . EFS K 9  .   ? 36.495 16.303  24.107  1.00 21.32 ? 1544 EFS A O1  1 
HETATM 4420 F  F   . F   L 10 .   ? 16.928 29.188  12.633  1.00 46.54 ? 1546 F   A F   1 
HETATM 4421 O  O   . HOH M 11 .   ? 15.808 37.797  47.514  1.00 58.74 ? 2001 HOH A O   1 
HETATM 4422 O  O   . HOH M 11 .   ? 20.737 14.973  47.669  1.00 37.03 ? 2002 HOH A O   1 
HETATM 4423 O  O   . HOH M 11 .   ? 34.331 24.926  47.597  1.00 42.02 ? 2003 HOH A O   1 
HETATM 4424 O  O   . HOH M 11 .   ? 37.124 15.350  52.705  1.00 38.06 ? 2004 HOH A O   1 
HETATM 4425 O  O   . HOH M 11 .   ? 46.417 19.120  27.905  1.00 38.72 ? 2005 HOH A O   1 
HETATM 4426 O  O   . HOH M 11 .   ? 23.238 41.825  40.952  1.00 52.79 ? 2006 HOH A O   1 
HETATM 4427 O  O   . HOH M 11 .   ? 25.396 38.830  35.209  1.00 38.91 ? 2007 HOH A O   1 
HETATM 4428 O  O   . HOH M 11 .   ? 25.304 40.728  38.175  1.00 33.78 ? 2008 HOH A O   1 
HETATM 4429 O  O   . HOH M 11 .   ? 22.864 41.465  30.529  1.00 40.52 ? 2009 HOH A O   1 
HETATM 4430 O  O   . HOH M 11 .   ? 20.804 44.229  32.230  1.00 38.36 ? 2010 HOH A O   1 
HETATM 4431 O  O   . HOH M 11 .   ? 15.027 42.623  37.123  1.00 60.84 ? 2011 HOH A O   1 
HETATM 4432 O  O   . HOH M 11 .   ? 30.561 27.595  46.135  1.00 38.36 ? 2012 HOH A O   1 
HETATM 4433 O  O   . HOH M 11 .   ? 32.276 26.141  46.177  1.00 34.76 ? 2013 HOH A O   1 
HETATM 4434 O  O   . HOH M 11 .   ? 41.145 22.280  24.091  1.00 48.46 ? 2014 HOH A O   1 
HETATM 4435 O  O   . HOH M 11 .   ? 50.531 18.893  22.575  1.00 46.05 ? 2015 HOH A O   1 
HETATM 4436 O  O   . HOH M 11 .   ? 25.504 12.644  47.195  1.00 42.39 ? 2016 HOH A O   1 
HETATM 4437 O  O   . HOH M 11 .   ? 32.159 17.663  46.990  1.00 23.70 ? 2017 HOH A O   1 
HETATM 4438 O  O   . HOH M 11 .   ? 33.424 10.248  46.948  1.00 23.56 ? 2018 HOH A O   1 
HETATM 4439 O  O   . HOH M 11 .   ? 34.641 15.520  53.588  1.00 54.60 ? 2019 HOH A O   1 
HETATM 4440 O  O   . HOH M 11 .   ? 44.230 20.311  26.880  1.00 47.18 ? 2020 HOH A O   1 
HETATM 4441 O  O   . HOH M 11 .   ? 40.626 32.820  33.574  1.00 48.26 ? 2021 HOH A O   1 
HETATM 4442 O  O   . HOH M 11 .   ? 36.577 12.924  51.524  1.00 33.81 ? 2022 HOH A O   1 
HETATM 4443 O  O   . HOH M 11 .   ? 46.563 19.209  44.248  1.00 50.93 ? 2023 HOH A O   1 
HETATM 4444 O  O   . HOH M 11 .   ? 47.350 22.687  40.635  1.00 31.02 ? 2024 HOH A O   1 
HETATM 4445 O  O   . HOH M 11 .   ? 48.474 23.718  44.318  1.00 47.54 ? 2025 HOH A O   1 
HETATM 4446 O  O   . HOH M 11 .   ? 40.592 11.928  43.478  1.00 20.39 ? 2026 HOH A O   1 
HETATM 4447 O  O   . HOH M 11 .   ? 38.535 10.690  51.696  1.00 34.71 ? 2027 HOH A O   1 
HETATM 4448 O  O   . HOH M 11 .   ? 41.612 18.625  49.514  1.00 65.90 ? 2028 HOH A O   1 
HETATM 4449 O  O   . HOH M 11 .   ? 45.330 7.311   50.590  1.00 38.83 ? 2029 HOH A O   1 
HETATM 4450 O  O   . HOH M 11 .   ? 43.946 11.969  47.600  1.00 23.66 ? 2030 HOH A O   1 
HETATM 4451 O  O   . HOH M 11 .   ? 44.741 9.399   47.458  1.00 30.70 ? 2031 HOH A O   1 
HETATM 4452 O  O   . HOH M 11 .   ? 41.916 8.622   53.767  1.00 37.13 ? 2032 HOH A O   1 
HETATM 4453 O  O   . HOH M 11 .   ? 40.123 2.831   47.498  1.00 55.52 ? 2033 HOH A O   1 
HETATM 4454 O  O   . HOH M 11 .   ? 35.363 8.418   45.706  1.00 21.83 ? 2034 HOH A O   1 
HETATM 4455 O  O   . HOH M 11 .   ? 48.000 12.833  47.944  1.00 32.21 ? 2035 HOH A O   1 
HETATM 4456 O  O   . HOH M 11 .   ? 29.386 0.343   44.005  1.00 41.52 ? 2036 HOH A O   1 
HETATM 4457 O  O   . HOH M 11 .   ? 26.419 3.097   41.299  1.00 35.05 ? 2037 HOH A O   1 
HETATM 4458 O  O   . HOH M 11 .   ? 28.835 5.938   42.495  1.00 45.43 ? 2038 HOH A O   1 
HETATM 4459 O  O   . HOH M 11 .   ? 32.099 2.461   45.951  1.00 45.94 ? 2039 HOH A O   1 
HETATM 4460 O  O   . HOH M 11 .   ? 28.418 6.054   49.796  1.00 52.90 ? 2040 HOH A O   1 
HETATM 4461 O  O   . HOH M 11 .   ? 24.894 9.040   46.928  1.00 53.32 ? 2041 HOH A O   1 
HETATM 4462 O  O   . HOH M 11 .   ? 22.891 12.477  54.411  1.00 67.49 ? 2042 HOH A O   1 
HETATM 4463 O  O   . HOH M 11 .   ? 36.966 34.433  28.271  1.00 47.62 ? 2043 HOH A O   1 
HETATM 4464 O  O   . HOH M 11 .   ? 27.589 16.712  54.013  1.00 52.81 ? 2044 HOH A O   1 
HETATM 4465 O  O   . HOH M 11 .   ? 21.123 15.908  60.042  1.00 74.66 ? 2045 HOH A O   1 
HETATM 4466 O  O   . HOH M 11 .   ? 27.356 24.446  57.595  1.00 41.76 ? 2046 HOH A O   1 
HETATM 4467 O  O   . HOH M 11 .   ? 26.893 20.973  59.884  1.00 37.17 ? 2047 HOH A O   1 
HETATM 4468 O  O   . HOH M 11 .   ? 21.651 23.272  56.079  1.00 31.61 ? 2048 HOH A O   1 
HETATM 4469 O  O   . HOH M 11 .   ? 31.640 28.776  48.278  1.00 40.81 ? 2049 HOH A O   1 
HETATM 4470 O  O   . HOH M 11 .   ? 29.897 28.148  52.333  1.00 44.04 ? 2050 HOH A O   1 
HETATM 4471 O  O   . HOH M 11 .   ? 36.769 27.993  44.133  1.00 39.03 ? 2051 HOH A O   1 
HETATM 4472 O  O   . HOH M 11 .   ? 33.164 32.300  40.604  1.00 31.57 ? 2052 HOH A O   1 
HETATM 4473 O  O   . HOH M 11 .   ? 33.239 -0.650  41.827  1.00 41.13 ? 2053 HOH A O   1 
HETATM 4474 O  O   . HOH M 11 .   ? 34.784 24.920  38.383  1.00 22.15 ? 2054 HOH A O   1 
HETATM 4475 O  O   . HOH M 11 .   ? 38.832 27.180  43.266  1.00 32.63 ? 2055 HOH A O   1 
HETATM 4476 O  O   . HOH M 11 .   ? 41.205 26.046  46.202  1.00 34.38 ? 2056 HOH A O   1 
HETATM 4477 O  O   . HOH M 11 .   ? 35.872 24.469  45.787  1.00 30.62 ? 2057 HOH A O   1 
HETATM 4478 O  O   . HOH M 11 .   ? 36.741 19.934  36.470  1.00 18.14 ? 2058 HOH A O   1 
HETATM 4479 O  O   . HOH M 11 .   ? 40.860 15.297  40.265  1.00 22.15 ? 2059 HOH A O   1 
HETATM 4480 O  O   . HOH M 11 .   ? 40.666 14.635  37.502  1.00 16.25 ? 2060 HOH A O   1 
HETATM 4481 O  O   . HOH M 11 .   ? 48.134 20.740  35.975  1.00 23.98 ? 2061 HOH A O   1 
HETATM 4482 O  O   . HOH M 11 .   ? 43.255 21.518  31.062  1.00 20.83 ? 2062 HOH A O   1 
HETATM 4483 O  O   . HOH M 11 .   ? 49.289 15.129  29.386  1.00 41.04 ? 2063 HOH A O   1 
HETATM 4484 O  O   . HOH M 11 .   ? 46.657 14.815  29.879  1.00 46.67 ? 2064 HOH A O   1 
HETATM 4485 O  O   . HOH M 11 .   ? 10.816 15.951  43.291  1.00 35.16 ? 2065 HOH A O   1 
HETATM 4486 O  O   . HOH M 11 .   ? 43.138 24.598  24.613  1.00 28.03 ? 2066 HOH A O   1 
HETATM 4487 O  O   . HOH M 11 .   ? 48.956 28.630  27.679  1.00 34.83 ? 2067 HOH A O   1 
HETATM 4488 O  O   . HOH M 11 .   ? 50.544 21.576  26.825  1.00 34.89 ? 2068 HOH A O   1 
HETATM 4489 O  O   . HOH M 11 .   ? 50.025 20.501  32.148  1.00 42.64 ? 2069 HOH A O   1 
HETATM 4490 O  O   . HOH M 11 .   ? 49.251 21.107  24.263  1.00 44.07 ? 2070 HOH A O   1 
HETATM 4491 O  O   . HOH M 11 .   ? 52.402 31.806  22.405  1.00 20.76 ? 2071 HOH A O   1 
HETATM 4492 O  O   . HOH M 11 .   ? 41.953 33.667  27.286  1.00 39.27 ? 2072 HOH A O   1 
HETATM 4493 O  O   . HOH M 11 .   ? 45.070 36.093  22.478  1.00 32.07 ? 2073 HOH A O   1 
HETATM 4494 O  O   . HOH M 11 .   ? 35.641 33.203  23.976  1.00 27.90 ? 2074 HOH A O   1 
HETATM 4495 O  O   . HOH M 11 .   ? 48.044 27.292  25.105  1.00 26.58 ? 2075 HOH A O   1 
HETATM 4496 O  O   . HOH M 11 .   ? 46.695 34.825  29.287  1.00 39.59 ? 2076 HOH A O   1 
HETATM 4497 O  O   . HOH M 11 .   ? 49.955 32.667  29.638  1.00 32.20 ? 2077 HOH A O   1 
HETATM 4498 O  O   . HOH M 11 .   ? 44.590 34.104  26.544  1.00 30.41 ? 2078 HOH A O   1 
HETATM 4499 O  O   . HOH M 11 .   ? 40.836 32.546  28.924  1.00 50.43 ? 2079 HOH A O   1 
HETATM 4500 O  O   . HOH M 11 .   ? 43.589 30.461  30.878  1.00 46.21 ? 2080 HOH A O   1 
HETATM 4501 O  O   . HOH M 11 .   ? 35.725 29.839  28.083  1.00 23.27 ? 2081 HOH A O   1 
HETATM 4502 O  O   . HOH M 11 .   ? 39.494 23.179  31.630  1.00 28.86 ? 2082 HOH A O   1 
HETATM 4503 O  O   . HOH M 11 .   ? 38.246 22.656  28.363  1.00 21.04 ? 2083 HOH A O   1 
HETATM 4504 O  O   . HOH M 11 .   ? 45.649 28.966  30.609  1.00 29.19 ? 2084 HOH A O   1 
HETATM 4505 O  O   . HOH M 11 .   ? 39.534 29.678  30.654  1.00 34.96 ? 2085 HOH A O   1 
HETATM 4506 O  O   . HOH M 11 .   ? 42.822 22.433  28.483  1.00 25.54 ? 2086 HOH A O   1 
HETATM 4507 O  O   . HOH M 11 .   ? 40.869 32.359  36.783  1.00 48.98 ? 2087 HOH A O   1 
HETATM 4508 O  O   . HOH M 11 .   ? 37.209 33.107  33.047  1.00 45.39 ? 2088 HOH A O   1 
HETATM 4509 O  O   . HOH M 11 .   ? 35.263 -1.687  23.840  1.00 50.97 ? 2089 HOH A O   1 
HETATM 4510 O  O   . HOH M 11 .   ? 45.759 26.473  42.633  1.00 25.50 ? 2090 HOH A O   1 
HETATM 4511 O  O   . HOH M 11 .   ? 40.652 29.973  41.422  1.00 32.85 ? 2091 HOH A O   1 
HETATM 4512 O  O   . HOH M 11 .   ? 41.885 30.166  45.209  1.00 32.65 ? 2092 HOH A O   1 
HETATM 4513 O  O   . HOH M 11 .   ? 46.426 21.270  42.874  1.00 35.92 ? 2093 HOH A O   1 
HETATM 4514 O  O   . HOH M 11 .   ? 44.130 23.749  45.072  1.00 33.07 ? 2094 HOH A O   1 
HETATM 4515 O  O   . HOH M 11 .   ? 39.457 14.049  42.099  1.00 20.52 ? 2095 HOH A O   1 
HETATM 4516 O  O   . HOH M 11 .   ? 44.051 18.091  45.534  1.00 25.35 ? 2096 HOH A O   1 
HETATM 4517 O  O   . HOH M 11 .   ? 44.958 16.032  46.749  1.00 24.25 ? 2097 HOH A O   1 
HETATM 4518 O  O   . HOH M 11 .   ? 34.805 17.116  46.086  1.00 19.00 ? 2098 HOH A O   1 
HETATM 4519 O  O   . HOH M 11 .   ? 40.036 20.887  49.403  1.00 47.68 ? 2099 HOH A O   1 
HETATM 4520 O  O   . HOH M 11 .   ? 32.599 18.970  49.265  1.00 24.13 ? 2100 HOH A O   1 
HETATM 4521 O  O   . HOH M 11 .   ? 34.592 22.275  50.320  1.00 39.37 ? 2101 HOH A O   1 
HETATM 4522 O  O   . HOH M 11 .   ? 31.482 25.134  40.375  1.00 23.04 ? 2102 HOH A O   1 
HETATM 4523 O  O   . HOH M 11 .   ? 15.047 32.941  40.910  1.00 31.38 ? 2103 HOH A O   1 
HETATM 4524 O  O   . HOH M 11 .   ? 10.076 24.695  44.535  1.00 42.36 ? 2104 HOH A O   1 
HETATM 4525 O  O   . HOH M 11 .   ? 13.420 34.800  42.254  1.00 38.81 ? 2105 HOH A O   1 
HETATM 4526 O  O   . HOH M 11 .   ? 8.718  26.777  42.137  1.00 44.50 ? 2106 HOH A O   1 
HETATM 4527 O  O   . HOH M 11 .   ? 48.302 17.412  21.535  1.00 45.10 ? 2107 HOH A O   1 
HETATM 4528 O  O   . HOH M 11 .   ? 8.938  21.252  32.561  1.00 31.14 ? 2108 HOH A O   1 
HETATM 4529 O  O   . HOH M 11 .   ? 3.431  22.147  34.866  1.00 39.13 ? 2109 HOH A O   1 
HETATM 4530 O  O   . HOH M 11 .   ? 8.244  22.497  29.958  1.00 40.39 ? 2110 HOH A O   1 
HETATM 4531 O  O   . HOH M 11 .   ? 10.456 24.963  31.072  1.00 28.71 ? 2111 HOH A O   1 
HETATM 4532 O  O   . HOH M 11 .   ? 29.675 19.905  32.866  1.00 15.63 ? 2112 HOH A O   1 
HETATM 4533 O  O   . HOH M 11 .   ? 32.727 20.896  25.900  1.00 19.71 ? 2113 HOH A O   1 
HETATM 4534 O  O   . HOH M 11 .   ? 44.982 15.743  32.316  1.00 24.76 ? 2114 HOH A O   1 
HETATM 4535 O  O   . HOH M 11 .   ? 45.808 12.456  30.227  1.00 29.01 ? 2115 HOH A O   1 
HETATM 4536 O  O   . HOH M 11 .   ? 40.396 21.211  27.444  1.00 26.12 ? 2116 HOH A O   1 
HETATM 4537 O  O   . HOH M 11 .   ? 42.284 18.305  25.745  1.00 46.21 ? 2117 HOH A O   1 
HETATM 4538 O  O   . HOH M 11 .   ? 40.950 24.621  19.812  1.00 37.99 ? 2118 HOH A O   1 
HETATM 4539 O  O   . HOH M 11 .   ? 28.560 25.369  33.092  1.00 18.05 ? 2119 HOH A O   1 
HETATM 4540 O  O   . HOH M 11 .   ? 32.300 24.583  38.052  1.00 36.79 ? 2120 HOH A O   1 
HETATM 4541 O  O   . HOH M 11 .   ? 42.041 21.453  20.916  1.00 50.10 ? 2121 HOH A O   1 
HETATM 4542 O  O   . HOH M 11 .   ? 30.392 28.363  33.381  1.00 22.90 ? 2122 HOH A O   1 
HETATM 4543 O  O   . HOH M 11 .   ? 36.743 30.602  30.751  1.00 31.13 ? 2123 HOH A O   1 
HETATM 4544 O  O   . HOH M 11 .   ? 35.850 32.395  26.511  1.00 29.94 ? 2124 HOH A O   1 
HETATM 4545 O  O   . HOH M 11 .   ? 30.693 37.656  32.351  1.00 55.29 ? 2125 HOH A O   1 
HETATM 4546 O  O   . HOH M 11 .   ? 35.758 21.708  28.931  1.00 15.63 ? 2126 HOH A O   1 
HETATM 4547 O  O   . HOH M 11 .   ? 52.150 6.136   -5.363  1.00 40.39 ? 2127 HOH A O   1 
HETATM 4548 O  O   . HOH M 11 .   ? 31.049 33.364  32.765  1.00 36.94 ? 2128 HOH A O   1 
HETATM 4549 O  O   . HOH M 11 .   ? 23.627 30.387  28.873  1.00 18.32 ? 2129 HOH A O   1 
HETATM 4550 O  O   . HOH M 11 .   ? 28.430 38.136  36.267  1.00 53.12 ? 2130 HOH A O   1 
HETATM 4551 O  O   . HOH M 11 .   ? 13.736 35.375  32.470  1.00 28.15 ? 2131 HOH A O   1 
HETATM 4552 O  O   . HOH M 11 .   ? 11.675 40.559  30.917  1.00 50.38 ? 2132 HOH A O   1 
HETATM 4553 O  O   . HOH M 11 .   ? 12.218 35.053  28.800  1.00 51.53 ? 2133 HOH A O   1 
HETATM 4554 O  O   . HOH M 11 .   ? 9.934  30.694  27.219  1.00 43.14 ? 2134 HOH A O   1 
HETATM 4555 O  O   . HOH M 11 .   ? 36.543 15.720  29.324  1.00 16.64 ? 2135 HOH A O   1 
HETATM 4556 O  O   . HOH M 11 .   ? 39.996 9.784   41.847  1.00 15.17 ? 2136 HOH A O   1 
HETATM 4557 O  O   . HOH M 11 .   ? 14.309 3.040   10.137  1.00 51.16 ? 2137 HOH A O   1 
HETATM 4558 O  O   . HOH M 11 .   ? 37.687 3.938   32.718  1.00 17.18 ? 2138 HOH A O   1 
HETATM 4559 O  O   . HOH M 11 .   ? 39.811 -6.945  39.104  1.00 45.89 ? 2139 HOH A O   1 
HETATM 4560 O  O   . HOH M 11 .   ? 34.550 2.054   43.508  1.00 29.33 ? 2140 HOH A O   1 
HETATM 4561 O  O   . HOH M 11 .   ? 35.148 -2.611  36.864  1.00 31.28 ? 2141 HOH A O   1 
HETATM 4562 O  O   . HOH M 11 .   ? 27.445 7.552   40.791  1.00 28.45 ? 2142 HOH A O   1 
HETATM 4563 O  O   . HOH M 11 .   ? 24.906 2.893   35.693  1.00 37.46 ? 2143 HOH A O   1 
HETATM 4564 O  O   . HOH M 11 .   ? 15.114 37.877  26.220  1.00 59.70 ? 2144 HOH A O   1 
HETATM 4565 O  O   . HOH M 11 .   ? 25.084 7.130   40.554  1.00 40.35 ? 2145 HOH A O   1 
HETATM 4566 O  O   . HOH M 11 .   ? 12.315 12.838  41.531  1.00 39.77 ? 2146 HOH A O   1 
HETATM 4567 O  O   . HOH M 11 .   ? 11.753 12.252  37.465  1.00 28.69 ? 2147 HOH A O   1 
HETATM 4568 O  O   . HOH M 11 .   ? 14.316 9.703   39.446  1.00 49.90 ? 2148 HOH A O   1 
HETATM 4569 O  O   . HOH M 11 .   ? 13.378 17.081  42.515  1.00 23.38 ? 2149 HOH A O   1 
HETATM 4570 O  O   . HOH M 11 .   ? 13.546 18.381  45.591  1.00 27.34 ? 2150 HOH A O   1 
HETATM 4571 O  O   . HOH M 11 .   ? 12.171 25.344  47.743  1.00 34.92 ? 2151 HOH A O   1 
HETATM 4572 O  O   . HOH M 11 .   ? 14.887 14.879  0.008   0.50 21.06 ? 2152 HOH A O   1 
HETATM 4573 O  O   . HOH M 11 .   ? 8.748  20.771  40.130  1.00 36.58 ? 2153 HOH A O   1 
HETATM 4574 O  O   . HOH M 11 .   ? 7.766  16.370  38.042  1.00 29.23 ? 2154 HOH A O   1 
HETATM 4575 O  O   . HOH M 11 .   ? 15.216 16.895  1.794   1.00 19.58 ? 2155 HOH A O   1 
HETATM 4576 O  O   . HOH M 11 .   ? 24.990 10.439  -1.432  1.00 42.20 ? 2156 HOH A O   1 
HETATM 4577 O  O   . HOH M 11 .   ? 34.991 3.248   -0.504  1.00 49.88 ? 2157 HOH A O   1 
HETATM 4578 O  O   . HOH M 11 .   ? 13.800 17.567  28.939  1.00 22.60 ? 2158 HOH A O   1 
HETATM 4579 O  O   . HOH M 11 .   ? 37.795 2.374   12.971  1.00 50.55 ? 2159 HOH A O   1 
HETATM 4580 O  O   . HOH M 11 .   ? 32.216 21.177  18.812  1.00 16.97 ? 2160 HOH A O   1 
HETATM 4581 O  O   . HOH M 11 .   ? 17.861 4.122   35.840  1.00 35.22 ? 2161 HOH A O   1 
HETATM 4582 O  O   . HOH M 11 .   ? 12.314 5.448   33.583  1.00 63.44 ? 2162 HOH A O   1 
HETATM 4583 O  O   . HOH M 11 .   ? 13.619 11.444  34.363  1.00 39.37 ? 2163 HOH A O   1 
HETATM 4584 O  O   . HOH M 11 .   ? 18.443 14.394  36.529  1.00 20.03 ? 2164 HOH A O   1 
HETATM 4585 O  O   . HOH M 11 .   ? 12.330 11.567  32.201  1.00 33.16 ? 2165 HOH A O   1 
HETATM 4586 O  O   . HOH M 11 .   ? 34.555 3.608   20.517  1.00 27.09 ? 2166 HOH A O   1 
HETATM 4587 O  O   . HOH M 11 .   ? 32.899 2.121   20.918  1.00 41.55 ? 2167 HOH A O   1 
HETATM 4588 O  O   . HOH M 11 .   ? 34.954 5.478   14.277  1.00 58.91 ? 2168 HOH A O   1 
HETATM 4589 O  O   . HOH M 11 .   ? 41.838 4.651   18.172  1.00 47.96 ? 2169 HOH A O   1 
HETATM 4590 O  O   . HOH M 11 .   ? 37.003 4.154   21.043  1.00 39.05 ? 2170 HOH A O   1 
HETATM 4591 O  O   . HOH M 11 .   ? 36.800 -1.432  27.416  1.00 36.20 ? 2171 HOH A O   1 
HETATM 4592 O  O   . HOH M 11 .   ? 43.178 -3.058  22.169  1.00 44.76 ? 2172 HOH A O   1 
HETATM 4593 O  O   . HOH M 11 .   ? 36.982 -3.991  25.601  1.00 40.30 ? 2173 HOH A O   1 
HETATM 4594 O  O   . HOH M 11 .   ? 40.517 -5.429  24.915  1.00 39.62 ? 2174 HOH A O   1 
HETATM 4595 O  O   . HOH M 11 .   ? 47.736 1.500   25.099  1.00 32.61 ? 2175 HOH A O   1 
HETATM 4596 O  O   . HOH M 11 .   ? 43.471 2.613   32.965  1.00 25.21 ? 2176 HOH A O   1 
HETATM 4597 O  O   . HOH M 11 .   ? 57.975 -1.237  30.641  1.00 45.30 ? 2177 HOH A O   1 
HETATM 4598 O  O   . HOH M 11 .   ? 53.509 -2.349  36.476  1.00 37.69 ? 2178 HOH A O   1 
HETATM 4599 O  O   . HOH M 11 .   ? 57.482 0.228   40.502  1.00 46.71 ? 2179 HOH A O   1 
HETATM 4600 O  O   . HOH M 11 .   ? 45.983 -9.171  42.180  1.00 57.21 ? 2180 HOH A O   1 
HETATM 4601 O  O   . HOH M 11 .   ? 42.874 -5.447  40.342  1.00 75.60 ? 2181 HOH A O   1 
HETATM 4602 O  O   . HOH M 11 .   ? 41.180 3.234   45.446  1.00 34.58 ? 2182 HOH A O   1 
HETATM 4603 O  O   . HOH M 11 .   ? 44.817 4.870   50.813  1.00 42.36 ? 2183 HOH A O   1 
HETATM 4604 O  O   . HOH M 11 .   ? 53.366 4.052   49.311  1.00 58.30 ? 2184 HOH A O   1 
HETATM 4605 O  O   . HOH M 11 .   ? 54.769 16.085  43.018  1.00 48.30 ? 2185 HOH A O   1 
HETATM 4606 O  O   . HOH M 11 .   ? 48.632 21.453  38.558  1.00 33.29 ? 2186 HOH A O   1 
HETATM 4607 O  O   . HOH M 11 .   ? 44.043 12.564  36.482  1.00 22.16 ? 2187 HOH A O   1 
HETATM 4608 O  O   . HOH M 11 .   ? 51.243 13.892  30.938  1.00 33.89 ? 2188 HOH A O   1 
HETATM 4609 O  O   . HOH M 11 .   ? 50.317 10.558  25.158  1.00 41.90 ? 2189 HOH A O   1 
HETATM 4610 O  O   . HOH M 11 .   ? 50.077 1.563   26.861  1.00 37.01 ? 2190 HOH A O   1 
HETATM 4611 O  O   . HOH M 11 .   ? 54.852 8.529   25.054  1.00 46.56 ? 2191 HOH A O   1 
HETATM 4612 O  O   . HOH M 11 .   ? 51.292 10.350  16.862  1.00 37.20 ? 2192 HOH A O   1 
HETATM 4613 O  O   . HOH M 11 .   ? 44.890 8.829   18.939  1.00 51.16 ? 2193 HOH A O   1 
HETATM 4614 O  O   . HOH M 11 .   ? 45.711 17.937  21.359  1.00 47.48 ? 2194 HOH A O   1 
HETATM 4615 O  O   . HOH M 11 .   ? 42.605 8.679   19.934  1.00 34.69 ? 2195 HOH A O   1 
HETATM 4616 O  O   . HOH M 11 .   ? 45.205 11.505  26.656  1.00 32.07 ? 2196 HOH A O   1 
HETATM 4617 O  O   . HOH M 11 .   ? 47.459 11.615  28.323  1.00 36.99 ? 2197 HOH A O   1 
HETATM 4618 O  O   . HOH M 11 .   ? 46.476 7.462   23.219  1.00 41.71 ? 2198 HOH A O   1 
HETATM 4619 O  O   . HOH M 11 .   ? 43.412 3.761   30.302  1.00 31.45 ? 2199 HOH A O   1 
HETATM 4620 O  O   . HOH M 11 .   ? 40.965 4.125   30.949  1.00 23.11 ? 2200 HOH A O   1 
HETATM 4621 O  O   . HOH M 11 .   ? 36.856 -1.059  33.564  1.00 34.29 ? 2201 HOH A O   1 
HETATM 4622 O  O   . HOH M 11 .   ? 33.145 -2.925  38.523  1.00 35.96 ? 2202 HOH A O   1 
HETATM 4623 O  O   . HOH M 11 .   ? 33.266 1.046   37.387  1.00 19.91 ? 2203 HOH A O   1 
HETATM 4624 O  O   . HOH M 11 .   ? 29.126 -7.167  35.895  1.00 32.10 ? 2204 HOH A O   1 
HETATM 4625 O  O   . HOH M 11 .   ? 32.247 -0.601  39.201  1.00 23.01 ? 2205 HOH A O   1 
HETATM 4626 O  O   . HOH M 11 .   ? 25.411 -3.026  35.730  1.00 44.85 ? 2206 HOH A O   1 
HETATM 4627 O  O   . HOH M 11 .   ? 25.480 -0.510  29.757  1.00 26.34 ? 2207 HOH A O   1 
HETATM 4628 O  O   . HOH M 11 .   ? 27.945 -8.377  28.448  1.00 34.09 ? 2208 HOH A O   1 
HETATM 4629 O  O   . HOH M 11 .   ? 33.296 -0.749  21.650  1.00 49.38 ? 2209 HOH A O   1 
HETATM 4630 O  O   . HOH M 11 .   ? 27.392 -0.325  16.570  1.00 28.03 ? 2210 HOH A O   1 
HETATM 4631 O  O   . HOH M 11 .   ? 20.993 0.073   15.886  1.00 25.20 ? 2211 HOH A O   1 
HETATM 4632 O  O   . HOH M 11 .   ? 18.109 -6.624  19.717  1.00 25.82 ? 2212 HOH A O   1 
HETATM 4633 O  O   . HOH M 11 .   ? 15.888 -6.276  23.647  1.00 48.32 ? 2213 HOH A O   1 
HETATM 4634 O  O   . HOH M 11 .   ? 22.306 -0.600  27.287  1.00 26.07 ? 2214 HOH A O   1 
HETATM 4635 O  O   . HOH M 11 .   ? 12.458 9.503   30.554  1.00 27.76 ? 2215 HOH A O   1 
HETATM 4636 O  O   . HOH M 11 .   ? 13.841 3.039   27.044  1.00 27.96 ? 2216 HOH A O   1 
HETATM 4637 O  O   . HOH M 11 .   ? 13.382 -0.521  24.814  1.00 42.85 ? 2217 HOH A O   1 
HETATM 4638 O  O   . HOH M 11 .   ? 11.013 10.729  25.601  1.00 38.10 ? 2218 HOH A O   1 
HETATM 4639 O  O   . HOH M 11 .   ? 8.870  11.160  24.506  1.00 44.97 ? 2219 HOH A O   1 
HETATM 4640 O  O   . HOH M 11 .   ? 27.801 14.653  17.524  1.00 19.11 ? 2220 HOH A O   1 
HETATM 4641 O  O   . HOH M 11 .   ? 33.324 24.959  1.635   1.00 54.39 ? 2221 HOH A O   1 
HETATM 4642 O  O   . HOH M 11 .   ? 37.841 20.651  7.594   1.00 23.02 ? 2222 HOH A O   1 
HETATM 4643 O  O   . HOH M 11 .   ? 35.806 23.107  4.733   1.00 49.35 ? 2223 HOH A O   1 
HETATM 4644 O  O   . HOH M 11 .   ? 38.552 22.157  14.412  1.00 19.85 ? 2224 HOH A O   1 
HETATM 4645 O  O   . HOH M 11 .   ? 36.914 18.559  9.469   1.00 22.57 ? 2225 HOH A O   1 
HETATM 4646 O  O   . HOH M 11 .   ? 43.207 24.463  17.815  1.00 36.56 ? 2226 HOH A O   1 
HETATM 4647 O  O   . HOH M 11 .   ? 51.757 22.676  19.011  1.00 44.36 ? 2227 HOH A O   1 
HETATM 4648 O  O   . HOH M 11 .   ? 51.633 24.555  15.707  1.00 36.98 ? 2228 HOH A O   1 
HETATM 4649 O  O   . HOH M 11 .   ? 42.967 24.599  21.579  1.00 39.24 ? 2229 HOH A O   1 
HETATM 4650 O  O   . HOH M 11 .   ? 51.800 21.227  14.129  1.00 36.87 ? 2230 HOH A O   1 
HETATM 4651 O  O   . HOH M 11 .   ? 51.097 17.687  7.885   1.00 21.46 ? 2231 HOH A O   1 
HETATM 4652 O  O   . HOH M 11 .   ? 53.351 24.940  5.625   1.00 33.09 ? 2232 HOH A O   1 
HETATM 4653 O  O   . HOH M 11 .   ? 53.876 28.199  14.495  1.00 41.46 ? 2233 HOH A O   1 
HETATM 4654 O  O   . HOH M 11 .   ? 50.937 26.930  15.443  1.00 26.00 ? 2234 HOH A O   1 
HETATM 4655 O  O   . HOH M 11 .   ? 47.712 32.978  10.301  1.00 44.65 ? 2235 HOH A O   1 
HETATM 4656 O  O   . HOH M 11 .   ? 52.399 30.928  18.030  1.00 38.00 ? 2236 HOH A O   1 
HETATM 4657 O  O   . HOH M 11 .   ? 50.817 32.796  5.262   1.00 37.97 ? 2237 HOH A O   1 
HETATM 4658 O  O   . HOH M 11 .   ? 51.774 22.179  -1.678  1.00 53.64 ? 2238 HOH A O   1 
HETATM 4659 O  O   . HOH M 11 .   ? 58.082 18.310  2.382   1.00 43.34 ? 2239 HOH A O   1 
HETATM 4660 O  O   . HOH M 11 .   ? 53.014 18.291  -3.332  1.00 43.73 ? 2240 HOH A O   1 
HETATM 4661 O  O   . HOH M 11 .   ? 52.081 8.236   -3.265  1.00 51.17 ? 2241 HOH A O   1 
HETATM 4662 O  O   . HOH M 11 .   ? 55.899 16.500  -1.419  1.00 32.48 ? 2242 HOH A O   1 
HETATM 4663 O  O   . HOH M 11 .   ? 51.694 8.350   5.395   1.00 41.11 ? 2243 HOH A O   1 
HETATM 4664 O  O   . HOH M 11 .   ? 55.308 12.083  10.685  1.00 39.16 ? 2244 HOH A O   1 
HETATM 4665 O  O   . HOH M 11 .   ? 57.931 7.147   9.521   1.00 62.25 ? 2245 HOH A O   1 
HETATM 4666 O  O   . HOH M 11 .   ? 44.742 6.758   15.072  1.00 49.77 ? 2246 HOH A O   1 
HETATM 4667 O  O   . HOH M 11 .   ? 46.262 -1.127  10.769  1.00 40.28 ? 2247 HOH A O   1 
HETATM 4668 O  O   . HOH M 11 .   ? 52.845 -2.069  7.355   1.00 41.19 ? 2248 HOH A O   1 
HETATM 4669 O  O   . HOH M 11 .   ? 50.792 -2.430  4.805   1.00 33.81 ? 2249 HOH A O   1 
HETATM 4670 O  O   . HOH M 11 .   ? 36.971 11.970  0.026   1.00 53.87 ? 2250 HOH A O   1 
HETATM 4671 O  O   . HOH M 11 .   ? 46.975 10.922  -4.630  1.00 45.45 ? 2251 HOH A O   1 
HETATM 4672 O  O   . HOH M 11 .   ? 46.848 13.404  -5.933  1.00 41.68 ? 2252 HOH A O   1 
HETATM 4673 O  O   . HOH M 11 .   ? 42.517 8.994   -7.474  1.00 49.67 ? 2253 HOH A O   1 
HETATM 4674 O  O   . HOH M 11 .   ? 41.241 25.278  -11.052 1.00 21.88 ? 2254 HOH A O   1 
HETATM 4675 O  O   . HOH M 11 .   ? 48.777 24.136  -6.809  1.00 44.28 ? 2255 HOH A O   1 
HETATM 4676 O  O   . HOH M 11 .   ? 47.560 18.843  -11.037 1.00 46.31 ? 2256 HOH A O   1 
HETATM 4677 O  O   . HOH M 11 .   ? 48.212 22.186  1.009   1.00 22.45 ? 2257 HOH A O   1 
HETATM 4678 O  O   . HOH M 11 .   ? 40.932 27.125  -4.892  1.00 61.73 ? 2258 HOH A O   1 
HETATM 4679 O  O   . HOH M 11 .   ? 43.274 28.414  -4.662  1.00 47.24 ? 2259 HOH A O   1 
HETATM 4680 O  O   . HOH M 11 .   ? 41.781 19.873  -5.803  1.00 51.94 ? 2260 HOH A O   1 
HETATM 4681 O  O   . HOH M 11 .   ? 49.458 16.185  -6.229  1.00 37.35 ? 2261 HOH A O   1 
HETATM 4682 O  O   . HOH M 11 .   ? 51.481 16.324  -5.419  1.00 47.23 ? 2262 HOH A O   1 
HETATM 4683 O  O   . HOH M 11 .   ? 42.468 21.972  6.951   1.00 25.19 ? 2263 HOH A O   1 
HETATM 4684 O  O   . HOH M 11 .   ? 45.062 30.010  2.113   1.00 47.07 ? 2264 HOH A O   1 
HETATM 4685 O  O   . HOH M 11 .   ? 39.960 20.847  6.120   1.00 23.76 ? 2265 HOH A O   1 
HETATM 4686 O  O   . HOH M 11 .   ? 37.495 21.267  3.680   1.00 33.22 ? 2266 HOH A O   1 
HETATM 4687 O  O   . HOH M 11 .   ? 35.217 20.723  5.745   1.00 31.83 ? 2267 HOH A O   1 
HETATM 4688 O  O   . HOH M 11 .   ? 35.380 17.130  7.619   1.00 20.09 ? 2268 HOH A O   1 
HETATM 4689 O  O   . HOH M 11 .   ? 35.287 15.582  3.873   1.00 25.05 ? 2269 HOH A O   1 
HETATM 4690 O  O   . HOH M 11 .   ? 35.162 6.844   12.053  1.00 26.04 ? 2270 HOH A O   1 
HETATM 4691 O  O   . HOH M 11 .   ? 41.761 9.060   16.866  1.00 33.79 ? 2271 HOH A O   1 
HETATM 4692 O  O   . HOH M 11 .   ? 42.813 10.640  13.911  1.00 31.36 ? 2272 HOH A O   1 
HETATM 4693 O  O   . HOH M 11 .   ? 31.373 11.619  17.116  1.00 21.03 ? 2273 HOH A O   1 
HETATM 4694 O  O   . HOH M 11 .   ? 29.064 7.342   9.139   1.00 29.43 ? 2274 HOH A O   1 
HETATM 4695 O  O   . HOH M 11 .   ? 31.934 0.974   11.786  1.00 58.84 ? 2275 HOH A O   1 
HETATM 4696 O  O   . HOH M 11 .   ? 31.862 4.681   13.799  1.00 50.31 ? 2276 HOH A O   1 
HETATM 4697 O  O   . HOH M 11 .   ? 29.289 1.515   16.893  1.00 33.54 ? 2277 HOH A O   1 
HETATM 4698 O  O   . HOH M 11 .   ? 25.794 -1.000  9.406   1.00 63.81 ? 2278 HOH A O   1 
HETATM 4699 O  O   . HOH M 11 .   ? 15.296 4.610   18.515  1.00 30.59 ? 2279 HOH A O   1 
HETATM 4700 O  O   . HOH M 11 .   ? 14.677 0.486   11.260  1.00 42.99 ? 2280 HOH A O   1 
HETATM 4701 O  O   . HOH M 11 .   ? 11.830 3.588   19.899  1.00 36.07 ? 2281 HOH A O   1 
HETATM 4702 O  O   . HOH M 11 .   ? 9.995  5.928   22.852  1.00 42.42 ? 2282 HOH A O   1 
HETATM 4703 O  O   . HOH M 11 .   ? 28.641 20.669  16.968  1.00 17.74 ? 2283 HOH A O   1 
HETATM 4704 O  O   . HOH M 11 .   ? 31.072 28.196  6.266   1.00 43.75 ? 2284 HOH A O   1 
HETATM 4705 O  O   . HOH M 11 .   ? 29.612 24.139  4.046   1.00 40.29 ? 2285 HOH A O   1 
HETATM 4706 O  O   . HOH M 11 .   ? 26.008 22.881  3.310   1.00 31.34 ? 2286 HOH A O   1 
HETATM 4707 O  O   . HOH M 11 .   ? 23.663 25.682  4.071   1.00 28.41 ? 2287 HOH A O   1 
HETATM 4708 O  O   . HOH M 11 .   ? 32.022 29.412  15.141  1.00 23.73 ? 2288 HOH A O   1 
HETATM 4709 O  O   . HOH M 11 .   ? 32.196 35.170  10.373  1.00 29.65 ? 2289 HOH A O   1 
HETATM 4710 O  O   . HOH M 11 .   ? 30.851 31.599  8.554   1.00 27.03 ? 2290 HOH A O   1 
HETATM 4711 O  O   . HOH M 11 .   ? 40.273 35.718  10.643  1.00 42.93 ? 2291 HOH A O   1 
HETATM 4712 O  O   . HOH M 11 .   ? 36.213 34.752  11.971  1.00 28.73 ? 2292 HOH A O   1 
HETATM 4713 O  O   . HOH M 11 .   ? 38.398 36.055  13.033  1.00 43.14 ? 2293 HOH A O   1 
HETATM 4714 O  O   . HOH M 11 .   ? 45.998 32.733  15.713  1.00 33.43 ? 2294 HOH A O   1 
HETATM 4715 O  O   . HOH M 11 .   ? 41.831 35.076  13.343  1.00 38.55 ? 2295 HOH A O   1 
HETATM 4716 O  O   . HOH M 11 .   ? 44.349 31.655  7.346   1.00 23.06 ? 2296 HOH A O   1 
HETATM 4717 O  O   . HOH M 11 .   ? 41.346 30.606  4.462   1.00 49.79 ? 2297 HOH A O   1 
HETATM 4718 O  O   . HOH M 11 .   ? 42.073 24.298  5.675   1.00 26.59 ? 2298 HOH A O   1 
HETATM 4719 O  O   . HOH M 11 .   ? 38.522 26.855  5.582   1.00 50.80 ? 2299 HOH A O   1 
HETATM 4720 O  O   . HOH M 11 .   ? 38.726 23.556  19.888  1.00 33.55 ? 2300 HOH A O   1 
HETATM 4721 O  O   . HOH M 11 .   ? 32.263 28.177  21.706  1.00 17.53 ? 2301 HOH A O   1 
HETATM 4722 O  O   . HOH M 11 .   ? 22.998 43.411  27.971  1.00 40.42 ? 2302 HOH A O   1 
HETATM 4723 O  O   . HOH M 11 .   ? 27.152 39.396  30.136  1.00 38.48 ? 2303 HOH A O   1 
HETATM 4724 O  O   . HOH M 11 .   ? 27.321 40.784  20.687  1.00 32.61 ? 2304 HOH A O   1 
HETATM 4725 O  O   . HOH M 11 .   ? 22.413 42.456  25.002  1.00 39.99 ? 2305 HOH A O   1 
HETATM 4726 O  O   . HOH M 11 .   ? 26.812 51.398  30.103  1.00 59.11 ? 2306 HOH A O   1 
HETATM 4727 O  O   . HOH M 11 .   ? 28.676 37.301  25.712  1.00 31.39 ? 2307 HOH A O   1 
HETATM 4728 O  O   . HOH M 11 .   ? 30.003 42.042  26.755  1.00 60.02 ? 2308 HOH A O   1 
HETATM 4729 O  O   . HOH M 11 .   ? 31.848 36.798  25.638  1.00 41.98 ? 2309 HOH A O   1 
HETATM 4730 O  O   . HOH M 11 .   ? 34.685 42.754  21.926  1.00 49.94 ? 2310 HOH A O   1 
HETATM 4731 O  O   . HOH M 11 .   ? 32.260 40.618  15.518  1.00 32.34 ? 2311 HOH A O   1 
HETATM 4732 O  O   . HOH M 11 .   ? 32.619 35.875  23.273  1.00 38.68 ? 2312 HOH A O   1 
HETATM 4733 O  O   . HOH M 11 .   ? 26.973 44.782  16.267  1.00 52.77 ? 2313 HOH A O   1 
HETATM 4734 O  O   . HOH M 11 .   ? 28.283 37.549  11.093  1.00 27.44 ? 2314 HOH A O   1 
HETATM 4735 O  O   . HOH M 11 .   ? 26.580 43.680  13.069  1.00 32.05 ? 2315 HOH A O   1 
HETATM 4736 O  O   . HOH M 11 .   ? 18.790 46.205  17.035  1.00 58.61 ? 2316 HOH A O   1 
HETATM 4737 O  O   . HOH M 11 .   ? 21.455 35.051  11.342  1.00 32.92 ? 2317 HOH A O   1 
HETATM 4738 O  O   . HOH M 11 .   ? 23.967 42.298  18.199  1.00 41.67 ? 2318 HOH A O   1 
HETATM 4739 O  O   . HOH M 11 .   ? 16.799 34.753  15.685  1.00 34.48 ? 2319 HOH A O   1 
HETATM 4740 O  O   . HOH M 11 .   ? 12.880 36.666  23.163  1.00 45.48 ? 2320 HOH A O   1 
HETATM 4741 O  O   . HOH M 11 .   ? 9.775  32.908  23.384  1.00 43.35 ? 2321 HOH A O   1 
HETATM 4742 O  O   . HOH M 11 .   ? 9.537  27.870  23.484  1.00 19.90 ? 2322 HOH A O   1 
HETATM 4743 O  O   . HOH M 11 .   ? 8.072  16.871  26.793  1.00 47.65 ? 2323 HOH A O   1 
HETATM 4744 O  O   . HOH M 11 .   ? 6.167  24.794  28.342  1.00 31.08 ? 2324 HOH A O   1 
HETATM 4745 O  O   . HOH M 11 .   ? 9.870  14.522  18.582  1.00 23.83 ? 2325 HOH A O   1 
HETATM 4746 O  O   . HOH M 11 .   ? 7.491  15.542  18.556  1.00 36.60 ? 2326 HOH A O   1 
HETATM 4747 O  O   . HOH M 11 .   ? 11.453 25.074  12.765  1.00 30.51 ? 2327 HOH A O   1 
HETATM 4748 O  O   . HOH M 11 .   ? 9.986  30.824  18.720  1.00 20.64 ? 2328 HOH A O   1 
HETATM 4749 O  O   . HOH M 11 .   ? 8.534  28.856  11.815  1.00 31.20 ? 2329 HOH A O   1 
HETATM 4750 O  O   . HOH M 11 .   ? 9.129  28.195  18.835  1.00 19.73 ? 2330 HOH A O   1 
HETATM 4751 O  O   . HOH M 11 .   ? 2.873  28.394  15.201  1.00 49.69 ? 2331 HOH A O   1 
HETATM 4752 O  O   . HOH M 11 .   ? 4.403  29.223  17.358  1.00 31.94 ? 2332 HOH A O   1 
HETATM 4753 O  O   . HOH M 11 .   ? 13.154 32.645  9.799   1.00 50.20 ? 2333 HOH A O   1 
HETATM 4754 O  O   . HOH M 11 .   ? 6.460  31.003  11.757  1.00 31.02 ? 2334 HOH A O   1 
HETATM 4755 O  O   . HOH M 11 .   ? 12.533 29.704  6.411   1.00 45.77 ? 2335 HOH A O   1 
HETATM 4756 O  O   . HOH M 11 .   ? 15.111 30.884  12.760  1.00 34.45 ? 2336 HOH A O   1 
HETATM 4757 O  O   . HOH M 11 .   ? 8.781  25.818  11.672  1.00 46.03 ? 2337 HOH A O   1 
HETATM 4758 O  O   . HOH M 11 .   ? 10.752 24.425  6.078   1.00 32.23 ? 2338 HOH A O   1 
HETATM 4759 O  O   . HOH M 11 .   ? 6.950  22.555  7.310   1.00 52.76 ? 2339 HOH A O   1 
HETATM 4760 O  O   . HOH M 11 .   ? 10.046 17.498  11.817  1.00 30.16 ? 2340 HOH A O   1 
HETATM 4761 O  O   . HOH M 11 .   ? 17.558 16.017  10.922  1.00 15.58 ? 2341 HOH A O   1 
HETATM 4762 O  O   . HOH M 11 .   ? 9.985  15.348  9.778   1.00 30.82 ? 2342 HOH A O   1 
HETATM 4763 O  O   . HOH M 11 .   ? 12.156 13.141  7.815   1.00 23.82 ? 2343 HOH A O   1 
HETATM 4764 O  O   . HOH M 11 .   ? 15.577 12.006  7.195   1.00 16.50 ? 2344 HOH A O   1 
HETATM 4765 O  O   . HOH M 11 .   ? 14.207 9.639   13.441  1.00 20.99 ? 2345 HOH A O   1 
HETATM 4766 O  O   . HOH M 11 .   ? 16.114 5.431   10.782  1.00 36.71 ? 2346 HOH A O   1 
HETATM 4767 O  O   . HOH M 11 .   ? 19.571 5.583   1.953   1.00 40.36 ? 2347 HOH A O   1 
HETATM 4768 O  O   . HOH M 11 .   ? 13.891 4.989   7.182   1.00 55.14 ? 2348 HOH A O   1 
HETATM 4769 O  O   . HOH M 11 .   ? 17.804 11.289  0.879   1.00 27.85 ? 2349 HOH A O   1 
HETATM 4770 O  O   . HOH M 11 .   ? 11.152 13.274  1.383   1.00 33.93 ? 2350 HOH A O   1 
HETATM 4771 O  O   . HOH M 11 .   ? 15.036 12.330  0.469   1.00 32.51 ? 2351 HOH A O   1 
HETATM 4772 O  O   . HOH M 11 .   ? 13.220 11.358  5.950   1.00 29.21 ? 2352 HOH A O   1 
HETATM 4773 O  O   . HOH M 11 .   ? 23.895 10.370  6.775   1.00 27.99 ? 2353 HOH A O   1 
HETATM 4774 O  O   . HOH M 11 .   ? 24.971 8.541   3.650   1.00 31.43 ? 2354 HOH A O   1 
HETATM 4775 O  O   . HOH M 11 .   ? 22.864 5.832   1.069   1.00 47.25 ? 2355 HOH A O   1 
HETATM 4776 O  O   . HOH M 11 .   ? 9.278  16.726  3.097   1.00 36.49 ? 2356 HOH A O   1 
HETATM 4777 O  O   . HOH M 11 .   ? 10.866 14.781  6.016   1.00 39.77 ? 2357 HOH A O   1 
HETATM 4778 O  O   . HOH M 11 .   ? 26.528 19.971  3.773   1.00 35.51 ? 2358 HOH A O   1 
HETATM 4779 O  O   . HOH M 11 .   ? 20.205 32.653  11.311  1.00 48.38 ? 2359 HOH A O   1 
HETATM 4780 O  O   . HOH M 11 .   ? 19.939 32.035  8.440   1.00 50.45 ? 2360 HOH A O   1 
HETATM 4781 O  O   . HOH M 11 .   ? 27.109 31.656  8.613   1.00 26.58 ? 2361 HOH A O   1 
HETATM 4782 O  O   . HOH M 11 .   ? 15.448 34.603  6.473   1.00 48.20 ? 2362 HOH A O   1 
HETATM 4783 O  O   . HOH M 11 .   ? 20.837 28.216  9.550   1.00 39.81 ? 2363 HOH A O   1 
HETATM 4784 O  O   . HOH M 11 .   ? 19.470 29.022  12.074  1.00 47.35 ? 2364 HOH A O   1 
HETATM 4785 O  O   . HOH M 11 .   ? 16.495 24.861  -1.945  1.00 25.78 ? 2365 HOH A O   1 
HETATM 4786 O  O   . HOH M 11 .   ? 19.434 29.034  -3.254  1.00 30.22 ? 2366 HOH A O   1 
HETATM 4787 O  O   . HOH M 11 .   ? 23.098 27.929  2.647   1.00 38.79 ? 2367 HOH A O   1 
HETATM 4788 O  O   . HOH M 11 .   ? 17.536 21.907  0.051   1.00 22.19 ? 2368 HOH A O   1 
HETATM 4789 O  O   . HOH M 11 .   ? 16.856 18.564  0.626   1.00 20.86 ? 2369 HOH A O   1 
HETATM 4790 O  O   . HOH M 11 .   ? 15.994 23.749  2.494   1.00 22.00 ? 2370 HOH A O   1 
HETATM 4791 O  O   . HOH M 11 .   ? 22.530 13.977  -1.206  1.00 24.67 ? 2371 HOH A O   1 
HETATM 4792 O  O   . HOH M 11 .   ? 25.196 13.410  -0.037  1.00 28.78 ? 2372 HOH A O   1 
HETATM 4793 O  O   . HOH M 11 .   ? 23.046 12.995  6.431   1.00 18.10 ? 2373 HOH A O   1 
HETATM 4794 O  O   . HOH M 11 .   ? 26.266 10.085  5.491   1.00 28.83 ? 2374 HOH A O   1 
HETATM 4795 O  O   . HOH M 11 .   ? 33.713 17.675  3.207   1.00 37.35 ? 2375 HOH A O   1 
HETATM 4796 O  O   . HOH M 11 .   ? 27.899 6.885   3.916   1.00 41.75 ? 2376 HOH A O   1 
HETATM 4797 O  O   . HOH M 11 .   ? 34.776 10.896  -1.012  1.00 63.99 ? 2377 HOH A O   1 
HETATM 4798 O  O   . HOH M 11 .   ? 33.414 5.956   -0.510  1.00 31.60 ? 2378 HOH A O   1 
HETATM 4799 O  O   . HOH M 11 .   ? 36.731 15.606  1.952   1.00 38.38 ? 2379 HOH A O   1 
HETATM 4800 O  O   . HOH M 11 .   ? 30.104 12.647  -0.251  1.00 40.02 ? 2380 HOH A O   1 
HETATM 4801 O  O   . HOH M 11 .   ? 31.278 5.244   -3.458  1.00 56.12 ? 2381 HOH A O   1 
HETATM 4802 O  O   . HOH M 11 .   ? 26.459 8.993   -2.828  1.00 53.52 ? 2382 HOH A O   1 
HETATM 4803 O  O   . HOH M 11 .   ? 36.491 4.397   11.080  1.00 35.94 ? 2383 HOH A O   1 
HETATM 4804 O  O   . HOH M 11 .   ? 32.515 6.173   11.835  1.00 21.90 ? 2384 HOH A O   1 
HETATM 4805 O  O   . HOH M 11 .   ? 40.356 -0.817  12.522  1.00 57.07 ? 2385 HOH A O   1 
HETATM 4806 O  O   . HOH M 11 .   ? 43.537 -2.797  10.928  1.00 53.72 ? 2386 HOH A O   1 
HETATM 4807 O  O   . HOH M 11 .   ? 7.552  20.264  28.929  1.00 27.71 ? 2387 HOH A O   1 
HETATM 4808 O  O   . HOH M 11 .   ? 5.354  19.835  32.909  1.00 39.77 ? 2388 HOH A O   1 
HETATM 4809 O  O   . HOH M 11 .   ? 8.866  13.552  27.475  1.00 38.65 ? 2389 HOH A O   1 
HETATM 4810 O  O   . HOH M 11 .   ? 4.343  15.581  28.695  1.00 51.68 ? 2390 HOH A O   1 
HETATM 4811 O  O   . HOH M 11 .   ? 25.622 39.216  51.520  1.00 55.70 ? 2391 HOH A O   1 
HETATM 4812 O  O   . HOH M 11 .   ? 10.482 39.407  19.996  1.00 59.80 ? 2392 HOH A O   1 
HETATM 4813 O  O   . HOH M 11 .   ? 47.350 -6.357  53.721  1.00 53.11 ? 2393 HOH A O   1 
HETATM 4814 O  O   . HOH M 11 .   ? 44.862 -9.445  53.423  1.00 42.12 ? 2394 HOH A O   1 
HETATM 4815 O  O   . HOH M 11 .   ? 53.452 -2.560  29.457  1.00 43.05 ? 2395 HOH A O   1 
HETATM 4816 O  O   . HOH M 11 .   ? 9.664  5.095   19.301  1.00 47.65 ? 2396 HOH A O   1 
HETATM 4817 O  O   . HOH M 11 .   ? 39.995 20.143  21.427  1.00 43.97 ? 2397 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG A 1537 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  PRO 32  32  32  PRO PRO A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  GLN 47  47  47  GLN GLN A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  TRP 52  52  52  TRP TRP A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  CSS 66  66  66  CSS CSS A . n 
A 1 67  GLN 67  67  67  GLN GLN A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  HIS 77  77  77  HIS HIS A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  MET 81  81  81  MET MET A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  TRP 98  98  98  TRP TRP A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 MET 144 144 144 MET MET A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 MET 166 166 166 MET MET A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 TRP 177 177 177 TRP TRP A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 ASN 188 188 188 ASN ASN A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 HIS 214 214 214 HIS HIS A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 THR 218 218 218 THR THR A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 GLN 223 223 223 GLN GLN A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 ASN 241 241 241 ASN ASN A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 CYS 252 252 252 CYS CYS A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 ASN 256 256 256 ASN ASN A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 CYS 263 263 263 CYS CYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ARG 265 265 265 ARG ARG A . n 
A 1 266 ASN 266 266 266 ASN ASN A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 GLN 270 270 270 GLN GLN A . n 
A 1 271 GLU 271 271 271 GLU GLU A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 VAL 279 279 279 VAL VAL A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 PRO 281 281 281 PRO PRO A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 THR 284 284 284 THR THR A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 ASN 289 289 289 ASN ASN A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 GLY 291 291 291 GLY GLY A . n 
A 1 292 PRO 292 292 292 PRO PRO A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 PHE 298 298 298 PHE PHE A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 MET 302 302 302 MET MET A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 PHE 312 312 312 PHE PHE A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 ILE 317 317 317 ILE ILE A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 GLU 325 325 325 GLU GLU A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 PHE 329 329 329 PHE PHE A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 TYR 332 332 332 TYR TYR A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 PRO 335 335 335 PRO PRO A . n 
A 1 336 GLY 336 336 336 GLY GLY A . n 
A 1 337 PHE 337 337 337 PHE PHE A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 ASN 341 341 341 ASN ASN A . n 
A 1 342 ASN 342 342 342 ASN ASN A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 ILE 344 344 344 ILE ILE A . n 
A 1 345 ILE 345 345 345 ILE ILE A . n 
A 1 346 THR 346 346 346 THR THR A . n 
A 1 347 ARG 347 347 347 ARG ARG A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 GLU 349 349 349 GLU GLU A . n 
A 1 350 PHE 350 350 350 PHE PHE A . n 
A 1 351 GLN 351 351 351 GLN GLN A . n 
A 1 352 GLU 352 352 352 GLU GLU A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 PHE 357 357 357 PHE PHE A . n 
A 1 358 PHE 358 358 358 PHE PHE A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 VAL 361 361 361 VAL VAL A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 GLU 363 363 363 GLU GLU A . n 
A 1 364 PHE 364 364 364 PHE PHE A . n 
A 1 365 GLY 365 365 365 GLY GLY A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 SER 368 368 368 SER SER A . n 
A 1 369 ILE 369 369 369 ILE ILE A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 HIS 372 372 372 HIS HIS A . n 
A 1 373 TYR 373 373 373 TYR TYR A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 TRP 376 376 376 TRP TRP A . n 
A 1 377 VAL 377 377 377 VAL VAL A . n 
A 1 378 ASP 378 378 378 ASP ASP A . n 
A 1 379 ASP 379 379 379 ASP ASP A . n 
A 1 380 GLN 380 380 380 GLN GLN A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 GLU 383 383 383 GLU GLU A . n 
A 1 384 ASN 384 384 384 ASN ASN A . n 
A 1 385 TYR 385 385 385 TYR TYR A . n 
A 1 386 ARG 386 386 386 ARG ARG A . n 
A 1 387 GLU 387 387 387 GLU GLU A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 VAL 392 392 392 VAL VAL A . n 
A 1 393 VAL 393 393 393 VAL VAL A . n 
A 1 394 GLY 394 394 394 GLY GLY A . n 
A 1 395 ASP 395 395 395 ASP ASP A . n 
A 1 396 TYR 396 396 396 TYR TYR A . n 
A 1 397 ASN 397 397 397 ASN ASN A . n 
A 1 398 PHE 398 398 398 PHE PHE A . n 
A 1 399 ILE 399 399 399 ILE ILE A . n 
A 1 400 CYS 400 400 400 CYS CYS A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 ALA 402 402 402 ALA ALA A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 PHE 405 405 405 PHE PHE A . n 
A 1 406 THR 406 406 406 THR THR A . n 
A 1 407 LYS 407 407 407 LYS LYS A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 PHE 409 409 409 PHE PHE A . n 
A 1 410 SER 410 410 410 SER SER A . n 
A 1 411 GLU 411 411 411 GLU GLU A . n 
A 1 412 TRP 412 412 412 TRP TRP A . n 
A 1 413 GLY 413 413 413 GLY GLY A . n 
A 1 414 ASN 414 414 414 ASN ASN A . n 
A 1 415 ASN 415 415 415 ASN ASN A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 PHE 417 417 417 PHE PHE A . n 
A 1 418 PHE 418 418 418 PHE PHE A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 TYR 420 420 420 TYR TYR A . n 
A 1 421 PHE 421 421 421 PHE PHE A . n 
A 1 422 GLU 422 422 422 GLU GLU A . n 
A 1 423 HIS 423 423 423 HIS HIS A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 SER 425 425 425 SER SER A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 LYS 427 427 427 LYS LYS A . n 
A 1 428 LEU 428 428 428 LEU LEU A . n 
A 1 429 PRO 429 429 429 PRO PRO A . n 
A 1 430 TRP 430 430 430 TRP TRP A . n 
A 1 431 PRO 431 431 431 PRO PRO A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 TRP 433 433 433 TRP TRP A . n 
A 1 434 MET 434 434 434 MET MET A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 VAL 436 436 436 VAL VAL A . n 
A 1 437 MET 437 437 437 MET MET A . n 
A 1 438 HIS 438 438 438 HIS HIS A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 TYR 440 440 440 TYR TYR A . n 
A 1 441 GLU 441 441 441 GLU GLU A . n 
A 1 442 ILE 442 442 442 ILE ILE A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 PHE 444 444 444 PHE PHE A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 GLY 447 447 447 GLY GLY A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 PRO 449 449 449 PRO PRO A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 GLU 451 451 451 GLU GLU A . n 
A 1 452 ARG 452 452 452 ARG ARG A . n 
A 1 453 ARG 453 453 453 ARG ARG A . n 
A 1 454 ASP 454 454 454 ASP ASP A . n 
A 1 455 GLN 455 455 455 GLN GLN A . n 
A 1 456 TYR 456 456 456 TYR TYR A . n 
A 1 457 THR 457 457 457 THR THR A . n 
A 1 458 LYS 458 458 458 LYS LYS A . n 
A 1 459 ALA 459 459 459 ALA ALA A . n 
A 1 460 GLU 460 460 460 GLU GLU A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 ILE 462 462 462 ILE ILE A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 SER 464 464 464 SER SER A . n 
A 1 465 ARG 465 465 465 ARG ARG A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ILE 467 467 467 ILE ILE A . n 
A 1 468 VAL 468 468 468 VAL VAL A . n 
A 1 469 LYS 469 469 469 LYS LYS A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 TRP 471 471 471 TRP TRP A . n 
A 1 472 ALA 472 472 472 ALA ALA A . n 
A 1 473 ASN 473 473 473 ASN ASN A . n 
A 1 474 PHE 474 474 474 PHE PHE A . n 
A 1 475 ALA 475 475 475 ALA ALA A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 TYR 477 477 477 TYR TYR A . n 
A 1 478 GLY 478 478 478 GLY GLY A . n 
A 1 479 ASN 479 479 479 ASN ASN A . n 
A 1 480 PRO 480 480 480 PRO PRO A . n 
A 1 481 GLN 481 481 481 GLN GLN A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 THR 483 483 483 THR THR A . n 
A 1 484 GLN 484 484 484 GLN GLN A . n 
A 1 485 ASN 485 485 485 ASN ASN A . n 
A 1 486 GLN 486 486 486 GLN GLN A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 THR 488 488 488 THR THR A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 TRP 490 490 490 TRP TRP A . n 
A 1 491 PRO 491 491 491 PRO PRO A . n 
A 1 492 VAL 492 492 492 VAL VAL A . n 
A 1 493 PHE 493 493 493 PHE PHE A . n 
A 1 494 LYS 494 494 494 LYS LYS A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 GLN 498 498 498 GLN GLN A . n 
A 1 499 LYS 499 499 499 LYS LYS A . n 
A 1 500 TYR 500 500 500 TYR TYR A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 THR 502 502 502 THR THR A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 ASN 504 504 504 ASN ASN A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 GLU 506 506 506 GLU GLU A . n 
A 1 507 SER 507 507 507 SER SER A . n 
A 1 508 THR 508 508 508 THR THR A . n 
A 1 509 ARG 509 509 509 ARG ARG A . n 
A 1 510 ILE 510 510 510 ILE ILE A . n 
A 1 511 MET 511 511 511 MET MET A . n 
A 1 512 THR 512 512 512 THR THR A . n 
A 1 513 LYS 513 513 513 LYS LYS A . n 
A 1 514 LEU 514 514 514 LEU LEU A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 ALA 516 516 516 ALA ALA A . n 
A 1 517 GLN 517 517 517 GLN GLN A . n 
A 1 518 GLN 518 518 518 GLN GLN A . n 
A 1 519 CYS 519 519 519 CYS CYS A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 PHE 521 521 521 PHE PHE A . n 
A 1 522 TRP 522 522 522 TRP TRP A . n 
A 1 523 THR 523 523 523 THR THR A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 PHE 526 526 526 PHE PHE A . n 
A 1 527 PRO 527 527 527 PRO PRO A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  NAG 1   1535 1535 NAG NAG A . 
F 5  NAG 1   1536 1536 NAG NAG A . 
G 5  NAG 1   1537 1537 NAG NAG A . 
H 6  CL  1   1541 1541 CL  CL  A . 
I 7  NA  1   1542 1542 NA  NA  A . 
J 8  SO4 1   1543 1543 SO4 SO4 A . 
K 9  EFS 1   1544 1544 EFS EFS A . 
L 10 F   1   1546 1546 F   F   A . 
M 11 HOH 1   2001 2001 HOH HOH A . 
M 11 HOH 2   2002 2002 HOH HOH A . 
M 11 HOH 3   2003 2003 HOH HOH A . 
M 11 HOH 4   2004 2004 HOH HOH A . 
M 11 HOH 5   2005 2005 HOH HOH A . 
M 11 HOH 6   2006 2006 HOH HOH A . 
M 11 HOH 7   2007 2007 HOH HOH A . 
M 11 HOH 8   2008 2008 HOH HOH A . 
M 11 HOH 9   2009 2009 HOH HOH A . 
M 11 HOH 10  2010 2010 HOH HOH A . 
M 11 HOH 11  2011 2011 HOH HOH A . 
M 11 HOH 12  2012 2012 HOH HOH A . 
M 11 HOH 13  2013 2013 HOH HOH A . 
M 11 HOH 14  2014 2014 HOH HOH A . 
M 11 HOH 15  2015 2015 HOH HOH A . 
M 11 HOH 16  2016 2016 HOH HOH A . 
M 11 HOH 17  2017 2017 HOH HOH A . 
M 11 HOH 18  2018 2018 HOH HOH A . 
M 11 HOH 19  2019 2019 HOH HOH A . 
M 11 HOH 20  2020 2020 HOH HOH A . 
M 11 HOH 21  2021 2021 HOH HOH A . 
M 11 HOH 22  2022 2022 HOH HOH A . 
M 11 HOH 23  2023 2023 HOH HOH A . 
M 11 HOH 24  2024 2024 HOH HOH A . 
M 11 HOH 25  2025 2025 HOH HOH A . 
M 11 HOH 26  2026 2026 HOH HOH A . 
M 11 HOH 27  2027 2027 HOH HOH A . 
M 11 HOH 28  2028 2028 HOH HOH A . 
M 11 HOH 29  2029 2029 HOH HOH A . 
M 11 HOH 30  2030 2030 HOH HOH A . 
M 11 HOH 31  2031 2031 HOH HOH A . 
M 11 HOH 32  2032 2032 HOH HOH A . 
M 11 HOH 33  2033 2033 HOH HOH A . 
M 11 HOH 34  2034 2034 HOH HOH A . 
M 11 HOH 35  2035 2035 HOH HOH A . 
M 11 HOH 36  2036 2036 HOH HOH A . 
M 11 HOH 37  2037 2037 HOH HOH A . 
M 11 HOH 38  2038 2038 HOH HOH A . 
M 11 HOH 39  2039 2039 HOH HOH A . 
M 11 HOH 40  2040 2040 HOH HOH A . 
M 11 HOH 41  2041 2041 HOH HOH A . 
M 11 HOH 42  2042 2042 HOH HOH A . 
M 11 HOH 43  2043 2043 HOH HOH A . 
M 11 HOH 44  2044 2044 HOH HOH A . 
M 11 HOH 45  2045 2045 HOH HOH A . 
M 11 HOH 46  2046 2046 HOH HOH A . 
M 11 HOH 47  2047 2047 HOH HOH A . 
M 11 HOH 48  2048 2048 HOH HOH A . 
M 11 HOH 49  2049 2049 HOH HOH A . 
M 11 HOH 50  2050 2050 HOH HOH A . 
M 11 HOH 51  2051 2051 HOH HOH A . 
M 11 HOH 52  2052 2052 HOH HOH A . 
M 11 HOH 53  2053 2053 HOH HOH A . 
M 11 HOH 54  2054 2054 HOH HOH A . 
M 11 HOH 55  2055 2055 HOH HOH A . 
M 11 HOH 56  2056 2056 HOH HOH A . 
M 11 HOH 57  2057 2057 HOH HOH A . 
M 11 HOH 58  2058 2058 HOH HOH A . 
M 11 HOH 59  2059 2059 HOH HOH A . 
M 11 HOH 60  2060 2060 HOH HOH A . 
M 11 HOH 61  2061 2061 HOH HOH A . 
M 11 HOH 62  2062 2062 HOH HOH A . 
M 11 HOH 63  2063 2063 HOH HOH A . 
M 11 HOH 64  2064 2064 HOH HOH A . 
M 11 HOH 65  2065 2065 HOH HOH A . 
M 11 HOH 66  2066 2066 HOH HOH A . 
M 11 HOH 67  2067 2067 HOH HOH A . 
M 11 HOH 68  2068 2068 HOH HOH A . 
M 11 HOH 69  2069 2069 HOH HOH A . 
M 11 HOH 70  2070 2070 HOH HOH A . 
M 11 HOH 71  2071 2071 HOH HOH A . 
M 11 HOH 72  2072 2072 HOH HOH A . 
M 11 HOH 73  2073 2073 HOH HOH A . 
M 11 HOH 74  2074 2074 HOH HOH A . 
M 11 HOH 75  2075 2075 HOH HOH A . 
M 11 HOH 76  2076 2076 HOH HOH A . 
M 11 HOH 77  2077 2077 HOH HOH A . 
M 11 HOH 78  2078 2078 HOH HOH A . 
M 11 HOH 79  2079 2079 HOH HOH A . 
M 11 HOH 80  2080 2080 HOH HOH A . 
M 11 HOH 81  2081 2081 HOH HOH A . 
M 11 HOH 82  2082 2082 HOH HOH A . 
M 11 HOH 83  2083 2083 HOH HOH A . 
M 11 HOH 84  2084 2084 HOH HOH A . 
M 11 HOH 85  2085 2085 HOH HOH A . 
M 11 HOH 86  2086 2086 HOH HOH A . 
M 11 HOH 87  2087 2087 HOH HOH A . 
M 11 HOH 88  2088 2088 HOH HOH A . 
M 11 HOH 89  2089 2089 HOH HOH A . 
M 11 HOH 90  2090 2090 HOH HOH A . 
M 11 HOH 91  2091 2091 HOH HOH A . 
M 11 HOH 92  2092 2092 HOH HOH A . 
M 11 HOH 93  2093 2093 HOH HOH A . 
M 11 HOH 94  2094 2094 HOH HOH A . 
M 11 HOH 95  2095 2095 HOH HOH A . 
M 11 HOH 96  2096 2096 HOH HOH A . 
M 11 HOH 97  2097 2097 HOH HOH A . 
M 11 HOH 98  2098 2098 HOH HOH A . 
M 11 HOH 99  2099 2099 HOH HOH A . 
M 11 HOH 100 2100 2100 HOH HOH A . 
M 11 HOH 101 2101 2101 HOH HOH A . 
M 11 HOH 102 2102 2102 HOH HOH A . 
M 11 HOH 103 2103 2103 HOH HOH A . 
M 11 HOH 104 2104 2104 HOH HOH A . 
M 11 HOH 105 2105 2105 HOH HOH A . 
M 11 HOH 106 2106 2106 HOH HOH A . 
M 11 HOH 107 2107 2107 HOH HOH A . 
M 11 HOH 108 2108 2108 HOH HOH A . 
M 11 HOH 109 2109 2109 HOH HOH A . 
M 11 HOH 110 2110 2110 HOH HOH A . 
M 11 HOH 111 2111 2111 HOH HOH A . 
M 11 HOH 112 2112 2112 HOH HOH A . 
M 11 HOH 113 2113 2113 HOH HOH A . 
M 11 HOH 114 2114 2114 HOH HOH A . 
M 11 HOH 115 2115 2115 HOH HOH A . 
M 11 HOH 116 2116 2116 HOH HOH A . 
M 11 HOH 117 2117 2117 HOH HOH A . 
M 11 HOH 118 2118 2118 HOH HOH A . 
M 11 HOH 119 2119 2119 HOH HOH A . 
M 11 HOH 120 2120 2120 HOH HOH A . 
M 11 HOH 121 2121 2121 HOH HOH A . 
M 11 HOH 122 2122 2122 HOH HOH A . 
M 11 HOH 123 2123 2123 HOH HOH A . 
M 11 HOH 124 2124 2124 HOH HOH A . 
M 11 HOH 125 2125 2125 HOH HOH A . 
M 11 HOH 126 2126 2126 HOH HOH A . 
M 11 HOH 127 2127 2127 HOH HOH A . 
M 11 HOH 128 2128 2128 HOH HOH A . 
M 11 HOH 129 2129 2129 HOH HOH A . 
M 11 HOH 130 2130 2130 HOH HOH A . 
M 11 HOH 131 2131 2131 HOH HOH A . 
M 11 HOH 132 2132 2132 HOH HOH A . 
M 11 HOH 133 2133 2133 HOH HOH A . 
M 11 HOH 134 2134 2134 HOH HOH A . 
M 11 HOH 135 2135 2135 HOH HOH A . 
M 11 HOH 136 2136 2136 HOH HOH A . 
M 11 HOH 137 2137 2137 HOH HOH A . 
M 11 HOH 138 2138 2138 HOH HOH A . 
M 11 HOH 139 2139 2139 HOH HOH A . 
M 11 HOH 140 2140 2140 HOH HOH A . 
M 11 HOH 141 2141 2141 HOH HOH A . 
M 11 HOH 142 2142 2142 HOH HOH A . 
M 11 HOH 143 2143 2143 HOH HOH A . 
M 11 HOH 144 2144 2144 HOH HOH A . 
M 11 HOH 145 2145 2145 HOH HOH A . 
M 11 HOH 146 2146 2146 HOH HOH A . 
M 11 HOH 147 2147 2147 HOH HOH A . 
M 11 HOH 148 2148 2148 HOH HOH A . 
M 11 HOH 149 2149 2149 HOH HOH A . 
M 11 HOH 150 2150 2150 HOH HOH A . 
M 11 HOH 151 2151 2151 HOH HOH A . 
M 11 HOH 152 2152 2152 HOH HOH A . 
M 11 HOH 153 2153 2153 HOH HOH A . 
M 11 HOH 154 2154 2154 HOH HOH A . 
M 11 HOH 155 2155 2155 HOH HOH A . 
M 11 HOH 156 2156 2156 HOH HOH A . 
M 11 HOH 157 2157 2157 HOH HOH A . 
M 11 HOH 158 2158 2158 HOH HOH A . 
M 11 HOH 159 2159 2159 HOH HOH A . 
M 11 HOH 160 2160 2160 HOH HOH A . 
M 11 HOH 161 2161 2161 HOH HOH A . 
M 11 HOH 162 2162 2162 HOH HOH A . 
M 11 HOH 163 2163 2163 HOH HOH A . 
M 11 HOH 164 2164 2164 HOH HOH A . 
M 11 HOH 165 2165 2165 HOH HOH A . 
M 11 HOH 166 2166 2166 HOH HOH A . 
M 11 HOH 167 2167 2167 HOH HOH A . 
M 11 HOH 168 2168 2168 HOH HOH A . 
M 11 HOH 169 2169 2169 HOH HOH A . 
M 11 HOH 170 2170 2170 HOH HOH A . 
M 11 HOH 171 2171 2171 HOH HOH A . 
M 11 HOH 172 2172 2172 HOH HOH A . 
M 11 HOH 173 2173 2173 HOH HOH A . 
M 11 HOH 174 2174 2174 HOH HOH A . 
M 11 HOH 175 2175 2175 HOH HOH A . 
M 11 HOH 176 2176 2176 HOH HOH A . 
M 11 HOH 177 2177 2177 HOH HOH A . 
M 11 HOH 178 2178 2178 HOH HOH A . 
M 11 HOH 179 2179 2179 HOH HOH A . 
M 11 HOH 180 2180 2180 HOH HOH A . 
M 11 HOH 181 2181 2181 HOH HOH A . 
M 11 HOH 182 2182 2182 HOH HOH A . 
M 11 HOH 183 2183 2183 HOH HOH A . 
M 11 HOH 184 2184 2184 HOH HOH A . 
M 11 HOH 185 2185 2185 HOH HOH A . 
M 11 HOH 186 2186 2186 HOH HOH A . 
M 11 HOH 187 2187 2187 HOH HOH A . 
M 11 HOH 188 2188 2188 HOH HOH A . 
M 11 HOH 189 2189 2189 HOH HOH A . 
M 11 HOH 190 2190 2190 HOH HOH A . 
M 11 HOH 191 2191 2191 HOH HOH A . 
M 11 HOH 192 2192 2192 HOH HOH A . 
M 11 HOH 193 2193 2193 HOH HOH A . 
M 11 HOH 194 2194 2194 HOH HOH A . 
M 11 HOH 195 2195 2195 HOH HOH A . 
M 11 HOH 196 2196 2196 HOH HOH A . 
M 11 HOH 197 2197 2197 HOH HOH A . 
M 11 HOH 198 2198 2198 HOH HOH A . 
M 11 HOH 199 2199 2199 HOH HOH A . 
M 11 HOH 200 2200 2200 HOH HOH A . 
M 11 HOH 201 2201 2201 HOH HOH A . 
M 11 HOH 202 2202 2202 HOH HOH A . 
M 11 HOH 203 2203 2203 HOH HOH A . 
M 11 HOH 204 2204 2204 HOH HOH A . 
M 11 HOH 205 2205 2205 HOH HOH A . 
M 11 HOH 206 2206 2206 HOH HOH A . 
M 11 HOH 207 2207 2207 HOH HOH A . 
M 11 HOH 208 2208 2208 HOH HOH A . 
M 11 HOH 209 2209 2209 HOH HOH A . 
M 11 HOH 210 2210 2210 HOH HOH A . 
M 11 HOH 211 2211 2211 HOH HOH A . 
M 11 HOH 212 2212 2212 HOH HOH A . 
M 11 HOH 213 2213 2213 HOH HOH A . 
M 11 HOH 214 2214 2214 HOH HOH A . 
M 11 HOH 215 2215 2215 HOH HOH A . 
M 11 HOH 216 2216 2216 HOH HOH A . 
M 11 HOH 217 2217 2217 HOH HOH A . 
M 11 HOH 218 2218 2218 HOH HOH A . 
M 11 HOH 219 2219 2219 HOH HOH A . 
M 11 HOH 220 2220 2220 HOH HOH A . 
M 11 HOH 221 2221 2221 HOH HOH A . 
M 11 HOH 222 2222 2222 HOH HOH A . 
M 11 HOH 223 2223 2223 HOH HOH A . 
M 11 HOH 224 2224 2224 HOH HOH A . 
M 11 HOH 225 2225 2225 HOH HOH A . 
M 11 HOH 226 2226 2226 HOH HOH A . 
M 11 HOH 227 2227 2227 HOH HOH A . 
M 11 HOH 228 2228 2228 HOH HOH A . 
M 11 HOH 229 2229 2229 HOH HOH A . 
M 11 HOH 230 2230 2230 HOH HOH A . 
M 11 HOH 231 2231 2231 HOH HOH A . 
M 11 HOH 232 2232 2232 HOH HOH A . 
M 11 HOH 233 2233 2233 HOH HOH A . 
M 11 HOH 234 2234 2234 HOH HOH A . 
M 11 HOH 235 2235 2235 HOH HOH A . 
M 11 HOH 236 2236 2236 HOH HOH A . 
M 11 HOH 237 2237 2237 HOH HOH A . 
M 11 HOH 238 2238 2238 HOH HOH A . 
M 11 HOH 239 2239 2239 HOH HOH A . 
M 11 HOH 240 2240 2240 HOH HOH A . 
M 11 HOH 241 2241 2241 HOH HOH A . 
M 11 HOH 242 2242 2242 HOH HOH A . 
M 11 HOH 243 2243 2243 HOH HOH A . 
M 11 HOH 244 2244 2244 HOH HOH A . 
M 11 HOH 245 2245 2245 HOH HOH A . 
M 11 HOH 246 2246 2246 HOH HOH A . 
M 11 HOH 247 2247 2247 HOH HOH A . 
M 11 HOH 248 2248 2248 HOH HOH A . 
M 11 HOH 249 2249 2249 HOH HOH A . 
M 11 HOH 250 2250 2250 HOH HOH A . 
M 11 HOH 251 2251 2251 HOH HOH A . 
M 11 HOH 252 2252 2252 HOH HOH A . 
M 11 HOH 253 2253 2253 HOH HOH A . 
M 11 HOH 254 2254 2254 HOH HOH A . 
M 11 HOH 255 2255 2255 HOH HOH A . 
M 11 HOH 256 2256 2256 HOH HOH A . 
M 11 HOH 257 2257 2257 HOH HOH A . 
M 11 HOH 258 2258 2258 HOH HOH A . 
M 11 HOH 259 2259 2259 HOH HOH A . 
M 11 HOH 260 2260 2260 HOH HOH A . 
M 11 HOH 261 2261 2261 HOH HOH A . 
M 11 HOH 262 2262 2262 HOH HOH A . 
M 11 HOH 263 2263 2263 HOH HOH A . 
M 11 HOH 264 2264 2264 HOH HOH A . 
M 11 HOH 265 2265 2265 HOH HOH A . 
M 11 HOH 266 2266 2266 HOH HOH A . 
M 11 HOH 267 2267 2267 HOH HOH A . 
M 11 HOH 268 2268 2268 HOH HOH A . 
M 11 HOH 269 2269 2269 HOH HOH A . 
M 11 HOH 270 2270 2270 HOH HOH A . 
M 11 HOH 271 2271 2271 HOH HOH A . 
M 11 HOH 272 2272 2272 HOH HOH A . 
M 11 HOH 273 2273 2273 HOH HOH A . 
M 11 HOH 274 2274 2274 HOH HOH A . 
M 11 HOH 275 2275 2275 HOH HOH A . 
M 11 HOH 276 2276 2276 HOH HOH A . 
M 11 HOH 277 2277 2277 HOH HOH A . 
M 11 HOH 278 2278 2278 HOH HOH A . 
M 11 HOH 279 2279 2279 HOH HOH A . 
M 11 HOH 280 2280 2280 HOH HOH A . 
M 11 HOH 281 2281 2281 HOH HOH A . 
M 11 HOH 282 2282 2282 HOH HOH A . 
M 11 HOH 283 2283 2283 HOH HOH A . 
M 11 HOH 284 2284 2284 HOH HOH A . 
M 11 HOH 285 2285 2285 HOH HOH A . 
M 11 HOH 286 2286 2286 HOH HOH A . 
M 11 HOH 287 2287 2287 HOH HOH A . 
M 11 HOH 288 2288 2288 HOH HOH A . 
M 11 HOH 289 2289 2289 HOH HOH A . 
M 11 HOH 290 2290 2290 HOH HOH A . 
M 11 HOH 291 2291 2291 HOH HOH A . 
M 11 HOH 292 2292 2292 HOH HOH A . 
M 11 HOH 293 2293 2293 HOH HOH A . 
M 11 HOH 294 2294 2294 HOH HOH A . 
M 11 HOH 295 2295 2295 HOH HOH A . 
M 11 HOH 296 2296 2296 HOH HOH A . 
M 11 HOH 297 2297 2297 HOH HOH A . 
M 11 HOH 298 2298 2298 HOH HOH A . 
M 11 HOH 299 2299 2299 HOH HOH A . 
M 11 HOH 300 2300 2300 HOH HOH A . 
M 11 HOH 301 2301 2301 HOH HOH A . 
M 11 HOH 302 2302 2302 HOH HOH A . 
M 11 HOH 303 2303 2303 HOH HOH A . 
M 11 HOH 304 2304 2304 HOH HOH A . 
M 11 HOH 305 2305 2305 HOH HOH A . 
M 11 HOH 306 2306 2306 HOH HOH A . 
M 11 HOH 307 2307 2307 HOH HOH A . 
M 11 HOH 308 2308 2308 HOH HOH A . 
M 11 HOH 309 2309 2309 HOH HOH A . 
M 11 HOH 310 2310 2310 HOH HOH A . 
M 11 HOH 311 2311 2311 HOH HOH A . 
M 11 HOH 312 2312 2312 HOH HOH A . 
M 11 HOH 313 2313 2313 HOH HOH A . 
M 11 HOH 314 2314 2314 HOH HOH A . 
M 11 HOH 315 2315 2315 HOH HOH A . 
M 11 HOH 316 2316 2316 HOH HOH A . 
M 11 HOH 317 2317 2317 HOH HOH A . 
M 11 HOH 318 2318 2318 HOH HOH A . 
M 11 HOH 319 2319 2319 HOH HOH A . 
M 11 HOH 320 2320 2320 HOH HOH A . 
M 11 HOH 321 2321 2321 HOH HOH A . 
M 11 HOH 322 2322 2322 HOH HOH A . 
M 11 HOH 323 2323 2323 HOH HOH A . 
M 11 HOH 324 2324 2324 HOH HOH A . 
M 11 HOH 325 2325 2325 HOH HOH A . 
M 11 HOH 326 2326 2326 HOH HOH A . 
M 11 HOH 327 2327 2327 HOH HOH A . 
M 11 HOH 328 2328 2328 HOH HOH A . 
M 11 HOH 329 2329 2329 HOH HOH A . 
M 11 HOH 330 2330 2330 HOH HOH A . 
M 11 HOH 331 2331 2331 HOH HOH A . 
M 11 HOH 332 2332 2332 HOH HOH A . 
M 11 HOH 333 2333 2333 HOH HOH A . 
M 11 HOH 334 2334 2334 HOH HOH A . 
M 11 HOH 335 2335 2335 HOH HOH A . 
M 11 HOH 336 2336 2336 HOH HOH A . 
M 11 HOH 337 2337 2337 HOH HOH A . 
M 11 HOH 338 2338 2338 HOH HOH A . 
M 11 HOH 339 2339 2339 HOH HOH A . 
M 11 HOH 340 2340 2340 HOH HOH A . 
M 11 HOH 341 2341 2341 HOH HOH A . 
M 11 HOH 342 2342 2342 HOH HOH A . 
M 11 HOH 343 2343 2343 HOH HOH A . 
M 11 HOH 344 2344 2344 HOH HOH A . 
M 11 HOH 345 2345 2345 HOH HOH A . 
M 11 HOH 346 2346 2346 HOH HOH A . 
M 11 HOH 347 2347 2347 HOH HOH A . 
M 11 HOH 348 2348 2348 HOH HOH A . 
M 11 HOH 349 2349 2349 HOH HOH A . 
M 11 HOH 350 2350 2350 HOH HOH A . 
M 11 HOH 351 2351 2351 HOH HOH A . 
M 11 HOH 352 2352 2352 HOH HOH A . 
M 11 HOH 353 2353 2353 HOH HOH A . 
M 11 HOH 354 2354 2354 HOH HOH A . 
M 11 HOH 355 2355 2355 HOH HOH A . 
M 11 HOH 356 2356 2356 HOH HOH A . 
M 11 HOH 357 2357 2357 HOH HOH A . 
M 11 HOH 358 2358 2358 HOH HOH A . 
M 11 HOH 359 2359 2359 HOH HOH A . 
M 11 HOH 360 2360 2360 HOH HOH A . 
M 11 HOH 361 2361 2361 HOH HOH A . 
M 11 HOH 362 2362 2362 HOH HOH A . 
M 11 HOH 363 2363 2363 HOH HOH A . 
M 11 HOH 364 2364 2364 HOH HOH A . 
M 11 HOH 365 2365 2365 HOH HOH A . 
M 11 HOH 366 2366 2366 HOH HOH A . 
M 11 HOH 367 2367 2367 HOH HOH A . 
M 11 HOH 368 2368 2368 HOH HOH A . 
M 11 HOH 369 2369 2369 HOH HOH A . 
M 11 HOH 370 2370 2370 HOH HOH A . 
M 11 HOH 371 2371 2371 HOH HOH A . 
M 11 HOH 372 2372 2372 HOH HOH A . 
M 11 HOH 373 2373 2373 HOH HOH A . 
M 11 HOH 374 2374 2374 HOH HOH A . 
M 11 HOH 375 2375 2375 HOH HOH A . 
M 11 HOH 376 2376 2376 HOH HOH A . 
M 11 HOH 377 2377 2377 HOH HOH A . 
M 11 HOH 378 2378 2378 HOH HOH A . 
M 11 HOH 379 2379 2379 HOH HOH A . 
M 11 HOH 380 2380 2380 HOH HOH A . 
M 11 HOH 381 2381 2381 HOH HOH A . 
M 11 HOH 382 2382 2382 HOH HOH A . 
M 11 HOH 383 2383 2383 HOH HOH A . 
M 11 HOH 384 2384 2384 HOH HOH A . 
M 11 HOH 385 2385 2385 HOH HOH A . 
M 11 HOH 386 2386 2386 HOH HOH A . 
M 11 HOH 387 2387 2387 HOH HOH A . 
M 11 HOH 388 2388 2388 HOH HOH A . 
M 11 HOH 389 2389 2389 HOH HOH A . 
M 11 HOH 390 2390 2390 HOH HOH A . 
M 11 HOH 391 2391 2391 HOH HOH A . 
M 11 HOH 392 2392 2392 HOH HOH A . 
M 11 HOH 393 2393 2393 HOH HOH A . 
M 11 HOH 394 2394 2394 HOH HOH A . 
M 11 HOH 395 2395 2395 HOH HOH A . 
M 11 HOH 396 2396 2396 HOH HOH A . 
M 11 HOH 397 2397 2397 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 57  A ASN 57  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 106 A ASN 106 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 241 A ASN 241 ? ASN 'GLYCOSYLATION SITE' 
4 A ASN 256 A ASN 256 ? ASN 'GLYCOSYLATION SITE' 
5 A ASN 341 A ASN 341 ? ASN 'GLYCOSYLATION SITE' 
6 A ASN 485 A ASN 485 ? ASN 'GLYCOSYLATION SITE' 
7 A CSS 66  A CSS 66  ? CYS S-MERCAPTOCYSTEINE   
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8540  ? 
1 MORE         -1.85 ? 
1 'SSA (A^2)'  41560 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 6_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2152 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   M 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-09-15 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-02-28 
4 'Structure model' 1 3 2019-10-16 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' Advisory                    
2  2 'Structure model' 'Version format compliance' 
3  3 'Structure model' 'Database references'       
4  3 'Structure model' 'Source and taxonomy'       
5  4 'Structure model' 'Data collection'           
6  4 'Structure model' 'Derived calculations'      
7  4 'Structure model' 'Experimental preparation'  
8  4 'Structure model' Other                       
9  5 'Structure model' Advisory                    
10 5 'Structure model' 'Atomic model'              
11 5 'Structure model' 'Data collection'           
12 5 'Structure model' 'Derived calculations'      
13 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' citation                      
2  3 'Structure model' entity_src_gen                
3  4 'Structure model' chem_comp                     
4  4 'Structure model' exptl_crystal_grow            
5  4 'Structure model' pdbx_database_status          
6  4 'Structure model' reflns_shell                  
7  4 'Structure model' struct_conn                   
8  5 'Structure model' atom_site                     
9  5 'Structure model' chem_comp                     
10 5 'Structure model' database_PDB_caveat           
11 5 'Structure model' entity                        
12 5 'Structure model' pdbx_branch_scheme            
13 5 'Structure model' pdbx_chem_comp_identifier     
14 5 'Structure model' pdbx_entity_branch            
15 5 'Structure model' pdbx_entity_branch_descriptor 
16 5 'Structure model' pdbx_entity_branch_link       
17 5 'Structure model' pdbx_entity_branch_list       
18 5 'Structure model' pdbx_entity_nonpoly           
19 5 'Structure model' pdbx_nonpoly_scheme           
20 5 'Structure model' pdbx_struct_assembly_gen      
21 5 'Structure model' pdbx_struct_special_symmetry  
22 5 'Structure model' struct_asym                   
23 5 'Structure model' struct_conn                   
24 5 'Structure model' struct_site                   
25 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_abbrev'                    
2  3 'Structure model' '_citation.journal_id_ISSN'                   
3  3 'Structure model' '_citation.page_last'                         
4  3 'Structure model' '_citation.title'                             
5  3 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'     
6  3 'Structure model' '_entity_src_gen.pdbx_host_org_strain'        
7  4 'Structure model' '_chem_comp.type'                             
8  4 'Structure model' '_exptl_crystal_grow.method'                  
9  4 'Structure model' '_exptl_crystal_grow.temp'                    
10 4 'Structure model' '_pdbx_database_status.status_code_sf'        
11 4 'Structure model' '_reflns_shell.Rmerge_I_obs'                  
12 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
13 5 'Structure model' '_atom_site.B_iso_or_equiv'                   
14 5 'Structure model' '_atom_site.Cartn_x'                          
15 5 'Structure model' '_atom_site.Cartn_y'                          
16 5 'Structure model' '_atom_site.Cartn_z'                          
17 5 'Structure model' '_atom_site.auth_asym_id'                     
18 5 'Structure model' '_atom_site.auth_atom_id'                     
19 5 'Structure model' '_atom_site.auth_comp_id'                     
20 5 'Structure model' '_atom_site.auth_seq_id'                      
21 5 'Structure model' '_atom_site.label_asym_id'                    
22 5 'Structure model' '_atom_site.label_atom_id'                    
23 5 'Structure model' '_atom_site.label_comp_id'                    
24 5 'Structure model' '_atom_site.label_entity_id'                  
25 5 'Structure model' '_atom_site.type_symbol'                      
26 5 'Structure model' '_chem_comp.name'                             
27 5 'Structure model' '_chem_comp.type'                             
28 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
29 5 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 
30 5 'Structure model' '_struct_conn.pdbx_dist_value'                
31 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
32 5 'Structure model' '_struct_conn.pdbx_role'                      
33 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
34 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
35 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
36 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
37 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
38 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
39 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
40 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
41 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         32.1619 
_pdbx_refine_tls.origin_y         16.9442 
_pdbx_refine_tls.origin_z         24.8764 
_pdbx_refine_tls.T[1][1]          0.0137 
_pdbx_refine_tls.T[2][2]          0.0163 
_pdbx_refine_tls.T[3][3]          0.0319 
_pdbx_refine_tls.T[1][2]          -0.0000 
_pdbx_refine_tls.T[1][3]          -0.0144 
_pdbx_refine_tls.T[2][3]          -0.0105 
_pdbx_refine_tls.L[1][1]          0.5499 
_pdbx_refine_tls.L[2][2]          0.4482 
_pdbx_refine_tls.L[3][3]          0.7360 
_pdbx_refine_tls.L[1][2]          0.1086 
_pdbx_refine_tls.L[1][3]          0.0327 
_pdbx_refine_tls.L[2][3]          0.1779 
_pdbx_refine_tls.S[1][1]          0.0394 
_pdbx_refine_tls.S[1][2]          -0.0688 
_pdbx_refine_tls.S[1][3]          -0.0285 
_pdbx_refine_tls.S[2][1]          -0.0051 
_pdbx_refine_tls.S[2][2]          0.0095 
_pdbx_refine_tls.S[2][3]          -0.0458 
_pdbx_refine_tls.S[3][1]          -0.0298 
_pdbx_refine_tls.S[3][2]          0.0124 
_pdbx_refine_tls.S[3][3]          -0.0489 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     2397 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.5.0044 ? 1 ? ? ? ? 
XDS    'data reduction' .        ? 2 ? ? ? ? 
XSCALE 'data scaling'   .        ? 3 ? ? ? ? 
XDS    phasing          .        ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id                 2WSL 
_pdbx_entry_details.compound_details         
;ENGINEERED RESIDUE IN CHAIN A, ASN  45 TO GLN
ENGINEERED RESIDUE IN CHAIN A, ASN 483 TO GLN
ENGINEERED RESIDUE IN CHAIN A, ASN 509 TO GLN
ENGINEERED RESIDUE IN CHAIN A, ASN 514 TO GLN
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG A SER 466  ? ? F A F   1546 ? ? 2.16 
2 1 O  A HOH 2261 ? ? O A HOH 2262 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 43  ? ? 75.19   -1.18   
2  1 LYS A 51  ? ? 86.17   143.54  
3  1 ASP A 54  ? ? 66.83   -175.41 
4  1 ASN A 106 ? ? -158.57 61.28   
5  1 ALA A 162 ? ? -154.13 72.56   
6  1 SER A 198 ? ? 57.82   -118.47 
7  1 PRO A 285 ? ? -57.50  -9.37   
8  1 ASP A 297 ? ? -133.32 -79.54  
9  1 ASP A 324 ? ? -117.68 53.25   
10 1 VAL A 361 ? ? 54.24   100.75  
11 1 ASP A 378 ? ? -148.54 -75.54  
12 1 ASP A 379 ? ? 53.16   -74.13  
13 1 GLN A 380 ? ? 54.26   76.88   
14 1 ARG A 381 ? ? 70.04   72.93   
15 1 PHE A 398 ? ? -130.00 -54.88  
16 1 GLU A 497 ? ? 101.20  -52.73  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     1537 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 1 ? A GLU 1 
2 1 Y 1 A ASP 2 ? A ASP 2 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 1530 n 
B 2 NAG 2 B NAG 2 A NAG 1531 n 
B 2 FUL 3 B FUL 3 A FUL 1532 n 
C 3 NAG 1 C NAG 1 A NAG 1533 n 
C 3 FUC 2 C FUC 2 A FUC 1534 n 
D 4 NAG 1 D NAG 1 A NAG 1538 n 
D 4 NAG 2 D NAG 2 A NAG 1539 n 
D 4 FUC 3 D FUC 3 A FUC 1540 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
FUL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpb                         
FUL 'COMMON NAME'                         GMML     1.0 b-L-fucopyranose               
FUL 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-L-Fucp                       
FUL 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
4 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpb1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1b_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][b-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
4 3 LFucpa1-6DGlcpNAcb1-                                                         'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2/a6-b1'         WURCS                       PDB2Glycan 1.1.0 
6 3 '[]{[(4+1)][b-D-GlcpNAc]{[(6+1)][a-L-Fucp]{}}}'                              LINUCS                      PDB-CARE   ?     
7 4 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
8 4 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
9 4 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUL C1 O1 1 NAG O6 HO6 sing ? 
3 3 2 FUC C1 O1 1 NAG O6 HO6 sing ? 
4 4 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
5 4 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUL 3 n 
3 NAG 1 n 
3 FUC 2 n 
4 NAG 1 n 
4 NAG 2 n 
4 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
6  'CHLORIDE ION'                           CL  
7  'SODIUM ION'                             NA  
8  'SULFATE ION'                            SO4 
9  'ETHYL DIHYDROGEN PHOSPHATE'             EFS 
10 'FLUORIDE ION'                           F   
11 water                                    HOH 
#