data_2WU3
# 
_entry.id   2WU3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2WU3         
PDBE  EBI-41273    
WWPDB D_1290041273 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 2WLS unspecified 'CRYSTAL STRUCTURE OF MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH AMTS13' 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2WU4 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND ORTHO-7' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2WU3 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hornberg, A.'  1 
'Artursson, E.' 2 
'Warme, R.'     3 
'Pang, Y.-P.'   4 
'Ekstrom, F.'   5 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structures of Oxime-Bound Fenamiphos-Acetylcholinesterases: Reactivation Involving Flipping of the His447 Ring to Form a Reactive Glu334-His447-Oxime Triad.
;
_citation.journal_abbrev            Biochem.Pharm. 
_citation.journal_volume            79 
_citation.page_first                507 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           BCPCA6 
_citation.country                   UK 
_citation.journal_id_ISSN           0006-2952 
_citation.journal_id_CSD            0725 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19732756 
_citation.pdbx_database_id_DOI      10.1016/J.BCP.2009.08.027 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hornberg, A.'  1 ? 
primary 'Artursson, E.' 2 ? 
primary 'Warme, R.'     3 ? 
primary 'Pang, Y.-P.'   4 ? 
primary 'Ekstrom, F.'   5 ? 
# 
_cell.entry_id           2WU3 
_cell.length_a           78.760 
_cell.length_b           111.230 
_cell.length_c           227.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2WU3 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                                                           60383.109 2   
3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' 'FENAMIPHOS COVALENTLY BOUND TO SER203' 
2 non-polymer syn '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 288.302   2   ? ? 
?                                   ?                                       
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       221.208   2   ? ? 
?                                   ?                                       
4 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                                          282.331   1   ? ? 
?                                   ?                                       
5 non-polymer syn 'CARBONATE ION'                                                                                60.009    2   ? ? 
?                                   ?                                       
6 water       nat water                                                                                          18.015    291 ? ? 
?                                   ?                                       
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SXE)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SXE n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               MOUSE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PCDNA3.1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACES_MOUSE 1 ? ? P21836 ? 
2 PDB 2WU3       1 ? ? 2WU3   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2WU3 A 1   ? 543 ? P21836 32  ? 574 ? 1   543 
2 2 2WU3 A 544 ? 548 ? 2WU3   544 ? 548 ? 544 548 
3 1 2WU3 B 1   ? 543 ? P21836 32  ? 574 ? 1   543 
4 2 2WU3 B 544 ? 548 ? 2WU3   544 ? 548 ? 544 548 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                        
? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                       
? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                     
? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                                
? 'C4 H7 N O4'      133.103 
CO3 non-polymer                  . 'CARBONATE ION'                                                                                
? 'C O3 -2'         60.009  
CYS 'L-peptide linking'          y CYSTEINE                                                                                       
? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                      
? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                                
? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE                                                                                        
? 'C2 H5 N O2'      75.067  
HI6 non-polymer                  . '4-(AMINOCARBONYL)-1-[({2-[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]PYRIDINIUM' 
'1-(2-HYDROXY-IMINOMETHYLPYRIDINIUM)-1-(4-CARBOXYAMINO)-PYRIDINIUM DIMETHYLETHER' 'C14 H16 N4 O3 2' 288.302 
HIS 'L-peptide linking'          y HISTIDINE                                                                                      
? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                                                                                          
? 'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                     
? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                        
? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                         
? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                     
? 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'     221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL'                                                                          
'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'      282.331 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                                  
? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                        
? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'          y SERINE                                                                                         
? 'C3 H7 N O3'      105.093 
SXE 'L-peptide linking'          n 'O-{(S)-ETHOXY[(1-METHYLETHYL)AMINO]PHOSPHORYL}-L-SERINE'                                      
? 'C8 H19 N2 O5 P'  254.221 
THR 'L-peptide linking'          y THREONINE                                                                                      
? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                     
? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                       
? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                                                                                         
? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2WU3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '28% PEG750MME, 0.1M HEPES PH7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2007-02-21 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.90736 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-5' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-5 
_diffrn_source.pdbx_wavelength             0.90736 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2WU3 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.79 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   55859 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        52.16 
_reflns.pdbx_redundancy              7.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.44 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        7.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2WU3 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     55778 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.91 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.024 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_R_factor_obs                          0.1723 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1712 
_refine.ls_R_factor_R_free                       0.2260 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1098 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               53.21 
_refine.aniso_B[1][1]                            -0.9782 
_refine.aniso_B[2][2]                            -0.4190 
_refine.aniso_B[3][3]                            1.3972 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.307 
_refine.solvent_model_param_bsol                 45.342 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.35 
_refine.pdbx_overall_phase_error                 20.86 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8387 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         91 
_refine_hist.number_atoms_solvent             291 
_refine_hist.number_atoms_total               8769 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        29.024 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 8770  'X-RAY DIFFRACTION' ? 
f_angle_d          1.395  ? ? 11967 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.703 ? ? 3104  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.209  ? ? 1285  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 1572  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.7000 2.8228  6753 0.2619 100.00 0.3379 . . 134 . . 
'X-RAY DIFFRACTION' . 2.8228 2.9715  6715 0.2255 100.00 0.2923 . . 136 . . 
'X-RAY DIFFRACTION' . 2.9715 3.1574  6766 0.1998 100.00 0.2861 . . 157 . . 
'X-RAY DIFFRACTION' . 3.1574 3.4009  6788 0.1807 100.00 0.2277 . . 116 . . 
'X-RAY DIFFRACTION' . 3.4009 3.7425  6798 0.1570 100.00 0.2108 . . 148 . . 
'X-RAY DIFFRACTION' . 3.7425 4.2825  6821 0.1375 100.00 0.2065 . . 133 . . 
'X-RAY DIFFRACTION' . 4.2825 5.3899  6886 0.1255 100.00 0.1717 . . 133 . . 
'X-RAY DIFFRACTION' . 5.3899 29.0254 7153 0.1579 100.00 0.1877 . . 141 . . 
# 
_struct.entry_id                  2WU3 
_struct.title                     'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND HI-6' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2WU3 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;ACETYLCHOLINESTERASE, ALTERNATIVE SPLICING, FENAMIPHOS, GLYCOPROTEIN, HYDROLASE, MEMBRANE, NEUROTRANSMITTER DEGRADATION, SERINE ESTERASE, SYNAPSE, HI-6
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 2 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  AA2 VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  AA6 VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SXE A 203 ? LEU A 214 ? SXE A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 AB1 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 AB2 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 AB3 ASP A 266 ? ARG A 276 ? ASP A 266 ARG A 276 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 277 ? TRP A 286 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 AB5 HIS A 287 ? LEU A 289 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P15 AB6 THR A 311 ? ASN A 317 ? THR A 311 ASN A 317 1 ? 7  
HELX_P HELX_P16 AB7 GLY A 335 ? VAL A 343 ? GLY A 335 VAL A 343 1 ? 9  
HELX_P HELX_P17 AB8 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 AC6 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 534 ? LEU A 539 ? ARG A 534 LEU A 539 1 ? 6  
HELX_P HELX_P27 AC9 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P28 AD1 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P29 AD2 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P30 AD3 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P31 AD4 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P32 AD5 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P33 AD6 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P34 AD7 SXE B 203 ? LEU B 214 ? SXE B 203 LEU B 214 1 ? 12 
HELX_P HELX_P35 AD8 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P36 AD9 SER B 240 ? GLY B 256 ? SER B 240 GLY B 256 1 ? 17 
HELX_P HELX_P37 AE1 ASP B 266 ? ARG B 276 ? ASP B 266 ARG B 276 1 ? 11 
HELX_P HELX_P38 AE2 PRO B 277 ? TRP B 286 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P39 AE3 HIS B 287 ? LEU B 289 ? HIS B 287 LEU B 289 5 ? 3  
HELX_P HELX_P40 AE4 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P41 AE5 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P42 AE6 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P43 AE7 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P44 AE8 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P45 AE9 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P46 AF1 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P47 AF2 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P48 AF3 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P49 AF4 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P50 AF5 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P51 AF6 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 1.987 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.068 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
covale1 covale one  ? A GLU 202 C   ? ? ? 1_555 A SXE 203 N  A ? A GLU 202 A SXE 203 1_555 ? ? ? ? ? ? ? 1.339 ? ?               
covale2 covale one  ? A GLU 202 C   ? ? ? 1_555 A SXE 203 N  B ? A GLU 202 A SXE 203 1_555 ? ? ? ? ? ? ? 1.340 ? ?               
covale3 covale both ? A SXE 203 C   A ? ? 1_555 A ALA 204 N  ? ? A SXE 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.326 ? ?               
covale4 covale both ? A SXE 203 C   B ? ? 1_555 A ALA 204 N  ? ? A SXE 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.326 ? ?               
covale5 covale one  ? A ASN 464 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 464 A NAG 603 1_555 ? ? ? ? ? ? ? 1.481 ? N-Glycosylation 
covale6 covale one  ? B GLU 202 C   ? ? ? 1_555 B SXE 203 N  A ? B GLU 202 B SXE 203 1_555 ? ? ? ? ? ? ? 1.341 ? ?               
covale7 covale one  ? B GLU 202 C   ? ? ? 1_555 B SXE 203 N  B ? B GLU 202 B SXE 203 1_555 ? ? ? ? ? ? ? 1.341 ? ?               
covale8 covale both ? B SXE 203 C   A ? ? 1_555 B ALA 204 N  ? ? B SXE 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.326 ? ?               
covale9 covale both ? B SXE 203 C   B ? ? 1_555 B ALA 204 N  ? ? B SXE 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.327 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 0.66  
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 7.07  
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -8.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA1 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA1 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AA2 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AA2 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AA2 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AA2 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AA2 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AA2 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AA2 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AA2 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AA2 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AA2 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AA2 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AA3 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AA3 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
AA4 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
AA4 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
AA4 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
AA5 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
AA5 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
AA5 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
AA5 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
AA5 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
AA5 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
AA5 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
AA5 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
AA5 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
AA5 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
AA5 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
AA6 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
AA6 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 10  ? N VAL A 10  O LEU A 17  ? O LEU A 17  
AA1 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
AA2 1  2  N ILE A 20  ? N ILE A 20  O ALA A 31  ? O ALA A 31  
AA2 2  3  N PHE A 32  ? N PHE A 32  O VAL A 101 ? O VAL A 101 
AA2 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AA2 4  5  O VAL A 147 ? O VAL A 147 N LEU A 115 ? N LEU A 115 
AA2 5  6  N VAL A 114 ? N VAL A 114 O SER A 196 ? O SER A 196 
AA2 6  7  N LEU A 199 ? N LEU A 199 O VAL A 226 ? O VAL A 226 
AA2 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
AA2 8  9  N VAL A 330 ? N VAL A 330 O PHE A 430 ? O PHE A 430 
AA2 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
AA2 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
AA3 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
AA4 1  2  N VAL B 10  ? N VAL B 10  O LEU B 17  ? O LEU B 17  
AA4 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
AA5 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
AA5 2  3  N PHE B 32  ? N PHE B 32  O VAL B 101 ? O VAL B 101 
AA5 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
AA5 4  5  O VAL B 147 ? O VAL B 147 N LEU B 115 ? N LEU B 115 
AA5 5  6  N ILE B 116 ? N ILE B 116 O THR B 198 ? O THR B 198 
AA5 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
AA5 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
AA5 8  9  N VAL B 328 ? N VAL B 328 O TYR B 426 ? O TYR B 426 
AA5 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
AA5 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
AA6 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
# 
_database_PDB_matrix.entry_id          2WU3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2WU3 
_atom_sites.fract_transf_matrix[1][1]   0.012697 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008990 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004392 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.707  14.976  55.349  1.00 110.46 ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.263  14.858  55.229  1.00 102.40 ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.654  14.916  56.612  1.00 93.95  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.366  14.873  57.611  1.00 93.52  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 29.878  13.548  54.524  1.00 101.30 ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.241  12.248  55.282  1.00 96.31  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.832  10.958  54.524  1.00 69.10  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.737  10.399  54.801  1.00 56.54  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.604  10.513  53.639  1.00 74.48  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.332  15.015  56.666  1.00 85.87  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.620  15.038  57.928  1.00 74.28  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.420  15.935  57.772  1.00 76.85  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.296  15.585  58.156  1.00 66.38  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.682  17.091  57.165  1.00 88.73  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.698  18.148  56.959  1.00 82.28  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.174  18.103  55.529  1.00 74.84  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.104  18.616  55.250  1.00 74.46  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.341  19.496  57.280  1.00 85.07  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 26.787  19.626  58.748  1.00 92.19  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 25.823  20.526  59.521  1.00 102.17 ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.392  20.025  60.836  1.00 102.62 ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.242  19.383  61.048  1.00 91.80  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.423  19.135  60.024  1.00 93.00  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 23.910  18.987  62.275  1.00 73.23  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 25.937  17.456  54.646  1.00 73.42  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.571  17.188  53.248  1.00 66.89  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.152  16.655  53.076  1.00 57.63  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 23.447  16.427  54.051  1.00 62.85  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.508  16.123  52.676  1.00 79.41  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 27.189  16.483  51.373  1.00 88.25  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 28.644  16.850  51.606  1.00 98.99  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 29.416  15.956  52.034  1.00 99.30  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.010  18.029  51.381  1.00 101.61 ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.757  16.446  51.822  1.00 46.32  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.502  15.788  51.477  1.00 46.03  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 22.798  14.313  51.267  1.00 57.13  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 23.568  13.950  50.372  1.00 59.11  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 21.919  16.387  50.190  1.00 46.25  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 20.745  15.576  49.631  1.00 55.41  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.473  14.476  50.136  1.00 60.61  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.090  16.034  48.672  1.00 57.09  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.198  13.449  52.096  1.00 61.45  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 22.499  12.012  52.054  1.00 61.84  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.224  11.345  50.701  1.00 57.44  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 22.781  10.297  50.416  1.00 51.69  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 21.570  11.436  53.129  1.00 61.68  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 20.506  12.479  53.293  1.00 63.44  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.278  13.756  53.198  1.00 61.97  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.389  11.936  49.863  1.00 58.98  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.041  11.267  48.618  1.00 59.67  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 21.998  11.603  47.454  1.00 56.93  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 21.813  11.146  46.321  1.00 56.00  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 19.582  11.563  48.266  1.00 70.69  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.157  11.034  46.897  1.00 83.41  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 18.788  9.562   46.893  1.00 83.95  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 18.968  8.876   45.888  1.00 82.77  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 18.249  9.077   48.011  1.00 89.89  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.036  12.387  47.735  1.00 56.82  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 23.949  12.828  46.676  1.00 49.25  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.351  12.233  46.772  1.00 53.43  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.221  12.561  45.969  1.00 65.62  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.024  14.359  46.626  1.00 39.99  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 22.712  15.000  46.169  1.00 40.42  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 22.716  16.467  46.421  1.00 39.11  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.432  14.689  44.691  1.00 36.06  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 25.581  11.363  47.747  1.00 41.42  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 26.915  10.816  47.906  1.00 42.34  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 26.961  9.377   47.413  1.00 41.73  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.176  8.553   47.851  1.00 43.74  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.381  10.935  49.358  1.00 38.63  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.210  12.327  49.998  1.00 46.04  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.471  12.315  51.508  1.00 39.56  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.063  13.393  49.323  1.00 51.91  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 27.859  9.091   46.473  1.00 33.63  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 27.992  7.743   45.907  1.00 26.23  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.478  7.304   45.841  1.00 49.87  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.390  8.141   45.706  1.00 50.23  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.294  7.663   44.513  1.00 45.38  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 27.555  6.335   43.843  1.00 47.94  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 25.788  7.885   44.660  1.00 39.33  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 29.731  6.004   45.986  1.00 38.21  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.088  5.509   45.785  1.00 38.67  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.165  4.828   44.442  1.00 45.29  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.235  4.131   44.047  1.00 52.22  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.528  4.543   46.888  1.00 30.39  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 32.847  3.844   46.627  1.00 29.80  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.380  3.171   47.890  1.00 39.12  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 33.664  4.149   48.946  1.00 47.78  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 34.883  4.548   49.297  1.00 50.90  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.032  5.445   50.264  1.00 51.42  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 35.953  4.056   48.681  1.00 51.83  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.264  5.059   43.736  1.00 46.02  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 32.586  4.295   42.538  1.00 47.45  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 33.979  3.721   42.711  1.00 49.85  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 34.683  4.049   43.666  1.00 55.25  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.500  5.129   41.246  1.00 37.39  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.055  5.357   40.859  1.00 31.66  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.218  6.467   41.419  1.00 37.47  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.356  2.853   41.790  1.00 44.51  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 35.583  2.083   41.883  1.00 40.15  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 36.817  2.982   42.111  1.00 41.30  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 37.812  2.563   42.712  1.00 35.05  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 35.682  1.225   40.619  1.00 38.74  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 36.980  0.530   40.366  1.00 47.00  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.294  -0.543  41.377  1.00 44.28  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.443  -0.144  42.172  1.00 51.27  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 39.600  -0.778  42.149  1.00 57.86  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 39.740  -1.844  41.385  1.00 57.78  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.600  -0.360  42.902  1.00 61.98  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 36.727  4.232   41.664  1.00 41.44  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 37.789  5.197   41.854  1.00 34.75  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 37.794  5.838   43.232  1.00 49.32  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 38.835  6.292   43.714  1.00 56.65  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 36.626  5.883   43.867  1.00 49.98  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.474  6.547   45.151  1.00 54.23  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.134  7.240   45.355  1.00 52.85  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.126  6.858   44.771  1.00 57.11  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.122  8.267   46.191  1.00 45.79  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 33.873  8.911   46.574  1.00 50.91  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.447  10.120  45.729  1.00 51.30  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.264  10.970  45.375  1.00 54.91  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 33.921  9.292   48.051  1.00 42.91  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.285  8.260   48.919  1.00 41.18  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.678  8.401   50.352  1.00 46.92  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 32.826  8.354   51.241  1.00 39.98  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 34.987  8.563   50.602  1.00 57.41  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.152  10.203  45.437  1.00 40.16  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 31.639  11.322  44.667  1.00 38.50  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 30.553  12.080  45.396  1.00 40.77  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 29.693  11.487  46.040  1.00 50.62  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.074  10.839  43.332  1.00 44.87  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 31.943  9.969   42.434  1.00 42.52  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.070  9.449   41.314  1.00 50.38  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.145  10.751  41.900  1.00 41.29  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 30.588  13.400  45.285  1.00 40.78  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.462  14.201  45.728  1.00 42.84  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 28.803  14.816  44.496  1.00 48.51  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.401  15.648  43.815  1.00 50.87  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 29.905  15.287  46.712  1.00 39.64  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 28.779  16.254  47.128  1.00 45.67  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.243  17.205  48.213  1.00 48.00  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.587  17.698  47.927  1.00 66.94  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 31.672  17.378  48.630  1.00 73.35  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 31.578  16.580  49.686  1.00 65.08  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 32.855  17.864  48.280  1.00 79.82  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 27.579  14.388  44.205  1.00 38.89  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 26.807  14.965  43.120  1.00 41.18  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 25.933  16.145  43.532  1.00 47.04  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.041  16.686  44.646  1.00 46.58  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.050  16.543  42.624  1.00 39.98  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.244  17.744  42.818  1.00 42.64  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 22.749  17.551  42.483  1.00 43.22  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.389  16.852  41.519  1.00 40.47  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 24.820  18.884  41.978  1.00 48.47  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 23.975  20.139  42.128  1.00 48.57  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 24.900  18.481  40.503  1.00 44.54  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 24.717  21.353  41.721  1.00 43.54  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 21.888  18.169  43.288  1.00 35.71  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.445  18.038  43.124  1.00 37.27  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 19.915  19.075  42.155  1.00 37.64  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 19.617  20.184  42.556  1.00 56.71  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 19.749  18.185  44.485  1.00 46.68  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.223  18.006  44.476  1.00 50.59  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.558  18.570  45.739  1.00 57.63  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.453  19.449  45.351  1.00 79.06  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.182  19.332  45.746  1.00 82.79  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 14.827  18.367  46.593  1.00 79.49  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.264  20.199  45.297  1.00 76.09  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 19.792  18.719  40.883  1.00 33.95  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.289  19.656  39.865  1.00 42.78  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 17.776  19.737  39.767  1.00 42.80  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.075  18.743  39.963  1.00 46.48  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 19.801  19.273  38.479  1.00 43.41  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.298  19.372  38.254  1.00 38.85  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 21.557  19.055  36.816  1.00 32.34  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 21.795  20.758  38.639  1.00 31.01  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.284  20.917  39.398  1.00 45.24  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 15.857  21.122  39.160  1.00 36.14  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.462  20.898  37.696  1.00 44.46  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.015  21.514  36.784  1.00 46.35  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.438  22.513  39.597  1.00 47.30  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 13.973  22.566  40.006  1.00 81.11  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 13.782  23.369  41.298  1.00 101.92 ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 13.915  24.863  41.025  1.00 111.67 ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 13.225  25.230  39.738  1.00 114.38 ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.526  19.979  37.476  1.00 47.02  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 13.863  19.853  36.177  1.00 45.32  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.427  20.342  36.338  1.00 54.21  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 11.906  20.415  37.463  1.00 53.22  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 13.886  18.417  35.676  1.00 32.22  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 11.787  20.693  35.216  1.00 59.21  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.426  21.245  35.217  1.00 47.70  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.485   20.480  36.130  1.00 54.59  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 8.690   21.099  36.836  1.00 60.38  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.000  21.084  33.768  1.00 50.94  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.295  21.255  32.987  1.00 57.47  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.385  20.678  33.865  1.00 60.43  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 9.584   19.154  36.138  1.00 53.79  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.660   18.333  36.905  1.00 48.68  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.167   17.831  38.250  1.00 59.17  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.445   17.115  38.934  1.00 55.29  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.387  18.212  38.641  1.00 64.32  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 10.990  17.740  39.883  1.00 57.89  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.510  17.650  39.842  1.00 56.60  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.136  17.963  38.822  1.00 53.29  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.123  17.201  40.950  1.00 50.74  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.590  17.179  41.060  1.00 53.13  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.223  15.972  40.380  1.00 49.55  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.620  14.900  40.328  1.00 51.73  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 14.826  17.068  42.566  1.00 48.20  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.451  16.856  43.192  1.00 43.53  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.486  16.570  42.108  1.00 39.44  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.433  16.147  39.863  1.00 47.05  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.236  14.996  39.434  1.00 52.51  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.578  14.965  40.148  1.00 43.48  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.037  15.981  40.663  1.00 38.57  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.489  14.995  37.920  1.00 47.01  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.190  14.826  37.180  1.00 39.60  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.186  16.268  37.507  1.00 52.77  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.193  13.792  40.200  1.00 43.10  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 20.556  13.671  40.711  1.00 44.34  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.520  13.885  39.529  1.00 39.59  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.391  13.241  38.489  1.00 41.48  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 20.780  12.281  41.320  1.00 50.41  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.113  12.080  42.559  1.00 56.43  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.466  14.805  39.650  1.00 32.22  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.510  14.879  38.621  1.00 36.59  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 24.891  14.645  39.223  1.00 39.36  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.199  15.129  40.315  1.00 42.58  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.465  16.189  37.883  1.00 32.50  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 25.702  13.860  38.527  1.00 42.81  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.104  13.634  38.904  1.00 41.35  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 27.973  14.022  37.728  1.00 44.03  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.128  13.269  36.771  1.00 45.30  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.324  12.177  39.309  1.00 34.46  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 26.505  11.776  40.493  1.00 34.73  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 25.174  11.420  40.342  1.00 41.53  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.032  11.827  41.763  1.00 31.19  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 24.390  11.081  41.439  1.00 33.76  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 26.253  11.509  42.848  1.00 36.73  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 24.927  11.127  42.679  1.00 35.07  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.495  15.235  37.779  1.00 43.43  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.150  15.809  36.617  1.00 39.45  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 30.674  15.896  36.760  1.00 34.27  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.201  16.129  37.859  1.00 29.97  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 28.572  17.185  36.370  1.00 34.36  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.062  17.258  36.307  1.00 35.11  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 26.664  18.714  36.211  1.00 36.19  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.541  16.471  35.118  1.00 34.67  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.374  15.721  35.642  1.00 25.36  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 32.824  15.674  35.659  1.00 31.18  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 33.486  14.528  36.435  1.00 33.07  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 34.463  14.729  37.130  1.00 35.52  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 32.967  13.318  36.323  1.00 35.77  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 33.659  12.156  36.881  1.00 37.61  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 34.773  11.630  35.967  1.00 39.92  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 34.504  11.190  34.853  1.00 39.86  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 32.715  10.994  37.036  1.00 32.72  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.434  11.413  37.782  1.00 33.05  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.444  9.902   37.701  1.00 21.95  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.315  10.373  37.711  1.00 19.81  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.019  11.640  36.444  1.00 41.62  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.131  11.240  35.572  1.00 46.16  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.088  9.754   35.364  1.00 43.24  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 36.805  9.059   36.331  1.00 39.75  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.384  11.558  36.405  1.00 52.70  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 37.893  11.948  37.772  1.00 46.08  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.419  11.734  37.857  1.00 35.43  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.390  9.274   34.162  1.00 46.35  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.333  7.849   33.888  1.00 37.97  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.624  7.337   33.266  1.00 42.57  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 38.793  6.143   33.021  1.00 56.78  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.114  7.518   33.023  1.00 41.86  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.186  8.057   31.613  1.00 42.14  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 36.839  7.341   30.605  1.00 36.92  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.575  9.256   31.286  1.00 33.58  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 36.896  7.831   29.296  1.00 34.30  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 35.640  9.756   29.977  1.00 33.73  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.304  9.044   28.981  1.00 28.24  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.552  8.242   33.025  1.00 41.79  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 40.859  7.856   32.512  1.00 41.67  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 41.885  8.772   33.122  1.00 47.38  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.551  9.827   33.666  1.00 52.70  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 40.908  7.967   30.992  1.00 38.09  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.142  8.368   33.036  1.00 47.57  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.216  9.292   33.324  1.00 45.79  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.234  10.385  32.257  1.00 44.94  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 43.956  10.146  31.079  1.00 45.32  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.535  8.553   33.365  1.00 39.63  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 45.685  7.705   34.606  1.00 47.79  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 45.799  8.531   35.879  1.00 53.22  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 46.649  9.453   35.936  1.00 63.62  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.044  8.247   36.827  1.00 45.43  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.534  11.606  32.675  1.00 35.69  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.658  12.704  31.721  1.00 31.66  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.564  12.318  30.552  1.00 37.69  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 46.747  12.069  30.755  1.00 46.14  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.306  13.796  32.566  1.00 34.85  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 44.890  13.501  33.934  1.00 30.32  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 44.842  12.020  34.048  1.00 32.82  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.026  12.261  29.326  1.00 42.05  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 45.916  11.830  28.242  1.00 44.95  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 46.861  12.974  27.825  1.00 39.35  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 46.860  13.412  26.680  1.00 41.16  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 44.938  11.511  27.099  1.00 29.86  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 43.696  12.213  27.432  1.00 35.75  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 43.789  12.836  28.800  1.00 36.17  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 47.667  13.458  28.755  1.00 34.54  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.525  14.610  28.472  1.00 43.38  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.030  14.268  28.354  1.00 43.28  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.448  13.144  28.616  1.00 33.56  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.325  15.702  29.538  1.00 43.19  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 46.821  15.959  29.772  1.00 40.87  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 48.969  15.272  30.806  1.00 24.77  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 50.839  15.238  27.937  1.00 46.09  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.264  15.012  27.789  1.00 41.34  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.592  13.756  26.999  1.00 51.45  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.116  13.582  25.874  1.00 55.45  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.407  12.880  27.589  1.00 53.06  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 53.788  11.619  26.957  1.00 52.64  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 52.596  10.712  26.616  1.00 48.40  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 52.734  9.758   25.847  1.00 47.67  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 54.728  10.856  27.866  1.00 58.53  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.002  10.349  28.964  1.00 66.54  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.426  11.011  27.173  1.00 46.87  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.244  10.208  26.890  1.00 47.96  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.436  10.722  25.694  1.00 46.55  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.483  10.072  25.266  1.00 41.77  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.351  10.108  28.118  1.00 53.20  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.016  9.554   29.353  1.00 62.30  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.520  8.156   29.667  1.00 79.91  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 48.935  8.085   31.012  1.00 89.69  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.612  8.245   32.146  1.00 95.25  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 50.919  8.494   32.118  1.00 98.30  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 48.980  8.162   33.313  1.00 95.71  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 49.804  11.878  25.144  1.00 49.10  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.109  12.385  23.947  1.00 45.36  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.194  11.381  22.796  1.00 46.65  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.268  10.830  22.535  1.00 54.72  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 49.669  13.745  23.507  1.00 33.04  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.158  14.220  22.179  1.00 28.57  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 49.854  15.484  21.674  1.00 30.38  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.625  16.668  22.500  1.00 32.46  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.182  17.851  22.250  1.00 36.46  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 50.978  17.970  21.218  1.00 42.11  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 49.970  18.909  23.025  1.00 34.84  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.068  11.167  22.112  1.00 39.27  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 47.937  10.192  21.007  1.00 36.89  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 47.853  8.724   21.455  1.00 42.71  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 47.494  7.845   20.660  1.00 35.22  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.061  10.299  19.973  1.00 26.52  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.291  11.665  19.454  1.00 34.89  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.244  12.399  18.896  1.00 35.79  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 50.570  12.221  19.489  1.00 30.66  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 48.461  13.669  18.389  1.00 30.02  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 50.803  13.498  18.999  1.00 21.40  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 49.753  14.218  18.450  1.00 40.33  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.222  8.459   22.707  1.00 44.20  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.169  7.112   23.268  1.00 37.51  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 46.765  6.727   23.761  1.00 43.24  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 45.946  7.581   24.122  1.00 36.63  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.161  7.005   24.401  1.00 35.10  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.573  7.294   23.964  1.00 48.02  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.341  5.793   23.351  1.00 71.86  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.627  5.001   24.923  1.00 62.03  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.482  5.425   23.752  1.00 46.33  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.237  4.852   24.276  1.00 36.63  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.064  5.239   25.732  1.00 34.61  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.039  5.245   26.477  1.00 40.28  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.481  3.358   24.189  1.00 30.64  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.569  3.191   23.178  1.00 34.07  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.405  4.406   23.220  1.00 39.88  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 43.836  5.569   26.135  1.00 35.21  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.560  6.001   27.503  1.00 38.12  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 43.952  4.906   28.490  1.00 48.10  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 43.640  3.718   28.270  1.00 50.12  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.036  6.122   27.506  1.00 42.48  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.596  5.089   26.446  1.00 33.53  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.592  5.338   25.370  1.00 33.76  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.630  5.299   29.563  1.00 48.53  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 44.806  4.437   30.727  1.00 52.67  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.722  4.753   31.765  1.00 52.78  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.424  5.914   32.034  1.00 56.10  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.187  4.649   31.343  1.00 68.75  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.343  4.366   30.401  1.00 93.92  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.700  4.435   31.099  1.00 112.11 ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 48.751  4.904   32.260  1.00 116.56 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.713  4.023   30.484  1.00 117.04 ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.127  3.714   32.354  1.00 54.21  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.085  3.828   33.381  1.00 53.57  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.480  4.743   34.547  1.00 47.26  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.649  4.770   34.936  1.00 43.62  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 41.944  2.388   33.872  1.00 42.63  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.290  1.594   32.680  1.00 46.67  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.441  2.311   32.060  1.00 49.42  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.497  5.453   35.099  1.00 37.22  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 41.729  6.441   36.139  1.00 43.38  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.181  5.814   37.437  1.00 50.19  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.466  4.991   38.014  1.00 56.31  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.456  7.247   36.412  1.00 47.74  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.596  8.206   37.593  1.00 51.96  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 41.765  9.174   37.387  1.00 48.25  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.748  10.306  38.396  1.00 42.72  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.745  11.371  38.098  1.00 37.16  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.360  6.215   37.904  1.00 51.23  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 43.852  5.762   39.202  1.00 52.69  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 42.949  6.305   40.294  1.00 55.24  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.500  7.448   40.208  1.00 61.22  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.283  6.232   39.434  1.00 48.63  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.281  5.565   38.540  1.00 56.43  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.672  5.668   39.119  1.00 75.75  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.651  5.783   38.046  1.00 95.59  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.177  6.936   37.655  1.00 108.46 ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 48.819  8.060   38.270  1.00 114.39 ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 50.062  6.965   36.663  1.00 108.88 ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.653  5.476   41.307  1.00 46.60  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 41.763  5.857   42.413  1.00 44.75  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.274  7.087   43.132  1.00 45.53  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.482  7.246   43.254  1.00 46.48  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 41.836  4.654   43.344  1.00 32.19  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.116  3.526   42.461  1.00 37.71  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 42.943  4.042   41.312  1.00 38.40  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.358  7.934   43.590  1.00 42.72  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.690  9.170   44.289  1.00 44.80  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.315  9.084   45.766  1.00 51.64  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.705  8.096   46.214  1.00 49.28  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 40.926  10.333  43.666  1.00 50.36  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.426  10.126  43.664  1.00 55.88  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.558  10.424  44.671  1.00 60.81  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 38.630  9.583   42.604  1.00 49.41  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.280  10.099  44.306  1.00 55.70  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.296  9.585   43.039  1.00 50.69  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 38.914  9.115   41.321  1.00 50.16  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.250  9.126   42.243  1.00 50.31  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 37.869  8.644   40.532  1.00 49.51  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.559  8.648   40.999  1.00 46.63  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 41.646  10.122  46.530  1.00 50.84  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.325  10.078  47.952  1.00 57.88  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.287  11.119  48.339  1.00 55.75  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.266  12.234  47.820  1.00 55.79  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.579  10.207  48.823  1.00 59.39  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.066  11.536  48.807  1.00 69.32  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.425  10.739  49.266  1.00 48.95  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 38.429  11.660  49.743  1.00 47.78  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.263  11.740  48.790  1.00 53.46  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.092  10.884  47.899  1.00 42.89  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.452  12.775  48.984  1.00 48.83  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.225  12.908  48.225  1.00 45.15  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.472  13.822  47.053  1.00 40.73  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 35.734  15.008  47.232  1.00 48.59  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.087  13.453  49.108  1.00 48.25  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 32.913  13.890  48.260  1.00 46.53  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 33.658  12.398  50.153  1.00 40.52  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.418  13.262  45.852  1.00 37.09  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.573  14.049  44.636  1.00 40.51  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.299  14.848  44.351  1.00 48.68  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.198  14.281  44.293  1.00 56.62  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 35.878  13.126  43.464  1.00 39.67  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.128  13.774  42.097  1.00 36.51  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 36.900  12.819  41.233  1.00 29.98  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 34.830  14.124  41.417  1.00 35.74  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.431  16.161  44.182  1.00 41.19  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.254  16.965  43.868  1.00 40.83  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 32.844  16.807  42.403  1.00 40.93  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 33.632  17.075  41.484  1.00 45.18  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 33.446  18.445  44.202  1.00 45.24  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.229  19.287  43.817  1.00 56.83  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.068  19.575  42.600  1.00 54.47  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 31.429  19.637  44.732  1.00 62.07  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 31.597  16.384  42.207  1.00 29.86  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.053  16.104  40.887  1.00 32.30  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 29.790  16.957  40.610  1.00 41.85  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 28.761  16.449  40.166  1.00 46.25  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 30.740  14.619  40.776  1.00 30.02  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 29.882  18.256  40.872  1.00 40.59  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 28.727  19.129  40.759  1.00 48.20  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 28.794  20.039  39.525  1.00 48.62  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 27.841  20.757  39.224  1.00 45.79  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 28.555  19.979  42.035  1.00 53.04  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 29.569  20.986  42.082  1.00 53.73  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 28.687  19.109  43.278  1.00 49.22  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 29.909  19.996  38.799  1.00 44.11  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.065  20.848  37.623  1.00 44.48  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 30.637  20.101  36.443  1.00 47.53  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.280  19.077  36.599  1.00 37.69  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 30.998  22.002  37.901  1.00 38.22  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.304  21.482  38.154  1.00 43.94  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.512  22.775  39.113  1.00 26.45  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.394  20.612  35.247  1.00 56.63  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 30.948  19.963  34.080  1.00 43.37  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.441  20.231  34.067  1.00 46.69  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 32.887  21.325  34.418  1.00 54.78  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.321  20.503  32.810  1.00 36.84  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 28.931  20.000  32.549  1.00 42.62  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 28.690  18.638  32.359  1.00 45.08  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 27.859  20.900  32.457  1.00 30.88  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.396  18.179  32.120  1.00 46.23  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.575  20.461  32.205  1.00 25.63  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.335  19.100  32.036  1.00 44.93  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.200  19.214  33.672  1.00 42.91  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 34.640  19.306  33.485  1.00 35.27  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.018  19.895  32.126  1.00 40.30  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.150  20.266  31.323  1.00 37.20  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.256  17.922  33.579  1.00 27.98  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 35.727  17.565  34.916  1.00 36.42  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 36.980  18.334  35.326  1.00 50.78  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.599  17.997  36.340  1.00 46.71  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.361  19.369  34.547  1.00 47.41  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.327  19.946  31.875  1.00 37.24  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 36.873  20.528  30.652  1.00 34.30  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.344  19.904  29.393  1.00 28.75  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 35.886  18.777  29.390  1.00 35.09  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.396  20.437  30.641  1.00 34.12  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.026  21.225  31.756  1.00 42.41  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 38.689  22.390  32.000  1.00 47.97  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 39.957  20.598  32.441  1.00 46.86  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.406  20.670  28.320  1.00 26.98  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.153  20.155  26.991  1.00 27.39  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.468  19.788  26.293  1.00 33.76  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.484  20.515  26.382  1.00 36.37  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.395  21.192  26.176  1.00 33.42  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.315  20.770  24.724  1.00 22.51  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.006  21.391  26.790  1.00 33.54  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.438  18.656  25.599  1.00 22.48  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.598  18.160  24.874  1.00 24.98  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.135  19.192  23.870  1.00 39.83  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.347  19.801  23.118  1.00 30.82  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.279  16.841  24.179  1.00 15.19  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 37.805  15.453  25.325  1.00 46.33  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.464  19.378  23.844  1.00 35.16  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.044  20.400  22.970  1.00 40.59  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.529  20.314  21.525  1.00 44.67  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.621  19.259  20.875  1.00 43.25  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.574  20.369  22.992  1.00 43.08  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.138  21.749  23.135  1.00 42.77  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.579  22.210  24.361  1.00 49.16  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.168  22.618  22.059  1.00 47.40  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.068  23.496  24.501  1.00 48.27  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.650  23.897  22.186  1.00 43.16  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.095  24.329  23.406  1.00 52.14  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.587  25.607  23.544  1.00 70.11  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 39.993  21.422  21.018  1.00 44.92  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.305  21.369  19.725  1.00 53.11  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.225  22.709  19.015  1.00 45.85  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.375  23.768  19.611  1.00 41.66  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 37.884  20.759  19.855  1.00 25.92  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 36.901  21.658  20.598  1.00 30.46  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 35.578  20.988  20.915  1.00 36.10  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.539  21.358  20.369  1.00 40.83  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 35.609  19.994  21.792  1.00 35.89  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 38.984  22.625  17.718  1.00 46.40  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 38.803  23.777  16.863  1.00 49.24  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.445  24.399  17.173  1.00 47.75  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.472  23.671  17.365  1.00 50.47  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.864  23.303  15.407  1.00 53.49  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.546  24.379  14.404  1.00 64.05  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.221  24.603  13.967  1.00 45.09  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.569  25.191  13.897  1.00 64.07  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.945  25.603  13.038  1.00 50.20  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.306  26.195  12.976  1.00 56.04  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 38.002  26.400  12.541  1.00 58.58  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.776  27.410  11.619  1.00 58.35  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.372  25.730  17.239  1.00 48.13  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.093  26.423  17.491  1.00 52.34  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 35.561  27.147  16.258  1.00 57.03  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.286  27.914  15.636  1.00 47.27  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.231  27.474  18.576  1.00 45.45  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 34.932  28.226  18.732  1.00 37.33  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 36.654  26.837  19.865  1.00 44.09  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.295  26.923  15.909  1.00 65.54  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 33.771  27.487  14.664  1.00 69.97  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.361  28.952  14.781  1.00 72.20  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 32.678  29.364  15.715  1.00 68.96  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.680  26.598  14.046  1.00 75.68  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 33.277  25.433  13.216  1.00 81.75  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 33.913  25.740  12.167  1.00 84.54  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 33.123  24.233  13.615  1.00 68.09  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 33.833  29.741  13.826  1.00 83.21  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 33.663  31.188  13.852  1.00 90.84  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.164  31.682  12.510  1.00 96.76  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.689  32.662  11.969  1.00 98.36  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 34.995  31.885  14.089  1.00 79.94  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.006  31.209  13.321  1.00 72.27  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 35.342  31.888  15.581  1.00 70.53  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.170  30.992  11.959  1.00 92.58  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 31.610  31.414  10.695  1.00 87.84  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 30.616  32.534  10.963  1.00 88.20  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 30.669  33.589  10.327  1.00 81.87  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 30.952  30.250  9.963   1.00 87.54  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.541  30.647  8.542   1.00 92.81  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 31.760  31.105  7.738   1.00 96.63  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 29.792  29.527  7.827   1.00 89.32  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 29.725  32.310  11.927  1.00 93.05  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 28.774  33.338  12.346  1.00 90.22  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 28.998  33.725  13.799  1.00 94.51  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.341  33.202  14.696  1.00 93.86  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 27.343  32.866  12.120  1.00 82.33  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.056  32.616  10.663  1.00 83.79  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 26.872  33.673  9.786   1.00 79.23  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 26.995  31.324  10.154  1.00 89.91  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 26.619  33.455  8.444   1.00 80.93  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 26.740  31.094  8.809   1.00 89.56  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 26.553  32.166  7.955   1.00 85.02  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 26.296  31.952  6.612   1.00 82.72  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 29.948  34.641  14.031  1.00 99.85  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.332  35.056  15.386  1.00 99.57  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.192  35.708  16.179  1.00 91.50  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.828  36.854  15.907  1.00 86.90  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.467  36.062  15.130  1.00 104.66 ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.028  35.670  13.785  1.00 103.40 ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 30.817  35.241  13.001  1.00 102.61 ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.651  34.977  17.153  1.00 87.61  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.593  35.488  18.014  1.00 85.62  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.236  34.861  17.738  1.00 77.84  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.330  34.881  18.572  1.00 64.29  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.113  34.294  16.546  1.00 78.22  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 24.889  33.660  16.087  1.00 73.10  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 24.578  32.391  16.875  1.00 73.51  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.417  31.500  16.958  1.00 70.60  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.057  33.326  14.609  1.00 68.49  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 23.893  32.626  14.013  1.00 71.15  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 22.612  33.144  14.156  1.00 72.84  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.071  31.461  13.292  1.00 68.36  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 21.525  32.511  13.598  1.00 67.77  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 22.991  30.822  12.731  1.00 67.56  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 21.713  31.349  12.882  1.00 68.84  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.372  32.304  17.438  1.00 77.24  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 22.996  31.170  18.291  1.00 82.84  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 22.956  29.820  17.555  1.00 83.36  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 23.182  28.761  18.148  1.00 80.78  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 21.652  31.431  18.981  1.00 93.12  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.209  30.329  19.952  1.00 105.18 ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 22.021  30.295  21.254  1.00 115.73 ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 22.673  31.317  21.587  1.00 121.39 ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 22.000  29.245  21.945  1.00 112.51 ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 22.663  29.862  16.262  1.00 80.15  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 22.621  28.656  15.466  1.00 72.21  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 23.962  27.943  15.420  1.00 71.14  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 23.988  26.726  15.261  1.00 72.53  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.074  28.677  15.535  1.00 62.21  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.389  28.024  15.592  1.00 53.05  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 26.993  27.954  17.022  1.00 64.60  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 27.614  26.954  17.383  1.00 67.19  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.411  28.575  14.530  1.00 67.91  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.889  29.869  14.911  1.00 74.29  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 26.784  28.650  13.145  1.00 66.78  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 26.781  28.989  17.832  1.00 58.74  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.277  29.022  19.208  1.00 57.95  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 26.754  27.895  20.113  1.00 61.16  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.423  27.522  21.074  1.00 59.11  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 26.941  30.361  19.867  1.00 66.78  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 27.454  31.585  19.121  1.00 82.80  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 28.958  31.754  19.209  1.00 89.85  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 29.604  30.960  19.935  1.00 92.71  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 29.487  32.683  18.550  1.00 88.83  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 25.560  27.375  19.839  1.00 57.68  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.002  26.318  20.684  1.00 50.46  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 25.879  25.057  20.651  1.00 50.31  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 25.898  24.272  21.600  1.00 52.82  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 23.568  25.973  20.273  1.00 44.06  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.468  25.380  18.872  1.00 49.20  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 21.793  25.025  18.307  1.00 59.64  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.511  23.456  19.127  1.00 55.80  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 26.607  24.875  19.555  1.00 40.48  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.490  23.729  19.394  1.00 35.77  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 28.920  23.982  19.943  1.00 42.68  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 29.699  23.053  20.182  1.00 47.37  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.548  23.336  17.912  1.00 28.61  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.205  23.142  17.294  1.00 41.43  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 25.598  23.967  16.401  1.00 48.91  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.303  22.045  17.503  1.00 46.17  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.378  23.462  16.041  1.00 52.92  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.168  22.286  16.710  1.00 52.06  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.341  20.893  18.293  1.00 42.61  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.078  21.418  16.685  1.00 48.43  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.262  20.040  18.275  1.00 40.96  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.143  20.307  17.478  1.00 48.29  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.256  25.245  20.138  1.00 38.42  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 30.577  25.618  20.603  1.00 47.62  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 30.828  25.167  22.045  1.00 50.85  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 29.887  25.035  22.837  1.00 49.70  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 30.766  27.137  20.457  1.00 46.81  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.251  27.534  19.070  1.00 47.46  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 31.752  26.705  18.303  1.00 54.11  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.106  28.802  18.745  1.00 47.59  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.105  24.921  22.381  1.00 43.17  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 32.548  24.480  23.719  1.00 39.03  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.107  25.454  24.785  1.00 40.55  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.180  26.651  24.551  1.00 45.33  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.082  24.487  23.619  1.00 31.46  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.379  24.343  22.169  1.00 38.06  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.190  24.913  21.387  1.00 36.80  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 31.688  24.951  25.942  1.00 42.49  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.068  25.777  26.977  1.00 31.50  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 31.733  25.607  28.335  1.00 39.16  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.179  25.969  29.362  1.00 48.28  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.545  25.499  27.054  1.00 25.47  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.205  24.085  27.591  1.00 43.99  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.016  23.155  27.538  1.00 33.96  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 27.995  23.937  28.110  1.00 37.95  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 32.921  25.023  28.330  1.00 45.01  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 33.745  24.884  29.523  1.00 42.25  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.123  25.040  28.957  1.00 32.63  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.270  25.048  27.749  1.00 29.11  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 33.577  23.501  30.176  1.00 42.32  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 32.512  23.450  31.254  1.00 40.69  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 32.851  24.397  32.414  1.00 60.15  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 31.807  24.349  33.416  1.00 77.31  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.593  24.860  33.228  1.00 94.55  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.299  25.480  32.087  1.00 85.30  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.669  24.754  34.177  1.00 108.33 ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.134  25.175  29.801  1.00 33.88  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 37.482  25.409  29.296  1.00 36.68  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.054  24.285  28.401  1.00 39.00  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 37.851  23.098  28.671  1.00 37.46  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 38.411  25.638  30.465  1.00 36.03  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 39.842  25.732  30.054  1.00 46.65  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 40.776  25.666  31.238  1.00 55.53  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.365  26.088  32.343  1.00 43.06  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 41.919  25.187  31.055  1.00 65.37  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 38.787  24.670  27.353  1.00 41.75  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 39.503  23.706  26.487  1.00 42.49  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 40.758  23.149  27.132  1.00 35.19  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 41.496  23.868  27.791  1.00 38.43  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 39.886  24.328  25.148  1.00 37.74  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 38.700  24.773  24.298  1.00 34.35  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.181  25.135  22.933  1.00 31.88  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 37.699  23.629  24.204  1.00 47.45  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 40.990  21.862  26.950  1.00 35.71  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.096  21.203  27.632  1.00 37.11  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.272  19.747  27.213  1.00 39.57  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.297  19.049  26.922  1.00 35.46  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 41.896  21.279  29.151  1.00 35.96  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 42.724  20.352  29.846  1.00 33.43  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 43.521  19.294  27.192  1.00 36.82  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 43.808  17.911  26.874  1.00 27.20  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.429  17.001  28.024  1.00 31.53  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.258  15.796  27.829  1.00 36.52  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.271  17.720  26.520  1.00 28.68  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 45.691  18.280  25.181  1.00 36.46  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 46.990  17.623  24.703  1.00 50.36  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 46.944  16.432  24.261  1.00 47.69  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.049  18.296  24.802  1.00 50.39  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.319  17.585  29.219  1.00 32.51  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 42.814  16.896  30.414  1.00 36.25  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.304  17.069  30.412  1.00 43.81  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 40.757  18.113  30.789  1.00 45.80  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 43.395  17.515  31.673  1.00 32.19  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 42.878  16.863  32.933  1.00 43.78  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.283  15.763  32.876  1.00 45.31  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 43.097  17.453  33.997  1.00 55.16  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 40.641  15.994  30.049  1.00 39.52  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.569  16.079  29.103  1.00 41.06  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 38.554  14.967  29.345  1.00 39.82  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.380  15.114  29.039  1.00 39.72  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 40.292  15.803  27.796  1.00 42.14  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 39.415  15.943  26.381  1.00 37.03  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.045  13.858  29.899  1.00 34.39  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 38.367  12.574  29.889  1.00 38.59  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 37.497  12.393  31.142  1.00 45.64  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 37.931  11.830  32.152  1.00 39.40  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 39.399  11.442  29.731  1.00 35.88  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.092  11.457  28.360  1.00 40.51  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 40.977  10.252  28.067  1.00 27.06  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.029  11.573  27.284  1.00 43.24  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 36.264  12.897  31.064  1.00 41.47  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 35.340  12.856  32.188  1.00 34.32  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 33.996  12.459  31.658  1.00 35.09  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 33.705  12.741  30.515  1.00 49.66  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 35.255  14.210  32.891  1.00 34.87  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 36.581  14.684  33.454  1.00 47.54  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 36.934  14.435  34.785  1.00 45.91  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 37.497  15.362  32.646  1.00 51.00  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 38.171  14.847  35.286  1.00 44.26  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 38.722  15.785  33.140  1.00 50.73  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.054  15.528  34.454  1.00 45.72  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 40.268  15.958  34.917  1.00 37.95  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.186  11.774  32.456  1.00 32.33  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 31.814  11.514  32.032  1.00 38.58  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 30.819  12.105  33.028  1.00 41.92  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.188  12.497  34.134  1.00 50.25  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 31.571  10.020  31.799  1.00 28.95  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 31.899  9.131   32.995  1.00 30.05  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 30.738  9.105   33.966  1.00 27.83  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.272  7.718   32.545  1.00 26.46  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 29.559  12.164  32.616  1.00 31.78  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 28.476  12.705  33.442  1.00 37.50  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 27.388  11.672  33.642  1.00 35.84  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.180  10.825  32.778  1.00 44.35  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 27.890  13.959  32.786  1.00 30.35  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 28.968  14.878  32.268  1.00 31.77  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 29.151  15.045  31.050  1.00 30.72  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.733  15.442  33.194  1.00 26.02  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 26.715  11.734  34.788  1.00 32.81  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 25.589  10.859  35.083  1.00 38.84  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 24.367  11.616  35.610  1.00 37.27  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 24.478  12.390  36.548  1.00 46.49  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 25.966  9.810   36.131  1.00 38.90  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 24.762  8.918   36.415  1.00 39.66  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.141  9.000   35.647  1.00 34.07  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.207  11.394  35.004  1.00 30.15  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 21.944  11.904  35.545  1.00 37.18  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.073  10.711  35.922  1.00 41.68  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 20.980  9.731   35.172  1.00 41.15  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.168  12.733  34.514  1.00 41.14  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 21.727  14.100  34.120  1.00 44.54  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 21.350  15.333  34.615  1.00 46.25  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 22.695  14.361  33.107  1.00 40.71  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.037  16.336  33.971  1.00 38.82  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 22.872  15.765  33.046  1.00 40.69  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.434  13.555  32.243  1.00 44.71  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 23.765  16.361  32.165  1.00 42.42  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.313  14.153  31.363  1.00 46.10  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.474  15.544  31.334  1.00 44.69  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 20.431  10.794  37.081  1.00 38.49  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 19.532  9.745   37.543  1.00 37.24  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 18.351  10.447  38.172  1.00 42.71  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 18.457  11.622  38.524  1.00 42.94  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.174  8.846   38.629  1.00 41.20  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 20.373  9.615   39.810  1.00 49.99  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 21.500  8.336   38.204  1.00 39.96  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 17.215  9.737   38.313  1.00 43.68  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.101  10.273  39.096  1.00 40.52  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 16.591  10.660  40.475  1.00 47.15  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 17.650  10.192  40.893  1.00 49.64  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 15.151  9.085   39.209  1.00 38.07  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 15.410  8.303   37.972  1.00 39.91  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 16.891  8.430   37.724  1.00 43.45  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 15.844  11.521  41.154  1.00 48.13  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.124  11.872  42.532  1.00 49.01  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 14.833  11.655  43.305  1.00 59.36  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 13.800  12.247  42.988  1.00 66.49  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.566  13.327  42.629  1.00 45.44  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 16.891  13.830  44.030  1.00 43.88  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.199  14.065  44.423  1.00 49.33  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 15.891  14.105  44.940  1.00 42.07  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 18.494  14.552  45.701  1.00 52.37  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.175  14.589  46.215  1.00 44.65  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.472  14.818  46.590  1.00 47.21  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 17.751  15.293  47.858  1.00 41.81  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 14.879  10.782  44.311  1.00 56.10  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.098  10.063  44.688  1.00 49.78  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.350  8.978   43.685  1.00 50.48  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 15.505  8.794   42.799  1.00 52.41  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 15.734  9.408   46.018  1.00 44.59  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.336  9.883   46.347  1.00 46.82  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 13.711  10.323  45.076  1.00 52.98  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 17.469  8.268   43.834  1.00 48.28  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 17.902  7.276   42.850  1.00 43.22  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 16.921  6.124   42.764  1.00 51.28  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 16.162  5.884   43.692  1.00 56.27  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 19.323  6.787   43.143  1.00 41.03  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 20.383  7.894   43.006  1.00 54.35  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 21.781  7.301   43.004  1.00 62.01  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.096  6.702   44.294  1.00 59.78  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 22.477  7.419   45.337  1.00 52.63  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 22.592  8.725   45.213  1.00 56.12  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 22.746  6.842   46.486  1.00 54.98  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 16.911  5.424   41.626  1.00 60.68  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 15.940  4.359   41.370  1.00 65.49  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 15.977  3.206   42.374  1.00 71.85  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.047  2.821   42.878  1.00 68.13  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.344  3.867   39.980  1.00 62.58  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 16.973  5.026   39.345  1.00 53.60  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.709  5.731   40.429  1.00 57.64  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 14.788  2.666   42.637  1.00 77.63  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 14.605  1.500   43.494  1.00 86.99  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 15.242  0.254   42.874  1.00 84.52  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 16.247  -0.280  43.365  1.00 75.73  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 13.115  1.258   43.711  1.00 89.91  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 14.625  -0.207  41.795  1.00 76.25  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.131  -1.326  41.038  1.00 69.01  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.088  -0.803  39.979  1.00 64.64  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 15.999  0.350   39.570  1.00 55.03  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 13.959  -2.028  40.377  1.00 75.14  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 12.935  -1.083  40.118  1.00 82.55  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.019  -1.649  39.534  1.00 62.15  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 17.939  -1.280  38.459  1.00 68.43  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.229  -0.766  37.186  1.00 63.42  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.354  -1.422  36.616  1.00 58.12  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 18.708  -2.593  38.203  1.00 60.76  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 17.879  -3.640  38.847  1.00 52.16  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.342  -2.977  40.055  1.00 50.19  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 17.646  0.418   36.750  1.00 55.01  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.040  1.125   35.628  1.00 51.34  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 17.904  0.995   34.387  1.00 41.54  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.124  1.035   34.486  1.00 46.05  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 16.920  2.622   35.961  1.00 54.10  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.323  2.772   37.256  1.00 50.26  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.104  3.364   34.898  1.00 53.45  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.276  0.850   33.212  1.00 37.64  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.031  0.725   31.958  1.00 46.81  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 18.784  2.011   31.660  1.00 48.18  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 18.294  3.112   31.933  1.00 49.00  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 16.938  0.502   30.906  1.00 45.96  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 15.708  0.137   31.691  1.00 39.15  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 15.828  0.840   32.984  1.00 36.63  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 19.975  1.872   31.098  1.00 45.32  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 20.877  3.010   30.954  1.00 35.94  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 20.987  3.503   29.512  1.00 34.13  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.132  2.710   28.593  1.00 48.81  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 22.282  2.621   31.432  1.00 36.47  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 23.228  3.811   31.310  1.00 38.12  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.231  2.073   32.862  1.00 36.24  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 20.921  4.811   29.313  1.00 35.51  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.243  5.396   28.013  1.00 38.71  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 22.610  6.058   28.056  1.00 37.48  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 22.912  6.822   28.979  1.00 40.21  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.200  6.430   27.605  1.00 39.45  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 18.794  5.944   27.299  1.00 42.88  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 17.854  7.114   27.255  1.00 44.02  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 18.826  5.275   25.961  1.00 51.66  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 23.435  5.772   27.057  1.00 27.79  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 24.713  6.468   26.926  1.00 31.52  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 24.750  7.322   25.667  1.00 33.95  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 24.625  6.800   24.555  1.00 37.94  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 25.872  5.483   26.819  1.00 31.54  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 25.807  4.498   27.969  1.00 31.77  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.202  6.233   26.770  1.00 24.32  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 26.994  3.621   28.050  1.00 36.00  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 24.945  8.627   25.840  1.00 30.62  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.013  9.544   24.706  1.00 35.55  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 26.438  9.713   24.215  1.00 40.56  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.342  9.874   25.019  1.00 39.16  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 24.474  10.910  25.098  1.00 37.30  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 24.604  11.947  24.013  1.00 38.96  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 25.434  13.036  24.004  1.00 33.19  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 23.861  12.001  22.796  1.00 41.43  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.253  13.758  22.856  1.00 36.87  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.295  13.144  22.094  1.00 40.82  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 22.869  11.200  22.230  1.00 43.01  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 23.760  13.509  20.867  1.00 44.34  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.345  11.555  20.999  1.00 41.47  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 22.795  12.699  20.332  1.00 44.61  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 26.627  9.676   22.897  1.00 40.92  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 27.909  9.986   22.300  1.00 35.00  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 27.797  11.147  21.333  1.00 40.95  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.240  10.987  20.239  1.00 42.25  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 28.467  8.819   21.520  1.00 33.15  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 28.289  7.525   22.306  1.00 28.43  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 29.970  9.084   21.210  1.00 16.33  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.308  6.449   21.933  1.00 16.42  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.360  12.299  21.711  1.00 33.25  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.180  13.505  20.899  1.00 35.69  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 28.830  13.369  19.532  1.00 38.32  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 29.777  12.613  19.359  1.00 37.92  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 28.681  14.773  21.620  1.00 41.56  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.154  14.754  22.044  1.00 39.67  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.182  14.842  21.098  1.00 33.44  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.505  14.674  23.390  1.00 28.93  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.517  14.824  21.490  1.00 39.55  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 31.817  14.662  23.800  1.00 28.03  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 32.834  14.734  22.855  1.00 43.04  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.162  14.709  23.278  1.00 34.31  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.305  14.098  18.555  1.00 42.60  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 28.993  14.256  17.285  1.00 37.44  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 29.786  15.559  17.273  1.00 38.49  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 29.966  16.211  18.319  1.00 29.26  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.230  15.959  16.082  1.00 38.79  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.098  17.114  15.909  1.00 32.83  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.239  16.858  14.925  1.00 34.10  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.324  17.419  15.070  1.00 34.07  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 31.989  15.994  13.940  1.00 25.93  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 32.921  15.693  12.870  1.00 25.29  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.203  14.988  13.303  1.00 39.46  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.162  14.890  12.518  1.00 36.98  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.228  14.507  14.548  1.00 33.63  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.441  13.949  15.141  1.00 34.59  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.553  15.018  15.395  1.00 41.24  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 37.705  14.694  15.706  1.00 38.25  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 35.959  12.807  14.272  1.00 28.60  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.072  11.594  14.251  1.00 33.43  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 34.947  10.785  15.377  1.00 36.02  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.407  11.224  13.083  1.00 34.08  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.162  9.639   15.345  1.00 33.65  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 33.615  10.097  13.043  1.00 34.69  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.496  9.296   14.172  1.00 37.77  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.190  16.289  15.261  1.00 36.93  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.083  17.392  15.573  1.00 38.92  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.452  18.376  16.592  1.00 34.17  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.015  19.422  16.903  1.00 37.50  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.474  18.126  14.287  1.00 42.30  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.359  18.986  13.745  1.00 47.25  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.145  20.273  14.242  1.00 42.87  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.509  18.511  12.749  1.00 42.04  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.118  21.061  13.761  1.00 46.64  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.492  19.294  12.257  1.00 42.36  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.295  20.571  12.770  1.00 46.66  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.270  21.362  12.306  1.00 50.69  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.274  18.052  17.102  1.00 29.05  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 34.657  18.887  18.127  1.00 38.77  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.551  18.151  18.856  1.00 40.57  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.206  17.023  18.498  1.00 32.58  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.099  20.194  17.543  1.00 30.98  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.425  19.958  16.320  1.00 30.93  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 32.985  18.822  19.856  1.00 31.26  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 31.986  18.222  20.705  1.00 27.01  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.323  18.193  22.177  1.00 31.93  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.475  18.196  22.564  1.00 45.16  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.282  18.158  22.992  1.00 40.97  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.402  18.108  24.434  1.00 47.62  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.065  17.553  24.975  1.00 44.11  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.032  17.800  24.388  1.00 41.46  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 31.696  19.509  24.981  1.00 34.61  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.093  16.794  26.067  1.00 38.27  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 28.881  16.202  26.626  1.00 35.58  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.160  17.213  27.513  1.00 42.54  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.031  16.976  27.977  1.00 46.97  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 29.198  14.927  27.424  1.00 26.69  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 28.807  18.354  27.712  1.00 34.00  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.303  19.372  28.626  1.00 32.74  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 27.420  20.439  27.967  1.00 36.10  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 26.908  21.316  28.663  1.00 40.39  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 29.472  20.046  29.341  1.00 23.88  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.329  20.623  28.375  1.00 24.14  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.251  20.385  26.643  1.00 35.02  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.312  21.281  25.949  1.00 35.47  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 24.873  21.147  26.460  1.00 34.50  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.394  20.064  26.792  1.00 37.30  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.298  21.015  24.448  1.00 38.37  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 27.630  20.979  23.726  1.00 39.85  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 27.362  20.784  22.287  1.00 32.59  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 28.383  22.267  23.973  1.00 42.14  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.180  22.262  26.473  1.00 36.28  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 22.796  22.300  26.879  1.00 35.29  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 21.900  21.290  26.127  1.00 42.41  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.050  20.638  26.746  1.00 44.24  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.280  23.716  26.698  1.00 31.91  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 22.888  24.713  27.696  1.00 44.26  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.607  24.330  28.642  1.00 47.59  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 22.633  25.918  27.531  1.00 59.42  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.087  21.134  24.815  1.00 36.88  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.258  20.181  24.062  1.00 38.69  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.456  18.725  24.471  1.00 41.03  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 20.674  17.852  24.085  1.00 40.86  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.432  20.264  22.513  1.00 27.57  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 20.932  21.578  21.999  1.00 37.15  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 22.880  20.013  22.097  1.00 29.63  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.514  18.440  25.214  1.00 35.16  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 22.684  17.081  25.690  1.00 35.58  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.318  16.937  27.169  1.00 37.56  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 22.697  15.963  27.802  1.00 39.72  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.103  16.596  25.447  1.00 40.04  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 24.640  16.829  24.052  1.00 37.19  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 23.843  16.597  22.922  1.00 27.33  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 25.962  17.276  23.861  1.00 30.11  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.346  16.798  21.638  1.00 29.06  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.480  17.479  22.580  1.00 25.38  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 25.682  17.239  21.472  1.00 33.69  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.209  17.447  20.207  1.00 24.63  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 21.580  17.908  27.705  1.00 37.78  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.174  17.903  29.111  1.00 41.44  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.223  16.733  29.415  1.00 43.48  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.082  16.694  28.954  1.00 37.11  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 20.523  19.248  29.474  1.00 36.78  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.179  19.371  30.960  1.00 42.15  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.273  18.397  31.724  1.00 52.96  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 19.812  20.471  31.377  1.00 42.13  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 20.702  15.779  30.200  1.00 41.60  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 19.897  14.625  30.525  1.00 38.72  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 18.957  14.804  31.702  1.00 39.49  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.387  13.821  32.173  1.00 38.49  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 18.774  16.036  32.178  1.00 38.01  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 17.907  16.244  33.338  1.00 39.80  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 16.459  15.834  33.035  1.00 48.25  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 15.754  15.375  33.933  1.00 40.03  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.003  17.674  33.927  1.00 28.00  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.103  18.749  33.296  1.00 36.93  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 17.286  20.112  33.979  1.00 39.42  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 18.681  20.542  33.896  1.00 46.62  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.282  21.379  34.742  1.00 50.84  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 20.563  21.680  34.561  1.00 52.30  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 18.621  21.907  35.773  1.00 43.57  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.038  15.963  31.772  1.00 47.14  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 14.642  15.722  31.388  1.00 42.48  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 14.284  14.257  31.212  1.00 46.28  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.224  13.809  31.688  1.00 47.38  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.290  16.494  30.127  1.00 34.54  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 14.620  17.941  30.219  1.00 45.20  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 13.891  18.775  31.037  1.00 47.42  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 15.680  18.472  29.506  1.00 50.58  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.205  20.125  31.131  1.00 51.59  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 15.997  19.818  29.601  1.00 45.77  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.271  20.642  30.420  1.00 41.15  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.144  13.523  30.508  1.00 36.01  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 14.956  12.089  30.337  1.00 35.05  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.075  11.382  31.684  1.00 44.57  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 14.399  10.367  31.937  1.00 47.90  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 15.973  11.503  29.366  1.00 34.52  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 15.781  11.733  27.876  1.00 40.34  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.064  11.439  27.181  1.00 41.41  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 14.675  10.861  27.324  1.00 53.03  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 15.929  11.912  32.556  1.00 40.87  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.069  11.319  33.892  1.00 51.12  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 14.775  11.488  34.698  1.00 52.82  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 14.202  10.513  35.186  1.00 52.26  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 17.274  11.902  34.644  1.00 46.14  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 14.316  12.731  34.801  1.00 54.02  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.103  13.084  35.541  1.00 54.61  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 11.844  12.455  34.952  1.00 56.00  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.095  11.768  35.650  1.00 60.26  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 12.936  14.606  35.579  1.00 50.53  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.100  15.134  36.728  1.00 57.73  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 10.582  14.949  36.553  1.00 61.43  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.029  15.048  35.446  1.00 59.27  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 9.904   14.705  37.665  1.00 58.37  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 11.612  12.688  33.667  1.00 51.35  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 10.329  12.344  33.089  1.00 53.87  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.205  10.865  32.741  1.00 53.58  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.133   10.290  32.886  1.00 54.05  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 9.970   13.244  31.881  1.00 51.51  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 8.693   12.761  31.235  1.00 42.77  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 9.786   14.688  32.335  1.00 46.52  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 11.294  10.244  32.305  1.00 49.84  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.237  8.827   31.951  1.00 48.49  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 11.862  7.888   32.981  1.00 46.83  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 11.817  6.668   32.809  1.00 43.71  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 11.851  8.574   30.571  1.00 49.34  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.010  9.106   29.415  1.00 59.59  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 9.663   8.415   29.276  1.00 73.11  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 9.564   7.199   29.592  1.00 79.27  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 8.705   9.094   28.836  1.00 78.28  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 12.447  8.452   34.034  1.00 53.56  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 13.141  7.673   35.052  1.00 51.45  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 14.473  7.096   34.601  1.00 50.63  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.034  6.235   35.276  1.00 48.62  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 14.978  7.577   33.463  1.00 50.92  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.200  7.043   32.838  1.00 45.93  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 17.461  7.384   33.606  1.00 46.32  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 17.549  8.428   34.259  1.00 48.93  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 16.336  7.565   31.433  1.00 33.79  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 18.441  6.498   33.516  1.00 39.07  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 19.782  6.816   33.965  1.00 41.90  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 20.598  7.217   32.736  1.00 43.16  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 20.765  6.439   31.811  1.00 44.00  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 20.442  5.621   34.656  1.00 38.70  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 21.959  5.868   34.795  1.00 31.90  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 19.781  5.372   36.007  1.00 36.42  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.104  8.435   32.708  1.00 42.46  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 21.763  8.887   31.496  1.00 43.84  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.233  9.220   31.712  1.00 42.78  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 23.597  9.941   32.654  1.00 38.20  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.015  10.067  30.873  1.00 39.93  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 21.321  10.195  29.384  1.00 44.82  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.064  10.555  28.605  1.00 45.07  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.455  11.203  29.156  1.00 47.17  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.067  8.689   30.824  1.00 31.55  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 25.492  8.886   30.909  1.00 32.27  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.015  9.475   29.627  1.00 39.35  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 25.593  9.069   28.546  1.00 44.07  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.223  7.547   31.102  1.00 37.76  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 27.727  7.783   31.184  1.00 41.93  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 25.726  6.847   32.338  1.00 33.51  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 26.963  10.401  29.745  1.00 32.67  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 27.670  10.922  28.569  1.00 32.86  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.148  11.185  28.852  1.00 31.79  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 29.539  11.586  29.952  1.00 26.74  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.017  12.208  28.082  1.00 27.93  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.006  13.175  29.116  1.00 30.96  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 29.983  10.964  27.857  1.00 31.44  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.419  11.055  28.091  1.00 37.63  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.097  12.012  27.136  1.00 39.06  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 31.672  12.176  25.990  1.00 44.84  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.070  9.699   27.919  1.00 35.06  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.368  9.368   26.459  1.00 47.06  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 30.941  8.757   25.530  1.00 39.04  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 30.775  7.123   26.209  1.00 19.97  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.143  12.658  27.628  1.00 28.39  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.068  13.348  26.750  1.00 25.63  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.024  12.325  26.144  1.00 27.77  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.430  11.386  26.819  1.00 27.16  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 34.817  14.452  27.491  1.00 25.12  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 33.935  15.648  27.784  1.00 37.54  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 32.746  15.660  27.434  1.00 35.81  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 34.506  16.663  28.428  1.00 27.65  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.331  12.476  24.857  1.00 23.56  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.320  11.624  24.228  1.00 34.34  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.184  12.526  23.358  1.00 39.87  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 36.707  13.563  22.921  1.00 37.43  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 35.666  10.479  23.435  1.00 37.29  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 34.830  10.934  22.275  1.00 40.70  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.473  11.227  22.433  1.00 35.57  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.393  11.084  21.013  1.00 44.38  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 32.698  11.661  21.350  1.00 31.29  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 34.632  11.516  19.936  1.00 40.81  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.291  11.796  20.106  1.00 31.42  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.569  12.222  19.023  1.00 32.41  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.451  12.166  23.143  1.00 31.80  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.339  13.034  22.394  1.00 26.87  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 38.957  13.207  20.912  1.00 27.71  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.804  12.249  20.162  1.00 30.83  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 40.798  12.593  22.546  1.00 39.35  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.430  12.980  23.881  1.00 42.40  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 42.746  12.243  24.105  1.00 39.65  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.528  10.806  24.253  1.00 40.25  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.493  9.891   24.214  1.00 38.60  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 44.759  10.246  24.004  1.00 33.46  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.185  8.613   24.370  1.00 29.07  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 38.811  14.453  20.493  1.00 28.58  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 38.596  14.730  19.090  1.00 29.53  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 39.860  15.277  18.407  1.00 42.14  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 40.899  15.516  19.056  1.00 41.93  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.404  15.686  18.896  1.00 31.74  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.118  15.007  19.337  1.00 28.73  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 37.604  16.978  19.666  1.00 27.25  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 39.759  15.442  17.091  1.00 37.51  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 40.848  15.943  16.270  1.00 37.66  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.099  15.084  16.251  1.00 42.88  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.044  13.859  16.326  1.00 36.16  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.248  15.741  16.139  1.00 45.73  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.510  15.029  16.210  1.00 38.55  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 44.625  14.204  17.513  1.00 42.08  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 44.860  12.994  17.485  1.00 44.32  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 45.716  15.990  16.010  1.00 45.71  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.642  17.098  16.918  1.00 45.73  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 45.730  16.505  14.588  1.00 40.88  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.416  14.863  18.647  1.00 35.46  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.555  14.246  19.963  1.00 29.08  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 43.813  12.928  20.091  1.00 36.85  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.264  12.042  20.810  1.00 38.33  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.072  15.232  21.035  1.00 20.03  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.568  16.617  20.815  1.00 29.70  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 45.862  16.985  21.235  1.00 31.27  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 43.782  17.545  20.134  1.00 29.58  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.341  18.250  21.002  1.00 30.46  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.249  18.830  19.901  1.00 34.79  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.530  19.184  20.327  1.00 41.64  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 42.677  12.817  19.399  1.00 34.63  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 41.891  11.605  19.419  1.00 30.28  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 41.980  10.689  18.207  1.00 32.62  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 41.617  9.520   18.318  1.00 38.56  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.448  11.191  17.061  1.00 30.59  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.416  10.396  15.822  1.00 31.04  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 43.608  10.439  14.899  1.00 36.45  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 43.618  9.745   13.882  1.00 38.18  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.137  10.683  15.030  1.00 27.47  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 39.930  10.307  15.784  1.00 33.80  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 39.530  8.994   15.829  1.00 31.31  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.260  11.246  16.558  1.00 36.67  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 38.430  8.637   16.573  1.00 41.34  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.181  10.881  17.324  1.00 36.64  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 37.760  9.584   17.327  1.00 37.07  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 44.609  11.243  15.227  1.00 36.41  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 45.822  11.266  14.419  1.00 29.40  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 46.513  9.927   14.536  1.00 31.48  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 46.719  9.410   15.626  1.00 33.97  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 46.767  12.363  14.884  1.00 34.14  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.094  12.380  14.120  1.00 44.09  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 48.597  13.811  13.985  1.00 37.82  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.167  11.433  14.756  1.00 25.61  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 46.880  9.353   13.413  1.00 35.86  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.463  8.030   13.468  1.00 39.05  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 48.604  7.795   12.477  1.00 41.23  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 48.593  8.243   11.336  1.00 40.82  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.372  6.974   13.305  1.00 35.70  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 49.609  7.083   12.937  1.00 47.23  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 50.582  6.534   12.024  1.00 43.33  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.384  5.047   12.152  1.00 41.28  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 50.996  4.408   12.992  1.00 39.50  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 51.964  6.974   12.445  1.00 39.38  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.033  8.466   12.173  1.00 39.76  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 52.848  9.160   13.220  1.00 56.33  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 52.580  8.732   10.790  1.00 41.24  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 49.474  4.496   11.345  1.00 42.60  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.012  3.120   11.556  1.00 43.36  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.185  2.138   11.646  1.00 50.26  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.143  2.224   10.880  1.00 46.54  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.165  2.839   10.321  1.00 36.12  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 47.845  4.153   9.759   1.00 38.88  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 48.986  5.052   10.080  1.00 39.87  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.108  1.222   12.602  1.00 53.98  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.155  0.245   12.794  1.00 50.60  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.125  0.620   13.891  1.00 52.00  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 52.749  -0.236  14.492  1.00 63.25  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.260  1.906   14.155  1.00 48.48  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.175  2.365   15.186  1.00 45.81  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 52.678  2.090   16.608  1.00 48.03  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.487  1.816   16.852  1.00 47.51  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.422  3.859   15.029  1.00 46.54  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.313  4.590   15.515  1.00 45.53  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 53.603  2.195   17.553  1.00 49.43  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.291  1.952   18.949  1.00 62.28  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 52.712  3.219   19.594  1.00 64.95  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 51.811  3.156   20.439  1.00 59.01  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.568  1.528   19.679  1.00 71.74  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.349  0.843   21.010  1.00 85.20  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 55.464  1.215   21.982  1.00 98.92  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.071  2.330   22.846  1.00 106.27 ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 55.863  3.347   23.176  1.00 106.23 ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 57.102  3.409   22.696  1.00 109.35 ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 55.405  4.311   23.972  1.00 98.70  ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.232  4.369   19.172  1.00 63.53  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.012  5.624   19.872  1.00 60.18  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 51.818  6.445   19.354  1.00 59.00  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.441  7.459   19.966  1.00 54.88  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.293  6.462   19.837  1.00 64.53  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 55.566  5.694   20.178  1.00 73.88  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.245  5.060   18.961  1.00 80.40  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 55.546  4.607   18.022  1.00 78.75  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 57.492  5.013   18.955  1.00 78.86  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.224  6.002   18.245  1.00 47.69  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.074  6.694   17.659  1.00 48.91  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.305  5.764   16.752  1.00 44.58  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.261  5.954   15.533  1.00 41.55  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 50.515  7.932   16.894  1.00 50.82  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 48.676  4.762   17.358  1.00 41.97  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.021  3.639   16.677  1.00 33.80  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 46.744  4.061   16.006  1.00 45.17  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.242  3.297   15.189  1.00 55.42  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 47.654  2.704   17.814  1.00 23.94  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 48.025  3.423   19.120  1.00 29.55  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 48.378  4.813   18.797  1.00 37.60  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.216  5.231   16.368  1.00 46.02  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 44.949  5.705   15.841  1.00 44.30  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 43.747  5.236   16.647  1.00 41.56  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 43.862  4.374   17.522  1.00 46.53  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 42.592  5.816   16.342  1.00 31.83  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.329  5.473   16.988  1.00 33.38  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.258  5.641   18.518  1.00 39.90  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.344  5.117   19.146  1.00 46.35  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 40.900  4.060   16.601  1.00 27.06  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 40.696  3.902   15.098  1.00 42.26  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.117  4.770   14.434  1.00 44.27  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.150  2.774   14.558  1.00 36.75  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.193  6.364   19.120  1.00 30.32  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.201  6.427   20.572  1.00 24.63  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 40.976  7.175   21.095  1.00 32.53  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 40.591  7.010   22.250  1.00 33.26  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 43.509  7.031   21.146  1.00 34.46  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 44.710  6.304   20.596  1.00 35.61  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 43.605  8.531   20.863  1.00 35.00  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.354  7.991   20.249  1.00 28.45  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.095  8.615   20.624  1.00 27.17  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 37.999  7.572   20.850  1.00 30.72  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.276  7.640   21.829  1.00 28.94  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 37.868  6.616   19.931  1.00 24.61  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 36.997  5.469   20.137  1.00 31.64  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.316  4.680   21.418  1.00 37.04  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 36.409  4.217   22.123  1.00 40.70  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.052  4.545   18.925  1.00 31.70  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.515  5.248   17.687  1.00 36.91  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 36.845  4.443   16.457  1.00 31.57  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 34.990  5.528   17.808  1.00 26.14  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 38.598  4.530   21.719  1.00 31.33  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.002  3.859   22.938  1.00 32.92  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 38.633  4.643   24.207  1.00 39.44  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.319  4.038   25.226  1.00 39.70  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 40.496  3.541   22.913  1.00 33.80  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.017  2.603   21.813  1.00 36.86  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 42.499  2.420   21.987  1.00 39.07  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 40.335  1.249   21.802  1.00 32.64  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 38.676  5.975   24.158  1.00 40.28  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.151  6.791   25.255  1.00 38.13  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 36.687  6.387   25.499  1.00 43.78  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.243  6.167   26.632  1.00 41.84  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.218  8.282   24.907  1.00 38.12  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 39.652  8.797   24.755  1.00 49.98  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 40.584  8.079   25.161  1.00 45.50  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 39.848  9.924   24.236  1.00 51.19  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 35.940  6.265   24.411  1.00 42.22  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.541  5.913   24.485  1.00 43.15  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.349  4.510   25.044  1.00 45.48  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 33.406  4.260   25.822  1.00 43.47  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 33.906  6.004   23.101  1.00 44.97  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 33.874  7.399   22.514  1.00 44.29  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.384  7.413   21.075  1.00 50.05  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.516  8.419   20.394  1.00 48.45  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 32.802  6.303   20.613  1.00 46.94  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.209  3.583   24.631  1.00 36.24  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.033  2.196   25.063  1.00 40.28  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 35.340  2.094   26.545  1.00 44.15  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 34.668  1.369   27.278  1.00 39.08  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 35.919  1.252   24.258  1.00 42.09  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 35.926  -0.157  24.788  1.00 42.70  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 36.856  -1.041  23.998  1.00 36.86  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.328  -1.384  22.681  1.00 35.85  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.075  -1.834  21.671  1.00 42.52  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 38.392  -1.974  21.826  1.00 44.55  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 36.515  -2.126  20.495  1.00 30.85  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.346  2.854   26.979  1.00 46.96  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 36.775  2.862   28.374  1.00 42.10  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 35.669  3.404   29.256  1.00 37.07  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.466  2.928   30.364  1.00 35.80  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.050  3.695   28.565  1.00 32.59  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 38.459  3.969   30.015  1.00 25.70  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 38.691  2.652   30.739  1.00 21.82  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 39.696  4.834   30.085  1.00 30.35  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 34.965  4.416   28.769  1.00 34.34  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 33.777  4.883   29.480  1.00 39.03  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 32.652  3.825   29.485  1.00 33.86  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 31.993  3.673   30.490  1.00 38.52  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.285  6.282   28.962  1.00 19.32  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 32.446  3.071   28.405  1.00 34.45  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 31.437  1.995   28.464  1.00 42.68  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 31.797  0.969   29.542  1.00 45.65  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 30.913  0.527   30.286  1.00 42.49  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.146  1.310   27.103  1.00 23.18  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 30.895  2.251   25.901  1.00 35.04  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.425  1.517   24.664  1.00 31.71  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 29.919  3.388   26.240  1.00 33.08  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.084  0.615   29.643  1.00 36.53  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 33.521  -0.318  30.677  1.00 43.05  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 33.217  0.271   32.054  1.00 48.28  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 32.763  -0.420  32.983  1.00 46.26  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.016  -0.600  30.568  1.00 41.74  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 35.394  -1.579  29.482  1.00 51.14  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 36.827  -1.357  28.975  1.00 59.11  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 37.258  -1.998  28.025  1.00 54.25  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.555  -0.435  29.603  1.00 59.63  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 33.472  1.565   32.175  1.00 43.10  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 33.198  2.256   33.406  1.00 36.29  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 31.733  2.142   33.766  1.00 34.29  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 31.405  1.973   34.931  1.00 30.60  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 33.584  3.722   33.312  1.00 26.77  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 33.407  4.460   34.635  1.00 35.08  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 34.363  4.705   35.565  1.00 34.54  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.194  5.026   35.156  1.00 40.45  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 33.838  5.397   36.631  1.00 35.94  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 32.507  5.615   36.397  1.00 47.26  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 30.884  5.097   34.694  1.00 35.88  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 31.551  6.264   37.180  1.00 54.92  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 29.942  5.745   35.469  1.00 44.28  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 30.275  6.309   36.700  1.00 47.07  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 30.853  2.245   32.777  1.00 27.77  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 29.443  2.098   33.068  1.00 37.60  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.156  0.658   33.537  1.00 41.69  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 28.333  0.434   34.414  1.00 40.18  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 28.559  2.518   31.884  1.00 37.84  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.120  2.006   32.046  1.00 28.16  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 28.567  4.036   31.737  1.00 35.27  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 29.866  -0.310  32.980  1.00 44.04  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 29.676  -1.700  33.378  1.00 47.68  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.004  -1.897  34.853  1.00 48.05  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.196  -2.438  35.616  1.00 36.74  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 30.530  -2.620  32.520  1.00 36.52  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 29.946  -2.807  31.155  1.00 46.26  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 28.632  -3.552  31.204  1.00 52.91  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 27.558  -2.985  30.960  1.00 48.49  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 28.709  -4.836  31.531  1.00 47.75  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.178  -1.428  35.248  1.00 34.92  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 31.609  -1.554  36.621  1.00 32.70  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 30.757  -0.771  37.635  1.00 38.06  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 30.559  -1.231  38.762  1.00 47.64  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.079  -1.126  36.743  1.00 45.02  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 33.632  -1.191  38.164  1.00 61.25  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.016  -1.804  38.232  1.00 66.71  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 35.320  -2.479  39.247  1.00 65.66  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 35.779  -1.620  37.256  1.00 63.54  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 30.253  0.399   37.252  1.00 32.27  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 29.881  1.390   38.264  1.00 31.04  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 28.462  1.894   38.239  1.00 42.94  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.000  2.448   39.236  1.00 44.83  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 30.820  2.590   38.220  1.00 27.44  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 32.272  2.189   38.417  1.00 41.00  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.071  2.220   37.476  1.00 38.36  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 32.616  1.791   39.637  1.00 36.89  ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 27.771  1.717   37.117  1.00 40.15  ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 26.451  2.298   36.972  1.00 32.98  ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 25.472  1.723   38.016  1.00 42.30  ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 24.492  2.377   38.398  1.00 42.33  ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 25.917  2.154   35.530  1.00 33.26  ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 24.922  3.285   35.202  1.00 38.64  ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.320  0.764   35.316  1.00 37.91  ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 25.468  4.728   35.460  1.00 27.52  ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 25.746  0.518   38.510  1.00 41.93  ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 24.877  -0.065  39.542  1.00 43.66  ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 24.776  0.796   40.824  1.00 44.67  ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 23.773  0.757   41.529  1.00 51.58  ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 25.297  -1.511  39.870  1.00 37.07  ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 25.815  1.570   41.116  1.00 42.24  ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 25.864  2.415   42.308  1.00 33.29  ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 24.890  3.584   42.207  1.00 43.24  ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 24.608  4.258   43.193  1.00 63.29  ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 27.302  2.942   42.522  1.00 25.32  ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 24.377  3.827   41.011  1.00 37.31  ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 23.485  4.960   40.783  1.00 38.76  ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 22.082  4.437   40.515  1.00 43.81  ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 21.136  5.223   40.423  1.00 50.04  ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 23.961  5.817   39.586  1.00 33.66  ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 25.377  6.336   39.721  1.00 38.30  ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 26.463  5.517   39.466  1.00 38.91  ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 25.615  7.646   40.100  1.00 44.31  ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 27.753  5.996   39.585  1.00 44.07  ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 26.893  8.131   40.221  1.00 41.09  ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 27.973  7.301   39.959  1.00 42.05  ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 21.962  3.110   40.391  1.00 37.77  ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 20.697  2.446   40.121  1.00 27.41  ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 20.581  2.054   38.666  1.00 41.11  ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 19.517  1.671   38.200  1.00 46.30  ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 21.686  2.164   37.937  1.00 46.77  ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 21.723  1.739   36.551  1.00 44.40  ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 21.816  0.232   36.471  1.00 49.27  ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 22.297  -0.430  37.393  1.00 53.80  ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.360  -0.308  35.354  1.00 42.39  ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.304  -1.736  35.156  1.00 36.70  ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.287  -1.986  34.038  1.00 42.63  ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 21.991  -1.708  32.884  1.00 43.34  ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 19.868  -2.101  34.744  1.00 53.27  ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 19.670  -3.586  34.395  1.00 57.85  ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 20.641  -4.388  34.330  1.00 52.46  ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 18.488  -3.937  34.174  1.00 57.29  ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 23.475  -2.503  34.381  1.00 43.82  ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 24.577  -2.733  33.452  1.00 43.76  ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.189  -3.745  32.409  1.00 47.88  ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 24.888  -3.860  31.407  1.00 48.29  ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 25.663  -3.358  34.337  1.00 37.82  ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.266  -3.107  35.686  1.00 29.42  ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 23.791  -3.016  35.713  1.00 32.30  ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.126  -4.502  32.669  1.00 50.25  ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 22.685  -5.520  31.728  1.00 46.30  ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 21.663  -4.928  30.772  1.00 45.82  ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.152  -5.632  29.912  1.00 48.72  ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.107  -6.736  32.438  1.00 41.16  ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 22.940  -7.235  33.588  1.00 47.46  ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 22.714  -9.000  33.903  1.00 60.95  ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 23.433  -9.642  32.373  1.00 58.05  ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 21.380  -3.633  30.910  1.00 38.25  ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 20.532  -2.942  29.939  1.00 37.70  ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.101  -1.573  29.543  1.00 44.59  ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 20.776  -0.520  30.135  1.00 45.91  ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.112  -2.788  30.461  1.00 34.46  ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.276  -2.365  29.408  1.00 43.94  ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 21.948  -1.592  28.525  1.00 34.58  ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 22.665  -0.396  28.109  1.00 34.37  ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 22.444  -0.132  26.630  1.00 42.65  ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 22.694  -0.996  25.760  1.00 47.41  ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.200  -0.520  28.411  1.00 41.63  ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 24.990  0.605   27.753  1.00 24.26  ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 24.466  -0.579  29.938  1.00 20.98  ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 21.961  1.070   26.354  1.00 39.01  ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 21.677  1.489   24.996  1.00 36.87  ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 22.556  2.672   24.634  1.00 39.72  ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 22.531  3.694   25.321  1.00 42.30  ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.207  1.894   24.856  1.00 35.47  ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 19.366  0.782   25.201  1.00 26.62  ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 19.919  2.316   23.439  1.00 38.56  ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.351  2.528   23.573  1.00 36.32  ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.141  3.649   23.060  1.00 37.60  ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.287  4.487   22.131  1.00 40.42  ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 22.519  3.948   21.346  1.00 52.44  ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.373  3.158   22.296  1.00 26.47  ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.175  2.106   23.046  1.00 35.17  ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 27.230  1.447   22.173  1.00 30.77  ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 26.803  2.761   24.260  1.00 48.58  ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 23.402  5.801   22.215  1.00 29.32  ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 22.841  6.624   21.161  1.00 33.17  ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 23.709  7.829   20.934  1.00 36.50  ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.338  8.330   21.856  1.00 36.22  ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.368  6.990   21.408  1.00 34.59  ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.134  8.009   22.498  1.00 33.59  ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 21.663  7.847   23.764  1.00 38.25  ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.309  9.098   22.270  1.00 31.34  ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.414  8.779   24.778  1.00 32.38  ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.043  10.032  23.276  1.00 32.51  ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 20.598  9.878   24.528  1.00 31.46  ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 23.764  8.266   19.686  1.00 32.66  ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 24.594  9.385   19.321  1.00 27.81  ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.181  9.961   17.992  1.00 37.79  ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.333  9.420   17.273  1.00 33.79  ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 24.785  11.084  17.646  1.00 38.14  ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.319  11.787  16.475  1.00 33.34  ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.480  12.166  15.585  1.00 29.61  ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.522  12.590  16.067  1.00 33.56  ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.497  12.998  16.919  1.00 37.19  ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 22.716  13.662  15.826  1.00 46.03  ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 23.512  14.768  15.200  1.00 52.03  ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 24.524  15.166  15.821  1.00 47.28  ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.124  15.237  14.108  1.00 56.93  ? 202  GLU A OE2 1 
HETATM 1569 N N   A SXE A 1 203 ? 25.317  11.971  14.270  0.50 32.90  ? 203  SXE A N   1 
HETATM 1570 N N   B SXE A 1 203 ? 25.312  11.978  14.269  0.50 32.88  ? 203  SXE A N   1 
HETATM 1571 C CA  A SXE A 1 203 ? 26.307  12.432  13.319  0.50 36.05  ? 203  SXE A CA  1 
HETATM 1572 C CA  B SXE A 1 203 ? 26.305  12.432  13.316  0.50 36.05  ? 203  SXE A CA  1 
HETATM 1573 C C   A SXE A 1 203 ? 27.608  11.650  13.571  0.50 38.29  ? 203  SXE A C   1 
HETATM 1574 C C   B SXE A 1 203 ? 27.599  11.648  13.604  0.50 38.33  ? 203  SXE A C   1 
HETATM 1575 O O   A SXE A 1 203 ? 27.602  10.430  13.446  0.50 39.08  ? 203  SXE A O   1 
HETATM 1576 O O   B SXE A 1 203 ? 27.576  10.423  13.539  0.50 38.92  ? 203  SXE A O   1 
HETATM 1577 C CB  A SXE A 1 203 ? 26.251  13.911  13.651  0.50 36.85  ? 203  SXE A CB  1 
HETATM 1578 C CB  B SXE A 1 203 ? 26.220  13.920  13.600  0.50 36.79  ? 203  SXE A CB  1 
HETATM 1579 O OG  A SXE A 1 203 ? 27.192  14.601  12.795  0.50 39.22  ? 203  SXE A OG  1 
HETATM 1580 O OG  B SXE A 1 203 ? 27.225  14.588  12.801  0.50 39.39  ? 203  SXE A OG  1 
HETATM 1581 O O1  A SXE A 1 203 ? 29.564  15.374  13.646  0.50 55.07  ? 203  SXE A O1  1 
HETATM 1582 O O1  B SXE A 1 203 ? 29.583  15.341  13.703  0.50 54.88  ? 203  SXE A O1  1 
HETATM 1583 P P1  A SXE A 1 203 ? 28.147  15.743  13.433  0.50 58.64  ? 203  SXE A P1  1 
HETATM 1584 P P1  B SXE A 1 203 ? 28.165  15.709  13.496  0.50 58.50  ? 203  SXE A P1  1 
HETATM 1585 N N1  A SXE A 1 203 ? 27.358  16.237  14.814  0.50 39.59  ? 203  SXE A N1  1 
HETATM 1586 N N1  B SXE A 1 203 ? 27.945  17.082  12.580  0.50 47.26  ? 203  SXE A N1  1 
HETATM 1587 C C1  A SXE A 1 203 ? 27.354  17.668  15.182  0.50 40.90  ? 203  SXE A C1  1 
HETATM 1588 C C1  B SXE A 1 203 ? 28.944  17.536  11.601  0.50 45.47  ? 203  SXE A C1  1 
HETATM 1589 C C3  A SXE A 1 203 ? 26.030  18.302  14.742  0.50 47.19  ? 203  SXE A C3  1 
HETATM 1590 C C3  B SXE A 1 203 ? 29.334  16.459  10.585  0.50 30.28  ? 203  SXE A C3  1 
HETATM 1591 C C2  A SXE A 1 203 ? 27.630  17.884  16.676  0.50 33.73  ? 203  SXE A C2  1 
HETATM 1592 C C2  B SXE A 1 203 ? 28.505  18.852  10.958  0.50 43.97  ? 203  SXE A C2  1 
HETATM 1593 O O2  A SXE A 1 203 ? 27.860  16.941  12.381  0.50 48.58  ? 203  SXE A O2  1 
HETATM 1594 O O2  B SXE A 1 203 ? 27.292  15.994  14.830  0.50 39.19  ? 203  SXE A O2  1 
HETATM 1595 C C4  A SXE A 1 203 ? 28.976  17.486  11.637  0.50 45.71  ? 203  SXE A C4  1 
HETATM 1596 C C4  B SXE A 1 203 ? 26.750  17.321  15.032  0.50 41.79  ? 203  SXE A C4  1 
HETATM 1597 C C5  A SXE A 1 203 ? 28.959  18.993  11.809  0.50 45.89  ? 203  SXE A C5  1 
HETATM 1598 C C5  B SXE A 1 203 ? 27.632  18.046  16.031  0.50 36.78  ? 203  SXE A C5  1 
ATOM   1599 N N   . ALA A 1 204 ? 28.705  12.300  13.935  1.00 29.27  ? 204  ALA A N   1 
ATOM   1600 C CA  . ALA A 1 204 ? 29.915  11.526  14.252  1.00 36.37  ? 204  ALA A CA  1 
ATOM   1601 C C   . ALA A 1 204 ? 29.723  10.590  15.474  1.00 47.28  ? 204  ALA A C   1 
ATOM   1602 O O   . ALA A 1 204 ? 30.388  9.558   15.592  1.00 49.63  ? 204  ALA A O   1 
ATOM   1603 C CB  . ALA A 1 204 ? 31.137  12.411  14.428  1.00 36.54  ? 204  ALA A CB  1 
ATOM   1604 N N   . GLY A 1 205 ? 28.817  10.956  16.379  1.00 36.88  ? 205  GLY A N   1 
ATOM   1605 C CA  . GLY A 1 205 ? 28.479  10.110  17.511  1.00 34.20  ? 205  GLY A CA  1 
ATOM   1606 C C   . GLY A 1 205 ? 27.748  8.858   17.043  1.00 40.03  ? 205  GLY A C   1 
ATOM   1607 O O   . GLY A 1 205 ? 28.117  7.756   17.432  1.00 44.25  ? 205  GLY A O   1 
ATOM   1608 N N   . ALA A 1 206 ? 26.714  9.043   16.220  1.00 27.61  ? 206  ALA A N   1 
ATOM   1609 C CA  . ALA A 1 206 ? 26.070  7.958   15.501  1.00 38.04  ? 206  ALA A CA  1 
ATOM   1610 C C   . ALA A 1 206 ? 27.068  6.996   14.860  1.00 39.51  ? 206  ALA A C   1 
ATOM   1611 O O   . ALA A 1 206 ? 26.954  5.774   15.049  1.00 32.29  ? 206  ALA A O   1 
ATOM   1612 C CB  . ALA A 1 206 ? 25.118  8.491   14.455  1.00 39.18  ? 206  ALA A CB  1 
ATOM   1613 N N   . ALA A 1 207 ? 28.051  7.533   14.129  1.00 34.10  ? 207  ALA A N   1 
ATOM   1614 C CA  . ALA A 1 207 ? 29.082  6.680   13.522  1.00 32.38  ? 207  ALA A CA  1 
ATOM   1615 C C   . ALA A 1 207 ? 29.910  5.950   14.580  1.00 43.28  ? 207  ALA A C   1 
ATOM   1616 O O   . ALA A 1 207 ? 30.288  4.784   14.406  1.00 42.13  ? 207  ALA A O   1 
ATOM   1617 C CB  . ALA A 1 207 ? 29.983  7.463   12.616  1.00 20.92  ? 207  ALA A CB  1 
ATOM   1618 N N   . SER A 1 208 ? 30.203  6.630   15.681  1.00 42.96  ? 208  SER A N   1 
ATOM   1619 C CA  . SER A 1 208 ? 30.917  5.961   16.755  1.00 40.99  ? 208  SER A CA  1 
ATOM   1620 C C   . SER A 1 208 ? 30.064  4.824   17.304  1.00 45.20  ? 208  SER A C   1 
ATOM   1621 O O   . SER A 1 208 ? 30.592  3.760   17.613  1.00 41.64  ? 208  SER A O   1 
ATOM   1622 C CB  . SER A 1 208 ? 31.315  6.944   17.847  1.00 31.36  ? 208  SER A CB  1 
ATOM   1623 O OG  . SER A 1 208 ? 32.069  7.987   17.263  1.00 31.91  ? 208  SER A OG  1 
ATOM   1624 N N   . VAL A 1 209 ? 28.749  5.033   17.416  1.00 39.75  ? 209  VAL A N   1 
ATOM   1625 C CA  . VAL A 1 209 ? 27.898  3.985   17.952  1.00 31.54  ? 209  VAL A CA  1 
ATOM   1626 C C   . VAL A 1 209 ? 28.054  2.830   16.990  1.00 44.23  ? 209  VAL A C   1 
ATOM   1627 O O   . VAL A 1 209 ? 28.200  1.670   17.396  1.00 36.86  ? 209  VAL A O   1 
ATOM   1628 C CB  . VAL A 1 209 ? 26.424  4.406   18.058  1.00 33.26  ? 209  VAL A CB  1 
ATOM   1629 C CG1 . VAL A 1 209 ? 25.509  3.154   18.113  1.00 21.23  ? 209  VAL A CG1 1 
ATOM   1630 C CG2 . VAL A 1 209 ? 26.216  5.256   19.302  1.00 35.54  ? 209  VAL A CG2 1 
ATOM   1631 N N   . GLY A 1 210 ? 28.068  3.173   15.700  1.00 47.86  ? 210  GLY A N   1 
ATOM   1632 C CA  . GLY A 1 210 ? 28.216  2.199   14.634  1.00 37.01  ? 210  GLY A CA  1 
ATOM   1633 C C   . GLY A 1 210 ? 29.484  1.379   14.772  1.00 35.82  ? 210  GLY A C   1 
ATOM   1634 O O   . GLY A 1 210 ? 29.487  0.168   14.553  1.00 41.29  ? 210  GLY A O   1 
ATOM   1635 N N   . MET A 1 211 ? 30.570  2.034   15.148  1.00 32.65  ? 211  MET A N   1 
ATOM   1636 C CA  . MET A 1 211 ? 31.854  1.355   15.180  1.00 37.65  ? 211  MET A CA  1 
ATOM   1637 C C   . MET A 1 211 ? 32.029  0.454   16.381  1.00 40.18  ? 211  MET A C   1 
ATOM   1638 O O   . MET A 1 211 ? 32.770  -0.538  16.304  1.00 35.50  ? 211  MET A O   1 
ATOM   1639 C CB  . MET A 1 211 ? 32.992  2.350   15.044  1.00 41.35  ? 211  MET A CB  1 
ATOM   1640 C CG  . MET A 1 211 ? 33.212  2.658   13.583  1.00 48.06  ? 211  MET A CG  1 
ATOM   1641 S SD  . MET A 1 211 ? 34.119  4.160   13.377  1.00 54.83  ? 211  MET A SD  1 
ATOM   1642 C CE  . MET A 1 211 ? 33.380  4.814   11.890  1.00 83.13  ? 211  MET A CE  1 
ATOM   1643 N N   . HIS A 1 212 ? 31.334  0.783   17.476  1.00 31.59  ? 212  HIS A N   1 
ATOM   1644 C CA  . HIS A 1 212 ? 31.274  -0.129  18.606  1.00 35.60  ? 212  HIS A CA  1 
ATOM   1645 C C   . HIS A 1 212 ? 30.503  -1.396  18.253  1.00 42.10  ? 212  HIS A C   1 
ATOM   1646 O O   . HIS A 1 212 ? 30.852  -2.490  18.692  1.00 39.99  ? 212  HIS A O   1 
ATOM   1647 C CB  . HIS A 1 212 ? 30.659  0.533   19.817  1.00 34.67  ? 212  HIS A CB  1 
ATOM   1648 C CG  . HIS A 1 212 ? 31.496  1.631   20.378  1.00 32.93  ? 212  HIS A CG  1 
ATOM   1649 N ND1 . HIS A 1 212 ? 32.802  1.442   20.758  1.00 32.60  ? 212  HIS A ND1 1 
ATOM   1650 C CD2 . HIS A 1 212 ? 31.221  2.933   20.609  1.00 34.63  ? 212  HIS A CD2 1 
ATOM   1651 C CE1 . HIS A 1 212 ? 33.295  2.576   21.212  1.00 34.83  ? 212  HIS A CE1 1 
ATOM   1652 N NE2 . HIS A 1 212 ? 32.355  3.499   21.133  1.00 35.05  ? 212  HIS A NE2 1 
ATOM   1653 N N   . ILE A 1 213 ? 29.445  -1.238  17.469  1.00 38.99  ? 213  ILE A N   1 
ATOM   1654 C CA  . ILE A 1 213 ? 28.714  -2.390  16.979  1.00 42.23  ? 213  ILE A CA  1 
ATOM   1655 C C   . ILE A 1 213 ? 29.648  -3.300  16.197  1.00 43.71  ? 213  ILE A C   1 
ATOM   1656 O O   . ILE A 1 213 ? 29.537  -4.508  16.259  1.00 43.76  ? 213  ILE A O   1 
ATOM   1657 C CB  . ILE A 1 213 ? 27.561  -1.963  16.061  1.00 39.39  ? 213  ILE A CB  1 
ATOM   1658 C CG1 . ILE A 1 213 ? 26.571  -1.106  16.840  1.00 35.17  ? 213  ILE A CG1 1 
ATOM   1659 C CG2 . ILE A 1 213 ? 26.884  -3.185  15.442  1.00 33.01  ? 213  ILE A CG2 1 
ATOM   1660 C CD1 . ILE A 1 213 ? 25.253  -0.943  16.167  1.00 29.15  ? 213  ILE A CD1 1 
ATOM   1661 N N   . LEU A 1 214 ? 30.569  -2.700  15.454  1.00 45.26  ? 214  LEU A N   1 
ATOM   1662 C CA  . LEU A 1 214 ? 31.421  -3.444  14.537  1.00 43.15  ? 214  LEU A CA  1 
ATOM   1663 C C   . LEU A 1 214 ? 32.746  -3.885  15.155  1.00 43.00  ? 214  LEU A C   1 
ATOM   1664 O O   . LEU A 1 214 ? 33.572  -4.460  14.477  1.00 47.15  ? 214  LEU A O   1 
ATOM   1665 C CB  . LEU A 1 214 ? 31.724  -2.593  13.299  1.00 43.94  ? 214  LEU A CB  1 
ATOM   1666 C CG  . LEU A 1 214 ? 30.571  -2.292  12.351  1.00 52.51  ? 214  LEU A CG  1 
ATOM   1667 C CD1 . LEU A 1 214 ? 31.047  -1.493  11.145  1.00 47.23  ? 214  LEU A CD1 1 
ATOM   1668 C CD2 . LEU A 1 214 ? 29.918  -3.601  11.921  1.00 51.24  ? 214  LEU A CD2 1 
ATOM   1669 N N   . SER A 1 215 ? 32.972  -3.588  16.423  1.00 38.12  ? 215  SER A N   1 
ATOM   1670 C CA  . SER A 1 215 ? 34.251  -3.895  17.025  1.00 42.53  ? 215  SER A CA  1 
ATOM   1671 C C   . SER A 1 215 ? 34.059  -4.844  18.206  1.00 46.53  ? 215  SER A C   1 
ATOM   1672 O O   . SER A 1 215 ? 33.487  -4.475  19.230  1.00 44.74  ? 215  SER A O   1 
ATOM   1673 C CB  . SER A 1 215 ? 34.942  -2.596  17.456  1.00 45.35  ? 215  SER A CB  1 
ATOM   1674 O OG  . SER A 1 215 ? 36.275  -2.822  17.885  1.00 38.92  ? 215  SER A OG  1 
ATOM   1675 N N   . LEU A 1 216 ? 34.549  -6.069  18.061  1.00 55.83  ? 216  LEU A N   1 
ATOM   1676 C CA  . LEU A 1 216 ? 34.242  -7.144  19.015  1.00 63.62  ? 216  LEU A CA  1 
ATOM   1677 C C   . LEU A 1 216 ? 34.307  -6.790  20.509  1.00 56.67  ? 216  LEU A C   1 
ATOM   1678 O O   . LEU A 1 216 ? 33.350  -7.021  21.255  1.00 50.76  ? 216  LEU A O   1 
ATOM   1679 C CB  . LEU A 1 216 ? 35.086  -8.384  18.714  1.00 73.64  ? 216  LEU A CB  1 
ATOM   1680 C CG  . LEU A 1 216 ? 34.364  -9.292  17.719  1.00 80.11  ? 216  LEU A CG  1 
ATOM   1681 C CD1 . LEU A 1 216 ? 35.294  -10.359 17.145  1.00 81.87  ? 216  LEU A CD1 1 
ATOM   1682 C CD2 . LEU A 1 216 ? 33.137  -9.911  18.400  1.00 76.57  ? 216  LEU A CD2 1 
ATOM   1683 N N   . PRO A 1 217 ? 35.434  -6.221  20.949  1.00 48.28  ? 217  PRO A N   1 
ATOM   1684 C CA  . PRO A 1 217 ? 35.583  -5.885  22.365  1.00 40.89  ? 217  PRO A CA  1 
ATOM   1685 C C   . PRO A 1 217 ? 34.529  -4.893  22.906  1.00 49.07  ? 217  PRO A C   1 
ATOM   1686 O O   . PRO A 1 217 ? 34.368  -4.788  24.126  1.00 57.02  ? 217  PRO A O   1 
ATOM   1687 C CB  . PRO A 1 217 ? 36.983  -5.264  22.429  1.00 36.20  ? 217  PRO A CB  1 
ATOM   1688 C CG  . PRO A 1 217 ? 37.696  -5.756  21.222  1.00 37.85  ? 217  PRO A CG  1 
ATOM   1689 C CD  . PRO A 1 217 ? 36.626  -5.854  20.167  1.00 43.46  ? 217  PRO A CD  1 
ATOM   1690 N N   . SER A 1 218 ? 33.829  -4.172  22.035  1.00 37.22  ? 218  SER A N   1 
ATOM   1691 C CA  . SER A 1 218 ? 32.831  -3.230  22.524  1.00 40.53  ? 218  SER A CA  1 
ATOM   1692 C C   . SER A 1 218 ? 31.499  -3.916  22.697  1.00 46.65  ? 218  SER A C   1 
ATOM   1693 O O   . SER A 1 218 ? 30.637  -3.430  23.421  1.00 37.19  ? 218  SER A O   1 
ATOM   1694 C CB  . SER A 1 218 ? 32.656  -2.066  21.561  1.00 39.25  ? 218  SER A CB  1 
ATOM   1695 O OG  . SER A 1 218 ? 33.655  -1.106  21.795  1.00 46.31  ? 218  SER A OG  1 
ATOM   1696 N N   . ARG A 1 219 ? 31.337  -5.050  22.025  1.00 54.80  ? 219  ARG A N   1 
ATOM   1697 C CA  . ARG A 1 219 ? 30.024  -5.659  21.888  1.00 56.30  ? 219  ARG A CA  1 
ATOM   1698 C C   . ARG A 1 219 ? 29.477  -6.122  23.222  1.00 48.28  ? 219  ARG A C   1 
ATOM   1699 O O   . ARG A 1 219 ? 28.294  -6.023  23.481  1.00 60.06  ? 219  ARG A O   1 
ATOM   1700 C CB  . ARG A 1 219 ? 30.052  -6.796  20.868  1.00 66.80  ? 219  ARG A CB  1 
ATOM   1701 C CG  . ARG A 1 219 ? 30.078  -6.340  19.395  1.00 68.06  ? 219  ARG A CG  1 
ATOM   1702 C CD  . ARG A 1 219 ? 28.899  -5.415  19.041  1.00 71.05  ? 219  ARG A CD  1 
ATOM   1703 N NE  . ARG A 1 219 ? 27.573  -5.970  19.344  1.00 75.18  ? 219  ARG A NE  1 
ATOM   1704 C CZ  . ARG A 1 219 ? 26.784  -6.611  18.474  1.00 71.69  ? 219  ARG A CZ  1 
ATOM   1705 N NH1 . ARG A 1 219 ? 27.175  -6.817  17.215  1.00 64.50  ? 219  ARG A NH1 1 
ATOM   1706 N NH2 . ARG A 1 219 ? 25.597  -7.063  18.874  1.00 68.39  ? 219  ARG A NH2 1 
ATOM   1707 N N   . SER A 1 220 ? 30.346  -6.599  24.088  1.00 47.05  ? 220  SER A N   1 
ATOM   1708 C CA  . SER A 1 220 ? 29.908  -7.025  25.412  1.00 51.02  ? 220  SER A CA  1 
ATOM   1709 C C   . SER A 1 220 ? 29.564  -5.877  26.361  1.00 51.11  ? 220  SER A C   1 
ATOM   1710 O O   . SER A 1 220 ? 29.291  -6.117  27.532  1.00 53.02  ? 220  SER A O   1 
ATOM   1711 C CB  . SER A 1 220 ? 30.995  -7.886  26.064  1.00 53.09  ? 220  SER A CB  1 
ATOM   1712 O OG  . SER A 1 220 ? 32.157  -7.124  26.349  1.00 50.22  ? 220  SER A OG  1 
ATOM   1713 N N   . LEU A 1 221 ? 29.613  -4.636  25.880  1.00 46.08  ? 221  LEU A N   1 
ATOM   1714 C CA  . LEU A 1 221 ? 29.469  -3.476  26.766  1.00 37.27  ? 221  LEU A CA  1 
ATOM   1715 C C   . LEU A 1 221 ? 28.142  -2.769  26.559  1.00 38.13  ? 221  LEU A C   1 
ATOM   1716 O O   . LEU A 1 221 ? 27.869  -1.772  27.226  1.00 37.04  ? 221  LEU A O   1 
ATOM   1717 C CB  . LEU A 1 221 ? 30.603  -2.460  26.573  1.00 36.15  ? 221  LEU A CB  1 
ATOM   1718 C CG  . LEU A 1 221 ? 32.067  -2.920  26.607  1.00 45.91  ? 221  LEU A CG  1 
ATOM   1719 C CD1 . LEU A 1 221 ? 33.010  -1.814  26.119  1.00 45.36  ? 221  LEU A CD1 1 
ATOM   1720 C CD2 . LEU A 1 221 ? 32.461  -3.372  27.997  1.00 43.46  ? 221  LEU A CD2 1 
ATOM   1721 N N   . PHE A 1 222 ? 27.317  -3.266  25.639  1.00 35.68  ? 222  PHE A N   1 
ATOM   1722 C CA  . PHE A 1 222 ? 25.998  -2.665  25.420  1.00 39.74  ? 222  PHE A CA  1 
ATOM   1723 C C   . PHE A 1 222 ? 25.045  -3.624  24.724  1.00 44.65  ? 222  PHE A C   1 
ATOM   1724 O O   . PHE A 1 222 ? 25.449  -4.685  24.224  1.00 36.95  ? 222  PHE A O   1 
ATOM   1725 C CB  . PHE A 1 222 ? 26.125  -1.384  24.606  1.00 34.62  ? 222  PHE A CB  1 
ATOM   1726 C CG  . PHE A 1 222 ? 26.582  -1.606  23.190  1.00 30.52  ? 222  PHE A CG  1 
ATOM   1727 C CD1 . PHE A 1 222 ? 27.915  -1.898  22.912  1.00 28.89  ? 222  PHE A CD1 1 
ATOM   1728 C CD2 . PHE A 1 222 ? 25.671  -1.534  22.131  1.00 33.37  ? 222  PHE A CD2 1 
ATOM   1729 C CE1 . PHE A 1 222 ? 28.349  -2.095  21.583  1.00 36.12  ? 222  PHE A CE1 1 
ATOM   1730 C CE2 . PHE A 1 222 ? 26.093  -1.730  20.805  1.00 38.87  ? 222  PHE A CE2 1 
ATOM   1731 C CZ  . PHE A 1 222 ? 27.442  -2.003  20.534  1.00 36.07  ? 222  PHE A CZ  1 
ATOM   1732 N N   . HIS A 1 223 ? 23.775  -3.252  24.664  1.00 46.56  ? 223  HIS A N   1 
ATOM   1733 C CA  . HIS A 1 223 ? 22.794  -4.209  24.177  1.00 47.37  ? 223  HIS A CA  1 
ATOM   1734 C C   . HIS A 1 223 ? 21.997  -3.737  22.968  1.00 53.45  ? 223  HIS A C   1 
ATOM   1735 O O   . HIS A 1 223 ? 21.648  -4.545  22.105  1.00 55.01  ? 223  HIS A O   1 
ATOM   1736 C CB  . HIS A 1 223 ? 21.890  -4.619  25.320  1.00 39.48  ? 223  HIS A CB  1 
ATOM   1737 C CG  . HIS A 1 223 ? 22.643  -5.015  26.548  1.00 42.16  ? 223  HIS A CG  1 
ATOM   1738 N ND1 . HIS A 1 223 ? 22.911  -4.134  27.572  1.00 46.05  ? 223  HIS A ND1 1 
ATOM   1739 C CD2 . HIS A 1 223 ? 23.213  -6.189  26.901  1.00 47.16  ? 223  HIS A CD2 1 
ATOM   1740 C CE1 . HIS A 1 223 ? 23.594  -4.754  28.513  1.00 51.40  ? 223  HIS A CE1 1 
ATOM   1741 N NE2 . HIS A 1 223 ? 23.789  -6.004  28.136  1.00 53.00  ? 223  HIS A NE2 1 
ATOM   1742 N N   . ARG A 1 224 ? 21.724  -2.437  22.910  1.00 46.67  ? 224  ARG A N   1 
ATOM   1743 C CA  . ARG A 1 224 ? 21.017  -1.849  21.786  1.00 42.91  ? 224  ARG A CA  1 
ATOM   1744 C C   . ARG A 1 224 ? 21.712  -0.561  21.390  1.00 49.78  ? 224  ARG A C   1 
ATOM   1745 O O   . ARG A 1 224 ? 22.589  -0.064  22.100  1.00 51.27  ? 224  ARG A O   1 
ATOM   1746 C CB  . ARG A 1 224 ? 19.587  -1.530  22.171  1.00 46.49  ? 224  ARG A CB  1 
ATOM   1747 C CG  . ARG A 1 224 ? 18.741  -2.728  22.477  1.00 48.83  ? 224  ARG A CG  1 
ATOM   1748 C CD  . ARG A 1 224 ? 17.488  -2.282  23.204  1.00 51.29  ? 224  ARG A CD  1 
ATOM   1749 N NE  . ARG A 1 224 ? 17.494  -2.615  24.623  1.00 49.44  ? 224  ARG A NE  1 
ATOM   1750 C CZ  . ARG A 1 224 ? 17.942  -3.761  25.126  1.00 55.52  ? 224  ARG A CZ  1 
ATOM   1751 N NH1 . ARG A 1 224 ? 18.428  -4.708  24.333  1.00 62.81  ? 224  ARG A NH1 1 
ATOM   1752 N NH2 . ARG A 1 224 ? 17.900  -3.970  26.429  1.00 53.25  ? 224  ARG A NH2 1 
ATOM   1753 N N   . ALA A 1 225 ? 21.300  0.001   20.267  1.00 43.71  ? 225  ALA A N   1 
ATOM   1754 C CA  . ALA A 1 225 ? 22.019  1.117   19.707  1.00 38.44  ? 225  ALA A CA  1 
ATOM   1755 C C   . ALA A 1 225 ? 21.105  2.012   18.894  1.00 39.31  ? 225  ALA A C   1 
ATOM   1756 O O   . ALA A 1 225 ? 20.269  1.516   18.142  1.00 40.29  ? 225  ALA A O   1 
ATOM   1757 C CB  . ALA A 1 225 ? 23.119  0.591   18.844  1.00 43.72  ? 225  ALA A CB  1 
ATOM   1758 N N   . VAL A 1 226 ? 21.269  3.326   19.037  1.00 36.64  ? 226  VAL A N   1 
ATOM   1759 C CA  . VAL A 1 226 ? 20.535  4.275   18.204  1.00 43.09  ? 226  VAL A CA  1 
ATOM   1760 C C   . VAL A 1 226 ? 21.501  5.138   17.405  1.00 44.48  ? 226  VAL A C   1 
ATOM   1761 O O   . VAL A 1 226 ? 22.361  5.793   17.989  1.00 47.04  ? 226  VAL A O   1 
ATOM   1762 C CB  . VAL A 1 226 ? 19.634  5.218   19.027  1.00 41.26  ? 226  VAL A CB  1 
ATOM   1763 C CG1 . VAL A 1 226 ? 18.788  6.085   18.089  1.00 46.70  ? 226  VAL A CG1 1 
ATOM   1764 C CG2 . VAL A 1 226 ? 18.763  4.449   19.936  1.00 30.22  ? 226  VAL A CG2 1 
ATOM   1765 N N   . LEU A 1 227 ? 21.350  5.139   16.080  1.00 39.10  ? 227  LEU A N   1 
ATOM   1766 C CA  . LEU A 1 227 ? 22.177  5.970   15.204  1.00 43.76  ? 227  LEU A CA  1 
ATOM   1767 C C   . LEU A 1 227 ? 21.354  7.091   14.569  1.00 43.56  ? 227  LEU A C   1 
ATOM   1768 O O   . LEU A 1 227 ? 20.515  6.853   13.689  1.00 36.51  ? 227  LEU A O   1 
ATOM   1769 C CB  . LEU A 1 227 ? 22.838  5.118   14.100  1.00 45.80  ? 227  LEU A CB  1 
ATOM   1770 C CG  . LEU A 1 227 ? 24.025  4.204   14.451  1.00 40.90  ? 227  LEU A CG  1 
ATOM   1771 C CD1 . LEU A 1 227 ? 23.597  3.130   15.397  1.00 35.64  ? 227  LEU A CD1 1 
ATOM   1772 C CD2 . LEU A 1 227 ? 24.650  3.579   13.217  1.00 31.65  ? 227  LEU A CD2 1 
ATOM   1773 N N   . GLN A 1 228 ? 21.599  8.323   14.989  1.00 42.72  ? 228  GLN A N   1 
ATOM   1774 C CA  . GLN A 1 228 ? 20.831  9.434   14.437  1.00 36.42  ? 228  GLN A CA  1 
ATOM   1775 C C   . GLN A 1 228 ? 21.685  10.242  13.456  1.00 41.41  ? 228  GLN A C   1 
ATOM   1776 O O   . GLN A 1 228 ? 22.694  10.832  13.833  1.00 43.84  ? 228  GLN A O   1 
ATOM   1777 C CB  . GLN A 1 228 ? 20.295  10.331  15.561  1.00 29.39  ? 228  GLN A CB  1 
ATOM   1778 C CG  . GLN A 1 228 ? 19.812  9.587   16.799  1.00 33.14  ? 228  GLN A CG  1 
ATOM   1779 C CD  . GLN A 1 228 ? 19.483  10.518  17.952  1.00 35.33  ? 228  GLN A CD  1 
ATOM   1780 O OE1 . GLN A 1 228 ? 19.182  10.081  19.054  1.00 41.58  ? 228  GLN A OE1 1 
ATOM   1781 N NE2 . GLN A 1 228 ? 19.537  11.806  17.699  1.00 35.93  ? 228  GLN A NE2 1 
ATOM   1782 N N   . SER A 1 229 ? 21.282  10.266  12.191  1.00 38.90  ? 229  SER A N   1 
ATOM   1783 C CA  . SER A 1 229 ? 22.007  11.031  11.162  1.00 32.31  ? 229  SER A CA  1 
ATOM   1784 C C   . SER A 1 229 ? 23.514  10.737  11.075  1.00 35.51  ? 229  SER A C   1 
ATOM   1785 O O   . SER A 1 229 ? 24.327  11.647  11.025  1.00 39.48  ? 229  SER A O   1 
ATOM   1786 C CB  . SER A 1 229 ? 21.784  12.529  11.343  1.00 33.81  ? 229  SER A CB  1 
ATOM   1787 O OG  . SER A 1 229 ? 20.417  12.835  11.556  1.00 39.82  ? 229  SER A OG  1 
ATOM   1788 N N   . GLY A 1 230 ? 23.875  9.461   11.030  1.00 37.00  ? 230  GLY A N   1 
ATOM   1789 C CA  . GLY A 1 230 ? 25.262  9.059   10.882  1.00 25.43  ? 230  GLY A CA  1 
ATOM   1790 C C   . GLY A 1 230 ? 25.433  7.546   10.913  1.00 31.71  ? 230  GLY A C   1 
ATOM   1791 O O   . GLY A 1 230 ? 24.659  6.809   11.537  1.00 34.59  ? 230  GLY A O   1 
ATOM   1792 N N   . THR A 1 231 ? 26.469  7.079   10.234  1.00 33.90  ? 231  THR A N   1 
ATOM   1793 C CA  . THR A 1 231 ? 26.701  5.654   10.064  1.00 44.10  ? 231  THR A CA  1 
ATOM   1794 C C   . THR A 1 231 ? 28.194  5.403   10.069  1.00 39.79  ? 231  THR A C   1 
ATOM   1795 O O   . THR A 1 231 ? 28.953  6.307   9.786   1.00 39.65  ? 231  THR A O   1 
ATOM   1796 C CB  . THR A 1 231 ? 26.121  5.153   8.720   1.00 52.13  ? 231  THR A CB  1 
ATOM   1797 O OG1 . THR A 1 231 ? 26.784  5.813   7.632   1.00 52.71  ? 231  THR A OG1 1 
ATOM   1798 C CG2 . THR A 1 231 ? 24.607  5.410   8.635   1.00 42.16  ? 231  THR A CG2 1 
ATOM   1799 N N   . PRO A 1 232 ? 28.625  4.165   10.378  1.00 45.96  ? 232  PRO A N   1 
ATOM   1800 C CA  . PRO A 1 232 ? 30.071  3.928   10.326  1.00 34.28  ? 232  PRO A CA  1 
ATOM   1801 C C   . PRO A 1 232 ? 30.526  3.807   8.868   1.00 30.50  ? 232  PRO A C   1 
ATOM   1802 O O   . PRO A 1 232 ? 31.579  4.330   8.511   1.00 35.40  ? 232  PRO A O   1 
ATOM   1803 C CB  . PRO A 1 232 ? 30.238  2.595   11.067  1.00 38.09  ? 232  PRO A CB  1 
ATOM   1804 C CG  . PRO A 1 232 ? 28.830  2.070   11.354  1.00 26.73  ? 232  PRO A CG  1 
ATOM   1805 C CD  . PRO A 1 232 ? 27.868  2.917   10.606  1.00 37.67  ? 232  PRO A CD  1 
ATOM   1806 N N   . ASN A 1 233 ? 29.740  3.116   8.041   1.00 32.28  ? 233  ASN A N   1 
ATOM   1807 C CA  . ASN A 1 233 ? 29.956  3.087   6.586   1.00 30.74  ? 233  ASN A CA  1 
ATOM   1808 C C   . ASN A 1 233 ? 29.749  4.500   6.022   1.00 31.24  ? 233  ASN A C   1 
ATOM   1809 O O   . ASN A 1 233 ? 29.374  5.403   6.760   1.00 36.21  ? 233  ASN A O   1 
ATOM   1810 C CB  . ASN A 1 233 ? 28.971  2.131   5.938   1.00 27.27  ? 233  ASN A CB  1 
ATOM   1811 C CG  . ASN A 1 233 ? 27.523  2.444   6.338   1.00 32.09  ? 233  ASN A CG  1 
ATOM   1812 O OD1 . ASN A 1 233 ? 27.205  2.536   7.527   1.00 28.59  ? 233  ASN A OD1 1 
ATOM   1813 N ND2 . ASN A 1 233 ? 26.660  2.662   5.346   1.00 28.56  ? 233  ASN A ND2 1 
ATOM   1814 N N   . GLY A 1 234 ? 29.983  4.702   4.731   1.00 27.74  ? 234  GLY A N   1 
ATOM   1815 C CA  . GLY A 1 234 ? 29.832  6.035   4.156   1.00 33.71  ? 234  GLY A CA  1 
ATOM   1816 C C   . GLY A 1 234 ? 31.170  6.714   3.892   1.00 39.92  ? 234  GLY A C   1 
ATOM   1817 O O   . GLY A 1 234 ? 32.215  6.204   4.283   1.00 41.04  ? 234  GLY A O   1 
ATOM   1818 N N   . PRO A 1 235 ? 31.148  7.881   3.243   1.00 38.12  ? 235  PRO A N   1 
ATOM   1819 C CA  . PRO A 1 235 ? 32.383  8.431   2.691   1.00 36.91  ? 235  PRO A CA  1 
ATOM   1820 C C   . PRO A 1 235 ? 33.200  9.267   3.664   1.00 41.09  ? 235  PRO A C   1 
ATOM   1821 O O   . PRO A 1 235 ? 34.283  9.675   3.266   1.00 40.95  ? 235  PRO A O   1 
ATOM   1822 C CB  . PRO A 1 235 ? 31.881  9.367   1.575   1.00 35.38  ? 235  PRO A CB  1 
ATOM   1823 C CG  . PRO A 1 235 ? 30.409  9.577   1.813   1.00 26.49  ? 235  PRO A CG  1 
ATOM   1824 C CD  . PRO A 1 235 ? 30.021  8.805   3.065   1.00 39.12  ? 235  PRO A CD  1 
ATOM   1825 N N   . TRP A 1 236 ? 32.712  9.538   4.874   1.00 40.60  ? 236  TRP A N   1 
ATOM   1826 C CA  . TRP A 1 236 ? 33.404  10.481  5.760   1.00 39.09  ? 236  TRP A CA  1 
ATOM   1827 C C   . TRP A 1 236 ? 33.868  9.936   7.103   1.00 42.37  ? 236  TRP A C   1 
ATOM   1828 O O   . TRP A 1 236 ? 34.820  10.460  7.668   1.00 49.07  ? 236  TRP A O   1 
ATOM   1829 C CB  . TRP A 1 236 ? 32.555  11.724  5.995   1.00 41.63  ? 236  TRP A CB  1 
ATOM   1830 C CG  . TRP A 1 236 ? 31.185  11.432  6.541   1.00 41.19  ? 236  TRP A CG  1 
ATOM   1831 C CD1 . TRP A 1 236 ? 30.023  11.309  5.822   1.00 42.54  ? 236  TRP A CD1 1 
ATOM   1832 C CD2 . TRP A 1 236 ? 30.830  11.230  7.911   1.00 37.73  ? 236  TRP A CD2 1 
ATOM   1833 N NE1 . TRP A 1 236 ? 28.970  11.046  6.667   1.00 37.28  ? 236  TRP A NE1 1 
ATOM   1834 C CE2 . TRP A 1 236 ? 29.433  10.990  7.953   1.00 34.96  ? 236  TRP A CE2 1 
ATOM   1835 C CE3 . TRP A 1 236 ? 31.549  11.220  9.110   1.00 36.93  ? 236  TRP A CE3 1 
ATOM   1836 C CZ2 . TRP A 1 236 ? 28.746  10.738  9.147   1.00 28.11  ? 236  TRP A CZ2 1 
ATOM   1837 C CZ3 . TRP A 1 236 ? 30.855  10.989  10.309  1.00 35.32  ? 236  TRP A CZ3 1 
ATOM   1838 C CH2 . TRP A 1 236 ? 29.467  10.750  10.312  1.00 30.30  ? 236  TRP A CH2 1 
ATOM   1839 N N   . ALA A 1 237 ? 33.211  8.892   7.605   1.00 45.42  ? 237  ALA A N   1 
ATOM   1840 C CA  . ALA A 1 237 ? 33.491  8.357   8.955   1.00 38.61  ? 237  ALA A CA  1 
ATOM   1841 C C   . ALA A 1 237 ? 34.817  7.589   9.137   1.00 37.99  ? 237  ALA A C   1 
ATOM   1842 O O   . ALA A 1 237 ? 35.291  7.429   10.266  1.00 40.08  ? 237  ALA A O   1 
ATOM   1843 C CB  . ALA A 1 237 ? 32.322  7.509   9.454   1.00 22.68  ? 237  ALA A CB  1 
ATOM   1844 N N   . THR A 1 238 ? 35.408  7.101   8.050   1.00 29.60  ? 238  THR A N   1 
ATOM   1845 C CA  . THR A 1 238 ? 36.677  6.378   8.157   1.00 34.57  ? 238  THR A CA  1 
ATOM   1846 C C   . THR A 1 238 ? 37.676  6.801   7.095   1.00 40.78  ? 238  THR A C   1 
ATOM   1847 O O   . THR A 1 238 ? 37.297  7.411   6.094   1.00 46.38  ? 238  THR A O   1 
ATOM   1848 C CB  . THR A 1 238 ? 36.493  4.848   8.038   1.00 35.13  ? 238  THR A CB  1 
ATOM   1849 O OG1 . THR A 1 238 ? 35.885  4.518   6.776   1.00 36.60  ? 238  THR A OG1 1 
ATOM   1850 C CG2 . THR A 1 238 ? 35.645  4.345   9.159   1.00 25.46  ? 238  THR A CG2 1 
ATOM   1851 N N   . VAL A 1 239 ? 38.949  6.479   7.316   1.00 35.16  ? 239  VAL A N   1 
ATOM   1852 C CA  . VAL A 1 239 ? 39.979  6.655   6.285   1.00 35.09  ? 239  VAL A CA  1 
ATOM   1853 C C   . VAL A 1 239 ? 40.884  5.426   6.210   1.00 36.83  ? 239  VAL A C   1 
ATOM   1854 O O   . VAL A 1 239 ? 41.055  4.699   7.192   1.00 42.96  ? 239  VAL A O   1 
ATOM   1855 C CB  . VAL A 1 239 ? 40.828  7.959   6.480   1.00 34.09  ? 239  VAL A CB  1 
ATOM   1856 C CG1 . VAL A 1 239 ? 39.986  9.214   6.158   1.00 28.13  ? 239  VAL A CG1 1 
ATOM   1857 C CG2 . VAL A 1 239 ? 41.414  8.037   7.886   1.00 26.93  ? 239  VAL A CG2 1 
ATOM   1858 N N   . SER A 1 240 ? 41.443  5.172   5.038   1.00 34.02  ? 240  SER A N   1 
ATOM   1859 C CA  . SER A 1 240 ? 42.374  4.064   4.898   1.00 39.65  ? 240  SER A CA  1 
ATOM   1860 C C   . SER A 1 240 ? 43.558  4.301   5.831   1.00 37.80  ? 240  SER A C   1 
ATOM   1861 O O   . SER A 1 240 ? 43.758  5.411   6.319   1.00 40.76  ? 240  SER A O   1 
ATOM   1862 C CB  . SER A 1 240 ? 42.873  3.978   3.465   1.00 39.64  ? 240  SER A CB  1 
ATOM   1863 O OG  . SER A 1 240 ? 43.740  5.057   3.181   1.00 48.42  ? 240  SER A OG  1 
ATOM   1864 N N   . ALA A 1 241 ? 44.338  3.263   6.084   1.00 29.76  ? 241  ALA A N   1 
ATOM   1865 C CA  . ALA A 1 241 ? 45.543  3.430   6.871   1.00 42.27  ? 241  ALA A CA  1 
ATOM   1866 C C   . ALA A 1 241 ? 46.515  4.319   6.111   1.00 41.87  ? 241  ALA A C   1 
ATOM   1867 O O   . ALA A 1 241 ? 47.198  5.130   6.705   1.00 44.54  ? 241  ALA A O   1 
ATOM   1868 C CB  . ALA A 1 241 ? 46.191  2.065   7.219   1.00 28.61  ? 241  ALA A CB  1 
ATOM   1869 N N   . GLY A 1 242 ? 46.558  4.195   4.792   1.00 41.57  ? 242  GLY A N   1 
ATOM   1870 C CA  . GLY A 1 242 ? 47.502  4.985   4.026   1.00 46.94  ? 242  GLY A CA  1 
ATOM   1871 C C   . GLY A 1 242 ? 47.157  6.455   4.034   1.00 50.16  ? 242  GLY A C   1 
ATOM   1872 O O   . GLY A 1 242 ? 48.014  7.329   4.144   1.00 53.92  ? 242  GLY A O   1 
ATOM   1873 N N   . GLU A 1 243 ? 45.875  6.730   3.900   1.00 50.19  ? 243  GLU A N   1 
ATOM   1874 C CA  . GLU A 1 243 ? 45.405  8.092   3.921   1.00 48.25  ? 243  GLU A CA  1 
ATOM   1875 C C   . GLU A 1 243 ? 45.663  8.697   5.310   1.00 45.70  ? 243  GLU A C   1 
ATOM   1876 O O   . GLU A 1 243 ? 46.155  9.814   5.427   1.00 40.95  ? 243  GLU A O   1 
ATOM   1877 C CB  . GLU A 1 243 ? 43.926  8.116   3.508   1.00 44.37  ? 243  GLU A CB  1 
ATOM   1878 C CG  . GLU A 1 243 ? 43.232  9.441   3.623   1.00 47.07  ? 243  GLU A CG  1 
ATOM   1879 C CD  . GLU A 1 243 ? 43.867  10.595  2.817   1.00 50.82  ? 243  GLU A CD  1 
ATOM   1880 O OE1 . GLU A 1 243 ? 43.398  11.734  3.023   1.00 54.53  ? 243  GLU A OE1 1 
ATOM   1881 O OE2 . GLU A 1 243 ? 44.797  10.409  1.987   1.00 39.27  ? 243  GLU A OE2 1 
ATOM   1882 N N   . ALA A 1 244 ? 45.369  7.950   6.366   1.00 45.29  ? 244  ALA A N   1 
ATOM   1883 C CA  . ALA A 1 244 ? 45.636  8.440   7.711   1.00 41.73  ? 244  ALA A CA  1 
ATOM   1884 C C   . ALA A 1 244 ? 47.127  8.721   7.914   1.00 41.84  ? 244  ALA A C   1 
ATOM   1885 O O   . ALA A 1 244 ? 47.498  9.726   8.507   1.00 44.30  ? 244  ALA A O   1 
ATOM   1886 C CB  . ALA A 1 244 ? 45.116  7.462   8.760   1.00 34.12  ? 244  ALA A CB  1 
ATOM   1887 N N   . ARG A 1 245 ? 47.979  7.840   7.408   1.00 37.77  ? 245  ARG A N   1 
ATOM   1888 C CA  . ARG A 1 245 ? 49.420  8.025   7.532   1.00 45.19  ? 245  ARG A CA  1 
ATOM   1889 C C   . ARG A 1 245 ? 49.836  9.296   6.801   1.00 47.54  ? 245  ARG A C   1 
ATOM   1890 O O   . ARG A 1 245 ? 50.683  10.074  7.262   1.00 45.65  ? 245  ARG A O   1 
ATOM   1891 C CB  . ARG A 1 245 ? 50.203  6.808   6.978   1.00 37.36  ? 245  ARG A CB  1 
ATOM   1892 C CG  . ARG A 1 245 ? 51.728  7.053   6.822   1.00 30.60  ? 245  ARG A CG  1 
ATOM   1893 C CD  . ARG A 1 245 ? 52.536  5.756   6.778   1.00 32.62  ? 245  ARG A CD  1 
ATOM   1894 N NE  . ARG A 1 245 ? 52.411  4.977   8.012   1.00 34.19  ? 245  ARG A NE  1 
ATOM   1895 C CZ  . ARG A 1 245 ? 53.220  5.127   9.055   1.00 42.95  ? 245  ARG A CZ  1 
ATOM   1896 N NH1 . ARG A 1 245 ? 54.205  6.012   9.002   1.00 42.13  ? 245  ARG A NH1 1 
ATOM   1897 N NH2 . ARG A 1 245 ? 53.047  4.408   10.153  1.00 45.71  ? 245  ARG A NH2 1 
ATOM   1898 N N   . ARG A 1 246 ? 49.243  9.494   5.640   1.00 40.16  ? 246  ARG A N   1 
ATOM   1899 C CA  . ARG A 1 246 ? 49.617  10.624  4.829   1.00 41.10  ? 246  ARG A CA  1 
ATOM   1900 C C   . ARG A 1 246 ? 49.176  11.937  5.474   1.00 44.05  ? 246  ARG A C   1 
ATOM   1901 O O   . ARG A 1 246 ? 49.938  12.900  5.495   1.00 44.11  ? 246  ARG A O   1 
ATOM   1902 C CB  . ARG A 1 246 ? 49.033  10.472  3.444   1.00 44.60  ? 246  ARG A CB  1 
ATOM   1903 C CG  . ARG A 1 246 ? 49.284  11.647  2.569   1.00 48.63  ? 246  ARG A CG  1 
ATOM   1904 C CD  . ARG A 1 246 ? 48.122  11.853  1.616   1.00 49.63  ? 246  ARG A CD  1 
ATOM   1905 N NE  . ARG A 1 246 ? 47.864  13.280  1.554   1.00 57.47  ? 246  ARG A NE  1 
ATOM   1906 C CZ  . ARG A 1 246 ? 46.698  13.836  1.830   1.00 47.93  ? 246  ARG A CZ  1 
ATOM   1907 N NH1 . ARG A 1 246 ? 45.672  13.071  2.134   1.00 47.70  ? 246  ARG A NH1 1 
ATOM   1908 N NH2 . ARG A 1 246 ? 46.561  15.152  1.767   1.00 45.67  ? 246  ARG A NH2 1 
ATOM   1909 N N   . ARG A 1 247 ? 47.958  11.971  6.016   1.00 40.09  ? 247  ARG A N   1 
ATOM   1910 C CA  . ARG A 1 247 ? 47.486  13.163  6.707   1.00 39.14  ? 247  ARG A CA  1 
ATOM   1911 C C   . ARG A 1 247 ? 48.274  13.444  7.977   1.00 42.16  ? 247  ARG A C   1 
ATOM   1912 O O   . ARG A 1 247 ? 48.518  14.598  8.294   1.00 40.58  ? 247  ARG A O   1 
ATOM   1913 C CB  . ARG A 1 247 ? 46.012  13.056  7.064   1.00 36.53  ? 247  ARG A CB  1 
ATOM   1914 C CG  . ARG A 1 247 ? 45.089  13.102  5.901   1.00 34.81  ? 247  ARG A CG  1 
ATOM   1915 C CD  . ARG A 1 247 ? 43.674  12.766  6.350   1.00 32.76  ? 247  ARG A CD  1 
ATOM   1916 N NE  . ARG A 1 247 ? 42.792  12.594  5.206   1.00 31.54  ? 247  ARG A NE  1 
ATOM   1917 C CZ  . ARG A 1 247 ? 41.464  12.606  5.284   1.00 40.99  ? 247  ARG A CZ  1 
ATOM   1918 N NH1 . ARG A 1 247 ? 40.869  12.781  6.460   1.00 37.88  ? 247  ARG A NH1 1 
ATOM   1919 N NH2 . ARG A 1 247 ? 40.727  12.459  4.189   1.00 32.90  ? 247  ARG A NH2 1 
ATOM   1920 N N   . ALA A 1 248 ? 48.654  12.401  8.714   1.00 42.98  ? 248  ALA A N   1 
ATOM   1921 C CA  . ALA A 1 248 ? 49.463  12.593  9.926   1.00 41.28  ? 248  ALA A CA  1 
ATOM   1922 C C   . ALA A 1 248 ? 50.805  13.216  9.582   1.00 41.37  ? 248  ALA A C   1 
ATOM   1923 O O   . ALA A 1 248 ? 51.319  14.076  10.303  1.00 40.32  ? 248  ALA A O   1 
ATOM   1924 C CB  . ALA A 1 248 ? 49.675  11.282  10.666  1.00 37.23  ? 248  ALA A CB  1 
ATOM   1925 N N   . THR A 1 249 ? 51.369  12.784  8.466   1.00 42.90  ? 249  THR A N   1 
ATOM   1926 C CA  . THR A 1 249 ? 52.706  13.203  8.109   1.00 49.68  ? 249  THR A CA  1 
ATOM   1927 C C   . THR A 1 249 ? 52.689  14.658  7.681   1.00 49.04  ? 249  THR A C   1 
ATOM   1928 O O   . THR A 1 249 ? 53.563  15.451  8.071   1.00 46.88  ? 249  THR A O   1 
ATOM   1929 C CB  . THR A 1 249 ? 53.271  12.345  6.977   1.00 45.50  ? 249  THR A CB  1 
ATOM   1930 O OG1 . THR A 1 249 ? 53.342  10.983  7.409   1.00 47.11  ? 249  THR A OG1 1 
ATOM   1931 C CG2 . THR A 1 249 ? 54.640  12.826  6.631   1.00 38.82  ? 249  THR A CG2 1 
ATOM   1932 N N   . LEU A 1 250 ? 51.688  14.991  6.874   1.00 40.49  ? 250  LEU A N   1 
ATOM   1933 C CA  . LEU A 1 250 ? 51.542  16.339  6.374   1.00 43.32  ? 250  LEU A CA  1 
ATOM   1934 C C   . LEU A 1 250 ? 51.341  17.278  7.540   1.00 47.40  ? 250  LEU A C   1 
ATOM   1935 O O   . LEU A 1 250 ? 51.934  18.349  7.611   1.00 50.96  ? 250  LEU A O   1 
ATOM   1936 C CB  . LEU A 1 250 ? 50.344  16.438  5.445   1.00 38.14  ? 250  LEU A CB  1 
ATOM   1937 C CG  . LEU A 1 250 ? 50.106  17.846  4.882   1.00 41.76  ? 250  LEU A CG  1 
ATOM   1938 C CD1 . LEU A 1 250 ? 51.412  18.553  4.478   1.00 28.87  ? 250  LEU A CD1 1 
ATOM   1939 C CD2 . LEU A 1 250 ? 49.137  17.826  3.706   1.00 38.75  ? 250  LEU A CD2 1 
ATOM   1940 N N   . LEU A 1 251 ? 50.496  16.871  8.469   1.00 43.38  ? 251  LEU A N   1 
ATOM   1941 C CA  . LEU A 1 251 ? 50.240  17.715  9.609   1.00 37.82  ? 251  LEU A CA  1 
ATOM   1942 C C   . LEU A 1 251 ? 51.507  17.933  10.403  1.00 36.53  ? 251  LEU A C   1 
ATOM   1943 O O   . LEU A 1 251 ? 51.758  19.061  10.824  1.00 37.80  ? 251  LEU A O   1 
ATOM   1944 C CB  . LEU A 1 251 ? 49.145  17.147  10.510  1.00 32.59  ? 251  LEU A CB  1 
ATOM   1945 C CG  . LEU A 1 251 ? 49.199  17.995  11.776  1.00 36.94  ? 251  LEU A CG  1 
ATOM   1946 C CD1 . LEU A 1 251 ? 48.273  19.208  11.674  1.00 41.84  ? 251  LEU A CD1 1 
ATOM   1947 C CD2 . LEU A 1 251 ? 48.891  17.165  12.961  1.00 39.58  ? 251  LEU A CD2 1 
ATOM   1948 N N   . ALA A 1 252 ? 52.289  16.864  10.621  1.00 34.69  ? 252  ALA A N   1 
ATOM   1949 C CA  . ALA A 1 252 ? 53.614  16.985  11.267  1.00 39.61  ? 252  ALA A CA  1 
ATOM   1950 C C   . ALA A 1 252 ? 54.460  18.059  10.592  1.00 40.73  ? 252  ALA A C   1 
ATOM   1951 O O   . ALA A 1 252 ? 54.929  18.975  11.252  1.00 42.47  ? 252  ALA A O   1 
ATOM   1952 C CB  . ALA A 1 252 ? 54.373  15.647  11.289  1.00 33.42  ? 252  ALA A CB  1 
ATOM   1953 N N   . ARG A 1 253 ? 54.624  17.951  9.276   1.00 35.31  ? 253  ARG A N   1 
ATOM   1954 C CA  . ARG A 1 253 ? 55.354  18.950  8.506   1.00 42.78  ? 253  ARG A CA  1 
ATOM   1955 C C   . ARG A 1 253 ? 54.893  20.389  8.762   1.00 50.67  ? 253  ARG A C   1 
ATOM   1956 O O   . ARG A 1 253 ? 55.719  21.281  9.001   1.00 50.95  ? 253  ARG A O   1 
ATOM   1957 C CB  . ARG A 1 253 ? 55.265  18.649  7.017   1.00 34.95  ? 253  ARG A CB  1 
ATOM   1958 C CG  . ARG A 1 253 ? 56.243  17.617  6.560   1.00 49.86  ? 253  ARG A CG  1 
ATOM   1959 C CD  . ARG A 1 253 ? 56.294  17.560  5.033   1.00 69.88  ? 253  ARG A CD  1 
ATOM   1960 N NE  . ARG A 1 253 ? 56.746  16.250  4.555   1.00 86.50  ? 253  ARG A NE  1 
ATOM   1961 C CZ  . ARG A 1 253 ? 55.943  15.264  4.137   1.00 89.28  ? 253  ARG A CZ  1 
ATOM   1962 N NH1 . ARG A 1 253 ? 56.483  14.110  3.730   1.00 91.85  ? 253  ARG A NH1 1 
ATOM   1963 N NH2 . ARG A 1 253 ? 54.610  15.422  4.116   1.00 71.48  ? 253  ARG A NH2 1 
ATOM   1964 N N   . LEU A 1 254 ? 53.579  20.603  8.700   1.00 46.14  ? 254  LEU A N   1 
ATOM   1965 C CA  . LEU A 1 254 ? 52.986  21.931  8.828   1.00 49.68  ? 254  LEU A CA  1 
ATOM   1966 C C   . LEU A 1 254 ? 53.304  22.583  10.153  1.00 52.49  ? 254  LEU A C   1 
ATOM   1967 O O   . LEU A 1 254 ? 53.188  23.796  10.277  1.00 51.01  ? 254  LEU A O   1 
ATOM   1968 C CB  . LEU A 1 254 ? 51.465  21.873  8.664   1.00 48.60  ? 254  LEU A CB  1 
ATOM   1969 C CG  . LEU A 1 254 ? 50.988  21.439  7.283   1.00 49.39  ? 254  LEU A CG  1 
ATOM   1970 C CD1 . LEU A 1 254 ? 49.513  21.070  7.291   1.00 43.66  ? 254  LEU A CD1 1 
ATOM   1971 C CD2 . LEU A 1 254 ? 51.285  22.521  6.282   1.00 45.07  ? 254  LEU A CD2 1 
ATOM   1972 N N   . VAL A 1 255 ? 53.672  21.775  11.144  1.00 50.55  ? 255  VAL A N   1 
ATOM   1973 C CA  . VAL A 1 255 ? 54.034  22.298  12.457  1.00 49.04  ? 255  VAL A CA  1 
ATOM   1974 C C   . VAL A 1 255 ? 55.516  22.083  12.759  1.00 56.89  ? 255  VAL A C   1 
ATOM   1975 O O   . VAL A 1 255 ? 55.968  22.347  13.861  1.00 65.77  ? 255  VAL A O   1 
ATOM   1976 C CB  . VAL A 1 255 ? 53.166  21.692  13.589  1.00 40.77  ? 255  VAL A CB  1 
ATOM   1977 C CG1 . VAL A 1 255 ? 51.689  21.867  13.269  1.00 37.92  ? 255  VAL A CG1 1 
ATOM   1978 C CG2 . VAL A 1 255 ? 53.494  20.234  13.808  1.00 34.11  ? 255  VAL A CG2 1 
ATOM   1979 N N   . GLY A 1 256 ? 56.258  21.587  11.776  1.00 55.77  ? 256  GLY A N   1 
ATOM   1980 C CA  . GLY A 1 256 ? 57.698  21.462  11.882  1.00 62.13  ? 256  GLY A CA  1 
ATOM   1981 C C   . GLY A 1 256 ? 58.259  20.128  12.336  1.00 62.87  ? 256  GLY A C   1 
ATOM   1982 O O   . GLY A 1 256 ? 59.011  20.117  13.287  1.00 62.36  ? 256  GLY A O   1 
ATOM   1983 N N   . CYS A 1 257 ? 57.938  19.029  11.647  1.00 62.01  ? 257  CYS A N   1 
ATOM   1984 C CA  . CYS A 1 257 ? 58.414  17.713  12.051  1.00 56.62  ? 257  CYS A CA  1 
ATOM   1985 C C   . CYS A 1 257 ? 58.842  16.785  10.894  1.00 66.95  ? 257  CYS A C   1 
ATOM   1986 O O   . CYS A 1 257 ? 59.963  16.235  10.888  1.00 61.31  ? 257  CYS A O   1 
ATOM   1987 C CB  . CYS A 1 257 ? 57.367  17.052  12.947  1.00 51.96  ? 257  CYS A CB  1 
ATOM   1988 S SG  . CYS A 1 257 ? 57.022  17.901  14.601  1.00 56.35  ? 257  CYS A SG  1 
ATOM   1989 N N   . ASN A 1 265 ? 61.187  7.236   10.248  1.00 82.33  ? 265  ASN A N   1 
ATOM   1990 C CA  . ASN A 1 265 ? 60.962  6.647   11.570  1.00 84.45  ? 265  ASN A CA  1 
ATOM   1991 C C   . ASN A 1 265 ? 59.807  7.333   12.327  1.00 76.49  ? 265  ASN A C   1 
ATOM   1992 O O   . ASN A 1 265 ? 59.843  8.535   12.569  1.00 76.47  ? 265  ASN A O   1 
ATOM   1993 C CB  . ASN A 1 265 ? 62.281  6.648   12.366  1.00 90.96  ? 265  ASN A CB  1 
ATOM   1994 C CG  . ASN A 1 265 ? 62.094  6.305   13.840  1.00 93.06  ? 265  ASN A CG  1 
ATOM   1995 O OD1 . ASN A 1 265 ? 61.591  7.123   14.606  1.00 93.70  ? 265  ASN A OD1 1 
ATOM   1996 N ND2 . ASN A 1 265 ? 62.534  5.109   14.251  1.00 87.73  ? 265  ASN A ND2 1 
ATOM   1997 N N   . ASP A 1 266 ? 58.774  6.566   12.678  1.00 70.00  ? 266  ASP A N   1 
ATOM   1998 C CA  . ASP A 1 266 ? 57.542  7.115   13.278  1.00 57.50  ? 266  ASP A CA  1 
ATOM   1999 C C   . ASP A 1 266 ? 57.745  7.668   14.673  1.00 55.33  ? 266  ASP A C   1 
ATOM   2000 O O   . ASP A 1 266 ? 57.174  8.687   15.053  1.00 50.86  ? 266  ASP A O   1 
ATOM   2001 C CB  . ASP A 1 266 ? 56.466  6.033   13.391  1.00 56.37  ? 266  ASP A CB  1 
ATOM   2002 C CG  . ASP A 1 266 ? 55.920  5.610   12.059  1.00 64.10  ? 266  ASP A CG  1 
ATOM   2003 O OD1 . ASP A 1 266 ? 56.200  6.283   11.057  1.00 72.61  ? 266  ASP A OD1 1 
ATOM   2004 O OD2 . ASP A 1 266 ? 55.207  4.595   12.013  1.00 69.20  ? 266  ASP A OD2 1 
ATOM   2005 N N   . THR A 1 267 ? 58.534  6.944   15.448  1.00 56.90  ? 267  THR A N   1 
ATOM   2006 C CA  . THR A 1 267 ? 58.802  7.271   16.834  1.00 50.90  ? 267  THR A CA  1 
ATOM   2007 C C   . THR A 1 267 ? 59.273  8.698   17.026  1.00 45.17  ? 267  THR A C   1 
ATOM   2008 O O   . THR A 1 267 ? 58.751  9.425   17.857  1.00 39.58  ? 267  THR A O   1 
ATOM   2009 C CB  . THR A 1 267 ? 59.869  6.322   17.362  1.00 57.12  ? 267  THR A CB  1 
ATOM   2010 O OG1 . THR A 1 267 ? 59.388  4.978   17.235  1.00 58.08  ? 267  THR A OG1 1 
ATOM   2011 C CG2 . THR A 1 267 ? 60.205  6.622   18.806  1.00 30.57  ? 267  THR A CG2 1 
ATOM   2012 N N   . GLU A 1 268 ? 60.280  9.082   16.261  1.00 59.78  ? 268  GLU A N   1 
ATOM   2013 C CA  . GLU A 1 268 ? 60.891  10.399  16.374  1.00 70.36  ? 268  GLU A CA  1 
ATOM   2014 C C   . GLU A 1 268 ? 59.941  11.508  15.882  1.00 62.39  ? 268  GLU A C   1 
ATOM   2015 O O   . GLU A 1 268 ? 59.911  12.620  16.412  1.00 65.22  ? 268  GLU A O   1 
ATOM   2016 C CB  . GLU A 1 268 ? 62.230  10.381  15.627  1.00 77.58  ? 268  GLU A CB  1 
ATOM   2017 C CG  . GLU A 1 268 ? 62.658  11.671  14.984  1.00 93.47  ? 268  GLU A CG  1 
ATOM   2018 C CD  . GLU A 1 268 ? 63.796  11.442  13.992  1.00 111.62 ? 268  GLU A CD  1 
ATOM   2019 O OE1 . GLU A 1 268 ? 64.353  12.440  13.469  1.00 111.14 ? 268  GLU A OE1 1 
ATOM   2020 O OE2 . GLU A 1 268 ? 64.127  10.255  13.739  1.00 118.87 ? 268  GLU A OE2 1 
ATOM   2021 N N   . LEU A 1 269 ? 59.142  11.181  14.883  1.00 50.71  ? 269  LEU A N   1 
ATOM   2022 C CA  . LEU A 1 269 ? 58.145  12.106  14.378  1.00 49.34  ? 269  LEU A CA  1 
ATOM   2023 C C   . LEU A 1 269 ? 57.027  12.372  15.393  1.00 53.14  ? 269  LEU A C   1 
ATOM   2024 O O   . LEU A 1 269 ? 56.530  13.488  15.507  1.00 58.96  ? 269  LEU A O   1 
ATOM   2025 C CB  . LEU A 1 269 ? 57.556  11.569  13.083  1.00 36.58  ? 269  LEU A CB  1 
ATOM   2026 C CG  . LEU A 1 269 ? 56.514  12.440  12.410  1.00 43.13  ? 269  LEU A CG  1 
ATOM   2027 C CD1 . LEU A 1 269 ? 56.561  12.169  10.942  1.00 47.89  ? 269  LEU A CD1 1 
ATOM   2028 C CD2 . LEU A 1 269 ? 55.106  12.194  12.956  1.00 47.12  ? 269  LEU A CD2 1 
ATOM   2029 N N   . ILE A 1 270 ? 56.623  11.341  16.118  1.00 46.18  ? 270  ILE A N   1 
ATOM   2030 C CA  . ILE A 1 270 ? 55.544  11.497  17.063  1.00 42.74  ? 270  ILE A CA  1 
ATOM   2031 C C   . ILE A 1 270 ? 56.064  12.265  18.249  1.00 45.76  ? 270  ILE A C   1 
ATOM   2032 O O   . ILE A 1 270 ? 55.416  13.201  18.727  1.00 55.37  ? 270  ILE A O   1 
ATOM   2033 C CB  . ILE A 1 270 ? 54.950  10.146  17.476  1.00 46.42  ? 270  ILE A CB  1 
ATOM   2034 C CG1 . ILE A 1 270 ? 54.194  9.551   16.296  1.00 50.39  ? 270  ILE A CG1 1 
ATOM   2035 C CG2 . ILE A 1 270 ? 53.978  10.306  18.637  1.00 44.14  ? 270  ILE A CG2 1 
ATOM   2036 C CD1 . ILE A 1 270 ? 54.242  8.051   16.243  1.00 58.99  ? 270  ILE A CD1 1 
ATOM   2037 N N   . ALA A 1 271 ? 57.246  11.881  18.708  1.00 40.01  ? 271  ALA A N   1 
ATOM   2038 C CA  . ALA A 1 271 ? 57.914  12.599  19.777  1.00 42.78  ? 271  ALA A CA  1 
ATOM   2039 C C   . ALA A 1 271 ? 57.852  14.107  19.523  1.00 48.08  ? 271  ALA A C   1 
ATOM   2040 O O   . ALA A 1 271 ? 57.549  14.897  20.423  1.00 49.89  ? 271  ALA A O   1 
ATOM   2041 C CB  . ALA A 1 271 ? 59.349  12.154  19.885  1.00 34.31  ? 271  ALA A CB  1 
ATOM   2042 N N   . CYS A 1 272 ? 58.147  14.519  18.299  1.00 41.90  ? 272  CYS A N   1 
ATOM   2043 C CA  . CYS A 1 272 ? 58.134  15.942  18.024  1.00 41.83  ? 272  CYS A CA  1 
ATOM   2044 C C   . CYS A 1 272 ? 56.689  16.448  18.155  1.00 48.15  ? 272  CYS A C   1 
ATOM   2045 O O   . CYS A 1 272 ? 56.447  17.428  18.872  1.00 47.51  ? 272  CYS A O   1 
ATOM   2046 C CB  . CYS A 1 272 ? 58.750  16.245  16.656  1.00 36.57  ? 272  CYS A CB  1 
ATOM   2047 S SG  . CYS A 1 272 ? 58.503  17.921  16.044  1.00 61.62  ? 272  CYS A SG  1 
ATOM   2048 N N   . LEU A 1 273 ? 55.733  15.774  17.503  1.00 34.12  ? 273  LEU A N   1 
ATOM   2049 C CA  . LEU A 1 273 ? 54.325  16.136  17.684  1.00 48.25  ? 273  LEU A CA  1 
ATOM   2050 C C   . LEU A 1 273 ? 53.964  16.334  19.167  1.00 53.43  ? 273  LEU A C   1 
ATOM   2051 O O   . LEU A 1 273 ? 53.202  17.237  19.512  1.00 44.58  ? 273  LEU A O   1 
ATOM   2052 C CB  . LEU A 1 273 ? 53.368  15.134  17.019  1.00 40.70  ? 273  LEU A CB  1 
ATOM   2053 C CG  . LEU A 1 273 ? 53.207  15.299  15.496  1.00 43.49  ? 273  LEU A CG  1 
ATOM   2054 C CD1 . LEU A 1 273 ? 52.197  14.322  14.863  1.00 30.03  ? 273  LEU A CD1 1 
ATOM   2055 C CD2 . LEU A 1 273 ? 52.819  16.724  15.161  1.00 52.27  ? 273  LEU A CD2 1 
ATOM   2056 N N   . ARG A 1 274 ? 54.532  15.518  20.048  1.00 51.50  ? 274  ARG A N   1 
ATOM   2057 C CA  . ARG A 1 274 ? 54.168  15.603  21.455  1.00 47.66  ? 274  ARG A CA  1 
ATOM   2058 C C   . ARG A 1 274 ? 54.725  16.829  22.150  1.00 49.85  ? 274  ARG A C   1 
ATOM   2059 O O   . ARG A 1 274 ? 54.306  17.161  23.246  1.00 62.76  ? 274  ARG A O   1 
ATOM   2060 C CB  . ARG A 1 274 ? 54.541  14.333  22.206  1.00 39.21  ? 274  ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 274 ? 53.543  13.202  21.992  1.00 43.85  ? 274  ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 274 ? 53.724  12.158  23.066  1.00 54.93  ? 274  ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 274 ? 55.138  11.845  23.111  1.00 65.99  ? 274  ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 274 ? 55.661  10.783  22.523  1.00 62.73  ? 274  ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 274 ? 54.833  9.934   21.920  1.00 51.55  ? 274  ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 274 ? 56.989  10.572  22.559  1.00 54.49  ? 274  ARG A NH2 1 
ATOM   2067 N N   . THR A 1 275 ? 55.642  17.527  21.503  1.00 42.32  ? 275  THR A N   1 
ATOM   2068 C CA  . THR A 1 275 ? 56.200  18.734  22.095  1.00 44.52  ? 275  THR A CA  1 
ATOM   2069 C C   . THR A 1 275 ? 55.473  19.980  21.599  1.00 44.19  ? 275  THR A C   1 
ATOM   2070 O O   . THR A 1 275 ? 55.603  21.054  22.159  1.00 50.44  ? 275  THR A O   1 
ATOM   2071 C CB  . THR A 1 275 ? 57.717  18.878  21.806  1.00 45.21  ? 275  THR A CB  1 
ATOM   2072 O OG1 . THR A 1 275 ? 57.910  19.201  20.429  1.00 56.68  ? 275  THR A OG1 1 
ATOM   2073 C CG2 . THR A 1 275 ? 58.435  17.601  22.103  1.00 38.74  ? 275  THR A CG2 1 
ATOM   2074 N N   . ARG A 1 276 ? 54.701  19.832  20.540  1.00 45.07  ? 276  ARG A N   1 
ATOM   2075 C CA  . ARG A 1 276 ? 53.894  20.929  20.039  1.00 42.30  ? 276  ARG A CA  1 
ATOM   2076 C C   . ARG A 1 276 ? 52.753  21.310  20.991  1.00 47.29  ? 276  ARG A C   1 
ATOM   2077 O O   . ARG A 1 276 ? 52.037  20.451  21.522  1.00 40.54  ? 276  ARG A O   1 
ATOM   2078 C CB  . ARG A 1 276 ? 53.351  20.559  18.669  1.00 41.63  ? 276  ARG A CB  1 
ATOM   2079 C CG  . ARG A 1 276 ? 54.445  20.488  17.651  1.00 44.95  ? 276  ARG A CG  1 
ATOM   2080 C CD  . ARG A 1 276 ? 55.109  21.838  17.560  1.00 51.10  ? 276  ARG A CD  1 
ATOM   2081 N NE  . ARG A 1 276 ? 56.331  21.830  16.762  1.00 68.41  ? 276  ARG A NE  1 
ATOM   2082 C CZ  . ARG A 1 276 ? 57.549  21.582  17.247  1.00 71.38  ? 276  ARG A CZ  1 
ATOM   2083 N NH1 . ARG A 1 276 ? 57.692  21.303  18.541  1.00 67.71  ? 276  ARG A NH1 1 
ATOM   2084 N NH2 . ARG A 1 276 ? 58.619  21.617  16.441  1.00 62.76  ? 276  ARG A NH2 1 
ATOM   2085 N N   . PRO A 1 277 ? 52.595  22.617  21.219  1.00 46.23  ? 277  PRO A N   1 
ATOM   2086 C CA  . PRO A 1 277 ? 51.470  23.160  21.974  1.00 44.07  ? 277  PRO A CA  1 
ATOM   2087 C C   . PRO A 1 277 ? 50.207  22.643  21.318  1.00 37.76  ? 277  PRO A C   1 
ATOM   2088 O O   . PRO A 1 277 ? 50.184  22.585  20.098  1.00 40.59  ? 277  PRO A O   1 
ATOM   2089 C CB  . PRO A 1 277 ? 51.569  24.668  21.715  1.00 40.62  ? 277  PRO A CB  1 
ATOM   2090 C CG  . PRO A 1 277 ? 52.924  24.900  21.186  1.00 38.84  ? 277  PRO A CG  1 
ATOM   2091 C CD  . PRO A 1 277 ? 53.361  23.659  20.521  1.00 40.60  ? 277  PRO A CD  1 
ATOM   2092 N N   . ALA A 1 278 ? 49.185  22.294  22.088  1.00 37.36  ? 278  ALA A N   1 
ATOM   2093 C CA  . ALA A 1 278 ? 47.936  21.783  21.504  1.00 39.58  ? 278  ALA A CA  1 
ATOM   2094 C C   . ALA A 1 278 ? 47.364  22.700  20.426  1.00 40.79  ? 278  ALA A C   1 
ATOM   2095 O O   . ALA A 1 278 ? 46.920  22.228  19.378  1.00 39.15  ? 278  ALA A O   1 
ATOM   2096 C CB  . ALA A 1 278 ? 46.890  21.520  22.579  1.00 25.17  ? 278  ALA A CB  1 
ATOM   2097 N N   . GLN A 1 279 ? 47.391  24.006  20.680  1.00 38.58  ? 279  GLN A N   1 
ATOM   2098 C CA  . GLN A 1 279 ? 46.795  24.953  19.742  1.00 33.54  ? 279  GLN A CA  1 
ATOM   2099 C C   . GLN A 1 279 ? 47.418  24.948  18.347  1.00 38.82  ? 279  GLN A C   1 
ATOM   2100 O O   . GLN A 1 279 ? 46.702  25.133  17.363  1.00 43.89  ? 279  GLN A O   1 
ATOM   2101 C CB  . GLN A 1 279 ? 46.770  26.375  20.307  1.00 27.87  ? 279  GLN A CB  1 
ATOM   2102 C CG  . GLN A 1 279 ? 45.888  27.332  19.517  1.00 35.58  ? 279  GLN A CG  1 
ATOM   2103 C CD  . GLN A 1 279 ? 44.413  26.894  19.517  1.00 43.70  ? 279  GLN A CD  1 
ATOM   2104 O OE1 . GLN A 1 279 ? 43.809  26.684  20.581  1.00 36.71  ? 279  GLN A OE1 1 
ATOM   2105 N NE2 . GLN A 1 279 ? 43.836  26.745  18.317  1.00 43.84  ? 279  GLN A NE2 1 
ATOM   2106 N N   . ASP A 1 280 ? 48.730  24.739  18.247  1.00 36.93  ? 280  ASP A N   1 
ATOM   2107 C CA  . ASP A 1 280 ? 49.357  24.678  16.929  1.00 43.74  ? 280  ASP A CA  1 
ATOM   2108 C C   . ASP A 1 280 ? 48.771  23.530  16.125  1.00 42.37  ? 280  ASP A C   1 
ATOM   2109 O O   . ASP A 1 280 ? 48.604  23.655  14.911  1.00 43.98  ? 280  ASP A O   1 
ATOM   2110 C CB  . ASP A 1 280 ? 50.882  24.534  17.014  1.00 54.48  ? 280  ASP A CB  1 
ATOM   2111 C CG  . ASP A 1 280 ? 51.547  25.762  17.599  1.00 73.99  ? 280  ASP A CG  1 
ATOM   2112 O OD1 . ASP A 1 280 ? 50.864  26.819  17.689  1.00 82.13  ? 280  ASP A OD1 1 
ATOM   2113 O OD2 . ASP A 1 280 ? 52.743  25.670  17.966  1.00 76.72  ? 280  ASP A OD2 1 
ATOM   2114 N N   . LEU A 1 281 ? 48.449  22.422  16.799  1.00 28.91  ? 281  LEU A N   1 
ATOM   2115 C CA  . LEU A 1 281 ? 47.864  21.286  16.101  1.00 29.70  ? 281  LEU A CA  1 
ATOM   2116 C C   . LEU A 1 281 ? 46.437  21.627  15.619  1.00 38.23  ? 281  LEU A C   1 
ATOM   2117 O O   . LEU A 1 281 ? 46.067  21.339  14.469  1.00 39.28  ? 281  LEU A O   1 
ATOM   2118 C CB  . LEU A 1 281 ? 47.898  19.988  16.934  1.00 21.68  ? 281  LEU A CB  1 
ATOM   2119 C CG  . LEU A 1 281 ? 49.192  19.484  17.592  1.00 37.19  ? 281  LEU A CG  1 
ATOM   2120 C CD1 . LEU A 1 281 ? 48.970  18.169  18.289  1.00 45.58  ? 281  LEU A CD1 1 
ATOM   2121 C CD2 . LEU A 1 281 ? 50.379  19.368  16.632  1.00 36.40  ? 281  LEU A CD2 1 
ATOM   2122 N N   . VAL A 1 282 ? 45.645  22.256  16.482  1.00 33.48  ? 282  VAL A N   1 
ATOM   2123 C CA  . VAL A 1 282 ? 44.293  22.643  16.095  1.00 40.09  ? 282  VAL A CA  1 
ATOM   2124 C C   . VAL A 1 282 ? 44.325  23.630  14.922  1.00 42.43  ? 282  VAL A C   1 
ATOM   2125 O O   . VAL A 1 282 ? 43.530  23.508  13.976  1.00 42.26  ? 282  VAL A O   1 
ATOM   2126 C CB  . VAL A 1 282 ? 43.487  23.230  17.275  1.00 34.38  ? 282  VAL A CB  1 
ATOM   2127 C CG1 . VAL A 1 282 ? 42.243  23.885  16.770  1.00 27.21  ? 282  VAL A CG1 1 
ATOM   2128 C CG2 . VAL A 1 282 ? 43.142  22.148  18.264  1.00 35.69  ? 282  VAL A CG2 1 
ATOM   2129 N N   . ASP A 1 283 ? 45.248  24.593  14.976  1.00 33.96  ? 283  ASP A N   1 
ATOM   2130 C CA  . ASP A 1 283 ? 45.338  25.628  13.929  1.00 29.90  ? 283  ASP A CA  1 
ATOM   2131 C C   . ASP A 1 283 ? 45.696  25.060  12.549  1.00 34.00  ? 283  ASP A C   1 
ATOM   2132 O O   . ASP A 1 283 ? 45.655  25.768  11.550  1.00 39.37  ? 283  ASP A O   1 
ATOM   2133 C CB  . ASP A 1 283 ? 46.348  26.734  14.298  1.00 36.42  ? 283  ASP A CB  1 
ATOM   2134 C CG  . ASP A 1 283 ? 45.917  27.571  15.499  1.00 46.25  ? 283  ASP A CG  1 
ATOM   2135 O OD1 . ASP A 1 283 ? 44.709  27.559  15.828  1.00 53.88  ? 283  ASP A OD1 1 
ATOM   2136 O OD2 . ASP A 1 283 ? 46.791  28.236  16.113  1.00 46.83  ? 283  ASP A OD2 1 
ATOM   2137 N N   . HIS A 1 284 ? 46.050  23.782  12.485  1.00 40.54  ? 284  HIS A N   1 
ATOM   2138 C CA  . HIS A 1 284 ? 46.567  23.234  11.239  1.00 39.29  ? 284  HIS A CA  1 
ATOM   2139 C C   . HIS A 1 284 ? 45.884  21.979  10.767  1.00 37.95  ? 284  HIS A C   1 
ATOM   2140 O O   . HIS A 1 284 ? 46.078  21.574  9.610   1.00 27.29  ? 284  HIS A O   1 
ATOM   2141 C CB  . HIS A 1 284 ? 48.053  22.957  11.353  1.00 33.37  ? 284  HIS A CB  1 
ATOM   2142 C CG  . HIS A 1 284 ? 48.889  24.187  11.258  1.00 47.26  ? 284  HIS A CG  1 
ATOM   2143 N ND1 . HIS A 1 284 ? 49.264  24.914  12.369  1.00 51.15  ? 284  HIS A ND1 1 
ATOM   2144 C CD2 . HIS A 1 284 ? 49.403  24.835  10.189  1.00 57.68  ? 284  HIS A CD2 1 
ATOM   2145 C CE1 . HIS A 1 284 ? 49.996  25.946  11.983  1.00 61.66  ? 284  HIS A CE1 1 
ATOM   2146 N NE2 . HIS A 1 284 ? 50.086  25.925  10.667  1.00 63.50  ? 284  HIS A NE2 1 
ATOM   2147 N N   . GLU A 1 285 ? 45.105  21.355  11.650  1.00 33.92  ? 285  GLU A N   1 
ATOM   2148 C CA  . GLU A 1 285 ? 44.512  20.064  11.315  1.00 35.84  ? 285  GLU A CA  1 
ATOM   2149 C C   . GLU A 1 285 ? 43.713  20.161  10.018  1.00 32.28  ? 285  GLU A C   1 
ATOM   2150 O O   . GLU A 1 285 ? 43.808  19.301  9.141   1.00 31.61  ? 285  GLU A O   1 
ATOM   2151 C CB  . GLU A 1 285 ? 43.671  19.506  12.455  1.00 38.12  ? 285  GLU A CB  1 
ATOM   2152 C CG  . GLU A 1 285 ? 42.454  20.316  12.793  1.00 44.79  ? 285  GLU A CG  1 
ATOM   2153 C CD  . GLU A 1 285 ? 41.673  19.713  13.930  1.00 52.68  ? 285  GLU A CD  1 
ATOM   2154 O OE1 . GLU A 1 285 ? 40.530  20.173  14.162  1.00 58.66  ? 285  GLU A OE1 1 
ATOM   2155 O OE2 . GLU A 1 285 ? 42.207  18.782  14.583  1.00 57.52  ? 285  GLU A OE2 1 
ATOM   2156 N N   . TRP A 1 286 ? 43.006  21.262  9.853   1.00 32.37  ? 286  TRP A N   1 
ATOM   2157 C CA  . TRP A 1 286 ? 42.092  21.372  8.735   1.00 40.28  ? 286  TRP A CA  1 
ATOM   2158 C C   . TRP A 1 286 ? 42.772  21.507  7.361   1.00 43.36  ? 286  TRP A C   1 
ATOM   2159 O O   . TRP A 1 286 ? 42.147  21.337  6.321   1.00 46.53  ? 286  TRP A O   1 
ATOM   2160 C CB  . TRP A 1 286 ? 41.109  22.495  9.032   1.00 48.29  ? 286  TRP A CB  1 
ATOM   2161 C CG  . TRP A 1 286 ? 39.887  22.473  8.219   1.00 48.44  ? 286  TRP A CG  1 
ATOM   2162 C CD1 . TRP A 1 286 ? 39.501  21.520  7.311   1.00 48.10  ? 286  TRP A CD1 1 
ATOM   2163 C CD2 . TRP A 1 286 ? 38.862  23.460  8.231   1.00 57.44  ? 286  TRP A CD2 1 
ATOM   2164 N NE1 . TRP A 1 286 ? 38.305  21.881  6.730   1.00 48.46  ? 286  TRP A NE1 1 
ATOM   2165 C CE2 . TRP A 1 286 ? 37.888  23.065  7.292   1.00 54.90  ? 286  TRP A CE2 1 
ATOM   2166 C CE3 . TRP A 1 286 ? 38.677  24.658  8.936   1.00 61.93  ? 286  TRP A CE3 1 
ATOM   2167 C CZ2 . TRP A 1 286 ? 36.749  23.826  7.049   1.00 52.96  ? 286  TRP A CZ2 1 
ATOM   2168 C CZ3 . TRP A 1 286 ? 37.545  25.404  8.694   1.00 54.32  ? 286  TRP A CZ3 1 
ATOM   2169 C CH2 . TRP A 1 286 ? 36.596  24.984  7.764   1.00 51.21  ? 286  TRP A CH2 1 
ATOM   2170 N N   . HIS A 1 287 ? 44.071  21.758  7.352   1.00 52.99  ? 287  HIS A N   1 
ATOM   2171 C CA  . HIS A 1 287 ? 44.787  21.890  6.084   1.00 56.97  ? 287  HIS A CA  1 
ATOM   2172 C C   . HIS A 1 287 ? 45.176  20.577  5.414   1.00 54.18  ? 287  HIS A C   1 
ATOM   2173 O O   . HIS A 1 287 ? 45.506  20.563  4.238   1.00 55.67  ? 287  HIS A O   1 
ATOM   2174 C CB  . HIS A 1 287 ? 46.009  22.775  6.260   1.00 57.66  ? 287  HIS A CB  1 
ATOM   2175 C CG  . HIS A 1 287 ? 45.673  24.130  6.798   1.00 70.10  ? 287  HIS A CG  1 
ATOM   2176 N ND1 . HIS A 1 287 ? 46.543  24.869  7.572   1.00 74.73  ? 287  HIS A ND1 1 
ATOM   2177 C CD2 . HIS A 1 287 ? 44.541  24.865  6.695   1.00 72.61  ? 287  HIS A CD2 1 
ATOM   2178 C CE1 . HIS A 1 287 ? 45.967  26.007  7.908   1.00 74.57  ? 287  HIS A CE1 1 
ATOM   2179 N NE2 . HIS A 1 287 ? 44.749  26.026  7.394   1.00 75.38  ? 287  HIS A NE2 1 
ATOM   2180 N N   . VAL A 1 288 ? 45.113  19.469  6.137   1.00 47.06  ? 288  VAL A N   1 
ATOM   2181 C CA  . VAL A 1 288 ? 45.554  18.223  5.537   1.00 46.67  ? 288  VAL A CA  1 
ATOM   2182 C C   . VAL A 1 288 ? 44.521  17.513  4.665   1.00 50.00  ? 288  VAL A C   1 
ATOM   2183 O O   . VAL A 1 288 ? 44.781  16.412  4.207   1.00 55.00  ? 288  VAL A O   1 
ATOM   2184 C CB  . VAL A 1 288 ? 46.153  17.234  6.579   1.00 34.47  ? 288  VAL A CB  1 
ATOM   2185 C CG1 . VAL A 1 288 ? 47.285  17.917  7.376   1.00 31.85  ? 288  VAL A CG1 1 
ATOM   2186 C CG2 . VAL A 1 288 ? 45.078  16.664  7.488   1.00 22.35  ? 288  VAL A CG2 1 
ATOM   2187 N N   . LEU A 1 289 ? 43.358  18.120  4.429   1.00 51.00  ? 289  LEU A N   1 
ATOM   2188 C CA  . LEU A 1 289 ? 42.374  17.513  3.523   1.00 51.39  ? 289  LEU A CA  1 
ATOM   2189 C C   . LEU A 1 289 ? 42.872  17.566  2.072   1.00 57.47  ? 289  LEU A C   1 
ATOM   2190 O O   . LEU A 1 289 ? 43.498  18.541  1.664   1.00 63.07  ? 289  LEU A O   1 
ATOM   2191 C CB  . LEU A 1 289 ? 40.996  18.172  3.638   1.00 44.76  ? 289  LEU A CB  1 
ATOM   2192 C CG  . LEU A 1 289 ? 40.097  17.808  4.819   1.00 44.33  ? 289  LEU A CG  1 
ATOM   2193 C CD1 . LEU A 1 289 ? 38.833  18.620  4.771   1.00 34.16  ? 289  LEU A CD1 1 
ATOM   2194 C CD2 . LEU A 1 289 ? 39.769  16.325  4.860   1.00 48.24  ? 289  LEU A CD2 1 
ATOM   2195 N N   . PRO A 1 290 ? 42.582  16.512  1.296   1.00 60.53  ? 290  PRO A N   1 
ATOM   2196 C CA  . PRO A 1 290 ? 43.100  16.289  -0.054  1.00 60.42  ? 290  PRO A CA  1 
ATOM   2197 C C   . PRO A 1 290 ? 42.455  17.181  -1.102  1.00 58.25  ? 290  PRO A C   1 
ATOM   2198 O O   . PRO A 1 290 ? 43.140  17.603  -2.026  1.00 50.96  ? 290  PRO A O   1 
ATOM   2199 C CB  . PRO A 1 290 ? 42.727  14.824  -0.338  1.00 66.62  ? 290  PRO A CB  1 
ATOM   2200 C CG  . PRO A 1 290 ? 42.236  14.262  0.960   1.00 68.09  ? 290  PRO A CG  1 
ATOM   2201 C CD  . PRO A 1 290 ? 41.687  15.423  1.709   1.00 66.53  ? 290  PRO A CD  1 
ATOM   2202 N N   . GLN A 1 291 ? 41.153  17.435  -0.976  1.00 64.61  ? 291  GLN A N   1 
ATOM   2203 C CA  . GLN A 1 291 ? 40.438  18.313  -1.906  1.00 59.23  ? 291  GLN A CA  1 
ATOM   2204 C C   . GLN A 1 291 ? 39.676  19.388  -1.121  1.00 60.52  ? 291  GLN A C   1 
ATOM   2205 O O   . GLN A 1 291 ? 39.525  19.281  0.096   1.00 63.97  ? 291  GLN A O   1 
ATOM   2206 C CB  . GLN A 1 291 ? 39.475  17.510  -2.804  1.00 57.59  ? 291  GLN A CB  1 
ATOM   2207 C CG  . GLN A 1 291 ? 40.041  16.219  -3.431  1.00 65.41  ? 291  GLN A CG  1 
ATOM   2208 C CD  . GLN A 1 291 ? 39.726  14.956  -2.607  1.00 81.86  ? 291  GLN A CD  1 
ATOM   2209 O OE1 . GLN A 1 291 ? 38.922  14.991  -1.660  1.00 81.03  ? 291  GLN A OE1 1 
ATOM   2210 N NE2 . GLN A 1 291 ? 40.357  13.834  -2.974  1.00 82.21  ? 291  GLN A NE2 1 
ATOM   2211 N N   . GLU A 1 292 ? 39.233  20.441  -1.803  1.00 61.49  ? 292  GLU A N   1 
ATOM   2212 C CA  . GLU A 1 292 ? 38.315  21.393  -1.195  1.00 62.71  ? 292  GLU A CA  1 
ATOM   2213 C C   . GLU A 1 292 ? 37.027  20.619  -1.028  1.00 59.52  ? 292  GLU A C   1 
ATOM   2214 O O   . GLU A 1 292 ? 36.537  20.030  -1.985  1.00 60.48  ? 292  GLU A O   1 
ATOM   2215 C CB  . GLU A 1 292 ? 38.109  22.589  -2.116  1.00 70.72  ? 292  GLU A CB  1 
ATOM   2216 C CG  . GLU A 1 292 ? 37.419  23.806  -1.501  1.00 86.75  ? 292  GLU A CG  1 
ATOM   2217 C CD  . GLU A 1 292 ? 37.194  24.925  -2.541  1.00 102.65 ? 292  GLU A CD  1 
ATOM   2218 O OE1 . GLU A 1 292 ? 37.589  24.736  -3.718  1.00 105.86 ? 292  GLU A OE1 1 
ATOM   2219 O OE2 . GLU A 1 292 ? 36.623  25.988  -2.191  1.00 105.01 ? 292  GLU A OE2 1 
ATOM   2220 N N   . SER A 1 293 ? 36.479  20.581  0.177   1.00 56.62  ? 293  SER A N   1 
ATOM   2221 C CA  . SER A 1 293 ? 35.304  19.754  0.377   1.00 50.96  ? 293  SER A CA  1 
ATOM   2222 C C   . SER A 1 293 ? 34.414  20.264  1.477   1.00 44.79  ? 293  SER A C   1 
ATOM   2223 O O   . SER A 1 293 ? 34.827  21.136  2.237   1.00 42.66  ? 293  SER A O   1 
ATOM   2224 C CB  . SER A 1 293 ? 35.726  18.320  0.677   1.00 51.08  ? 293  SER A CB  1 
ATOM   2225 O OG  . SER A 1 293 ? 36.766  18.309  1.618   1.00 52.92  ? 293  SER A OG  1 
ATOM   2226 N N   . ILE A 1 294 ? 33.179  19.749  1.513   1.00 43.51  ? 294  ILE A N   1 
ATOM   2227 C CA  . ILE A 1 294 ? 32.330  19.832  2.706   1.00 44.37  ? 294  ILE A CA  1 
ATOM   2228 C C   . ILE A 1 294 ? 32.001  18.413  3.177   1.00 44.16  ? 294  ILE A C   1 
ATOM   2229 O O   . ILE A 1 294 ? 32.048  17.478  2.374   1.00 39.75  ? 294  ILE A O   1 
ATOM   2230 C CB  . ILE A 1 294 ? 31.040  20.604  2.470   1.00 40.36  ? 294  ILE A CB  1 
ATOM   2231 C CG1 . ILE A 1 294 ? 30.272  20.005  1.303   1.00 40.81  ? 294  ILE A CG1 1 
ATOM   2232 C CG2 . ILE A 1 294 ? 31.328  22.070  2.220   1.00 36.30  ? 294  ILE A CG2 1 
ATOM   2233 C CD1 . ILE A 1 294 ? 28.905  20.608  1.154   1.00 49.15  ? 294  ILE A CD1 1 
ATOM   2234 N N   . PHE A 1 295 ? 31.717  18.254  4.475   1.00 38.66  ? 295  PHE A N   1 
ATOM   2235 C CA  . PHE A 1 295 ? 31.401  16.950  5.062   1.00 35.65  ? 295  PHE A CA  1 
ATOM   2236 C C   . PHE A 1 295 ? 32.562  15.984  4.913   1.00 44.64  ? 295  PHE A C   1 
ATOM   2237 O O   . PHE A 1 295 ? 32.380  14.802  4.618   1.00 44.75  ? 295  PHE A O   1 
ATOM   2238 C CB  . PHE A 1 295 ? 30.146  16.329  4.427   1.00 32.56  ? 295  PHE A CB  1 
ATOM   2239 C CG  . PHE A 1 295 ? 29.190  15.722  5.431   1.00 45.03  ? 295  PHE A CG  1 
ATOM   2240 C CD1 . PHE A 1 295 ? 29.649  14.798  6.387   1.00 45.03  ? 295  PHE A CD1 1 
ATOM   2241 C CD2 . PHE A 1 295 ? 27.827  16.080  5.430   1.00 43.26  ? 295  PHE A CD2 1 
ATOM   2242 C CE1 . PHE A 1 295 ? 28.769  14.227  7.327   1.00 41.39  ? 295  PHE A CE1 1 
ATOM   2243 C CE2 . PHE A 1 295 ? 26.935  15.518  6.352   1.00 38.36  ? 295  PHE A CE2 1 
ATOM   2244 C CZ  . PHE A 1 295 ? 27.401  14.581  7.306   1.00 40.09  ? 295  PHE A CZ  1 
ATOM   2245 N N   . ARG A 1 296 ? 33.764  16.512  5.078   1.00 48.18  ? 296  ARG A N   1 
ATOM   2246 C CA  . ARG A 1 296 ? 34.965  15.698  5.166   1.00 42.19  ? 296  ARG A CA  1 
ATOM   2247 C C   . ARG A 1 296 ? 35.775  16.270  6.316   1.00 44.42  ? 296  ARG A C   1 
ATOM   2248 O O   . ARG A 1 296 ? 35.857  17.485  6.479   1.00 49.24  ? 296  ARG A O   1 
ATOM   2249 C CB  . ARG A 1 296 ? 35.773  15.726  3.870   1.00 32.00  ? 296  ARG A CB  1 
ATOM   2250 C CG  . ARG A 1 296 ? 35.108  15.067  2.671   1.00 38.48  ? 296  ARG A CG  1 
ATOM   2251 C CD  . ARG A 1 296 ? 35.074  13.538  2.744   1.00 43.50  ? 296  ARG A CD  1 
ATOM   2252 N NE  . ARG A 1 296 ? 34.426  12.970  1.553   1.00 56.24  ? 296  ARG A NE  1 
ATOM   2253 C CZ  . ARG A 1 296 ? 33.105  12.962  1.339   1.00 45.17  ? 296  ARG A CZ  1 
ATOM   2254 N NH1 . ARG A 1 296 ? 32.269  13.495  2.220   1.00 34.71  ? 296  ARG A NH1 1 
ATOM   2255 N NH2 . ARG A 1 296 ? 32.620  12.439  0.228   1.00 36.18  ? 296  ARG A NH2 1 
ATOM   2256 N N   . PHE A 1 297 ? 36.349  15.389  7.126   1.00 46.79  ? 297  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 297 ? 37.065  15.802  8.326   1.00 45.01  ? 297  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 297 ? 38.467  15.188  8.344   1.00 48.51  ? 297  PHE A C   1 
ATOM   2259 O O   . PHE A 1 297 ? 38.661  14.065  7.892   1.00 54.57  ? 297  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 297 ? 36.226  15.402  9.527   1.00 46.59  ? 297  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 297 ? 34.758  15.669  9.323   1.00 49.51  ? 297  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 297 ? 34.270  16.980  9.309   1.00 48.25  ? 297  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 297 ? 33.869  14.626  9.100   1.00 41.90  ? 297  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 297 ? 32.922  17.241  9.098   1.00 47.75  ? 297  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 297 ? 32.523  14.885  8.889   1.00 42.68  ? 297  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 297 ? 32.048  16.191  8.893   1.00 47.06  ? 297  PHE A CZ  1 
ATOM   2267 N N   . SER A 1 298 ? 39.438  15.943  8.837   1.00 40.64  ? 298  SER A N   1 
ATOM   2268 C CA  . SER A 1 298 ? 40.847  15.600  8.697   1.00 41.07  ? 298  SER A CA  1 
ATOM   2269 C C   . SER A 1 298 ? 41.244  14.328  9.420   1.00 49.26  ? 298  SER A C   1 
ATOM   2270 O O   . SER A 1 298 ? 42.022  13.518  8.905   1.00 47.56  ? 298  SER A O   1 
ATOM   2271 C CB  . SER A 1 298 ? 41.691  16.729  9.259   1.00 41.47  ? 298  SER A CB  1 
ATOM   2272 O OG  . SER A 1 298 ? 41.721  17.783  8.337   1.00 53.05  ? 298  SER A OG  1 
ATOM   2273 N N   . PHE A 1 299 ? 40.713  14.176  10.628  1.00 48.63  ? 299  PHE A N   1 
ATOM   2274 C CA  . PHE A 1 299 ? 41.141  13.128  11.533  1.00 44.24  ? 299  PHE A CA  1 
ATOM   2275 C C   . PHE A 1 299 ? 39.981  12.357  12.099  1.00 43.26  ? 299  PHE A C   1 
ATOM   2276 O O   . PHE A 1 299 ? 39.240  12.850  12.955  1.00 48.66  ? 299  PHE A O   1 
ATOM   2277 C CB  . PHE A 1 299 ? 42.020  13.727  12.622  1.00 35.43  ? 299  PHE A CB  1 
ATOM   2278 C CG  . PHE A 1 299 ? 43.336  14.171  12.100  1.00 30.02  ? 299  PHE A CG  1 
ATOM   2279 C CD1 . PHE A 1 299 ? 44.328  13.248  11.846  1.00 28.57  ? 299  PHE A CD1 1 
ATOM   2280 C CD2 . PHE A 1 299 ? 43.560  15.493  11.775  1.00 28.79  ? 299  PHE A CD2 1 
ATOM   2281 C CE1 . PHE A 1 299 ? 45.550  13.646  11.338  1.00 34.99  ? 299  PHE A CE1 1 
ATOM   2282 C CE2 . PHE A 1 299 ? 44.781  15.898  11.263  1.00 38.44  ? 299  PHE A CE2 1 
ATOM   2283 C CZ  . PHE A 1 299 ? 45.782  14.971  11.054  1.00 35.94  ? 299  PHE A CZ  1 
ATOM   2284 N N   . VAL A 1 300 ? 39.829  11.141  11.588  1.00 33.56  ? 300  VAL A N   1 
ATOM   2285 C CA  . VAL A 1 300 ? 38.668  10.312  11.886  1.00 34.60  ? 300  VAL A CA  1 
ATOM   2286 C C   . VAL A 1 300 ? 39.123  8.876   12.180  1.00 36.26  ? 300  VAL A C   1 
ATOM   2287 O O   . VAL A 1 300 ? 40.307  8.547   12.097  1.00 31.87  ? 300  VAL A O   1 
ATOM   2288 C CB  . VAL A 1 300 ? 37.634  10.375  10.719  1.00 35.52  ? 300  VAL A CB  1 
ATOM   2289 C CG1 . VAL A 1 300 ? 37.265  11.863  10.359  1.00 15.28  ? 300  VAL A CG1 1 
ATOM   2290 C CG2 . VAL A 1 300 ? 38.162  9.670   9.476   1.00 27.92  ? 300  VAL A CG2 1 
ATOM   2291 N N   . PRO A 1 301 ? 38.189  8.017   12.571  1.00 38.83  ? 301  PRO A N   1 
ATOM   2292 C CA  . PRO A 1 301 ? 38.615  6.622   12.725  1.00 33.72  ? 301  PRO A CA  1 
ATOM   2293 C C   . PRO A 1 301 ? 39.310  6.083   11.479  1.00 33.69  ? 301  PRO A C   1 
ATOM   2294 O O   . PRO A 1 301 ? 38.825  6.196   10.337  1.00 31.43  ? 301  PRO A O   1 
ATOM   2295 C CB  . PRO A 1 301 ? 37.289  5.900   12.980  1.00 33.81  ? 301  PRO A CB  1 
ATOM   2296 C CG  . PRO A 1 301 ? 36.486  6.916   13.730  1.00 28.98  ? 301  PRO A CG  1 
ATOM   2297 C CD  . PRO A 1 301 ? 36.837  8.249   13.101  1.00 33.50  ? 301  PRO A CD  1 
ATOM   2298 N N   . VAL A 1 302 ? 40.482  5.511   11.699  1.00 41.53  ? 302  VAL A N   1 
ATOM   2299 C CA  . VAL A 1 302 ? 41.215  4.833   10.628  1.00 39.29  ? 302  VAL A CA  1 
ATOM   2300 C C   . VAL A 1 302 ? 40.867  3.329   10.634  1.00 43.14  ? 302  VAL A C   1 
ATOM   2301 O O   . VAL A 1 302 ? 40.704  2.722   11.702  1.00 39.24  ? 302  VAL A O   1 
ATOM   2302 C CB  . VAL A 1 302 ? 42.734  5.037   10.797  1.00 41.70  ? 302  VAL A CB  1 
ATOM   2303 C CG1 . VAL A 1 302 ? 43.179  4.702   12.219  1.00 40.91  ? 302  VAL A CG1 1 
ATOM   2304 C CG2 . VAL A 1 302 ? 43.514  4.180   9.822   1.00 55.23  ? 302  VAL A CG2 1 
ATOM   2305 N N   . VAL A 1 303 ? 40.722  2.738   9.446   1.00 46.40  ? 303  VAL A N   1 
ATOM   2306 C CA  . VAL A 1 303 ? 40.666  1.275   9.311   1.00 44.08  ? 303  VAL A CA  1 
ATOM   2307 C C   . VAL A 1 303 ? 42.039  0.634   9.627   1.00 42.51  ? 303  VAL A C   1 
ATOM   2308 O O   . VAL A 1 303 ? 42.892  0.481   8.748   1.00 45.29  ? 303  VAL A O   1 
ATOM   2309 C CB  . VAL A 1 303 ? 40.215  0.860   7.909   1.00 38.70  ? 303  VAL A CB  1 
ATOM   2310 C CG1 . VAL A 1 303 ? 40.226  -0.638  7.784   1.00 37.62  ? 303  VAL A CG1 1 
ATOM   2311 C CG2 . VAL A 1 303 ? 38.835  1.368   7.644   1.00 43.08  ? 303  VAL A CG2 1 
ATOM   2312 N N   . ASP A 1 304 ? 42.233  0.278   10.894  1.00 42.94  ? 304  ASP A N   1 
ATOM   2313 C CA  . ASP A 1 304 ? 43.540  -0.117  11.424  1.00 46.50  ? 304  ASP A CA  1 
ATOM   2314 C C   . ASP A 1 304 ? 43.827  -1.608  11.333  1.00 49.67  ? 304  ASP A C   1 
ATOM   2315 O O   . ASP A 1 304 ? 44.952  -2.010  11.568  1.00 44.19  ? 304  ASP A O   1 
ATOM   2316 C CB  . ASP A 1 304 ? 43.712  0.341   12.895  1.00 41.92  ? 304  ASP A CB  1 
ATOM   2317 C CG  . ASP A 1 304 ? 42.533  -0.070  13.803  1.00 45.16  ? 304  ASP A CG  1 
ATOM   2318 O OD1 . ASP A 1 304 ? 41.537  -0.634  13.281  1.00 42.96  ? 304  ASP A OD1 1 
ATOM   2319 O OD2 . ASP A 1 304 ? 42.597  0.190   15.039  1.00 36.92  ? 304  ASP A OD2 1 
ATOM   2320 N N   . GLY A 1 305 ? 42.815  -2.410  10.996  1.00 49.72  ? 305  GLY A N   1 
ATOM   2321 C CA  . GLY A 1 305 ? 42.906  -3.853  11.095  1.00 47.29  ? 305  GLY A CA  1 
ATOM   2322 C C   . GLY A 1 305 ? 42.985  -4.278  12.556  1.00 55.60  ? 305  GLY A C   1 
ATOM   2323 O O   . GLY A 1 305 ? 43.607  -5.290  12.894  1.00 58.18  ? 305  GLY A O   1 
ATOM   2324 N N   . ASP A 1 306 ? 42.347  -3.505  13.430  1.00 55.09  ? 306  ASP A N   1 
ATOM   2325 C CA  . ASP A 1 306 ? 42.412  -3.752  14.871  1.00 52.68  ? 306  ASP A CA  1 
ATOM   2326 C C   . ASP A 1 306 ? 41.073  -3.434  15.574  1.00 50.56  ? 306  ASP A C   1 
ATOM   2327 O O   . ASP A 1 306 ? 40.256  -4.333  15.833  1.00 53.42  ? 306  ASP A O   1 
ATOM   2328 C CB  . ASP A 1 306 ? 43.562  -2.933  15.460  1.00 52.95  ? 306  ASP A CB  1 
ATOM   2329 C CG  . ASP A 1 306 ? 43.799  -3.212  16.930  1.00 55.16  ? 306  ASP A CG  1 
ATOM   2330 O OD1 . ASP A 1 306 ? 43.141  -4.134  17.467  1.00 48.44  ? 306  ASP A OD1 1 
ATOM   2331 O OD2 . ASP A 1 306 ? 44.656  -2.506  17.535  1.00 52.16  ? 306  ASP A OD2 1 
ATOM   2332 N N   . PHE A 1 307 ? 40.859  -2.159  15.900  1.00 39.65  ? 307  PHE A N   1 
ATOM   2333 C CA  . PHE A 1 307 ? 39.553  -1.730  16.353  1.00 38.63  ? 307  PHE A CA  1 
ATOM   2334 C C   . PHE A 1 307 ? 38.555  -2.071  15.252  1.00 40.69  ? 307  PHE A C   1 
ATOM   2335 O O   . PHE A 1 307 ? 37.473  -2.587  15.498  1.00 44.42  ? 307  PHE A O   1 
ATOM   2336 C CB  . PHE A 1 307 ? 39.533  -0.233  16.621  1.00 40.73  ? 307  PHE A CB  1 
ATOM   2337 C CG  . PHE A 1 307 ? 38.322  0.219   17.381  1.00 43.10  ? 307  PHE A CG  1 
ATOM   2338 C CD1 . PHE A 1 307 ? 37.110  0.396   16.731  1.00 36.38  ? 307  PHE A CD1 1 
ATOM   2339 C CD2 . PHE A 1 307 ? 38.389  0.446   18.748  1.00 43.15  ? 307  PHE A CD2 1 
ATOM   2340 C CE1 . PHE A 1 307 ? 36.009  0.794   17.418  1.00 32.70  ? 307  PHE A CE1 1 
ATOM   2341 C CE2 . PHE A 1 307 ? 37.278  0.846   19.447  1.00 42.39  ? 307  PHE A CE2 1 
ATOM   2342 C CZ  . PHE A 1 307 ? 36.087  1.021   18.784  1.00 40.91  ? 307  PHE A CZ  1 
ATOM   2343 N N   . LEU A 1 308 ? 38.944  -1.767  14.030  1.00 37.79  ? 308  LEU A N   1 
ATOM   2344 C CA  . LEU A 1 308 ? 38.179  -2.132  12.870  1.00 37.62  ? 308  LEU A CA  1 
ATOM   2345 C C   . LEU A 1 308 ? 38.959  -3.186  12.068  1.00 52.37  ? 308  LEU A C   1 
ATOM   2346 O O   . LEU A 1 308 ? 39.988  -2.896  11.452  1.00 58.88  ? 308  LEU A O   1 
ATOM   2347 C CB  . LEU A 1 308 ? 37.919  -0.882  12.041  1.00 31.91  ? 308  LEU A CB  1 
ATOM   2348 C CG  . LEU A 1 308 ? 37.002  0.125   12.735  1.00 43.25  ? 308  LEU A CG  1 
ATOM   2349 C CD1 . LEU A 1 308 ? 36.879  1.401   11.935  1.00 34.01  ? 308  LEU A CD1 1 
ATOM   2350 C CD2 . LEU A 1 308 ? 35.615  -0.491  12.963  1.00 49.77  ? 308  LEU A CD2 1 
ATOM   2351 N N   . SER A 1 309 ? 38.478  -4.420  12.102  1.00 51.57  ? 309  SER A N   1 
ATOM   2352 C CA  . SER A 1 309 ? 39.162  -5.525  11.440  1.00 52.41  ? 309  SER A CA  1 
ATOM   2353 C C   . SER A 1 309 ? 39.275  -5.310  9.931   1.00 55.56  ? 309  SER A C   1 
ATOM   2354 O O   . SER A 1 309 ? 40.298  -5.630  9.331   1.00 59.47  ? 309  SER A O   1 
ATOM   2355 C CB  . SER A 1 309 ? 38.411  -6.821  11.714  1.00 56.31  ? 309  SER A CB  1 
ATOM   2356 O OG  . SER A 1 309 ? 37.078  -6.709  11.251  1.00 64.00  ? 309  SER A OG  1 
ATOM   2357 N N   . ASP A 1 310 ? 38.205  -4.790  9.335   1.00 50.51  ? 310  ASP A N   1 
ATOM   2358 C CA  . ASP A 1 310 ? 38.141  -4.460  7.918   1.00 53.36  ? 310  ASP A CA  1 
ATOM   2359 C C   . ASP A 1 310 ? 37.403  -3.123  7.795   1.00 47.68  ? 310  ASP A C   1 
ATOM   2360 O O   . ASP A 1 310 ? 37.151  -2.475  8.800   1.00 47.66  ? 310  ASP A O   1 
ATOM   2361 C CB  . ASP A 1 310 ? 37.356  -5.543  7.184   1.00 62.81  ? 310  ASP A CB  1 
ATOM   2362 C CG  . ASP A 1 310 ? 37.709  -5.633  5.707   1.00 69.79  ? 310  ASP A CG  1 
ATOM   2363 O OD1 . ASP A 1 310 ? 37.965  -4.584  5.061   1.00 65.36  ? 310  ASP A OD1 1 
ATOM   2364 O OD2 . ASP A 1 310 ? 37.725  -6.774  5.198   1.00 69.35  ? 310  ASP A OD2 1 
ATOM   2365 N N   . THR A 1 311 ? 37.036  -2.712  6.585   1.00 37.98  ? 311  THR A N   1 
ATOM   2366 C CA  . THR A 1 311 ? 36.224  -1.505  6.430   1.00 40.71  ? 311  THR A CA  1 
ATOM   2367 C C   . THR A 1 311 ? 34.816  -1.720  6.944   1.00 42.95  ? 311  THR A C   1 
ATOM   2368 O O   . THR A 1 311 ? 34.330  -2.845  6.953   1.00 51.77  ? 311  THR A O   1 
ATOM   2369 C CB  . THR A 1 311 ? 36.061  -1.103  4.971   1.00 42.76  ? 311  THR A CB  1 
ATOM   2370 O OG1 . THR A 1 311 ? 35.230  -2.060  4.316   1.00 51.59  ? 311  THR A OG1 1 
ATOM   2371 C CG2 . THR A 1 311 ? 37.413  -1.002  4.270   1.00 34.15  ? 311  THR A CG2 1 
ATOM   2372 N N   . PRO A 1 312 ? 34.155  -0.641  7.377   1.00 45.76  ? 312  PRO A N   1 
ATOM   2373 C CA  . PRO A 1 312 ? 32.752  -0.723  7.776   1.00 44.02  ? 312  PRO A CA  1 
ATOM   2374 C C   . PRO A 1 312 ? 31.896  -1.358  6.686   1.00 47.17  ? 312  PRO A C   1 
ATOM   2375 O O   . PRO A 1 312 ? 31.054  -2.191  7.013   1.00 49.29  ? 312  PRO A O   1 
ATOM   2376 C CB  . PRO A 1 312 ? 32.371  0.742   7.982   1.00 39.69  ? 312  PRO A CB  1 
ATOM   2377 C CG  . PRO A 1 312 ? 33.590  1.365   8.453   1.00 38.47  ? 312  PRO A CG  1 
ATOM   2378 C CD  . PRO A 1 312 ? 34.724  0.679   7.705   1.00 47.00  ? 312  PRO A CD  1 
ATOM   2379 N N   . GLU A 1 313 ? 32.098  -0.983  5.423   1.00 49.79  ? 313  GLU A N   1 
ATOM   2380 C CA  A GLU A 1 313 ? 31.354  -1.583  4.303   0.50 51.85  ? 313  GLU A CA  1 
ATOM   2381 C CA  B GLU A 1 313 ? 31.319  -1.574  4.340   0.50 52.36  ? 313  GLU A CA  1 
ATOM   2382 C C   . GLU A 1 313 ? 31.469  -3.111  4.342   1.00 56.57  ? 313  GLU A C   1 
ATOM   2383 O O   . GLU A 1 313 ? 30.486  -3.834  4.284   1.00 56.11  ? 313  GLU A O   1 
ATOM   2384 C CB  A GLU A 1 313 ? 31.858  -1.040  2.951   0.50 49.56  ? 313  GLU A CB  1 
ATOM   2385 C CB  B GLU A 1 313 ? 31.686  -0.940  2.986   0.50 50.25  ? 313  GLU A CB  1 
ATOM   2386 C CG  A GLU A 1 313 ? 31.136  -1.597  1.718   0.50 52.96  ? 313  GLU A CG  1 
ATOM   2387 C CG  B GLU A 1 313 ? 30.948  0.384   2.665   0.50 31.86  ? 313  GLU A CG  1 
ATOM   2388 C CD  A GLU A 1 313 ? 31.661  -1.034  0.391   0.50 54.65  ? 313  GLU A CD  1 
ATOM   2389 C CD  B GLU A 1 313 ? 31.563  1.634   3.327   0.50 35.09  ? 313  GLU A CD  1 
ATOM   2390 O OE1 A GLU A 1 313 ? 32.890  -0.846  0.251   0.50 53.73  ? 313  GLU A OE1 1 
ATOM   2391 O OE1 B GLU A 1 313 ? 32.578  1.529   4.063   0.50 34.23  ? 313  GLU A OE1 1 
ATOM   2392 O OE2 A GLU A 1 313 ? 30.837  -0.787  -0.517  0.50 52.92  ? 313  GLU A OE2 1 
ATOM   2393 O OE2 B GLU A 1 313 ? 31.017  2.737   3.101   0.50 35.25  ? 313  GLU A OE2 1 
ATOM   2394 N N   . ALA A 1 314 ? 32.695  -3.602  4.453   1.00 51.55  ? 314  ALA A N   1 
ATOM   2395 C CA  . ALA A 1 314 ? 32.940  -5.024  4.506   1.00 46.28  ? 314  ALA A CA  1 
ATOM   2396 C C   . ALA A 1 314 ? 32.271  -5.660  5.707   1.00 50.88  ? 314  ALA A C   1 
ATOM   2397 O O   . ALA A 1 314 ? 31.684  -6.737  5.598   1.00 55.54  ? 314  ALA A O   1 
ATOM   2398 C CB  . ALA A 1 314 ? 34.455  -5.298  4.548   1.00 47.46  ? 314  ALA A CB  1 
ATOM   2399 N N   . LEU A 1 315 ? 32.389  -5.014  6.863   1.00 45.92  ? 315  LEU A N   1 
ATOM   2400 C CA  . LEU A 1 315 ? 31.947  -5.636  8.112   1.00 45.59  ? 315  LEU A CA  1 
ATOM   2401 C C   . LEU A 1 315 ? 30.429  -5.724  8.222   1.00 54.09  ? 315  LEU A C   1 
ATOM   2402 O O   . LEU A 1 315 ? 29.908  -6.692  8.780   1.00 62.74  ? 315  LEU A O   1 
ATOM   2403 C CB  . LEU A 1 315 ? 32.523  -4.919  9.332   1.00 45.37  ? 315  LEU A CB  1 
ATOM   2404 C CG  . LEU A 1 315 ? 34.043  -4.920  9.501   1.00 45.33  ? 315  LEU A CG  1 
ATOM   2405 C CD1 . LEU A 1 315 ? 34.464  -4.146  10.754  1.00 35.65  ? 315  LEU A CD1 1 
ATOM   2406 C CD2 . LEU A 1 315 ? 34.551  -6.351  9.545   1.00 41.39  ? 315  LEU A CD2 1 
ATOM   2407 N N   . ILE A 1 316 ? 29.717  -4.730  7.693   1.00 51.25  ? 316  ILE A N   1 
ATOM   2408 C CA  . ILE A 1 316 ? 28.258  -4.787  7.723   1.00 52.13  ? 316  ILE A CA  1 
ATOM   2409 C C   . ILE A 1 316 ? 27.728  -5.759  6.675   1.00 65.06  ? 316  ILE A C   1 
ATOM   2410 O O   . ILE A 1 316 ? 26.649  -6.333  6.839   1.00 74.66  ? 316  ILE A O   1 
ATOM   2411 C CB  . ILE A 1 316 ? 27.582  -3.406  7.545   1.00 45.38  ? 316  ILE A CB  1 
ATOM   2412 C CG1 . ILE A 1 316 ? 27.699  -2.898  6.112   1.00 59.82  ? 316  ILE A CG1 1 
ATOM   2413 C CG2 . ILE A 1 316 ? 28.139  -2.385  8.523   1.00 36.57  ? 316  ILE A CG2 1 
ATOM   2414 C CD1 . ILE A 1 316 ? 26.987  -1.548  5.888   1.00 74.21  ? 316  ILE A CD1 1 
ATOM   2415 N N   . ASN A 1 317 ? 28.501  -5.948  5.608   1.00 60.84  ? 317  ASN A N   1 
ATOM   2416 C CA  . ASN A 1 317 ? 28.099  -6.817  4.514   1.00 61.66  ? 317  ASN A CA  1 
ATOM   2417 C C   . ASN A 1 317 ? 28.210  -8.291  4.883   1.00 64.02  ? 317  ASN A C   1 
ATOM   2418 O O   . ASN A 1 317 ? 27.742  -9.145  4.138   1.00 65.16  ? 317  ASN A O   1 
ATOM   2419 C CB  . ASN A 1 317 ? 28.929  -6.544  3.252   1.00 63.36  ? 317  ASN A CB  1 
ATOM   2420 C CG  . ASN A 1 317 ? 28.392  -5.382  2.422   1.00 79.84  ? 317  ASN A CG  1 
ATOM   2421 O OD1 . ASN A 1 317 ? 27.579  -4.564  2.885   1.00 84.21  ? 317  ASN A OD1 1 
ATOM   2422 N ND2 . ASN A 1 317 ? 28.860  -5.298  1.182   1.00 86.46  ? 317  ASN A ND2 1 
ATOM   2423 N N   . THR A 1 318 ? 28.829  -8.593  6.021   1.00 56.61  ? 318  THR A N   1 
ATOM   2424 C CA  . THR A 1 318 ? 29.059  -9.988  6.364   1.00 63.28  ? 318  THR A CA  1 
ATOM   2425 C C   . THR A 1 318 ? 28.602  -10.347 7.770   1.00 75.15  ? 318  THR A C   1 
ATOM   2426 O O   . THR A 1 318 ? 27.841  -11.287 7.943   1.00 86.44  ? 318  THR A O   1 
ATOM   2427 C CB  . THR A 1 318 ? 30.533  -10.403 6.166   1.00 65.68  ? 318  THR A CB  1 
ATOM   2428 O OG1 . THR A 1 318 ? 31.344  -9.809  7.182   1.00 70.56  ? 318  THR A OG1 1 
ATOM   2429 C CG2 . THR A 1 318 ? 31.039  -9.954  4.805   1.00 62.07  ? 318  THR A CG2 1 
ATOM   2430 N N   . GLY A 1 319 ? 29.050  -9.594  8.765   1.00 80.50  ? 319  GLY A N   1 
ATOM   2431 C CA  . GLY A 1 319 ? 28.756  -9.894  10.158  1.00 81.98  ? 319  GLY A CA  1 
ATOM   2432 C C   . GLY A 1 319 ? 27.372  -10.451 10.474  1.00 80.72  ? 319  GLY A C   1 
ATOM   2433 O O   . GLY A 1 319 ? 26.426  -10.318 9.693   1.00 70.96  ? 319  GLY A O   1 
ATOM   2434 N N   . ASP A 1 320 ? 27.273  -11.082 11.642  1.00 86.09  ? 320  ASP A N   1 
ATOM   2435 C CA  . ASP A 1 320 ? 26.026  -11.614 12.174  1.00 86.61  ? 320  ASP A CA  1 
ATOM   2436 C C   . ASP A 1 320 ? 25.490  -10.641 13.227  1.00 91.04  ? 320  ASP A C   1 
ATOM   2437 O O   . ASP A 1 320 ? 26.229  -10.216 14.128  1.00 93.54  ? 320  ASP A O   1 
ATOM   2438 C CB  . ASP A 1 320 ? 26.289  -12.974 12.819  1.00 88.66  ? 320  ASP A CB  1 
ATOM   2439 C CG  . ASP A 1 320 ? 25.015  -13.737 13.131  1.00 96.53  ? 320  ASP A CG  1 
ATOM   2440 O OD1 . ASP A 1 320 ? 24.115  -13.793 12.266  1.00 102.85 ? 320  ASP A OD1 1 
ATOM   2441 O OD2 . ASP A 1 320 ? 24.922  -14.302 14.239  1.00 98.77  ? 320  ASP A OD2 1 
ATOM   2442 N N   . PHE A 1 321 ? 24.211  -10.288 13.121  1.00 84.63  ? 321  PHE A N   1 
ATOM   2443 C CA  . PHE A 1 321 ? 23.636  -9.294  14.019  1.00 80.46  ? 321  PHE A CA  1 
ATOM   2444 C C   . PHE A 1 321 ? 22.334  -9.761  14.657  1.00 82.48  ? 321  PHE A C   1 
ATOM   2445 O O   . PHE A 1 321 ? 21.449  -8.946  14.932  1.00 82.12  ? 321  PHE A O   1 
ATOM   2446 C CB  . PHE A 1 321 ? 23.397  -7.981  13.267  1.00 72.67  ? 321  PHE A CB  1 
ATOM   2447 C CG  . PHE A 1 321 ? 24.619  -7.445  12.575  1.00 61.64  ? 321  PHE A CG  1 
ATOM   2448 C CD1 . PHE A 1 321 ? 25.624  -6.825  13.295  1.00 52.14  ? 321  PHE A CD1 1 
ATOM   2449 C CD2 . PHE A 1 321 ? 24.763  -7.552  11.199  1.00 62.65  ? 321  PHE A CD2 1 
ATOM   2450 C CE1 . PHE A 1 321 ? 26.748  -6.338  12.660  1.00 40.03  ? 321  PHE A CE1 1 
ATOM   2451 C CE2 . PHE A 1 321 ? 25.894  -7.052  10.556  1.00 48.22  ? 321  PHE A CE2 1 
ATOM   2452 C CZ  . PHE A 1 321 ? 26.875  -6.452  11.288  1.00 36.94  ? 321  PHE A CZ  1 
ATOM   2453 N N   . GLN A 1 322 ? 22.227  -11.067 14.896  1.00 81.39  ? 322  GLN A N   1 
ATOM   2454 C CA  . GLN A 1 322 ? 21.011  -11.655 15.449  1.00 81.35  ? 322  GLN A CA  1 
ATOM   2455 C C   . GLN A 1 322 ? 20.667  -11.009 16.784  1.00 78.61  ? 322  GLN A C   1 
ATOM   2456 O O   . GLN A 1 322 ? 19.505  -10.698 17.070  1.00 81.38  ? 322  GLN A O   1 
ATOM   2457 C CB  . GLN A 1 322 ? 21.187  -13.163 15.644  1.00 88.90  ? 322  GLN A CB  1 
ATOM   2458 C CG  . GLN A 1 322 ? 21.924  -13.866 14.508  1.00 104.38 ? 322  GLN A CG  1 
ATOM   2459 C CD  . GLN A 1 322 ? 21.013  -14.704 13.610  1.00 113.19 ? 322  GLN A CD  1 
ATOM   2460 O OE1 . GLN A 1 322 ? 20.716  -14.328 12.466  1.00 110.88 ? 322  GLN A OE1 1 
ATOM   2461 N NE2 . GLN A 1 322 ? 20.573  -15.853 14.126  1.00 113.57 ? 322  GLN A NE2 1 
ATOM   2462 N N   . ASP A 1 323 ? 21.686  -10.788 17.601  1.00 70.25  ? 323  ASP A N   1 
ATOM   2463 C CA  . ASP A 1 323 ? 21.434  -10.349 18.960  1.00 87.71  ? 323  ASP A CA  1 
ATOM   2464 C C   . ASP A 1 323 ? 20.952  -8.893  19.049  1.00 84.24  ? 323  ASP A C   1 
ATOM   2465 O O   . ASP A 1 323 ? 20.568  -8.417  20.117  1.00 88.28  ? 323  ASP A O   1 
ATOM   2466 C CB  . ASP A 1 323 ? 22.697  -10.540 19.809  1.00 106.93 ? 323  ASP A CB  1 
ATOM   2467 C CG  . ASP A 1 323 ? 22.399  -10.574 21.312  1.00 119.37 ? 323  ASP A CG  1 
ATOM   2468 O OD1 . ASP A 1 323 ? 21.311  -11.084 21.686  1.00 118.80 ? 323  ASP A OD1 1 
ATOM   2469 O OD2 . ASP A 1 323 ? 23.249  -10.088 22.110  1.00 122.64 ? 323  ASP A OD2 1 
ATOM   2470 N N   . LEU A 1 324 ? 20.948  -8.192  17.926  1.00 75.94  ? 324  LEU A N   1 
ATOM   2471 C CA  . LEU A 1 324 ? 20.942  -6.735  17.968  1.00 65.79  ? 324  LEU A CA  1 
ATOM   2472 C C   . LEU A 1 324 ? 19.614  -6.051  17.661  1.00 57.18  ? 324  LEU A C   1 
ATOM   2473 O O   . LEU A 1 324 ? 18.939  -6.389  16.682  1.00 59.14  ? 324  LEU A O   1 
ATOM   2474 C CB  . LEU A 1 324 ? 22.001  -6.205  16.999  1.00 62.19  ? 324  LEU A CB  1 
ATOM   2475 C CG  . LEU A 1 324 ? 22.373  -4.751  17.242  1.00 53.74  ? 324  LEU A CG  1 
ATOM   2476 C CD1 . LEU A 1 324 ? 22.720  -4.580  18.701  1.00 47.36  ? 324  LEU A CD1 1 
ATOM   2477 C CD2 . LEU A 1 324 ? 23.532  -4.379  16.367  1.00 53.29  ? 324  LEU A CD2 1 
ATOM   2478 N N   . GLN A 1 325 ? 19.259  -5.064  18.482  1.00 44.98  ? 325  GLN A N   1 
ATOM   2479 C CA  . GLN A 1 325 ? 18.220  -4.114  18.077  1.00 51.83  ? 325  GLN A CA  1 
ATOM   2480 C C   . GLN A 1 325 ? 18.758  -2.685  17.902  1.00 51.29  ? 325  GLN A C   1 
ATOM   2481 O O   . GLN A 1 325 ? 19.551  -2.186  18.702  1.00 57.92  ? 325  GLN A O   1 
ATOM   2482 C CB  . GLN A 1 325 ? 17.015  -4.139  19.011  1.00 52.80  ? 325  GLN A CB  1 
ATOM   2483 C CG  . GLN A 1 325 ? 16.555  -5.523  19.353  1.00 57.20  ? 325  GLN A CG  1 
ATOM   2484 C CD  . GLN A 1 325 ? 17.100  -5.979  20.673  1.00 63.15  ? 325  GLN A CD  1 
ATOM   2485 O OE1 . GLN A 1 325 ? 16.872  -5.345  21.699  1.00 65.73  ? 325  GLN A OE1 1 
ATOM   2486 N NE2 . GLN A 1 325 ? 17.829  -7.081  20.661  1.00 72.49  ? 325  GLN A NE2 1 
ATOM   2487 N N   . VAL A 1 326 ? 18.303  -2.040  16.840  1.00 41.88  ? 326  VAL A N   1 
ATOM   2488 C CA  . VAL A 1 326 ? 18.873  -0.790  16.387  1.00 45.36  ? 326  VAL A CA  1 
ATOM   2489 C C   . VAL A 1 326 ? 17.771  0.134   15.906  1.00 49.70  ? 326  VAL A C   1 
ATOM   2490 O O   . VAL A 1 326 ? 16.887  -0.291  15.166  1.00 46.44  ? 326  VAL A O   1 
ATOM   2491 C CB  . VAL A 1 326 ? 19.803  -1.002  15.173  1.00 39.24  ? 326  VAL A CB  1 
ATOM   2492 C CG1 . VAL A 1 326 ? 20.198  0.329   14.618  1.00 40.30  ? 326  VAL A CG1 1 
ATOM   2493 C CG2 . VAL A 1 326 ? 21.031  -1.786  15.561  1.00 42.20  ? 326  VAL A CG2 1 
ATOM   2494 N N   . LEU A 1 327 ? 17.848  1.398   16.309  1.00 45.14  ? 327  LEU A N   1 
ATOM   2495 C CA  . LEU A 1 327 ? 16.971  2.436   15.820  1.00 40.60  ? 327  LEU A CA  1 
ATOM   2496 C C   . LEU A 1 327 ? 17.823  3.464   15.070  1.00 41.00  ? 327  LEU A C   1 
ATOM   2497 O O   . LEU A 1 327 ? 18.776  3.994   15.633  1.00 43.16  ? 327  LEU A O   1 
ATOM   2498 C CB  . LEU A 1 327 ? 16.244  3.102   16.997  1.00 45.54  ? 327  LEU A CB  1 
ATOM   2499 C CG  . LEU A 1 327 ? 15.534  4.397   16.594  1.00 42.86  ? 327  LEU A CG  1 
ATOM   2500 C CD1 . LEU A 1 327 ? 14.614  4.107   15.447  1.00 47.84  ? 327  LEU A CD1 1 
ATOM   2501 C CD2 . LEU A 1 327 ? 14.781  5.004   17.718  1.00 34.35  ? 327  LEU A CD2 1 
ATOM   2502 N N   . VAL A 1 328 ? 17.470  3.739   13.811  1.00 40.38  ? 328  VAL A N   1 
ATOM   2503 C CA  . VAL A 1 328 ? 18.202  4.673   12.936  1.00 33.26  ? 328  VAL A CA  1 
ATOM   2504 C C   . VAL A 1 328 ? 17.280  5.634   12.192  1.00 37.82  ? 328  VAL A C   1 
ATOM   2505 O O   . VAL A 1 328 ? 16.124  5.320   11.908  1.00 45.35  ? 328  VAL A O   1 
ATOM   2506 C CB  . VAL A 1 328 ? 19.027  3.929   11.849  1.00 38.11  ? 328  VAL A CB  1 
ATOM   2507 C CG1 . VAL A 1 328 ? 20.013  2.979   12.475  1.00 41.71  ? 328  VAL A CG1 1 
ATOM   2508 C CG2 . VAL A 1 328 ? 18.110  3.174   10.865  1.00 36.00  ? 328  VAL A CG2 1 
ATOM   2509 N N   . GLY A 1 329 ? 17.803  6.796   11.831  1.00 39.12  ? 329  GLY A N   1 
ATOM   2510 C CA  . GLY A 1 329 ? 17.005  7.762   11.100  1.00 27.43  ? 329  GLY A CA  1 
ATOM   2511 C C   . GLY A 1 329 ? 17.707  9.031   10.653  1.00 37.64  ? 329  GLY A C   1 
ATOM   2512 O O   . GLY A 1 329 ? 18.915  9.207   10.837  1.00 39.70  ? 329  GLY A O   1 
ATOM   2513 N N   . VAL A 1 330 ? 16.921  9.936   10.076  1.00 35.83  ? 330  VAL A N   1 
ATOM   2514 C CA  . VAL A 1 330 ? 17.458  11.120  9.428   1.00 35.47  ? 330  VAL A CA  1 
ATOM   2515 C C   . VAL A 1 330 ? 16.478  12.264  9.599   1.00 43.02  ? 330  VAL A C   1 
ATOM   2516 O O   . VAL A 1 330 ? 15.296  12.043  9.898   1.00 36.08  ? 330  VAL A O   1 
ATOM   2517 C CB  . VAL A 1 330 ? 17.683  10.882  7.913   1.00 46.21  ? 330  VAL A CB  1 
ATOM   2518 C CG1 . VAL A 1 330 ? 18.629  9.666   7.662   1.00 16.59  ? 330  VAL A CG1 1 
ATOM   2519 C CG2 . VAL A 1 330 ? 16.336  10.716  7.192   1.00 41.14  ? 330  VAL A CG2 1 
ATOM   2520 N N   . VAL A 1 331 ? 16.984  13.484  9.432   1.00 40.93  ? 331  VAL A N   1 
ATOM   2521 C CA  . VAL A 1 331 ? 16.141  14.665  9.422   1.00 35.46  ? 331  VAL A CA  1 
ATOM   2522 C C   . VAL A 1 331 ? 15.734  14.908  7.956   1.00 37.83  ? 331  VAL A C   1 
ATOM   2523 O O   . VAL A 1 331 ? 16.255  14.233  7.056   1.00 36.18  ? 331  VAL A O   1 
ATOM   2524 C CB  . VAL A 1 331 ? 16.885  15.880  10.035  1.00 35.34  ? 331  VAL A CB  1 
ATOM   2525 C CG1 . VAL A 1 331 ? 17.063  15.694  11.517  1.00 33.27  ? 331  VAL A CG1 1 
ATOM   2526 C CG2 . VAL A 1 331 ? 18.218  16.035  9.393   1.00 26.01  ? 331  VAL A CG2 1 
ATOM   2527 N N   . LYS A 1 332 ? 14.804  15.837  7.706   1.00 33.23  ? 332  LYS A N   1 
ATOM   2528 C CA  . LYS A 1 332 ? 14.271  16.005  6.358   1.00 40.47  ? 332  LYS A CA  1 
ATOM   2529 C C   . LYS A 1 332 ? 15.342  16.561  5.452   1.00 50.75  ? 332  LYS A C   1 
ATOM   2530 O O   . LYS A 1 332 ? 15.656  15.982  4.410   1.00 60.52  ? 332  LYS A O   1 
ATOM   2531 C CB  . LYS A 1 332 ? 13.030  16.895  6.338   1.00 44.32  ? 332  LYS A CB  1 
ATOM   2532 C CG  . LYS A 1 332 ? 12.175  16.739  5.074   1.00 46.25  ? 332  LYS A CG  1 
ATOM   2533 C CD  . LYS A 1 332 ? 10.782  17.428  5.210   1.00 35.36  ? 332  LYS A CD  1 
ATOM   2534 C CE  . LYS A 1 332 ? 10.702  18.819  4.521   1.00 76.99  ? 332  LYS A CE  1 
ATOM   2535 N NZ  . LYS A 1 332 ? 11.442  19.955  5.203   1.00 76.13  ? 332  LYS A NZ  1 
ATOM   2536 N N   . ASP A 1 333 ? 15.952  17.657  5.883   1.00 47.78  ? 333  ASP A N   1 
ATOM   2537 C CA  . ASP A 1 333 ? 16.969  18.314  5.070   1.00 46.26  ? 333  ASP A CA  1 
ATOM   2538 C C   . ASP A 1 333 ? 18.392  18.126  5.627   1.00 45.29  ? 333  ASP A C   1 
ATOM   2539 O O   . ASP A 1 333 ? 18.995  19.091  6.114   1.00 38.78  ? 333  ASP A O   1 
ATOM   2540 C CB  . ASP A 1 333 ? 16.609  19.796  4.926   1.00 42.05  ? 333  ASP A CB  1 
ATOM   2541 C CG  . ASP A 1 333 ? 15.140  19.999  4.587   1.00 56.53  ? 333  ASP A CG  1 
ATOM   2542 O OD1 . ASP A 1 333 ? 14.314  20.125  5.515   1.00 62.47  ? 333  ASP A OD1 1 
ATOM   2543 O OD2 . ASP A 1 333 ? 14.794  20.006  3.389   1.00 62.36  ? 333  ASP A OD2 1 
ATOM   2544 N N   . GLU A 1 334 ? 18.917  16.893  5.560   1.00 42.45  ? 334  GLU A N   1 
ATOM   2545 C CA  . GLU A 1 334 ? 20.259  16.601  6.108   1.00 39.41  ? 334  GLU A CA  1 
ATOM   2546 C C   . GLU A 1 334 ? 21.364  17.579  5.640   1.00 36.47  ? 334  GLU A C   1 
ATOM   2547 O O   . GLU A 1 334 ? 22.222  17.987  6.422   1.00 37.54  ? 334  GLU A O   1 
ATOM   2548 C CB  . GLU A 1 334 ? 20.727  15.161  5.813   1.00 32.23  ? 334  GLU A CB  1 
ATOM   2549 C CG  . GLU A 1 334 ? 20.033  14.063  6.554   1.00 41.65  ? 334  GLU A CG  1 
ATOM   2550 C CD  . GLU A 1 334 ? 20.412  14.016  8.009   1.00 44.84  ? 334  GLU A CD  1 
ATOM   2551 O OE1 . GLU A 1 334 ? 21.423  14.649  8.347   1.00 37.06  ? 334  GLU A OE1 1 
ATOM   2552 O OE2 . GLU A 1 334 ? 19.693  13.362  8.810   1.00 47.01  ? 334  GLU A OE2 1 
ATOM   2553 N N   . GLY A 1 335 ? 21.356  17.950  4.368   1.00 28.24  ? 335  GLY A N   1 
ATOM   2554 C CA  . GLY A 1 335 ? 22.500  18.655  3.821   1.00 35.67  ? 335  GLY A CA  1 
ATOM   2555 C C   . GLY A 1 335 ? 22.499  20.173  3.766   1.00 42.49  ? 335  GLY A C   1 
ATOM   2556 O O   . GLY A 1 335 ? 23.511  20.754  3.390   1.00 51.85  ? 335  GLY A O   1 
ATOM   2557 N N   . SER A 1 336 ? 21.399  20.829  4.123   1.00 36.75  ? 336  SER A N   1 
ATOM   2558 C CA  . SER A 1 336 ? 21.327  22.277  3.929   1.00 41.40  ? 336  SER A CA  1 
ATOM   2559 C C   . SER A 1 336 ? 22.370  23.016  4.785   1.00 46.55  ? 336  SER A C   1 
ATOM   2560 O O   . SER A 1 336 ? 23.043  23.923  4.310   1.00 44.02  ? 336  SER A O   1 
ATOM   2561 C CB  . SER A 1 336 ? 19.913  22.806  4.195   1.00 40.90  ? 336  SER A CB  1 
ATOM   2562 O OG  . SER A 1 336 ? 19.589  22.749  5.566   1.00 41.94  ? 336  SER A OG  1 
ATOM   2563 N N   . TYR A 1 337 ? 22.497  22.596  6.042   1.00 47.81  ? 337  TYR A N   1 
ATOM   2564 C CA  . TYR A 1 337 ? 23.493  23.101  6.996   1.00 44.18  ? 337  TYR A CA  1 
ATOM   2565 C C   . TYR A 1 337 ? 24.901  23.181  6.412   1.00 44.27  ? 337  TYR A C   1 
ATOM   2566 O O   . TYR A 1 337 ? 25.673  24.096  6.691   1.00 47.40  ? 337  TYR A O   1 
ATOM   2567 C CB  . TYR A 1 337 ? 23.512  22.174  8.212   1.00 44.35  ? 337  TYR A CB  1 
ATOM   2568 C CG  . TYR A 1 337 ? 24.279  22.661  9.398   1.00 47.78  ? 337  TYR A CG  1 
ATOM   2569 C CD1 . TYR A 1 337 ? 23.639  23.291  10.440  1.00 57.16  ? 337  TYR A CD1 1 
ATOM   2570 C CD2 . TYR A 1 337 ? 25.641  22.448  9.503   1.00 56.66  ? 337  TYR A CD2 1 
ATOM   2571 C CE1 . TYR A 1 337 ? 24.338  23.731  11.553  1.00 68.24  ? 337  TYR A CE1 1 
ATOM   2572 C CE2 . TYR A 1 337 ? 26.360  22.895  10.612  1.00 63.10  ? 337  TYR A CE2 1 
ATOM   2573 C CZ  . TYR A 1 337 ? 25.701  23.539  11.635  1.00 65.79  ? 337  TYR A CZ  1 
ATOM   2574 O OH  . TYR A 1 337 ? 26.393  23.988  12.747  1.00 63.07  ? 337  TYR A OH  1 
ATOM   2575 N N   . PHE A 1 338 ? 25.241  22.224  5.577   1.00 43.51  ? 338  PHE A N   1 
ATOM   2576 C CA  . PHE A 1 338 ? 26.610  22.129  5.140   1.00 40.86  ? 338  PHE A CA  1 
ATOM   2577 C C   . PHE A 1 338 ? 26.958  23.070  4.003   1.00 42.75  ? 338  PHE A C   1 
ATOM   2578 O O   . PHE A 1 338 ? 28.137  23.406  3.832   1.00 40.34  ? 338  PHE A O   1 
ATOM   2579 C CB  . PHE A 1 338 ? 26.909  20.688  4.780   1.00 30.50  ? 338  PHE A CB  1 
ATOM   2580 C CG  . PHE A 1 338 ? 26.859  19.788  5.949   1.00 39.05  ? 338  PHE A CG  1 
ATOM   2581 C CD1 . PHE A 1 338 ? 25.659  19.188  6.323   1.00 47.37  ? 338  PHE A CD1 1 
ATOM   2582 C CD2 . PHE A 1 338 ? 27.998  19.566  6.714   1.00 36.77  ? 338  PHE A CD2 1 
ATOM   2583 C CE1 . PHE A 1 338 ? 25.596  18.347  7.434   1.00 48.06  ? 338  PHE A CE1 1 
ATOM   2584 C CE2 . PHE A 1 338 ? 27.949  18.731  7.819   1.00 39.77  ? 338  PHE A CE2 1 
ATOM   2585 C CZ  . PHE A 1 338 ? 26.741  18.122  8.184   1.00 45.37  ? 338  PHE A CZ  1 
ATOM   2586 N N   . LEU A 1 339 ? 25.943  23.478  3.231   1.00 33.73  ? 339  LEU A N   1 
ATOM   2587 C CA  . LEU A 1 339 ? 26.178  24.282  2.040   1.00 40.23  ? 339  LEU A CA  1 
ATOM   2588 C C   . LEU A 1 339 ? 26.635  25.664  2.472   1.00 50.32  ? 339  LEU A C   1 
ATOM   2589 O O   . LEU A 1 339 ? 27.507  26.290  1.870   1.00 49.22  ? 339  LEU A O   1 
ATOM   2590 C CB  . LEU A 1 339 ? 24.907  24.386  1.203   1.00 33.43  ? 339  LEU A CB  1 
ATOM   2591 C CG  . LEU A 1 339 ? 24.217  23.049  0.996   1.00 40.25  ? 339  LEU A CG  1 
ATOM   2592 C CD1 . LEU A 1 339 ? 22.971  23.215  0.184   1.00 42.61  ? 339  LEU A CD1 1 
ATOM   2593 C CD2 . LEU A 1 339 ? 25.151  22.065  0.339   1.00 41.90  ? 339  LEU A CD2 1 
ATOM   2594 N N   . VAL A 1 340 ? 26.024  26.111  3.551   1.00 54.89  ? 340  VAL A N   1 
ATOM   2595 C CA  . VAL A 1 340 ? 26.168  27.458  4.040   1.00 58.13  ? 340  VAL A CA  1 
ATOM   2596 C C   . VAL A 1 340 ? 27.578  27.717  4.535   1.00 54.63  ? 340  VAL A C   1 
ATOM   2597 O O   . VAL A 1 340 ? 27.993  28.857  4.647   1.00 60.94  ? 340  VAL A O   1 
ATOM   2598 C CB  . VAL A 1 340 ? 25.145  27.696  5.158   1.00 57.59  ? 340  VAL A CB  1 
ATOM   2599 C CG1 . VAL A 1 340 ? 25.708  28.594  6.207   1.00 63.79  ? 340  VAL A CG1 1 
ATOM   2600 C CG2 . VAL A 1 340 ? 23.837  28.230  4.574   1.00 51.96  ? 340  VAL A CG2 1 
ATOM   2601 N N   . TYR A 1 341 ? 28.324  26.656  4.807   1.00 55.86  ? 341  TYR A N   1 
ATOM   2602 C CA  . TYR A 1 341 ? 29.679  26.791  5.343   1.00 65.09  ? 341  TYR A CA  1 
ATOM   2603 C C   . TYR A 1 341 ? 30.700  26.945  4.252   1.00 75.50  ? 341  TYR A C   1 
ATOM   2604 O O   . TYR A 1 341 ? 31.557  27.823  4.331   1.00 87.88  ? 341  TYR A O   1 
ATOM   2605 C CB  . TYR A 1 341 ? 30.069  25.597  6.230   1.00 76.89  ? 341  TYR A CB  1 
ATOM   2606 C CG  . TYR A 1 341 ? 29.936  25.869  7.720   1.00 86.03  ? 341  TYR A CG  1 
ATOM   2607 C CD1 . TYR A 1 341 ? 30.972  26.474  8.431   1.00 91.57  ? 341  TYR A CD1 1 
ATOM   2608 C CD2 . TYR A 1 341 ? 28.773  25.534  8.410   1.00 83.97  ? 341  TYR A CD2 1 
ATOM   2609 C CE1 . TYR A 1 341 ? 30.858  26.733  9.791   1.00 93.20  ? 341  TYR A CE1 1 
ATOM   2610 C CE2 . TYR A 1 341 ? 28.645  25.792  9.767   1.00 89.17  ? 341  TYR A CE2 1 
ATOM   2611 C CZ  . TYR A 1 341 ? 29.690  26.392  10.455  1.00 95.13  ? 341  TYR A CZ  1 
ATOM   2612 O OH  . TYR A 1 341 ? 29.565  26.649  11.809  1.00 99.12  ? 341  TYR A OH  1 
ATOM   2613 N N   . GLY A 1 342 ? 30.620  26.100  3.230   1.00 72.09  ? 342  GLY A N   1 
ATOM   2614 C CA  . GLY A 1 342 ? 31.653  26.113  2.216   1.00 65.61  ? 342  GLY A CA  1 
ATOM   2615 C C   . GLY A 1 342 ? 31.273  25.962  0.762   1.00 61.91  ? 342  GLY A C   1 
ATOM   2616 O O   . GLY A 1 342 ? 32.132  25.640  -0.055  1.00 69.13  ? 342  GLY A O   1 
ATOM   2617 N N   . VAL A 1 343 ? 30.014  26.174  0.408   1.00 53.40  ? 343  VAL A N   1 
ATOM   2618 C CA  . VAL A 1 343 ? 29.685  26.202  -1.020  1.00 49.16  ? 343  VAL A CA  1 
ATOM   2619 C C   . VAL A 1 343 ? 29.368  27.622  -1.523  1.00 50.79  ? 343  VAL A C   1 
ATOM   2620 O O   . VAL A 1 343 ? 28.425  28.276  -1.070  1.00 48.21  ? 343  VAL A O   1 
ATOM   2621 C CB  . VAL A 1 343 ? 28.584  25.199  -1.392  1.00 43.99  ? 343  VAL A CB  1 
ATOM   2622 C CG1 . VAL A 1 343 ? 28.376  25.186  -2.894  1.00 35.19  ? 343  VAL A CG1 1 
ATOM   2623 C CG2 . VAL A 1 343 ? 28.966  23.811  -0.903  1.00 43.67  ? 343  VAL A CG2 1 
ATOM   2624 N N   . PRO A 1 344 ? 30.191  28.125  -2.443  1.00 51.37  ? 344  PRO A N   1 
ATOM   2625 C CA  . PRO A 1 344 ? 29.953  29.491  -2.916  1.00 50.49  ? 344  PRO A CA  1 
ATOM   2626 C C   . PRO A 1 344 ? 28.532  29.623  -3.451  1.00 54.51  ? 344  PRO A C   1 
ATOM   2627 O O   . PRO A 1 344 ? 28.104  28.773  -4.233  1.00 56.62  ? 344  PRO A O   1 
ATOM   2628 C CB  . PRO A 1 344 ? 30.966  29.646  -4.052  1.00 39.87  ? 344  PRO A CB  1 
ATOM   2629 C CG  . PRO A 1 344 ? 32.040  28.663  -3.757  1.00 35.30  ? 344  PRO A CG  1 
ATOM   2630 C CD  . PRO A 1 344 ? 31.384  27.513  -3.051  1.00 45.35  ? 344  PRO A CD  1 
ATOM   2631 N N   . GLY A 1 345 ? 27.822  30.666  -3.026  1.00 50.25  ? 345  GLY A N   1 
ATOM   2632 C CA  . GLY A 1 345 ? 26.462  30.921  -3.464  1.00 28.74  ? 345  GLY A CA  1 
ATOM   2633 C C   . GLY A 1 345 ? 25.542  30.839  -2.273  1.00 45.61  ? 345  GLY A C   1 
ATOM   2634 O O   . GLY A 1 345 ? 24.450  31.411  -2.275  1.00 62.75  ? 345  GLY A O   1 
ATOM   2635 N N   . PHE A 1 346 ? 25.990  30.138  -1.237  1.00 44.20  ? 346  PHE A N   1 
ATOM   2636 C CA  . PHE A 1 346 ? 25.122  29.845  -0.103  1.00 46.12  ? 346  PHE A CA  1 
ATOM   2637 C C   . PHE A 1 346 ? 25.348  30.714  1.131   1.00 53.67  ? 346  PHE A C   1 
ATOM   2638 O O   . PHE A 1 346 ? 26.486  31.040  1.495   1.00 48.23  ? 346  PHE A O   1 
ATOM   2639 C CB  . PHE A 1 346 ? 25.199  28.369  0.245   1.00 38.90  ? 346  PHE A CB  1 
ATOM   2640 C CG  . PHE A 1 346 ? 24.616  27.485  -0.815  1.00 43.77  ? 346  PHE A CG  1 
ATOM   2641 C CD1 . PHE A 1 346 ? 25.376  27.119  -1.929  1.00 40.39  ? 346  PHE A CD1 1 
ATOM   2642 C CD2 . PHE A 1 346 ? 23.307  27.033  -0.716  1.00 39.86  ? 346  PHE A CD2 1 
ATOM   2643 C CE1 . PHE A 1 346 ? 24.851  26.309  -2.922  1.00 37.59  ? 346  PHE A CE1 1 
ATOM   2644 C CE2 . PHE A 1 346 ? 22.767  26.213  -1.695  1.00 42.90  ? 346  PHE A CE2 1 
ATOM   2645 C CZ  . PHE A 1 346 ? 23.539  25.848  -2.810  1.00 45.24  ? 346  PHE A CZ  1 
ATOM   2646 N N   . SER A 1 347 ? 24.236  31.105  1.751   1.00 55.23  ? 347  SER A N   1 
ATOM   2647 C CA  . SER A 1 347 ? 24.278  31.845  3.004   1.00 58.36  ? 347  SER A CA  1 
ATOM   2648 C C   . SER A 1 347 ? 23.038  31.646  3.862   1.00 57.83  ? 347  SER A C   1 
ATOM   2649 O O   . SER A 1 347 ? 21.982  31.243  3.371   1.00 64.44  ? 347  SER A O   1 
ATOM   2650 C CB  . SER A 1 347 ? 24.467  33.338  2.758   1.00 55.99  ? 347  SER A CB  1 
ATOM   2651 O OG  . SER A 1 347 ? 24.523  34.024  3.998   1.00 56.69  ? 347  SER A OG  1 
ATOM   2652 N N   . LYS A 1 348 ? 23.185  31.954  5.148   1.00 48.40  ? 348  LYS A N   1 
ATOM   2653 C CA  . LYS A 1 348 ? 22.078  31.934  6.082   1.00 49.60  ? 348  LYS A CA  1 
ATOM   2654 C C   . LYS A 1 348 ? 21.276  33.224  6.013   1.00 58.04  ? 348  LYS A C   1 
ATOM   2655 O O   . LYS A 1 348 ? 20.219  33.323  6.618   1.00 63.59  ? 348  LYS A O   1 
ATOM   2656 C CB  . LYS A 1 348 ? 22.587  31.709  7.507   1.00 50.06  ? 348  LYS A CB  1 
ATOM   2657 C CG  . LYS A 1 348 ? 23.044  32.946  8.254   1.00 62.38  ? 348  LYS A CG  1 
ATOM   2658 C CD  . LYS A 1 348 ? 23.400  32.611  9.713   1.00 67.22  ? 348  LYS A CD  1 
ATOM   2659 C CE  . LYS A 1 348 ? 23.692  33.865  10.537  1.00 73.80  ? 348  LYS A CE  1 
ATOM   2660 N NZ  . LYS A 1 348 ? 22.501  34.755  10.654  1.00 81.00  ? 348  LYS A NZ  1 
ATOM   2661 N N   . ASP A 1 349 ? 21.766  34.200  5.253   1.00 58.43  ? 349  ASP A N   1 
ATOM   2662 C CA  . ASP A 1 349 ? 21.208  35.549  5.303   1.00 56.85  ? 349  ASP A CA  1 
ATOM   2663 C C   . ASP A 1 349 ? 20.439  35.962  4.059   1.00 68.75  ? 349  ASP A C   1 
ATOM   2664 O O   . ASP A 1 349 ? 19.739  36.980  4.053   1.00 71.24  ? 349  ASP A O   1 
ATOM   2665 C CB  . ASP A 1 349 ? 22.308  36.546  5.606   1.00 48.54  ? 349  ASP A CB  1 
ATOM   2666 C CG  . ASP A 1 349 ? 22.878  36.350  6.988   1.00 61.11  ? 349  ASP A CG  1 
ATOM   2667 O OD1 . ASP A 1 349 ? 22.076  36.212  7.950   1.00 56.89  ? 349  ASP A OD1 1 
ATOM   2668 O OD2 . ASP A 1 349 ? 24.124  36.315  7.107   1.00 64.41  ? 349  ASP A OD2 1 
ATOM   2669 N N   . ASN A 1 350 ? 20.572  35.182  2.999   1.00 65.77  ? 350  ASN A N   1 
ATOM   2670 C CA  . ASN A 1 350 ? 19.674  35.354  1.880   1.00 61.10  ? 350  ASN A CA  1 
ATOM   2671 C C   . ASN A 1 350 ? 19.071  34.012  1.559   1.00 57.33  ? 350  ASN A C   1 
ATOM   2672 O O   . ASN A 1 350 ? 19.330  33.038  2.258   1.00 48.12  ? 350  ASN A O   1 
ATOM   2673 C CB  . ASN A 1 350 ? 20.396  35.900  0.668   1.00 48.61  ? 350  ASN A CB  1 
ATOM   2674 C CG  . ASN A 1 350 ? 21.536  35.042  0.264   1.00 63.10  ? 350  ASN A CG  1 
ATOM   2675 O OD1 . ASN A 1 350 ? 22.645  35.525  0.136   1.00 73.33  ? 350  ASN A OD1 1 
ATOM   2676 N ND2 . ASN A 1 350 ? 21.291  33.751  0.095   1.00 70.55  ? 350  ASN A ND2 1 
ATOM   2677 N N   . GLU A 1 351 ? 18.297  33.978  0.480   1.00 51.13  ? 351  GLU A N   1 
ATOM   2678 C CA  . GLU A 1 351 ? 17.588  32.787  0.078   1.00 50.09  ? 351  GLU A CA  1 
ATOM   2679 C C   . GLU A 1 351 ? 18.467  31.758  -0.680  1.00 48.08  ? 351  GLU A C   1 
ATOM   2680 O O   . GLU A 1 351 ? 17.991  30.677  -1.071  1.00 47.74  ? 351  GLU A O   1 
ATOM   2681 C CB  . GLU A 1 351 ? 16.325  33.184  -0.702  1.00 56.59  ? 351  GLU A CB  1 
ATOM   2682 C CG  . GLU A 1 351 ? 15.208  33.732  0.174   1.00 61.58  ? 351  GLU A CG  1 
ATOM   2683 C CD  . GLU A 1 351 ? 14.851  32.784  1.326   1.00 85.23  ? 351  GLU A CD  1 
ATOM   2684 O OE1 . GLU A 1 351 ? 14.114  31.791  1.097   1.00 93.58  ? 351  GLU A OE1 1 
ATOM   2685 O OE2 . GLU A 1 351 ? 15.304  33.032  2.468   1.00 91.87  ? 351  GLU A OE2 1 
ATOM   2686 N N   . SER A 1 352 ? 19.748  32.083  -0.857  1.00 40.94  ? 352  SER A N   1 
ATOM   2687 C CA  . SER A 1 352 ? 20.705  31.165  -1.488  1.00 46.05  ? 352  SER A CA  1 
ATOM   2688 C C   . SER A 1 352 ? 20.242  30.626  -2.844  1.00 47.86  ? 352  SER A C   1 
ATOM   2689 O O   . SER A 1 352 ? 20.555  29.506  -3.213  1.00 40.80  ? 352  SER A O   1 
ATOM   2690 C CB  . SER A 1 352 ? 21.036  29.993  -0.554  1.00 48.11  ? 352  SER A CB  1 
ATOM   2691 O OG  . SER A 1 352 ? 21.566  30.457  0.673   1.00 51.04  ? 352  SER A OG  1 
ATOM   2692 N N   . LEU A 1 353 ? 19.490  31.416  -3.593  1.00 56.87  ? 353  LEU A N   1 
ATOM   2693 C CA  . LEU A 1 353 ? 19.165  31.011  -4.947  1.00 53.94  ? 353  LEU A CA  1 
ATOM   2694 C C   . LEU A 1 353 ? 20.472  30.957  -5.722  1.00 57.35  ? 353  LEU A C   1 
ATOM   2695 O O   . LEU A 1 353 ? 21.235  31.917  -5.702  1.00 71.50  ? 353  LEU A O   1 
ATOM   2696 C CB  . LEU A 1 353 ? 18.194  32.002  -5.578  1.00 48.76  ? 353  LEU A CB  1 
ATOM   2697 C CG  . LEU A 1 353 ? 16.843  32.075  -4.868  1.00 51.60  ? 353  LEU A CG  1 
ATOM   2698 C CD1 . LEU A 1 353 ? 15.863  32.937  -5.621  1.00 51.70  ? 353  LEU A CD1 1 
ATOM   2699 C CD2 . LEU A 1 353 ? 16.274  30.693  -4.698  1.00 58.18  ? 353  LEU A CD2 1 
ATOM   2700 N N   . ILE A 1 354 ? 20.756  29.828  -6.366  1.00 48.68  ? 354  ILE A N   1 
ATOM   2701 C CA  . ILE A 1 354 ? 22.015  29.665  -7.097  1.00 45.89  ? 354  ILE A CA  1 
ATOM   2702 C C   . ILE A 1 354 ? 21.820  29.412  -8.581  1.00 47.92  ? 354  ILE A C   1 
ATOM   2703 O O   . ILE A 1 354 ? 20.705  29.180  -9.055  1.00 46.53  ? 354  ILE A O   1 
ATOM   2704 C CB  . ILE A 1 354 ? 22.918  28.531  -6.538  1.00 38.60  ? 354  ILE A CB  1 
ATOM   2705 C CG1 . ILE A 1 354 ? 22.137  27.222  -6.353  1.00 35.98  ? 354  ILE A CG1 1 
ATOM   2706 C CG2 . ILE A 1 354 ? 23.563  28.959  -5.257  1.00 37.03  ? 354  ILE A CG2 1 
ATOM   2707 C CD1 . ILE A 1 354 ? 22.955  25.985  -6.602  1.00 37.87  ? 354  ILE A CD1 1 
ATOM   2708 N N   . SER A 1 355 ? 22.933  29.456  -9.302  1.00 44.38  ? 355  SER A N   1 
ATOM   2709 C CA  . SER A 1 355 ? 22.953  29.185  -10.728 1.00 43.91  ? 355  SER A CA  1 
ATOM   2710 C C   . SER A 1 355 ? 23.451  27.773  -11.050 1.00 44.44  ? 355  SER A C   1 
ATOM   2711 O O   . SER A 1 355 ? 24.018  27.067  -10.220 1.00 44.64  ? 355  SER A O   1 
ATOM   2712 C CB  . SER A 1 355 ? 23.883  30.166  -11.406 1.00 40.93  ? 355  SER A CB  1 
ATOM   2713 O OG  . SER A 1 355 ? 25.231  29.873  -11.055 1.00 46.89  ? 355  SER A OG  1 
ATOM   2714 N N   . ARG A 1 356 ? 23.271  27.385  -12.293 1.00 45.16  ? 356  ARG A N   1 
ATOM   2715 C CA  . ARG A 1 356 ? 23.691  26.077  -12.714 1.00 50.57  ? 356  ARG A CA  1 
ATOM   2716 C C   . ARG A 1 356 ? 25.200  25.927  -12.511 1.00 49.52  ? 356  ARG A C   1 
ATOM   2717 O O   . ARG A 1 356 ? 25.684  24.864  -12.105 1.00 48.47  ? 356  ARG A O   1 
ATOM   2718 C CB  . ARG A 1 356 ? 23.291  25.861  -14.170 1.00 49.02  ? 356  ARG A CB  1 
ATOM   2719 C CG  . ARG A 1 356 ? 23.761  24.560  -14.731 1.00 53.75  ? 356  ARG A CG  1 
ATOM   2720 C CD  . ARG A 1 356 ? 22.698  23.936  -15.576 1.00 58.31  ? 356  ARG A CD  1 
ATOM   2721 N NE  . ARG A 1 356 ? 23.032  22.541  -15.844 1.00 62.84  ? 356  ARG A NE  1 
ATOM   2722 C CZ  . ARG A 1 356 ? 22.470  21.504  -15.235 1.00 52.40  ? 356  ARG A CZ  1 
ATOM   2723 N NH1 . ARG A 1 356 ? 21.526  21.698  -14.323 1.00 50.70  ? 356  ARG A NH1 1 
ATOM   2724 N NH2 . ARG A 1 356 ? 22.847  20.276  -15.558 1.00 47.94  ? 356  ARG A NH2 1 
ATOM   2725 N N   . ALA A 1 357 ? 25.926  27.007  -12.778 1.00 39.13  ? 357  ALA A N   1 
ATOM   2726 C CA  . ALA A 1 357 ? 27.374  27.034  -12.621 1.00 39.44  ? 357  ALA A CA  1 
ATOM   2727 C C   . ALA A 1 357 ? 27.722  26.756  -11.182 1.00 42.44  ? 357  ALA A C   1 
ATOM   2728 O O   . ALA A 1 357 ? 28.529  25.874  -10.884 1.00 42.66  ? 357  ALA A O   1 
ATOM   2729 C CB  . ALA A 1 357 ? 27.934  28.394  -13.030 1.00 31.86  ? 357  ALA A CB  1 
ATOM   2730 N N   . GLN A 1 358 ? 27.101  27.513  -10.287 1.00 36.88  ? 358  GLN A N   1 
ATOM   2731 C CA  . GLN A 1 358 ? 27.350  27.318  -8.875  1.00 40.62  ? 358  GLN A CA  1 
ATOM   2732 C C   . GLN A 1 358 ? 26.983  25.907  -8.428  1.00 38.76  ? 358  GLN A C   1 
ATOM   2733 O O   . GLN A 1 358 ? 27.613  25.362  -7.533  1.00 38.56  ? 358  GLN A O   1 
ATOM   2734 C CB  . GLN A 1 358 ? 26.597  28.350  -8.051  1.00 39.55  ? 358  GLN A CB  1 
ATOM   2735 C CG  . GLN A 1 358 ? 27.096  29.772  -8.208  1.00 36.89  ? 358  GLN A CG  1 
ATOM   2736 C CD  . GLN A 1 358 ? 26.177  30.778  -7.526  1.00 46.06  ? 358  GLN A CD  1 
ATOM   2737 O OE1 . GLN A 1 358 ? 24.952  30.775  -7.729  1.00 46.84  ? 358  GLN A OE1 1 
ATOM   2738 N NE2 . GLN A 1 358 ? 26.760  31.631  -6.695  1.00 46.59  ? 358  GLN A NE2 1 
ATOM   2739 N N   . PHE A 1 359 ? 25.964  25.320  -9.050  1.00 42.84  ? 359  PHE A N   1 
ATOM   2740 C CA  . PHE A 1 359 ? 25.560  23.946  -8.745  1.00 41.68  ? 359  PHE A CA  1 
ATOM   2741 C C   . PHE A 1 359 ? 26.629  22.910  -9.142  1.00 45.72  ? 359  PHE A C   1 
ATOM   2742 O O   . PHE A 1 359 ? 26.983  22.034  -8.357  1.00 45.29  ? 359  PHE A O   1 
ATOM   2743 C CB  . PHE A 1 359 ? 24.246  23.641  -9.432  1.00 32.50  ? 359  PHE A CB  1 
ATOM   2744 C CG  . PHE A 1 359 ? 23.790  22.229  -9.276  1.00 28.43  ? 359  PHE A CG  1 
ATOM   2745 C CD1 . PHE A 1 359 ? 23.723  21.385  -10.365 1.00 34.75  ? 359  PHE A CD1 1 
ATOM   2746 C CD2 . PHE A 1 359 ? 23.417  21.748  -8.057  1.00 32.64  ? 359  PHE A CD2 1 
ATOM   2747 C CE1 . PHE A 1 359 ? 23.282  20.091  -10.232 1.00 32.94  ? 359  PHE A CE1 1 
ATOM   2748 C CE2 . PHE A 1 359 ? 22.997  20.445  -7.916  1.00 28.13  ? 359  PHE A CE2 1 
ATOM   2749 C CZ  . PHE A 1 359 ? 22.914  19.629  -9.001  1.00 30.76  ? 359  PHE A CZ  1 
ATOM   2750 N N   . LEU A 1 360 ? 27.148  23.027  -10.357 1.00 42.16  ? 360  LEU A N   1 
ATOM   2751 C CA  . LEU A 1 360 ? 28.208  22.150  -10.822 1.00 38.62  ? 360  LEU A CA  1 
ATOM   2752 C C   . LEU A 1 360 ? 29.443  22.278  -9.939  1.00 47.17  ? 360  LEU A C   1 
ATOM   2753 O O   . LEU A 1 360 ? 30.106  21.293  -9.613  1.00 48.66  ? 360  LEU A O   1 
ATOM   2754 C CB  . LEU A 1 360 ? 28.558  22.482  -12.269 1.00 31.64  ? 360  LEU A CB  1 
ATOM   2755 C CG  . LEU A 1 360 ? 27.355  22.468  -13.233 1.00 47.74  ? 360  LEU A CG  1 
ATOM   2756 C CD1 . LEU A 1 360 ? 27.784  22.648  -14.687 1.00 34.42  ? 360  LEU A CD1 1 
ATOM   2757 C CD2 . LEU A 1 360 ? 26.489  21.210  -13.075 1.00 51.56  ? 360  LEU A CD2 1 
ATOM   2758 N N   . ALA A 1 361 ? 29.757  23.507  -9.568  1.00 43.09  ? 361  ALA A N   1 
ATOM   2759 C CA  . ALA A 1 361 ? 30.867  23.769  -8.668  1.00 38.02  ? 361  ALA A CA  1 
ATOM   2760 C C   . ALA A 1 361 ? 30.626  23.099  -7.307  1.00 41.05  ? 361  ALA A C   1 
ATOM   2761 O O   . ALA A 1 361 ? 31.527  22.473  -6.735  1.00 44.47  ? 361  ALA A O   1 
ATOM   2762 C CB  . ALA A 1 361 ? 31.052  25.277  -8.507  1.00 23.98  ? 361  ALA A CB  1 
ATOM   2763 N N   . GLY A 1 362 ? 29.399  23.232  -6.803  1.00 34.90  ? 362  GLY A N   1 
ATOM   2764 C CA  . GLY A 1 362 ? 29.029  22.688  -5.512  1.00 34.70  ? 362  GLY A CA  1 
ATOM   2765 C C   . GLY A 1 362 ? 29.061  21.165  -5.478  1.00 37.43  ? 362  GLY A C   1 
ATOM   2766 O O   . GLY A 1 362 ? 29.373  20.552  -4.460  1.00 31.76  ? 362  GLY A O   1 
ATOM   2767 N N   . VAL A 1 363 ? 28.740  20.542  -6.602  1.00 37.88  ? 363  VAL A N   1 
ATOM   2768 C CA  . VAL A 1 363 ? 28.790  19.097  -6.681  1.00 34.54  ? 363  VAL A CA  1 
ATOM   2769 C C   . VAL A 1 363 ? 30.239  18.602  -6.573  1.00 42.55  ? 363  VAL A C   1 
ATOM   2770 O O   . VAL A 1 363 ? 30.494  17.605  -5.917  1.00 40.23  ? 363  VAL A O   1 
ATOM   2771 C CB  . VAL A 1 363 ? 28.069  18.592  -7.946  1.00 36.31  ? 363  VAL A CB  1 
ATOM   2772 C CG1 . VAL A 1 363 ? 28.542  17.202  -8.374  1.00 21.80  ? 363  VAL A CG1 1 
ATOM   2773 C CG2 . VAL A 1 363 ? 26.539  18.623  -7.732  1.00 46.20  ? 363  VAL A CG2 1 
ATOM   2774 N N   . ARG A 1 364 ? 31.185  19.320  -7.181  1.00 45.52  ? 364  ARG A N   1 
ATOM   2775 C CA  . ARG A 1 364 ? 32.583  18.919  -7.127  1.00 39.95  ? 364  ARG A CA  1 
ATOM   2776 C C   . ARG A 1 364 ? 33.077  19.020  -5.697  1.00 46.04  ? 364  ARG A C   1 
ATOM   2777 O O   . ARG A 1 364 ? 33.870  18.186  -5.250  1.00 44.86  ? 364  ARG A O   1 
ATOM   2778 C CB  . ARG A 1 364 ? 33.462  19.769  -8.037  1.00 38.60  ? 364  ARG A CB  1 
ATOM   2779 C CG  . ARG A 1 364 ? 33.183  19.609  -9.516  1.00 53.31  ? 364  ARG A CG  1 
ATOM   2780 C CD  . ARG A 1 364 ? 32.879  18.170  -9.897  1.00 69.17  ? 364  ARG A CD  1 
ATOM   2781 N NE  . ARG A 1 364 ? 33.962  17.222  -9.590  1.00 76.91  ? 364  ARG A NE  1 
ATOM   2782 C CZ  . ARG A 1 364 ? 34.870  16.787  -10.466 1.00 69.63  ? 364  ARG A CZ  1 
ATOM   2783 N NH1 . ARG A 1 364 ? 34.862  17.221  -11.726 1.00 66.45  ? 364  ARG A NH1 1 
ATOM   2784 N NH2 . ARG A 1 364 ? 35.793  15.923  -10.075 1.00 61.21  ? 364  ARG A NH2 1 
ATOM   2785 N N   . ILE A 1 365 ? 32.594  20.028  -4.975  1.00 38.64  ? 365  ILE A N   1 
ATOM   2786 C CA  . ILE A 1 365 ? 32.962  20.170  -3.572  1.00 38.92  ? 365  ILE A CA  1 
ATOM   2787 C C   . ILE A 1 365 ? 32.242  19.149  -2.670  1.00 48.34  ? 365  ILE A C   1 
ATOM   2788 O O   . ILE A 1 365 ? 32.867  18.511  -1.812  1.00 41.40  ? 365  ILE A O   1 
ATOM   2789 C CB  . ILE A 1 365 ? 32.627  21.555  -3.065  1.00 36.17  ? 365  ILE A CB  1 
ATOM   2790 C CG1 . ILE A 1 365 ? 33.449  22.596  -3.806  1.00 40.61  ? 365  ILE A CG1 1 
ATOM   2791 C CG2 . ILE A 1 365 ? 32.844  21.644  -1.549  1.00 27.68  ? 365  ILE A CG2 1 
ATOM   2792 C CD1 . ILE A 1 365 ? 33.179  24.008  -3.343  1.00 43.71  ? 365  ILE A CD1 1 
ATOM   2793 N N   . GLY A 1 366 ? 30.927  19.012  -2.858  1.00 47.53  ? 366  GLY A N   1 
ATOM   2794 C CA  . GLY A 1 366 ? 30.127  18.081  -2.078  1.00 49.03  ? 366  GLY A CA  1 
ATOM   2795 C C   . GLY A 1 366 ? 30.486  16.613  -2.301  1.00 47.42  ? 366  GLY A C   1 
ATOM   2796 O O   . GLY A 1 366 ? 30.263  15.766  -1.441  1.00 41.93  ? 366  GLY A O   1 
ATOM   2797 N N   . VAL A 1 367 ? 31.042  16.312  -3.469  1.00 43.15  ? 367  VAL A N   1 
ATOM   2798 C CA  . VAL A 1 367 ? 31.448  14.962  -3.792  1.00 37.49  ? 367  VAL A CA  1 
ATOM   2799 C C   . VAL A 1 367 ? 32.904  14.976  -4.208  1.00 38.70  ? 367  VAL A C   1 
ATOM   2800 O O   . VAL A 1 367 ? 33.205  14.707  -5.368  1.00 39.33  ? 367  VAL A O   1 
ATOM   2801 C CB  . VAL A 1 367 ? 30.630  14.399  -4.963  1.00 37.63  ? 367  VAL A CB  1 
ATOM   2802 C CG1 . VAL A 1 367 ? 30.821  12.870  -5.071  1.00 28.89  ? 367  VAL A CG1 1 
ATOM   2803 C CG2 . VAL A 1 367 ? 29.147  14.746  -4.808  1.00 28.33  ? 367  VAL A CG2 1 
ATOM   2804 N N   . PRO A 1 368 ? 33.814  15.284  -3.261  1.00 37.27  ? 368  PRO A N   1 
ATOM   2805 C CA  . PRO A 1 368 ? 35.203  15.625  -3.608  1.00 39.07  ? 368  PRO A CA  1 
ATOM   2806 C C   . PRO A 1 368 ? 36.013  14.480  -4.231  1.00 44.14  ? 368  PRO A C   1 
ATOM   2807 O O   . PRO A 1 368 ? 36.842  14.750  -5.090  1.00 50.59  ? 368  PRO A O   1 
ATOM   2808 C CB  . PRO A 1 368 ? 35.792  16.094  -2.278  1.00 31.45  ? 368  PRO A CB  1 
ATOM   2809 C CG  . PRO A 1 368 ? 34.877  15.481  -1.222  1.00 33.95  ? 368  PRO A CG  1 
ATOM   2810 C CD  . PRO A 1 368 ? 33.537  15.530  -1.838  1.00 34.27  ? 368  PRO A CD  1 
ATOM   2811 N N   . GLN A 1 369 ? 35.739  13.236  -3.848  1.00 45.62  ? 369  GLN A N   1 
ATOM   2812 C CA  . GLN A 1 369 ? 36.410  12.068  -4.432  1.00 43.61  ? 369  GLN A CA  1 
ATOM   2813 C C   . GLN A 1 369 ? 36.011  11.746  -5.876  1.00 50.34  ? 369  GLN A C   1 
ATOM   2814 O O   . GLN A 1 369 ? 36.526  10.779  -6.439  1.00 51.95  ? 369  GLN A O   1 
ATOM   2815 C CB  . GLN A 1 369 ? 36.141  10.812  -3.598  1.00 38.30  ? 369  GLN A CB  1 
ATOM   2816 C CG  . GLN A 1 369 ? 35.337  11.066  -2.325  1.00 64.82  ? 369  GLN A CG  1 
ATOM   2817 C CD  . GLN A 1 369 ? 33.820  11.213  -2.590  1.00 64.45  ? 369  GLN A CD  1 
ATOM   2818 O OE1 . GLN A 1 369 ? 33.279  12.313  -2.501  1.00 62.09  ? 369  GLN A OE1 1 
ATOM   2819 N NE2 . GLN A 1 369 ? 33.146  10.102  -2.918  1.00 54.65  ? 369  GLN A NE2 1 
ATOM   2820 N N   . ALA A 1 370 ? 35.110  12.530  -6.472  1.00 47.52  ? 370  ALA A N   1 
ATOM   2821 C CA  . ALA A 1 370 ? 34.512  12.152  -7.760  1.00 50.40  ? 370  ALA A CA  1 
ATOM   2822 C C   . ALA A 1 370 ? 35.370  12.459  -8.967  1.00 50.82  ? 370  ALA A C   1 
ATOM   2823 O O   . ALA A 1 370 ? 35.905  13.556  -9.080  1.00 53.76  ? 370  ALA A O   1 
ATOM   2824 C CB  . ALA A 1 370 ? 33.163  12.795  -7.936  1.00 49.33  ? 370  ALA A CB  1 
ATOM   2825 N N   . SER A 1 371 ? 35.496  11.478  -9.863  1.00 49.81  ? 371  SER A N   1 
ATOM   2826 C CA  . SER A 1 371 ? 36.081  11.723  -11.178 1.00 53.83  ? 371  SER A CA  1 
ATOM   2827 C C   . SER A 1 371 ? 35.138  12.644  -11.934 1.00 55.71  ? 371  SER A C   1 
ATOM   2828 O O   . SER A 1 371 ? 34.019  12.916  -11.494 1.00 49.09  ? 371  SER A O   1 
ATOM   2829 C CB  . SER A 1 371 ? 36.286  10.425  -11.967 1.00 60.18  ? 371  SER A CB  1 
ATOM   2830 O OG  . SER A 1 371 ? 35.061  9.778   -12.299 1.00 65.35  ? 371  SER A OG  1 
ATOM   2831 N N   . ASP A 1 372 ? 35.581  13.134  -13.076 1.00 58.71  ? 372  ASP A N   1 
ATOM   2832 C CA  . ASP A 1 372 ? 34.747  14.061  -13.803 1.00 56.90  ? 372  ASP A CA  1 
ATOM   2833 C C   . ASP A 1 372 ? 33.436  13.390  -14.220 1.00 58.16  ? 372  ASP A C   1 
ATOM   2834 O O   . ASP A 1 372 ? 32.357  13.994  -14.103 1.00 53.18  ? 372  ASP A O   1 
ATOM   2835 C CB  . ASP A 1 372 ? 35.505  14.681  -14.980 1.00 54.60  ? 372  ASP A CB  1 
ATOM   2836 C CG  . ASP A 1 372 ? 36.511  15.722  -14.533 1.00 69.57  ? 372  ASP A CG  1 
ATOM   2837 O OD1 . ASP A 1 372 ? 36.748  15.838  -13.309 1.00 76.02  ? 372  ASP A OD1 1 
ATOM   2838 O OD2 . ASP A 1 372 ? 37.067  16.426  -15.401 1.00 75.66  ? 372  ASP A OD2 1 
ATOM   2839 N N   . LEU A 1 373 ? 33.520  12.139  -14.674 1.00 56.47  ? 373  LEU A N   1 
ATOM   2840 C CA  . LEU A 1 373 ? 32.317  11.423  -15.102 1.00 55.34  ? 373  LEU A CA  1 
ATOM   2841 C C   . LEU A 1 373 ? 31.309  11.221  -13.969 1.00 52.76  ? 373  LEU A C   1 
ATOM   2842 O O   . LEU A 1 373 ? 30.133  11.533  -14.120 1.00 51.40  ? 373  LEU A O   1 
ATOM   2843 C CB  . LEU A 1 373 ? 32.657  10.076  -15.730 1.00 55.68  ? 373  LEU A CB  1 
ATOM   2844 C CG  . LEU A 1 373 ? 31.430  9.396   -16.357 1.00 51.82  ? 373  LEU A CG  1 
ATOM   2845 C CD1 . LEU A 1 373 ? 30.822  10.254  -17.451 1.00 41.54  ? 373  LEU A CD1 1 
ATOM   2846 C CD2 . LEU A 1 373 ? 31.763  8.008   -16.900 1.00 51.75  ? 373  LEU A CD2 1 
ATOM   2847 N N   . ALA A 1 374 ? 31.772  10.694  -12.841 1.00 51.59  ? 374  ALA A N   1 
ATOM   2848 C CA  . ALA A 1 374 ? 30.898  10.464  -11.703 1.00 49.09  ? 374  ALA A CA  1 
ATOM   2849 C C   . ALA A 1 374 ? 30.164  11.746  -11.314 1.00 47.11  ? 374  ALA A C   1 
ATOM   2850 O O   . ALA A 1 374 ? 28.974  11.731  -10.978 1.00 40.41  ? 374  ALA A O   1 
ATOM   2851 C CB  . ALA A 1 374 ? 31.690  9.935   -10.536 1.00 47.38  ? 374  ALA A CB  1 
ATOM   2852 N N   . ALA A 1 375 ? 30.881  12.859  -11.356 1.00 47.69  ? 375  ALA A N   1 
ATOM   2853 C CA  . ALA A 1 375 ? 30.315  14.134  -10.968 1.00 44.24  ? 375  ALA A CA  1 
ATOM   2854 C C   . ALA A 1 375 ? 29.192  14.493  -11.951 1.00 58.38  ? 375  ALA A C   1 
ATOM   2855 O O   . ALA A 1 375 ? 28.116  14.934  -11.551 1.00 63.17  ? 375  ALA A O   1 
ATOM   2856 C CB  . ALA A 1 375 ? 31.400  15.190  -10.953 1.00 28.36  ? 375  ALA A CB  1 
ATOM   2857 N N   . GLU A 1 376 ? 29.440  14.270  -13.238 1.00 61.38  ? 376  GLU A N   1 
ATOM   2858 C CA  . GLU A 1 376 ? 28.425  14.489  -14.259 1.00 64.14  ? 376  GLU A CA  1 
ATOM   2859 C C   . GLU A 1 376 ? 27.208  13.591  -14.056 1.00 53.06  ? 376  GLU A C   1 
ATOM   2860 O O   . GLU A 1 376 ? 26.081  14.004  -14.299 1.00 54.70  ? 376  GLU A O   1 
ATOM   2861 C CB  . GLU A 1 376 ? 29.000  14.260  -15.653 1.00 78.40  ? 376  GLU A CB  1 
ATOM   2862 C CG  . GLU A 1 376 ? 29.641  15.481  -16.284 1.00 96.13  ? 376  GLU A CG  1 
ATOM   2863 C CD  . GLU A 1 376 ? 30.249  15.161  -17.650 1.00 114.22 ? 376  GLU A CD  1 
ATOM   2864 O OE1 . GLU A 1 376 ? 29.913  14.089  -18.202 1.00 124.04 ? 376  GLU A OE1 1 
ATOM   2865 O OE2 . GLU A 1 376 ? 31.059  15.965  -18.170 1.00 113.70 ? 376  GLU A OE2 1 
ATOM   2866 N N   . ALA A 1 377 ? 27.444  12.359  -13.623 1.00 42.18  ? 377  ALA A N   1 
ATOM   2867 C CA  . ALA A 1 377 ? 26.363  11.438  -13.326 1.00 36.43  ? 377  ALA A CA  1 
ATOM   2868 C C   . ALA A 1 377 ? 25.480  12.002  -12.228 1.00 43.38  ? 377  ALA A C   1 
ATOM   2869 O O   . ALA A 1 377 ? 24.262  11.858  -12.281 1.00 46.88  ? 377  ALA A O   1 
ATOM   2870 C CB  . ALA A 1 377 ? 26.907  10.120  -12.914 1.00 33.52  ? 377  ALA A CB  1 
ATOM   2871 N N   . VAL A 1 378 ? 26.100  12.658  -11.246 1.00 43.80  ? 378  VAL A N   1 
ATOM   2872 C CA  . VAL A 1 378 ? 25.371  13.252  -10.127 1.00 43.50  ? 378  VAL A CA  1 
ATOM   2873 C C   . VAL A 1 378 ? 24.528  14.421  -10.616 1.00 47.43  ? 378  VAL A C   1 
ATOM   2874 O O   . VAL A 1 378 ? 23.330  14.480  -10.360 1.00 50.38  ? 378  VAL A O   1 
ATOM   2875 C CB  . VAL A 1 378 ? 26.325  13.703  -8.982  1.00 36.29  ? 378  VAL A CB  1 
ATOM   2876 C CG1 . VAL A 1 378 ? 25.618  14.592  -7.968  1.00 30.42  ? 378  VAL A CG1 1 
ATOM   2877 C CG2 . VAL A 1 378 ? 26.889  12.501  -8.274  1.00 45.77  ? 378  VAL A CG2 1 
ATOM   2878 N N   . VAL A 1 379 ? 25.161  15.346  -11.323 1.00 48.44  ? 379  VAL A N   1 
ATOM   2879 C CA  . VAL A 1 379 ? 24.466  16.504  -11.851 1.00 47.24  ? 379  VAL A CA  1 
ATOM   2880 C C   . VAL A 1 379 ? 23.312  16.078  -12.738 1.00 48.51  ? 379  VAL A C   1 
ATOM   2881 O O   . VAL A 1 379 ? 22.234  16.683  -12.711 1.00 48.46  ? 379  VAL A O   1 
ATOM   2882 C CB  . VAL A 1 379 ? 25.406  17.356  -12.676 1.00 41.83  ? 379  VAL A CB  1 
ATOM   2883 C CG1 . VAL A 1 379 ? 24.612  18.271  -13.588 1.00 33.97  ? 379  VAL A CG1 1 
ATOM   2884 C CG2 . VAL A 1 379 ? 26.312  18.140  -11.759 1.00 41.36  ? 379  VAL A CG2 1 
ATOM   2885 N N   . LEU A 1 380 ? 23.534  15.024  -13.516 1.00 45.88  ? 380  LEU A N   1 
ATOM   2886 C CA  . LEU A 1 380 ? 22.484  14.504  -14.383 1.00 53.73  ? 380  LEU A CA  1 
ATOM   2887 C C   . LEU A 1 380 ? 21.292  13.976  -13.602 1.00 47.73  ? 380  LEU A C   1 
ATOM   2888 O O   . LEU A 1 380 ? 20.142  14.342  -13.858 1.00 40.57  ? 380  LEU A O   1 
ATOM   2889 C CB  . LEU A 1 380 ? 23.025  13.464  -15.359 1.00 61.04  ? 380  LEU A CB  1 
ATOM   2890 C CG  . LEU A 1 380 ? 23.358  14.231  -16.648 1.00 75.61  ? 380  LEU A CG  1 
ATOM   2891 C CD1 . LEU A 1 380 ? 24.728  14.959  -16.589 1.00 54.57  ? 380  LEU A CD1 1 
ATOM   2892 C CD2 . LEU A 1 380 ? 23.262  13.328  -17.862 1.00 83.24  ? 380  LEU A CD2 1 
ATOM   2893 N N   . HIS A 1 381 ? 21.577  13.146  -12.617 1.00 40.94  ? 381  HIS A N   1 
ATOM   2894 C CA  . HIS A 1 381 ? 20.532  12.652  -11.741 1.00 43.22  ? 381  HIS A CA  1 
ATOM   2895 C C   . HIS A 1 381 ? 19.779  13.749  -10.983 1.00 40.04  ? 381  HIS A C   1 
ATOM   2896 O O   . HIS A 1 381 ? 18.574  13.641  -10.764 1.00 48.60  ? 381  HIS A O   1 
ATOM   2897 C CB  . HIS A 1 381 ? 21.109  11.633  -10.758 1.00 49.90  ? 381  HIS A CB  1 
ATOM   2898 C CG  . HIS A 1 381 ? 20.078  10.970  -9.910  1.00 50.62  ? 381  HIS A CG  1 
ATOM   2899 N ND1 . HIS A 1 381 ? 19.346  9.891   -10.345 1.00 59.02  ? 381  HIS A ND1 1 
ATOM   2900 C CD2 . HIS A 1 381 ? 19.648  11.238  -8.654  1.00 55.81  ? 381  HIS A CD2 1 
ATOM   2901 C CE1 . HIS A 1 381 ? 18.509  9.516   -9.392  1.00 64.35  ? 381  HIS A CE1 1 
ATOM   2902 N NE2 . HIS A 1 381 ? 18.674  10.315  -8.354  1.00 58.81  ? 381  HIS A NE2 1 
ATOM   2903 N N   . TYR A 1 382 ? 20.470  14.800  -10.569 1.00 38.59  ? 382  TYR A N   1 
ATOM   2904 C CA  . TYR A 1 382 ? 19.828  15.757  -9.678  1.00 45.17  ? 382  TYR A CA  1 
ATOM   2905 C C   . TYR A 1 382 ? 19.180  16.927  -10.398 1.00 51.99  ? 382  TYR A C   1 
ATOM   2906 O O   . TYR A 1 382 ? 18.264  17.540  -9.847  1.00 52.88  ? 382  TYR A O   1 
ATOM   2907 C CB  . TYR A 1 382 ? 20.760  16.231  -8.551  1.00 34.85  ? 382  TYR A CB  1 
ATOM   2908 C CG  . TYR A 1 382 ? 20.847  15.236  -7.409  1.00 35.84  ? 382  TYR A CG  1 
ATOM   2909 C CD1 . TYR A 1 382 ? 21.804  14.218  -7.419  1.00 32.34  ? 382  TYR A CD1 1 
ATOM   2910 C CD2 . TYR A 1 382 ? 19.980  15.316  -6.321  1.00 31.56  ? 382  TYR A CD2 1 
ATOM   2911 C CE1 . TYR A 1 382 ? 21.886  13.313  -6.390  1.00 38.21  ? 382  TYR A CE1 1 
ATOM   2912 C CE2 . TYR A 1 382 ? 20.056  14.407  -5.270  1.00 39.21  ? 382  TYR A CE2 1 
ATOM   2913 C CZ  . TYR A 1 382 ? 21.008  13.394  -5.317  1.00 46.15  ? 382  TYR A CZ  1 
ATOM   2914 O OH  . TYR A 1 382 ? 21.091  12.462  -4.298  1.00 45.37  ? 382  TYR A OH  1 
ATOM   2915 N N   . THR A 1 383 ? 19.645  17.230  -11.613 1.00 41.99  ? 383  THR A N   1 
ATOM   2916 C CA  . THR A 1 383 ? 19.045  18.289  -12.411 1.00 39.12  ? 383  THR A CA  1 
ATOM   2917 C C   . THR A 1 383 ? 17.584  17.977  -12.678 1.00 43.81  ? 383  THR A C   1 
ATOM   2918 O O   . THR A 1 383 ? 17.250  16.841  -12.970 1.00 42.95  ? 383  THR A O   1 
ATOM   2919 C CB  . THR A 1 383 ? 19.714  18.396  -13.760 1.00 43.09  ? 383  THR A CB  1 
ATOM   2920 O OG1 . THR A 1 383 ? 20.906  19.158  -13.624 1.00 50.98  ? 383  THR A OG1 1 
ATOM   2921 C CG2 . THR A 1 383 ? 18.802  19.088  -14.743 1.00 38.66  ? 383  THR A CG2 1 
ATOM   2922 N N   . ASP A 1 384 ? 16.708  18.972  -12.577 1.00 46.04  ? 384  ASP A N   1 
ATOM   2923 C CA  . ASP A 1 384 ? 15.326  18.778  -13.024 1.00 48.59  ? 384  ASP A CA  1 
ATOM   2924 C C   . ASP A 1 384 ? 15.227  19.212  -14.508 1.00 50.42  ? 384  ASP A C   1 
ATOM   2925 O O   . ASP A 1 384 ? 15.337  20.394  -14.824 1.00 52.44  ? 384  ASP A O   1 
ATOM   2926 C CB  . ASP A 1 384 ? 14.375  19.546  -12.112 1.00 47.19  ? 384  ASP A CB  1 
ATOM   2927 C CG  . ASP A 1 384 ? 13.043  19.842  -12.760 1.00 57.33  ? 384  ASP A CG  1 
ATOM   2928 O OD1 . ASP A 1 384 ? 12.608  19.097  -13.671 1.00 52.19  ? 384  ASP A OD1 1 
ATOM   2929 O OD2 . ASP A 1 384 ? 12.429  20.845  -12.337 1.00 67.80  ? 384  ASP A OD2 1 
ATOM   2930 N N   . TRP A 1 385 ? 15.072  18.258  -15.423 1.00 48.27  ? 385  TRP A N   1 
ATOM   2931 C CA  . TRP A 1 385 ? 15.342  18.563  -16.828 1.00 50.20  ? 385  TRP A CA  1 
ATOM   2932 C C   . TRP A 1 385 ? 14.242  19.368  -17.488 1.00 51.45  ? 385  TRP A C   1 
ATOM   2933 O O   . TRP A 1 385 ? 14.396  19.834  -18.614 1.00 51.95  ? 385  TRP A O   1 
ATOM   2934 C CB  . TRP A 1 385 ? 15.744  17.313  -17.613 1.00 48.72  ? 385  TRP A CB  1 
ATOM   2935 C CG  . TRP A 1 385 ? 17.063  16.857  -17.169 1.00 43.62  ? 385  TRP A CG  1 
ATOM   2936 C CD1 . TRP A 1 385 ? 17.327  15.882  -16.270 1.00 41.88  ? 385  TRP A CD1 1 
ATOM   2937 C CD2 . TRP A 1 385 ? 18.316  17.419  -17.537 1.00 45.20  ? 385  TRP A CD2 1 
ATOM   2938 N NE1 . TRP A 1 385 ? 18.680  15.772  -16.071 1.00 40.28  ? 385  TRP A NE1 1 
ATOM   2939 C CE2 . TRP A 1 385 ? 19.316  16.703  -16.838 1.00 38.26  ? 385  TRP A CE2 1 
ATOM   2940 C CE3 . TRP A 1 385 ? 18.701  18.455  -18.401 1.00 45.38  ? 385  TRP A CE3 1 
ATOM   2941 C CZ2 . TRP A 1 385 ? 20.669  16.988  -16.965 1.00 40.03  ? 385  TRP A CZ2 1 
ATOM   2942 C CZ3 . TRP A 1 385 ? 20.058  18.744  -18.537 1.00 38.26  ? 385  TRP A CZ3 1 
ATOM   2943 C CH2 . TRP A 1 385 ? 21.025  18.007  -17.823 1.00 45.24  ? 385  TRP A CH2 1 
ATOM   2944 N N   . LEU A 1 386 ? 13.158  19.572  -16.747 1.00 51.33  ? 386  LEU A N   1 
ATOM   2945 C CA  . LEU A 1 386 ? 12.151  20.567  -17.101 1.00 57.20  ? 386  LEU A CA  1 
ATOM   2946 C C   . LEU A 1 386 ? 12.571  22.011  -16.813 1.00 61.79  ? 386  LEU A C   1 
ATOM   2947 O O   . LEU A 1 386 ? 12.216  22.925  -17.548 1.00 71.62  ? 386  LEU A O   1 
ATOM   2948 C CB  . LEU A 1 386 ? 10.870  20.292  -16.346 1.00 53.09  ? 386  LEU A CB  1 
ATOM   2949 C CG  . LEU A 1 386 ? 9.739   19.718  -17.172 1.00 54.13  ? 386  LEU A CG  1 
ATOM   2950 C CD1 . LEU A 1 386 ? 8.545   19.618  -16.257 1.00 51.97  ? 386  LEU A CD1 1 
ATOM   2951 C CD2 . LEU A 1 386 ? 9.459   20.616  -18.375 1.00 54.35  ? 386  LEU A CD2 1 
ATOM   2952 N N   . HIS A 1 387 ? 13.285  22.209  -15.712 1.00 59.09  ? 387  HIS A N   1 
ATOM   2953 C CA  . HIS A 1 387 ? 13.818  23.514  -15.347 1.00 59.24  ? 387  HIS A CA  1 
ATOM   2954 C C   . HIS A 1 387 ? 15.264  23.381  -14.875 1.00 52.28  ? 387  HIS A C   1 
ATOM   2955 O O   . HIS A 1 387 ? 15.560  23.592  -13.702 1.00 52.92  ? 387  HIS A O   1 
ATOM   2956 C CB  . HIS A 1 387 ? 13.002  24.142  -14.216 1.00 70.74  ? 387  HIS A CB  1 
ATOM   2957 C CG  . HIS A 1 387 ? 11.520  24.081  -14.412 1.00 75.53  ? 387  HIS A CG  1 
ATOM   2958 N ND1 . HIS A 1 387 ? 10.767  22.986  -14.043 1.00 66.68  ? 387  HIS A ND1 1 
ATOM   2959 C CD2 . HIS A 1 387 ? 10.645  24.993  -14.899 1.00 78.71  ? 387  HIS A CD2 1 
ATOM   2960 C CE1 . HIS A 1 387 ? 9.493   23.224  -14.309 1.00 66.75  ? 387  HIS A CE1 1 
ATOM   2961 N NE2 . HIS A 1 387 ? 9.394   24.434  -14.828 1.00 71.25  ? 387  HIS A NE2 1 
ATOM   2962 N N   . PRO A 1 388 ? 16.177  23.055  -15.793 1.00 54.33  ? 388  PRO A N   1 
ATOM   2963 C CA  . PRO A 1 388 ? 17.592  22.872  -15.447 1.00 54.00  ? 388  PRO A CA  1 
ATOM   2964 C C   . PRO A 1 388 ? 18.292  24.145  -14.904 1.00 47.05  ? 388  PRO A C   1 
ATOM   2965 O O   . PRO A 1 388 ? 19.382  24.028  -14.342 1.00 50.33  ? 388  PRO A O   1 
ATOM   2966 C CB  . PRO A 1 388 ? 18.237  22.461  -16.787 1.00 52.43  ? 388  PRO A CB  1 
ATOM   2967 C CG  . PRO A 1 388 ? 17.115  22.315  -17.776 1.00 53.35  ? 388  PRO A CG  1 
ATOM   2968 C CD  . PRO A 1 388 ? 15.950  23.065  -17.248 1.00 55.50  ? 388  PRO A CD  1 
ATOM   2969 N N   . GLU A 1 389 ? 17.691  25.322  -15.088 1.00 41.50  ? 389  GLU A N   1 
ATOM   2970 C CA  . GLU A 1 389 ? 18.342  26.596  -14.762 1.00 49.23  ? 389  GLU A CA  1 
ATOM   2971 C C   . GLU A 1 389 ? 17.726  27.270  -13.547 1.00 45.20  ? 389  GLU A C   1 
ATOM   2972 O O   . GLU A 1 389 ? 18.153  28.354  -13.131 1.00 42.39  ? 389  GLU A O   1 
ATOM   2973 C CB  . GLU A 1 389 ? 18.238  27.577  -15.935 1.00 58.17  ? 389  GLU A CB  1 
ATOM   2974 C CG  . GLU A 1 389 ? 18.958  27.155  -17.210 1.00 74.13  ? 389  GLU A CG  1 
ATOM   2975 C CD  . GLU A 1 389 ? 20.474  27.229  -17.096 1.00 83.25  ? 389  GLU A CD  1 
ATOM   2976 O OE1 . GLU A 1 389 ? 21.145  26.760  -18.036 1.00 78.06  ? 389  GLU A OE1 1 
ATOM   2977 O OE2 . GLU A 1 389 ? 20.995  27.749  -16.076 1.00 91.37  ? 389  GLU A OE2 1 
ATOM   2978 N N   . ASP A 1 390 ? 16.701  26.632  -13.002 1.00 33.57  ? 390  ASP A N   1 
ATOM   2979 C CA  . ASP A 1 390 ? 15.914  27.224  -11.948 1.00 35.05  ? 390  ASP A CA  1 
ATOM   2980 C C   . ASP A 1 390 ? 16.663  27.258  -10.613 1.00 40.85  ? 390  ASP A C   1 
ATOM   2981 O O   . ASP A 1 390 ? 16.898  26.217  -10.005 1.00 44.05  ? 390  ASP A O   1 
ATOM   2982 C CB  . ASP A 1 390 ? 14.626  26.430  -11.790 1.00 35.39  ? 390  ASP A CB  1 
ATOM   2983 C CG  . ASP A 1 390 ? 13.754  26.996  -10.733 1.00 44.38  ? 390  ASP A CG  1 
ATOM   2984 O OD1 . ASP A 1 390 ? 13.176  28.072  -10.952 1.00 49.46  ? 390  ASP A OD1 1 
ATOM   2985 O OD2 . ASP A 1 390 ? 13.664  26.378  -9.667  1.00 56.96  ? 390  ASP A OD2 1 
ATOM   2986 N N   . PRO A 1 391 ? 17.024  28.461  -10.150 1.00 41.54  ? 391  PRO A N   1 
ATOM   2987 C CA  . PRO A 1 391 ? 17.792  28.723  -8.918  1.00 40.28  ? 391  PRO A CA  1 
ATOM   2988 C C   . PRO A 1 391 ? 17.222  28.041  -7.699  1.00 42.61  ? 391  PRO A C   1 
ATOM   2989 O O   . PRO A 1 391 ? 17.981  27.594  -6.844  1.00 42.37  ? 391  PRO A O   1 
ATOM   2990 C CB  . PRO A 1 391 ? 17.637  30.225  -8.728  1.00 38.16  ? 391  PRO A CB  1 
ATOM   2991 C CG  . PRO A 1 391 ? 17.421  30.744  -10.102 1.00 40.83  ? 391  PRO A CG  1 
ATOM   2992 C CD  . PRO A 1 391 ? 16.630  29.702  -10.819 1.00 41.06  ? 391  PRO A CD  1 
ATOM   2993 N N   . THR A 1 392 ? 15.899  27.977  -7.605  1.00 46.36  ? 392  THR A N   1 
ATOM   2994 C CA  . THR A 1 392 ? 15.291  27.413  -6.424  1.00 40.12  ? 392  THR A CA  1 
ATOM   2995 C C   . THR A 1 392 ? 15.491  25.918  -6.499  1.00 40.67  ? 392  THR A C   1 
ATOM   2996 O O   . THR A 1 392 ? 15.989  25.300  -5.541  1.00 34.40  ? 392  THR A O   1 
ATOM   2997 C CB  . THR A 1 392 ? 13.811  27.828  -6.247  1.00 41.63  ? 392  THR A CB  1 
ATOM   2998 O OG1 . THR A 1 392 ? 13.763  29.181  -5.780  1.00 45.93  ? 392  THR A OG1 1 
ATOM   2999 C CG2 . THR A 1 392 ? 13.133  26.955  -5.205  1.00 31.17  ? 392  THR A CG2 1 
ATOM   3000 N N   . HIS A 1 393 ? 15.153  25.328  -7.644  1.00 39.31  ? 393  HIS A N   1 
ATOM   3001 C CA  . HIS A 1 393 ? 15.372  23.900  -7.749  1.00 41.07  ? 393  HIS A CA  1 
ATOM   3002 C C   . HIS A 1 393 ? 16.854  23.497  -7.504  1.00 42.32  ? 393  HIS A C   1 
ATOM   3003 O O   . HIS A 1 393 ? 17.127  22.518  -6.811  1.00 44.41  ? 393  HIS A O   1 
ATOM   3004 C CB  . HIS A 1 393 ? 14.885  23.265  -9.047  1.00 38.47  ? 393  HIS A CB  1 
ATOM   3005 C CG  . HIS A 1 393 ? 15.415  21.875  -9.192  1.00 68.06  ? 393  HIS A CG  1 
ATOM   3006 N ND1 . HIS A 1 393 ? 14.946  20.824  -8.432  1.00 71.06  ? 393  HIS A ND1 1 
ATOM   3007 C CD2 . HIS A 1 393 ? 16.472  21.391  -9.892  1.00 80.39  ? 393  HIS A CD2 1 
ATOM   3008 C CE1 . HIS A 1 393 ? 15.642  19.736  -8.709  1.00 79.06  ? 393  HIS A CE1 1 
ATOM   3009 N NE2 . HIS A 1 393 ? 16.578  20.056  -9.589  1.00 82.89  ? 393  HIS A NE2 1 
ATOM   3010 N N   . LEU A 1 394 ? 17.790  24.250  -8.076  1.00 32.61  ? 394  LEU A N   1 
ATOM   3011 C CA  . LEU A 1 394 ? 19.214  23.975  -7.921  1.00 37.82  ? 394  LEU A CA  1 
ATOM   3012 C C   . LEU A 1 394 ? 19.670  24.054  -6.461  1.00 40.60  ? 394  LEU A C   1 
ATOM   3013 O O   . LEU A 1 394 ? 20.388  23.168  -5.975  1.00 32.89  ? 394  LEU A O   1 
ATOM   3014 C CB  . LEU A 1 394 ? 20.053  24.909  -8.814  1.00 33.09  ? 394  LEU A CB  1 
ATOM   3015 C CG  . LEU A 1 394 ? 19.936  24.617  -10.321 1.00 36.05  ? 394  LEU A CG  1 
ATOM   3016 C CD1 . LEU A 1 394 ? 20.449  25.771  -11.198 1.00 32.48  ? 394  LEU A CD1 1 
ATOM   3017 C CD2 . LEU A 1 394 ? 20.640  23.300  -10.668 1.00 26.07  ? 394  LEU A CD2 1 
ATOM   3018 N N   . ARG A 1 395 ? 19.258  25.120  -5.777  1.00 36.62  ? 395  ARG A N   1 
ATOM   3019 C CA  . ARG A 1 395 ? 19.577  25.305  -4.372  1.00 33.64  ? 395  ARG A CA  1 
ATOM   3020 C C   . ARG A 1 395 ? 19.262  24.020  -3.621  1.00 36.79  ? 395  ARG A C   1 
ATOM   3021 O O   . ARG A 1 395 ? 20.099  23.489  -2.913  1.00 38.09  ? 395  ARG A O   1 
ATOM   3022 C CB  . ARG A 1 395 ? 18.740  26.456  -3.802  1.00 36.05  ? 395  ARG A CB  1 
ATOM   3023 C CG  . ARG A 1 395 ? 19.023  26.817  -2.345  1.00 30.32  ? 395  ARG A CG  1 
ATOM   3024 C CD  . ARG A 1 395 ? 17.761  26.713  -1.539  1.00 33.62  ? 395  ARG A CD  1 
ATOM   3025 N NE  . ARG A 1 395 ? 17.015  27.947  -1.443  1.00 46.82  ? 395  ARG A NE  1 
ATOM   3026 C CZ  . ARG A 1 395 ? 15.688  28.009  -1.421  1.00 48.70  ? 395  ARG A CZ  1 
ATOM   3027 N NH1 . ARG A 1 395 ? 14.971  26.897  -1.530  1.00 34.10  ? 395  ARG A NH1 1 
ATOM   3028 N NH2 . ARG A 1 395 ? 15.079  29.192  -1.323  1.00 57.86  ? 395  ARG A NH2 1 
ATOM   3029 N N   . ASP A 1 396 ? 18.043  23.520  -3.797  1.00 44.79  ? 396  ASP A N   1 
ATOM   3030 C CA  . ASP A 1 396 ? 17.546  22.385  -3.030  1.00 40.71  ? 396  ASP A CA  1 
ATOM   3031 C C   . ASP A 1 396 ? 18.166  21.086  -3.478  1.00 41.53  ? 396  ASP A C   1 
ATOM   3032 O O   . ASP A 1 396 ? 18.302  20.165  -2.687  1.00 46.50  ? 396  ASP A O   1 
ATOM   3033 C CB  . ASP A 1 396 ? 16.014  22.304  -3.116  1.00 44.41  ? 396  ASP A CB  1 
ATOM   3034 C CG  . ASP A 1 396 ? 15.321  23.550  -2.538  1.00 54.87  ? 396  ASP A CG  1 
ATOM   3035 O OD1 . ASP A 1 396 ? 16.003  24.362  -1.863  1.00 54.60  ? 396  ASP A OD1 1 
ATOM   3036 O OD2 . ASP A 1 396 ? 14.097  23.723  -2.758  1.00 59.25  ? 396  ASP A OD2 1 
ATOM   3037 N N   . ALA A 1 397 ? 18.538  21.012  -4.750  1.00 45.30  ? 397  ALA A N   1 
ATOM   3038 C CA  . ALA A 1 397 ? 19.191  19.823  -5.273  1.00 45.70  ? 397  ALA A CA  1 
ATOM   3039 C C   . ALA A 1 397 ? 20.559  19.692  -4.656  1.00 46.86  ? 397  ALA A C   1 
ATOM   3040 O O   . ALA A 1 397 ? 20.936  18.610  -4.228  1.00 47.33  ? 397  ALA A O   1 
ATOM   3041 C CB  . ALA A 1 397 ? 19.308  19.882  -6.763  1.00 42.98  ? 397  ALA A CB  1 
ATOM   3042 N N   . MET A 1 398 ? 21.301  20.798  -4.623  1.00 45.80  ? 398  MET A N   1 
ATOM   3043 C CA  . MET A 1 398 ? 22.609  20.842  -3.987  1.00 36.10  ? 398  MET A CA  1 
ATOM   3044 C C   . MET A 1 398 ? 22.524  20.332  -2.541  1.00 45.36  ? 398  MET A C   1 
ATOM   3045 O O   . MET A 1 398 ? 23.379  19.572  -2.073  1.00 40.47  ? 398  MET A O   1 
ATOM   3046 C CB  . MET A 1 398 ? 23.110  22.256  -3.972  1.00 33.64  ? 398  MET A CB  1 
ATOM   3047 C CG  . MET A 1 398 ? 24.538  22.418  -3.458  1.00 40.80  ? 398  MET A CG  1 
ATOM   3048 S SD  . MET A 1 398 ? 25.751  21.883  -4.674  1.00 40.02  ? 398  MET A SD  1 
ATOM   3049 C CE  . MET A 1 398 ? 26.236  20.353  -3.918  1.00 20.32  ? 398  MET A CE  1 
ATOM   3050 N N   . SER A 1 399 ? 21.473  20.742  -1.842  1.00 44.61  ? 399  SER A N   1 
ATOM   3051 C CA  . SER A 1 399 ? 21.213  20.267  -0.486  1.00 43.40  ? 399  SER A CA  1 
ATOM   3052 C C   . SER A 1 399 ? 21.057  18.746  -0.447  1.00 42.26  ? 399  SER A C   1 
ATOM   3053 O O   . SER A 1 399 ? 21.699  18.056  0.343   1.00 41.17  ? 399  SER A O   1 
ATOM   3054 C CB  . SER A 1 399 ? 19.936  20.910  0.032   1.00 36.19  ? 399  SER A CB  1 
ATOM   3055 O OG  . SER A 1 399 ? 19.735  20.640  1.398   1.00 34.65  ? 399  SER A OG  1 
ATOM   3056 N N   . ALA A 1 400 ? 20.182  18.245  -1.307  1.00 37.44  ? 400  ALA A N   1 
ATOM   3057 C CA  . ALA A 1 400 ? 19.936  16.821  -1.440  1.00 36.79  ? 400  ALA A CA  1 
ATOM   3058 C C   . ALA A 1 400 ? 21.213  16.033  -1.809  1.00 36.37  ? 400  ALA A C   1 
ATOM   3059 O O   . ALA A 1 400 ? 21.484  14.981  -1.230  1.00 35.76  ? 400  ALA A O   1 
ATOM   3060 C CB  . ALA A 1 400 ? 18.815  16.575  -2.475  1.00 25.00  ? 400  ALA A CB  1 
ATOM   3061 N N   . VAL A 1 401 ? 21.989  16.529  -2.771  1.00 29.87  ? 401  VAL A N   1 
ATOM   3062 C CA  . VAL A 1 401 ? 23.249  15.868  -3.138  1.00 39.40  ? 401  VAL A CA  1 
ATOM   3063 C C   . VAL A 1 401 ? 24.148  15.586  -1.909  1.00 42.69  ? 401  VAL A C   1 
ATOM   3064 O O   . VAL A 1 401 ? 24.608  14.453  -1.698  1.00 35.62  ? 401  VAL A O   1 
ATOM   3065 C CB  . VAL A 1 401 ? 24.051  16.694  -4.151  1.00 35.95  ? 401  VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 401 ? 25.466  16.155  -4.239  1.00 26.94  ? 401  VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 401 ? 23.371  16.671  -5.510  1.00 29.21  ? 401  VAL A CG2 1 
ATOM   3068 N N   . VAL A 1 402 ? 24.365  16.629  -1.106  1.00 31.17  ? 402  VAL A N   1 
ATOM   3069 C CA  . VAL A 1 402 ? 25.118  16.541  0.129   1.00 30.52  ? 402  VAL A CA  1 
ATOM   3070 C C   . VAL A 1 402 ? 24.475  15.683  1.218   1.00 42.04  ? 402  VAL A C   1 
ATOM   3071 O O   . VAL A 1 402 ? 25.159  14.861  1.849   1.00 44.63  ? 402  VAL A O   1 
ATOM   3072 C CB  . VAL A 1 402 ? 25.414  17.933  0.697   1.00 24.18  ? 402  VAL A CB  1 
ATOM   3073 C CG1 . VAL A 1 402 ? 26.031  17.813  2.062   1.00 19.72  ? 402  VAL A CG1 1 
ATOM   3074 C CG2 . VAL A 1 402 ? 26.350  18.683  -0.237  1.00 27.50  ? 402  VAL A CG2 1 
ATOM   3075 N N   . GLY A 1 403 ? 23.179  15.896  1.449   1.00 43.85  ? 403  GLY A N   1 
ATOM   3076 C CA  . GLY A 1 403 ? 22.396  15.105  2.391   1.00 33.84  ? 403  GLY A CA  1 
ATOM   3077 C C   . GLY A 1 403 ? 22.316  13.626  2.040   1.00 37.99  ? 403  GLY A C   1 
ATOM   3078 O O   . GLY A 1 403 ? 22.499  12.787  2.911   1.00 41.76  ? 403  GLY A O   1 
ATOM   3079 N N   . ASP A 1 404 ? 22.068  13.306  0.768   1.00 35.66  ? 404  ASP A N   1 
ATOM   3080 C CA  . ASP A 1 404 ? 21.939  11.915  0.323   1.00 32.04  ? 404  ASP A CA  1 
ATOM   3081 C C   . ASP A 1 404 ? 23.286  11.187  0.351   1.00 39.67  ? 404  ASP A C   1 
ATOM   3082 O O   . ASP A 1 404 ? 23.378  10.030  0.757   1.00 44.21  ? 404  ASP A O   1 
ATOM   3083 C CB  . ASP A 1 404 ? 21.341  11.838  -1.088  1.00 26.18  ? 404  ASP A CB  1 
ATOM   3084 C CG  . ASP A 1 404 ? 19.900  12.382  -1.161  1.00 42.46  ? 404  ASP A CG  1 
ATOM   3085 O OD1 . ASP A 1 404 ? 19.306  12.604  -0.085  1.00 44.08  ? 404  ASP A OD1 1 
ATOM   3086 O OD2 . ASP A 1 404 ? 19.361  12.589  -2.290  1.00 41.42  ? 404  ASP A OD2 1 
ATOM   3087 N N   . HIS A 1 405 ? 24.334  11.872  -0.077  1.00 35.13  ? 405  HIS A N   1 
ATOM   3088 C CA  . HIS A 1 405 ? 25.634  11.240  -0.219  1.00 38.44  ? 405  HIS A CA  1 
ATOM   3089 C C   . HIS A 1 405 ? 26.236  10.887  1.147   1.00 40.83  ? 405  HIS A C   1 
ATOM   3090 O O   . HIS A 1 405 ? 26.931  9.872   1.300   1.00 35.11  ? 405  HIS A O   1 
ATOM   3091 C CB  . HIS A 1 405 ? 26.559  12.160  -1.006  1.00 38.11  ? 405  HIS A CB  1 
ATOM   3092 C CG  . HIS A 1 405 ? 27.973  11.673  -1.111  1.00 47.41  ? 405  HIS A CG  1 
ATOM   3093 N ND1 . HIS A 1 405 ? 28.294  10.347  -1.306  1.00 46.46  ? 405  HIS A ND1 1 
ATOM   3094 C CD2 . HIS A 1 405 ? 29.151  12.347  -1.085  1.00 44.99  ? 405  HIS A CD2 1 
ATOM   3095 C CE1 . HIS A 1 405 ? 29.610  10.223  -1.381  1.00 44.81  ? 405  HIS A CE1 1 
ATOM   3096 N NE2 . HIS A 1 405 ? 30.151  11.423  -1.256  1.00 45.49  ? 405  HIS A NE2 1 
ATOM   3097 N N   . ASN A 1 406 ? 25.913  11.702  2.147   1.00 35.70  ? 406  ASN A N   1 
ATOM   3098 C CA  . ASN A 1 406 ? 26.569  11.610  3.450   1.00 39.53  ? 406  ASN A CA  1 
ATOM   3099 C C   . ASN A 1 406 ? 25.730  10.963  4.561   1.00 43.03  ? 406  ASN A C   1 
ATOM   3100 O O   . ASN A 1 406 ? 26.251  10.240  5.407   1.00 39.96  ? 406  ASN A O   1 
ATOM   3101 C CB  . ASN A 1 406 ? 27.089  12.996  3.880   1.00 43.03  ? 406  ASN A CB  1 
ATOM   3102 C CG  . ASN A 1 406 ? 28.232  13.494  2.997   1.00 45.13  ? 406  ASN A CG  1 
ATOM   3103 O OD1 . ASN A 1 406 ? 29.274  12.840  2.863   1.00 34.09  ? 406  ASN A OD1 1 
ATOM   3104 N ND2 . ASN A 1 406 ? 28.023  14.642  2.369   1.00 49.60  ? 406  ASN A ND2 1 
ATOM   3105 N N   . VAL A 1 407 ? 24.429  11.206  4.565   1.00 37.83  ? 407  VAL A N   1 
ATOM   3106 C CA  . VAL A 1 407 ? 23.621  10.611  5.608   1.00 30.67  ? 407  VAL A CA  1 
ATOM   3107 C C   . VAL A 1 407 ? 22.577  9.628   5.113   1.00 35.43  ? 407  VAL A C   1 
ATOM   3108 O O   . VAL A 1 407 ? 22.614  8.466   5.480   1.00 47.91  ? 407  VAL A O   1 
ATOM   3109 C CB  . VAL A 1 407 ? 22.958  11.668  6.490   1.00 29.29  ? 407  VAL A CB  1 
ATOM   3110 C CG1 . VAL A 1 407 ? 22.244  10.994  7.680   1.00 24.51  ? 407  VAL A CG1 1 
ATOM   3111 C CG2 . VAL A 1 407 ? 23.997  12.663  6.971   1.00 22.91  ? 407  VAL A CG2 1 
ATOM   3112 N N   . VAL A 1 408 ? 21.651  10.088  4.282   1.00 36.73  ? 408  VAL A N   1 
ATOM   3113 C CA  . VAL A 1 408 ? 20.481  9.275   3.954   1.00 38.86  ? 408  VAL A CA  1 
ATOM   3114 C C   . VAL A 1 408 ? 20.815  7.943   3.279   1.00 37.88  ? 408  VAL A C   1 
ATOM   3115 O O   . VAL A 1 408 ? 20.314  6.900   3.684   1.00 38.64  ? 408  VAL A O   1 
ATOM   3116 C CB  . VAL A 1 408 ? 19.447  10.032  3.115   1.00 33.26  ? 408  VAL A CB  1 
ATOM   3117 C CG1 . VAL A 1 408 ? 18.188  9.217   3.066   1.00 22.80  ? 408  VAL A CG1 1 
ATOM   3118 C CG2 . VAL A 1 408 ? 19.160  11.385  3.717   1.00 32.88  ? 408  VAL A CG2 1 
ATOM   3119 N N   . CYS A 1 409 ? 21.675  7.958   2.273   1.00 30.03  ? 409  CYS A N   1 
ATOM   3120 C CA  . CYS A 1 409 ? 22.010  6.699   1.619   1.00 40.04  ? 409  CYS A CA  1 
ATOM   3121 C C   . CYS A 1 409 ? 22.958  5.765   2.409   1.00 44.21  ? 409  CYS A C   1 
ATOM   3122 O O   . CYS A 1 409 ? 22.761  4.553   2.420   1.00 43.79  ? 409  CYS A O   1 
ATOM   3123 C CB  . CYS A 1 409 ? 22.440  6.941   0.167   1.00 36.20  ? 409  CYS A CB  1 
ATOM   3124 S SG  . CYS A 1 409 ? 21.153  7.845   -0.738  1.00 41.36  ? 409  CYS A SG  1 
ATOM   3125 N N   . PRO A 1 410 ? 23.968  6.319   3.093   1.00 44.04  ? 410  PRO A N   1 
ATOM   3126 C CA  . PRO A 1 410 ? 24.662  5.425   4.029   1.00 47.42  ? 410  PRO A CA  1 
ATOM   3127 C C   . PRO A 1 410 ? 23.729  4.823   5.093   1.00 43.70  ? 410  PRO A C   1 
ATOM   3128 O O   . PRO A 1 410 ? 23.896  3.659   5.460   1.00 32.93  ? 410  PRO A O   1 
ATOM   3129 C CB  . PRO A 1 410 ? 25.702  6.335   4.675   1.00 39.00  ? 410  PRO A CB  1 
ATOM   3130 C CG  . PRO A 1 410 ? 25.975  7.361   3.625   1.00 42.88  ? 410  PRO A CG  1 
ATOM   3131 C CD  . PRO A 1 410 ? 24.692  7.586   2.888   1.00 40.48  ? 410  PRO A CD  1 
ATOM   3132 N N   . VAL A 1 411 ? 22.761  5.598   5.571   1.00 38.20  ? 411  VAL A N   1 
ATOM   3133 C CA  . VAL A 1 411 ? 21.819  5.108   6.574   1.00 34.83  ? 411  VAL A CA  1 
ATOM   3134 C C   . VAL A 1 411 ? 20.880  4.047   5.968   1.00 40.81  ? 411  VAL A C   1 
ATOM   3135 O O   . VAL A 1 411 ? 20.606  2.997   6.581   1.00 34.43  ? 411  VAL A O   1 
ATOM   3136 C CB  . VAL A 1 411 ? 21.040  6.278   7.250   1.00 34.07  ? 411  VAL A CB  1 
ATOM   3137 C CG1 . VAL A 1 411 ? 19.871  5.772   8.037   1.00 27.11  ? 411  VAL A CG1 1 
ATOM   3138 C CG2 . VAL A 1 411 ? 21.958  7.087   8.182   1.00 35.77  ? 411  VAL A CG2 1 
ATOM   3139 N N   . ALA A 1 412 ? 20.412  4.303   4.751   1.00 39.49  ? 412  ALA A N   1 
ATOM   3140 C CA  . ALA A 1 412 ? 19.580  3.332   4.049   1.00 37.80  ? 412  ALA A CA  1 
ATOM   3141 C C   . ALA A 1 412 ? 20.367  2.046   3.886   1.00 42.53  ? 412  ALA A C   1 
ATOM   3142 O O   . ALA A 1 412 ? 19.878  0.941   4.154   1.00 43.26  ? 412  ALA A O   1 
ATOM   3143 C CB  . ALA A 1 412 ? 19.203  3.856   2.704   1.00 37.73  ? 412  ALA A CB  1 
ATOM   3144 N N   . GLN A 1 413 ? 21.595  2.219   3.424   1.00 34.03  ? 413  GLN A N   1 
ATOM   3145 C CA  . GLN A 1 413 ? 22.507  1.125   3.186   1.00 37.16  ? 413  GLN A CA  1 
ATOM   3146 C C   . GLN A 1 413 ? 22.629  0.273   4.441   1.00 47.12  ? 413  GLN A C   1 
ATOM   3147 O O   . GLN A 1 413 ? 22.507  -0.958  4.407   1.00 41.31  ? 413  GLN A O   1 
ATOM   3148 C CB  . GLN A 1 413 ? 23.857  1.725   2.826   1.00 43.57  ? 413  GLN A CB  1 
ATOM   3149 C CG  . GLN A 1 413 ? 25.018  0.795   2.951   1.00 55.76  ? 413  GLN A CG  1 
ATOM   3150 C CD  . GLN A 1 413 ? 25.464  0.304   1.636   1.00 66.71  ? 413  GLN A CD  1 
ATOM   3151 O OE1 . GLN A 1 413 ? 24.797  -0.528  1.019   1.00 75.49  ? 413  GLN A OE1 1 
ATOM   3152 N NE2 . GLN A 1 413 ? 26.601  0.815   1.171   1.00 69.33  ? 413  GLN A NE2 1 
ATOM   3153 N N   . LEU A 1 414 ? 22.878  0.946   5.558   1.00 49.12  ? 414  LEU A N   1 
ATOM   3154 C CA  . LEU A 1 414 ? 23.085  0.268   6.824   1.00 44.37  ? 414  LEU A CA  1 
ATOM   3155 C C   . LEU A 1 414 ? 21.803  -0.437  7.322   1.00 48.72  ? 414  LEU A C   1 
ATOM   3156 O O   . LEU A 1 414 ? 21.878  -1.568  7.805   1.00 45.95  ? 414  LEU A O   1 
ATOM   3157 C CB  . LEU A 1 414 ? 23.623  1.248   7.863   1.00 31.19  ? 414  LEU A CB  1 
ATOM   3158 C CG  . LEU A 1 414 ? 23.774  0.771   9.307   1.00 39.64  ? 414  LEU A CG  1 
ATOM   3159 C CD1 . LEU A 1 414 ? 24.989  -0.142  9.461   1.00 48.31  ? 414  LEU A CD1 1 
ATOM   3160 C CD2 . LEU A 1 414 ? 23.945  1.969   10.174  1.00 47.52  ? 414  LEU A CD2 1 
ATOM   3161 N N   . ALA A 1 415 ? 20.642  0.221   7.216   1.00 37.80  ? 415  ALA A N   1 
ATOM   3162 C CA  . ALA A 1 415 ? 19.378  -0.406  7.622   1.00 35.51  ? 415  ALA A CA  1 
ATOM   3163 C C   . ALA A 1 415 ? 19.168  -1.709  6.835   1.00 40.48  ? 415  ALA A C   1 
ATOM   3164 O O   . ALA A 1 415 ? 18.951  -2.783  7.405   1.00 30.57  ? 415  ALA A O   1 
ATOM   3165 C CB  . ALA A 1 415 ? 18.206  0.530   7.399   1.00 31.40  ? 415  ALA A CB  1 
ATOM   3166 N N   . GLY A 1 416 ? 19.240  -1.605  5.517   1.00 40.79  ? 416  GLY A N   1 
ATOM   3167 C CA  . GLY A 1 416 ? 19.230  -2.780  4.674   1.00 43.59  ? 416  GLY A CA  1 
ATOM   3168 C C   . GLY A 1 416 ? 20.107  -3.923  5.162   1.00 47.28  ? 416  GLY A C   1 
ATOM   3169 O O   . GLY A 1 416 ? 19.610  -5.006  5.452   1.00 58.54  ? 416  GLY A O   1 
ATOM   3170 N N   . ARG A 1 417 ? 21.411  -3.691  5.256   1.00 47.02  ? 417  ARG A N   1 
ATOM   3171 C CA  . ARG A 1 417 ? 22.346  -4.762  5.563   1.00 40.08  ? 417  ARG A CA  1 
ATOM   3172 C C   . ARG A 1 417 ? 22.078  -5.340  6.943   1.00 42.57  ? 417  ARG A C   1 
ATOM   3173 O O   . ARG A 1 417 ? 22.129  -6.540  7.128   1.00 51.12  ? 417  ARG A O   1 
ATOM   3174 C CB  . ARG A 1 417 ? 23.794  -4.269  5.462   1.00 41.39  ? 417  ARG A CB  1 
ATOM   3175 C CG  . ARG A 1 417 ? 24.194  -3.686  4.097   1.00 54.09  ? 417  ARG A CG  1 
ATOM   3176 C CD  . ARG A 1 417 ? 24.208  -4.721  2.969   1.00 72.15  ? 417  ARG A CD  1 
ATOM   3177 N NE  . ARG A 1 417 ? 24.487  -6.074  3.460   1.00 92.78  ? 417  ARG A NE  1 
ATOM   3178 C CZ  . ARG A 1 417 ? 24.872  -7.097  2.697   1.00 97.73  ? 417  ARG A CZ  1 
ATOM   3179 N NH1 . ARG A 1 417 ? 25.047  -6.929  1.389   1.00 99.65  ? 417  ARG A NH1 1 
ATOM   3180 N NH2 . ARG A 1 417 ? 25.094  -8.286  3.250   1.00 93.27  ? 417  ARG A NH2 1 
ATOM   3181 N N   . LEU A 1 418 ? 21.793  -4.489  7.917   1.00 43.17  ? 418  LEU A N   1 
ATOM   3182 C CA  . LEU A 1 418 ? 21.525  -4.969  9.265   1.00 49.23  ? 418  LEU A CA  1 
ATOM   3183 C C   . LEU A 1 418 ? 20.263  -5.842  9.295   1.00 52.54  ? 418  LEU A C   1 
ATOM   3184 O O   . LEU A 1 418 ? 20.259  -6.922  9.871   1.00 50.19  ? 418  LEU A O   1 
ATOM   3185 C CB  . LEU A 1 418 ? 21.403  -3.802  10.253  1.00 42.26  ? 418  LEU A CB  1 
ATOM   3186 C CG  . LEU A 1 418 ? 22.731  -3.125  10.603  1.00 45.58  ? 418  LEU A CG  1 
ATOM   3187 C CD1 . LEU A 1 418 ? 22.555  -1.902  11.503  1.00 28.37  ? 418  LEU A CD1 1 
ATOM   3188 C CD2 . LEU A 1 418 ? 23.663  -4.126  11.256  1.00 51.13  ? 418  LEU A CD2 1 
ATOM   3189 N N   . ALA A 1 419 ? 19.194  -5.371  8.674   1.00 45.85  ? 419  ALA A N   1 
ATOM   3190 C CA  . ALA A 1 419 ? 17.953  -6.118  8.668   1.00 49.51  ? 419  ALA A CA  1 
ATOM   3191 C C   . ALA A 1 419 ? 18.179  -7.519  8.082   1.00 58.62  ? 419  ALA A C   1 
ATOM   3192 O O   . ALA A 1 419 ? 17.701  -8.537  8.610   1.00 56.28  ? 419  ALA A O   1 
ATOM   3193 C CB  . ALA A 1 419 ? 16.883  -5.360  7.868   1.00 39.56  ? 419  ALA A CB  1 
ATOM   3194 N N   . ALA A 1 420 ? 18.923  -7.554  6.988   1.00 53.13  ? 420  ALA A N   1 
ATOM   3195 C CA  . ALA A 1 420 ? 19.140  -8.780  6.255   1.00 51.69  ? 420  ALA A CA  1 
ATOM   3196 C C   . ALA A 1 420 ? 20.002  -9.759  7.055   1.00 62.15  ? 420  ALA A C   1 
ATOM   3197 O O   . ALA A 1 420 ? 19.948  -10.974 6.835   1.00 66.34  ? 420  ALA A O   1 
ATOM   3198 C CB  . ALA A 1 420 ? 19.782  -8.466  4.912   1.00 37.21  ? 420  ALA A CB  1 
ATOM   3199 N N   . GLN A 1 421 ? 20.792  -9.221  7.980   1.00 58.62  ? 421  GLN A N   1 
ATOM   3200 C CA  . GLN A 1 421 ? 21.710  -10.024 8.775   1.00 56.23  ? 421  GLN A CA  1 
ATOM   3201 C C   . GLN A 1 421 ? 21.167  -10.305 10.169  1.00 59.43  ? 421  GLN A C   1 
ATOM   3202 O O   . GLN A 1 421 ? 21.939  -10.537 11.104  1.00 65.20  ? 421  GLN A O   1 
ATOM   3203 C CB  . GLN A 1 421 ? 23.082  -9.353  8.881   1.00 58.93  ? 421  GLN A CB  1 
ATOM   3204 C CG  . GLN A 1 421 ? 24.136  -9.907  7.935   1.00 67.51  ? 421  GLN A CG  1 
ATOM   3205 C CD  . GLN A 1 421 ? 24.168  -9.184  6.614   1.00 81.36  ? 421  GLN A CD  1 
ATOM   3206 O OE1 . GLN A 1 421 ? 23.132  -8.788  6.088   1.00 88.38  ? 421  GLN A OE1 1 
ATOM   3207 N NE2 . GLN A 1 421 ? 25.361  -9.005  6.065   1.00 85.67  ? 421  GLN A NE2 1 
ATOM   3208 N N   . GLY A 1 422 ? 19.843  -10.260 10.310  1.00 56.82  ? 422  GLY A N   1 
ATOM   3209 C CA  . GLY A 1 422 ? 19.187  -10.662 11.543  1.00 57.89  ? 422  GLY A CA  1 
ATOM   3210 C C   . GLY A 1 422 ? 18.979  -9.651  12.657  1.00 59.95  ? 422  GLY A C   1 
ATOM   3211 O O   . GLY A 1 422 ? 18.428  -9.986  13.707  1.00 64.67  ? 422  GLY A O   1 
ATOM   3212 N N   . ALA A 1 423 ? 19.430  -8.421  12.455  1.00 62.48  ? 423  ALA A N   1 
ATOM   3213 C CA  . ALA A 1 423 ? 19.202  -7.368  13.432  1.00 53.26  ? 423  ALA A CA  1 
ATOM   3214 C C   . ALA A 1 423 ? 17.731  -6.973  13.378  1.00 50.72  ? 423  ALA A C   1 
ATOM   3215 O O   . ALA A 1 423 ? 17.098  -7.117  12.334  1.00 56.43  ? 423  ALA A O   1 
ATOM   3216 C CB  . ALA A 1 423 ? 20.065  -6.200  13.113  1.00 43.63  ? 423  ALA A CB  1 
ATOM   3217 N N   . ARG A 1 424 ? 17.178  -6.517  14.499  1.00 42.70  ? 424  ARG A N   1 
ATOM   3218 C CA  . ARG A 1 424 ? 15.861  -5.875  14.475  1.00 48.24  ? 424  ARG A CA  1 
ATOM   3219 C C   . ARG A 1 424 ? 16.058  -4.367  14.336  1.00 51.50  ? 424  ARG A C   1 
ATOM   3220 O O   . ARG A 1 424 ? 16.636  -3.748  15.218  1.00 56.08  ? 424  ARG A O   1 
ATOM   3221 C CB  . ARG A 1 424 ? 15.053  -6.195  15.742  1.00 53.92  ? 424  ARG A CB  1 
ATOM   3222 C CG  . ARG A 1 424 ? 13.568  -5.766  15.668  1.00 66.74  ? 424  ARG A CG  1 
ATOM   3223 C CD  . ARG A 1 424 ? 12.601  -6.777  16.319  1.00 87.51  ? 424  ARG A CD  1 
ATOM   3224 N NE  . ARG A 1 424 ? 12.268  -6.450  17.709  1.00 104.50 ? 424  ARG A NE  1 
ATOM   3225 C CZ  . ARG A 1 424 ? 12.808  -7.043  18.775  1.00 109.58 ? 424  ARG A CZ  1 
ATOM   3226 N NH1 . ARG A 1 424 ? 13.717  -8.004  18.615  1.00 108.15 ? 424  ARG A NH1 1 
ATOM   3227 N NH2 . ARG A 1 424 ? 12.443  -6.677  20.004  1.00 108.33 ? 424  ARG A NH2 1 
ATOM   3228 N N   . VAL A 1 425 ? 15.594  -3.790  13.226  1.00 50.86  ? 425  VAL A N   1 
ATOM   3229 C CA  . VAL A 1 425 ? 15.838  -2.375  12.904  1.00 50.16  ? 425  VAL A CA  1 
ATOM   3230 C C   . VAL A 1 425 ? 14.578  -1.517  12.856  1.00 50.29  ? 425  VAL A C   1 
ATOM   3231 O O   . VAL A 1 425 ? 13.594  -1.886  12.231  1.00 59.27  ? 425  VAL A O   1 
ATOM   3232 C CB  . VAL A 1 425 ? 16.425  -2.222  11.504  1.00 45.72  ? 425  VAL A CB  1 
ATOM   3233 C CG1 . VAL A 1 425 ? 16.704  -0.750  11.240  1.00 41.13  ? 425  VAL A CG1 1 
ATOM   3234 C CG2 . VAL A 1 425 ? 17.653  -3.110  11.316  1.00 39.08  ? 425  VAL A CG2 1 
ATOM   3235 N N   . TYR A 1 426 ? 14.620  -0.356  13.487  1.00 44.16  ? 426  TYR A N   1 
ATOM   3236 C CA  . TYR A 1 426 ? 13.521  0.594   13.401  1.00 44.88  ? 426  TYR A CA  1 
ATOM   3237 C C   . TYR A 1 426 ? 14.027  1.863   12.725  1.00 47.14  ? 426  TYR A C   1 
ATOM   3238 O O   . TYR A 1 426 ? 15.109  2.336   13.033  1.00 49.64  ? 426  TYR A O   1 
ATOM   3239 C CB  . TYR A 1 426 ? 12.977  0.880   14.799  1.00 44.65  ? 426  TYR A CB  1 
ATOM   3240 C CG  . TYR A 1 426 ? 12.178  -0.276  15.369  1.00 57.35  ? 426  TYR A CG  1 
ATOM   3241 C CD1 . TYR A 1 426 ? 12.792  -1.270  16.122  1.00 55.91  ? 426  TYR A CD1 1 
ATOM   3242 C CD2 . TYR A 1 426 ? 10.800  -0.383  15.138  1.00 63.05  ? 426  TYR A CD2 1 
ATOM   3243 C CE1 . TYR A 1 426 ? 12.063  -2.341  16.635  1.00 61.13  ? 426  TYR A CE1 1 
ATOM   3244 C CE2 . TYR A 1 426 ? 10.064  -1.450  15.640  1.00 61.70  ? 426  TYR A CE2 1 
ATOM   3245 C CZ  . TYR A 1 426 ? 10.702  -2.427  16.387  1.00 64.07  ? 426  TYR A CZ  1 
ATOM   3246 O OH  . TYR A 1 426 ? 9.979   -3.482  16.890  1.00 64.50  ? 426  TYR A OH  1 
ATOM   3247 N N   . ALA A 1 427 ? 13.276  2.420   11.789  1.00 45.25  ? 427  ALA A N   1 
ATOM   3248 C CA  . ALA A 1 427 ? 13.785  3.604   11.102  1.00 43.34  ? 427  ALA A CA  1 
ATOM   3249 C C   . ALA A 1 427 ? 12.772  4.742   11.057  1.00 51.01  ? 427  ALA A C   1 
ATOM   3250 O O   . ALA A 1 427 ? 11.560  4.499   11.092  1.00 49.97  ? 427  ALA A O   1 
ATOM   3251 C CB  . ALA A 1 427 ? 14.267  3.257   9.717   1.00 38.26  ? 427  ALA A CB  1 
ATOM   3252 N N   . TYR A 1 428 ? 13.278  5.975   10.988  1.00 40.80  ? 428  TYR A N   1 
ATOM   3253 C CA  . TYR A 1 428 ? 12.435  7.162   11.042  1.00 42.89  ? 428  TYR A CA  1 
ATOM   3254 C C   . TYR A 1 428 ? 13.017  8.297   10.187  1.00 45.80  ? 428  TYR A C   1 
ATOM   3255 O O   . TYR A 1 428 ? 14.213  8.333   9.918   1.00 30.21  ? 428  TYR A O   1 
ATOM   3256 C CB  . TYR A 1 428 ? 12.333  7.667   12.484  1.00 45.81  ? 428  TYR A CB  1 
ATOM   3257 C CG  . TYR A 1 428 ? 13.635  8.289   12.960  1.00 51.15  ? 428  TYR A CG  1 
ATOM   3258 C CD1 . TYR A 1 428 ? 13.945  9.624   12.694  1.00 56.60  ? 428  TYR A CD1 1 
ATOM   3259 C CD2 . TYR A 1 428 ? 14.570  7.533   13.651  1.00 45.21  ? 428  TYR A CD2 1 
ATOM   3260 C CE1 . TYR A 1 428 ? 15.157  10.181  13.119  1.00 51.82  ? 428  TYR A CE1 1 
ATOM   3261 C CE2 . TYR A 1 428 ? 15.762  8.077   14.085  1.00 40.47  ? 428  TYR A CE2 1 
ATOM   3262 C CZ  . TYR A 1 428 ? 16.053  9.388   13.818  1.00 46.33  ? 428  TYR A CZ  1 
ATOM   3263 O OH  . TYR A 1 428 ? 17.244  9.899   14.263  1.00 45.01  ? 428  TYR A OH  1 
ATOM   3264 N N   . ILE A 1 429 ? 12.166  9.227   9.761   1.00 45.53  ? 429  ILE A N   1 
ATOM   3265 C CA  . ILE A 1 429 ? 12.654  10.497  9.280   1.00 40.17  ? 429  ILE A CA  1 
ATOM   3266 C C   . ILE A 1 429 ? 11.978  11.562  10.102  1.00 44.97  ? 429  ILE A C   1 
ATOM   3267 O O   . ILE A 1 429 ? 10.773  11.528  10.291  1.00 51.96  ? 429  ILE A O   1 
ATOM   3268 C CB  . ILE A 1 429 ? 12.433  10.699  7.768   1.00 40.93  ? 429  ILE A CB  1 
ATOM   3269 C CG1 . ILE A 1 429 ? 12.688  12.155  7.362   1.00 39.61  ? 429  ILE A CG1 1 
ATOM   3270 C CG2 . ILE A 1 429 ? 11.072  10.299  7.388   1.00 32.32  ? 429  ILE A CG2 1 
ATOM   3271 C CD1 . ILE A 1 429 ? 12.815  12.329  5.869   1.00 40.88  ? 429  ILE A CD1 1 
ATOM   3272 N N   . PHE A 1 430 ? 12.780  12.484  10.620  1.00 41.40  ? 430  PHE A N   1 
ATOM   3273 C CA  . PHE A 1 430 ? 12.318  13.514  11.524  1.00 35.91  ? 430  PHE A CA  1 
ATOM   3274 C C   . PHE A 1 430 ? 12.091  14.782  10.711  1.00 47.88  ? 430  PHE A C   1 
ATOM   3275 O O   . PHE A 1 430 ? 13.005  15.293  10.055  1.00 49.12  ? 430  PHE A O   1 
ATOM   3276 C CB  . PHE A 1 430 ? 13.380  13.728  12.580  1.00 36.90  ? 430  PHE A CB  1 
ATOM   3277 C CG  . PHE A 1 430 ? 13.029  14.744  13.604  1.00 36.91  ? 430  PHE A CG  1 
ATOM   3278 C CD1 . PHE A 1 430 ? 13.173  16.099  13.334  1.00 41.65  ? 430  PHE A CD1 1 
ATOM   3279 C CD2 . PHE A 1 430 ? 12.603  14.357  14.858  1.00 38.28  ? 430  PHE A CD2 1 
ATOM   3280 C CE1 . PHE A 1 430 ? 12.854  17.058  14.286  1.00 38.93  ? 430  PHE A CE1 1 
ATOM   3281 C CE2 . PHE A 1 430 ? 12.298  15.315  15.834  1.00 38.68  ? 430  PHE A CE2 1 
ATOM   3282 C CZ  . PHE A 1 430 ? 12.423  16.665  15.542  1.00 37.61  ? 430  PHE A CZ  1 
ATOM   3283 N N   . GLU A 1 431 ? 10.861  15.285  10.763  1.00 45.63  ? 431  GLU A N   1 
ATOM   3284 C CA  . GLU A 1 431 ? 10.409  16.289  9.816   1.00 40.25  ? 431  GLU A CA  1 
ATOM   3285 C C   . GLU A 1 431 ? 9.842   17.550  10.460  1.00 50.07  ? 431  GLU A C   1 
ATOM   3286 O O   . GLU A 1 431 ? 9.130   18.313  9.798   1.00 44.54  ? 431  GLU A O   1 
ATOM   3287 C CB  . GLU A 1 431 ? 9.303   15.707  8.954   1.00 37.60  ? 431  GLU A CB  1 
ATOM   3288 C CG  . GLU A 1 431 ? 9.659   14.479  8.195   1.00 51.63  ? 431  GLU A CG  1 
ATOM   3289 C CD  . GLU A 1 431 ? 8.605   14.158  7.159   1.00 62.41  ? 431  GLU A CD  1 
ATOM   3290 O OE1 . GLU A 1 431 ? 7.398   14.210  7.517   1.00 59.05  ? 431  GLU A OE1 1 
ATOM   3291 O OE2 . GLU A 1 431 ? 8.985   13.877  5.993   1.00 65.96  ? 431  GLU A OE2 1 
ATOM   3292 N N   . HIS A 1 432 ? 10.109  17.773  11.742  1.00 48.98  ? 432  HIS A N   1 
ATOM   3293 C CA  . HIS A 1 432 ? 9.580   18.977  12.361  1.00 41.63  ? 432  HIS A CA  1 
ATOM   3294 C C   . HIS A 1 432 ? 10.647  20.057  12.589  1.00 45.84  ? 432  HIS A C   1 
ATOM   3295 O O   . HIS A 1 432 ? 11.700  19.809  13.184  1.00 40.85  ? 432  HIS A O   1 
ATOM   3296 C CB  . HIS A 1 432 ? 8.832   18.670  13.644  1.00 39.70  ? 432  HIS A CB  1 
ATOM   3297 C CG  . HIS A 1 432 ? 8.478   19.895  14.428  1.00 48.96  ? 432  HIS A CG  1 
ATOM   3298 N ND1 . HIS A 1 432 ? 7.419   20.711  14.094  1.00 54.20  ? 432  HIS A ND1 1 
ATOM   3299 C CD2 . HIS A 1 432 ? 9.048   20.448  15.523  1.00 47.22  ? 432  HIS A CD2 1 
ATOM   3300 C CE1 . HIS A 1 432 ? 7.350   21.709  14.958  1.00 56.30  ? 432  HIS A CE1 1 
ATOM   3301 N NE2 . HIS A 1 432 ? 8.327   21.573  15.836  1.00 46.66  ? 432  HIS A NE2 1 
ATOM   3302 N N   . ARG A 1 433 ? 10.351  21.248  12.076  1.00 43.95  ? 433  ARG A N   1 
ATOM   3303 C CA  . ARG A 1 433 ? 11.203  22.414  12.202  1.00 46.65  ? 433  ARG A CA  1 
ATOM   3304 C C   . ARG A 1 433 ? 10.873  23.166  13.488  1.00 52.95  ? 433  ARG A C   1 
ATOM   3305 O O   . ARG A 1 433 ? 9.759   23.706  13.639  1.00 46.04  ? 433  ARG A O   1 
ATOM   3306 C CB  . ARG A 1 433 ? 10.992  23.330  11.000  1.00 50.23  ? 433  ARG A CB  1 
ATOM   3307 C CG  . ARG A 1 433 ? 11.874  24.549  10.971  1.00 52.80  ? 433  ARG A CG  1 
ATOM   3308 C CD  . ARG A 1 433 ? 11.815  25.221  9.619   1.00 59.03  ? 433  ARG A CD  1 
ATOM   3309 N NE  . ARG A 1 433 ? 13.020  26.008  9.354   1.00 66.74  ? 433  ARG A NE  1 
ATOM   3310 C CZ  . ARG A 1 433 ? 13.216  27.229  9.823   1.00 64.59  ? 433  ARG A CZ  1 
ATOM   3311 N NH1 . ARG A 1 433 ? 12.295  27.799  10.591  1.00 61.99  ? 433  ARG A NH1 1 
ATOM   3312 N NH2 . ARG A 1 433 ? 14.329  27.869  9.529   1.00 69.04  ? 433  ARG A NH2 1 
ATOM   3313 N N   . ALA A 1 434 ? 11.844  23.203  14.406  1.00 52.62  ? 434  ALA A N   1 
ATOM   3314 C CA  . ALA A 1 434 ? 11.624  23.764  15.726  1.00 45.89  ? 434  ALA A CA  1 
ATOM   3315 C C   . ALA A 1 434 ? 11.125  25.179  15.549  1.00 50.49  ? 434  ALA A C   1 
ATOM   3316 O O   . ALA A 1 434 ? 11.667  25.926  14.731  1.00 48.33  ? 434  ALA A O   1 
ATOM   3317 C CB  . ALA A 1 434 ? 12.881  23.737  16.528  1.00 42.95  ? 434  ALA A CB  1 
ATOM   3318 N N   . SER A 1 435 ? 10.072  25.531  16.290  1.00 50.52  ? 435  SER A N   1 
ATOM   3319 C CA  . SER A 1 435 ? 9.463   26.852  16.181  1.00 50.96  ? 435  SER A CA  1 
ATOM   3320 C C   . SER A 1 435 ? 10.490  27.920  16.497  1.00 54.49  ? 435  SER A C   1 
ATOM   3321 O O   . SER A 1 435 ? 10.371  29.045  16.049  1.00 57.89  ? 435  SER A O   1 
ATOM   3322 C CB  . SER A 1 435 ? 8.243   26.993  17.107  1.00 55.25  ? 435  SER A CB  1 
ATOM   3323 O OG  . SER A 1 435 ? 8.602   27.330  18.434  1.00 59.99  ? 435  SER A OG  1 
ATOM   3324 N N   . THR A 1 436 ? 11.514  27.541  17.250  1.00 53.75  ? 436  THR A N   1 
ATOM   3325 C CA  . THR A 1 436 ? 12.516  28.479  17.715  1.00 55.46  ? 436  THR A CA  1 
ATOM   3326 C C   . THR A 1 436 ? 13.852  28.407  16.962  1.00 62.05  ? 436  THR A C   1 
ATOM   3327 O O   . THR A 1 436 ? 14.902  28.667  17.550  1.00 64.75  ? 436  THR A O   1 
ATOM   3328 C CB  . THR A 1 436 ? 12.785  28.273  19.228  1.00 59.92  ? 436  THR A CB  1 
ATOM   3329 O OG1 . THR A 1 436 ? 13.270  26.945  19.475  1.00 44.29  ? 436  THR A OG1 1 
ATOM   3330 C CG2 . THR A 1 436 ? 11.511  28.485  20.013  1.00 73.29  ? 436  THR A CG2 1 
ATOM   3331 N N   . LEU A 1 437 ? 13.821  28.086  15.671  1.00 58.32  ? 437  LEU A N   1 
ATOM   3332 C CA  . LEU A 1 437 ? 15.060  27.876  14.918  1.00 59.35  ? 437  LEU A CA  1 
ATOM   3333 C C   . LEU A 1 437 ? 15.611  29.186  14.352  1.00 61.99  ? 437  LEU A C   1 
ATOM   3334 O O   . LEU A 1 437 ? 14.866  29.991  13.785  1.00 64.38  ? 437  LEU A O   1 
ATOM   3335 C CB  . LEU A 1 437 ? 14.811  26.873  13.795  1.00 66.33  ? 437  LEU A CB  1 
ATOM   3336 C CG  . LEU A 1 437 ? 15.956  26.049  13.217  1.00 65.04  ? 437  LEU A CG  1 
ATOM   3337 C CD1 . LEU A 1 437 ? 16.406  25.013  14.207  1.00 63.71  ? 437  LEU A CD1 1 
ATOM   3338 C CD2 . LEU A 1 437 ? 15.478  25.390  11.945  1.00 65.91  ? 437  LEU A CD2 1 
ATOM   3339 N N   . THR A 1 438 ? 16.915  29.401  14.501  1.00 61.80  ? 438  THR A N   1 
ATOM   3340 C CA  . THR A 1 438 ? 17.533  30.644  14.033  1.00 62.38  ? 438  THR A CA  1 
ATOM   3341 C C   . THR A 1 438 ? 18.076  30.559  12.608  1.00 65.91  ? 438  THR A C   1 
ATOM   3342 O O   . THR A 1 438 ? 18.663  31.515  12.123  1.00 68.22  ? 438  THR A O   1 
ATOM   3343 C CB  . THR A 1 438 ? 18.671  31.099  14.950  1.00 59.35  ? 438  THR A CB  1 
ATOM   3344 O OG1 . THR A 1 438 ? 19.627  30.042  15.063  1.00 69.18  ? 438  THR A OG1 1 
ATOM   3345 C CG2 . THR A 1 438 ? 18.142  31.426  16.327  1.00 48.96  ? 438  THR A CG2 1 
ATOM   3346 N N   . TRP A 1 439 ? 17.886  29.425  11.937  1.00 65.07  ? 439  TRP A N   1 
ATOM   3347 C CA  . TRP A 1 439 ? 18.241  29.315  10.523  1.00 57.67  ? 439  TRP A CA  1 
ATOM   3348 C C   . TRP A 1 439 ? 17.070  29.730  9.619   1.00 55.49  ? 439  TRP A C   1 
ATOM   3349 O O   . TRP A 1 439 ? 15.953  29.910  10.099  1.00 54.14  ? 439  TRP A O   1 
ATOM   3350 C CB  . TRP A 1 439 ? 18.717  27.905  10.197  1.00 53.55  ? 439  TRP A CB  1 
ATOM   3351 C CG  . TRP A 1 439 ? 19.932  27.473  10.973  1.00 51.63  ? 439  TRP A CG  1 
ATOM   3352 C CD1 . TRP A 1 439 ? 19.948  26.699  12.089  1.00 58.11  ? 439  TRP A CD1 1 
ATOM   3353 C CD2 . TRP A 1 439 ? 21.306  27.761  10.672  1.00 42.33  ? 439  TRP A CD2 1 
ATOM   3354 N NE1 . TRP A 1 439 ? 21.240  26.498  12.515  1.00 50.62  ? 439  TRP A NE1 1 
ATOM   3355 C CE2 . TRP A 1 439 ? 22.094  27.135  11.659  1.00 46.39  ? 439  TRP A CE2 1 
ATOM   3356 C CE3 . TRP A 1 439 ? 21.947  28.469  9.657   1.00 43.27  ? 439  TRP A CE3 1 
ATOM   3357 C CZ2 . TRP A 1 439 ? 23.498  27.211  11.673  1.00 53.25  ? 439  TRP A CZ2 1 
ATOM   3358 C CZ3 . TRP A 1 439 ? 23.349  28.544  9.667   1.00 51.45  ? 439  TRP A CZ3 1 
ATOM   3359 C CH2 . TRP A 1 439 ? 24.105  27.923  10.676  1.00 54.21  ? 439  TRP A CH2 1 
ATOM   3360 N N   . PRO A 1 440 ? 17.326  29.914  8.308   1.00 56.78  ? 440  PRO A N   1 
ATOM   3361 C CA  . PRO A 1 440 ? 16.255  30.405  7.421   1.00 46.63  ? 440  PRO A CA  1 
ATOM   3362 C C   . PRO A 1 440 ? 15.362  29.282  6.951   1.00 53.31  ? 440  PRO A C   1 
ATOM   3363 O O   . PRO A 1 440 ? 15.745  28.114  7.005   1.00 59.41  ? 440  PRO A O   1 
ATOM   3364 C CB  . PRO A 1 440 ? 17.007  30.978  6.213   1.00 49.47  ? 440  PRO A CB  1 
ATOM   3365 C CG  . PRO A 1 440 ? 18.543  30.758  6.506   1.00 63.61  ? 440  PRO A CG  1 
ATOM   3366 C CD  . PRO A 1 440 ? 18.613  29.736  7.598   1.00 60.99  ? 440  PRO A CD  1 
ATOM   3367 N N   . LEU A 1 441 ? 14.178  29.629  6.480   1.00 53.98  ? 441  LEU A N   1 
ATOM   3368 C CA  . LEU A 1 441 ? 13.220  28.618  6.097   1.00 54.82  ? 441  LEU A CA  1 
ATOM   3369 C C   . LEU A 1 441 ? 13.739  27.717  4.999   1.00 62.73  ? 441  LEU A C   1 
ATOM   3370 O O   . LEU A 1 441 ? 13.377  26.543  4.951   1.00 70.77  ? 441  LEU A O   1 
ATOM   3371 C CB  . LEU A 1 441 ? 11.923  29.268  5.663   1.00 70.07  ? 441  LEU A CB  1 
ATOM   3372 C CG  . LEU A 1 441 ? 10.974  29.517  6.826   1.00 83.21  ? 441  LEU A CG  1 
ATOM   3373 C CD1 . LEU A 1 441 ? 10.269  30.856  6.659   1.00 85.57  ? 441  LEU A CD1 1 
ATOM   3374 C CD2 . LEU A 1 441 ? 9.984   28.357  6.949   1.00 84.67  ? 441  LEU A CD2 1 
ATOM   3375 N N   . TRP A 1 442 ? 14.581  28.250  4.114   1.00 62.08  ? 442  TRP A N   1 
ATOM   3376 C CA  . TRP A 1 442 ? 15.033  27.444  2.983   1.00 53.79  ? 442  TRP A CA  1 
ATOM   3377 C C   . TRP A 1 442 ? 15.757  26.182  3.470   1.00 56.65  ? 442  TRP A C   1 
ATOM   3378 O O   . TRP A 1 442 ? 15.719  25.137  2.810   1.00 58.46  ? 442  TRP A O   1 
ATOM   3379 C CB  . TRP A 1 442 ? 15.843  28.250  1.942   1.00 42.00  ? 442  TRP A CB  1 
ATOM   3380 C CG  . TRP A 1 442 ? 17.258  28.681  2.308   1.00 46.94  ? 442  TRP A CG  1 
ATOM   3381 C CD1 . TRP A 1 442 ? 17.654  29.927  2.696   1.00 53.80  ? 442  TRP A CD1 1 
ATOM   3382 C CD2 . TRP A 1 442 ? 18.455  27.887  2.249   1.00 45.46  ? 442  TRP A CD2 1 
ATOM   3383 N NE1 . TRP A 1 442 ? 19.018  29.961  2.912   1.00 45.94  ? 442  TRP A NE1 1 
ATOM   3384 C CE2 . TRP A 1 442 ? 19.536  28.724  2.644   1.00 50.56  ? 442  TRP A CE2 1 
ATOM   3385 C CE3 . TRP A 1 442 ? 18.726  26.561  1.913   1.00 41.15  ? 442  TRP A CE3 1 
ATOM   3386 C CZ2 . TRP A 1 442 ? 20.862  28.258  2.735   1.00 43.65  ? 442  TRP A CZ2 1 
ATOM   3387 C CZ3 . TRP A 1 442 ? 20.050  26.104  1.981   1.00 37.57  ? 442  TRP A CZ3 1 
ATOM   3388 C CH2 . TRP A 1 442 ? 21.097  26.953  2.406   1.00 37.74  ? 442  TRP A CH2 1 
ATOM   3389 N N   . MET A 1 443 ? 16.360  26.270  4.652   1.00 47.05  ? 443  MET A N   1 
ATOM   3390 C CA  . MET A 1 443 ? 17.118  25.153  5.198   1.00 40.66  ? 443  MET A CA  1 
ATOM   3391 C C   . MET A 1 443 ? 16.282  23.996  5.698   1.00 40.34  ? 443  MET A C   1 
ATOM   3392 O O   . MET A 1 443 ? 16.826  22.936  5.983   1.00 36.24  ? 443  MET A O   1 
ATOM   3393 C CB  . MET A 1 443 ? 18.068  25.618  6.288   1.00 40.72  ? 443  MET A CB  1 
ATOM   3394 C CG  . MET A 1 443 ? 19.381  26.072  5.726   1.00 43.25  ? 443  MET A CG  1 
ATOM   3395 S SD  . MET A 1 443 ? 20.391  26.870  6.953   1.00 54.15  ? 443  MET A SD  1 
ATOM   3396 C CE  . MET A 1 443 ? 21.960  26.127  6.634   1.00 47.47  ? 443  MET A CE  1 
ATOM   3397 N N   . GLY A 1 444 ? 14.965  24.184  5.780   1.00 41.98  ? 444  GLY A N   1 
ATOM   3398 C CA  . GLY A 1 444 ? 14.070  23.113  6.197   1.00 27.76  ? 444  GLY A CA  1 
ATOM   3399 C C   . GLY A 1 444 ? 14.295  22.709  7.642   1.00 31.48  ? 444  GLY A C   1 
ATOM   3400 O O   . GLY A 1 444 ? 14.458  23.570  8.497   1.00 39.23  ? 444  GLY A O   1 
ATOM   3401 N N   . VAL A 1 445 ? 14.299  21.400  7.900   1.00 36.40  ? 445  VAL A N   1 
ATOM   3402 C CA  . VAL A 1 445 ? 14.705  20.821  9.188   1.00 33.83  ? 445  VAL A CA  1 
ATOM   3403 C C   . VAL A 1 445 ? 16.145  20.351  9.045   1.00 36.45  ? 445  VAL A C   1 
ATOM   3404 O O   . VAL A 1 445 ? 16.370  19.288  8.470   1.00 53.40  ? 445  VAL A O   1 
ATOM   3405 C CB  . VAL A 1 445 ? 13.850  19.569  9.519   1.00 41.25  ? 445  VAL A CB  1 
ATOM   3406 C CG1 . VAL A 1 445 ? 14.173  19.037  10.910  1.00 44.81  ? 445  VAL A CG1 1 
ATOM   3407 C CG2 . VAL A 1 445 ? 12.366  19.868  9.370   1.00 40.22  ? 445  VAL A CG2 1 
ATOM   3408 N N   . PRO A 1 446 ? 17.127  21.130  9.555   1.00 33.06  ? 446  PRO A N   1 
ATOM   3409 C CA  . PRO A 1 446 ? 18.550  20.840  9.286   1.00 29.89  ? 446  PRO A CA  1 
ATOM   3410 C C   . PRO A 1 446 ? 19.208  19.814  10.187  1.00 34.08  ? 446  PRO A C   1 
ATOM   3411 O O   . PRO A 1 446 ? 18.766  19.523  11.286  1.00 35.45  ? 446  PRO A O   1 
ATOM   3412 C CB  . PRO A 1 446 ? 19.241  22.196  9.509   1.00 29.25  ? 446  PRO A CB  1 
ATOM   3413 C CG  . PRO A 1 446 ? 18.092  23.224  9.642   1.00 34.45  ? 446  PRO A CG  1 
ATOM   3414 C CD  . PRO A 1 446 ? 16.963  22.433  10.216  1.00 32.48  ? 446  PRO A CD  1 
ATOM   3415 N N   . HIS A 1 447 ? 20.307  19.278  9.686   1.00 45.57  ? 447  HIS A N   1 
ATOM   3416 C CA  . HIS A 1 447 ? 21.197  18.393  10.439  1.00 43.13  ? 447  HIS A CA  1 
ATOM   3417 C C   . HIS A 1 447 ? 21.428  18.838  11.896  1.00 39.60  ? 447  HIS A C   1 
ATOM   3418 O O   . HIS A 1 447 ? 21.949  19.920  12.139  1.00 41.92  ? 447  HIS A O   1 
ATOM   3419 C CB  . HIS A 1 447 ? 22.530  18.349  9.690   1.00 40.72  ? 447  HIS A CB  1 
ATOM   3420 C CG  . HIS A 1 447 ? 23.464  17.273  10.141  1.00 42.88  ? 447  HIS A CG  1 
ATOM   3421 N ND1 . HIS A 1 447 ? 23.226  15.936  9.910   1.00 48.21  ? 447  HIS A ND1 1 
ATOM   3422 C CD2 . HIS A 1 447 ? 24.662  17.339  10.769  1.00 42.77  ? 447  HIS A CD2 1 
ATOM   3423 C CE1 . HIS A 1 447 ? 24.227  15.222  10.393  1.00 46.68  ? 447  HIS A CE1 1 
ATOM   3424 N NE2 . HIS A 1 447 ? 25.109  16.051  10.924  1.00 48.53  ? 447  HIS A NE2 1 
ATOM   3425 N N   . GLY A 1 448 ? 21.047  17.996  12.857  1.00 41.12  ? 448  GLY A N   1 
ATOM   3426 C CA  . GLY A 1 448 ? 21.363  18.241  14.254  1.00 32.42  ? 448  GLY A CA  1 
ATOM   3427 C C   . GLY A 1 448 ? 20.226  18.788  15.091  1.00 39.42  ? 448  GLY A C   1 
ATOM   3428 O O   . GLY A 1 448 ? 20.336  18.853  16.304  1.00 45.69  ? 448  GLY A O   1 
ATOM   3429 N N   . TYR A 1 449 ? 19.123  19.158  14.451  1.00 40.18  ? 449  TYR A N   1 
ATOM   3430 C CA  . TYR A 1 449 ? 18.052  19.863  15.142  1.00 34.76  ? 449  TYR A CA  1 
ATOM   3431 C C   . TYR A 1 449 ? 16.864  19.003  15.525  1.00 37.36  ? 449  TYR A C   1 
ATOM   3432 O O   . TYR A 1 449 ? 15.754  19.500  15.603  1.00 47.99  ? 449  TYR A O   1 
ATOM   3433 C CB  . TYR A 1 449 ? 17.622  21.113  14.350  1.00 30.15  ? 449  TYR A CB  1 
ATOM   3434 C CG  . TYR A 1 449 ? 18.710  22.141  14.399  1.00 38.06  ? 449  TYR A CG  1 
ATOM   3435 C CD1 . TYR A 1 449 ? 19.744  22.120  13.484  1.00 38.89  ? 449  TYR A CD1 1 
ATOM   3436 C CD2 . TYR A 1 449 ? 18.749  23.098  15.415  1.00 40.95  ? 449  TYR A CD2 1 
ATOM   3437 C CE1 . TYR A 1 449 ? 20.769  23.047  13.563  1.00 48.82  ? 449  TYR A CE1 1 
ATOM   3438 C CE2 . TYR A 1 449 ? 19.766  24.032  15.495  1.00 32.55  ? 449  TYR A CE2 1 
ATOM   3439 C CZ  . TYR A 1 449 ? 20.771  24.001  14.574  1.00 44.23  ? 449  TYR A CZ  1 
ATOM   3440 O OH  . TYR A 1 449 ? 21.797  24.910  14.646  1.00 47.11  ? 449  TYR A OH  1 
ATOM   3441 N N   . GLU A 1 450 ? 17.098  17.719  15.769  1.00 42.41  ? 450  GLU A N   1 
ATOM   3442 C CA  . GLU A 1 450 ? 16.078  16.861  16.395  1.00 42.30  ? 450  GLU A CA  1 
ATOM   3443 C C   . GLU A 1 450 ? 16.568  16.502  17.782  1.00 42.16  ? 450  GLU A C   1 
ATOM   3444 O O   . GLU A 1 450 ? 15.791  16.162  18.663  1.00 43.61  ? 450  GLU A O   1 
ATOM   3445 C CB  . GLU A 1 450 ? 15.827  15.579  15.594  1.00 34.45  ? 450  GLU A CB  1 
ATOM   3446 C CG  . GLU A 1 450 ? 16.808  14.433  15.853  1.00 33.96  ? 450  GLU A CG  1 
ATOM   3447 C CD  . GLU A 1 450 ? 18.211  14.669  15.286  1.00 46.74  ? 450  GLU A CD  1 
ATOM   3448 O OE1 . GLU A 1 450 ? 18.562  15.829  14.959  1.00 49.44  ? 450  GLU A OE1 1 
ATOM   3449 O OE2 . GLU A 1 450 ? 18.967  13.675  15.162  1.00 48.41  ? 450  GLU A OE2 1 
ATOM   3450 N N   . ILE A 1 451 ? 17.879  16.587  17.964  1.00 36.81  ? 451  ILE A N   1 
ATOM   3451 C CA  . ILE A 1 451 ? 18.485  16.268  19.242  1.00 35.50  ? 451  ILE A CA  1 
ATOM   3452 C C   . ILE A 1 451 ? 17.724  16.904  20.414  1.00 36.71  ? 451  ILE A C   1 
ATOM   3453 O O   . ILE A 1 451 ? 17.486  16.251  21.442  1.00 32.32  ? 451  ILE A O   1 
ATOM   3454 C CB  . ILE A 1 451 ? 19.964  16.727  19.289  1.00 21.64  ? 451  ILE A CB  1 
ATOM   3455 C CG1 . ILE A 1 451 ? 20.798  15.903  18.318  1.00 29.81  ? 451  ILE A CG1 1 
ATOM   3456 C CG2 . ILE A 1 451 ? 20.501  16.567  20.677  1.00 19.09  ? 451  ILE A CG2 1 
ATOM   3457 C CD1 . ILE A 1 451 ? 22.172  16.427  18.102  1.00 33.95  ? 451  ILE A CD1 1 
ATOM   3458 N N   . GLU A 1 452 ? 17.347  18.174  20.254  1.00 30.04  ? 452  GLU A N   1 
ATOM   3459 C CA  . GLU A 1 452 ? 16.842  18.945  21.370  1.00 31.61  ? 452  GLU A CA  1 
ATOM   3460 C C   . GLU A 1 452 ? 15.465  18.447  21.757  1.00 33.33  ? 452  GLU A C   1 
ATOM   3461 O O   . GLU A 1 452 ? 15.081  18.553  22.926  1.00 39.48  ? 452  GLU A O   1 
ATOM   3462 C CB  . GLU A 1 452 ? 16.860  20.463  21.100  1.00 36.53  ? 452  GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 452 ? 15.810  20.954  20.119  1.00 46.83  ? 452  GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 452 ? 16.297  22.123  19.277  1.00 49.67  ? 452  GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 452 ? 15.529  23.103  19.087  1.00 51.66  ? 452  GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 452 ? 17.459  22.055  18.812  1.00 47.49  ? 452  GLU A OE2 1 
ATOM   3467 N N   . PHE A 1 453 ? 14.747  17.871  20.795  1.00 24.29  ? 453  PHE A N   1 
ATOM   3468 C CA  . PHE A 1 453 ? 13.453  17.269  21.094  1.00 37.38  ? 453  PHE A CA  1 
ATOM   3469 C C   . PHE A 1 453 ? 13.586  15.916  21.762  1.00 42.05  ? 453  PHE A C   1 
ATOM   3470 O O   . PHE A 1 453 ? 12.777  15.568  22.636  1.00 51.40  ? 453  PHE A O   1 
ATOM   3471 C CB  . PHE A 1 453 ? 12.590  17.161  19.845  1.00 44.74  ? 453  PHE A CB  1 
ATOM   3472 C CG  . PHE A 1 453 ? 12.165  18.484  19.305  1.00 46.14  ? 453  PHE A CG  1 
ATOM   3473 C CD1 . PHE A 1 453 ? 10.989  19.061  19.722  1.00 44.89  ? 453  PHE A CD1 1 
ATOM   3474 C CD2 . PHE A 1 453 ? 12.956  19.159  18.399  1.00 43.26  ? 453  PHE A CD2 1 
ATOM   3475 C CE1 . PHE A 1 453 ? 10.602  20.279  19.244  1.00 45.93  ? 453  PHE A CE1 1 
ATOM   3476 C CE2 . PHE A 1 453 ? 12.573  20.379  17.912  1.00 47.76  ? 453  PHE A CE2 1 
ATOM   3477 C CZ  . PHE A 1 453 ? 11.393  20.946  18.337  1.00 47.96  ? 453  PHE A CZ  1 
ATOM   3478 N N   . ILE A 1 454 ? 14.608  15.164  21.360  1.00 29.45  ? 454  ILE A N   1 
ATOM   3479 C CA  . ILE A 1 454 ? 14.856  13.841  21.931  1.00 32.79  ? 454  ILE A CA  1 
ATOM   3480 C C   . ILE A 1 454 ? 15.277  13.932  23.382  1.00 29.36  ? 454  ILE A C   1 
ATOM   3481 O O   . ILE A 1 454 ? 14.899  13.093  24.196  1.00 38.85  ? 454  ILE A O   1 
ATOM   3482 C CB  . ILE A 1 454 ? 15.899  13.061  21.108  1.00 37.96  ? 454  ILE A CB  1 
ATOM   3483 C CG1 . ILE A 1 454 ? 15.333  12.713  19.739  1.00 36.19  ? 454  ILE A CG1 1 
ATOM   3484 C CG2 . ILE A 1 454 ? 16.377  11.787  21.835  1.00 19.11  ? 454  ILE A CG2 1 
ATOM   3485 C CD1 . ILE A 1 454 ? 16.369  12.224  18.833  1.00 41.54  ? 454  ILE A CD1 1 
ATOM   3486 N N   . PHE A 1 455 ? 16.032  14.972  23.711  1.00 33.85  ? 455  PHE A N   1 
ATOM   3487 C CA  . PHE A 1 455 ? 16.469  15.193  25.089  1.00 37.44  ? 455  PHE A CA  1 
ATOM   3488 C C   . PHE A 1 455 ? 15.402  15.898  25.896  1.00 37.75  ? 455  PHE A C   1 
ATOM   3489 O O   . PHE A 1 455 ? 15.534  16.049  27.103  1.00 45.15  ? 455  PHE A O   1 
ATOM   3490 C CB  . PHE A 1 455 ? 17.795  15.969  25.137  1.00 32.49  ? 455  PHE A CB  1 
ATOM   3491 C CG  . PHE A 1 455 ? 19.003  15.093  25.020  1.00 30.22  ? 455  PHE A CG  1 
ATOM   3492 C CD1 . PHE A 1 455 ? 19.393  14.584  23.794  1.00 32.47  ? 455  PHE A CD1 1 
ATOM   3493 C CD2 . PHE A 1 455 ? 19.751  14.762  26.149  1.00 39.25  ? 455  PHE A CD2 1 
ATOM   3494 C CE1 . PHE A 1 455 ? 20.528  13.745  23.690  1.00 40.81  ? 455  PHE A CE1 1 
ATOM   3495 C CE2 . PHE A 1 455 ? 20.893  13.925  26.064  1.00 36.09  ? 455  PHE A CE2 1 
ATOM   3496 C CZ  . PHE A 1 455 ? 21.275  13.412  24.828  1.00 35.25  ? 455  PHE A CZ  1 
ATOM   3497 N N   . GLY A 1 456 ? 14.345  16.331  25.217  1.00 38.74  ? 456  GLY A N   1 
ATOM   3498 C CA  . GLY A 1 456 ? 13.221  16.960  25.876  1.00 38.73  ? 456  GLY A CA  1 
ATOM   3499 C C   . GLY A 1 456 ? 13.371  18.415  26.293  1.00 45.43  ? 456  GLY A C   1 
ATOM   3500 O O   . GLY A 1 456 ? 12.607  18.892  27.131  1.00 50.06  ? 456  GLY A O   1 
ATOM   3501 N N   . LEU A 1 457 ? 14.325  19.142  25.719  1.00 41.13  ? 457  LEU A N   1 
ATOM   3502 C CA  . LEU A 1 457 ? 14.434  20.570  26.049  1.00 40.44  ? 457  LEU A CA  1 
ATOM   3503 C C   . LEU A 1 457 ? 13.100  21.367  25.975  1.00 45.10  ? 457  LEU A C   1 
ATOM   3504 O O   . LEU A 1 457 ? 12.890  22.265  26.779  1.00 44.39  ? 457  LEU A O   1 
ATOM   3505 C CB  . LEU A 1 457 ? 15.552  21.262  25.260  1.00 33.84  ? 457  LEU A CB  1 
ATOM   3506 C CG  . LEU A 1 457 ? 16.975  21.062  25.829  1.00 45.91  ? 457  LEU A CG  1 
ATOM   3507 C CD1 . LEU A 1 457 ? 17.492  19.590  25.748  1.00 39.70  ? 457  LEU A CD1 1 
ATOM   3508 C CD2 . LEU A 1 457 ? 17.980  21.980  25.160  1.00 40.13  ? 457  LEU A CD2 1 
ATOM   3509 N N   . PRO A 1 458 ? 12.184  21.029  25.043  1.00 42.25  ? 458  PRO A N   1 
ATOM   3510 C CA  . PRO A 1 458 ? 10.970  21.859  25.007  1.00 51.18  ? 458  PRO A CA  1 
ATOM   3511 C C   . PRO A 1 458 ? 10.105  21.819  26.276  1.00 60.48  ? 458  PRO A C   1 
ATOM   3512 O O   . PRO A 1 458 ? 9.193   22.644  26.371  1.00 72.04  ? 458  PRO A O   1 
ATOM   3513 C CB  . PRO A 1 458 ? 10.203  21.314  23.795  1.00 44.37  ? 458  PRO A CB  1 
ATOM   3514 C CG  . PRO A 1 458 ? 11.287  20.693  22.944  1.00 47.54  ? 458  PRO A CG  1 
ATOM   3515 C CD  . PRO A 1 458 ? 12.204  20.062  23.934  1.00 39.10  ? 458  PRO A CD  1 
ATOM   3516 N N   . LEU A 1 459 ? 10.393  20.908  27.213  1.00 56.44  ? 459  LEU A N   1 
ATOM   3517 C CA  . LEU A 1 459 ? 9.683   20.829  28.504  1.00 52.06  ? 459  LEU A CA  1 
ATOM   3518 C C   . LEU A 1 459 ? 10.067  21.957  29.438  1.00 51.89  ? 459  LEU A C   1 
ATOM   3519 O O   . LEU A 1 459 ? 9.374   22.211  30.429  1.00 49.53  ? 459  LEU A O   1 
ATOM   3520 C CB  . LEU A 1 459 ? 9.940   19.500  29.233  1.00 47.85  ? 459  LEU A CB  1 
ATOM   3521 C CG  . LEU A 1 459 ? 9.644   18.209  28.472  1.00 50.54  ? 459  LEU A CG  1 
ATOM   3522 C CD1 . LEU A 1 459 ? 9.644   17.046  29.398  1.00 45.10  ? 459  LEU A CD1 1 
ATOM   3523 C CD2 . LEU A 1 459 ? 8.314   18.308  27.805  1.00 56.48  ? 459  LEU A CD2 1 
ATOM   3524 N N   . ASP A 1 460 ? 11.193  22.603  29.147  1.00 55.56  ? 460  ASP A N   1 
ATOM   3525 C CA  . ASP A 1 460 ? 11.644  23.737  29.936  1.00 58.70  ? 460  ASP A CA  1 
ATOM   3526 C C   . ASP A 1 460 ? 10.862  24.942  29.462  1.00 63.54  ? 460  ASP A C   1 
ATOM   3527 O O   . ASP A 1 460 ? 11.115  25.464  28.388  1.00 67.62  ? 460  ASP A O   1 
ATOM   3528 C CB  . ASP A 1 460 ? 13.132  23.965  29.737  1.00 58.64  ? 460  ASP A CB  1 
ATOM   3529 C CG  . ASP A 1 460 ? 13.701  24.944  30.732  1.00 76.12  ? 460  ASP A CG  1 
ATOM   3530 O OD1 . ASP A 1 460 ? 12.906  25.588  31.453  1.00 83.31  ? 460  ASP A OD1 1 
ATOM   3531 O OD2 . ASP A 1 460 ? 14.945  25.064  30.799  1.00 81.35  ? 460  ASP A OD2 1 
ATOM   3532 N N   . PRO A 1 461 ? 9.879   25.373  30.251  1.00 71.07  ? 461  PRO A N   1 
ATOM   3533 C CA  . PRO A 1 461 ? 8.953   26.419  29.799  1.00 71.01  ? 461  PRO A CA  1 
ATOM   3534 C C   . PRO A 1 461 ? 9.727   27.680  29.434  1.00 67.52  ? 461  PRO A C   1 
ATOM   3535 O O   . PRO A 1 461 ? 9.348   28.405  28.515  1.00 72.12  ? 461  PRO A O   1 
ATOM   3536 C CB  . PRO A 1 461 ? 8.092   26.665  31.035  1.00 71.32  ? 461  PRO A CB  1 
ATOM   3537 C CG  . PRO A 1 461 ? 8.988   26.246  32.168  1.00 77.00  ? 461  PRO A CG  1 
ATOM   3538 C CD  . PRO A 1 461 ? 9.648   25.012  31.656  1.00 74.39  ? 461  PRO A CD  1 
ATOM   3539 N N   . SER A 1 462 ? 10.827  27.919  30.137  1.00 54.52  ? 462  SER A N   1 
ATOM   3540 C CA  . SER A 1 462 ? 11.659  29.076  29.857  1.00 55.47  ? 462  SER A CA  1 
ATOM   3541 C C   . SER A 1 462 ? 12.262  29.125  28.432  1.00 62.83  ? 462  SER A C   1 
ATOM   3542 O O   . SER A 1 462 ? 12.821  30.147  28.025  1.00 70.82  ? 462  SER A O   1 
ATOM   3543 C CB  . SER A 1 462 ? 12.773  29.183  30.906  1.00 54.84  ? 462  SER A CB  1 
ATOM   3544 O OG  . SER A 1 462 ? 14.001  28.667  30.433  1.00 61.25  ? 462  SER A OG  1 
ATOM   3545 N N   . LEU A 1 463 ? 12.157  28.038  27.675  1.00 53.10  ? 463  LEU A N   1 
ATOM   3546 C CA  . LEU A 1 463 ? 12.787  27.995  26.361  1.00 47.40  ? 463  LEU A CA  1 
ATOM   3547 C C   . LEU A 1 463 ? 11.894  28.457  25.219  1.00 56.78  ? 463  LEU A C   1 
ATOM   3548 O O   . LEU A 1 463 ? 12.355  28.560  24.079  1.00 61.64  ? 463  LEU A O   1 
ATOM   3549 C CB  . LEU A 1 463 ? 13.364  26.610  26.056  1.00 47.04  ? 463  LEU A CB  1 
ATOM   3550 C CG  . LEU A 1 463 ? 14.628  26.241  26.835  1.00 52.08  ? 463  LEU A CG  1 
ATOM   3551 C CD1 . LEU A 1 463 ? 15.183  24.928  26.353  1.00 51.70  ? 463  LEU A CD1 1 
ATOM   3552 C CD2 . LEU A 1 463 ? 15.694  27.327  26.720  1.00 47.67  ? 463  LEU A CD2 1 
ATOM   3553 N N   . ASN A 1 464 ? 10.626  28.728  25.517  1.00 62.67  ? 464  ASN A N   1 
ATOM   3554 C CA  . ASN A 1 464 ? 9.714   29.340  24.542  1.00 63.61  ? 464  ASN A CA  1 
ATOM   3555 C C   . ASN A 1 464 ? 9.268   28.434  23.374  1.00 56.04  ? 464  ASN A C   1 
ATOM   3556 O O   . ASN A 1 464 ? 8.908   28.912  22.306  1.00 61.99  ? 464  ASN A O   1 
ATOM   3557 C CB  . ASN A 1 464 ? 10.260  30.706  24.064  1.00 67.61  ? 464  ASN A CB  1 
ATOM   3558 C CG  . ASN A 1 464 ? 10.198  31.772  25.168  1.00 85.70  ? 464  ASN A CG  1 
ATOM   3559 O OD1 . ASN A 1 464 ? 9.485   31.591  26.165  1.00 76.03  ? 464  ASN A OD1 1 
ATOM   3560 N ND2 . ASN A 1 464 ? 10.945  32.881  25.000  1.00 107.71 ? 464  ASN A ND2 1 
ATOM   3561 N N   . TYR A 1 465 ? 9.273   27.125  23.595  1.00 49.34  ? 465  TYR A N   1 
ATOM   3562 C CA  . TYR A 1 465 ? 8.660   26.199  22.654  1.00 47.86  ? 465  TYR A CA  1 
ATOM   3563 C C   . TYR A 1 465 ? 7.136   26.222  22.805  1.00 50.74  ? 465  TYR A C   1 
ATOM   3564 O O   . TYR A 1 465 ? 6.616   26.508  23.888  1.00 52.47  ? 465  TYR A O   1 
ATOM   3565 C CB  . TYR A 1 465 ? 9.147   24.778  22.922  1.00 46.99  ? 465  TYR A CB  1 
ATOM   3566 C CG  . TYR A 1 465 ? 10.587  24.532  22.574  1.00 46.52  ? 465  TYR A CG  1 
ATOM   3567 C CD1 . TYR A 1 465 ? 10.945  24.121  21.301  1.00 51.68  ? 465  TYR A CD1 1 
ATOM   3568 C CD2 . TYR A 1 465 ? 11.593  24.697  23.523  1.00 48.32  ? 465  TYR A CD2 1 
ATOM   3569 C CE1 . TYR A 1 465 ? 12.269  23.884  20.966  1.00 47.24  ? 465  TYR A CE1 1 
ATOM   3570 C CE2 . TYR A 1 465 ? 12.920  24.459  23.206  1.00 46.00  ? 465  TYR A CE2 1 
ATOM   3571 C CZ  . TYR A 1 465 ? 13.246  24.055  21.919  1.00 45.08  ? 465  TYR A CZ  1 
ATOM   3572 O OH  . TYR A 1 465 ? 14.549  23.824  21.570  1.00 41.53  ? 465  TYR A OH  1 
ATOM   3573 N N   . THR A 1 466 ? 6.433   25.891  21.723  1.00 50.08  ? 466  THR A N   1 
ATOM   3574 C CA  . THR A 1 466 ? 4.976   25.707  21.730  1.00 45.89  ? 466  THR A CA  1 
ATOM   3575 C C   . THR A 1 466 ? 4.528   24.474  22.516  1.00 52.77  ? 466  THR A C   1 
ATOM   3576 O O   . THR A 1 466 ? 5.302   23.557  22.765  1.00 53.18  ? 466  THR A O   1 
ATOM   3577 C CB  . THR A 1 466 ? 4.404   25.557  20.295  1.00 46.24  ? 466  THR A CB  1 
ATOM   3578 O OG1 . THR A 1 466 ? 4.737   24.261  19.752  1.00 47.07  ? 466  THR A OG1 1 
ATOM   3579 C CG2 . THR A 1 466 ? 4.941   26.641  19.396  1.00 43.26  ? 466  THR A CG2 1 
ATOM   3580 N N   . THR A 1 467 ? 3.253   24.449  22.878  1.00 59.57  ? 467  THR A N   1 
ATOM   3581 C CA  . THR A 1 467 ? 2.700   23.338  23.634  1.00 59.21  ? 467  THR A CA  1 
ATOM   3582 C C   . THR A 1 467 ? 2.699   22.022  22.853  1.00 59.58  ? 467  THR A C   1 
ATOM   3583 O O   . THR A 1 467 ? 2.968   20.949  23.427  1.00 53.27  ? 467  THR A O   1 
ATOM   3584 C CB  . THR A 1 467 ? 1.287   23.672  24.116  1.00 60.94  ? 467  THR A CB  1 
ATOM   3585 O OG1 . THR A 1 467 ? 1.374   24.685  25.125  1.00 60.56  ? 467  THR A OG1 1 
ATOM   3586 C CG2 . THR A 1 467 ? 0.608   22.432  24.697  1.00 58.64  ? 467  THR A CG2 1 
ATOM   3587 N N   . GLU A 1 468 ? 2.392   22.107  21.555  1.00 55.53  ? 468  GLU A N   1 
ATOM   3588 C CA  . GLU A 1 468 ? 2.430   20.942  20.674  1.00 57.86  ? 468  GLU A CA  1 
ATOM   3589 C C   . GLU A 1 468 ? 3.843   20.408  20.637  1.00 61.38  ? 468  GLU A C   1 
ATOM   3590 O O   . GLU A 1 468 ? 4.058   19.194  20.643  1.00 61.89  ? 468  GLU A O   1 
ATOM   3591 C CB  . GLU A 1 468 ? 1.975   21.289  19.256  1.00 61.14  ? 468  GLU A CB  1 
ATOM   3592 C CG  . GLU A 1 468 ? 0.739   22.150  19.216  1.00 83.66  ? 468  GLU A CG  1 
ATOM   3593 C CD  . GLU A 1 468 ? 1.061   23.627  19.380  1.00 100.22 ? 468  GLU A CD  1 
ATOM   3594 O OE1 . GLU A 1 468 ? 0.902   24.159  20.510  1.00 99.26  ? 468  GLU A OE1 1 
ATOM   3595 O OE2 . GLU A 1 468 ? 1.493   24.245  18.375  1.00 106.97 ? 468  GLU A OE2 1 
ATOM   3596 N N   . GLU A 1 469 ? 4.802   21.332  20.602  1.00 55.12  ? 469  GLU A N   1 
ATOM   3597 C CA  . GLU A 1 469 ? 6.204   20.976  20.712  1.00 51.74  ? 469  GLU A CA  1 
ATOM   3598 C C   . GLU A 1 469 ? 6.554   20.297  22.042  1.00 56.47  ? 469  GLU A C   1 
ATOM   3599 O O   . GLU A 1 469 ? 7.377   19.375  22.071  1.00 61.17  ? 469  GLU A O   1 
ATOM   3600 C CB  . GLU A 1 469 ? 7.089   22.194  20.464  1.00 51.22  ? 469  GLU A CB  1 
ATOM   3601 C CG  . GLU A 1 469 ? 7.564   22.260  19.038  1.00 55.58  ? 469  GLU A CG  1 
ATOM   3602 C CD  . GLU A 1 469 ? 8.205   23.568  18.690  1.00 52.38  ? 469  GLU A CD  1 
ATOM   3603 O OE1 . GLU A 1 469 ? 8.100   24.512  19.504  1.00 47.53  ? 469  GLU A OE1 1 
ATOM   3604 O OE2 . GLU A 1 469 ? 8.810   23.635  17.598  1.00 44.79  ? 469  GLU A OE2 1 
ATOM   3605 N N   . ARG A 1 470 ? 5.944   20.738  23.143  1.00 47.11  ? 470  ARG A N   1 
ATOM   3606 C CA  . ARG A 1 470 ? 6.143   20.023  24.395  1.00 49.47  ? 470  ARG A CA  1 
ATOM   3607 C C   . ARG A 1 470 ? 5.586   18.589  24.288  1.00 50.94  ? 470  ARG A C   1 
ATOM   3608 O O   . ARG A 1 470 ? 6.285   17.623  24.586  1.00 51.32  ? 470  ARG A O   1 
ATOM   3609 C CB  . ARG A 1 470 ? 5.593   20.798  25.594  1.00 61.80  ? 470  ARG A CB  1 
ATOM   3610 C CG  . ARG A 1 470 ? 5.816   20.096  26.936  1.00 74.55  ? 470  ARG A CG  1 
ATOM   3611 C CD  . ARG A 1 470 ? 5.185   20.844  28.122  1.00 88.94  ? 470  ARG A CD  1 
ATOM   3612 N NE  . ARG A 1 470 ? 3.808   21.261  27.852  1.00 101.32 ? 470  ARG A NE  1 
ATOM   3613 C CZ  . ARG A 1 470 ? 2.750   20.450  27.872  1.00 104.25 ? 470  ARG A CZ  1 
ATOM   3614 N NH1 . ARG A 1 470 ? 2.901   19.160  28.153  1.00 100.46 ? 470  ARG A NH1 1 
ATOM   3615 N NH2 . ARG A 1 470 ? 1.537   20.932  27.603  1.00 106.81 ? 470  ARG A NH2 1 
ATOM   3616 N N   . ILE A 1 471 ? 4.360   18.440  23.801  1.00 50.25  ? 471  ILE A N   1 
ATOM   3617 C CA  . ILE A 1 471 ? 3.739   17.117  23.692  1.00 48.89  ? 471  ILE A CA  1 
ATOM   3618 C C   . ILE A 1 471 ? 4.501   16.179  22.761  1.00 46.25  ? 471  ILE A C   1 
ATOM   3619 O O   . ILE A 1 471 ? 4.625   14.976  23.021  1.00 53.13  ? 471  ILE A O   1 
ATOM   3620 C CB  . ILE A 1 471 ? 2.263   17.252  23.262  1.00 49.83  ? 471  ILE A CB  1 
ATOM   3621 C CG1 . ILE A 1 471 ? 1.461   17.822  24.437  1.00 53.61  ? 471  ILE A CG1 1 
ATOM   3622 C CG2 . ILE A 1 471 ? 1.702   15.914  22.795  1.00 33.26  ? 471  ILE A CG2 1 
ATOM   3623 C CD1 . ILE A 1 471 ? 0.421   18.815  24.027  1.00 64.62  ? 471  ILE A CD1 1 
ATOM   3624 N N   . PHE A 1 472 ? 5.019   16.757  21.686  1.00 46.99  ? 472  PHE A N   1 
ATOM   3625 C CA  . PHE A 1 472 ? 5.865   16.072  20.703  1.00 49.33  ? 472  PHE A CA  1 
ATOM   3626 C C   . PHE A 1 472 ? 7.137   15.508  21.327  1.00 50.18  ? 472  PHE A C   1 
ATOM   3627 O O   . PHE A 1 472 ? 7.453   14.340  21.147  1.00 58.39  ? 472  PHE A O   1 
ATOM   3628 C CB  . PHE A 1 472 ? 6.227   17.065  19.584  1.00 40.09  ? 472  PHE A CB  1 
ATOM   3629 C CG  . PHE A 1 472 ? 7.110   16.505  18.519  1.00 37.04  ? 472  PHE A CG  1 
ATOM   3630 C CD1 . PHE A 1 472 ? 6.814   15.303  17.912  1.00 40.80  ? 472  PHE A CD1 1 
ATOM   3631 C CD2 . PHE A 1 472 ? 8.235   17.213  18.090  1.00 49.69  ? 472  PHE A CD2 1 
ATOM   3632 C CE1 . PHE A 1 472 ? 7.643   14.788  16.907  1.00 47.09  ? 472  PHE A CE1 1 
ATOM   3633 C CE2 . PHE A 1 472 ? 9.069   16.725  17.075  1.00 47.48  ? 472  PHE A CE2 1 
ATOM   3634 C CZ  . PHE A 1 472 ? 8.775   15.507  16.482  1.00 47.43  ? 472  PHE A CZ  1 
ATOM   3635 N N   . ALA A 1 473 ? 7.849   16.347  22.072  1.00 41.49  ? 473  ALA A N   1 
ATOM   3636 C CA  . ALA A 1 473 ? 9.109   15.959  22.699  1.00 41.94  ? 473  ALA A CA  1 
ATOM   3637 C C   . ALA A 1 473 ? 8.939   14.762  23.636  1.00 49.56  ? 473  ALA A C   1 
ATOM   3638 O O   . ALA A 1 473 ? 9.821   13.910  23.754  1.00 48.64  ? 473  ALA A O   1 
ATOM   3639 C CB  . ALA A 1 473 ? 9.697   17.140  23.439  1.00 39.71  ? 473  ALA A CB  1 
ATOM   3640 N N   . GLN A 1 474 ? 7.786   14.688  24.286  1.00 49.14  ? 474  GLN A N   1 
ATOM   3641 C CA  . GLN A 1 474 ? 7.534   13.617  25.228  1.00 47.72  ? 474  GLN A CA  1 
ATOM   3642 C C   . GLN A 1 474 ? 7.258   12.353  24.459  1.00 54.35  ? 474  GLN A C   1 
ATOM   3643 O O   . GLN A 1 474 ? 7.588   11.232  24.887  1.00 50.88  ? 474  GLN A O   1 
ATOM   3644 C CB  . GLN A 1 474 ? 6.325   13.950  26.068  1.00 39.79  ? 474  GLN A CB  1 
ATOM   3645 C CG  . GLN A 1 474 ? 6.232   15.391  26.426  1.00 48.01  ? 474  GLN A CG  1 
ATOM   3646 C CD  . GLN A 1 474 ? 5.205   15.641  27.496  1.00 60.28  ? 474  GLN A CD  1 
ATOM   3647 O OE1 . GLN A 1 474 ? 5.389   15.234  28.644  1.00 63.44  ? 474  GLN A OE1 1 
ATOM   3648 N NE2 . GLN A 1 474 ? 4.109   16.317  27.131  1.00 62.24  ? 474  GLN A NE2 1 
ATOM   3649 N N   . ARG A 1 475 ? 6.613   12.538  23.321  1.00 55.23  ? 475  ARG A N   1 
ATOM   3650 C CA  . ARG A 1 475 ? 6.323   11.411  22.478  1.00 54.16  ? 475  ARG A CA  1 
ATOM   3651 C C   . ARG A 1 475 ? 7.673   10.785  22.099  1.00 51.18  ? 475  ARG A C   1 
ATOM   3652 O O   . ARG A 1 475 ? 7.876   9.558   22.231  1.00 37.29  ? 475  ARG A O   1 
ATOM   3653 C CB  . ARG A 1 475 ? 5.520   11.867  21.264  1.00 43.56  ? 475  ARG A CB  1 
ATOM   3654 C CG  . ARG A 1 475 ? 4.367   10.961  20.958  1.00 45.15  ? 475  ARG A CG  1 
ATOM   3655 C CD  . ARG A 1 475 ? 3.546   11.481  19.778  1.00 47.06  ? 475  ARG A CD  1 
ATOM   3656 N NE  . ARG A 1 475 ? 4.076   11.027  18.492  1.00 45.74  ? 475  ARG A NE  1 
ATOM   3657 C CZ  . ARG A 1 475 ? 4.122   11.787  17.408  1.00 46.33  ? 475  ARG A CZ  1 
ATOM   3658 N NH1 . ARG A 1 475 ? 3.665   13.040  17.473  1.00 43.57  ? 475  ARG A NH1 1 
ATOM   3659 N NH2 . ARG A 1 475 ? 4.623   11.303  16.269  1.00 48.72  ? 475  ARG A NH2 1 
ATOM   3660 N N   . LEU A 1 476 ? 8.605   11.644  21.674  1.00 46.29  ? 476  LEU A N   1 
ATOM   3661 C CA  . LEU A 1 476 ? 9.930   11.201  21.228  1.00 45.64  ? 476  LEU A CA  1 
ATOM   3662 C C   . LEU A 1 476 ? 10.695  10.532  22.357  1.00 41.37  ? 476  LEU A C   1 
ATOM   3663 O O   . LEU A 1 476 ? 11.311  9.474   22.168  1.00 37.89  ? 476  LEU A O   1 
ATOM   3664 C CB  . LEU A 1 476 ? 10.735  12.369  20.666  1.00 46.33  ? 476  LEU A CB  1 
ATOM   3665 C CG  . LEU A 1 476 ? 10.177  12.899  19.352  1.00 39.70  ? 476  LEU A CG  1 
ATOM   3666 C CD1 . LEU A 1 476 ? 10.988  14.047  18.870  1.00 36.30  ? 476  LEU A CD1 1 
ATOM   3667 C CD2 . LEU A 1 476 ? 10.207  11.777  18.354  1.00 45.50  ? 476  LEU A CD2 1 
ATOM   3668 N N   . MET A 1 477 ? 10.636  11.149  23.535  1.00 29.54  ? 477  MET A N   1 
ATOM   3669 C CA  . MET A 1 477 ? 11.227  10.557  24.718  1.00 30.78  ? 477  MET A CA  1 
ATOM   3670 C C   . MET A 1 477 ? 10.651  9.184   25.060  1.00 35.99  ? 477  MET A C   1 
ATOM   3671 O O   . MET A 1 477 ? 11.382  8.308   25.503  1.00 48.67  ? 477  MET A O   1 
ATOM   3672 C CB  . MET A 1 477 ? 11.107  11.497  25.908  1.00 42.31  ? 477  MET A CB  1 
ATOM   3673 C CG  . MET A 1 477 ? 12.049  12.681  25.848  1.00 43.48  ? 477  MET A CG  1 
ATOM   3674 S SD  . MET A 1 477 ? 11.504  13.982  26.964  1.00 56.85  ? 477  MET A SD  1 
ATOM   3675 C CE  . MET A 1 477 ? 12.285  13.468  28.453  1.00 32.18  ? 477  MET A CE  1 
ATOM   3676 N N   . LYS A 1 478 ? 9.354   8.989   24.858  1.00 40.20  ? 478  LYS A N   1 
ATOM   3677 C CA  . LYS A 1 478 ? 8.776   7.661   25.046  1.00 51.95  ? 478  LYS A CA  1 
ATOM   3678 C C   . LYS A 1 478 ? 9.374   6.643   24.071  1.00 46.51  ? 478  LYS A C   1 
ATOM   3679 O O   . LYS A 1 478 ? 9.794   5.567   24.497  1.00 37.70  ? 478  LYS A O   1 
ATOM   3680 C CB  . LYS A 1 478 ? 7.241   7.671   24.914  1.00 53.12  ? 478  LYS A CB  1 
ATOM   3681 C CG  . LYS A 1 478 ? 6.500   8.071   26.149  1.00 48.84  ? 478  LYS A CG  1 
ATOM   3682 C CD  . LYS A 1 478 ? 6.297   6.897   27.056  1.00 63.35  ? 478  LYS A CD  1 
ATOM   3683 C CE  . LYS A 1 478 ? 5.626   7.325   28.360  1.00 69.01  ? 478  LYS A CE  1 
ATOM   3684 N NZ  . LYS A 1 478 ? 6.575   7.399   29.508  1.00 72.83  ? 478  LYS A NZ  1 
ATOM   3685 N N   . TYR A 1 479 ? 9.394   6.971   22.775  1.00 39.81  ? 479  TYR A N   1 
ATOM   3686 C CA  . TYR A 1 479 ? 9.922   6.041   21.773  1.00 42.93  ? 479  TYR A CA  1 
ATOM   3687 C C   . TYR A 1 479 ? 11.347  5.669   22.114  1.00 46.95  ? 479  TYR A C   1 
ATOM   3688 O O   . TYR A 1 479 ? 11.710  4.494   22.099  1.00 51.17  ? 479  TYR A O   1 
ATOM   3689 C CB  . TYR A 1 479 ? 9.962   6.662   20.391  1.00 39.82  ? 479  TYR A CB  1 
ATOM   3690 C CG  . TYR A 1 479 ? 8.638   6.995   19.787  1.00 46.29  ? 479  TYR A CG  1 
ATOM   3691 C CD1 . TYR A 1 479 ? 7.555   6.125   19.896  1.00 51.98  ? 479  TYR A CD1 1 
ATOM   3692 C CD2 . TYR A 1 479 ? 8.477   8.164   19.067  1.00 43.68  ? 479  TYR A CD2 1 
ATOM   3693 C CE1 . TYR A 1 479 ? 6.338   6.428   19.314  1.00 53.77  ? 479  TYR A CE1 1 
ATOM   3694 C CE2 . TYR A 1 479 ? 7.268   8.482   18.495  1.00 57.63  ? 479  TYR A CE2 1 
ATOM   3695 C CZ  . TYR A 1 479 ? 6.197   7.611   18.610  1.00 60.13  ? 479  TYR A CZ  1 
ATOM   3696 O OH  . TYR A 1 479 ? 4.990   7.942   18.022  1.00 59.99  ? 479  TYR A OH  1 
ATOM   3697 N N   . TRP A 1 480 ? 12.157  6.687   22.396  1.00 39.94  ? 480  TRP A N   1 
ATOM   3698 C CA  . TRP A 1 480 ? 13.558  6.467   22.703  1.00 45.36  ? 480  TRP A CA  1 
ATOM   3699 C C   . TRP A 1 480 ? 13.742  5.564   23.939  1.00 49.70  ? 480  TRP A C   1 
ATOM   3700 O O   . TRP A 1 480 ? 14.379  4.513   23.850  1.00 46.24  ? 480  TRP A O   1 
ATOM   3701 C CB  . TRP A 1 480 ? 14.317  7.800   22.805  1.00 35.62  ? 480  TRP A CB  1 
ATOM   3702 C CG  . TRP A 1 480 ? 15.148  8.150   21.564  1.00 47.33  ? 480  TRP A CG  1 
ATOM   3703 C CD1 . TRP A 1 480 ? 16.526  8.298   21.486  1.00 51.40  ? 480  TRP A CD1 1 
ATOM   3704 C CD2 . TRP A 1 480 ? 14.660  8.391   20.235  1.00 49.75  ? 480  TRP A CD2 1 
ATOM   3705 N NE1 . TRP A 1 480 ? 16.903  8.614   20.195  1.00 45.08  ? 480  TRP A NE1 1 
ATOM   3706 C CE2 . TRP A 1 480 ? 15.777  8.684   19.417  1.00 48.29  ? 480  TRP A CE2 1 
ATOM   3707 C CE3 . TRP A 1 480 ? 13.384  8.384   19.661  1.00 44.06  ? 480  TRP A CE3 1 
ATOM   3708 C CZ2 . TRP A 1 480 ? 15.650  8.966   18.070  1.00 48.60  ? 480  TRP A CZ2 1 
ATOM   3709 C CZ3 . TRP A 1 480 ? 13.269  8.658   18.340  1.00 46.44  ? 480  TRP A CZ3 1 
ATOM   3710 C CH2 . TRP A 1 480 ? 14.395  8.949   17.547  1.00 46.45  ? 480  TRP A CH2 1 
ATOM   3711 N N   . THR A 1 481 ? 13.161  5.940   25.076  1.00 43.19  ? 481  THR A N   1 
ATOM   3712 C CA  . THR A 1 481 ? 13.285  5.112   26.279  1.00 41.39  ? 481  THR A CA  1 
ATOM   3713 C C   . THR A 1 481 ? 12.652  3.724   26.141  1.00 47.62  ? 481  THR A C   1 
ATOM   3714 O O   . THR A 1 481 ? 13.240  2.731   26.566  1.00 52.53  ? 481  THR A O   1 
ATOM   3715 C CB  . THR A 1 481 ? 12.670  5.779   27.493  1.00 41.26  ? 481  THR A CB  1 
ATOM   3716 O OG1 . THR A 1 481 ? 11.308  6.116   27.196  1.00 67.81  ? 481  THR A OG1 1 
ATOM   3717 C CG2 . THR A 1 481 ? 13.411  7.016   27.832  1.00 27.09  ? 481  THR A CG2 1 
ATOM   3718 N N   . ASN A 1 482 ? 11.450  3.658   25.572  1.00 46.62  ? 482  ASN A N   1 
ATOM   3719 C CA  . ASN A 1 482 ? 10.821  2.369   25.278  1.00 42.64  ? 482  ASN A CA  1 
ATOM   3720 C C   . ASN A 1 482 ? 11.766  1.474   24.511  1.00 45.01  ? 482  ASN A C   1 
ATOM   3721 O O   . ASN A 1 482 ? 11.873  0.276   24.802  1.00 44.58  ? 482  ASN A O   1 
ATOM   3722 C CB  . ASN A 1 482 ? 9.512   2.536   24.501  1.00 36.72  ? 482  ASN A CB  1 
ATOM   3723 C CG  . ASN A 1 482 ? 8.371   2.900   25.396  1.00 45.14  ? 482  ASN A CG  1 
ATOM   3724 O OD1 . ASN A 1 482 ? 8.471   2.775   26.620  1.00 47.16  ? 482  ASN A OD1 1 
ATOM   3725 N ND2 . ASN A 1 482 ? 7.287   3.371   24.811  1.00 50.50  ? 482  ASN A ND2 1 
ATOM   3726 N N   . PHE A 1 483 ? 12.454  2.063   23.535  1.00 42.72  ? 483  PHE A N   1 
ATOM   3727 C CA  . PHE A 1 483 ? 13.448  1.324   22.786  1.00 45.73  ? 483  PHE A CA  1 
ATOM   3728 C C   . PHE A 1 483 ? 14.641  0.870   23.649  1.00 51.98  ? 483  PHE A C   1 
ATOM   3729 O O   . PHE A 1 483 ? 15.069  -0.288  23.571  1.00 51.31  ? 483  PHE A O   1 
ATOM   3730 C CB  . PHE A 1 483 ? 13.937  2.086   21.556  1.00 40.17  ? 483  PHE A CB  1 
ATOM   3731 C CG  . PHE A 1 483 ? 14.990  1.335   20.804  1.00 39.66  ? 483  PHE A CG  1 
ATOM   3732 C CD1 . PHE A 1 483 ? 14.644  0.259   19.984  1.00 40.27  ? 483  PHE A CD1 1 
ATOM   3733 C CD2 . PHE A 1 483 ? 16.331  1.638   20.969  1.00 28.85  ? 483  PHE A CD2 1 
ATOM   3734 C CE1 . PHE A 1 483 ? 15.625  -0.484  19.329  1.00 42.87  ? 483  PHE A CE1 1 
ATOM   3735 C CE2 . PHE A 1 483 ? 17.308  0.894   20.308  1.00 36.33  ? 483  PHE A CE2 1 
ATOM   3736 C CZ  . PHE A 1 483 ? 16.958  -0.160  19.484  1.00 35.59  ? 483  PHE A CZ  1 
ATOM   3737 N N   . ALA A 1 484 ? 15.176  1.769   24.472  1.00 49.90  ? 484  ALA A N   1 
ATOM   3738 C CA  . ALA A 1 484 ? 16.244  1.393   25.398  1.00 42.37  ? 484  ALA A CA  1 
ATOM   3739 C C   . ALA A 1 484 ? 15.783  0.214   26.243  1.00 45.62  ? 484  ALA A C   1 
ATOM   3740 O O   . ALA A 1 484 ? 16.487  -0.789  26.356  1.00 35.58  ? 484  ALA A O   1 
ATOM   3741 C CB  . ALA A 1 484 ? 16.600  2.543   26.284  1.00 35.10  ? 484  ALA A CB  1 
ATOM   3742 N N   . ARG A 1 485 ? 14.579  0.350   26.803  1.00 50.64  ? 485  ARG A N   1 
ATOM   3743 C CA  . ARG A 1 485 ? 13.946  -0.643  27.680  1.00 54.58  ? 485  ARG A CA  1 
ATOM   3744 C C   . ARG A 1 485 ? 13.726  -2.034  27.099  1.00 51.31  ? 485  ARG A C   1 
ATOM   3745 O O   . ARG A 1 485 ? 13.922  -3.026  27.787  1.00 50.63  ? 485  ARG A O   1 
ATOM   3746 C CB  . ARG A 1 485 ? 12.579  -0.136  28.132  1.00 68.16  ? 485  ARG A CB  1 
ATOM   3747 C CG  . ARG A 1 485 ? 12.411  0.081   29.621  1.00 75.17  ? 485  ARG A CG  1 
ATOM   3748 C CD  . ARG A 1 485 ? 10.973  0.505   29.940  1.00 80.52  ? 485  ARG A CD  1 
ATOM   3749 N NE  . ARG A 1 485 ? 10.578  1.752   29.266  1.00 82.59  ? 485  ARG A NE  1 
ATOM   3750 C CZ  . ARG A 1 485 ? 10.832  2.985   29.723  1.00 78.98  ? 485  ARG A CZ  1 
ATOM   3751 N NH1 . ARG A 1 485 ? 11.491  3.163   30.873  1.00 66.34  ? 485  ARG A NH1 1 
ATOM   3752 N NH2 . ARG A 1 485 ? 10.419  4.051   29.033  1.00 77.64  ? 485  ARG A NH2 1 
ATOM   3753 N N   . THR A 1 486 ? 13.297  -2.113  25.847  1.00 49.39  ? 486  THR A N   1 
ATOM   3754 C CA  . THR A 1 486 ? 12.707  -3.359  25.346  1.00 47.33  ? 486  THR A CA  1 
ATOM   3755 C C   . THR A 1 486 ? 13.173  -3.730  23.957  1.00 56.15  ? 486  THR A C   1 
ATOM   3756 O O   . THR A 1 486 ? 12.825  -4.798  23.445  1.00 51.25  ? 486  THR A O   1 
ATOM   3757 C CB  . THR A 1 486 ? 11.186  -3.220  25.250  1.00 37.91  ? 486  THR A CB  1 
ATOM   3758 O OG1 . THR A 1 486 ? 10.859  -2.235  24.254  1.00 37.84  ? 486  THR A OG1 1 
ATOM   3759 C CG2 . THR A 1 486 ? 10.618  -2.784  26.579  1.00 23.39  ? 486  THR A CG2 1 
ATOM   3760 N N   . GLY A 1 487 ? 13.943  -2.836  23.340  1.00 62.29  ? 487  GLY A N   1 
ATOM   3761 C CA  . GLY A 1 487 ? 14.375  -3.015  21.967  1.00 58.66  ? 487  GLY A CA  1 
ATOM   3762 C C   . GLY A 1 487 ? 13.209  -2.789  21.032  1.00 51.17  ? 487  GLY A C   1 
ATOM   3763 O O   . GLY A 1 487 ? 13.196  -3.304  19.920  1.00 46.78  ? 487  GLY A O   1 
ATOM   3764 N N   . ASP A 1 488 ? 12.226  -2.022  21.499  1.00 48.43  ? 488  ASP A N   1 
ATOM   3765 C CA  . ASP A 1 488 ? 11.053  -1.693  20.696  1.00 52.01  ? 488  ASP A CA  1 
ATOM   3766 C C   . ASP A 1 488 ? 10.468  -0.313  21.092  1.00 45.83  ? 488  ASP A C   1 
ATOM   3767 O O   . ASP A 1 488 ? 10.065  -0.103  22.232  1.00 48.80  ? 488  ASP A O   1 
ATOM   3768 C CB  . ASP A 1 488 ? 10.026  -2.836  20.809  1.00 52.51  ? 488  ASP A CB  1 
ATOM   3769 C CG  . ASP A 1 488 ? 8.756   -2.587  20.014  1.00 58.52  ? 488  ASP A CG  1 
ATOM   3770 O OD1 . ASP A 1 488 ? 8.588   -1.499  19.415  1.00 68.53  ? 488  ASP A OD1 1 
ATOM   3771 O OD2 . ASP A 1 488 ? 7.903   -3.491  20.006  1.00 52.04  ? 488  ASP A OD2 1 
ATOM   3772 N N   . PRO A 1 489 ? 10.419  0.626   20.139  1.00 43.01  ? 489  PRO A N   1 
ATOM   3773 C CA  . PRO A 1 489 ? 9.979   1.986   20.462  1.00 49.02  ? 489  PRO A CA  1 
ATOM   3774 C C   . PRO A 1 489 ? 8.498   2.026   20.802  1.00 50.22  ? 489  PRO A C   1 
ATOM   3775 O O   . PRO A 1 489 ? 8.048   2.924   21.523  1.00 51.25  ? 489  PRO A O   1 
ATOM   3776 C CB  . PRO A 1 489 ? 10.240  2.767   19.171  1.00 43.17  ? 489  PRO A CB  1 
ATOM   3777 C CG  . PRO A 1 489 ? 10.234  1.727   18.078  1.00 44.78  ? 489  PRO A CG  1 
ATOM   3778 C CD  . PRO A 1 489 ? 10.695  0.442   18.698  1.00 43.96  ? 489  PRO A CD  1 
ATOM   3779 N N   . ASN A 1 490 ? 7.758   1.052   20.283  1.00 48.71  ? 490  ASN A N   1 
ATOM   3780 C CA  . ASN A 1 490 ? 6.303   1.035   20.425  1.00 59.97  ? 490  ASN A CA  1 
ATOM   3781 C C   . ASN A 1 490 ? 5.806   0.991   21.870  1.00 66.52  ? 490  ASN A C   1 
ATOM   3782 O O   . ASN A 1 490 ? 6.380   0.320   22.727  1.00 63.88  ? 490  ASN A O   1 
ATOM   3783 C CB  . ASN A 1 490 ? 5.701   -0.110  19.602  1.00 58.23  ? 490  ASN A CB  1 
ATOM   3784 C CG  . ASN A 1 490 ? 5.583   0.231   18.118  1.00 55.56  ? 490  ASN A CG  1 
ATOM   3785 O OD1 . ASN A 1 490 ? 4.916   1.198   17.737  1.00 54.18  ? 490  ASN A OD1 1 
ATOM   3786 N ND2 . ASN A 1 490 ? 6.208   -0.579  17.277  1.00 48.52  ? 490  ASN A ND2 1 
ATOM   3787 N N   . ASP A 1 491 ? 4.738   1.726   22.144  1.00 84.43  ? 491  ASP A N   1 
ATOM   3788 C CA  . ASP A 1 491 ? 4.140   1.669   23.471  1.00 100.28 ? 491  ASP A CA  1 
ATOM   3789 C C   . ASP A 1 491 ? 3.320   0.382   23.586  1.00 99.48  ? 491  ASP A C   1 
ATOM   3790 O O   . ASP A 1 491 ? 2.400   0.146   22.790  1.00 93.75  ? 491  ASP A O   1 
ATOM   3791 C CB  . ASP A 1 491 ? 3.287   2.917   23.749  1.00 112.64 ? 491  ASP A CB  1 
ATOM   3792 C CG  . ASP A 1 491 ? 3.180   3.237   25.240  1.00 121.56 ? 491  ASP A CG  1 
ATOM   3793 O OD1 . ASP A 1 491 ? 3.210   4.437   25.599  1.00 121.54 ? 491  ASP A OD1 1 
ATOM   3794 O OD2 . ASP A 1 491 ? 3.077   2.286   26.051  1.00 124.14 ? 491  ASP A OD2 1 
ATOM   3795 N N   . PRO A 1 492 ? 3.676   -0.475  24.559  1.00 102.28 ? 492  PRO A N   1 
ATOM   3796 C CA  . PRO A 1 492 ? 2.972   -1.746  24.746  1.00 106.49 ? 492  PRO A CA  1 
ATOM   3797 C C   . PRO A 1 492 ? 1.540   -1.491  25.212  1.00 115.82 ? 492  PRO A C   1 
ATOM   3798 O O   . PRO A 1 492 ? 0.593   -2.110  24.721  1.00 111.58 ? 492  PRO A O   1 
ATOM   3799 C CB  . PRO A 1 492 ? 3.783   -2.440  25.851  1.00 100.53 ? 492  PRO A CB  1 
ATOM   3800 C CG  . PRO A 1 492 ? 5.074   -1.687  25.946  1.00 97.08  ? 492  PRO A CG  1 
ATOM   3801 C CD  . PRO A 1 492 ? 4.747   -0.289  25.552  1.00 99.61  ? 492  PRO A CD  1 
ATOM   3802 N N   . ARG A 1 493 ? 1.395   -0.563  26.153  1.00 129.57 ? 493  ARG A N   1 
ATOM   3803 C CA  . ARG A 1 493 ? 0.088   -0.164  26.659  1.00 143.54 ? 493  ARG A CA  1 
ATOM   3804 C C   . ARG A 1 493 ? -0.750  0.453   25.539  1.00 153.92 ? 493  ARG A C   1 
ATOM   3805 O O   . ARG A 1 493 ? -1.626  -0.205  24.964  1.00 155.31 ? 493  ARG A O   1 
ATOM   3806 C CB  . ARG A 1 493 ? 0.255   0.836   27.812  1.00 144.75 ? 493  ARG A CB  1 
ATOM   3807 C CG  . ARG A 1 493 ? -1.025  1.139   28.581  1.00 149.93 ? 493  ARG A CG  1 
ATOM   3808 C CD  . ARG A 1 493 ? -1.422  -0.010  29.512  1.00 151.99 ? 493  ARG A CD  1 
ATOM   3809 N NE  . ARG A 1 493 ? -2.730  0.202   30.134  1.00 152.24 ? 493  ARG A NE  1 
ATOM   3810 C CZ  . ARG A 1 493 ? -3.873  -0.293  29.666  1.00 154.42 ? 493  ARG A CZ  1 
ATOM   3811 N NH1 . ARG A 1 493 ? -3.874  -1.037  28.568  1.00 154.29 ? 493  ARG A NH1 1 
ATOM   3812 N NH2 . ARG A 1 493 ? -5.017  -0.048  30.295  1.00 156.26 ? 493  ARG A NH2 1 
ATOM   3813 N N   . ASP A 1 494 ? -0.455  1.715   25.229  1.00 159.23 ? 494  ASP A N   1 
ATOM   3814 C CA  . ASP A 1 494 ? -1.182  2.492   24.223  1.00 159.96 ? 494  ASP A CA  1 
ATOM   3815 C C   . ASP A 1 494 ? -0.961  1.986   22.797  1.00 159.07 ? 494  ASP A C   1 
ATOM   3816 O O   . ASP A 1 494 ? -0.110  2.500   22.067  1.00 156.08 ? 494  ASP A O   1 
ATOM   3817 C CB  . ASP A 1 494 ? -0.782  3.966   24.313  1.00 159.30 ? 494  ASP A CB  1 
ATOM   3818 C CG  . ASP A 1 494 ? -1.626  4.854   23.426  1.00 160.06 ? 494  ASP A CG  1 
ATOM   3819 O OD1 . ASP A 1 494 ? -2.523  4.328   22.734  1.00 162.27 ? 494  ASP A OD1 1 
ATOM   3820 O OD2 . ASP A 1 494 ? -1.396  6.081   23.426  1.00 158.41 ? 494  ASP A OD2 1 
ATOM   3821 N N   . SER A 1 495 ? -1.746  0.987   22.405  1.00 161.13 ? 495  SER A N   1 
ATOM   3822 C CA  . SER A 1 495 ? -1.642  0.399   21.075  1.00 159.39 ? 495  SER A CA  1 
ATOM   3823 C C   . SER A 1 495 ? -2.768  0.875   20.151  1.00 156.31 ? 495  SER A C   1 
ATOM   3824 O O   . SER A 1 495 ? -2.885  0.413   19.014  1.00 154.03 ? 495  SER A O   1 
ATOM   3825 C CB  . SER A 1 495 ? -1.630  -1.127  21.170  1.00 158.81 ? 495  SER A CB  1 
ATOM   3826 O OG  . SER A 1 495 ? -2.613  -1.577  22.086  1.00 159.21 ? 495  SER A OG  1 
ATOM   3827 N N   . LYS A 1 496 ? -3.592  1.796   20.650  1.00 151.77 ? 496  LYS A N   1 
ATOM   3828 C CA  . LYS A 1 496 ? -4.598  2.469   19.829  1.00 144.13 ? 496  LYS A CA  1 
ATOM   3829 C C   . LYS A 1 496 ? -3.914  3.314   18.743  1.00 137.45 ? 496  LYS A C   1 
ATOM   3830 O O   . LYS A 1 496 ? -4.142  3.121   17.540  1.00 130.75 ? 496  LYS A O   1 
ATOM   3831 C CB  . LYS A 1 496 ? -5.513  3.343   20.702  1.00 142.07 ? 496  LYS A CB  1 
ATOM   3832 C CG  . LYS A 1 496 ? -6.393  2.557   21.675  1.00 144.19 ? 496  LYS A CG  1 
ATOM   3833 C CD  . LYS A 1 496 ? -7.402  3.445   22.425  1.00 146.04 ? 496  LYS A CD  1 
ATOM   3834 C CE  . LYS A 1 496 ? -8.321  2.607   23.337  1.00 144.80 ? 496  LYS A CE  1 
ATOM   3835 N NZ  . LYS A 1 496 ? -9.287  3.408   24.151  1.00 141.64 ? 496  LYS A NZ  1 
ATOM   3836 N N   . SER A 1 497 ? -3.067  4.243   19.188  1.00 133.82 ? 497  SER A N   1 
ATOM   3837 C CA  . SER A 1 497 ? -2.234  5.064   18.306  1.00 123.03 ? 497  SER A CA  1 
ATOM   3838 C C   . SER A 1 497 ? -1.348  4.218   17.390  1.00 114.84 ? 497  SER A C   1 
ATOM   3839 O O   . SER A 1 497 ? -0.796  3.202   17.817  1.00 116.88 ? 497  SER A O   1 
ATOM   3840 C CB  . SER A 1 497 ? -1.363  6.007   19.139  1.00 116.80 ? 497  SER A CB  1 
ATOM   3841 O OG  . SER A 1 497 ? -0.699  5.305   20.180  1.00 113.42 ? 497  SER A OG  1 
ATOM   3842 N N   . PRO A 1 498 ? -1.194  4.652   16.129  1.00 102.52 ? 498  PRO A N   1 
ATOM   3843 C CA  . PRO A 1 498 ? -0.527  3.877   15.074  1.00 89.80  ? 498  PRO A CA  1 
ATOM   3844 C C   . PRO A 1 498 ? 0.802   3.298   15.542  1.00 75.83  ? 498  PRO A C   1 
ATOM   3845 O O   . PRO A 1 498 ? 1.462   3.908   16.382  1.00 70.37  ? 498  PRO A O   1 
ATOM   3846 C CB  . PRO A 1 498 ? -0.312  4.917   13.961  1.00 92.56  ? 498  PRO A CB  1 
ATOM   3847 C CG  . PRO A 1 498 ? -0.504  6.259   14.645  1.00 95.59  ? 498  PRO A CG  1 
ATOM   3848 C CD  . PRO A 1 498 ? -1.569  5.991   15.646  1.00 100.04 ? 498  PRO A CD  1 
ATOM   3849 N N   . GLN A 1 499 ? 1.177   2.139   15.003  1.00 72.72  ? 499  GLN A N   1 
ATOM   3850 C CA  . GLN A 1 499 ? 2.399   1.426   15.404  1.00 66.46  ? 499  GLN A CA  1 
ATOM   3851 C C   . GLN A 1 499 ? 3.591   1.707   14.485  1.00 63.63  ? 499  GLN A C   1 
ATOM   3852 O O   . GLN A 1 499 ? 3.426   2.071   13.317  1.00 58.97  ? 499  GLN A O   1 
ATOM   3853 C CB  . GLN A 1 499 ? 2.147   -0.086  15.434  1.00 67.01  ? 499  GLN A CB  1 
ATOM   3854 C CG  . GLN A 1 499 ? 1.005   -0.482  16.327  1.00 72.81  ? 499  GLN A CG  1 
ATOM   3855 C CD  . GLN A 1 499 ? 1.403   -0.460  17.786  1.00 76.98  ? 499  GLN A CD  1 
ATOM   3856 O OE1 . GLN A 1 499 ? 2.209   -1.291  18.219  1.00 73.36  ? 499  GLN A OE1 1 
ATOM   3857 N NE2 . GLN A 1 499 ? 0.841   0.491   18.560  1.00 73.66  ? 499  GLN A NE2 1 
ATOM   3858 N N   . TRP A 1 500 ? 4.791   1.513   15.024  1.00 62.34  ? 500  TRP A N   1 
ATOM   3859 C CA  . TRP A 1 500 ? 6.037   1.710   14.287  1.00 55.39  ? 500  TRP A CA  1 
ATOM   3860 C C   . TRP A 1 500 ? 6.562   0.317   13.877  1.00 53.03  ? 500  TRP A C   1 
ATOM   3861 O O   . TRP A 1 500 ? 7.058   -0.434  14.717  1.00 53.07  ? 500  TRP A O   1 
ATOM   3862 C CB  . TRP A 1 500 ? 7.030   2.471   15.188  1.00 45.33  ? 500  TRP A CB  1 
ATOM   3863 C CG  . TRP A 1 500 ? 8.371   2.884   14.604  1.00 48.63  ? 500  TRP A CG  1 
ATOM   3864 C CD1 . TRP A 1 500 ? 8.993   2.382   13.491  1.00 56.11  ? 500  TRP A CD1 1 
ATOM   3865 C CD2 . TRP A 1 500 ? 9.271   3.856   15.158  1.00 48.44  ? 500  TRP A CD2 1 
ATOM   3866 N NE1 . TRP A 1 500 ? 10.223  2.995   13.314  1.00 56.44  ? 500  TRP A NE1 1 
ATOM   3867 C CE2 . TRP A 1 500 ? 10.409  3.906   14.320  1.00 50.36  ? 500  TRP A CE2 1 
ATOM   3868 C CE3 . TRP A 1 500 ? 9.219   4.702   16.270  1.00 42.79  ? 500  TRP A CE3 1 
ATOM   3869 C CZ2 . TRP A 1 500 ? 11.468  4.769   14.559  1.00 44.47  ? 500  TRP A CZ2 1 
ATOM   3870 C CZ3 . TRP A 1 500 ? 10.277  5.547   16.509  1.00 45.99  ? 500  TRP A CZ3 1 
ATOM   3871 C CH2 . TRP A 1 500 ? 11.390  5.577   15.656  1.00 44.10  ? 500  TRP A CH2 1 
ATOM   3872 N N   . PRO A 1 501 ? 6.429   -0.041  12.583  1.00 48.01  ? 501  PRO A N   1 
ATOM   3873 C CA  . PRO A 1 501 ? 6.869   -1.341  12.065  1.00 43.30  ? 501  PRO A CA  1 
ATOM   3874 C C   . PRO A 1 501 ? 8.385   -1.422  11.984  1.00 43.07  ? 501  PRO A C   1 
ATOM   3875 O O   . PRO A 1 501 ? 9.019   -0.390  11.847  1.00 51.24  ? 501  PRO A O   1 
ATOM   3876 C CB  . PRO A 1 501 ? 6.313   -1.364  10.633  1.00 43.15  ? 501  PRO A CB  1 
ATOM   3877 C CG  . PRO A 1 501 ? 5.613   -0.083  10.405  1.00 47.75  ? 501  PRO A CG  1 
ATOM   3878 C CD  . PRO A 1 501 ? 5.973   0.851   11.504  1.00 50.21  ? 501  PRO A CD  1 
ATOM   3879 N N   . PRO A 1 502 ? 8.966   -2.628  12.072  1.00 43.15  ? 502  PRO A N   1 
ATOM   3880 C CA  . PRO A 1 502 ? 10.404  -2.720  11.778  1.00 44.58  ? 502  PRO A CA  1 
ATOM   3881 C C   . PRO A 1 502 ? 10.733  -2.468  10.314  1.00 55.69  ? 502  PRO A C   1 
ATOM   3882 O O   . PRO A 1 502 ? 9.911   -2.711  9.436   1.00 63.25  ? 502  PRO A O   1 
ATOM   3883 C CB  . PRO A 1 502 ? 10.742  -4.155  12.152  1.00 39.22  ? 502  PRO A CB  1 
ATOM   3884 C CG  . PRO A 1 502 ? 9.759   -4.468  13.278  1.00 36.14  ? 502  PRO A CG  1 
ATOM   3885 C CD  . PRO A 1 502 ? 8.481   -3.794  12.832  1.00 36.49  ? 502  PRO A CD  1 
ATOM   3886 N N   . TYR A 1 503 ? 11.926  -1.945  10.063  1.00 52.55  ? 503  TYR A N   1 
ATOM   3887 C CA  . TYR A 1 503 ? 12.418  -1.818  8.709   1.00 45.95  ? 503  TYR A CA  1 
ATOM   3888 C C   . TYR A 1 503 ? 12.867  -3.207  8.227   1.00 45.14  ? 503  TYR A C   1 
ATOM   3889 O O   . TYR A 1 503 ? 13.601  -3.908  8.929   1.00 46.54  ? 503  TYR A O   1 
ATOM   3890 C CB  . TYR A 1 503 ? 13.574  -0.799  8.655   1.00 40.65  ? 503  TYR A CB  1 
ATOM   3891 C CG  . TYR A 1 503 ? 14.174  -0.603  7.265   1.00 42.63  ? 503  TYR A CG  1 
ATOM   3892 C CD1 . TYR A 1 503 ? 15.179  -1.463  6.782   1.00 38.35  ? 503  TYR A CD1 1 
ATOM   3893 C CD2 . TYR A 1 503 ? 13.746  0.435   6.443   1.00 41.15  ? 503  TYR A CD2 1 
ATOM   3894 C CE1 . TYR A 1 503 ? 15.726  -1.288  5.528   1.00 39.48  ? 503  TYR A CE1 1 
ATOM   3895 C CE2 . TYR A 1 503 ? 14.289  0.617   5.177   1.00 48.04  ? 503  TYR A CE2 1 
ATOM   3896 C CZ  . TYR A 1 503 ? 15.273  -0.247  4.723   1.00 49.00  ? 503  TYR A CZ  1 
ATOM   3897 O OH  . TYR A 1 503 ? 15.804  -0.072  3.463   1.00 49.38  ? 503  TYR A OH  1 
ATOM   3898 N N   . THR A 1 504 ? 12.420  -3.599  7.034   1.00 42.03  ? 504  THR A N   1 
ATOM   3899 C CA  . THR A 1 504 ? 12.806  -4.883  6.436   1.00 47.77  ? 504  THR A CA  1 
ATOM   3900 C C   . THR A 1 504 ? 13.383  -4.727  5.031   1.00 49.60  ? 504  THR A C   1 
ATOM   3901 O O   . THR A 1 504 ? 13.104  -3.753  4.339   1.00 41.96  ? 504  THR A O   1 
ATOM   3902 C CB  . THR A 1 504 ? 11.616  -5.887  6.365   1.00 48.22  ? 504  THR A CB  1 
ATOM   3903 O OG1 . THR A 1 504 ? 10.586  -5.388  5.487   1.00 49.01  ? 504  THR A OG1 1 
ATOM   3904 C CG2 . THR A 1 504 ? 11.042  -6.152  7.759   1.00 28.29  ? 504  THR A CG2 1 
ATOM   3905 N N   . THR A 1 505 ? 14.186  -5.698  4.618   1.00 58.97  ? 505  THR A N   1 
ATOM   3906 C CA  . THR A 1 505 ? 14.672  -5.756  3.254   1.00 59.28  ? 505  THR A CA  1 
ATOM   3907 C C   . THR A 1 505 ? 13.487  -5.570  2.312   1.00 59.49  ? 505  THR A C   1 
ATOM   3908 O O   . THR A 1 505 ? 13.517  -4.721  1.418   1.00 62.75  ? 505  THR A O   1 
ATOM   3909 C CB  . THR A 1 505 ? 15.295  -7.123  2.988   1.00 76.60  ? 505  THR A CB  1 
ATOM   3910 O OG1 . THR A 1 505 ? 16.047  -7.540  4.139   1.00 86.23  ? 505  THR A OG1 1 
ATOM   3911 C CG2 . THR A 1 505 ? 16.194  -7.076  1.770   1.00 83.08  ? 505  THR A CG2 1 
ATOM   3912 N N   . ALA A 1 506 ? 12.431  -6.349  2.549   1.00 56.16  ? 506  ALA A N   1 
ATOM   3913 C CA  . ALA A 1 506 ? 11.254  -6.383  1.686   1.00 52.40  ? 506  ALA A CA  1 
ATOM   3914 C C   . ALA A 1 506 ? 10.507  -5.083  1.645   1.00 66.82  ? 506  ALA A C   1 
ATOM   3915 O O   . ALA A 1 506 ? 10.461  -4.424  0.607   1.00 82.82  ? 506  ALA A O   1 
ATOM   3916 C CB  . ALA A 1 506 ? 10.306  -7.471  2.126   1.00 55.99  ? 506  ALA A CB  1 
ATOM   3917 N N   . ALA A 1 507 ? 9.906   -4.716  2.772   1.00 62.42  ? 507  ALA A N   1 
ATOM   3918 C CA  . ALA A 1 507 ? 8.966   -3.595  2.787   1.00 59.26  ? 507  ALA A CA  1 
ATOM   3919 C C   . ALA A 1 507 ? 9.595   -2.214  3.040   1.00 50.77  ? 507  ALA A C   1 
ATOM   3920 O O   . ALA A 1 507 ? 8.972   -1.190  2.770   1.00 49.58  ? 507  ALA A O   1 
ATOM   3921 C CB  . ALA A 1 507 ? 7.830   -3.871  3.764   1.00 53.25  ? 507  ALA A CB  1 
ATOM   3922 N N   . GLN A 1 508 ? 10.823  -2.194  3.548   1.00 48.76  ? 508  GLN A N   1 
ATOM   3923 C CA  . GLN A 1 508 ? 11.546  -0.944  3.804   1.00 56.40  ? 508  GLN A CA  1 
ATOM   3924 C C   . GLN A 1 508 ? 10.649  0.129   4.404   1.00 55.72  ? 508  GLN A C   1 
ATOM   3925 O O   . GLN A 1 508 ? 10.539  1.240   3.886   1.00 51.50  ? 508  GLN A O   1 
ATOM   3926 C CB  . GLN A 1 508 ? 12.185  -0.416  2.521   1.00 46.86  ? 508  GLN A CB  1 
ATOM   3927 C CG  . GLN A 1 508 ? 12.734  -1.507  1.651   1.00 43.59  ? 508  GLN A CG  1 
ATOM   3928 C CD  . GLN A 1 508 ? 13.138  -0.989  0.313   1.00 53.17  ? 508  GLN A CD  1 
ATOM   3929 O OE1 . GLN A 1 508 ? 13.913  -0.042  0.223   1.00 59.83  ? 508  GLN A OE1 1 
ATOM   3930 N NE2 . GLN A 1 508 ? 12.612  -1.595  -0.750  1.00 58.51  ? 508  GLN A NE2 1 
ATOM   3931 N N   . GLN A 1 509 ? 10.010  -0.221  5.505   1.00 53.52  ? 509  GLN A N   1 
ATOM   3932 C CA  . GLN A 1 509 ? 9.128   0.697   6.191   1.00 56.99  ? 509  GLN A CA  1 
ATOM   3933 C C   . GLN A 1 509 ? 9.856   1.544   7.224   1.00 53.52  ? 509  GLN A C   1 
ATOM   3934 O O   . GLN A 1 509 ? 10.688  1.053   7.991   1.00 48.79  ? 509  GLN A O   1 
ATOM   3935 C CB  . GLN A 1 509 ? 8.004   -0.080  6.875   1.00 54.50  ? 509  GLN A CB  1 
ATOM   3936 C CG  . GLN A 1 509 ? 7.255   -0.969  5.930   1.00 58.03  ? 509  GLN A CG  1 
ATOM   3937 C CD  . GLN A 1 509 ? 5.960   -1.448  6.513   1.00 57.56  ? 509  GLN A CD  1 
ATOM   3938 O OE1 . GLN A 1 509 ? 5.945   -2.357  7.334   1.00 61.20  ? 509  GLN A OE1 1 
ATOM   3939 N NE2 . GLN A 1 509 ? 4.857   -0.839  6.093   1.00 55.63  ? 509  GLN A NE2 1 
ATOM   3940 N N   . TYR A 1 510 ? 9.496   2.817   7.258   1.00 50.01  ? 510  TYR A N   1 
ATOM   3941 C CA  . TYR A 1 510 ? 10.007  3.732   8.256   1.00 51.49  ? 510  TYR A CA  1 
ATOM   3942 C C   . TYR A 1 510 ? 8.856   4.654   8.692   1.00 53.69  ? 510  TYR A C   1 
ATOM   3943 O O   . TYR A 1 510 ? 7.837   4.708   8.014   1.00 68.32  ? 510  TYR A O   1 
ATOM   3944 C CB  . TYR A 1 510 ? 11.197  4.501   7.660   1.00 54.06  ? 510  TYR A CB  1 
ATOM   3945 C CG  . TYR A 1 510 ? 10.877  5.406   6.473   1.00 51.55  ? 510  TYR A CG  1 
ATOM   3946 C CD1 . TYR A 1 510 ? 10.857  4.922   5.163   1.00 51.94  ? 510  TYR A CD1 1 
ATOM   3947 C CD2 . TYR A 1 510 ? 10.622  6.750   6.671   1.00 48.36  ? 510  TYR A CD2 1 
ATOM   3948 C CE1 . TYR A 1 510 ? 10.576  5.767   4.093   1.00 53.08  ? 510  TYR A CE1 1 
ATOM   3949 C CE2 . TYR A 1 510 ? 10.320  7.589   5.621   1.00 56.58  ? 510  TYR A CE2 1 
ATOM   3950 C CZ  . TYR A 1 510 ? 10.303  7.111   4.339   1.00 59.61  ? 510  TYR A CZ  1 
ATOM   3951 O OH  . TYR A 1 510 ? 10.023  8.017   3.333   1.00 61.05  ? 510  TYR A OH  1 
ATOM   3952 N N   . VAL A 1 511 ? 8.985   5.360   9.816   1.00 43.51  ? 511  VAL A N   1 
ATOM   3953 C CA  . VAL A 1 511 ? 7.946   6.321   10.199  1.00 33.84  ? 511  VAL A CA  1 
ATOM   3954 C C   . VAL A 1 511 ? 8.410   7.753   10.051  1.00 39.00  ? 511  VAL A C   1 
ATOM   3955 O O   . VAL A 1 511 ? 9.597   8.029   10.058  1.00 50.63  ? 511  VAL A O   1 
ATOM   3956 C CB  . VAL A 1 511 ? 7.393   6.130   11.656  1.00 42.50  ? 511  VAL A CB  1 
ATOM   3957 C CG1 . VAL A 1 511 ? 6.584   4.866   11.772  1.00 44.21  ? 511  VAL A CG1 1 
ATOM   3958 C CG2 . VAL A 1 511 ? 8.498   6.157   12.693  1.00 42.21  ? 511  VAL A CG2 1 
ATOM   3959 N N   . SER A 1 512 ? 7.455   8.660   9.912   1.00 45.38  ? 512  SER A N   1 
ATOM   3960 C CA  . SER A 1 512 ? 7.719   10.082  10.027  1.00 45.84  ? 512  SER A CA  1 
ATOM   3961 C C   . SER A 1 512 ? 7.483   10.548  11.461  1.00 52.79  ? 512  SER A C   1 
ATOM   3962 O O   . SER A 1 512 ? 6.430   10.267  12.065  1.00 60.88  ? 512  SER A O   1 
ATOM   3963 C CB  . SER A 1 512 ? 6.802   10.862  9.096   1.00 41.42  ? 512  SER A CB  1 
ATOM   3964 O OG  . SER A 1 512 ? 5.440   10.562  9.370   1.00 47.99  ? 512  SER A OG  1 
ATOM   3965 N N   . LEU A 1 513 ? 8.468   11.258  12.000  1.00 45.43  ? 513  LEU A N   1 
ATOM   3966 C CA  . LEU A 1 513 ? 8.318   11.938  13.283  1.00 44.15  ? 513  LEU A CA  1 
ATOM   3967 C C   . LEU A 1 513 ? 8.079   13.448  13.075  1.00 44.72  ? 513  LEU A C   1 
ATOM   3968 O O   . LEU A 1 513 ? 8.967   14.179  12.625  1.00 46.96  ? 513  LEU A O   1 
ATOM   3969 C CB  . LEU A 1 513 ? 9.548   11.694  14.170  1.00 41.38  ? 513  LEU A CB  1 
ATOM   3970 C CG  . LEU A 1 513 ? 10.012  10.250  14.367  1.00 39.12  ? 513  LEU A CG  1 
ATOM   3971 C CD1 . LEU A 1 513 ? 11.370  10.149  15.082  1.00 32.39  ? 513  LEU A CD1 1 
ATOM   3972 C CD2 . LEU A 1 513 ? 8.964   9.524   15.137  1.00 35.96  ? 513  LEU A CD2 1 
ATOM   3973 N N   . ASN A 1 514 ? 6.863   13.888  13.386  1.00 45.40  ? 514  ASN A N   1 
ATOM   3974 C CA  . ASN A 1 514 ? 6.446   15.302  13.350  1.00 53.80  ? 514  ASN A CA  1 
ATOM   3975 C C   . ASN A 1 514 ? 5.243   15.470  14.294  1.00 57.72  ? 514  ASN A C   1 
ATOM   3976 O O   . ASN A 1 514 ? 4.917   14.545  15.036  1.00 64.96  ? 514  ASN A O   1 
ATOM   3977 C CB  . ASN A 1 514 ? 6.092   15.751  11.924  1.00 57.62  ? 514  ASN A CB  1 
ATOM   3978 C CG  . ASN A 1 514 ? 5.087   14.809  11.241  1.00 60.45  ? 514  ASN A CG  1 
ATOM   3979 O OD1 . ASN A 1 514 ? 4.006   14.555  11.771  1.00 60.07  ? 514  ASN A OD1 1 
ATOM   3980 N ND2 . ASN A 1 514 ? 5.452   14.282  10.066  1.00 54.09  ? 514  ASN A ND2 1 
ATOM   3981 N N   . LEU A 1 515 ? 4.569   16.618  14.266  1.00 55.20  ? 515  LEU A N   1 
ATOM   3982 C CA  . LEU A 1 515 ? 3.489   16.873  15.236  1.00 47.37  ? 515  LEU A CA  1 
ATOM   3983 C C   . LEU A 1 515 ? 2.280   15.937  15.077  1.00 52.51  ? 515  LEU A C   1 
ATOM   3984 O O   . LEU A 1 515 ? 1.672   15.535  16.056  1.00 58.09  ? 515  LEU A O   1 
ATOM   3985 C CB  . LEU A 1 515 ? 3.061   18.330  15.185  1.00 39.81  ? 515  LEU A CB  1 
ATOM   3986 C CG  . LEU A 1 515 ? 4.281   19.216  15.370  1.00 51.45  ? 515  LEU A CG  1 
ATOM   3987 C CD1 . LEU A 1 515 ? 3.949   20.682  15.212  1.00 46.13  ? 515  LEU A CD1 1 
ATOM   3988 C CD2 . LEU A 1 515 ? 4.910   18.915  16.727  1.00 55.38  ? 515  LEU A CD2 1 
ATOM   3989 N N   . LYS A 1 516 ? 1.956   15.597  13.833  1.00 55.20  ? 516  LYS A N   1 
ATOM   3990 C CA  . LYS A 1 516 ? 0.962   14.582  13.503  1.00 54.28  ? 516  LYS A CA  1 
ATOM   3991 C C   . LYS A 1 516 ? 1.376   13.189  14.014  1.00 59.66  ? 516  LYS A C   1 
ATOM   3992 O O   . LYS A 1 516 ? 2.559   12.919  14.235  1.00 62.78  ? 516  LYS A O   1 
ATOM   3993 C CB  . LYS A 1 516 ? 0.758   14.578  11.988  1.00 52.62  ? 516  LYS A CB  1 
ATOM   3994 C CG  . LYS A 1 516 ? 0.275   15.943  11.449  1.00 68.21  ? 516  LYS A CG  1 
ATOM   3995 C CD  . LYS A 1 516 ? 0.780   16.277  10.033  1.00 76.37  ? 516  LYS A CD  1 
ATOM   3996 C CE  . LYS A 1 516 ? 0.111   15.447  8.940   1.00 80.14  ? 516  LYS A CE  1 
ATOM   3997 N NZ  . LYS A 1 516 ? 0.409   15.997  7.572   1.00 82.87  ? 516  LYS A NZ  1 
ATOM   3998 N N   . PRO A 1 517 ? 0.400   12.302  14.222  1.00 56.08  ? 517  PRO A N   1 
ATOM   3999 C CA  . PRO A 1 517 ? 0.739   10.972  14.737  1.00 53.52  ? 517  PRO A CA  1 
ATOM   4000 C C   . PRO A 1 517 ? 1.534   10.188  13.697  1.00 55.05  ? 517  PRO A C   1 
ATOM   4001 O O   . PRO A 1 517 ? 1.488   10.538  12.505  1.00 53.64  ? 517  PRO A O   1 
ATOM   4002 C CB  . PRO A 1 517 ? -0.637  10.313  14.964  1.00 53.37  ? 517  PRO A CB  1 
ATOM   4003 C CG  . PRO A 1 517 ? -1.621  11.455  15.020  1.00 48.26  ? 517  PRO A CG  1 
ATOM   4004 C CD  . PRO A 1 517 ? -1.054  12.495  14.077  1.00 50.30  ? 517  PRO A CD  1 
ATOM   4005 N N   . LEU A 1 518 ? 2.233   9.140   14.134  1.00 49.72  ? 518  LEU A N   1 
ATOM   4006 C CA  . LEU A 1 518 ? 3.058   8.352   13.226  1.00 50.44  ? 518  LEU A CA  1 
ATOM   4007 C C   . LEU A 1 518 ? 2.378   8.063   11.897  1.00 57.69  ? 518  LEU A C   1 
ATOM   4008 O O   . LEU A 1 518 ? 1.264   7.540   11.865  1.00 65.83  ? 518  LEU A O   1 
ATOM   4009 C CB  . LEU A 1 518 ? 3.442   7.018   13.847  1.00 43.46  ? 518  LEU A CB  1 
ATOM   4010 C CG  . LEU A 1 518 ? 4.496   6.967   14.937  1.00 43.99  ? 518  LEU A CG  1 
ATOM   4011 C CD1 . LEU A 1 518 ? 4.878   5.518   15.073  1.00 46.58  ? 518  LEU A CD1 1 
ATOM   4012 C CD2 . LEU A 1 518 ? 5.713   7.829   14.610  1.00 43.24  ? 518  LEU A CD2 1 
ATOM   4013 N N   . GLU A 1 519 ? 3.059   8.393   10.806  1.00 50.87  ? 519  GLU A N   1 
ATOM   4014 C CA  . GLU A 1 519 ? 2.679   7.885   9.501   1.00 51.11  ? 519  GLU A CA  1 
ATOM   4015 C C   . GLU A 1 519 ? 3.769   6.940   8.972   1.00 59.14  ? 519  GLU A C   1 
ATOM   4016 O O   . GLU A 1 519 ? 4.954   7.247   9.081   1.00 65.04  ? 519  GLU A O   1 
ATOM   4017 C CB  . GLU A 1 519 ? 2.460   9.048   8.558   1.00 52.84  ? 519  GLU A CB  1 
ATOM   4018 C CG  . GLU A 1 519 ? 2.511   8.690   7.095   1.00 68.36  ? 519  GLU A CG  1 
ATOM   4019 C CD  . GLU A 1 519 ? 2.338   9.918   6.218   1.00 84.87  ? 519  GLU A CD  1 
ATOM   4020 O OE1 . GLU A 1 519 ? 1.456   10.749  6.556   1.00 96.77  ? 519  GLU A OE1 1 
ATOM   4021 O OE2 . GLU A 1 519 ? 3.078   10.056  5.209   1.00 77.93  ? 519  GLU A OE2 1 
ATOM   4022 N N   . VAL A 1 520 ? 3.381   5.786   8.429   1.00 55.19  ? 520  VAL A N   1 
ATOM   4023 C CA  . VAL A 1 520 ? 4.363   4.821   7.919   1.00 50.69  ? 520  VAL A CA  1 
ATOM   4024 C C   . VAL A 1 520 ? 4.615   5.010   6.428   1.00 59.49  ? 520  VAL A C   1 
ATOM   4025 O O   . VAL A 1 520 ? 3.674   5.128   5.643   1.00 69.58  ? 520  VAL A O   1 
ATOM   4026 C CB  . VAL A 1 520 ? 3.898   3.373   8.121   1.00 44.88  ? 520  VAL A CB  1 
ATOM   4027 C CG1 . VAL A 1 520 ? 4.719   2.431   7.261   1.00 41.41  ? 520  VAL A CG1 1 
ATOM   4028 C CG2 . VAL A 1 520 ? 3.980   2.979   9.579   1.00 38.66  ? 520  VAL A CG2 1 
ATOM   4029 N N   . ARG A 1 521 ? 5.884   5.041   6.034   1.00 53.52  ? 521  ARG A N   1 
ATOM   4030 C CA  . ARG A 1 521 ? 6.230   5.174   4.623   1.00 49.31  ? 521  ARG A CA  1 
ATOM   4031 C C   . ARG A 1 521 ? 7.129   4.031   4.176   1.00 56.32  ? 521  ARG A C   1 
ATOM   4032 O O   . ARG A 1 521 ? 7.761   3.361   4.997   1.00 60.79  ? 521  ARG A O   1 
ATOM   4033 C CB  . ARG A 1 521 ? 6.902   6.514   4.342   1.00 42.72  ? 521  ARG A CB  1 
ATOM   4034 C CG  . ARG A 1 521 ? 6.337   7.653   5.137   1.00 42.69  ? 521  ARG A CG  1 
ATOM   4035 C CD  . ARG A 1 521 ? 6.306   8.914   4.324   1.00 41.16  ? 521  ARG A CD  1 
ATOM   4036 N NE  . ARG A 1 521 ? 5.986   10.098  5.120   1.00 47.11  ? 521  ARG A NE  1 
ATOM   4037 C CZ  . ARG A 1 521 ? 6.833   11.110  5.313   1.00 58.26  ? 521  ARG A CZ  1 
ATOM   4038 N NH1 . ARG A 1 521 ? 8.053   11.080  4.759   1.00 61.08  ? 521  ARG A NH1 1 
ATOM   4039 N NH2 . ARG A 1 521 ? 6.460   12.158  6.047   1.00 50.90  ? 521  ARG A NH2 1 
ATOM   4040 N N   . ARG A 1 522 ? 7.177   3.803   2.870   1.00 50.34  ? 522  ARG A N   1 
ATOM   4041 C CA  . ARG A 1 522 ? 7.989   2.724   2.340   1.00 47.38  ? 522  ARG A CA  1 
ATOM   4042 C C   . ARG A 1 522 ? 9.087   3.348   1.516   1.00 50.74  ? 522  ARG A C   1 
ATOM   4043 O O   . ARG A 1 522 ? 8.828   4.256   0.722   1.00 52.09  ? 522  ARG A O   1 
ATOM   4044 C CB  . ARG A 1 522 ? 7.147   1.750   1.495   1.00 43.04  ? 522  ARG A CB  1 
ATOM   4045 C CG  . ARG A 1 522 ? 6.085   0.988   2.297   1.00 66.54  ? 522  ARG A CG  1 
ATOM   4046 C CD  . ARG A 1 522 ? 5.267   0.000   1.449   1.00 88.57  ? 522  ARG A CD  1 
ATOM   4047 N NE  . ARG A 1 522 ? 6.046   -1.147  0.957   1.00 105.32 ? 522  ARG A NE  1 
ATOM   4048 C CZ  . ARG A 1 522 ? 6.479   -1.286  -0.299  1.00 115.33 ? 522  ARG A CZ  1 
ATOM   4049 N NH1 . ARG A 1 522 ? 6.220   -0.348  -1.207  1.00 119.25 ? 522  ARG A NH1 1 
ATOM   4050 N NH2 . ARG A 1 522 ? 7.178   -2.361  -0.654  1.00 114.50 ? 522  ARG A NH2 1 
ATOM   4051 N N   . GLY A 1 523 ? 10.315  2.886   1.733   1.00 47.33  ? 523  GLY A N   1 
ATOM   4052 C CA  . GLY A 1 523 ? 11.415  3.232   0.856   1.00 43.55  ? 523  GLY A CA  1 
ATOM   4053 C C   . GLY A 1 523 ? 12.125  4.503   1.228   1.00 47.41  ? 523  GLY A C   1 
ATOM   4054 O O   . GLY A 1 523 ? 11.613  5.605   1.078   1.00 60.57  ? 523  GLY A O   1 
ATOM   4055 N N   . LEU A 1 524 ? 13.336  4.336   1.714   1.00 51.26  ? 524  LEU A N   1 
ATOM   4056 C CA  . LEU A 1 524 ? 14.157  5.452   2.115   1.00 51.36  ? 524  LEU A CA  1 
ATOM   4057 C C   . LEU A 1 524 ? 14.875  6.021   0.913   1.00 50.64  ? 524  LEU A C   1 
ATOM   4058 O O   . LEU A 1 524 ? 15.966  5.562   0.595   1.00 49.28  ? 524  LEU A O   1 
ATOM   4059 C CB  . LEU A 1 524 ? 15.199  4.942   3.103   1.00 59.20  ? 524  LEU A CB  1 
ATOM   4060 C CG  . LEU A 1 524 ? 15.381  5.837   4.321   1.00 65.73  ? 524  LEU A CG  1 
ATOM   4061 C CD1 . LEU A 1 524 ? 14.432  7.044   4.254   1.00 67.88  ? 524  LEU A CD1 1 
ATOM   4062 C CD2 . LEU A 1 524 ? 15.125  5.001   5.568   1.00 56.87  ? 524  LEU A CD2 1 
ATOM   4063 N N   . ARG A 1 525 ? 14.290  7.015   0.250   1.00 48.84  ? 525  ARG A N   1 
ATOM   4064 C CA  . ARG A 1 525 ? 14.874  7.515   -0.995  1.00 52.56  ? 525  ARG A CA  1 
ATOM   4065 C C   . ARG A 1 525 ? 15.363  6.354   -1.838  1.00 58.24  ? 525  ARG A C   1 
ATOM   4066 O O   . ARG A 1 525 ? 16.519  6.370   -2.270  1.00 64.91  ? 525  ARG A O   1 
ATOM   4067 C CB  . ARG A 1 525 ? 16.110  8.357   -0.723  1.00 45.78  ? 525  ARG A CB  1 
ATOM   4068 C CG  . ARG A 1 525 ? 15.869  9.651   -0.063  1.00 50.79  ? 525  ARG A CG  1 
ATOM   4069 C CD  . ARG A 1 525 ? 15.679  10.736  -1.060  1.00 58.30  ? 525  ARG A CD  1 
ATOM   4070 N NE  . ARG A 1 525 ? 16.135  12.015  -0.512  1.00 68.13  ? 525  ARG A NE  1 
ATOM   4071 C CZ  . ARG A 1 525 ? 15.585  12.629  0.534   1.00 70.34  ? 525  ARG A CZ  1 
ATOM   4072 N NH1 . ARG A 1 525 ? 14.546  12.078  1.156   1.00 82.18  ? 525  ARG A NH1 1 
ATOM   4073 N NH2 . ARG A 1 525 ? 16.066  13.800  0.953   1.00 59.83  ? 525  ARG A NH2 1 
ATOM   4074 N N   . ALA A 1 526 ? 14.521  5.354   -2.083  1.00 44.70  ? 526  ALA A N   1 
ATOM   4075 C CA  . ALA A 1 526 ? 15.035  4.131   -2.676  1.00 37.25  ? 526  ALA A CA  1 
ATOM   4076 C C   . ALA A 1 526 ? 15.681  4.300   -4.073  1.00 44.28  ? 526  ALA A C   1 
ATOM   4077 O O   . ALA A 1 526 ? 16.812  3.866   -4.268  1.00 58.17  ? 526  ALA A O   1 
ATOM   4078 C CB  . ALA A 1 526 ? 13.988  3.014   -2.646  1.00 33.22  ? 526  ALA A CB  1 
ATOM   4079 N N   . GLN A 1 527 ? 15.015  4.946   -5.028  1.00 36.35  ? 527  GLN A N   1 
ATOM   4080 C CA  . GLN A 1 527 ? 15.649  5.115   -6.351  1.00 50.20  ? 527  GLN A CA  1 
ATOM   4081 C C   . GLN A 1 527 ? 16.988  5.848   -6.275  1.00 46.10  ? 527  GLN A C   1 
ATOM   4082 O O   . GLN A 1 527 ? 17.987  5.413   -6.843  1.00 49.61  ? 527  GLN A O   1 
ATOM   4083 C CB  . GLN A 1 527 ? 14.738  5.817   -7.378  1.00 49.50  ? 527  GLN A CB  1 
ATOM   4084 C CG  . GLN A 1 527 ? 13.534  5.005   -7.849  1.00 59.09  ? 527  GLN A CG  1 
ATOM   4085 C CD  . GLN A 1 527 ? 13.886  3.683   -8.528  1.00 61.73  ? 527  GLN A CD  1 
ATOM   4086 O OE1 . GLN A 1 527 ? 13.654  2.608   -7.957  1.00 57.97  ? 527  GLN A OE1 1 
ATOM   4087 N NE2 . GLN A 1 527 ? 14.416  3.751   -9.759  1.00 60.18  ? 527  GLN A NE2 1 
ATOM   4088 N N   . THR A 1 528 ? 17.005  6.973   -5.583  1.00 39.81  ? 528  THR A N   1 
ATOM   4089 C CA  . THR A 1 528 ? 18.238  7.736   -5.477  1.00 45.89  ? 528  THR A CA  1 
ATOM   4090 C C   . THR A 1 528 ? 19.341  7.022   -4.701  1.00 45.71  ? 528  THR A C   1 
ATOM   4091 O O   . THR A 1 528 ? 20.512  7.116   -5.053  1.00 38.45  ? 528  THR A O   1 
ATOM   4092 C CB  . THR A 1 528 ? 17.975  9.081   -4.865  1.00 41.13  ? 528  THR A CB  1 
ATOM   4093 O OG1 . THR A 1 528 ? 17.411  9.899   -5.875  1.00 41.91  ? 528  THR A OG1 1 
ATOM   4094 C CG2 . THR A 1 528 ? 19.261  9.711   -4.376  1.00 39.13  ? 528  THR A CG2 1 
ATOM   4095 N N   . CYS A 1 529 ? 18.985  6.295   -3.651  1.00 40.61  ? 529  CYS A N   1 
ATOM   4096 C CA  . CYS A 1 529 ? 20.032  5.569   -2.947  1.00 38.36  ? 529  CYS A CA  1 
ATOM   4097 C C   . CYS A 1 529 ? 20.588  4.389   -3.781  1.00 39.77  ? 529  CYS A C   1 
ATOM   4098 O O   . CYS A 1 529 ? 21.736  3.988   -3.614  1.00 38.07  ? 529  CYS A O   1 
ATOM   4099 C CB  . CYS A 1 529 ? 19.636  5.220   -1.499  1.00 26.54  ? 529  CYS A CB  1 
ATOM   4100 S SG  . CYS A 1 529 ? 19.473  6.725   -0.438  1.00 49.47  ? 529  CYS A SG  1 
ATOM   4101 N N   . ALA A 1 530 ? 19.812  3.871   -4.724  1.00 36.69  ? 530  ALA A N   1 
ATOM   4102 C CA  . ALA A 1 530 ? 20.389  2.894   -5.642  1.00 35.03  ? 530  ALA A CA  1 
ATOM   4103 C C   . ALA A 1 530 ? 21.544  3.497   -6.427  1.00 41.43  ? 530  ALA A C   1 
ATOM   4104 O O   . ALA A 1 530 ? 22.495  2.796   -6.792  1.00 47.09  ? 530  ALA A O   1 
ATOM   4105 C CB  . ALA A 1 530 ? 19.364  2.361   -6.582  1.00 27.51  ? 530  ALA A CB  1 
ATOM   4106 N N   . PHE A 1 531 ? 21.450  4.792   -6.704  1.00 35.60  ? 531  PHE A N   1 
ATOM   4107 C CA  . PHE A 1 531 ? 22.467  5.459   -7.484  1.00 41.12  ? 531  PHE A CA  1 
ATOM   4108 C C   . PHE A 1 531 ? 23.783  5.555   -6.688  1.00 48.03  ? 531  PHE A C   1 
ATOM   4109 O O   . PHE A 1 531 ? 24.848  5.104   -7.140  1.00 41.18  ? 531  PHE A O   1 
ATOM   4110 C CB  . PHE A 1 531 ? 21.978  6.846   -7.904  1.00 44.17  ? 531  PHE A CB  1 
ATOM   4111 C CG  . PHE A 1 531 ? 23.064  7.726   -8.414  1.00 49.82  ? 531  PHE A CG  1 
ATOM   4112 C CD1 . PHE A 1 531 ? 23.641  7.489   -9.647  1.00 56.48  ? 531  PHE A CD1 1 
ATOM   4113 C CD2 . PHE A 1 531 ? 23.538  8.763   -7.653  1.00 55.10  ? 531  PHE A CD2 1 
ATOM   4114 C CE1 . PHE A 1 531 ? 24.664  8.283   -10.123 1.00 54.05  ? 531  PHE A CE1 1 
ATOM   4115 C CE2 . PHE A 1 531 ? 24.556  9.563   -8.129  1.00 58.25  ? 531  PHE A CE2 1 
ATOM   4116 C CZ  . PHE A 1 531 ? 25.116  9.322   -9.367  1.00 53.02  ? 531  PHE A CZ  1 
ATOM   4117 N N   . TRP A 1 532 ? 23.687  6.122   -5.489  1.00 45.02  ? 532  TRP A N   1 
ATOM   4118 C CA  . TRP A 1 532 ? 24.838  6.300   -4.611  1.00 44.26  ? 532  TRP A CA  1 
ATOM   4119 C C   . TRP A 1 532 ? 25.428  4.996   -4.105  1.00 48.11  ? 532  TRP A C   1 
ATOM   4120 O O   . TRP A 1 532 ? 26.647  4.809   -4.115  1.00 56.70  ? 532  TRP A O   1 
ATOM   4121 C CB  . TRP A 1 532 ? 24.452  7.133   -3.408  1.00 37.16  ? 532  TRP A CB  1 
ATOM   4122 C CG  . TRP A 1 532 ? 24.084  8.517   -3.738  1.00 37.00  ? 532  TRP A CG  1 
ATOM   4123 C CD1 . TRP A 1 532 ? 22.831  9.050   -3.763  1.00 39.76  ? 532  TRP A CD1 1 
ATOM   4124 C CD2 . TRP A 1 532 ? 24.980  9.573   -4.081  1.00 34.22  ? 532  TRP A CD2 1 
ATOM   4125 N NE1 . TRP A 1 532 ? 22.889  10.379  -4.107  1.00 35.93  ? 532  TRP A NE1 1 
ATOM   4126 C CE2 . TRP A 1 532 ? 24.201  10.724  -4.308  1.00 30.73  ? 532  TRP A CE2 1 
ATOM   4127 C CE3 . TRP A 1 532 ? 26.374  9.654   -4.222  1.00 36.62  ? 532  TRP A CE3 1 
ATOM   4128 C CZ2 . TRP A 1 532 ? 24.765  11.954  -4.659  1.00 29.88  ? 532  TRP A CZ2 1 
ATOM   4129 C CZ3 . TRP A 1 532 ? 26.933  10.881  -4.559  1.00 38.13  ? 532  TRP A CZ3 1 
ATOM   4130 C CH2 . TRP A 1 532 ? 26.124  12.013  -4.781  1.00 36.37  ? 532  TRP A CH2 1 
ATOM   4131 N N   . ASN A 1 533 ? 24.562  4.101   -3.648  1.00 43.18  ? 533  ASN A N   1 
ATOM   4132 C CA  . ASN A 1 533 ? 25.013  2.870   -3.021  1.00 39.19  ? 533  ASN A CA  1 
ATOM   4133 C C   . ASN A 1 533 ? 25.388  1.740   -3.988  1.00 40.45  ? 533  ASN A C   1 
ATOM   4134 O O   . ASN A 1 533 ? 26.150  0.857   -3.623  1.00 44.60  ? 533  ASN A O   1 
ATOM   4135 C CB  . ASN A 1 533 ? 23.994  2.390   -1.998  1.00 37.71  ? 533  ASN A CB  1 
ATOM   4136 C CG  . ASN A 1 533 ? 23.679  3.437   -0.964  1.00 51.43  ? 533  ASN A CG  1 
ATOM   4137 O OD1 . ASN A 1 533 ? 24.509  4.294   -0.658  1.00 58.20  ? 533  ASN A OD1 1 
ATOM   4138 N ND2 . ASN A 1 533 ? 22.473  3.368   -0.401  1.00 57.99  ? 533  ASN A ND2 1 
ATOM   4139 N N   . ARG A 1 534 ? 24.883  1.776   -5.217  1.00 44.42  ? 534  ARG A N   1 
ATOM   4140 C CA  . ARG A 1 534 ? 25.163  0.703   -6.180  1.00 48.72  ? 534  ARG A CA  1 
ATOM   4141 C C   . ARG A 1 534 ? 25.907  1.152   -7.409  1.00 59.24  ? 534  ARG A C   1 
ATOM   4142 O O   . ARG A 1 534 ? 26.928  0.579   -7.760  1.00 72.30  ? 534  ARG A O   1 
ATOM   4143 C CB  . ARG A 1 534 ? 23.880  0.076   -6.675  1.00 49.30  ? 534  ARG A CB  1 
ATOM   4144 C CG  . ARG A 1 534 ? 23.248  -0.858  -5.715  1.00 47.32  ? 534  ARG A CG  1 
ATOM   4145 C CD  . ARG A 1 534 ? 21.752  -0.761  -5.864  1.00 48.76  ? 534  ARG A CD  1 
ATOM   4146 N NE  . ARG A 1 534 ? 21.089  -1.469  -4.781  1.00 59.59  ? 534  ARG A NE  1 
ATOM   4147 C CZ  . ARG A 1 534 ? 21.016  -2.795  -4.695  1.00 60.77  ? 534  ARG A CZ  1 
ATOM   4148 N NH1 . ARG A 1 534 ? 21.572  -3.557  -5.640  1.00 62.38  ? 534  ARG A NH1 1 
ATOM   4149 N NH2 . ARG A 1 534 ? 20.383  -3.353  -3.668  1.00 49.73  ? 534  ARG A NH2 1 
ATOM   4150 N N   . PHE A 1 535 ? 25.366  2.146   -8.096  1.00 55.84  ? 535  PHE A N   1 
ATOM   4151 C CA  . PHE A 1 535 ? 25.972  2.577   -9.338  1.00 50.81  ? 535  PHE A CA  1 
ATOM   4152 C C   . PHE A 1 535 ? 27.278  3.318   -9.092  1.00 51.99  ? 535  PHE A C   1 
ATOM   4153 O O   . PHE A 1 535 ? 28.312  2.930   -9.611  1.00 53.09  ? 535  PHE A O   1 
ATOM   4154 C CB  . PHE A 1 535 ? 25.014  3.444   -10.142 1.00 52.37  ? 535  PHE A CB  1 
ATOM   4155 C CG  . PHE A 1 535 ? 25.545  3.824   -11.479 1.00 50.27  ? 535  PHE A CG  1 
ATOM   4156 C CD1 . PHE A 1 535 ? 25.813  2.847   -12.428 1.00 46.37  ? 535  PHE A CD1 1 
ATOM   4157 C CD2 . PHE A 1 535 ? 25.786  5.157   -11.794 1.00 53.77  ? 535  PHE A CD2 1 
ATOM   4158 C CE1 . PHE A 1 535 ? 26.331  3.183   -13.661 1.00 49.31  ? 535  PHE A CE1 1 
ATOM   4159 C CE2 . PHE A 1 535 ? 26.297  5.515   -13.041 1.00 50.94  ? 535  PHE A CE2 1 
ATOM   4160 C CZ  . PHE A 1 535 ? 26.572  4.526   -13.972 1.00 51.28  ? 535  PHE A CZ  1 
ATOM   4161 N N   . LEU A 1 536 ? 27.248  4.371   -8.288  1.00 53.79  ? 536  LEU A N   1 
ATOM   4162 C CA  . LEU A 1 536 ? 28.431  5.216   -8.168  1.00 52.10  ? 536  LEU A CA  1 
ATOM   4163 C C   . LEU A 1 536 ? 29.750  4.451   -7.957  1.00 62.93  ? 536  LEU A C   1 
ATOM   4164 O O   . LEU A 1 536 ? 30.753  4.747   -8.620  1.00 61.76  ? 536  LEU A O   1 
ATOM   4165 C CB  . LEU A 1 536 ? 28.268  6.242   -7.070  1.00 42.90  ? 536  LEU A CB  1 
ATOM   4166 C CG  . LEU A 1 536 ? 29.202  7.393   -7.424  1.00 59.55  ? 536  LEU A CG  1 
ATOM   4167 C CD1 . LEU A 1 536 ? 28.354  8.511   -7.996  1.00 64.26  ? 536  LEU A CD1 1 
ATOM   4168 C CD2 . LEU A 1 536 ? 30.064  7.887   -6.234  1.00 48.60  ? 536  LEU A CD2 1 
ATOM   4169 N N   . PRO A 1 537 ? 29.761  3.479   -7.020  1.00 63.97  ? 537  PRO A N   1 
ATOM   4170 C CA  . PRO A 1 537 ? 31.001  2.735   -6.767  1.00 55.19  ? 537  PRO A CA  1 
ATOM   4171 C C   . PRO A 1 537 ? 31.544  2.161   -8.058  1.00 58.45  ? 537  PRO A C   1 
ATOM   4172 O O   . PRO A 1 537 ? 32.668  2.479   -8.439  1.00 65.87  ? 537  PRO A O   1 
ATOM   4173 C CB  . PRO A 1 537 ? 30.552  1.605   -5.844  1.00 50.85  ? 537  PRO A CB  1 
ATOM   4174 C CG  . PRO A 1 537 ? 29.351  2.133   -5.163  1.00 52.43  ? 537  PRO A CG  1 
ATOM   4175 C CD  . PRO A 1 537 ? 28.660  3.034   -6.144  1.00 56.43  ? 537  PRO A CD  1 
ATOM   4176 N N   . LYS A 1 538 ? 30.741  1.334   -8.721  1.00 56.92  ? 538  LYS A N   1 
ATOM   4177 C CA  . LYS A 1 538 ? 31.088  0.775   -10.030 1.00 56.22  ? 538  LYS A CA  1 
ATOM   4178 C C   . LYS A 1 538 ? 31.539  1.821   -11.055 1.00 51.41  ? 538  LYS A C   1 
ATOM   4179 O O   . LYS A 1 538 ? 32.375  1.543   -11.912 1.00 54.33  ? 538  LYS A O   1 
ATOM   4180 C CB  . LYS A 1 538 ? 29.914  -0.019  -10.603 1.00 56.01  ? 538  LYS A CB  1 
ATOM   4181 C CG  . LYS A 1 538 ? 29.678  -1.358  -9.950  1.00 60.33  ? 538  LYS A CG  1 
ATOM   4182 C CD  . LYS A 1 538 ? 28.284  -1.873  -10.304 1.00 68.72  ? 538  LYS A CD  1 
ATOM   4183 C CE  . LYS A 1 538 ? 27.895  -3.059  -9.441  1.00 76.70  ? 538  LYS A CE  1 
ATOM   4184 N NZ  . LYS A 1 538 ? 28.744  -4.252  -9.752  1.00 83.77  ? 538  LYS A NZ  1 
ATOM   4185 N N   . LEU A 1 539 ? 30.990  3.024   -10.966 1.00 59.15  ? 539  LEU A N   1 
ATOM   4186 C CA  . LEU A 1 539 ? 31.340  4.089   -11.908 1.00 69.36  ? 539  LEU A CA  1 
ATOM   4187 C C   . LEU A 1 539 ? 32.783  4.506   -11.685 1.00 80.26  ? 539  LEU A C   1 
ATOM   4188 O O   . LEU A 1 539 ? 33.314  5.382   -12.378 1.00 73.54  ? 539  LEU A O   1 
ATOM   4189 C CB  . LEU A 1 539 ? 30.400  5.284   -11.746 1.00 64.39  ? 539  LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 539 ? 30.525  6.454   -12.726 1.00 56.84  ? 539  LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 539 ? 30.506  5.952   -14.143 1.00 56.67  ? 539  LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 539 ? 29.422  7.480   -12.497 1.00 48.09  ? 539  LEU A CD2 1 
ATOM   4193 N N   . LEU A 1 540 ? 33.409  3.859   -10.703 1.00 94.35  ? 540  LEU A N   1 
ATOM   4194 C CA  . LEU A 1 540 ? 34.831  4.046   -10.432 1.00 95.17  ? 540  LEU A CA  1 
ATOM   4195 C C   . LEU A 1 540 ? 35.696  2.783   -10.683 1.00 78.24  ? 540  LEU A C   1 
ATOM   4196 O O   . LEU A 1 540 ? 35.544  1.686   -10.102 1.00 56.19  ? 540  LEU A O   1 
ATOM   4197 C CB  . LEU A 1 540 ? 35.043  4.782   -9.119  1.00 87.63  ? 540  LEU A CB  1 
ATOM   4198 C CG  . LEU A 1 540 ? 34.056  5.973   -9.200  1.00 81.82  ? 540  LEU A CG  1 
ATOM   4199 C CD1 . LEU A 1 540 ? 33.805  6.666   -7.850  1.00 70.11  ? 540  LEU A CD1 1 
ATOM   4200 C CD2 . LEU A 1 540 ? 34.444  7.000   -10.285 1.00 85.29  ? 540  LEU A CD2 1 
ATOM   4201 N N   . SER A 1 541 ? 36.679  3.072   -11.523 1.00 92.57  ? 541  SER A N   1 
ATOM   4202 C CA  . SER A 1 541 ? 36.809  2.488   -12.835 1.00 90.18  ? 541  SER A CA  1 
ATOM   4203 C C   . SER A 1 541 ? 37.341  3.758   -13.523 1.00 87.92  ? 541  SER A C   1 
ATOM   4204 O O   . SER A 1 541 ? 36.752  4.255   -14.497 1.00 60.07  ? 541  SER A O   1 
ATOM   4205 C CB  . SER A 1 541 ? 35.414  2.154   -13.381 1.00 84.99  ? 541  SER A CB  1 
ATOM   4206 O OG  . SER A 1 541 ? 35.429  1.056   -14.269 1.00 86.78  ? 541  SER A OG  1 
ATOM   4207 N N   . ALA A 1 542 ? 38.399  4.313   -12.899 1.00 101.59 ? 542  ALA A N   1 
ATOM   4208 C CA  . ALA A 1 542 ? 39.207  5.476   -13.346 1.00 97.70  ? 542  ALA A CA  1 
ATOM   4209 C C   . ALA A 1 542 ? 40.500  5.604   -12.487 1.00 134.65 ? 542  ALA A C   1 
ATOM   4210 O O   . ALA A 1 542 ? 40.515  5.175   -11.328 1.00 130.31 ? 542  ALA A O   1 
ATOM   4211 C CB  . ALA A 1 542 ? 38.393  6.781   -13.295 1.00 84.72  ? 542  ALA A CB  1 
ATOM   4212 N N   . THR A 1 543 ? 41.568  6.187   -13.054 1.00 136.64 ? 543  THR A N   1 
ATOM   4213 C CA  . THR A 1 543 ? 42.843  6.433   -12.334 1.00 137.97 ? 543  THR A CA  1 
ATOM   4214 C C   . THR A 1 543 ? 43.457  7.840   -12.570 1.00 118.28 ? 543  THR A C   1 
ATOM   4215 O O   . THR A 1 543 ? 44.018  8.107   -13.630 1.00 111.05 ? 543  THR A O   1 
ATOM   4216 C CB  . THR A 1 543 ? 43.925  5.322   -12.628 1.00 93.60  ? 543  THR A CB  1 
ATOM   4217 O OG1 . THR A 1 543 ? 45.061  5.478   -11.762 1.00 90.07  ? 543  THR A OG1 1 
ATOM   4218 C CG2 . THR A 1 543 ? 44.401  5.369   -14.074 1.00 94.57  ? 543  THR A CG2 1 
ATOM   4219 N N   . ALA A 1 544 ? 43.340  8.726   -11.576 1.00 123.77 ? 544  ALA A N   1 
ATOM   4220 C CA  . ALA A 1 544 ? 43.958  10.062  -11.607 1.00 126.63 ? 544  ALA A CA  1 
ATOM   4221 C C   . ALA A 1 544 ? 43.565  10.961  -10.413 1.00 130.22 ? 544  ALA A C   1 
ATOM   4222 O O   . ALA A 1 544 ? 44.304  11.888  -10.090 1.00 131.14 ? 544  ALA A O   1 
ATOM   4223 C CB  . ALA A 1 544 ? 43.705  10.790  -12.968 1.00 59.90  ? 544  ALA A CB  1 
ATOM   4224 N N   . THR A 1 545 ? 42.418  10.686  -9.769  1.00 134.40 ? 545  THR A N   1 
ATOM   4225 C CA  . THR A 1 545 ? 41.921  11.466  -8.601  1.00 135.23 ? 545  THR A CA  1 
ATOM   4226 C C   . THR A 1 545 ? 42.747  11.185  -7.320  1.00 131.59 ? 545  THR A C   1 
ATOM   4227 O O   . THR A 1 545 ? 43.956  11.445  -7.299  1.00 130.46 ? 545  THR A O   1 
ATOM   4228 C CB  . THR A 1 545 ? 40.356  11.282  -8.352  1.00 82.22  ? 545  THR A CB  1 
ATOM   4229 O OG1 . THR A 1 545 ? 39.630  11.584  -9.553  1.00 80.56  ? 545  THR A OG1 1 
ATOM   4230 C CG2 . THR A 1 545 ? 39.825  12.184  -7.200  1.00 48.14  ? 545  THR A CG2 1 
ATOM   4231 N N   . GLU A 1 546 ? 42.090  10.667  -6.275  1.00 125.90 ? 546  GLU A N   1 
ATOM   4232 C CA  . GLU A 1 546 ? 42.726  10.244  -5.006  1.00 119.04 ? 546  GLU A CA  1 
ATOM   4233 C C   . GLU A 1 546 ? 42.411  11.165  -3.829  1.00 112.24 ? 546  GLU A C   1 
ATOM   4234 O O   . GLU A 1 546 ? 41.731  10.767  -2.884  1.00 107.99 ? 546  GLU A O   1 
ATOM   4235 C CB  . GLU A 1 546 ? 44.247  10.060  -5.141  1.00 119.01 ? 546  GLU A CB  1 
ATOM   4236 C CG  . GLU A 1 546 ? 44.956  9.689   -3.848  1.00 113.97 ? 546  GLU A CG  1 
ATOM   4237 C CD  . GLU A 1 546 ? 44.544  8.332   -3.325  1.00 108.80 ? 546  GLU A CD  1 
ATOM   4238 O OE1 . GLU A 1 546 ? 44.152  7.464   -4.146  1.00 102.82 ? 546  GLU A OE1 1 
ATOM   4239 O OE2 . GLU A 1 546 ? 44.621  8.140   -2.090  1.00 106.30 ? 546  GLU A OE2 1 
ATOM   4240 N N   . GLU B 1 4   ? -17.176 5.538   -70.159 1.00 111.22 ? 4    GLU B N   1 
ATOM   4241 C CA  . GLU B 1 4   ? -15.876 5.988   -69.655 1.00 109.34 ? 4    GLU B CA  1 
ATOM   4242 C C   . GLU B 1 4   ? -15.959 7.302   -68.855 1.00 102.09 ? 4    GLU B C   1 
ATOM   4243 O O   . GLU B 1 4   ? -16.141 8.378   -69.426 1.00 101.48 ? 4    GLU B O   1 
ATOM   4244 C CB  . GLU B 1 4   ? -14.874 6.125   -70.808 1.00 112.97 ? 4    GLU B CB  1 
ATOM   4245 C CG  . GLU B 1 4   ? -13.609 6.926   -70.461 1.00 117.38 ? 4    GLU B CG  1 
ATOM   4246 C CD  . GLU B 1 4   ? -12.507 6.092   -69.802 1.00 117.97 ? 4    GLU B CD  1 
ATOM   4247 O OE1 . GLU B 1 4   ? -12.404 6.102   -68.549 1.00 117.31 ? 4    GLU B OE1 1 
ATOM   4248 O OE2 . GLU B 1 4   ? -11.736 5.438   -70.542 1.00 113.18 ? 4    GLU B OE2 1 
ATOM   4249 N N   . ASP B 1 5   ? -15.801 7.205   -67.536 1.00 93.14  ? 5    ASP B N   1 
ATOM   4250 C CA  . ASP B 1 5   ? -15.896 8.358   -66.633 1.00 86.62  ? 5    ASP B CA  1 
ATOM   4251 C C   . ASP B 1 5   ? -14.707 9.325   -66.713 1.00 87.52  ? 5    ASP B C   1 
ATOM   4252 O O   . ASP B 1 5   ? -13.600 8.986   -66.299 1.00 95.83  ? 5    ASP B O   1 
ATOM   4253 C CB  . ASP B 1 5   ? -16.031 7.858   -65.197 1.00 78.36  ? 5    ASP B CB  1 
ATOM   4254 C CG  . ASP B 1 5   ? -16.432 8.953   -64.231 1.00 72.77  ? 5    ASP B CG  1 
ATOM   4255 O OD1 . ASP B 1 5   ? -16.868 8.586   -63.109 1.00 63.43  ? 5    ASP B OD1 1 
ATOM   4256 O OD2 . ASP B 1 5   ? -16.324 10.158  -64.594 1.00 64.94  ? 5    ASP B OD2 1 
ATOM   4257 N N   . PRO B 1 6   ? -14.942 10.546  -67.212 1.00 80.67  ? 6    PRO B N   1 
ATOM   4258 C CA  . PRO B 1 6   ? -13.870 11.519  -67.474 1.00 80.21  ? 6    PRO B CA  1 
ATOM   4259 C C   . PRO B 1 6   ? -13.223 12.061  -66.205 1.00 73.80  ? 6    PRO B C   1 
ATOM   4260 O O   . PRO B 1 6   ? -12.241 12.792  -66.281 1.00 69.49  ? 6    PRO B O   1 
ATOM   4261 C CB  . PRO B 1 6   ? -14.594 12.647  -68.206 1.00 83.83  ? 6    PRO B CB  1 
ATOM   4262 C CG  . PRO B 1 6   ? -15.996 12.544  -67.763 1.00 84.15  ? 6    PRO B CG  1 
ATOM   4263 C CD  . PRO B 1 6   ? -16.278 11.104  -67.464 1.00 82.00  ? 6    PRO B CD  1 
ATOM   4264 N N   . GLN B 1 7   ? -13.783 11.706  -65.056 1.00 71.15  ? 7    GLN B N   1 
ATOM   4265 C CA  . GLN B 1 7   ? -13.225 12.080  -63.765 1.00 64.29  ? 7    GLN B CA  1 
ATOM   4266 C C   . GLN B 1 7   ? -12.127 11.118  -63.388 1.00 62.40  ? 7    GLN B C   1 
ATOM   4267 O O   . GLN B 1 7   ? -11.346 11.390  -62.471 1.00 57.88  ? 7    GLN B O   1 
ATOM   4268 C CB  . GLN B 1 7   ? -14.302 12.008  -62.686 1.00 71.05  ? 7    GLN B CB  1 
ATOM   4269 C CG  . GLN B 1 7   ? -15.069 13.289  -62.494 1.00 75.18  ? 7    GLN B CG  1 
ATOM   4270 C CD  . GLN B 1 7   ? -14.185 14.370  -61.972 1.00 79.22  ? 7    GLN B CD  1 
ATOM   4271 O OE1 . GLN B 1 7   ? -13.869 15.326  -62.672 1.00 80.53  ? 7    GLN B OE1 1 
ATOM   4272 N NE2 . GLN B 1 7   ? -13.737 14.207  -60.741 1.00 86.55  ? 7    GLN B NE2 1 
ATOM   4273 N N   . LEU B 1 8   ? -12.108 9.977   -64.075 1.00 58.32  ? 8    LEU B N   1 
ATOM   4274 C CA  . LEU B 1 8   ? -11.120 8.942   -63.833 1.00 54.76  ? 8    LEU B CA  1 
ATOM   4275 C C   . LEU B 1 8   ? -10.075 8.948   -64.932 1.00 55.68  ? 8    LEU B C   1 
ATOM   4276 O O   . LEU B 1 8   ? -9.243  8.058   -65.006 1.00 67.95  ? 8    LEU B O   1 
ATOM   4277 C CB  . LEU B 1 8   ? -11.792 7.574   -63.755 1.00 55.18  ? 8    LEU B CB  1 
ATOM   4278 C CG  . LEU B 1 8   ? -12.930 7.502   -62.740 1.00 61.10  ? 8    LEU B CG  1 
ATOM   4279 C CD1 . LEU B 1 8   ? -13.515 6.109   -62.678 1.00 60.11  ? 8    LEU B CD1 1 
ATOM   4280 C CD2 . LEU B 1 8   ? -12.407 7.905   -61.386 1.00 66.11  ? 8    LEU B CD2 1 
ATOM   4281 N N   . LEU B 1 9   ? -10.122 9.948   -65.795 1.00 53.86  ? 9    LEU B N   1 
ATOM   4282 C CA  . LEU B 1 9   ? -9.128  10.077  -66.845 1.00 59.96  ? 9    LEU B CA  1 
ATOM   4283 C C   . LEU B 1 9   ? -8.205  11.210  -66.495 1.00 62.34  ? 9    LEU B C   1 
ATOM   4284 O O   . LEU B 1 9   ? -8.638  12.360  -66.376 1.00 70.27  ? 9    LEU B O   1 
ATOM   4285 C CB  . LEU B 1 9   ? -9.770  10.379  -68.195 1.00 68.02  ? 9    LEU B CB  1 
ATOM   4286 C CG  . LEU B 1 9   ? -10.117 9.224   -69.127 1.00 77.16  ? 9    LEU B CG  1 
ATOM   4287 C CD1 . LEU B 1 9   ? -9.850  9.661   -70.565 1.00 80.07  ? 9    LEU B CD1 1 
ATOM   4288 C CD2 . LEU B 1 9   ? -9.301  7.995   -68.780 1.00 75.69  ? 9    LEU B CD2 1 
ATOM   4289 N N   . VAL B 1 10  ? -6.929  10.892  -66.326 1.00 55.02  ? 10   VAL B N   1 
ATOM   4290 C CA  . VAL B 1 10  ? -5.949  11.927  -66.043 1.00 51.42  ? 10   VAL B CA  1 
ATOM   4291 C C   . VAL B 1 10  ? -4.750  11.829  -66.964 1.00 52.88  ? 10   VAL B C   1 
ATOM   4292 O O   . VAL B 1 10  ? -4.387  10.736  -67.410 1.00 57.47  ? 10   VAL B O   1 
ATOM   4293 C CB  . VAL B 1 10  ? -5.474  11.868  -64.591 1.00 49.18  ? 10   VAL B CB  1 
ATOM   4294 C CG1 . VAL B 1 10  ? -4.408  12.938  -64.327 1.00 48.04  ? 10   VAL B CG1 1 
ATOM   4295 C CG2 . VAL B 1 10  ? -6.650  12.042  -63.670 1.00 49.99  ? 10   VAL B CG2 1 
ATOM   4296 N N   . ARG B 1 11  ? -4.134  12.978  -67.233 1.00 48.69  ? 11   ARG B N   1 
ATOM   4297 C CA  . ARG B 1 11  ? -2.948  13.019  -68.068 1.00 56.35  ? 11   ARG B CA  1 
ATOM   4298 C C   . ARG B 1 11  ? -1.750  13.641  -67.370 1.00 62.88  ? 11   ARG B C   1 
ATOM   4299 O O   . ARG B 1 11  ? -1.706  14.847  -67.098 1.00 71.35  ? 11   ARG B O   1 
ATOM   4300 C CB  . ARG B 1 11  ? -3.217  13.755  -69.368 1.00 57.97  ? 11   ARG B CB  1 
ATOM   4301 C CG  . ARG B 1 11  ? -1.946  14.135  -70.046 1.00 70.63  ? 11   ARG B CG  1 
ATOM   4302 C CD  . ARG B 1 11  ? -2.168  14.608  -71.444 1.00 85.70  ? 11   ARG B CD  1 
ATOM   4303 N NE  . ARG B 1 11  ? -1.192  13.957  -72.304 1.00 98.92  ? 11   ARG B NE  1 
ATOM   4304 C CZ  . ARG B 1 11  ? -1.491  12.979  -73.152 1.00 103.21 ? 11   ARG B CZ  1 
ATOM   4305 N NH1 . ARG B 1 11  ? -2.753  12.563  -73.273 1.00 97.14  ? 11   ARG B NH1 1 
ATOM   4306 N NH2 . ARG B 1 11  ? -0.527  12.437  -73.890 1.00 104.76 ? 11   ARG B NH2 1 
ATOM   4307 N N   . VAL B 1 12  ? -0.766  12.797  -67.104 1.00 55.09  ? 12   VAL B N   1 
ATOM   4308 C CA  . VAL B 1 12  ? 0.464   13.228  -66.479 1.00 53.80  ? 12   VAL B CA  1 
ATOM   4309 C C   . VAL B 1 12  ? 1.545   13.282  -67.556 1.00 56.65  ? 12   VAL B C   1 
ATOM   4310 O O   . VAL B 1 12  ? 1.300   12.870  -68.688 1.00 63.89  ? 12   VAL B O   1 
ATOM   4311 C CB  . VAL B 1 12  ? 0.857   12.264  -65.330 1.00 43.54  ? 12   VAL B CB  1 
ATOM   4312 C CG1 . VAL B 1 12  ? -0.260  12.194  -64.312 1.00 47.78  ? 12   VAL B CG1 1 
ATOM   4313 C CG2 . VAL B 1 12  ? 1.143   10.866  -65.851 1.00 39.07  ? 12   VAL B CG2 1 
ATOM   4314 N N   . ARG B 1 13  ? 2.730   13.782  -67.204 1.00 53.03  ? 13   ARG B N   1 
ATOM   4315 C CA  . ARG B 1 13  ? 3.854   13.903  -68.135 1.00 53.24  ? 13   ARG B CA  1 
ATOM   4316 C C   . ARG B 1 13  ? 4.263   12.599  -68.856 1.00 60.00  ? 13   ARG B C   1 
ATOM   4317 O O   . ARG B 1 13  ? 5.039   12.624  -69.806 1.00 58.65  ? 13   ARG B O   1 
ATOM   4318 C CB  . ARG B 1 13  ? 5.078   14.478  -67.416 1.00 56.64  ? 13   ARG B CB  1 
ATOM   4319 C CG  . ARG B 1 13  ? 4.977   15.948  -67.055 1.00 72.14  ? 13   ARG B CG  1 
ATOM   4320 C CD  . ARG B 1 13  ? 6.352   16.515  -66.730 1.00 90.90  ? 13   ARG B CD  1 
ATOM   4321 N NE  . ARG B 1 13  ? 6.255   17.840  -66.115 1.00 113.16 ? 13   ARG B NE  1 
ATOM   4322 C CZ  . ARG B 1 13  ? 7.277   18.499  -65.566 1.00 121.33 ? 13   ARG B CZ  1 
ATOM   4323 N NH1 . ARG B 1 13  ? 8.491   17.955  -65.555 1.00 123.50 ? 13   ARG B NH1 1 
ATOM   4324 N NH2 . ARG B 1 13  ? 7.088   19.702  -65.023 1.00 117.76 ? 13   ARG B NH2 1 
ATOM   4325 N N   . GLY B 1 14  ? 3.763   11.461  -68.399 1.00 60.69  ? 14   GLY B N   1 
ATOM   4326 C CA  . GLY B 1 14  ? 4.238   10.201  -68.921 1.00 54.53  ? 14   GLY B CA  1 
ATOM   4327 C C   . GLY B 1 14  ? 3.245   9.583   -69.867 1.00 51.80  ? 14   GLY B C   1 
ATOM   4328 O O   . GLY B 1 14  ? 3.575   8.660   -70.605 1.00 56.77  ? 14   GLY B O   1 
ATOM   4329 N N   . GLY B 1 15  ? 2.024   10.098  -69.844 1.00 42.11  ? 15   GLY B N   1 
ATOM   4330 C CA  . GLY B 1 15  ? 0.938   9.515   -70.611 1.00 40.22  ? 15   GLY B CA  1 
ATOM   4331 C C   . GLY B 1 15  ? -0.405  9.647   -69.915 1.00 50.75  ? 15   GLY B C   1 
ATOM   4332 O O   . GLY B 1 15  ? -0.588  10.482  -69.016 1.00 54.47  ? 15   GLY B O   1 
ATOM   4333 N N   . GLN B 1 16  ? -1.352  8.821   -70.335 1.00 51.16  ? 16   GLN B N   1 
ATOM   4334 C CA  . GLN B 1 16  ? -2.683  8.837   -69.749 1.00 57.45  ? 16   GLN B CA  1 
ATOM   4335 C C   . GLN B 1 16  ? -2.965  7.683   -68.789 1.00 57.33  ? 16   GLN B C   1 
ATOM   4336 O O   . GLN B 1 16  ? -2.514  6.546   -68.990 1.00 61.99  ? 16   GLN B O   1 
ATOM   4337 C CB  . GLN B 1 16  ? -3.733  8.856   -70.836 1.00 63.67  ? 16   GLN B CB  1 
ATOM   4338 C CG  . GLN B 1 16  ? -3.878  10.191  -71.499 1.00 75.52  ? 16   GLN B CG  1 
ATOM   4339 C CD  . GLN B 1 16  ? -5.247  10.352  -72.110 1.00 86.97  ? 16   GLN B CD  1 
ATOM   4340 O OE1 . GLN B 1 16  ? -5.592  9.679   -73.104 1.00 82.89  ? 16   GLN B OE1 1 
ATOM   4341 N NE2 . GLN B 1 16  ? -6.060  11.227  -71.502 1.00 90.40  ? 16   GLN B NE2 1 
ATOM   4342 N N   . LEU B 1 17  ? -3.739  7.999   -67.757 1.00 42.39  ? 17   LEU B N   1 
ATOM   4343 C CA  . LEU B 1 17  ? -4.053  7.063   -66.701 1.00 40.44  ? 17   LEU B CA  1 
ATOM   4344 C C   . LEU B 1 17  ? -5.538  7.000   -66.585 1.00 41.17  ? 17   LEU B C   1 
ATOM   4345 O O   . LEU B 1 17  ? -6.221  8.012   -66.737 1.00 46.00  ? 17   LEU B O   1 
ATOM   4346 C CB  . LEU B 1 17  ? -3.495  7.576   -65.356 1.00 48.17  ? 17   LEU B CB  1 
ATOM   4347 C CG  . LEU B 1 17  ? -1.977  7.802   -65.343 1.00 53.30  ? 17   LEU B CG  1 
ATOM   4348 C CD1 . LEU B 1 17  ? -1.527  8.742   -64.255 1.00 49.07  ? 17   LEU B CD1 1 
ATOM   4349 C CD2 . LEU B 1 17  ? -1.224  6.468   -65.263 1.00 49.07  ? 17   LEU B CD2 1 
ATOM   4350 N N   . ARG B 1 18  ? -6.045  5.813   -66.295 1.00 47.61  ? 18   ARG B N   1 
ATOM   4351 C CA  . ARG B 1 18  ? -7.432  5.664   -65.875 1.00 42.08  ? 18   ARG B CA  1 
ATOM   4352 C C   . ARG B 1 18  ? -7.460  5.141   -64.448 1.00 41.37  ? 18   ARG B C   1 
ATOM   4353 O O   . ARG B 1 18  ? -6.897  4.087   -64.145 1.00 41.98  ? 18   ARG B O   1 
ATOM   4354 C CB  . ARG B 1 18  ? -8.181  4.707   -66.794 1.00 48.98  ? 18   ARG B CB  1 
ATOM   4355 C CG  . ARG B 1 18  ? -9.581  4.351   -66.311 1.00 61.43  ? 18   ARG B CG  1 
ATOM   4356 C CD  . ARG B 1 18  ? -10.293 3.519   -67.343 1.00 75.46  ? 18   ARG B CD  1 
ATOM   4357 N NE  . ARG B 1 18  ? -9.353  2.600   -67.976 1.00 90.03  ? 18   ARG B NE  1 
ATOM   4358 C CZ  . ARG B 1 18  ? -8.981  2.670   -69.251 1.00 97.06  ? 18   ARG B CZ  1 
ATOM   4359 N NH1 . ARG B 1 18  ? -9.493  3.609   -70.046 1.00 93.79  ? 18   ARG B NH1 1 
ATOM   4360 N NH2 . ARG B 1 18  ? -8.098  1.797   -69.730 1.00 100.02 ? 18   ARG B NH2 1 
ATOM   4361 N N   . GLY B 1 19  ? -8.097  5.891   -63.564 1.00 40.79  ? 19   GLY B N   1 
ATOM   4362 C CA  . GLY B 1 19  ? -8.229  5.449   -62.194 1.00 43.62  ? 19   GLY B CA  1 
ATOM   4363 C C   . GLY B 1 19  ? -9.553  4.751   -62.013 1.00 48.94  ? 19   GLY B C   1 
ATOM   4364 O O   . GLY B 1 19  ? -10.249 4.424   -62.978 1.00 50.06  ? 19   GLY B O   1 
ATOM   4365 N N   . ILE B 1 20  ? -9.918  4.547   -60.763 1.00 45.17  ? 20   ILE B N   1 
ATOM   4366 C CA  . ILE B 1 20  ? -11.155 3.871   -60.461 1.00 50.65  ? 20   ILE B CA  1 
ATOM   4367 C C   . ILE B 1 20  ? -11.931 4.658   -59.421 1.00 53.39  ? 20   ILE B C   1 
ATOM   4368 O O   . ILE B 1 20  ? -11.341 5.312   -58.584 1.00 60.07  ? 20   ILE B O   1 
ATOM   4369 C CB  . ILE B 1 20  ? -10.853 2.479   -59.928 1.00 52.70  ? 20   ILE B CB  1 
ATOM   4370 C CG1 . ILE B 1 20  ? -12.131 1.775   -59.503 1.00 58.77  ? 20   ILE B CG1 1 
ATOM   4371 C CG2 . ILE B 1 20  ? -9.909  2.555   -58.755 1.00 45.32  ? 20   ILE B CG2 1 
ATOM   4372 C CD1 . ILE B 1 20  ? -11.856 0.400   -58.949 1.00 62.29  ? 20   ILE B CD1 1 
ATOM   4373 N N   . ARG B 1 21  ? -13.254 4.603   -59.479 1.00 59.59  ? 21   ARG B N   1 
ATOM   4374 C CA  . ARG B 1 21  ? -14.089 5.220   -58.453 1.00 57.16  ? 21   ARG B CA  1 
ATOM   4375 C C   . ARG B 1 21  ? -14.311 4.218   -57.320 1.00 56.59  ? 21   ARG B C   1 
ATOM   4376 O O   . ARG B 1 21  ? -14.592 3.039   -57.561 1.00 61.90  ? 21   ARG B O   1 
ATOM   4377 C CB  . ARG B 1 21  ? -15.420 5.693   -59.037 1.00 54.06  ? 21   ARG B CB  1 
ATOM   4378 C CG  . ARG B 1 21  ? -16.316 6.387   -58.040 1.00 70.19  ? 21   ARG B CG  1 
ATOM   4379 C CD  . ARG B 1 21  ? -17.613 6.896   -58.682 1.00 82.66  ? 21   ARG B CD  1 
ATOM   4380 N NE  . ARG B 1 21  ? -18.543 5.811   -58.961 1.00 87.41  ? 21   ARG B NE  1 
ATOM   4381 C CZ  . ARG B 1 21  ? -19.387 5.305   -58.070 1.00 95.73  ? 21   ARG B CZ  1 
ATOM   4382 N NH1 . ARG B 1 21  ? -19.427 5.795   -56.836 1.00 93.79  ? 21   ARG B NH1 1 
ATOM   4383 N NH2 . ARG B 1 21  ? -20.192 4.306   -58.418 1.00 103.47 ? 21   ARG B NH2 1 
ATOM   4384 N N   . LEU B 1 22  ? -14.161 4.696   -56.087 1.00 49.00  ? 22   LEU B N   1 
ATOM   4385 C CA  . LEU B 1 22  ? -14.241 3.848   -54.904 1.00 52.79  ? 22   LEU B CA  1 
ATOM   4386 C C   . LEU B 1 22  ? -15.246 4.426   -53.949 1.00 62.77  ? 22   LEU B C   1 
ATOM   4387 O O   . LEU B 1 22  ? -15.479 5.635   -53.940 1.00 66.77  ? 22   LEU B O   1 
ATOM   4388 C CB  . LEU B 1 22  ? -12.898 3.782   -54.182 1.00 54.36  ? 22   LEU B CB  1 
ATOM   4389 C CG  . LEU B 1 22  ? -11.741 3.047   -54.840 1.00 57.12  ? 22   LEU B CG  1 
ATOM   4390 C CD1 . LEU B 1 22  ? -10.536 3.201   -53.967 1.00 54.62  ? 22   LEU B CD1 1 
ATOM   4391 C CD2 . LEU B 1 22  ? -12.085 1.590   -55.029 1.00 60.97  ? 22   LEU B CD2 1 
ATOM   4392 N N   . LYS B 1 23  ? -15.829 3.555   -53.136 1.00 71.43  ? 23   LYS B N   1 
ATOM   4393 C CA  . LYS B 1 23  ? -16.834 3.958   -52.161 1.00 71.72  ? 23   LYS B CA  1 
ATOM   4394 C C   . LYS B 1 23  ? -16.155 4.172   -50.798 1.00 66.17  ? 23   LYS B C   1 
ATOM   4395 O O   . LYS B 1 23  ? -15.449 3.302   -50.284 1.00 61.08  ? 23   LYS B O   1 
ATOM   4396 C CB  . LYS B 1 23  ? -17.976 2.915   -52.112 1.00 75.10  ? 23   LYS B CB  1 
ATOM   4397 C CG  . LYS B 1 23  ? -18.971 3.039   -50.951 1.00 87.89  ? 23   LYS B CG  1 
ATOM   4398 C CD  . LYS B 1 23  ? -20.365 3.541   -51.370 1.00 99.19  ? 23   LYS B CD  1 
ATOM   4399 C CE  . LYS B 1 23  ? -20.580 5.047   -51.109 1.00 103.17 ? 23   LYS B CE  1 
ATOM   4400 N NZ  . LYS B 1 23  ? -20.413 5.901   -52.336 1.00 102.01 ? 23   LYS B NZ  1 
ATOM   4401 N N   . ALA B 1 24  ? -16.320 5.376   -50.266 1.00 66.68  ? 24   ALA B N   1 
ATOM   4402 C CA  . ALA B 1 24  ? -15.987 5.695   -48.887 1.00 63.60  ? 24   ALA B CA  1 
ATOM   4403 C C   . ALA B 1 24  ? -17.339 5.914   -48.202 1.00 71.16  ? 24   ALA B C   1 
ATOM   4404 O O   . ALA B 1 24  ? -18.308 6.282   -48.865 1.00 72.95  ? 24   ALA B O   1 
ATOM   4405 C CB  . ALA B 1 24  ? -15.115 6.951   -48.822 1.00 50.61  ? 24   ALA B CB  1 
ATOM   4406 N N   . PRO B 1 25  ? -17.414 5.693   -46.878 1.00 72.19  ? 25   PRO B N   1 
ATOM   4407 C CA  . PRO B 1 25  ? -18.709 5.599   -46.188 1.00 68.31  ? 25   PRO B CA  1 
ATOM   4408 C C   . PRO B 1 25  ? -19.666 6.715   -46.567 1.00 71.75  ? 25   PRO B C   1 
ATOM   4409 O O   . PRO B 1 25  ? -20.871 6.482   -46.714 1.00 80.24  ? 25   PRO B O   1 
ATOM   4410 C CB  . PRO B 1 25  ? -18.332 5.732   -44.715 1.00 59.41  ? 25   PRO B CB  1 
ATOM   4411 C CG  . PRO B 1 25  ? -16.933 5.283   -44.642 1.00 63.14  ? 25   PRO B CG  1 
ATOM   4412 C CD  . PRO B 1 25  ? -16.289 5.694   -45.930 1.00 66.61  ? 25   PRO B CD  1 
ATOM   4413 N N   . GLY B 1 26  ? -19.128 7.917   -46.733 1.00 67.78  ? 26   GLY B N   1 
ATOM   4414 C CA  . GLY B 1 26  ? -19.947 9.079   -47.006 1.00 63.55  ? 26   GLY B CA  1 
ATOM   4415 C C   . GLY B 1 26  ? -19.794 9.639   -48.402 1.00 65.76  ? 26   GLY B C   1 
ATOM   4416 O O   . GLY B 1 26  ? -20.144 10.787  -48.640 1.00 62.00  ? 26   GLY B O   1 
ATOM   4417 N N   . GLY B 1 27  ? -19.278 8.840   -49.331 1.00 72.58  ? 27   GLY B N   1 
ATOM   4418 C CA  . GLY B 1 27  ? -19.114 9.317   -50.692 1.00 73.73  ? 27   GLY B CA  1 
ATOM   4419 C C   . GLY B 1 27  ? -18.175 8.509   -51.560 1.00 69.56  ? 27   GLY B C   1 
ATOM   4420 O O   . GLY B 1 27  ? -17.639 7.501   -51.120 1.00 69.26  ? 27   GLY B O   1 
ATOM   4421 N N   . PRO B 1 28  ? -17.992 8.946   -52.815 1.00 62.56  ? 28   PRO B N   1 
ATOM   4422 C CA  . PRO B 1 28  ? -17.054 8.354   -53.762 1.00 59.57  ? 28   PRO B CA  1 
ATOM   4423 C C   . PRO B 1 28  ? -15.707 9.070   -53.678 1.00 53.38  ? 28   PRO B C   1 
ATOM   4424 O O   . PRO B 1 28  ? -15.661 10.238  -53.281 1.00 46.77  ? 28   PRO B O   1 
ATOM   4425 C CB  . PRO B 1 28  ? -17.704 8.672   -55.119 1.00 56.55  ? 28   PRO B CB  1 
ATOM   4426 C CG  . PRO B 1 28  ? -18.980 9.413   -54.814 1.00 41.59  ? 28   PRO B CG  1 
ATOM   4427 C CD  . PRO B 1 28  ? -18.787 9.988   -53.471 1.00 49.32  ? 28   PRO B CD  1 
ATOM   4428 N N   . VAL B 1 29  ? -14.634 8.374   -54.043 1.00 51.75  ? 29   VAL B N   1 
ATOM   4429 C CA  . VAL B 1 29  ? -13.326 8.999   -54.210 1.00 47.53  ? 29   VAL B CA  1 
ATOM   4430 C C   . VAL B 1 29  ? -12.731 8.517   -55.530 1.00 51.19  ? 29   VAL B C   1 
ATOM   4431 O O   . VAL B 1 29  ? -12.917 7.368   -55.904 1.00 55.33  ? 29   VAL B O   1 
ATOM   4432 C CB  . VAL B 1 29  ? -12.369 8.630   -53.056 1.00 47.02  ? 29   VAL B CB  1 
ATOM   4433 C CG1 . VAL B 1 29  ? -12.935 9.060   -51.732 1.00 44.44  ? 29   VAL B CG1 1 
ATOM   4434 C CG2 . VAL B 1 29  ? -12.092 7.129   -53.044 1.00 50.12  ? 29   VAL B CG2 1 
ATOM   4435 N N   . SER B 1 30  ? -12.042 9.393   -56.253 1.00 53.63  ? 30   SER B N   1 
ATOM   4436 C CA  . SER B 1 30  ? -11.214 8.947   -57.372 1.00 51.95  ? 30   SER B CA  1 
ATOM   4437 C C   . SER B 1 30  ? -9.933  8.277   -56.805 1.00 57.38  ? 30   SER B C   1 
ATOM   4438 O O   . SER B 1 30  ? -9.255  8.832   -55.946 1.00 70.13  ? 30   SER B O   1 
ATOM   4439 C CB  . SER B 1 30  ? -10.826 10.133  -58.282 1.00 54.54  ? 30   SER B CB  1 
ATOM   4440 O OG  . SER B 1 30  ? -11.933 10.876  -58.771 1.00 52.81  ? 30   SER B OG  1 
ATOM   4441 N N   . ALA B 1 31  ? -9.588  7.090   -57.277 1.00 48.08  ? 31   ALA B N   1 
ATOM   4442 C CA  . ALA B 1 31  ? -8.332  6.476   -56.867 1.00 42.10  ? 31   ALA B CA  1 
ATOM   4443 C C   . ALA B 1 31  ? -7.520  6.039   -58.066 1.00 50.28  ? 31   ALA B C   1 
ATOM   4444 O O   . ALA B 1 31  ? -8.048  5.393   -58.971 1.00 48.86  ? 31   ALA B O   1 
ATOM   4445 C CB  . ALA B 1 31  ? -8.580  5.296   -55.961 1.00 38.06  ? 31   ALA B CB  1 
ATOM   4446 N N   . PHE B 1 32  ? -6.238  6.403   -58.060 1.00 53.39  ? 32   PHE B N   1 
ATOM   4447 C CA  . PHE B 1 32  ? -5.299  6.021   -59.111 1.00 50.19  ? 32   PHE B CA  1 
ATOM   4448 C C   . PHE B 1 32  ? -4.144  5.231   -58.516 1.00 50.41  ? 32   PHE B C   1 
ATOM   4449 O O   . PHE B 1 32  ? -3.200  5.793   -57.959 1.00 47.29  ? 32   PHE B O   1 
ATOM   4450 C CB  . PHE B 1 32  ? -4.784  7.260   -59.841 1.00 47.47  ? 32   PHE B CB  1 
ATOM   4451 C CG  . PHE B 1 32  ? -5.878  8.144   -60.355 1.00 53.57  ? 32   PHE B CG  1 
ATOM   4452 C CD1 . PHE B 1 32  ? -6.435  9.111   -59.551 1.00 55.75  ? 32   PHE B CD1 1 
ATOM   4453 C CD2 . PHE B 1 32  ? -6.372  7.984   -61.636 1.00 60.20  ? 32   PHE B CD2 1 
ATOM   4454 C CE1 . PHE B 1 32  ? -7.444  9.914   -60.016 1.00 52.23  ? 32   PHE B CE1 1 
ATOM   4455 C CE2 . PHE B 1 32  ? -7.382  8.780   -62.110 1.00 54.81  ? 32   PHE B CE2 1 
ATOM   4456 C CZ  . PHE B 1 32  ? -7.912  9.751   -61.299 1.00 56.84  ? 32   PHE B CZ  1 
ATOM   4457 N N   . LEU B 1 33  ? -4.225  3.917   -58.642 1.00 52.15  ? 33   LEU B N   1 
ATOM   4458 C CA  . LEU B 1 33  ? -3.273  3.039   -57.987 1.00 53.12  ? 33   LEU B CA  1 
ATOM   4459 C C   . LEU B 1 33  ? -2.285  2.394   -58.959 1.00 56.67  ? 33   LEU B C   1 
ATOM   4460 O O   . LEU B 1 33  ? -2.631  2.125   -60.104 1.00 61.35  ? 33   LEU B O   1 
ATOM   4461 C CB  . LEU B 1 33  ? -4.039  1.961   -57.234 1.00 47.38  ? 33   LEU B CB  1 
ATOM   4462 C CG  . LEU B 1 33  ? -5.358  2.424   -56.621 1.00 44.91  ? 33   LEU B CG  1 
ATOM   4463 C CD1 . LEU B 1 33  ? -6.207  1.217   -56.192 1.00 41.94  ? 33   LEU B CD1 1 
ATOM   4464 C CD2 . LEU B 1 33  ? -5.115  3.370   -55.451 1.00 41.70  ? 33   LEU B CD2 1 
ATOM   4465 N N   . GLY B 1 34  ? -1.061  2.144   -58.493 1.00 54.40  ? 34   GLY B N   1 
ATOM   4466 C CA  . GLY B 1 34  ? -0.059  1.450   -59.286 1.00 42.15  ? 34   GLY B CA  1 
ATOM   4467 C C   . GLY B 1 34  ? 0.440   2.269   -60.463 1.00 42.89  ? 34   GLY B C   1 
ATOM   4468 O O   . GLY B 1 34  ? 0.611   1.735   -61.540 1.00 43.42  ? 34   GLY B O   1 
ATOM   4469 N N   . ILE B 1 35  ? 0.637   3.572   -60.264 1.00 42.95  ? 35   ILE B N   1 
ATOM   4470 C CA  . ILE B 1 35  ? 1.235   4.445   -61.273 1.00 37.56  ? 35   ILE B CA  1 
ATOM   4471 C C   . ILE B 1 35  ? 2.753   4.308   -61.216 1.00 39.85  ? 35   ILE B C   1 
ATOM   4472 O O   . ILE B 1 35  ? 3.351   4.440   -60.156 1.00 47.00  ? 35   ILE B O   1 
ATOM   4473 C CB  . ILE B 1 35  ? 0.877   5.917   -60.992 1.00 42.11  ? 35   ILE B CB  1 
ATOM   4474 C CG1 . ILE B 1 35  ? -0.640  6.138   -61.109 1.00 44.88  ? 35   ILE B CG1 1 
ATOM   4475 C CG2 . ILE B 1 35  ? 1.664   6.846   -61.921 1.00 30.90  ? 35   ILE B CG2 1 
ATOM   4476 C CD1 . ILE B 1 35  ? -1.202  7.349   -60.328 1.00 31.22  ? 35   ILE B CD1 1 
ATOM   4477 N N   . PRO B 1 36  ? 3.396   4.023   -62.347 1.00 40.32  ? 36   PRO B N   1 
ATOM   4478 C CA  . PRO B 1 36  ? 4.861   3.872   -62.276 1.00 39.69  ? 36   PRO B CA  1 
ATOM   4479 C C   . PRO B 1 36  ? 5.555   5.204   -62.211 1.00 37.53  ? 36   PRO B C   1 
ATOM   4480 O O   . PRO B 1 36  ? 5.160   6.116   -62.925 1.00 39.85  ? 36   PRO B O   1 
ATOM   4481 C CB  . PRO B 1 36  ? 5.218   3.211   -63.608 1.00 41.10  ? 36   PRO B CB  1 
ATOM   4482 C CG  . PRO B 1 36  ? 4.094   3.558   -64.534 1.00 44.35  ? 36   PRO B CG  1 
ATOM   4483 C CD  . PRO B 1 36  ? 2.851   3.791   -63.698 1.00 37.93  ? 36   PRO B CD  1 
ATOM   4484 N N   . PHE B 1 37  ? 6.593   5.327   -61.397 1.00 42.41  ? 37   PHE B N   1 
ATOM   4485 C CA  . PHE B 1 37  ? 7.353   6.574   -61.385 1.00 41.51  ? 37   PHE B CA  1 
ATOM   4486 C C   . PHE B 1 37  ? 8.818   6.323   -61.662 1.00 43.27  ? 37   PHE B C   1 
ATOM   4487 O O   . PHE B 1 37  ? 9.629   7.246   -61.692 1.00 48.99  ? 37   PHE B O   1 
ATOM   4488 C CB  . PHE B 1 37  ? 7.163   7.316   -60.063 1.00 43.09  ? 37   PHE B CB  1 
ATOM   4489 C CG  . PHE B 1 37  ? 7.672   6.567   -58.867 1.00 43.14  ? 37   PHE B CG  1 
ATOM   4490 C CD1 . PHE B 1 37  ? 9.009   6.650   -58.487 1.00 36.36  ? 37   PHE B CD1 1 
ATOM   4491 C CD2 . PHE B 1 37  ? 6.823   5.777   -58.120 1.00 41.71  ? 37   PHE B CD2 1 
ATOM   4492 C CE1 . PHE B 1 37  ? 9.479   5.963   -57.364 1.00 32.75  ? 37   PHE B CE1 1 
ATOM   4493 C CE2 . PHE B 1 37  ? 7.306   5.067   -57.009 1.00 43.06  ? 37   PHE B CE2 1 
ATOM   4494 C CZ  . PHE B 1 37  ? 8.630   5.167   -56.631 1.00 31.01  ? 37   PHE B CZ  1 
ATOM   4495 N N   . ALA B 1 38  ? 9.154   5.058   -61.872 1.00 46.80  ? 38   ALA B N   1 
ATOM   4496 C CA  . ALA B 1 38  ? 10.528  4.685   -62.188 1.00 41.36  ? 38   ALA B CA  1 
ATOM   4497 C C   . ALA B 1 38  ? 10.563  3.574   -63.191 1.00 42.06  ? 38   ALA B C   1 
ATOM   4498 O O   . ALA B 1 38  ? 9.607   2.798   -63.325 1.00 45.01  ? 38   ALA B O   1 
ATOM   4499 C CB  . ALA B 1 38  ? 11.271  4.264   -60.949 1.00 33.06  ? 38   ALA B CB  1 
ATOM   4500 N N   . GLU B 1 39  ? 11.671  3.524   -63.913 1.00 41.40  ? 39   GLU B N   1 
ATOM   4501 C CA  . GLU B 1 39  ? 12.016  2.344   -64.680 1.00 42.84  ? 39   GLU B CA  1 
ATOM   4502 C C   . GLU B 1 39  ? 12.321  1.311   -63.636 1.00 47.17  ? 39   GLU B C   1 
ATOM   4503 O O   . GLU B 1 39  ? 13.103  1.586   -62.721 1.00 48.24  ? 39   GLU B O   1 
ATOM   4504 C CB  . GLU B 1 39  ? 13.248  2.603   -65.516 1.00 28.70  ? 39   GLU B CB  1 
ATOM   4505 C CG  . GLU B 1 39  ? 12.956  3.574   -66.598 1.00 41.37  ? 39   GLU B CG  1 
ATOM   4506 C CD  . GLU B 1 39  ? 12.232  2.924   -67.737 1.00 49.68  ? 39   GLU B CD  1 
ATOM   4507 O OE1 . GLU B 1 39  ? 12.939  2.292   -68.553 1.00 44.17  ? 39   GLU B OE1 1 
ATOM   4508 O OE2 . GLU B 1 39  ? 10.980  3.042   -67.814 1.00 56.68  ? 39   GLU B OE2 1 
ATOM   4509 N N   . PRO B 1 40  ? 11.694  0.128   -63.759 1.00 40.23  ? 40   PRO B N   1 
ATOM   4510 C CA  . PRO B 1 40  ? 11.822  -1.000  -62.823 1.00 40.61  ? 40   PRO B CA  1 
ATOM   4511 C C   . PRO B 1 40  ? 13.299  -1.294  -62.525 1.00 47.02  ? 40   PRO B C   1 
ATOM   4512 O O   . PRO B 1 40  ? 14.070  -1.561  -63.449 1.00 45.86  ? 40   PRO B O   1 
ATOM   4513 C CB  . PRO B 1 40  ? 11.189  -2.161  -63.588 1.00 36.99  ? 40   PRO B CB  1 
ATOM   4514 C CG  . PRO B 1 40  ? 10.225  -1.493  -64.539 1.00 34.11  ? 40   PRO B CG  1 
ATOM   4515 C CD  . PRO B 1 40  ? 10.917  -0.227  -64.958 1.00 23.56  ? 40   PRO B CD  1 
ATOM   4516 N N   . PRO B 1 41  ? 13.675  -1.242  -61.239 1.00 43.10  ? 41   PRO B N   1 
ATOM   4517 C CA  . PRO B 1 41  ? 15.039  -1.346  -60.733 1.00 50.96  ? 41   PRO B CA  1 
ATOM   4518 C C   . PRO B 1 41  ? 15.512  -2.792  -60.724 1.00 55.50  ? 41   PRO B C   1 
ATOM   4519 O O   . PRO B 1 41  ? 16.016  -3.299  -59.713 1.00 59.86  ? 41   PRO B O   1 
ATOM   4520 C CB  . PRO B 1 41  ? 14.873  -0.856  -59.310 1.00 50.66  ? 41   PRO B CB  1 
ATOM   4521 C CG  . PRO B 1 41  ? 13.557  -1.428  -58.921 1.00 42.74  ? 41   PRO B CG  1 
ATOM   4522 C CD  . PRO B 1 41  ? 12.695  -1.281  -60.136 1.00 39.62  ? 41   PRO B CD  1 
ATOM   4523 N N   . VAL B 1 42  ? 15.346  -3.444  -61.865 1.00 51.90  ? 42   VAL B N   1 
ATOM   4524 C CA  . VAL B 1 42  ? 15.647  -4.859  -62.012 1.00 55.41  ? 42   VAL B CA  1 
ATOM   4525 C C   . VAL B 1 42  ? 16.853  -5.158  -62.902 1.00 47.94  ? 42   VAL B C   1 
ATOM   4526 O O   . VAL B 1 42  ? 17.314  -4.318  -63.669 1.00 42.83  ? 42   VAL B O   1 
ATOM   4527 C CB  . VAL B 1 42  ? 14.424  -5.620  -62.570 1.00 58.88  ? 42   VAL B CB  1 
ATOM   4528 C CG1 . VAL B 1 42  ? 13.253  -5.474  -61.623 1.00 50.97  ? 42   VAL B CG1 1 
ATOM   4529 C CG2 . VAL B 1 42  ? 14.067  -5.107  -63.931 1.00 24.27  ? 42   VAL B CG2 1 
ATOM   4530 N N   . GLY B 1 43  ? 17.342  -6.385  -62.806 1.00 56.29  ? 43   GLY B N   1 
ATOM   4531 C CA  . GLY B 1 43  ? 18.535  -6.798  -63.526 1.00 49.99  ? 43   GLY B CA  1 
ATOM   4532 C C   . GLY B 1 43  ? 19.754  -6.021  -63.078 1.00 56.18  ? 43   GLY B C   1 
ATOM   4533 O O   . GLY B 1 43  ? 20.140  -6.045  -61.899 1.00 60.29  ? 43   GLY B O   1 
ATOM   4534 N N   . SER B 1 44  ? 20.357  -5.322  -64.031 1.00 57.00  ? 44   SER B N   1 
ATOM   4535 C CA  . SER B 1 44  ? 21.550  -4.536  -63.768 1.00 60.95  ? 44   SER B CA  1 
ATOM   4536 C C   . SER B 1 44  ? 21.207  -3.234  -63.050 1.00 60.04  ? 44   SER B C   1 
ATOM   4537 O O   . SER B 1 44  ? 22.095  -2.543  -62.534 1.00 60.15  ? 44   SER B O   1 
ATOM   4538 C CB  . SER B 1 44  ? 22.258  -4.228  -65.074 1.00 58.86  ? 44   SER B CB  1 
ATOM   4539 O OG  . SER B 1 44  ? 21.467  -3.351  -65.850 1.00 67.84  ? 44   SER B OG  1 
ATOM   4540 N N   . ARG B 1 45  ? 19.921  -2.892  -63.043 1.00 48.45  ? 45   ARG B N   1 
ATOM   4541 C CA  . ARG B 1 45  ? 19.460  -1.738  -62.288 1.00 50.91  ? 45   ARG B CA  1 
ATOM   4542 C C   . ARG B 1 45  ? 19.476  -2.019  -60.756 1.00 53.25  ? 45   ARG B C   1 
ATOM   4543 O O   . ARG B 1 45  ? 19.539  -1.096  -59.937 1.00 55.61  ? 45   ARG B O   1 
ATOM   4544 C CB  . ARG B 1 45  ? 18.072  -1.305  -62.770 1.00 47.90  ? 45   ARG B CB  1 
ATOM   4545 C CG  . ARG B 1 45  ? 18.047  -0.546  -64.091 1.00 52.71  ? 45   ARG B CG  1 
ATOM   4546 C CD  . ARG B 1 45  ? 18.510  0.902   -63.923 1.00 77.29  ? 45   ARG B CD  1 
ATOM   4547 N NE  . ARG B 1 45  ? 19.973  1.058   -63.924 1.00 94.64  ? 45   ARG B NE  1 
ATOM   4548 C CZ  . ARG B 1 45  ? 20.628  2.160   -63.538 1.00 103.93 ? 45   ARG B CZ  1 
ATOM   4549 N NH1 . ARG B 1 45  ? 19.971  3.228   -63.080 1.00 100.99 ? 45   ARG B NH1 1 
ATOM   4550 N NH2 . ARG B 1 45  ? 21.955  2.188   -63.593 1.00 109.18 ? 45   ARG B NH2 1 
ATOM   4551 N N   . ARG B 1 46  ? 19.451  -3.293  -60.375 1.00 40.50  ? 46   ARG B N   1 
ATOM   4552 C CA  . ARG B 1 46  ? 19.519  -3.655  -58.961 1.00 45.68  ? 46   ARG B CA  1 
ATOM   4553 C C   . ARG B 1 46  ? 20.635  -2.931  -58.203 1.00 47.46  ? 46   ARG B C   1 
ATOM   4554 O O   . ARG B 1 46  ? 21.801  -2.939  -58.628 1.00 52.27  ? 46   ARG B O   1 
ATOM   4555 C CB  . ARG B 1 46  ? 19.663  -5.177  -58.786 1.00 41.46  ? 46   ARG B CB  1 
ATOM   4556 C CG  . ARG B 1 46  ? 19.692  -5.639  -57.333 1.00 35.14  ? 46   ARG B CG  1 
ATOM   4557 C CD  . ARG B 1 46  ? 19.991  -7.145  -57.217 1.00 45.14  ? 46   ARG B CD  1 
ATOM   4558 N NE  . ARG B 1 46  ? 18.809  -8.011  -57.316 1.00 45.65  ? 46   ARG B NE  1 
ATOM   4559 C CZ  . ARG B 1 46  ? 18.847  -9.345  -57.302 1.00 48.06  ? 46   ARG B CZ  1 
ATOM   4560 N NH1 . ARG B 1 46  ? 20.003  -9.997  -57.204 1.00 49.36  ? 46   ARG B NH1 1 
ATOM   4561 N NH2 . ARG B 1 46  ? 17.720  -10.035 -57.392 1.00 45.57  ? 46   ARG B NH2 1 
ATOM   4562 N N   . PHE B 1 47  ? 20.256  -2.339  -57.067 1.00 49.05  ? 47   PHE B N   1 
ATOM   4563 C CA  . PHE B 1 47  ? 21.150  -1.608  -56.141 1.00 45.51  ? 47   PHE B CA  1 
ATOM   4564 C C   . PHE B 1 47  ? 21.482  -0.196  -56.609 1.00 46.76  ? 47   PHE B C   1 
ATOM   4565 O O   . PHE B 1 47  ? 22.250  0.501   -55.960 1.00 52.96  ? 47   PHE B O   1 
ATOM   4566 C CB  . PHE B 1 47  ? 22.480  -2.353  -55.837 1.00 47.58  ? 47   PHE B CB  1 
ATOM   4567 C CG  . PHE B 1 47  ? 22.313  -3.777  -55.367 1.00 53.75  ? 47   PHE B CG  1 
ATOM   4568 C CD1 . PHE B 1 47  ? 21.649  -4.069  -54.178 1.00 60.32  ? 47   PHE B CD1 1 
ATOM   4569 C CD2 . PHE B 1 47  ? 22.848  -4.827  -56.104 1.00 56.55  ? 47   PHE B CD2 1 
ATOM   4570 C CE1 . PHE B 1 47  ? 21.492  -5.386  -53.748 1.00 59.90  ? 47   PHE B CE1 1 
ATOM   4571 C CE2 . PHE B 1 47  ? 22.705  -6.149  -55.676 1.00 59.50  ? 47   PHE B CE2 1 
ATOM   4572 C CZ  . PHE B 1 47  ? 22.022  -6.429  -54.506 1.00 60.93  ? 47   PHE B CZ  1 
ATOM   4573 N N   . MET B 1 48  ? 20.939  0.225   -57.745 1.00 50.77  ? 48   MET B N   1 
ATOM   4574 C CA  . MET B 1 48  ? 21.303  1.533   -58.283 1.00 47.72  ? 48   MET B CA  1 
ATOM   4575 C C   . MET B 1 48  ? 20.226  2.562   -58.058 1.00 45.82  ? 48   MET B C   1 
ATOM   4576 O O   . MET B 1 48  ? 19.055  2.230   -57.877 1.00 41.51  ? 48   MET B O   1 
ATOM   4577 C CB  . MET B 1 48  ? 21.611  1.435   -59.776 1.00 50.08  ? 48   MET B CB  1 
ATOM   4578 C CG  . MET B 1 48  ? 22.482  0.240   -60.133 1.00 59.79  ? 48   MET B CG  1 
ATOM   4579 S SD  . MET B 1 48  ? 23.801  0.661   -61.279 1.00 111.72 ? 48   MET B SD  1 
ATOM   4580 C CE  . MET B 1 48  ? 24.662  1.900   -60.322 1.00 26.20  ? 48   MET B CE  1 
ATOM   4581 N N   . PRO B 1 49  ? 20.624  3.830   -58.085 1.00 52.81  ? 49   PRO B N   1 
ATOM   4582 C CA  . PRO B 1 49  ? 19.681  4.951   -58.099 1.00 46.50  ? 49   PRO B CA  1 
ATOM   4583 C C   . PRO B 1 49  ? 18.608  4.675   -59.141 1.00 47.36  ? 49   PRO B C   1 
ATOM   4584 O O   . PRO B 1 49  ? 18.916  4.101   -60.196 1.00 54.55  ? 49   PRO B O   1 
ATOM   4585 C CB  . PRO B 1 49  ? 20.543  6.120   -58.565 1.00 41.56  ? 49   PRO B CB  1 
ATOM   4586 C CG  . PRO B 1 49  ? 21.920  5.751   -58.194 1.00 40.37  ? 49   PRO B CG  1 
ATOM   4587 C CD  . PRO B 1 49  ? 22.013  4.262   -58.294 1.00 48.69  ? 49   PRO B CD  1 
ATOM   4588 N N   . PRO B 1 50  ? 17.356  5.055   -58.845 1.00 45.61  ? 50   PRO B N   1 
ATOM   4589 C CA  . PRO B 1 50  ? 16.236  4.891   -59.772 1.00 37.56  ? 50   PRO B CA  1 
ATOM   4590 C C   . PRO B 1 50  ? 16.346  5.863   -60.941 1.00 43.29  ? 50   PRO B C   1 
ATOM   4591 O O   . PRO B 1 50  ? 16.865  6.965   -60.754 1.00 52.41  ? 50   PRO B O   1 
ATOM   4592 C CB  . PRO B 1 50  ? 15.030  5.265   -58.910 1.00 35.29  ? 50   PRO B CB  1 
ATOM   4593 C CG  . PRO B 1 50  ? 15.607  6.192   -57.872 1.00 36.27  ? 50   PRO B CG  1 
ATOM   4594 C CD  . PRO B 1 50  ? 16.888  5.533   -57.527 1.00 44.62  ? 50   PRO B CD  1 
ATOM   4595 N N   . GLU B 1 51  ? 15.886  5.459   -62.123 1.00 40.78  ? 51   GLU B N   1 
ATOM   4596 C CA  . GLU B 1 51  ? 15.729  6.385   -63.245 1.00 45.63  ? 51   GLU B CA  1 
ATOM   4597 C C   . GLU B 1 51  ? 14.241  6.584   -63.511 1.00 41.93  ? 51   GLU B C   1 
ATOM   4598 O O   . GLU B 1 51  ? 13.437  5.681   -63.297 1.00 49.08  ? 51   GLU B O   1 
ATOM   4599 C CB  . GLU B 1 51  ? 16.414  5.853   -64.496 1.00 54.79  ? 51   GLU B CB  1 
ATOM   4600 C CG  . GLU B 1 51  ? 17.873  5.510   -64.332 1.00 71.31  ? 51   GLU B CG  1 
ATOM   4601 C CD  . GLU B 1 51  ? 18.303  4.392   -65.283 1.00 96.58  ? 51   GLU B CD  1 
ATOM   4602 O OE1 . GLU B 1 51  ? 17.449  3.541   -65.658 1.00 99.35  ? 51   GLU B OE1 1 
ATOM   4603 O OE2 . GLU B 1 51  ? 19.499  4.364   -65.658 1.00 108.03 ? 51   GLU B OE2 1 
ATOM   4604 N N   . PRO B 1 52  ? 13.869  7.775   -63.964 1.00 42.16  ? 52   PRO B N   1 
ATOM   4605 C CA  . PRO B 1 52  ? 12.467  8.144   -64.235 1.00 47.29  ? 52   PRO B CA  1 
ATOM   4606 C C   . PRO B 1 52  ? 11.821  7.218   -65.267 1.00 46.22  ? 52   PRO B C   1 
ATOM   4607 O O   . PRO B 1 52  ? 12.464  6.859   -66.260 1.00 50.72  ? 52   PRO B O   1 
ATOM   4608 C CB  . PRO B 1 52  ? 12.562  9.553   -64.846 1.00 46.73  ? 52   PRO B CB  1 
ATOM   4609 C CG  . PRO B 1 52  ? 13.989  9.975   -64.749 1.00 42.23  ? 52   PRO B CG  1 
ATOM   4610 C CD  . PRO B 1 52  ? 14.845  8.809   -64.341 1.00 39.60  ? 52   PRO B CD  1 
ATOM   4611 N N   . LYS B 1 53  ? 10.564  6.857   -65.038 1.00 40.09  ? 53   LYS B N   1 
ATOM   4612 C CA  . LYS B 1 53  ? 9.772   6.048   -65.979 1.00 46.80  ? 53   LYS B CA  1 
ATOM   4613 C C   . LYS B 1 53  ? 9.682   6.656   -67.372 1.00 46.92  ? 53   LYS B C   1 
ATOM   4614 O O   . LYS B 1 53  ? 9.326   7.824   -67.519 1.00 48.49  ? 53   LYS B O   1 
ATOM   4615 C CB  . LYS B 1 53  ? 8.342   5.853   -65.446 1.00 40.17  ? 53   LYS B CB  1 
ATOM   4616 C CG  . LYS B 1 53  ? 7.413   5.112   -66.377 1.00 36.02  ? 53   LYS B CG  1 
ATOM   4617 C CD  . LYS B 1 53  ? 7.589   3.613   -66.248 1.00 44.65  ? 53   LYS B CD  1 
ATOM   4618 C CE  . LYS B 1 53  ? 6.686   2.832   -67.227 1.00 42.46  ? 53   LYS B CE  1 
ATOM   4619 N NZ  . LYS B 1 53  ? 6.940   3.180   -68.662 1.00 40.06  ? 53   LYS B NZ  1 
ATOM   4620 N N   . ARG B 1 54  ? 9.987   5.871   -68.403 1.00 41.19  ? 54   ARG B N   1 
ATOM   4621 C CA  . ARG B 1 54  ? 9.779   6.362   -69.763 1.00 42.58  ? 54   ARG B CA  1 
ATOM   4622 C C   . ARG B 1 54  ? 8.276   6.518   -70.025 1.00 51.82  ? 54   ARG B C   1 
ATOM   4623 O O   . ARG B 1 54  ? 7.464   5.784   -69.468 1.00 57.12  ? 54   ARG B O   1 
ATOM   4624 C CB  . ARG B 1 54  ? 10.413  5.417   -70.784 1.00 30.12  ? 54   ARG B CB  1 
ATOM   4625 C CG  . ARG B 1 54  ? 11.850  5.086   -70.452 1.00 40.75  ? 54   ARG B CG  1 
ATOM   4626 C CD  . ARG B 1 54  ? 12.389  3.910   -71.255 1.00 39.20  ? 54   ARG B CD  1 
ATOM   4627 N NE  . ARG B 1 54  ? 11.600  2.710   -71.011 1.00 43.70  ? 54   ARG B NE  1 
ATOM   4628 C CZ  . ARG B 1 54  ? 10.956  2.017   -71.946 1.00 49.87  ? 54   ARG B CZ  1 
ATOM   4629 N NH1 . ARG B 1 54  ? 10.249  0.953   -71.583 1.00 44.65  ? 54   ARG B NH1 1 
ATOM   4630 N NH2 . ARG B 1 54  ? 11.019  2.378   -73.232 1.00 55.06  ? 54   ARG B NH2 1 
ATOM   4631 N N   . PRO B 1 55  ? 7.905   7.473   -70.879 1.00 53.60  ? 55   PRO B N   1 
ATOM   4632 C CA  . PRO B 1 55  ? 6.512   7.711   -71.298 1.00 55.55  ? 55   PRO B CA  1 
ATOM   4633 C C   . PRO B 1 55  ? 5.851   6.473   -71.901 1.00 49.39  ? 55   PRO B C   1 
ATOM   4634 O O   . PRO B 1 55  ? 6.554   5.601   -72.377 1.00 46.34  ? 55   PRO B O   1 
ATOM   4635 C CB  . PRO B 1 55  ? 6.647   8.793   -72.367 1.00 48.94  ? 55   PRO B CB  1 
ATOM   4636 C CG  . PRO B 1 55  ? 7.929   9.476   -72.048 1.00 54.09  ? 55   PRO B CG  1 
ATOM   4637 C CD  . PRO B 1 55  ? 8.841   8.430   -71.486 1.00 53.85  ? 55   PRO B CD  1 
ATOM   4638 N N   . TRP B 1 56  ? 4.522   6.400   -71.870 1.00 48.59  ? 56   TRP B N   1 
ATOM   4639 C CA  . TRP B 1 56  ? 3.800   5.232   -72.379 1.00 48.98  ? 56   TRP B CA  1 
ATOM   4640 C C   . TRP B 1 56  ? 2.684   5.623   -73.343 1.00 48.89  ? 56   TRP B C   1 
ATOM   4641 O O   . TRP B 1 56  ? 2.184   6.744   -73.305 1.00 52.13  ? 56   TRP B O   1 
ATOM   4642 C CB  . TRP B 1 56  ? 3.206   4.411   -71.237 1.00 47.05  ? 56   TRP B CB  1 
ATOM   4643 C CG  . TRP B 1 56  ? 2.328   5.210   -70.371 1.00 51.56  ? 56   TRP B CG  1 
ATOM   4644 C CD1 . TRP B 1 56  ? 1.009   5.465   -70.561 1.00 49.60  ? 56   TRP B CD1 1 
ATOM   4645 C CD2 . TRP B 1 56  ? 2.708   5.900   -69.170 1.00 56.14  ? 56   TRP B CD2 1 
ATOM   4646 N NE1 . TRP B 1 56  ? 0.533   6.262   -69.550 1.00 52.29  ? 56   TRP B NE1 1 
ATOM   4647 C CE2 . TRP B 1 56  ? 1.556   6.539   -68.679 1.00 53.65  ? 56   TRP B CE2 1 
ATOM   4648 C CE3 . TRP B 1 56  ? 3.907   6.021   -68.454 1.00 55.23  ? 56   TRP B CE3 1 
ATOM   4649 C CZ2 . TRP B 1 56  ? 1.564   7.291   -67.496 1.00 49.59  ? 56   TRP B CZ2 1 
ATOM   4650 C CZ3 . TRP B 1 56  ? 3.915   6.774   -67.287 1.00 52.81  ? 56   TRP B CZ3 1 
ATOM   4651 C CH2 . TRP B 1 56  ? 2.750   7.406   -66.826 1.00 48.91  ? 56   TRP B CH2 1 
ATOM   4652 N N   . SER B 1 57  ? 2.305   4.686   -74.205 1.00 44.76  ? 57   SER B N   1 
ATOM   4653 C CA  . SER B 1 57  ? 1.269   4.916   -75.197 1.00 48.95  ? 57   SER B CA  1 
ATOM   4654 C C   . SER B 1 57  ? -0.115  4.604   -74.625 1.00 52.34  ? 57   SER B C   1 
ATOM   4655 O O   . SER B 1 57  ? -0.238  3.839   -73.673 1.00 59.91  ? 57   SER B O   1 
ATOM   4656 C CB  . SER B 1 57  ? 1.520   4.015   -76.403 1.00 53.07  ? 57   SER B CB  1 
ATOM   4657 O OG  . SER B 1 57  ? 0.934   2.729   -76.222 1.00 45.86  ? 57   SER B OG  1 
ATOM   4658 N N   . GLY B 1 58  ? -1.155  5.183   -75.210 1.00 43.02  ? 58   GLY B N   1 
ATOM   4659 C CA  . GLY B 1 58  ? -2.508  4.853   -74.797 1.00 50.08  ? 58   GLY B CA  1 
ATOM   4660 C C   . GLY B 1 58  ? -2.856  5.213   -73.365 1.00 57.36  ? 58   GLY B C   1 
ATOM   4661 O O   . GLY B 1 58  ? -2.440  6.244   -72.832 1.00 57.75  ? 58   GLY B O   1 
ATOM   4662 N N   . VAL B 1 59  ? -3.631  4.348   -72.729 1.00 55.05  ? 59   VAL B N   1 
ATOM   4663 C CA  . VAL B 1 59  ? -4.163  4.657   -71.411 1.00 50.75  ? 59   VAL B CA  1 
ATOM   4664 C C   . VAL B 1 59  ? -3.769  3.576   -70.431 1.00 56.22  ? 59   VAL B C   1 
ATOM   4665 O O   . VAL B 1 59  ? -4.290  2.454   -70.483 1.00 53.93  ? 59   VAL B O   1 
ATOM   4666 C CB  . VAL B 1 59  ? -5.701  4.809   -71.477 1.00 52.16  ? 59   VAL B CB  1 
ATOM   4667 C CG1 . VAL B 1 59  ? -6.320  4.904   -70.087 1.00 53.98  ? 59   VAL B CG1 1 
ATOM   4668 C CG2 . VAL B 1 59  ? -6.055  6.032   -72.308 1.00 47.80  ? 59   VAL B CG2 1 
ATOM   4669 N N   . LEU B 1 60  ? -2.822  3.911   -69.553 1.00 65.22  ? 60   LEU B N   1 
ATOM   4670 C CA  . LEU B 1 60  ? -2.335  2.976   -68.535 1.00 59.94  ? 60   LEU B CA  1 
ATOM   4671 C C   . LEU B 1 60  ? -3.427  2.710   -67.509 1.00 54.39  ? 60   LEU B C   1 
ATOM   4672 O O   . LEU B 1 60  ? -4.087  3.633   -67.022 1.00 50.59  ? 60   LEU B O   1 
ATOM   4673 C CB  . LEU B 1 60  ? -1.098  3.533   -67.846 1.00 55.44  ? 60   LEU B CB  1 
ATOM   4674 C CG  . LEU B 1 60  ? -0.191  2.580   -67.075 1.00 60.48  ? 60   LEU B CG  1 
ATOM   4675 C CD1 . LEU B 1 60  ? 0.252   1.372   -67.917 1.00 65.70  ? 60   LEU B CD1 1 
ATOM   4676 C CD2 . LEU B 1 60  ? 1.020   3.351   -66.627 1.00 57.49  ? 60   LEU B CD2 1 
ATOM   4677 N N   . ASP B 1 61  ? -3.649  1.441   -67.215 1.00 48.38  ? 61   ASP B N   1 
ATOM   4678 C CA  . ASP B 1 61  ? -4.688  1.083   -66.278 1.00 50.85  ? 61   ASP B CA  1 
ATOM   4679 C C   . ASP B 1 61  ? -4.183  1.237   -64.854 1.00 54.13  ? 61   ASP B C   1 
ATOM   4680 O O   . ASP B 1 61  ? -3.323  0.472   -64.414 1.00 60.09  ? 61   ASP B O   1 
ATOM   4681 C CB  . ASP B 1 61  ? -5.150  -0.351  -66.500 1.00 55.68  ? 61   ASP B CB  1 
ATOM   4682 C CG  . ASP B 1 61  ? -6.042  -0.840  -65.376 1.00 74.84  ? 61   ASP B CG  1 
ATOM   4683 O OD1 . ASP B 1 61  ? -5.594  -1.718  -64.590 1.00 83.76  ? 61   ASP B OD1 1 
ATOM   4684 O OD2 . ASP B 1 61  ? -7.175  -0.312  -65.260 1.00 73.35  ? 61   ASP B OD2 1 
ATOM   4685 N N   . ALA B 1 62  ? -4.727  2.212   -64.132 1.00 46.32  ? 62   ALA B N   1 
ATOM   4686 C CA  . ALA B 1 62  ? -4.270  2.492   -62.772 1.00 47.25  ? 62   ALA B CA  1 
ATOM   4687 C C   . ALA B 1 62  ? -5.395  2.313   -61.771 1.00 50.96  ? 62   ALA B C   1 
ATOM   4688 O O   . ALA B 1 62  ? -5.811  3.269   -61.121 1.00 52.98  ? 62   ALA B O   1 
ATOM   4689 C CB  . ALA B 1 62  ? -3.720  3.900   -62.676 1.00 39.37  ? 62   ALA B CB  1 
ATOM   4690 N N   . THR B 1 63  ? -5.884  1.089   -61.649 1.00 51.83  ? 63   THR B N   1 
ATOM   4691 C CA  . THR B 1 63  ? -7.059  0.841   -60.828 1.00 62.17  ? 63   THR B CA  1 
ATOM   4692 C C   . THR B 1 63  ? -6.758  -0.256  -59.831 1.00 64.07  ? 63   THR B C   1 
ATOM   4693 O O   . THR B 1 63  ? -7.622  -0.683  -59.073 1.00 66.69  ? 63   THR B O   1 
ATOM   4694 C CB  . THR B 1 63  ? -8.326  0.478   -61.692 1.00 55.51  ? 63   THR B CB  1 
ATOM   4695 O OG1 . THR B 1 63  ? -8.212  -0.851  -62.236 1.00 51.25  ? 63   THR B OG1 1 
ATOM   4696 C CG2 . THR B 1 63  ? -8.532  1.497   -62.826 1.00 42.27  ? 63   THR B CG2 1 
ATOM   4697 N N   . THR B 1 64  ? -5.511  -0.695  -59.826 1.00 61.57  ? 64   THR B N   1 
ATOM   4698 C CA  . THR B 1 64  ? -5.115  -1.799  -58.983 1.00 57.82  ? 64   THR B CA  1 
ATOM   4699 C C   . THR B 1 64  ? -3.752  -1.545  -58.299 1.00 54.99  ? 64   THR B C   1 
ATOM   4700 O O   . THR B 1 64  ? -2.861  -0.883  -58.849 1.00 52.79  ? 64   THR B O   1 
ATOM   4701 C CB  . THR B 1 64  ? -5.044  -3.060  -59.826 1.00 63.16  ? 64   THR B CB  1 
ATOM   4702 O OG1 . THR B 1 64  ? -5.111  -4.204  -58.971 1.00 68.28  ? 64   THR B OG1 1 
ATOM   4703 C CG2 . THR B 1 64  ? -3.736  -3.071  -60.650 1.00 63.74  ? 64   THR B CG2 1 
ATOM   4704 N N   . PHE B 1 65  ? -3.585  -2.054  -57.086 1.00 48.98  ? 65   PHE B N   1 
ATOM   4705 C CA  . PHE B 1 65  ? -2.296  -1.910  -56.436 1.00 49.55  ? 65   PHE B CA  1 
ATOM   4706 C C   . PHE B 1 65  ? -1.265  -2.734  -57.181 1.00 52.90  ? 65   PHE B C   1 
ATOM   4707 O O   . PHE B 1 65  ? -1.515  -3.883  -57.557 1.00 54.12  ? 65   PHE B O   1 
ATOM   4708 C CB  . PHE B 1 65  ? -2.337  -2.335  -54.963 1.00 47.20  ? 65   PHE B CB  1 
ATOM   4709 C CG  . PHE B 1 65  ? -3.021  -1.351  -54.066 1.00 51.43  ? 65   PHE B CG  1 
ATOM   4710 C CD1 . PHE B 1 65  ? -2.567  -0.035  -53.974 1.00 57.20  ? 65   PHE B CD1 1 
ATOM   4711 C CD2 . PHE B 1 65  ? -4.119  -1.733  -53.307 1.00 47.09  ? 65   PHE B CD2 1 
ATOM   4712 C CE1 . PHE B 1 65  ? -3.205  0.882   -53.147 1.00 51.56  ? 65   PHE B CE1 1 
ATOM   4713 C CE2 . PHE B 1 65  ? -4.754  -0.831  -52.470 1.00 46.92  ? 65   PHE B CE2 1 
ATOM   4714 C CZ  . PHE B 1 65  ? -4.293  0.481   -52.390 1.00 51.91  ? 65   PHE B CZ  1 
ATOM   4715 N N   . GLN B 1 66  ? -0.101  -2.131  -57.379 1.00 48.54  ? 66   GLN B N   1 
ATOM   4716 C CA  . GLN B 1 66  ? 1.015   -2.830  -57.978 1.00 43.20  ? 66   GLN B CA  1 
ATOM   4717 C C   . GLN B 1 66  ? 1.723   -3.733  -56.976 1.00 50.09  ? 66   GLN B C   1 
ATOM   4718 O O   . GLN B 1 66  ? 1.363   -3.754  -55.791 1.00 53.69  ? 66   GLN B O   1 
ATOM   4719 C CB  . GLN B 1 66  ? 2.000   -1.838  -58.574 1.00 33.51  ? 66   GLN B CB  1 
ATOM   4720 C CG  . GLN B 1 66  ? 1.785   -1.573  -60.042 1.00 31.58  ? 66   GLN B CG  1 
ATOM   4721 C CD  . GLN B 1 66  ? 2.190   -2.743  -60.890 1.00 49.28  ? 66   GLN B CD  1 
ATOM   4722 O OE1 . GLN B 1 66  ? 2.161   -2.671  -62.107 1.00 51.48  ? 66   GLN B OE1 1 
ATOM   4723 N NE2 . GLN B 1 66  ? 2.580   -3.838  -60.249 1.00 56.24  ? 66   GLN B NE2 1 
ATOM   4724 N N   . ASN B 1 67  ? 2.716   -4.481  -57.475 1.00 38.29  ? 67   ASN B N   1 
ATOM   4725 C CA  . ASN B 1 67  ? 3.524   -5.383  -56.664 1.00 33.63  ? 67   ASN B CA  1 
ATOM   4726 C C   . ASN B 1 67  ? 4.274   -4.719  -55.528 1.00 42.45  ? 67   ASN B C   1 
ATOM   4727 O O   . ASN B 1 67  ? 4.826   -3.624  -55.682 1.00 54.31  ? 67   ASN B O   1 
ATOM   4728 C CB  . ASN B 1 67  ? 4.561   -6.099  -57.532 1.00 49.99  ? 67   ASN B CB  1 
ATOM   4729 C CG  . ASN B 1 67  ? 3.939   -6.834  -58.693 1.00 59.43  ? 67   ASN B CG  1 
ATOM   4730 O OD1 . ASN B 1 67  ? 2.941   -7.543  -58.516 1.00 60.91  ? 67   ASN B OD1 1 
ATOM   4731 N ND2 . ASN B 1 67  ? 4.516   -6.664  -59.899 1.00 55.34  ? 67   ASN B ND2 1 
ATOM   4732 N N   . VAL B 1 68  ? 4.330   -5.423  -54.399 1.00 44.27  ? 68   VAL B N   1 
ATOM   4733 C CA  . VAL B 1 68  ? 5.124   -5.016  -53.241 1.00 39.76  ? 68   VAL B CA  1 
ATOM   4734 C C   . VAL B 1 68  ? 6.593   -5.306  -53.462 1.00 41.93  ? 68   VAL B C   1 
ATOM   4735 O O   . VAL B 1 68  ? 6.948   -6.413  -53.865 1.00 48.28  ? 68   VAL B O   1 
ATOM   4736 C CB  . VAL B 1 68  ? 4.716   -5.833  -52.000 1.00 47.68  ? 68   VAL B CB  1 
ATOM   4737 C CG1 . VAL B 1 68  ? 5.671   -5.538  -50.850 1.00 46.49  ? 68   VAL B CG1 1 
ATOM   4738 C CG2 . VAL B 1 68  ? 3.245   -5.573  -51.624 1.00 40.62  ? 68   VAL B CG2 1 
ATOM   4739 N N   . CYS B 1 69  ? 7.452   -4.339  -53.160 1.00 41.82  ? 69   CYS B N   1 
ATOM   4740 C CA  . CYS B 1 69  ? 8.903   -4.521  -53.285 1.00 33.50  ? 69   CYS B CA  1 
ATOM   4741 C C   . CYS B 1 69  ? 9.390   -5.767  -52.571 1.00 41.84  ? 69   CYS B C   1 
ATOM   4742 O O   . CYS B 1 69  ? 8.919   -6.085  -51.467 1.00 34.50  ? 69   CYS B O   1 
ATOM   4743 C CB  . CYS B 1 69  ? 9.637   -3.325  -52.706 1.00 30.22  ? 69   CYS B CB  1 
ATOM   4744 S SG  . CYS B 1 69  ? 9.544   -1.865  -53.666 1.00 49.87  ? 69   CYS B SG  1 
ATOM   4745 N N   . TYR B 1 70  ? 10.351  -6.462  -53.180 1.00 50.09  ? 70   TYR B N   1 
ATOM   4746 C CA  . TYR B 1 70  ? 10.808  -7.734  -52.626 1.00 42.40  ? 70   TYR B CA  1 
ATOM   4747 C C   . TYR B 1 70  ? 11.395  -7.574  -51.218 1.00 46.25  ? 70   TYR B C   1 
ATOM   4748 O O   . TYR B 1 70  ? 12.281  -6.745  -50.978 1.00 49.45  ? 70   TYR B O   1 
ATOM   4749 C CB  . TYR B 1 70  ? 11.780  -8.442  -53.563 1.00 47.15  ? 70   TYR B CB  1 
ATOM   4750 C CG  . TYR B 1 70  ? 11.699  -9.949  -53.438 1.00 52.75  ? 70   TYR B CG  1 
ATOM   4751 C CD1 . TYR B 1 70  ? 10.763  -10.672 -54.158 1.00 53.70  ? 70   TYR B CD1 1 
ATOM   4752 C CD2 . TYR B 1 70  ? 12.535  -10.640 -52.576 1.00 51.03  ? 70   TYR B CD2 1 
ATOM   4753 C CE1 . TYR B 1 70  ? 10.677  -12.045 -54.040 1.00 54.15  ? 70   TYR B CE1 1 
ATOM   4754 C CE2 . TYR B 1 70  ? 12.450  -12.009 -52.446 1.00 59.00  ? 70   TYR B CE2 1 
ATOM   4755 C CZ  . TYR B 1 70  ? 11.518  -12.708 -53.180 1.00 56.96  ? 70   TYR B CZ  1 
ATOM   4756 O OH  . TYR B 1 70  ? 11.430  -14.072 -53.042 1.00 54.40  ? 70   TYR B OH  1 
ATOM   4757 N N   . GLN B 1 71  ? 10.873  -8.378  -50.292 1.00 52.09  ? 71   GLN B N   1 
ATOM   4758 C CA  . GLN B 1 71  ? 11.145  -8.222  -48.865 1.00 49.24  ? 71   GLN B CA  1 
ATOM   4759 C C   . GLN B 1 71  ? 10.896  -9.494  -48.084 1.00 50.08  ? 71   GLN B C   1 
ATOM   4760 O O   . GLN B 1 71  ? 10.184  -10.374 -48.542 1.00 49.44  ? 71   GLN B O   1 
ATOM   4761 C CB  . GLN B 1 71  ? 10.244  -7.137  -48.264 1.00 38.73  ? 71   GLN B CB  1 
ATOM   4762 C CG  . GLN B 1 71  ? 8.790   -7.518  -48.165 1.00 37.84  ? 71   GLN B CG  1 
ATOM   4763 C CD  . GLN B 1 71  ? 7.906   -6.326  -47.897 1.00 54.32  ? 71   GLN B CD  1 
ATOM   4764 O OE1 . GLN B 1 71  ? 7.847   -5.394  -48.692 1.00 58.91  ? 71   GLN B OE1 1 
ATOM   4765 N NE2 . GLN B 1 71  ? 7.204   -6.351  -46.777 1.00 61.42  ? 71   GLN B NE2 1 
ATOM   4766 N N   . TYR B 1 72  ? 11.470  -9.557  -46.885 1.00 53.69  ? 72   TYR B N   1 
ATOM   4767 C CA  . TYR B 1 72  ? 11.159  -10.588 -45.898 1.00 54.20  ? 72   TYR B CA  1 
ATOM   4768 C C   . TYR B 1 72  ? 9.670   -10.590 -45.484 1.00 54.87  ? 72   TYR B C   1 
ATOM   4769 O O   . TYR B 1 72  ? 9.005   -9.531  -45.397 1.00 54.73  ? 72   TYR B O   1 
ATOM   4770 C CB  . TYR B 1 72  ? 12.050  -10.374 -44.674 1.00 59.84  ? 72   TYR B CB  1 
ATOM   4771 C CG  . TYR B 1 72  ? 11.827  -11.349 -43.553 1.00 63.90  ? 72   TYR B CG  1 
ATOM   4772 C CD1 . TYR B 1 72  ? 11.071  -10.993 -42.439 1.00 67.14  ? 72   TYR B CD1 1 
ATOM   4773 C CD2 . TYR B 1 72  ? 12.378  -12.627 -43.600 1.00 64.29  ? 72   TYR B CD2 1 
ATOM   4774 C CE1 . TYR B 1 72  ? 10.866  -11.889 -41.400 1.00 72.39  ? 72   TYR B CE1 1 
ATOM   4775 C CE2 . TYR B 1 72  ? 12.181  -13.531 -42.571 1.00 63.24  ? 72   TYR B CE2 1 
ATOM   4776 C CZ  . TYR B 1 72  ? 11.426  -13.157 -41.475 1.00 70.42  ? 72   TYR B CZ  1 
ATOM   4777 O OH  . TYR B 1 72  ? 11.225  -14.050 -40.450 1.00 75.09  ? 72   TYR B OH  1 
ATOM   4778 N N   . VAL B 1 73  ? 9.145   -11.786 -45.232 1.00 52.56  ? 73   VAL B N   1 
ATOM   4779 C CA  . VAL B 1 73  ? 7.763   -11.926 -44.773 1.00 55.04  ? 73   VAL B CA  1 
ATOM   4780 C C   . VAL B 1 73  ? 7.714   -12.618 -43.418 1.00 65.99  ? 73   VAL B C   1 
ATOM   4781 O O   . VAL B 1 73  ? 8.289   -13.697 -43.255 1.00 68.93  ? 73   VAL B O   1 
ATOM   4782 C CB  . VAL B 1 73  ? 6.923   -12.728 -45.771 1.00 50.50  ? 73   VAL B CB  1 
ATOM   4783 C CG1 . VAL B 1 73  ? 5.602   -13.134 -45.154 1.00 48.04  ? 73   VAL B CG1 1 
ATOM   4784 C CG2 . VAL B 1 73  ? 6.701   -11.924 -47.023 1.00 50.05  ? 73   VAL B CG2 1 
ATOM   4785 N N   . ASP B 1 74  ? 7.029   -12.011 -42.447 1.00 68.51  ? 74   ASP B N   1 
ATOM   4786 C CA  . ASP B 1 74  ? 7.040   -12.549 -41.088 1.00 72.49  ? 74   ASP B CA  1 
ATOM   4787 C C   . ASP B 1 74  ? 6.239   -13.840 -40.910 1.00 78.02  ? 74   ASP B C   1 
ATOM   4788 O O   . ASP B 1 74  ? 5.090   -13.956 -41.350 1.00 76.60  ? 74   ASP B O   1 
ATOM   4789 C CB  . ASP B 1 74  ? 6.595   -11.517 -40.059 1.00 77.17  ? 74   ASP B CB  1 
ATOM   4790 C CG  . ASP B 1 74  ? 7.121   -11.837 -38.684 1.00 88.82  ? 74   ASP B CG  1 
ATOM   4791 O OD1 . ASP B 1 74  ? 6.313   -12.244 -37.811 1.00 95.02  ? 74   ASP B OD1 1 
ATOM   4792 O OD2 . ASP B 1 74  ? 8.359   -11.722 -38.502 1.00 89.58  ? 74   ASP B OD2 1 
ATOM   4793 N N   . THR B 1 75  ? 6.859   -14.803 -40.240 1.00 84.09  ? 75   THR B N   1 
ATOM   4794 C CA  . THR B 1 75  ? 6.253   -16.109 -40.036 1.00 89.54  ? 75   THR B CA  1 
ATOM   4795 C C   . THR B 1 75  ? 6.129   -16.443 -38.549 1.00 93.79  ? 75   THR B C   1 
ATOM   4796 O O   . THR B 1 75  ? 5.676   -17.527 -38.181 1.00 91.85  ? 75   THR B O   1 
ATOM   4797 C CB  . THR B 1 75  ? 7.069   -17.192 -40.755 1.00 88.63  ? 75   THR B CB  1 
ATOM   4798 O OG1 . THR B 1 75  ? 8.471   -16.949 -40.550 1.00 90.03  ? 75   THR B OG1 1 
ATOM   4799 C CG2 . THR B 1 75  ? 6.755   -17.171 -42.247 1.00 77.38  ? 75   THR B CG2 1 
ATOM   4800 N N   . LEU B 1 76  ? 6.520   -15.498 -37.700 1.00 98.82  ? 76   LEU B N   1 
ATOM   4801 C CA  . LEU B 1 76  ? 6.525   -15.722 -36.262 1.00 97.73  ? 76   LEU B CA  1 
ATOM   4802 C C   . LEU B 1 76  ? 5.190   -16.257 -35.744 1.00 99.25  ? 76   LEU B C   1 
ATOM   4803 O O   . LEU B 1 76  ? 5.145   -17.292 -35.073 1.00 104.34 ? 76   LEU B O   1 
ATOM   4804 C CB  . LEU B 1 76  ? 6.907   -14.449 -35.514 1.00 94.16  ? 76   LEU B CB  1 
ATOM   4805 C CG  . LEU B 1 76  ? 6.931   -14.641 -33.992 1.00 97.11  ? 76   LEU B CG  1 
ATOM   4806 C CD1 . LEU B 1 76  ? 7.805   -15.838 -33.598 1.00 94.64  ? 76   LEU B CD1 1 
ATOM   4807 C CD2 . LEU B 1 76  ? 7.379   -13.368 -33.278 1.00 96.32  ? 76   LEU B CD2 1 
ATOM   4808 N N   . TYR B 1 77  ? 4.108   -15.547 -36.040 1.00 91.51  ? 77   TYR B N   1 
ATOM   4809 C CA  . TYR B 1 77  ? 2.790   -16.005 -35.629 1.00 88.74  ? 77   TYR B CA  1 
ATOM   4810 C C   . TYR B 1 77  ? 1.923   -16.219 -36.846 1.00 92.70  ? 77   TYR B C   1 
ATOM   4811 O O   . TYR B 1 77  ? 1.112   -15.357 -37.181 1.00 91.77  ? 77   TYR B O   1 
ATOM   4812 C CB  . TYR B 1 77  ? 2.138   -14.980 -34.733 1.00 87.01  ? 77   TYR B CB  1 
ATOM   4813 C CG  . TYR B 1 77  ? 2.793   -14.851 -33.385 1.00 90.20  ? 77   TYR B CG  1 
ATOM   4814 C CD1 . TYR B 1 77  ? 2.597   -15.814 -32.404 1.00 87.65  ? 77   TYR B CD1 1 
ATOM   4815 C CD2 . TYR B 1 77  ? 3.593   -13.753 -33.081 1.00 89.99  ? 77   TYR B CD2 1 
ATOM   4816 C CE1 . TYR B 1 77  ? 3.183   -15.691 -31.150 1.00 89.58  ? 77   TYR B CE1 1 
ATOM   4817 C CE2 . TYR B 1 77  ? 4.184   -13.619 -31.834 1.00 89.29  ? 77   TYR B CE2 1 
ATOM   4818 C CZ  . TYR B 1 77  ? 3.979   -14.592 -30.863 1.00 89.60  ? 77   TYR B CZ  1 
ATOM   4819 O OH  . TYR B 1 77  ? 4.563   -14.465 -29.609 1.00 84.35  ? 77   TYR B OH  1 
ATOM   4820 N N   . PRO B 1 78  ? 2.088   -17.379 -37.504 1.00 96.43  ? 78   PRO B N   1 
ATOM   4821 C CA  . PRO B 1 78  ? 1.516   -17.658 -38.833 1.00 91.84  ? 78   PRO B CA  1 
ATOM   4822 C C   . PRO B 1 78  ? -0.009  -17.514 -38.893 1.00 85.51  ? 78   PRO B C   1 
ATOM   4823 O O   . PRO B 1 78  ? -0.725  -18.302 -38.271 1.00 75.05  ? 78   PRO B O   1 
ATOM   4824 C CB  . PRO B 1 78  ? 1.934   -19.113 -39.101 1.00 89.57  ? 78   PRO B CB  1 
ATOM   4825 C CG  . PRO B 1 78  ? 3.106   -19.362 -38.177 1.00 92.27  ? 78   PRO B CG  1 
ATOM   4826 C CD  . PRO B 1 78  ? 2.811   -18.544 -36.956 1.00 94.98  ? 78   PRO B CD  1 
ATOM   4827 N N   . GLY B 1 79  ? -0.491  -16.517 -39.637 1.00 86.40  ? 79   GLY B N   1 
ATOM   4828 C CA  . GLY B 1 79  ? -1.922  -16.300 -39.801 1.00 83.52  ? 79   GLY B CA  1 
ATOM   4829 C C   . GLY B 1 79  ? -2.583  -15.572 -38.641 1.00 79.67  ? 79   GLY B C   1 
ATOM   4830 O O   . GLY B 1 79  ? -3.811  -15.537 -38.532 1.00 73.86  ? 79   GLY B O   1 
ATOM   4831 N N   . PHE B 1 80  ? -1.752  -15.003 -37.769 1.00 77.40  ? 80   PHE B N   1 
ATOM   4832 C CA  . PHE B 1 80  ? -2.204  -14.145 -36.689 1.00 71.69  ? 80   PHE B CA  1 
ATOM   4833 C C   . PHE B 1 80  ? -2.476  -12.756 -37.265 1.00 75.52  ? 80   PHE B C   1 
ATOM   4834 O O   . PHE B 1 80  ? -1.605  -12.177 -37.918 1.00 80.53  ? 80   PHE B O   1 
ATOM   4835 C CB  . PHE B 1 80  ? -1.134  -14.082 -35.586 1.00 68.22  ? 80   PHE B CB  1 
ATOM   4836 C CG  . PHE B 1 80  ? -1.444  -13.091 -34.501 1.00 74.06  ? 80   PHE B CG  1 
ATOM   4837 C CD1 . PHE B 1 80  ? -2.655  -13.144 -33.819 1.00 71.59  ? 80   PHE B CD1 1 
ATOM   4838 C CD2 . PHE B 1 80  ? -0.535  -12.092 -34.174 1.00 81.84  ? 80   PHE B CD2 1 
ATOM   4839 C CE1 . PHE B 1 80  ? -2.957  -12.230 -32.827 1.00 76.18  ? 80   PHE B CE1 1 
ATOM   4840 C CE2 . PHE B 1 80  ? -0.827  -11.168 -33.176 1.00 81.45  ? 80   PHE B CE2 1 
ATOM   4841 C CZ  . PHE B 1 80  ? -2.043  -11.236 -32.500 1.00 80.10  ? 80   PHE B CZ  1 
ATOM   4842 N N   . GLU B 1 81  ? -3.679  -12.228 -37.044 1.00 75.80  ? 81   GLU B N   1 
ATOM   4843 C CA  . GLU B 1 81  ? -4.049  -10.935 -37.623 1.00 82.84  ? 81   GLU B CA  1 
ATOM   4844 C C   . GLU B 1 81  ? -3.061  -9.827  -37.239 1.00 78.54  ? 81   GLU B C   1 
ATOM   4845 O O   . GLU B 1 81  ? -2.773  -8.927  -38.031 1.00 66.80  ? 81   GLU B O   1 
ATOM   4846 C CB  . GLU B 1 81  ? -5.472  -10.534 -37.217 1.00 95.70  ? 81   GLU B CB  1 
ATOM   4847 C CG  . GLU B 1 81  ? -5.896  -9.164  -37.756 1.00 109.45 ? 81   GLU B CG  1 
ATOM   4848 C CD  . GLU B 1 81  ? -6.297  -9.200  -39.236 1.00 122.44 ? 81   GLU B CD  1 
ATOM   4849 O OE1 . GLU B 1 81  ? -7.426  -9.660  -39.532 1.00 130.47 ? 81   GLU B OE1 1 
ATOM   4850 O OE2 . GLU B 1 81  ? -5.494  -8.761  -40.099 1.00 119.79 ? 81   GLU B OE2 1 
ATOM   4851 N N   . GLY B 1 82  ? -2.539  -9.909  -36.019 1.00 78.30  ? 82   GLY B N   1 
ATOM   4852 C CA  . GLY B 1 82  ? -1.657  -8.889  -35.498 1.00 75.44  ? 82   GLY B CA  1 
ATOM   4853 C C   . GLY B 1 82  ? -0.357  -8.715  -36.257 1.00 69.94  ? 82   GLY B C   1 
ATOM   4854 O O   . GLY B 1 82  ? 0.106   -7.586  -36.403 1.00 59.56  ? 82   GLY B O   1 
ATOM   4855 N N   . THR B 1 83  ? 0.249   -9.814  -36.711 1.00 67.46  ? 83   THR B N   1 
ATOM   4856 C CA  . THR B 1 83  ? 1.496   -9.710  -37.471 1.00 67.04  ? 83   THR B CA  1 
ATOM   4857 C C   . THR B 1 83  ? 1.212   -9.679  -38.969 1.00 66.94  ? 83   THR B C   1 
ATOM   4858 O O   . THR B 1 83  ? 1.983   -9.131  -39.761 1.00 63.91  ? 83   THR B O   1 
ATOM   4859 C CB  . THR B 1 83  ? 2.510   -10.836 -37.129 1.00 68.39  ? 83   THR B CB  1 
ATOM   4860 O OG1 . THR B 1 83  ? 2.015   -12.120 -37.548 1.00 66.41  ? 83   THR B OG1 1 
ATOM   4861 C CG2 . THR B 1 83  ? 2.787   -10.854 -35.642 1.00 74.59  ? 83   THR B CG2 1 
ATOM   4862 N N   . GLU B 1 84  ? 0.074   -10.248 -39.337 1.00 66.22  ? 84   GLU B N   1 
ATOM   4863 C CA  . GLU B 1 84  ? -0.275  -10.455 -40.727 1.00 66.70  ? 84   GLU B CA  1 
ATOM   4864 C C   . GLU B 1 84  ? -0.622  -9.145  -41.439 1.00 68.70  ? 84   GLU B C   1 
ATOM   4865 O O   . GLU B 1 84  ? -0.306  -8.960  -42.620 1.00 63.93  ? 84   GLU B O   1 
ATOM   4866 C CB  . GLU B 1 84  ? -1.442  -11.431 -40.808 1.00 71.49  ? 84   GLU B CB  1 
ATOM   4867 C CG  . GLU B 1 84  ? -1.370  -12.348 -41.990 1.00 88.77  ? 84   GLU B CG  1 
ATOM   4868 C CD  . GLU B 1 84  ? -0.081  -13.148 -42.026 1.00 99.30  ? 84   GLU B CD  1 
ATOM   4869 O OE1 . GLU B 1 84  ? 0.125   -14.003 -41.125 1.00 99.26  ? 84   GLU B OE1 1 
ATOM   4870 O OE2 . GLU B 1 84  ? 0.715   -12.923 -42.969 1.00 99.76  ? 84   GLU B OE2 1 
ATOM   4871 N N   . MET B 1 85  ? -1.261  -8.233  -40.710 1.00 69.74  ? 85   MET B N   1 
ATOM   4872 C CA  . MET B 1 85  ? -1.702  -6.944  -41.260 1.00 61.48  ? 85   MET B CA  1 
ATOM   4873 C C   . MET B 1 85  ? -0.553  -6.097  -41.806 1.00 56.51  ? 85   MET B C   1 
ATOM   4874 O O   . MET B 1 85  ? -0.781  -5.162  -42.581 1.00 52.59  ? 85   MET B O   1 
ATOM   4875 C CB  . MET B 1 85  ? -2.448  -6.147  -40.192 1.00 55.78  ? 85   MET B CB  1 
ATOM   4876 C CG  . MET B 1 85  ? -1.604  -5.904  -38.956 1.00 56.12  ? 85   MET B CG  1 
ATOM   4877 S SD  . MET B 1 85  ? -2.455  -4.963  -37.694 1.00 62.85  ? 85   MET B SD  1 
ATOM   4878 C CE  . MET B 1 85  ? -2.459  -3.325  -38.448 1.00 42.25  ? 85   MET B CE  1 
ATOM   4879 N N   . TRP B 1 86  ? 0.669   -6.430  -41.384 1.00 55.98  ? 86   TRP B N   1 
ATOM   4880 C CA  . TRP B 1 86  ? 1.893   -5.769  -41.847 1.00 50.05  ? 86   TRP B CA  1 
ATOM   4881 C C   . TRP B 1 86  ? 2.522   -6.466  -43.052 1.00 56.25  ? 86   TRP B C   1 
ATOM   4882 O O   . TRP B 1 86  ? 3.295   -5.868  -43.792 1.00 63.40  ? 86   TRP B O   1 
ATOM   4883 C CB  . TRP B 1 86  ? 2.892   -5.691  -40.700 1.00 45.34  ? 86   TRP B CB  1 
ATOM   4884 C CG  . TRP B 1 86  ? 2.279   -5.039  -39.539 1.00 55.74  ? 86   TRP B CG  1 
ATOM   4885 C CD1 . TRP B 1 86  ? 1.951   -5.612  -38.353 1.00 50.35  ? 86   TRP B CD1 1 
ATOM   4886 C CD2 . TRP B 1 86  ? 1.859   -3.674  -39.460 1.00 58.72  ? 86   TRP B CD2 1 
ATOM   4887 N NE1 . TRP B 1 86  ? 1.358   -4.686  -37.536 1.00 43.97  ? 86   TRP B NE1 1 
ATOM   4888 C CE2 . TRP B 1 86  ? 1.300   -3.485  -38.190 1.00 51.53  ? 86   TRP B CE2 1 
ATOM   4889 C CE3 . TRP B 1 86  ? 1.920   -2.587  -40.336 1.00 52.69  ? 86   TRP B CE3 1 
ATOM   4890 C CZ2 . TRP B 1 86  ? 0.808   -2.255  -37.773 1.00 53.51  ? 86   TRP B CZ2 1 
ATOM   4891 C CZ3 . TRP B 1 86  ? 1.419   -1.383  -39.930 1.00 49.98  ? 86   TRP B CZ3 1 
ATOM   4892 C CH2 . TRP B 1 86  ? 0.876   -1.218  -38.658 1.00 49.74  ? 86   TRP B CH2 1 
ATOM   4893 N N   . ASN B 1 87  ? 2.172   -7.730  -43.249 1.00 57.79  ? 87   ASN B N   1 
ATOM   4894 C CA  . ASN B 1 87  ? 2.716   -8.526  -44.344 1.00 57.80  ? 87   ASN B CA  1 
ATOM   4895 C C   . ASN B 1 87  ? 2.221   -8.103  -45.731 1.00 54.18  ? 87   ASN B C   1 
ATOM   4896 O O   . ASN B 1 87  ? 1.090   -7.638  -45.874 1.00 48.29  ? 87   ASN B O   1 
ATOM   4897 C CB  . ASN B 1 87  ? 2.418   -10.005 -44.100 1.00 56.82  ? 87   ASN B CB  1 
ATOM   4898 C CG  . ASN B 1 87  ? 3.459   -10.671 -43.223 1.00 58.01  ? 87   ASN B CG  1 
ATOM   4899 O OD1 . ASN B 1 87  ? 4.639   -10.311 -43.252 1.00 63.36  ? 87   ASN B OD1 1 
ATOM   4900 N ND2 . ASN B 1 87  ? 3.030   -11.655 -42.446 1.00 56.03  ? 87   ASN B ND2 1 
ATOM   4901 N N   . PRO B 1 88  ? 3.066   -8.293  -46.763 1.00 59.00  ? 88   PRO B N   1 
ATOM   4902 C CA  . PRO B 1 88  ? 2.681   -7.878  -48.124 1.00 52.46  ? 88   PRO B CA  1 
ATOM   4903 C C   . PRO B 1 88  ? 1.337   -8.488  -48.525 1.00 57.20  ? 88   PRO B C   1 
ATOM   4904 O O   . PRO B 1 88  ? 1.101   -9.685  -48.279 1.00 58.67  ? 88   PRO B O   1 
ATOM   4905 C CB  . PRO B 1 88  ? 3.800   -8.452  -49.022 1.00 39.99  ? 88   PRO B CB  1 
ATOM   4906 C CG  . PRO B 1 88  ? 4.885   -8.878  -48.123 1.00 42.12  ? 88   PRO B CG  1 
ATOM   4907 C CD  . PRO B 1 88  ? 4.305   -9.102  -46.748 1.00 52.10  ? 88   PRO B CD  1 
ATOM   4908 N N   . ASN B 1 89  ? 0.485   -7.676  -49.151 1.00 45.41  ? 89   ASN B N   1 
ATOM   4909 C CA  . ASN B 1 89  ? -0.831  -8.114  -49.578 1.00 36.15  ? 89   ASN B CA  1 
ATOM   4910 C C   . ASN B 1 89  ? -0.992  -8.067  -51.104 1.00 49.44  ? 89   ASN B C   1 
ATOM   4911 O O   . ASN B 1 89  ? -2.107  -8.014  -51.620 1.00 62.47  ? 89   ASN B O   1 
ATOM   4912 C CB  . ASN B 1 89  ? -1.914  -7.300  -48.862 1.00 42.25  ? 89   ASN B CB  1 
ATOM   4913 C CG  . ASN B 1 89  ? -1.994  -5.837  -49.348 1.00 53.24  ? 89   ASN B CG  1 
ATOM   4914 O OD1 . ASN B 1 89  ? -1.004  -5.257  -49.816 1.00 51.44  ? 89   ASN B OD1 1 
ATOM   4915 N ND2 . ASN B 1 89  ? -3.187  -5.246  -49.243 1.00 57.00  ? 89   ASN B ND2 1 
ATOM   4916 N N   . ARG B 1 90  ? 0.132   -8.073  -51.814 1.00 49.31  ? 90   ARG B N   1 
ATOM   4917 C CA  . ARG B 1 90  ? 0.158   -8.276  -53.262 1.00 48.83  ? 90   ARG B CA  1 
ATOM   4918 C C   . ARG B 1 90  ? 1.358   -9.144  -53.563 1.00 52.79  ? 90   ARG B C   1 
ATOM   4919 O O   . ARG B 1 90  ? 2.086   -9.533  -52.652 1.00 61.15  ? 90   ARG B O   1 
ATOM   4920 C CB  . ARG B 1 90  ? 0.264   -6.956  -54.018 1.00 42.55  ? 90   ARG B CB  1 
ATOM   4921 C CG  . ARG B 1 90  ? -0.998  -6.122  -53.999 1.00 44.78  ? 90   ARG B CG  1 
ATOM   4922 C CD  . ARG B 1 90  ? -2.057  -6.665  -54.957 1.00 63.08  ? 90   ARG B CD  1 
ATOM   4923 N NE  . ARG B 1 90  ? -3.261  -5.838  -54.966 1.00 65.34  ? 90   ARG B NE  1 
ATOM   4924 C CZ  . ARG B 1 90  ? -4.115  -5.767  -53.950 1.00 64.02  ? 90   ARG B CZ  1 
ATOM   4925 N NH1 . ARG B 1 90  ? -3.901  -6.479  -52.850 1.00 58.49  ? 90   ARG B NH1 1 
ATOM   4926 N NH2 . ARG B 1 90  ? -5.179  -4.980  -54.027 1.00 64.43  ? 90   ARG B NH2 1 
ATOM   4927 N N   . GLU B 1 91  ? 1.568   -9.471  -54.830 1.00 52.81  ? 91   GLU B N   1 
ATOM   4928 C CA  . GLU B 1 91  ? 2.698   -10.328 -55.183 1.00 55.26  ? 91   GLU B CA  1 
ATOM   4929 C C   . GLU B 1 91  ? 4.017   -9.596  -54.952 1.00 57.22  ? 91   GLU B C   1 
ATOM   4930 O O   . GLU B 1 91  ? 4.127   -8.401  -55.225 1.00 60.54  ? 91   GLU B O   1 
ATOM   4931 C CB  . GLU B 1 91  ? 2.593   -10.808 -56.639 1.00 62.72  ? 91   GLU B CB  1 
ATOM   4932 C CG  . GLU B 1 91  ? 1.772   -12.098 -56.832 1.00 72.62  ? 91   GLU B CG  1 
ATOM   4933 C CD  . GLU B 1 91  ? 2.338   -13.273 -56.035 1.00 82.63  ? 91   GLU B CD  1 
ATOM   4934 O OE1 . GLU B 1 91  ? 3.467   -13.726 -56.345 1.00 74.72  ? 91   GLU B OE1 1 
ATOM   4935 O OE2 . GLU B 1 91  ? 1.655   -13.734 -55.091 1.00 92.17  ? 91   GLU B OE2 1 
ATOM   4936 N N   . LEU B 1 92  ? 5.015   -10.303 -54.433 1.00 50.06  ? 92   LEU B N   1 
ATOM   4937 C CA  . LEU B 1 92  ? 6.346   -9.718  -54.302 1.00 42.23  ? 92   LEU B CA  1 
ATOM   4938 C C   . LEU B 1 92  ? 7.040   -9.625  -55.660 1.00 46.15  ? 92   LEU B C   1 
ATOM   4939 O O   . LEU B 1 92  ? 6.932   -10.533 -56.468 1.00 51.95  ? 92   LEU B O   1 
ATOM   4940 C CB  . LEU B 1 92  ? 7.214   -10.551 -53.366 1.00 34.72  ? 92   LEU B CB  1 
ATOM   4941 C CG  . LEU B 1 92  ? 6.721   -10.904 -51.971 1.00 40.01  ? 92   LEU B CG  1 
ATOM   4942 C CD1 . LEU B 1 92  ? 7.914   -11.341 -51.152 1.00 38.18  ? 92   LEU B CD1 1 
ATOM   4943 C CD2 . LEU B 1 92  ? 6.060   -9.721  -51.325 1.00 50.20  ? 92   LEU B CD2 1 
ATOM   4944 N N   . SER B 1 93  ? 7.774   -8.545  -55.896 1.00 44.60  ? 93   SER B N   1 
ATOM   4945 C CA  . SER B 1 93  ? 8.607   -8.435  -57.089 1.00 40.37  ? 93   SER B CA  1 
ATOM   4946 C C   . SER B 1 93  ? 9.628   -7.284  -56.971 1.00 49.17  ? 93   SER B C   1 
ATOM   4947 O O   . SER B 1 93  ? 9.375   -6.280  -56.324 1.00 54.93  ? 93   SER B O   1 
ATOM   4948 C CB  . SER B 1 93  ? 7.719   -8.256  -58.314 1.00 38.77  ? 93   SER B CB  1 
ATOM   4949 O OG  . SER B 1 93  ? 8.429   -7.649  -59.369 1.00 43.08  ? 93   SER B OG  1 
ATOM   4950 N N   . GLU B 1 94  ? 10.795  -7.430  -57.574 1.00 50.02  ? 94   GLU B N   1 
ATOM   4951 C CA  . GLU B 1 94  ? 11.720  -6.313  -57.619 1.00 42.94  ? 94   GLU B CA  1 
ATOM   4952 C C   . GLU B 1 94  ? 11.134  -5.167  -58.436 1.00 38.08  ? 94   GLU B C   1 
ATOM   4953 O O   . GLU B 1 94  ? 11.456  -4.018  -58.229 1.00 28.31  ? 94   GLU B O   1 
ATOM   4954 C CB  . GLU B 1 94  ? 13.066  -6.738  -58.189 1.00 35.23  ? 94   GLU B CB  1 
ATOM   4955 C CG  . GLU B 1 94  ? 14.169  -6.700  -57.172 1.00 53.08  ? 94   GLU B CG  1 
ATOM   4956 C CD  . GLU B 1 94  ? 15.377  -7.531  -57.582 1.00 64.76  ? 94   GLU B CD  1 
ATOM   4957 O OE1 . GLU B 1 94  ? 16.472  -6.953  -57.803 1.00 75.35  ? 94   GLU B OE1 1 
ATOM   4958 O OE2 . GLU B 1 94  ? 15.215  -8.763  -57.688 1.00 48.95  ? 94   GLU B OE2 1 
ATOM   4959 N N   . ASP B 1 95  ? 10.281  -5.482  -59.392 1.00 35.96  ? 95   ASP B N   1 
ATOM   4960 C CA  . ASP B 1 95  ? 9.649   -4.432  -60.144 1.00 34.49  ? 95   ASP B CA  1 
ATOM   4961 C C   . ASP B 1 95  ? 8.477   -3.906  -59.327 1.00 38.36  ? 95   ASP B C   1 
ATOM   4962 O O   . ASP B 1 95  ? 7.384   -4.453  -59.379 1.00 39.88  ? 95   ASP B O   1 
ATOM   4963 C CB  . ASP B 1 95  ? 9.150   -4.984  -61.453 1.00 32.69  ? 95   ASP B CB  1 
ATOM   4964 C CG  . ASP B 1 95  ? 8.245   -4.024  -62.168 1.00 43.51  ? 95   ASP B CG  1 
ATOM   4965 O OD1 . ASP B 1 95  ? 8.185   -2.820  -61.774 1.00 46.59  ? 95   ASP B OD1 1 
ATOM   4966 O OD2 . ASP B 1 95  ? 7.615   -4.491  -63.136 1.00 39.21  ? 95   ASP B OD2 1 
ATOM   4967 N N   . CYS B 1 96  ? 8.718   -2.845  -58.569 1.00 35.13  ? 96   CYS B N   1 
ATOM   4968 C CA  . CYS B 1 96  ? 7.749   -2.367  -57.592 1.00 39.53  ? 96   CYS B CA  1 
ATOM   4969 C C   . CYS B 1 96  ? 7.710   -0.848  -57.439 1.00 39.42  ? 96   CYS B C   1 
ATOM   4970 O O   . CYS B 1 96  ? 7.126   -0.350  -56.494 1.00 35.64  ? 96   CYS B O   1 
ATOM   4971 C CB  . CYS B 1 96  ? 8.059   -2.972  -56.231 1.00 45.85  ? 96   CYS B CB  1 
ATOM   4972 S SG  . CYS B 1 96  ? 9.682   -2.502  -55.587 1.00 43.65  ? 96   CYS B SG  1 
ATOM   4973 N N   . LEU B 1 97  ? 8.315   -0.112  -58.360 1.00 41.05  ? 97   LEU B N   1 
ATOM   4974 C CA  . LEU B 1 97  ? 8.344   1.331   -58.213 1.00 34.45  ? 97   LEU B CA  1 
ATOM   4975 C C   . LEU B 1 97  ? 7.066   1.993   -58.775 1.00 43.73  ? 97   LEU B C   1 
ATOM   4976 O O   . LEU B 1 97  ? 7.000   2.509   -59.911 1.00 39.91  ? 97   LEU B O   1 
ATOM   4977 C CB  . LEU B 1 97  ? 9.660   1.927   -58.721 1.00 29.72  ? 97   LEU B CB  1 
ATOM   4978 C CG  . LEU B 1 97  ? 10.864  1.336   -57.980 1.00 36.24  ? 97   LEU B CG  1 
ATOM   4979 C CD1 . LEU B 1 97  ? 12.164  2.116   -58.234 1.00 35.96  ? 97   LEU B CD1 1 
ATOM   4980 C CD2 . LEU B 1 97  ? 10.547  1.287   -56.491 1.00 32.87  ? 97   LEU B CD2 1 
ATOM   4981 N N   . TYR B 1 98  ? 6.043   1.954   -57.933 1.00 39.09  ? 98   TYR B N   1 
ATOM   4982 C CA  . TYR B 1 98  ? 4.758   2.508   -58.273 1.00 45.13  ? 98   TYR B CA  1 
ATOM   4983 C C   . TYR B 1 98  ? 4.277   3.295   -57.079 1.00 49.01  ? 98   TYR B C   1 
ATOM   4984 O O   . TYR B 1 98  ? 4.686   3.027   -55.938 1.00 50.34  ? 98   TYR B O   1 
ATOM   4985 C CB  . TYR B 1 98  ? 3.776   1.390   -58.615 1.00 42.63  ? 98   TYR B CB  1 
ATOM   4986 C CG  . TYR B 1 98  ? 4.283   0.534   -59.743 1.00 47.10  ? 98   TYR B CG  1 
ATOM   4987 C CD1 . TYR B 1 98  ? 3.914   0.799   -61.059 1.00 36.91  ? 98   TYR B CD1 1 
ATOM   4988 C CD2 . TYR B 1 98  ? 5.172   -0.521  -59.499 1.00 43.48  ? 98   TYR B CD2 1 
ATOM   4989 C CE1 . TYR B 1 98  ? 4.392   0.032   -62.090 1.00 35.28  ? 98   TYR B CE1 1 
ATOM   4990 C CE2 . TYR B 1 98  ? 5.653   -1.303  -60.530 1.00 41.32  ? 98   TYR B CE2 1 
ATOM   4991 C CZ  . TYR B 1 98  ? 5.260   -1.022  -61.828 1.00 45.06  ? 98   TYR B CZ  1 
ATOM   4992 O OH  . TYR B 1 98  ? 5.739   -1.779  -62.882 1.00 49.79  ? 98   TYR B OH  1 
ATOM   4993 N N   . LEU B 1 99  ? 3.417   4.267   -57.352 1.00 37.28  ? 99   LEU B N   1 
ATOM   4994 C CA  . LEU B 1 99  ? 2.842   5.086   -56.311 1.00 41.85  ? 99   LEU B CA  1 
ATOM   4995 C C   . LEU B 1 99  ? 1.335   5.165   -56.511 1.00 40.43  ? 99   LEU B C   1 
ATOM   4996 O O   . LEU B 1 99  ? 0.845   4.888   -57.607 1.00 38.62  ? 99   LEU B O   1 
ATOM   4997 C CB  . LEU B 1 99  ? 3.482   6.484   -56.309 1.00 35.40  ? 99   LEU B CB  1 
ATOM   4998 C CG  . LEU B 1 99  ? 3.382   7.408   -57.519 1.00 31.31  ? 99   LEU B CG  1 
ATOM   4999 C CD1 . LEU B 1 99  ? 1.966   7.917   -57.711 1.00 33.08  ? 99   LEU B CD1 1 
ATOM   5000 C CD2 . LEU B 1 99  ? 4.326   8.554   -57.309 1.00 39.82  ? 99   LEU B CD2 1 
ATOM   5001 N N   . ASN B 1 100 ? 0.619   5.547   -55.450 1.00 38.75  ? 100  ASN B N   1 
ATOM   5002 C CA  . ASN B 1 100 ? -0.845  5.678   -55.483 1.00 41.58  ? 100  ASN B CA  1 
ATOM   5003 C C   . ASN B 1 100 ? -1.323  7.062   -55.091 1.00 45.90  ? 100  ASN B C   1 
ATOM   5004 O O   . ASN B 1 100 ? -0.830  7.634   -54.123 1.00 49.19  ? 100  ASN B O   1 
ATOM   5005 C CB  . ASN B 1 100 ? -1.461  4.669   -54.534 1.00 40.01  ? 100  ASN B CB  1 
ATOM   5006 C CG  . ASN B 1 100 ? -0.765  3.326   -54.598 1.00 43.94  ? 100  ASN B CG  1 
ATOM   5007 O OD1 . ASN B 1 100 ? -0.732  2.674   -55.650 1.00 42.68  ? 100  ASN B OD1 1 
ATOM   5008 N ND2 . ASN B 1 100 ? -0.209  2.901   -53.475 1.00 36.04  ? 100  ASN B ND2 1 
ATOM   5009 N N   . VAL B 1 101 ? -2.270  7.602   -55.853 1.00 47.70  ? 101  VAL B N   1 
ATOM   5010 C CA  . VAL B 1 101 ? -2.926  8.864   -55.503 1.00 48.96  ? 101  VAL B CA  1 
ATOM   5011 C C   . VAL B 1 101 ? -4.411  8.669   -55.236 1.00 48.19  ? 101  VAL B C   1 
ATOM   5012 O O   . VAL B 1 101 ? -5.102  8.022   -56.028 1.00 47.28  ? 101  VAL B O   1 
ATOM   5013 C CB  . VAL B 1 101 ? -2.855  9.879   -56.645 1.00 50.68  ? 101  VAL B CB  1 
ATOM   5014 C CG1 . VAL B 1 101 ? -3.666  11.120  -56.289 1.00 49.99  ? 101  VAL B CG1 1 
ATOM   5015 C CG2 . VAL B 1 101 ? -1.420  10.246  -56.964 1.00 47.63  ? 101  VAL B CG2 1 
ATOM   5016 N N   . TRP B 1 102 ? -4.903  9.233   -54.132 1.00 41.15  ? 102  TRP B N   1 
ATOM   5017 C CA  . TRP B 1 102 ? -6.347  9.306   -53.885 1.00 41.06  ? 102  TRP B CA  1 
ATOM   5018 C C   . TRP B 1 102 ? -6.765  10.772  -53.888 1.00 45.07  ? 102  TRP B C   1 
ATOM   5019 O O   . TRP B 1 102 ? -6.080  11.619  -53.307 1.00 54.20  ? 102  TRP B O   1 
ATOM   5020 C CB  . TRP B 1 102 ? -6.703  8.758   -52.508 1.00 41.88  ? 102  TRP B CB  1 
ATOM   5021 C CG  . TRP B 1 102 ? -6.735  7.273   -52.314 1.00 41.70  ? 102  TRP B CG  1 
ATOM   5022 C CD1 . TRP B 1 102 ? -7.836  6.452   -52.365 1.00 44.66  ? 102  TRP B CD1 1 
ATOM   5023 C CD2 . TRP B 1 102 ? -5.631  6.441   -51.946 1.00 40.01  ? 102  TRP B CD2 1 
ATOM   5024 N NE1 . TRP B 1 102 ? -7.472  5.154   -52.076 1.00 45.53  ? 102  TRP B NE1 1 
ATOM   5025 C CE2 . TRP B 1 102 ? -6.125  5.122   -51.815 1.00 41.55  ? 102  TRP B CE2 1 
ATOM   5026 C CE3 . TRP B 1 102 ? -4.272  6.681   -51.713 1.00 39.87  ? 102  TRP B CE3 1 
ATOM   5027 C CZ2 . TRP B 1 102 ? -5.303  4.051   -51.473 1.00 45.25  ? 102  TRP B CZ2 1 
ATOM   5028 C CZ3 . TRP B 1 102 ? -3.453  5.616   -51.371 1.00 46.47  ? 102  TRP B CZ3 1 
ATOM   5029 C CH2 . TRP B 1 102 ? -3.970  4.317   -51.252 1.00 48.32  ? 102  TRP B CH2 1 
ATOM   5030 N N   . THR B 1 103 ? -7.890  11.078  -54.521 1.00 42.34  ? 103  THR B N   1 
ATOM   5031 C CA  . THR B 1 103 ? -8.425  12.441  -54.517 1.00 52.63  ? 103  THR B CA  1 
ATOM   5032 C C   . THR B 1 103 ? -9.921  12.394  -54.280 1.00 54.53  ? 103  THR B C   1 
ATOM   5033 O O   . THR B 1 103 ? -10.539 11.355  -54.448 1.00 54.02  ? 103  THR B O   1 
ATOM   5034 C CB  . THR B 1 103 ? -8.191  13.204  -55.856 1.00 47.82  ? 103  THR B CB  1 
ATOM   5035 O OG1 . THR B 1 103 ? -9.316  13.010  -56.717 1.00 59.08  ? 103  THR B OG1 1 
ATOM   5036 C CG2 . THR B 1 103 ? -6.973  12.704  -56.552 1.00 45.92  ? 103  THR B CG2 1 
ATOM   5037 N N   . PRO B 1 104 ? -10.513 13.537  -53.908 1.00 55.65  ? 104  PRO B N   1 
ATOM   5038 C CA  . PRO B 1 104 ? -11.973 13.641  -53.812 1.00 47.17  ? 104  PRO B CA  1 
ATOM   5039 C C   . PRO B 1 104 ? -12.627 13.435  -55.176 1.00 52.57  ? 104  PRO B C   1 
ATOM   5040 O O   . PRO B 1 104 ? -12.070 13.805  -56.206 1.00 60.83  ? 104  PRO B O   1 
ATOM   5041 C CB  . PRO B 1 104 ? -12.187 15.080  -53.359 1.00 44.01  ? 104  PRO B CB  1 
ATOM   5042 C CG  . PRO B 1 104 ? -10.873 15.518  -52.813 1.00 51.15  ? 104  PRO B CG  1 
ATOM   5043 C CD  . PRO B 1 104 ? -9.847  14.809  -53.594 1.00 52.85  ? 104  PRO B CD  1 
ATOM   5044 N N   . TYR B 1 105 ? -13.800 12.823  -55.175 1.00 54.22  ? 105  TYR B N   1 
ATOM   5045 C CA  . TYR B 1 105 ? -14.576 12.642  -56.387 1.00 52.76  ? 105  TYR B CA  1 
ATOM   5046 C C   . TYR B 1 105 ? -15.813 13.500  -56.226 1.00 64.86  ? 105  TYR B C   1 
ATOM   5047 O O   . TYR B 1 105 ? -16.644 13.221  -55.360 1.00 77.97  ? 105  TYR B O   1 
ATOM   5048 C CB  . TYR B 1 105 ? -14.992 11.187  -56.517 1.00 56.72  ? 105  TYR B CB  1 
ATOM   5049 C CG  . TYR B 1 105 ? -15.730 10.896  -57.784 1.00 69.67  ? 105  TYR B CG  1 
ATOM   5050 C CD1 . TYR B 1 105 ? -15.082 10.316  -58.863 1.00 82.26  ? 105  TYR B CD1 1 
ATOM   5051 C CD2 . TYR B 1 105 ? -17.064 11.218  -57.917 1.00 74.42  ? 105  TYR B CD2 1 
ATOM   5052 C CE1 . TYR B 1 105 ? -15.745 10.057  -60.041 1.00 85.20  ? 105  TYR B CE1 1 
ATOM   5053 C CE2 . TYR B 1 105 ? -17.739 10.963  -59.088 1.00 83.57  ? 105  TYR B CE2 1 
ATOM   5054 C CZ  . TYR B 1 105 ? -17.076 10.381  -60.148 1.00 85.18  ? 105  TYR B CZ  1 
ATOM   5055 O OH  . TYR B 1 105 ? -17.748 10.126  -61.319 1.00 83.04  ? 105  TYR B OH  1 
ATOM   5056 N N   . PRO B 1 106 ? -15.960 14.545  -57.055 1.00 64.30  ? 106  PRO B N   1 
ATOM   5057 C CA  . PRO B 1 106 ? -15.141 14.911  -58.220 1.00 67.70  ? 106  PRO B CA  1 
ATOM   5058 C C   . PRO B 1 106 ? -13.808 15.551  -57.848 1.00 65.61  ? 106  PRO B C   1 
ATOM   5059 O O   . PRO B 1 106 ? -13.665 16.037  -56.731 1.00 63.24  ? 106  PRO B O   1 
ATOM   5060 C CB  . PRO B 1 106 ? -16.008 15.947  -58.934 1.00 59.23  ? 106  PRO B CB  1 
ATOM   5061 C CG  . PRO B 1 106 ? -16.774 16.598  -57.835 1.00 55.85  ? 106  PRO B CG  1 
ATOM   5062 C CD  . PRO B 1 106 ? -16.988 15.560  -56.766 1.00 56.70  ? 106  PRO B CD  1 
ATOM   5063 N N   . ARG B 1 107 ? -12.864 15.542  -58.786 1.00 67.63  ? 107  ARG B N   1 
ATOM   5064 C CA  . ARG B 1 107 ? -11.556 16.162  -58.623 1.00 70.79  ? 107  ARG B CA  1 
ATOM   5065 C C   . ARG B 1 107 ? -11.677 17.555  -58.014 1.00 71.73  ? 107  ARG B C   1 
ATOM   5066 O O   . ARG B 1 107 ? -12.398 18.402  -58.541 1.00 76.74  ? 107  ARG B O   1 
ATOM   5067 C CB  . ARG B 1 107 ? -10.895 16.265  -59.994 1.00 74.81  ? 107  ARG B CB  1 
ATOM   5068 C CG  . ARG B 1 107 ? -9.422  16.619  -59.976 1.00 80.41  ? 107  ARG B CG  1 
ATOM   5069 C CD  . ARG B 1 107 ? -8.800  16.235  -61.304 1.00 86.88  ? 107  ARG B CD  1 
ATOM   5070 N NE  . ARG B 1 107 ? -9.450  15.047  -61.853 1.00 88.72  ? 107  ARG B NE  1 
ATOM   5071 C CZ  . ARG B 1 107 ? -9.300  14.609  -63.098 1.00 87.43  ? 107  ARG B CZ  1 
ATOM   5072 N NH1 . ARG B 1 107 ? -9.946  13.522  -63.498 1.00 92.41  ? 107  ARG B NH1 1 
ATOM   5073 N NH2 . ARG B 1 107 ? -8.509  15.254  -63.945 1.00 81.46  ? 107  ARG B NH2 1 
ATOM   5074 N N   . PRO B 1 108 ? -10.963 17.809  -56.908 1.00 69.19  ? 108  PRO B N   1 
ATOM   5075 C CA  . PRO B 1 108 ? -11.071 19.129  -56.284 1.00 71.84  ? 108  PRO B CA  1 
ATOM   5076 C C   . PRO B 1 108 ? -10.972 20.249  -57.320 1.00 76.19  ? 108  PRO B C   1 
ATOM   5077 O O   . PRO B 1 108 ? -10.180 20.156  -58.266 1.00 71.71  ? 108  PRO B O   1 
ATOM   5078 C CB  . PRO B 1 108 ? -9.857  19.167  -55.336 1.00 64.59  ? 108  PRO B CB  1 
ATOM   5079 C CG  . PRO B 1 108 ? -8.992  18.043  -55.771 1.00 64.06  ? 108  PRO B CG  1 
ATOM   5080 C CD  . PRO B 1 108 ? -9.957  16.991  -56.222 1.00 67.58  ? 108  PRO B CD  1 
ATOM   5081 N N   . ALA B 1 109 ? -11.768 21.299  -57.130 1.00 78.90  ? 109  ALA B N   1 
ATOM   5082 C CA  . ALA B 1 109 ? -11.785 22.432  -58.052 1.00 80.47  ? 109  ALA B CA  1 
ATOM   5083 C C   . ALA B 1 109 ? -10.608 23.381  -57.822 1.00 81.02  ? 109  ALA B C   1 
ATOM   5084 O O   . ALA B 1 109 ? -9.977  23.858  -58.763 1.00 85.34  ? 109  ALA B O   1 
ATOM   5085 C CB  . ALA B 1 109 ? -13.100 23.183  -57.951 1.00 79.07  ? 109  ALA B CB  1 
ATOM   5086 N N   . SER B 1 110 ? -10.315 23.669  -56.567 1.00 73.99  ? 110  SER B N   1 
ATOM   5087 C CA  . SER B 1 110 ? -9.137  24.454  -56.266 1.00 69.01  ? 110  SER B CA  1 
ATOM   5088 C C   . SER B 1 110 ? -8.052  23.513  -55.768 1.00 61.46  ? 110  SER B C   1 
ATOM   5089 O O   . SER B 1 110 ? -8.347  22.462  -55.205 1.00 61.40  ? 110  SER B O   1 
ATOM   5090 C CB  . SER B 1 110 ? -9.470  25.501  -55.214 1.00 69.68  ? 110  SER B CB  1 
ATOM   5091 O OG  . SER B 1 110 ? -10.281 24.927  -54.208 1.00 73.36  ? 110  SER B OG  1 
ATOM   5092 N N   . PRO B 1 111 ? -6.791  23.886  -55.985 1.00 55.81  ? 111  PRO B N   1 
ATOM   5093 C CA  . PRO B 1 111 ? -5.614  23.127  -55.541 1.00 54.06  ? 111  PRO B CA  1 
ATOM   5094 C C   . PRO B 1 111 ? -5.697  22.753  -54.059 1.00 56.63  ? 111  PRO B C   1 
ATOM   5095 O O   . PRO B 1 111 ? -5.938  23.624  -53.217 1.00 58.91  ? 111  PRO B O   1 
ATOM   5096 C CB  . PRO B 1 111 ? -4.461  24.109  -55.777 1.00 53.91  ? 111  PRO B CB  1 
ATOM   5097 C CG  . PRO B 1 111 ? -4.928  24.987  -56.881 1.00 48.23  ? 111  PRO B CG  1 
ATOM   5098 C CD  . PRO B 1 111 ? -6.424  25.126  -56.686 1.00 53.17  ? 111  PRO B CD  1 
ATOM   5099 N N   . THR B 1 112 ? -5.499  21.472  -53.751 1.00 51.49  ? 112  THR B N   1 
ATOM   5100 C CA  . THR B 1 112 ? -5.706  20.955  -52.403 1.00 48.82  ? 112  THR B CA  1 
ATOM   5101 C C   . THR B 1 112 ? -4.382  20.535  -51.766 1.00 50.14  ? 112  THR B C   1 
ATOM   5102 O O   . THR B 1 112 ? -3.497  20.061  -52.466 1.00 55.13  ? 112  THR B O   1 
ATOM   5103 C CB  . THR B 1 112 ? -6.656  19.754  -52.424 1.00 49.26  ? 112  THR B CB  1 
ATOM   5104 O OG1 . THR B 1 112 ? -7.810  20.080  -53.200 1.00 51.22  ? 112  THR B OG1 1 
ATOM   5105 C CG2 . THR B 1 112 ? -7.087  19.390  -51.004 1.00 58.16  ? 112  THR B CG2 1 
ATOM   5106 N N   . PRO B 1 113 ? -4.227  20.731  -50.441 1.00 45.07  ? 113  PRO B N   1 
ATOM   5107 C CA  . PRO B 1 113 ? -2.984  20.264  -49.811 1.00 43.51  ? 113  PRO B CA  1 
ATOM   5108 C C   . PRO B 1 113 ? -2.758  18.791  -50.077 1.00 42.86  ? 113  PRO B C   1 
ATOM   5109 O O   . PRO B 1 113 ? -3.730  18.037  -50.084 1.00 43.52  ? 113  PRO B O   1 
ATOM   5110 C CB  . PRO B 1 113 ? -3.222  20.517  -48.323 1.00 40.94  ? 113  PRO B CB  1 
ATOM   5111 C CG  . PRO B 1 113 ? -4.109  21.731  -48.330 1.00 50.07  ? 113  PRO B CG  1 
ATOM   5112 C CD  . PRO B 1 113 ? -4.997  21.617  -49.553 1.00 46.68  ? 113  PRO B CD  1 
ATOM   5113 N N   . VAL B 1 114 ? -1.501  18.409  -50.307 1.00 30.12  ? 114  VAL B N   1 
ATOM   5114 C CA  . VAL B 1 114 ? -1.136  17.031  -50.546 1.00 24.54  ? 114  VAL B CA  1 
ATOM   5115 C C   . VAL B 1 114 ? -0.451  16.408  -49.352 1.00 38.02  ? 114  VAL B C   1 
ATOM   5116 O O   . VAL B 1 114 ? 0.582   16.883  -48.890 1.00 53.38  ? 114  VAL B O   1 
ATOM   5117 C CB  . VAL B 1 114 ? -0.128  16.917  -51.686 1.00 32.75  ? 114  VAL B CB  1 
ATOM   5118 C CG1 . VAL B 1 114 ? 0.121   15.414  -52.018 1.00 18.78  ? 114  VAL B CG1 1 
ATOM   5119 C CG2 . VAL B 1 114 ? -0.579  17.753  -52.889 1.00 16.87  ? 114  VAL B CG2 1 
ATOM   5120 N N   . LEU B 1 115 ? -1.011  15.316  -48.869 1.00 41.33  ? 115  LEU B N   1 
ATOM   5121 C CA  . LEU B 1 115 ? -0.319  14.503  -47.890 1.00 43.12  ? 115  LEU B CA  1 
ATOM   5122 C C   . LEU B 1 115 ? 0.436   13.364  -48.594 1.00 42.93  ? 115  LEU B C   1 
ATOM   5123 O O   . LEU B 1 115 ? -0.112  12.680  -49.455 1.00 44.86  ? 115  LEU B O   1 
ATOM   5124 C CB  . LEU B 1 115 ? -1.321  13.948  -46.880 1.00 42.52  ? 115  LEU B CB  1 
ATOM   5125 C CG  . LEU B 1 115 ? -1.832  14.899  -45.801 1.00 40.96  ? 115  LEU B CG  1 
ATOM   5126 C CD1 . LEU B 1 115 ? -2.903  14.240  -44.985 1.00 45.68  ? 115  LEU B CD1 1 
ATOM   5127 C CD2 . LEU B 1 115 ? -0.713  15.280  -44.892 1.00 50.03  ? 115  LEU B CD2 1 
ATOM   5128 N N   . ILE B 1 116 ? 1.706   13.180  -48.259 1.00 39.90  ? 116  ILE B N   1 
ATOM   5129 C CA  . ILE B 1 116 ? 2.449   12.062  -48.833 1.00 37.82  ? 116  ILE B CA  1 
ATOM   5130 C C   . ILE B 1 116 ? 2.886   11.094  -47.762 1.00 37.84  ? 116  ILE B C   1 
ATOM   5131 O O   . ILE B 1 116 ? 3.588   11.469  -46.836 1.00 39.16  ? 116  ILE B O   1 
ATOM   5132 C CB  . ILE B 1 116 ? 3.665   12.500  -49.627 1.00 38.85  ? 116  ILE B CB  1 
ATOM   5133 C CG1 . ILE B 1 116 ? 3.261   13.517  -50.700 1.00 45.87  ? 116  ILE B CG1 1 
ATOM   5134 C CG2 . ILE B 1 116 ? 4.297   11.291  -50.269 1.00 37.90  ? 116  ILE B CG2 1 
ATOM   5135 C CD1 . ILE B 1 116 ? 4.408   14.010  -51.577 1.00 43.62  ? 116  ILE B CD1 1 
ATOM   5136 N N   . TRP B 1 117 ? 2.440   9.849   -47.882 1.00 37.19  ? 117  TRP B N   1 
ATOM   5137 C CA  . TRP B 1 117 ? 2.710   8.841   -46.866 1.00 36.43  ? 117  TRP B CA  1 
ATOM   5138 C C   . TRP B 1 117 ? 3.857   7.911   -47.206 1.00 33.81  ? 117  TRP B C   1 
ATOM   5139 O O   . TRP B 1 117 ? 3.861   7.263   -48.237 1.00 39.47  ? 117  TRP B O   1 
ATOM   5140 C CB  . TRP B 1 117 ? 1.477   8.001   -46.624 1.00 27.89  ? 117  TRP B CB  1 
ATOM   5141 C CG  . TRP B 1 117 ? 1.744   6.818   -45.800 1.00 31.51  ? 117  TRP B CG  1 
ATOM   5142 C CD1 . TRP B 1 117 ? 1.893   5.531   -46.233 1.00 40.69  ? 117  TRP B CD1 1 
ATOM   5143 C CD2 . TRP B 1 117 ? 1.883   6.783   -44.383 1.00 40.04  ? 117  TRP B CD2 1 
ATOM   5144 N NE1 . TRP B 1 117 ? 2.120   4.692   -45.165 1.00 37.80  ? 117  TRP B NE1 1 
ATOM   5145 C CE2 . TRP B 1 117 ? 2.122   5.431   -44.016 1.00 38.09  ? 117  TRP B CE2 1 
ATOM   5146 C CE3 . TRP B 1 117 ? 1.824   7.759   -43.374 1.00 36.86  ? 117  TRP B CE3 1 
ATOM   5147 C CZ2 . TRP B 1 117 ? 2.298   5.034   -42.688 1.00 30.94  ? 117  TRP B CZ2 1 
ATOM   5148 C CZ3 . TRP B 1 117 ? 2.013   7.358   -42.048 1.00 31.48  ? 117  TRP B CZ3 1 
ATOM   5149 C CH2 . TRP B 1 117 ? 2.245   6.009   -41.720 1.00 28.78  ? 117  TRP B CH2 1 
ATOM   5150 N N   . ILE B 1 118 ? 4.815   7.823   -46.304 1.00 35.29  ? 118  ILE B N   1 
ATOM   5151 C CA  . ILE B 1 118 ? 5.904   6.869   -46.432 1.00 39.53  ? 118  ILE B CA  1 
ATOM   5152 C C   . ILE B 1 118 ? 5.773   5.738   -45.403 1.00 44.91  ? 118  ILE B C   1 
ATOM   5153 O O   . ILE B 1 118 ? 6.002   5.937   -44.202 1.00 50.17  ? 118  ILE B O   1 
ATOM   5154 C CB  . ILE B 1 118 ? 7.248   7.579   -46.240 1.00 29.87  ? 118  ILE B CB  1 
ATOM   5155 C CG1 . ILE B 1 118 ? 7.278   8.856   -47.070 1.00 27.78  ? 118  ILE B CG1 1 
ATOM   5156 C CG2 . ILE B 1 118 ? 8.365   6.694   -46.631 1.00 22.38  ? 118  ILE B CG2 1 
ATOM   5157 C CD1 . ILE B 1 118 ? 8.604   9.575   -47.052 1.00 24.05  ? 118  ILE B CD1 1 
ATOM   5158 N N   . TYR B 1 119 ? 5.416   4.547   -45.864 1.00 44.39  ? 119  TYR B N   1 
ATOM   5159 C CA  . TYR B 1 119 ? 5.335   3.412   -44.943 1.00 45.00  ? 119  TYR B CA  1 
ATOM   5160 C C   . TYR B 1 119 ? 6.631   3.152   -44.210 1.00 40.62  ? 119  TYR B C   1 
ATOM   5161 O O   . TYR B 1 119 ? 7.705   3.442   -44.712 1.00 43.23  ? 119  TYR B O   1 
ATOM   5162 C CB  . TYR B 1 119 ? 4.883   2.127   -45.645 1.00 44.08  ? 119  TYR B CB  1 
ATOM   5163 C CG  . TYR B 1 119 ? 5.739   1.610   -46.795 1.00 41.16  ? 119  TYR B CG  1 
ATOM   5164 C CD1 . TYR B 1 119 ? 6.931   0.921   -46.567 1.00 44.78  ? 119  TYR B CD1 1 
ATOM   5165 C CD2 . TYR B 1 119 ? 5.314   1.745   -48.104 1.00 35.24  ? 119  TYR B CD2 1 
ATOM   5166 C CE1 . TYR B 1 119 ? 7.698   0.400   -47.634 1.00 38.75  ? 119  TYR B CE1 1 
ATOM   5167 C CE2 . TYR B 1 119 ? 6.052   1.246   -49.158 1.00 39.41  ? 119  TYR B CE2 1 
ATOM   5168 C CZ  . TYR B 1 119 ? 7.245   0.573   -48.928 1.00 45.28  ? 119  TYR B CZ  1 
ATOM   5169 O OH  . TYR B 1 119 ? 7.961   0.089   -50.012 1.00 48.99  ? 119  TYR B OH  1 
ATOM   5170 N N   . GLY B 1 120 ? 6.523   2.605   -43.009 1.00 44.04  ? 120  GLY B N   1 
ATOM   5171 C CA  . GLY B 1 120 ? 7.685   2.050   -42.333 1.00 43.84  ? 120  GLY B CA  1 
ATOM   5172 C C   . GLY B 1 120 ? 7.753   0.543   -42.571 1.00 42.13  ? 120  GLY B C   1 
ATOM   5173 O O   . GLY B 1 120 ? 7.021   -0.005  -43.389 1.00 43.55  ? 120  GLY B O   1 
ATOM   5174 N N   . GLY B 1 121 ? 8.630   -0.135  -41.851 1.00 42.07  ? 121  GLY B N   1 
ATOM   5175 C CA  . GLY B 1 121 ? 8.830   -1.558  -42.041 1.00 43.70  ? 121  GLY B CA  1 
ATOM   5176 C C   . GLY B 1 121 ? 10.257  -2.008  -41.765 1.00 45.08  ? 121  GLY B C   1 
ATOM   5177 O O   . GLY B 1 121 ? 10.683  -3.057  -42.253 1.00 42.79  ? 121  GLY B O   1 
ATOM   5178 N N   . GLY B 1 122 ? 10.989  -1.210  -40.984 1.00 45.14  ? 122  GLY B N   1 
ATOM   5179 C CA  . GLY B 1 122 ? 12.358  -1.513  -40.592 1.00 39.09  ? 122  GLY B CA  1 
ATOM   5180 C C   . GLY B 1 122 ? 13.387  -1.311  -41.693 1.00 46.67  ? 122  GLY B C   1 
ATOM   5181 O O   . GLY B 1 122 ? 14.550  -1.670  -41.546 1.00 55.25  ? 122  GLY B O   1 
ATOM   5182 N N   . PHE B 1 123 ? 12.971  -0.723  -42.806 1.00 43.30  ? 123  PHE B N   1 
ATOM   5183 C CA  . PHE B 1 123 ? 13.855  -0.642  -43.954 1.00 41.26  ? 123  PHE B CA  1 
ATOM   5184 C C   . PHE B 1 123 ? 14.063  -2.038  -44.555 1.00 48.39  ? 123  PHE B C   1 
ATOM   5185 O O   . PHE B 1 123 ? 14.869  -2.199  -45.467 1.00 49.40  ? 123  PHE B O   1 
ATOM   5186 C CB  . PHE B 1 123 ? 15.200  0.006   -43.577 1.00 39.03  ? 123  PHE B CB  1 
ATOM   5187 C CG  . PHE B 1 123 ? 15.102  1.486   -43.312 1.00 39.10  ? 123  PHE B CG  1 
ATOM   5188 C CD1 . PHE B 1 123 ? 14.660  2.360   -44.308 1.00 39.53  ? 123  PHE B CD1 1 
ATOM   5189 C CD2 . PHE B 1 123 ? 15.428  2.006   -42.071 1.00 32.20  ? 123  PHE B CD2 1 
ATOM   5190 C CE1 . PHE B 1 123 ? 14.536  3.731   -44.068 1.00 28.17  ? 123  PHE B CE1 1 
ATOM   5191 C CE2 . PHE B 1 123 ? 15.305  3.361   -41.820 1.00 32.29  ? 123  PHE B CE2 1 
ATOM   5192 C CZ  . PHE B 1 123 ? 14.866  4.232   -42.830 1.00 31.38  ? 123  PHE B CZ  1 
ATOM   5193 N N   . TYR B 1 124 ? 13.329  -3.039  -44.056 1.00 51.65  ? 124  TYR B N   1 
ATOM   5194 C CA  . TYR B 1 124 ? 13.369  -4.396  -44.637 1.00 54.64  ? 124  TYR B CA  1 
ATOM   5195 C C   . TYR B 1 124 ? 12.004  -4.927  -45.126 1.00 53.03  ? 124  TYR B C   1 
ATOM   5196 O O   . TYR B 1 124 ? 11.916  -6.062  -45.616 1.00 52.75  ? 124  TYR B O   1 
ATOM   5197 C CB  . TYR B 1 124 ? 13.997  -5.408  -43.667 1.00 56.42  ? 124  TYR B CB  1 
ATOM   5198 C CG  . TYR B 1 124 ? 13.096  -5.723  -42.511 1.00 55.26  ? 124  TYR B CG  1 
ATOM   5199 C CD1 . TYR B 1 124 ? 12.087  -6.689  -42.625 1.00 47.87  ? 124  TYR B CD1 1 
ATOM   5200 C CD2 . TYR B 1 124 ? 13.229  -5.033  -41.309 1.00 52.68  ? 124  TYR B CD2 1 
ATOM   5201 C CE1 . TYR B 1 124 ? 11.240  -6.965  -41.566 1.00 46.98  ? 124  TYR B CE1 1 
ATOM   5202 C CE2 . TYR B 1 124 ? 12.392  -5.298  -40.242 1.00 54.47  ? 124  TYR B CE2 1 
ATOM   5203 C CZ  . TYR B 1 124 ? 11.399  -6.264  -40.373 1.00 51.92  ? 124  TYR B CZ  1 
ATOM   5204 O OH  . TYR B 1 124 ? 10.579  -6.507  -39.297 1.00 46.68  ? 124  TYR B OH  1 
ATOM   5205 N N   . SER B 1 125 ? 10.958  -4.109  -44.999 1.00 45.27  ? 125  SER B N   1 
ATOM   5206 C CA  . SER B 1 125 ? 9.613   -4.510  -45.394 1.00 39.64  ? 125  SER B CA  1 
ATOM   5207 C C   . SER B 1 125 ? 8.656   -3.335  -45.475 1.00 43.90  ? 125  SER B C   1 
ATOM   5208 O O   . SER B 1 125 ? 9.041   -2.199  -45.252 1.00 49.62  ? 125  SER B O   1 
ATOM   5209 C CB  . SER B 1 125 ? 9.049   -5.542  -44.419 1.00 41.13  ? 125  SER B CB  1 
ATOM   5210 O OG  . SER B 1 125 ? 8.781   -4.973  -43.143 1.00 43.76  ? 125  SER B OG  1 
ATOM   5211 N N   . GLY B 1 126 ? 7.400   -3.629  -45.786 1.00 42.09  ? 126  GLY B N   1 
ATOM   5212 C CA  . GLY B 1 126 ? 6.376   -2.618  -45.935 1.00 37.00  ? 126  GLY B CA  1 
ATOM   5213 C C   . GLY B 1 126 ? 5.877   -2.475  -47.365 1.00 40.17  ? 126  GLY B C   1 
ATOM   5214 O O   . GLY B 1 126 ? 6.586   -2.770  -48.324 1.00 39.96  ? 126  GLY B O   1 
ATOM   5215 N N   . ALA B 1 127 ? 4.645   -2.005  -47.501 1.00 36.57  ? 127  ALA B N   1 
ATOM   5216 C CA  . ALA B 1 127 ? 4.057   -1.730  -48.805 1.00 40.33  ? 127  ALA B CA  1 
ATOM   5217 C C   . ALA B 1 127 ? 2.986   -0.659  -48.647 1.00 44.92  ? 127  ALA B C   1 
ATOM   5218 O O   . ALA B 1 127 ? 2.348   -0.575  -47.604 1.00 46.95  ? 127  ALA B O   1 
ATOM   5219 C CB  . ALA B 1 127 ? 3.453   -2.992  -49.398 1.00 33.95  ? 127  ALA B CB  1 
ATOM   5220 N N   . ALA B 1 128 ? 2.792   0.150   -49.684 1.00 42.01  ? 128  ALA B N   1 
ATOM   5221 C CA  . ALA B 1 128 ? 1.803   1.220   -49.649 1.00 43.86  ? 128  ALA B CA  1 
ATOM   5222 C C   . ALA B 1 128 ? 0.393   0.689   -49.911 1.00 44.59  ? 128  ALA B C   1 
ATOM   5223 O O   . ALA B 1 128 ? -0.573  1.449   -49.936 1.00 38.89  ? 128  ALA B O   1 
ATOM   5224 C CB  . ALA B 1 128 ? 2.160   2.333   -50.639 1.00 35.88  ? 128  ALA B CB  1 
ATOM   5225 N N   . SER B 1 129 ? 0.273   -0.622  -50.074 1.00 39.21  ? 129  SER B N   1 
ATOM   5226 C CA  . SER B 1 129 ? -1.030  -1.214  -50.354 1.00 40.26  ? 129  SER B CA  1 
ATOM   5227 C C   . SER B 1 129 ? -1.765  -1.810  -49.142 1.00 40.98  ? 129  SER B C   1 
ATOM   5228 O O   . SER B 1 129 ? -2.841  -2.400  -49.307 1.00 40.22  ? 129  SER B O   1 
ATOM   5229 C CB  . SER B 1 129 ? -0.913  -2.258  -51.477 1.00 42.87  ? 129  SER B CB  1 
ATOM   5230 O OG  . SER B 1 129 ? 0.236   -3.081  -51.348 1.00 41.81  ? 129  SER B OG  1 
ATOM   5231 N N   . LEU B 1 130 ? -1.202  -1.680  -47.938 1.00 33.41  ? 130  LEU B N   1 
ATOM   5232 C CA  . LEU B 1 130 ? -1.831  -2.304  -46.778 1.00 38.97  ? 130  LEU B CA  1 
ATOM   5233 C C   . LEU B 1 130 ? -3.119  -1.550  -46.487 1.00 52.88  ? 130  LEU B C   1 
ATOM   5234 O O   . LEU B 1 130 ? -3.212  -0.338  -46.758 1.00 53.52  ? 130  LEU B O   1 
ATOM   5235 C CB  . LEU B 1 130 ? -0.917  -2.251  -45.556 1.00 38.10  ? 130  LEU B CB  1 
ATOM   5236 C CG  . LEU B 1 130 ? 0.534   -2.723  -45.714 1.00 40.19  ? 130  LEU B CG  1 
ATOM   5237 C CD1 . LEU B 1 130 ? 1.242   -2.676  -44.372 1.00 35.84  ? 130  LEU B CD1 1 
ATOM   5238 C CD2 . LEU B 1 130 ? 0.647   -4.120  -46.337 1.00 26.39  ? 130  LEU B CD2 1 
ATOM   5239 N N   . ASP B 1 131 ? -4.106  -2.244  -45.934 1.00 48.67  ? 131  ASP B N   1 
ATOM   5240 C CA  . ASP B 1 131 ? -5.357  -1.579  -45.590 1.00 52.73  ? 131  ASP B CA  1 
ATOM   5241 C C   . ASP B 1 131 ? -5.162  -0.417  -44.606 1.00 53.41  ? 131  ASP B C   1 
ATOM   5242 O O   . ASP B 1 131 ? -5.841  0.601   -44.711 1.00 59.93  ? 131  ASP B O   1 
ATOM   5243 C CB  . ASP B 1 131 ? -6.409  -2.569  -45.071 1.00 56.83  ? 131  ASP B CB  1 
ATOM   5244 C CG  . ASP B 1 131 ? -6.679  -3.711  -46.051 1.00 68.51  ? 131  ASP B CG  1 
ATOM   5245 O OD1 . ASP B 1 131 ? -6.646  -3.475  -47.281 1.00 65.64  ? 131  ASP B OD1 1 
ATOM   5246 O OD2 . ASP B 1 131 ? -6.924  -4.851  -45.591 1.00 74.59  ? 131  ASP B OD2 1 
ATOM   5247 N N   . VAL B 1 132 ? -4.238  -0.539  -43.661 1.00 45.89  ? 132  VAL B N   1 
ATOM   5248 C CA  . VAL B 1 132 ? -4.028  0.572   -42.723 1.00 48.53  ? 132  VAL B CA  1 
ATOM   5249 C C   . VAL B 1 132 ? -3.545  1.876   -43.374 1.00 55.64  ? 132  VAL B C   1 
ATOM   5250 O O   . VAL B 1 132 ? -3.567  2.933   -42.737 1.00 57.44  ? 132  VAL B O   1 
ATOM   5251 C CB  . VAL B 1 132 ? -3.087  0.212   -41.557 1.00 39.74  ? 132  VAL B CB  1 
ATOM   5252 C CG1 . VAL B 1 132 ? -3.825  -0.595  -40.536 1.00 33.69  ? 132  VAL B CG1 1 
ATOM   5253 C CG2 . VAL B 1 132 ? -1.852  -0.541  -42.056 1.00 43.57  ? 132  VAL B CG2 1 
ATOM   5254 N N   . TYR B 1 133 ? -3.114  1.805   -44.631 1.00 48.99  ? 133  TYR B N   1 
ATOM   5255 C CA  . TYR B 1 133 ? -2.695  3.007   -45.337 1.00 42.16  ? 133  TYR B CA  1 
ATOM   5256 C C   . TYR B 1 133 ? -3.709  3.462   -46.358 1.00 41.22  ? 133  TYR B C   1 
ATOM   5257 O O   . TYR B 1 133 ? -3.382  4.236   -47.240 1.00 46.97  ? 133  TYR B O   1 
ATOM   5258 C CB  . TYR B 1 133 ? -1.359  2.790   -46.041 1.00 39.70  ? 133  TYR B CB  1 
ATOM   5259 C CG  . TYR B 1 133 ? -0.298  2.228   -45.147 1.00 32.11  ? 133  TYR B CG  1 
ATOM   5260 C CD1 . TYR B 1 133 ? -0.298  2.490   -43.796 1.00 26.48  ? 133  TYR B CD1 1 
ATOM   5261 C CD2 . TYR B 1 133 ? 0.711   1.449   -45.663 1.00 33.24  ? 133  TYR B CD2 1 
ATOM   5262 C CE1 . TYR B 1 133 ? 0.673   1.979   -42.986 1.00 35.68  ? 133  TYR B CE1 1 
ATOM   5263 C CE2 . TYR B 1 133 ? 1.689   0.932   -44.866 1.00 36.17  ? 133  TYR B CE2 1 
ATOM   5264 C CZ  . TYR B 1 133 ? 1.677   1.194   -43.524 1.00 37.56  ? 133  TYR B CZ  1 
ATOM   5265 O OH  . TYR B 1 133 ? 2.671   0.661   -42.727 1.00 39.98  ? 133  TYR B OH  1 
ATOM   5266 N N   . ASP B 1 134 ? -4.934  2.975   -46.243 1.00 41.72  ? 134  ASP B N   1 
ATOM   5267 C CA  . ASP B 1 134 ? -5.992  3.267   -47.204 1.00 39.56  ? 134  ASP B CA  1 
ATOM   5268 C C   . ASP B 1 134 ? -6.385  4.747   -47.155 1.00 44.54  ? 134  ASP B C   1 
ATOM   5269 O O   . ASP B 1 134 ? -6.783  5.265   -46.108 1.00 43.29  ? 134  ASP B O   1 
ATOM   5270 C CB  . ASP B 1 134 ? -7.177  2.367   -46.891 1.00 47.98  ? 134  ASP B CB  1 
ATOM   5271 C CG  . ASP B 1 134 ? -8.299  2.541   -47.839 1.00 49.66  ? 134  ASP B CG  1 
ATOM   5272 O OD1 . ASP B 1 134 ? -8.318  3.547   -48.577 1.00 48.10  ? 134  ASP B OD1 1 
ATOM   5273 O OD2 . ASP B 1 134 ? -9.166  1.654   -47.832 1.00 50.04  ? 134  ASP B OD2 1 
ATOM   5274 N N   . GLY B 1 135 ? -6.256  5.432   -48.288 1.00 51.61  ? 135  GLY B N   1 
ATOM   5275 C CA  . GLY B 1 135 ? -6.387  6.882   -48.328 1.00 55.39  ? 135  GLY B CA  1 
ATOM   5276 C C   . GLY B 1 135 ? -7.776  7.441   -48.631 1.00 47.99  ? 135  GLY B C   1 
ATOM   5277 O O   . GLY B 1 135 ? -7.972  8.659   -48.681 1.00 39.74  ? 135  GLY B O   1 
ATOM   5278 N N   . ARG B 1 136 ? -8.748  6.566   -48.841 1.00 37.82  ? 136  ARG B N   1 
ATOM   5279 C CA  . ARG B 1 136 ? -10.045 7.050   -49.277 1.00 49.58  ? 136  ARG B CA  1 
ATOM   5280 C C   . ARG B 1 136 ? -10.644 7.971   -48.211 1.00 50.38  ? 136  ARG B C   1 
ATOM   5281 O O   . ARG B 1 136 ? -11.342 8.938   -48.542 1.00 49.75  ? 136  ARG B O   1 
ATOM   5282 C CB  . ARG B 1 136 ? -11.008 5.895   -49.641 1.00 44.95  ? 136  ARG B CB  1 
ATOM   5283 C CG  . ARG B 1 136 ? -11.528 5.134   -48.447 1.00 46.12  ? 136  ARG B CG  1 
ATOM   5284 C CD  . ARG B 1 136 ? -11.308 3.657   -48.584 1.00 53.81  ? 136  ARG B CD  1 
ATOM   5285 N NE  . ARG B 1 136 ? -12.360 3.003   -49.341 1.00 64.18  ? 136  ARG B NE  1 
ATOM   5286 C CZ  . ARG B 1 136 ? -12.133 2.045   -50.231 1.00 73.54  ? 136  ARG B CZ  1 
ATOM   5287 N NH1 . ARG B 1 136 ? -10.887 1.654   -50.475 1.00 78.21  ? 136  ARG B NH1 1 
ATOM   5288 N NH2 . ARG B 1 136 ? -13.146 1.492   -50.888 1.00 77.02  ? 136  ARG B NH2 1 
ATOM   5289 N N   . PHE B 1 137 ? -10.366 7.686   -46.940 1.00 35.87  ? 137  PHE B N   1 
ATOM   5290 C CA  . PHE B 1 137 ? -11.114 8.355   -45.892 1.00 39.45  ? 137  PHE B CA  1 
ATOM   5291 C C   . PHE B 1 137 ? -10.698 9.812   -45.800 1.00 48.12  ? 137  PHE B C   1 
ATOM   5292 O O   . PHE B 1 137 ? -11.564 10.697  -45.785 1.00 50.33  ? 137  PHE B O   1 
ATOM   5293 C CB  . PHE B 1 137 ? -10.988 7.640   -44.547 1.00 42.02  ? 137  PHE B CB  1 
ATOM   5294 C CG  . PHE B 1 137 ? -11.367 6.201   -44.597 1.00 52.95  ? 137  PHE B CG  1 
ATOM   5295 C CD1 . PHE B 1 137 ? -12.700 5.822   -44.672 1.00 56.87  ? 137  PHE B CD1 1 
ATOM   5296 C CD2 . PHE B 1 137 ? -10.390 5.209   -44.585 1.00 56.09  ? 137  PHE B CD2 1 
ATOM   5297 C CE1 . PHE B 1 137 ? -13.054 4.461   -44.723 1.00 58.03  ? 137  PHE B CE1 1 
ATOM   5298 C CE2 . PHE B 1 137 ? -10.735 3.849   -44.640 1.00 54.46  ? 137  PHE B CE2 1 
ATOM   5299 C CZ  . PHE B 1 137 ? -12.063 3.474   -44.706 1.00 47.64  ? 137  PHE B CZ  1 
ATOM   5300 N N   . LEU B 1 138 ? -9.384  10.053  -45.750 1.00 40.34  ? 138  LEU B N   1 
ATOM   5301 C CA  . LEU B 1 138 ? -8.837  11.410  -45.713 1.00 37.54  ? 138  LEU B CA  1 
ATOM   5302 C C   . LEU B 1 138 ? -9.205  12.200  -46.977 1.00 46.99  ? 138  LEU B C   1 
ATOM   5303 O O   . LEU B 1 138 ? -9.494  13.394  -46.924 1.00 46.88  ? 138  LEU B O   1 
ATOM   5304 C CB  . LEU B 1 138 ? -7.317  11.381  -45.494 1.00 37.45  ? 138  LEU B CB  1 
ATOM   5305 C CG  . LEU B 1 138 ? -6.809  11.075  -44.071 1.00 37.27  ? 138  LEU B CG  1 
ATOM   5306 C CD1 . LEU B 1 138 ? -5.522  10.300  -44.078 1.00 28.62  ? 138  LEU B CD1 1 
ATOM   5307 C CD2 . LEU B 1 138 ? -6.638  12.341  -43.274 1.00 41.78  ? 138  LEU B CD2 1 
ATOM   5308 N N   . ALA B 1 139 ? -9.210  11.524  -48.117 1.00 51.91  ? 139  ALA B N   1 
ATOM   5309 C CA  . ALA B 1 139 ? -9.637  12.148  -49.365 1.00 49.60  ? 139  ALA B CA  1 
ATOM   5310 C C   . ALA B 1 139 ? -11.085 12.590  -49.273 1.00 57.01  ? 139  ALA B C   1 
ATOM   5311 O O   . ALA B 1 139 ? -11.416 13.737  -49.568 1.00 66.03  ? 139  ALA B O   1 
ATOM   5312 C CB  . ALA B 1 139 ? -9.465  11.182  -50.523 1.00 44.44  ? 139  ALA B CB  1 
ATOM   5313 N N   . GLN B 1 140 ? -11.943 11.662  -48.861 1.00 52.74  ? 140  GLN B N   1 
ATOM   5314 C CA  . GLN B 1 140 ? -13.383 11.882  -48.825 1.00 49.97  ? 140  GLN B CA  1 
ATOM   5315 C C   . GLN B 1 140 ? -13.780 12.905  -47.773 1.00 57.60  ? 140  GLN B C   1 
ATOM   5316 O O   . GLN B 1 140 ? -14.470 13.879  -48.059 1.00 59.17  ? 140  GLN B O   1 
ATOM   5317 C CB  . GLN B 1 140 ? -14.084 10.569  -48.508 1.00 49.74  ? 140  GLN B CB  1 
ATOM   5318 C CG  . GLN B 1 140 ? -15.507 10.476  -49.029 1.00 63.88  ? 140  GLN B CG  1 
ATOM   5319 C CD  . GLN B 1 140 ? -16.537 11.207  -48.181 1.00 62.57  ? 140  GLN B CD  1 
ATOM   5320 O OE1 . GLN B 1 140 ? -17.179 12.137  -48.655 1.00 59.73  ? 140  GLN B OE1 1 
ATOM   5321 N NE2 . GLN B 1 140 ? -16.722 10.765  -46.937 1.00 62.64  ? 140  GLN B NE2 1 
ATOM   5322 N N   . VAL B 1 141 ? -13.330 12.674  -46.549 1.00 58.87  ? 141  VAL B N   1 
ATOM   5323 C CA  . VAL B 1 141 ? -13.805 13.434  -45.413 1.00 58.66  ? 141  VAL B CA  1 
ATOM   5324 C C   . VAL B 1 141 ? -13.159 14.802  -45.353 1.00 57.53  ? 141  VAL B C   1 
ATOM   5325 O O   . VAL B 1 141 ? -13.847 15.808  -45.156 1.00 55.46  ? 141  VAL B O   1 
ATOM   5326 C CB  . VAL B 1 141 ? -13.521 12.679  -44.112 1.00 58.14  ? 141  VAL B CB  1 
ATOM   5327 C CG1 . VAL B 1 141 ? -13.744 13.581  -42.916 1.00 50.77  ? 141  VAL B CG1 1 
ATOM   5328 C CG2 . VAL B 1 141 ? -14.384 11.420  -44.041 1.00 55.60  ? 141  VAL B CG2 1 
ATOM   5329 N N   . GLU B 1 142 ? -11.841 14.829  -45.531 1.00 48.58  ? 142  GLU B N   1 
ATOM   5330 C CA  . GLU B 1 142 ? -11.072 16.065  -45.409 1.00 41.83  ? 142  GLU B CA  1 
ATOM   5331 C C   . GLU B 1 142 ? -10.730 16.701  -46.751 1.00 46.20  ? 142  GLU B C   1 
ATOM   5332 O O   . GLU B 1 142 ? -9.994  17.694  -46.806 1.00 52.23  ? 142  GLU B O   1 
ATOM   5333 C CB  . GLU B 1 142 ? -9.802  15.812  -44.623 1.00 31.41  ? 142  GLU B CB  1 
ATOM   5334 C CG  . GLU B 1 142 ? -10.066 15.547  -43.182 1.00 48.28  ? 142  GLU B CG  1 
ATOM   5335 C CD  . GLU B 1 142 ? -10.660 16.759  -42.484 1.00 67.72  ? 142  GLU B CD  1 
ATOM   5336 O OE1 . GLU B 1 142 ? -10.609 17.872  -43.070 1.00 70.31  ? 142  GLU B OE1 1 
ATOM   5337 O OE2 . GLU B 1 142 ? -11.174 16.599  -41.352 1.00 73.33  ? 142  GLU B OE2 1 
ATOM   5338 N N   . GLY B 1 143 ? -11.278 16.137  -47.824 1.00 37.37  ? 143  GLY B N   1 
ATOM   5339 C CA  . GLY B 1 143 ? -10.961 16.597  -49.163 1.00 43.65  ? 143  GLY B CA  1 
ATOM   5340 C C   . GLY B 1 143 ? -9.470  16.668  -49.469 1.00 50.23  ? 143  GLY B C   1 
ATOM   5341 O O   . GLY B 1 143 ? -9.046  17.492  -50.286 1.00 46.76  ? 143  GLY B O   1 
ATOM   5342 N N   . ALA B 1 144 ? -8.673  15.805  -48.834 1.00 50.00  ? 144  ALA B N   1 
ATOM   5343 C CA  . ALA B 1 144 ? -7.230  15.753  -49.101 1.00 50.80  ? 144  ALA B CA  1 
ATOM   5344 C C   . ALA B 1 144 ? -6.893  15.053  -50.416 1.00 48.65  ? 144  ALA B C   1 
ATOM   5345 O O   . ALA B 1 144 ? -7.577  14.116  -50.821 1.00 50.93  ? 144  ALA B O   1 
ATOM   5346 C CB  . ALA B 1 144 ? -6.497  15.067  -47.955 1.00 41.42  ? 144  ALA B CB  1 
ATOM   5347 N N   . VAL B 1 145 ? -5.854  15.522  -51.095 1.00 38.13  ? 145  VAL B N   1 
ATOM   5348 C CA  . VAL B 1 145 ? -5.202  14.671  -52.076 1.00 48.07  ? 145  VAL B CA  1 
ATOM   5349 C C   . VAL B 1 145 ? -4.052  13.952  -51.370 1.00 49.41  ? 145  VAL B C   1 
ATOM   5350 O O   . VAL B 1 145 ? -3.130  14.584  -50.838 1.00 45.02  ? 145  VAL B O   1 
ATOM   5351 C CB  . VAL B 1 145 ? -4.626  15.446  -53.244 1.00 47.83  ? 145  VAL B CB  1 
ATOM   5352 C CG1 . VAL B 1 145 ? -3.766  14.514  -54.108 1.00 33.71  ? 145  VAL B CG1 1 
ATOM   5353 C CG2 . VAL B 1 145 ? -5.740  16.089  -54.049 1.00 50.57  ? 145  VAL B CG2 1 
ATOM   5354 N N   . LEU B 1 146 ? -4.118  12.629  -51.372 1.00 40.17  ? 146  LEU B N   1 
ATOM   5355 C CA  . LEU B 1 146 ? -3.170  11.817  -50.631 1.00 39.13  ? 146  LEU B CA  1 
ATOM   5356 C C   . LEU B 1 146 ? -2.396  10.881  -51.548 1.00 45.06  ? 146  LEU B C   1 
ATOM   5357 O O   . LEU B 1 146 ? -2.983  10.137  -52.352 1.00 46.08  ? 146  LEU B O   1 
ATOM   5358 C CB  . LEU B 1 146 ? -3.910  11.001  -49.569 1.00 46.67  ? 146  LEU B CB  1 
ATOM   5359 C CG  . LEU B 1 146 ? -3.057  10.374  -48.478 1.00 57.18  ? 146  LEU B CG  1 
ATOM   5360 C CD1 . LEU B 1 146 ? -3.796  10.414  -47.165 1.00 61.56  ? 146  LEU B CD1 1 
ATOM   5361 C CD2 . LEU B 1 146 ? -2.660  8.950   -48.848 1.00 61.74  ? 146  LEU B CD2 1 
ATOM   5362 N N   . VAL B 1 147 ? -1.074  10.916  -51.404 1.00 46.95  ? 147  VAL B N   1 
ATOM   5363 C CA  . VAL B 1 147 ? -0.168  10.127  -52.229 1.00 40.74  ? 147  VAL B CA  1 
ATOM   5364 C C   . VAL B 1 147 ? 0.601   9.166   -51.355 1.00 43.91  ? 147  VAL B C   1 
ATOM   5365 O O   . VAL B 1 147 ? 1.032   9.554   -50.282 1.00 55.09  ? 147  VAL B O   1 
ATOM   5366 C CB  . VAL B 1 147 ? 0.840   11.041  -52.919 1.00 41.72  ? 147  VAL B CB  1 
ATOM   5367 C CG1 . VAL B 1 147 ? 1.828   10.242  -53.715 1.00 43.82  ? 147  VAL B CG1 1 
ATOM   5368 C CG2 . VAL B 1 147 ? 0.116   12.040  -53.806 1.00 48.80  ? 147  VAL B CG2 1 
ATOM   5369 N N   . SER B 1 148 ? 0.756   7.916   -51.794 1.00 41.77  ? 148  SER B N   1 
ATOM   5370 C CA  . SER B 1 148 ? 1.720   6.996   -51.167 1.00 41.77  ? 148  SER B CA  1 
ATOM   5371 C C   . SER B 1 148 ? 2.502   6.210   -52.218 1.00 44.73  ? 148  SER B C   1 
ATOM   5372 O O   . SER B 1 148 ? 1.946   5.849   -53.272 1.00 43.25  ? 148  SER B O   1 
ATOM   5373 C CB  . SER B 1 148 ? 1.037   6.026   -50.190 1.00 40.79  ? 148  SER B CB  1 
ATOM   5374 O OG  . SER B 1 148 ? 0.324   5.002   -50.865 1.00 39.72  ? 148  SER B OG  1 
ATOM   5375 N N   . MET B 1 149 ? 3.780   5.937   -51.928 1.00 38.09  ? 149  MET B N   1 
ATOM   5376 C CA  . MET B 1 149 ? 4.642   5.197   -52.867 1.00 37.60  ? 149  MET B CA  1 
ATOM   5377 C C   . MET B 1 149 ? 5.245   3.927   -52.262 1.00 47.71  ? 149  MET B C   1 
ATOM   5378 O O   . MET B 1 149 ? 5.301   3.763   -51.035 1.00 50.54  ? 149  MET B O   1 
ATOM   5379 C CB  . MET B 1 149 ? 5.793   6.066   -53.388 1.00 28.81  ? 149  MET B CB  1 
ATOM   5380 C CG  . MET B 1 149 ? 7.037   6.058   -52.467 1.00 40.76  ? 149  MET B CG  1 
ATOM   5381 S SD  . MET B 1 149 ? 6.764   6.839   -50.858 1.00 41.57  ? 149  MET B SD  1 
ATOM   5382 C CE  . MET B 1 149 ? 6.687   8.554   -51.344 1.00 14.59  ? 149  MET B CE  1 
ATOM   5383 N N   . ASN B 1 150 ? 5.676   3.029   -53.149 1.00 38.79  ? 150  ASN B N   1 
ATOM   5384 C CA  . ASN B 1 150 ? 6.535   1.935   -52.769 1.00 40.34  ? 150  ASN B CA  1 
ATOM   5385 C C   . ASN B 1 150 ? 7.974   2.395   -52.949 1.00 37.45  ? 150  ASN B C   1 
ATOM   5386 O O   . ASN B 1 150 ? 8.253   3.213   -53.819 1.00 36.27  ? 150  ASN B O   1 
ATOM   5387 C CB  . ASN B 1 150 ? 6.249   0.691   -53.615 1.00 44.75  ? 150  ASN B CB  1 
ATOM   5388 C CG  . ASN B 1 150 ? 4.959   0.014   -53.225 1.00 51.23  ? 150  ASN B CG  1 
ATOM   5389 O OD1 . ASN B 1 150 ? 4.540   -0.978  -53.830 1.00 50.80  ? 150  ASN B OD1 1 
ATOM   5390 N ND2 . ASN B 1 150 ? 4.317   0.545   -52.203 1.00 56.10  ? 150  ASN B ND2 1 
ATOM   5391 N N   . TYR B 1 151 ? 8.883   1.887   -52.119 1.00 31.63  ? 151  TYR B N   1 
ATOM   5392 C CA  . TYR B 1 151 ? 10.302  2.186   -52.279 1.00 36.19  ? 151  TYR B CA  1 
ATOM   5393 C C   . TYR B 1 151 ? 11.100  0.911   -51.923 1.00 37.19  ? 151  TYR B C   1 
ATOM   5394 O O   . TYR B 1 151 ? 10.667  0.157   -51.057 1.00 31.68  ? 151  TYR B O   1 
ATOM   5395 C CB  . TYR B 1 151 ? 10.698  3.411   -51.428 1.00 27.53  ? 151  TYR B CB  1 
ATOM   5396 C CG  . TYR B 1 151 ? 10.526  3.194   -49.950 1.00 38.33  ? 151  TYR B CG  1 
ATOM   5397 C CD1 . TYR B 1 151 ? 9.303   3.451   -49.313 1.00 33.70  ? 151  TYR B CD1 1 
ATOM   5398 C CD2 . TYR B 1 151 ? 11.574  2.683   -49.189 1.00 41.13  ? 151  TYR B CD2 1 
ATOM   5399 C CE1 . TYR B 1 151 ? 9.149   3.224   -47.943 1.00 33.14  ? 151  TYR B CE1 1 
ATOM   5400 C CE2 . TYR B 1 151 ? 11.433  2.449   -47.830 1.00 40.48  ? 151  TYR B CE2 1 
ATOM   5401 C CZ  . TYR B 1 151 ? 10.231  2.724   -47.210 1.00 40.33  ? 151  TYR B CZ  1 
ATOM   5402 O OH  . TYR B 1 151 ? 10.139  2.470   -45.860 1.00 37.94  ? 151  TYR B OH  1 
ATOM   5403 N N   . ARG B 1 152 ? 12.227  0.641   -52.592 1.00 37.06  ? 152  ARG B N   1 
ATOM   5404 C CA  . ARG B 1 152 ? 12.923  -0.643  -52.354 1.00 40.67  ? 152  ARG B CA  1 
ATOM   5405 C C   . ARG B 1 152 ? 13.381  -0.818  -50.898 1.00 37.80  ? 152  ARG B C   1 
ATOM   5406 O O   . ARG B 1 152 ? 13.878  0.101   -50.282 1.00 35.04  ? 152  ARG B O   1 
ATOM   5407 C CB  . ARG B 1 152 ? 14.099  -0.862  -53.309 1.00 33.70  ? 152  ARG B CB  1 
ATOM   5408 C CG  . ARG B 1 152 ? 13.704  -1.184  -54.738 1.00 36.72  ? 152  ARG B CG  1 
ATOM   5409 C CD  . ARG B 1 152 ? 14.885  -1.014  -55.690 1.00 36.04  ? 152  ARG B CD  1 
ATOM   5410 N NE  . ARG B 1 152 ? 15.178  0.394   -55.906 1.00 36.03  ? 152  ARG B NE  1 
ATOM   5411 C CZ  . ARG B 1 152 ? 16.273  0.868   -56.492 1.00 42.69  ? 152  ARG B CZ  1 
ATOM   5412 N NH1 . ARG B 1 152 ? 17.215  0.044   -56.953 1.00 39.49  ? 152  ARG B NH1 1 
ATOM   5413 N NH2 . ARG B 1 152 ? 16.411  2.181   -56.623 1.00 38.94  ? 152  ARG B NH2 1 
ATOM   5414 N N   . VAL B 1 153 ? 13.197  -2.006  -50.351 1.00 38.28  ? 153  VAL B N   1 
ATOM   5415 C CA  . VAL B 1 153 ? 13.609  -2.266  -48.988 1.00 35.02  ? 153  VAL B CA  1 
ATOM   5416 C C   . VAL B 1 153 ? 14.677  -3.345  -48.967 1.00 46.03  ? 153  VAL B C   1 
ATOM   5417 O O   . VAL B 1 153 ? 15.038  -3.899  -50.020 1.00 51.71  ? 153  VAL B O   1 
ATOM   5418 C CB  . VAL B 1 153 ? 12.422  -2.701  -48.129 1.00 39.29  ? 153  VAL B CB  1 
ATOM   5419 C CG1 . VAL B 1 153 ? 11.430  -1.585  -48.065 1.00 45.21  ? 153  VAL B CG1 1 
ATOM   5420 C CG2 . VAL B 1 153 ? 11.765  -3.977  -48.690 1.00 33.92  ? 153  VAL B CG2 1 
ATOM   5421 N N   . GLY B 1 154 ? 15.176  -3.639  -47.766 1.00 40.93  ? 154  GLY B N   1 
ATOM   5422 C CA  . GLY B 1 154 ? 16.213  -4.641  -47.576 1.00 41.31  ? 154  GLY B CA  1 
ATOM   5423 C C   . GLY B 1 154 ? 17.463  -4.344  -48.396 1.00 51.87  ? 154  GLY B C   1 
ATOM   5424 O O   . GLY B 1 154 ? 17.825  -3.178  -48.623 1.00 45.76  ? 154  GLY B O   1 
ATOM   5425 N N   . THR B 1 155 ? 18.118  -5.408  -48.853 1.00 56.64  ? 155  THR B N   1 
ATOM   5426 C CA  . THR B 1 155 ? 19.341  -5.274  -49.630 1.00 55.05  ? 155  THR B CA  1 
ATOM   5427 C C   . THR B 1 155 ? 19.096  -4.441  -50.879 1.00 50.67  ? 155  THR B C   1 
ATOM   5428 O O   . THR B 1 155 ? 19.929  -3.623  -51.266 1.00 55.06  ? 155  THR B O   1 
ATOM   5429 C CB  . THR B 1 155 ? 19.902  -6.647  -50.026 1.00 51.98  ? 155  THR B CB  1 
ATOM   5430 O OG1 . THR B 1 155 ? 18.837  -7.459  -50.526 1.00 59.87  ? 155  THR B OG1 1 
ATOM   5431 C CG2 . THR B 1 155 ? 20.515  -7.343  -48.812 1.00 42.19  ? 155  THR B CG2 1 
ATOM   5432 N N   . PHE B 1 156 ? 17.936  -4.629  -51.495 1.00 37.30  ? 156  PHE B N   1 
ATOM   5433 C CA  . PHE B 1 156 ? 17.643  -3.956  -52.751 1.00 40.70  ? 156  PHE B CA  1 
ATOM   5434 C C   . PHE B 1 156 ? 17.636  -2.448  -52.625 1.00 50.58  ? 156  PHE B C   1 
ATOM   5435 O O   . PHE B 1 156 ? 18.057  -1.756  -53.547 1.00 58.91  ? 156  PHE B O   1 
ATOM   5436 C CB  . PHE B 1 156 ? 16.322  -4.457  -53.304 1.00 41.10  ? 156  PHE B CB  1 
ATOM   5437 C CG  . PHE B 1 156 ? 16.208  -5.947  -53.262 1.00 43.27  ? 156  PHE B CG  1 
ATOM   5438 C CD1 . PHE B 1 156 ? 16.821  -6.728  -54.237 1.00 39.73  ? 156  PHE B CD1 1 
ATOM   5439 C CD2 . PHE B 1 156 ? 15.543  -6.577  -52.222 1.00 44.21  ? 156  PHE B CD2 1 
ATOM   5440 C CE1 . PHE B 1 156 ? 16.747  -8.107  -54.187 1.00 44.13  ? 156  PHE B CE1 1 
ATOM   5441 C CE2 . PHE B 1 156 ? 15.456  -7.957  -52.172 1.00 46.50  ? 156  PHE B CE2 1 
ATOM   5442 C CZ  . PHE B 1 156 ? 16.060  -8.726  -53.154 1.00 44.48  ? 156  PHE B CZ  1 
ATOM   5443 N N   . GLY B 1 157 ? 17.161  -1.944  -51.484 1.00 41.31  ? 157  GLY B N   1 
ATOM   5444 C CA  . GLY B 1 157 ? 17.059  -0.517  -51.267 1.00 34.72  ? 157  GLY B CA  1 
ATOM   5445 C C   . GLY B 1 157 ? 18.213  0.073   -50.476 1.00 43.20  ? 157  GLY B C   1 
ATOM   5446 O O   . GLY B 1 157 ? 18.517  1.271   -50.583 1.00 42.77  ? 157  GLY B O   1 
ATOM   5447 N N   . PHE B 1 158 ? 18.888  -0.764  -49.699 1.00 42.07  ? 158  PHE B N   1 
ATOM   5448 C CA  . PHE B 1 158 ? 19.843  -0.219  -48.756 1.00 41.05  ? 158  PHE B CA  1 
ATOM   5449 C C   . PHE B 1 158 ? 21.209  -0.888  -48.677 1.00 47.90  ? 158  PHE B C   1 
ATOM   5450 O O   . PHE B 1 158 ? 22.061  -0.466  -47.896 1.00 51.03  ? 158  PHE B O   1 
ATOM   5451 C CB  . PHE B 1 158 ? 19.164  -0.025  -47.383 1.00 31.86  ? 158  PHE B CB  1 
ATOM   5452 C CG  . PHE B 1 158 ? 18.031  0.960   -47.444 1.00 32.57  ? 158  PHE B CG  1 
ATOM   5453 C CD1 . PHE B 1 158 ? 18.288  2.313   -47.528 1.00 30.77  ? 158  PHE B CD1 1 
ATOM   5454 C CD2 . PHE B 1 158 ? 16.707  0.527   -47.498 1.00 36.61  ? 158  PHE B CD2 1 
ATOM   5455 C CE1 . PHE B 1 158 ? 17.251  3.221   -47.635 1.00 42.39  ? 158  PHE B CE1 1 
ATOM   5456 C CE2 . PHE B 1 158 ? 15.655  1.429   -47.608 1.00 30.56  ? 158  PHE B CE2 1 
ATOM   5457 C CZ  . PHE B 1 158 ? 15.921  2.773   -47.692 1.00 36.58  ? 158  PHE B CZ  1 
ATOM   5458 N N   . LEU B 1 159 ? 21.438  -1.914  -49.489 1.00 56.20  ? 159  LEU B N   1 
ATOM   5459 C CA  . LEU B 1 159 ? 22.785  -2.487  -49.555 1.00 54.69  ? 159  LEU B CA  1 
ATOM   5460 C C   . LEU B 1 159 ? 23.712  -1.477  -50.206 1.00 58.35  ? 159  LEU B C   1 
ATOM   5461 O O   . LEU B 1 159 ? 23.427  -0.952  -51.288 1.00 60.18  ? 159  LEU B O   1 
ATOM   5462 C CB  . LEU B 1 159 ? 22.818  -3.795  -50.331 1.00 49.59  ? 159  LEU B CB  1 
ATOM   5463 C CG  . LEU B 1 159 ? 24.206  -4.440  -50.417 1.00 49.82  ? 159  LEU B CG  1 
ATOM   5464 C CD1 . LEU B 1 159 ? 24.131  -5.973  -50.368 1.00 45.03  ? 159  LEU B CD1 1 
ATOM   5465 C CD2 . LEU B 1 159 ? 24.970  -3.986  -51.636 1.00 53.02  ? 159  LEU B CD2 1 
ATOM   5466 N N   . ALA B 1 160 ? 24.820  -1.199  -49.535 1.00 59.57  ? 160  ALA B N   1 
ATOM   5467 C CA  . ALA B 1 160 ? 25.735  -0.169  -49.993 1.00 57.02  ? 160  ALA B CA  1 
ATOM   5468 C C   . ALA B 1 160 ? 27.169  -0.618  -49.857 1.00 56.41  ? 160  ALA B C   1 
ATOM   5469 O O   . ALA B 1 160 ? 27.571  -1.119  -48.811 1.00 63.37  ? 160  ALA B O   1 
ATOM   5470 C CB  . ALA B 1 160 ? 25.524  1.103   -49.208 1.00 55.64  ? 160  ALA B CB  1 
ATOM   5471 N N   . LEU B 1 161 ? 27.924  -0.459  -50.935 1.00 56.11  ? 161  LEU B N   1 
ATOM   5472 C CA  . LEU B 1 161 ? 29.379  -0.491  -50.867 1.00 56.87  ? 161  LEU B CA  1 
ATOM   5473 C C   . LEU B 1 161 ? 29.834  0.938   -51.026 1.00 58.72  ? 161  LEU B C   1 
ATOM   5474 O O   . LEU B 1 161 ? 30.080  1.396   -52.149 1.00 54.20  ? 161  LEU B O   1 
ATOM   5475 C CB  . LEU B 1 161 ? 29.973  -1.351  -51.974 1.00 50.61  ? 161  LEU B CB  1 
ATOM   5476 C CG  . LEU B 1 161 ? 29.717  -2.820  -51.687 1.00 57.83  ? 161  LEU B CG  1 
ATOM   5477 C CD1 . LEU B 1 161 ? 30.006  -3.652  -52.890 1.00 74.68  ? 161  LEU B CD1 1 
ATOM   5478 C CD2 . LEU B 1 161 ? 30.559  -3.257  -50.537 1.00 51.24  ? 161  LEU B CD2 1 
ATOM   5479 N N   . PRO B 1 162 ? 29.948  1.653   -49.898 1.00 53.94  ? 162  PRO B N   1 
ATOM   5480 C CA  . PRO B 1 162 ? 30.167  3.100   -49.955 1.00 50.39  ? 162  PRO B CA  1 
ATOM   5481 C C   . PRO B 1 162 ? 31.307  3.398   -50.891 1.00 52.92  ? 162  PRO B C   1 
ATOM   5482 O O   . PRO B 1 162 ? 32.339  2.733   -50.834 1.00 67.11  ? 162  PRO B O   1 
ATOM   5483 C CB  . PRO B 1 162 ? 30.531  3.465   -48.520 1.00 50.68  ? 162  PRO B CB  1 
ATOM   5484 C CG  . PRO B 1 162 ? 29.960  2.356   -47.684 1.00 55.91  ? 162  PRO B CG  1 
ATOM   5485 C CD  . PRO B 1 162 ? 30.082  1.121   -48.535 1.00 56.36  ? 162  PRO B CD  1 
ATOM   5486 N N   . GLY B 1 163 ? 31.091  4.364   -51.770 1.00 45.20  ? 163  GLY B N   1 
ATOM   5487 C CA  . GLY B 1 163 ? 32.083  4.786   -52.725 1.00 43.27  ? 163  GLY B CA  1 
ATOM   5488 C C   . GLY B 1 163 ? 31.959  4.106   -54.063 1.00 53.97  ? 163  GLY B C   1 
ATOM   5489 O O   . GLY B 1 163 ? 32.346  4.676   -55.073 1.00 58.46  ? 163  GLY B O   1 
ATOM   5490 N N   . SER B 1 164 ? 31.444  2.882   -54.076 1.00 62.84  ? 164  SER B N   1 
ATOM   5491 C CA  . SER B 1 164 ? 31.237  2.162   -55.334 1.00 61.75  ? 164  SER B CA  1 
ATOM   5492 C C   . SER B 1 164 ? 30.300  2.911   -56.280 1.00 57.47  ? 164  SER B C   1 
ATOM   5493 O O   . SER B 1 164 ? 29.523  3.777   -55.857 1.00 56.18  ? 164  SER B O   1 
ATOM   5494 C CB  . SER B 1 164 ? 30.682  0.774   -55.067 1.00 57.33  ? 164  SER B CB  1 
ATOM   5495 O OG  . SER B 1 164 ? 29.452  0.857   -54.378 1.00 54.35  ? 164  SER B OG  1 
ATOM   5496 N N   . ARG B 1 165 ? 30.383  2.576   -57.562 1.00 60.42  ? 165  ARG B N   1 
ATOM   5497 C CA  . ARG B 1 165 ? 29.550  3.226   -58.557 1.00 69.50  ? 165  ARG B CA  1 
ATOM   5498 C C   . ARG B 1 165 ? 28.234  2.469   -58.676 1.00 68.30  ? 165  ARG B C   1 
ATOM   5499 O O   . ARG B 1 165 ? 27.203  3.041   -59.029 1.00 64.84  ? 165  ARG B O   1 
ATOM   5500 C CB  . ARG B 1 165 ? 30.255  3.254   -59.917 1.00 82.15  ? 165  ARG B CB  1 
ATOM   5501 C CG  . ARG B 1 165 ? 29.580  4.171   -60.935 1.00 97.31  ? 165  ARG B CG  1 
ATOM   5502 C CD  . ARG B 1 165 ? 29.657  3.641   -62.375 1.00 109.60 ? 165  ARG B CD  1 
ATOM   5503 N NE  . ARG B 1 165 ? 28.439  2.933   -62.787 1.00 114.59 ? 165  ARG B NE  1 
ATOM   5504 C CZ  . ARG B 1 165 ? 28.403  1.677   -63.233 1.00 116.16 ? 165  ARG B CZ  1 
ATOM   5505 N NH1 . ARG B 1 165 ? 29.525  0.973   -63.337 1.00 119.63 ? 165  ARG B NH1 1 
ATOM   5506 N NH2 . ARG B 1 165 ? 27.244  1.125   -63.586 1.00 110.44 ? 165  ARG B NH2 1 
ATOM   5507 N N   . GLU B 1 166 ? 28.272  1.177   -58.360 1.00 70.84  ? 166  GLU B N   1 
ATOM   5508 C CA  . GLU B 1 166 ? 27.153  0.303   -58.684 1.00 74.44  ? 166  GLU B CA  1 
ATOM   5509 C C   . GLU B 1 166 ? 26.276  -0.082  -57.481 1.00 70.21  ? 166  GLU B C   1 
ATOM   5510 O O   . GLU B 1 166 ? 25.212  -0.692  -57.645 1.00 69.04  ? 166  GLU B O   1 
ATOM   5511 C CB  . GLU B 1 166 ? 27.633  -0.914  -59.497 1.00 79.69  ? 166  GLU B CB  1 
ATOM   5512 C CG  . GLU B 1 166 ? 28.961  -1.513  -59.031 1.00 90.45  ? 166  GLU B CG  1 
ATOM   5513 C CD  . GLU B 1 166 ? 30.194  -0.855  -59.639 1.00 93.64  ? 166  GLU B CD  1 
ATOM   5514 O OE1 . GLU B 1 166 ? 30.401  -1.003  -60.866 1.00 93.73  ? 166  GLU B OE1 1 
ATOM   5515 O OE2 . GLU B 1 166 ? 30.967  -0.220  -58.880 1.00 90.69  ? 166  GLU B OE2 1 
ATOM   5516 N N   . ALA B 1 167 ? 26.720  0.310   -56.287 1.00 65.40  ? 167  ALA B N   1 
ATOM   5517 C CA  . ALA B 1 167 ? 25.933  0.168   -55.054 1.00 63.16  ? 167  ALA B CA  1 
ATOM   5518 C C   . ALA B 1 167 ? 26.215  1.297   -54.059 1.00 58.52  ? 167  ALA B C   1 
ATOM   5519 O O   . ALA B 1 167 ? 26.723  1.049   -52.966 1.00 49.69  ? 167  ALA B O   1 
ATOM   5520 C CB  . ALA B 1 167 ? 26.196  -1.172  -54.397 1.00 62.86  ? 167  ALA B CB  1 
ATOM   5521 N N   . PRO B 1 168 ? 25.863  2.537   -54.431 1.00 54.08  ? 168  PRO B N   1 
ATOM   5522 C CA  . PRO B 1 168 ? 26.186  3.755   -53.677 1.00 45.73  ? 168  PRO B CA  1 
ATOM   5523 C C   . PRO B 1 168 ? 25.476  3.879   -52.337 1.00 45.72  ? 168  PRO B C   1 
ATOM   5524 O O   . PRO B 1 168 ? 25.800  4.778   -51.555 1.00 44.33  ? 168  PRO B O   1 
ATOM   5525 C CB  . PRO B 1 168 ? 25.689  4.873   -54.607 1.00 38.34  ? 168  PRO B CB  1 
ATOM   5526 C CG  . PRO B 1 168 ? 24.671  4.232   -55.433 1.00 45.77  ? 168  PRO B CG  1 
ATOM   5527 C CD  . PRO B 1 168 ? 25.200  2.862   -55.707 1.00 47.31  ? 168  PRO B CD  1 
ATOM   5528 N N   . GLY B 1 169 ? 24.506  3.007   -52.087 1.00 50.24  ? 169  GLY B N   1 
ATOM   5529 C CA  . GLY B 1 169 ? 23.640  3.139   -50.926 1.00 51.05  ? 169  GLY B CA  1 
ATOM   5530 C C   . GLY B 1 169 ? 22.470  4.117   -51.093 1.00 50.43  ? 169  GLY B C   1 
ATOM   5531 O O   . GLY B 1 169 ? 22.401  4.928   -52.056 1.00 44.36  ? 169  GLY B O   1 
ATOM   5532 N N   . ASN B 1 170 ? 21.539  4.030   -50.146 1.00 32.35  ? 170  ASN B N   1 
ATOM   5533 C CA  . ASN B 1 170 ? 20.435  4.974   -50.066 1.00 38.61  ? 170  ASN B CA  1 
ATOM   5534 C C   . ASN B 1 170 ? 19.443  4.983   -51.256 1.00 44.07  ? 170  ASN B C   1 
ATOM   5535 O O   . ASN B 1 170 ? 18.629  5.915   -51.400 1.00 40.40  ? 170  ASN B O   1 
ATOM   5536 C CB  . ASN B 1 170 ? 20.981  6.383   -49.797 1.00 38.77  ? 170  ASN B CB  1 
ATOM   5537 C CG  . ASN B 1 170 ? 21.641  6.500   -48.419 1.00 51.50  ? 170  ASN B CG  1 
ATOM   5538 O OD1 . ASN B 1 170 ? 21.285  5.766   -47.472 1.00 43.01  ? 170  ASN B OD1 1 
ATOM   5539 N ND2 . ASN B 1 170 ? 22.616  7.418   -48.302 1.00 47.13  ? 170  ASN B ND2 1 
ATOM   5540 N N   . VAL B 1 171 ? 19.492  3.957   -52.101 1.00 31.46  ? 171  VAL B N   1 
ATOM   5541 C CA  . VAL B 1 171 ? 18.637  3.996   -53.268 1.00 34.21  ? 171  VAL B CA  1 
ATOM   5542 C C   . VAL B 1 171 ? 17.146  3.932   -52.855 1.00 38.60  ? 171  VAL B C   1 
ATOM   5543 O O   . VAL B 1 171 ? 16.289  4.511   -53.515 1.00 35.30  ? 171  VAL B O   1 
ATOM   5544 C CB  . VAL B 1 171 ? 19.036  2.959   -54.354 1.00 40.75  ? 171  VAL B CB  1 
ATOM   5545 C CG1 . VAL B 1 171 ? 20.484  3.145   -54.737 1.00 40.41  ? 171  VAL B CG1 1 
ATOM   5546 C CG2 . VAL B 1 171 ? 18.760  1.539   -53.905 1.00 38.48  ? 171  VAL B CG2 1 
ATOM   5547 N N   . GLY B 1 172 ? 16.853  3.274   -51.739 1.00 33.73  ? 172  GLY B N   1 
ATOM   5548 C CA  . GLY B 1 172 ? 15.518  3.323   -51.176 1.00 38.45  ? 172  GLY B CA  1 
ATOM   5549 C C   . GLY B 1 172 ? 14.997  4.741   -50.991 1.00 38.66  ? 172  GLY B C   1 
ATOM   5550 O O   . GLY B 1 172 ? 13.881  5.060   -51.394 1.00 37.25  ? 172  GLY B O   1 
ATOM   5551 N N   . LEU B 1 173 ? 15.807  5.599   -50.381 1.00 40.67  ? 173  LEU B N   1 
ATOM   5552 C CA  . LEU B 1 173 ? 15.422  6.984   -50.152 1.00 34.03  ? 173  LEU B CA  1 
ATOM   5553 C C   . LEU B 1 173 ? 15.423  7.747   -51.461 1.00 42.69  ? 173  LEU B C   1 
ATOM   5554 O O   . LEU B 1 173 ? 14.671  8.714   -51.630 1.00 44.84  ? 173  LEU B O   1 
ATOM   5555 C CB  . LEU B 1 173 ? 16.366  7.655   -49.151 1.00 43.87  ? 173  LEU B CB  1 
ATOM   5556 C CG  . LEU B 1 173 ? 16.416  7.078   -47.721 1.00 40.06  ? 173  LEU B CG  1 
ATOM   5557 C CD1 . LEU B 1 173 ? 17.679  7.494   -46.978 1.00 27.71  ? 173  LEU B CD1 1 
ATOM   5558 C CD2 . LEU B 1 173 ? 15.163  7.433   -46.921 1.00 35.88  ? 173  LEU B CD2 1 
ATOM   5559 N N   . LEU B 1 174 ? 16.253  7.315   -52.405 1.00 37.99  ? 174  LEU B N   1 
ATOM   5560 C CA  . LEU B 1 174 ? 16.213  7.941   -53.715 1.00 37.92  ? 174  LEU B CA  1 
ATOM   5561 C C   . LEU B 1 174 ? 14.935  7.608   -54.436 1.00 39.24  ? 174  LEU B C   1 
ATOM   5562 O O   . LEU B 1 174 ? 14.424  8.426   -55.176 1.00 40.03  ? 174  LEU B O   1 
ATOM   5563 C CB  . LEU B 1 174 ? 17.407  7.554   -54.559 1.00 43.04  ? 174  LEU B CB  1 
ATOM   5564 C CG  . LEU B 1 174 ? 18.677  8.237   -54.080 1.00 42.80  ? 174  LEU B CG  1 
ATOM   5565 C CD1 . LEU B 1 174 ? 19.842  7.738   -54.914 1.00 43.76  ? 174  LEU B CD1 1 
ATOM   5566 C CD2 . LEU B 1 174 ? 18.513  9.743   -54.171 1.00 35.11  ? 174  LEU B CD2 1 
ATOM   5567 N N   . ASP B 1 175 ? 14.422  6.402   -54.219 1.00 43.15  ? 175  ASP B N   1 
ATOM   5568 C CA  . ASP B 1 175 ? 13.138  6.026   -54.779 1.00 37.39  ? 175  ASP B CA  1 
ATOM   5569 C C   . ASP B 1 175 ? 12.089  7.002   -54.278 1.00 40.53  ? 175  ASP B C   1 
ATOM   5570 O O   . ASP B 1 175 ? 11.334  7.579   -55.074 1.00 41.71  ? 175  ASP B O   1 
ATOM   5571 C CB  . ASP B 1 175 ? 12.764  4.613   -54.371 1.00 37.95  ? 175  ASP B CB  1 
ATOM   5572 C CG  . ASP B 1 175 ? 13.661  3.567   -55.002 1.00 50.39  ? 175  ASP B CG  1 
ATOM   5573 O OD1 . ASP B 1 175 ? 14.465  3.933   -55.894 1.00 48.13  ? 175  ASP B OD1 1 
ATOM   5574 O OD2 . ASP B 1 175 ? 13.562  2.381   -54.595 1.00 53.75  ? 175  ASP B OD2 1 
ATOM   5575 N N   . GLN B 1 176 ? 12.057  7.183   -52.957 1.00 26.86  ? 176  GLN B N   1 
ATOM   5576 C CA  . GLN B 1 176 ? 11.195  8.176   -52.326 1.00 36.33  ? 176  GLN B CA  1 
ATOM   5577 C C   . GLN B 1 176 ? 11.351  9.564   -52.928 1.00 41.08  ? 176  GLN B C   1 
ATOM   5578 O O   . GLN B 1 176 ? 10.368  10.197  -53.304 1.00 45.49  ? 176  GLN B O   1 
ATOM   5579 C CB  . GLN B 1 176 ? 11.522  8.270   -50.849 1.00 38.21  ? 176  GLN B CB  1 
ATOM   5580 C CG  . GLN B 1 176 ? 11.314  6.972   -50.131 1.00 46.40  ? 176  GLN B CG  1 
ATOM   5581 C CD  . GLN B 1 176 ? 11.586  7.091   -48.665 1.00 46.78  ? 176  GLN B CD  1 
ATOM   5582 O OE1 . GLN B 1 176 ? 11.745  8.200   -48.136 1.00 40.54  ? 176  GLN B OE1 1 
ATOM   5583 N NE2 . GLN B 1 176 ? 11.639  5.951   -47.984 1.00 43.64  ? 176  GLN B NE2 1 
ATOM   5584 N N   . ARG B 1 177 ? 12.587  10.042  -52.998 1.00 37.01  ? 177  ARG B N   1 
ATOM   5585 C CA  . ARG B 1 177 ? 12.845  11.358  -53.545 1.00 37.43  ? 177  ARG B CA  1 
ATOM   5586 C C   . ARG B 1 177 ? 12.275  11.474  -54.954 1.00 38.56  ? 177  ARG B C   1 
ATOM   5587 O O   . ARG B 1 177 ? 11.770  12.530  -55.345 1.00 40.60  ? 177  ARG B O   1 
ATOM   5588 C CB  . ARG B 1 177 ? 14.346  11.672  -53.543 1.00 38.83  ? 177  ARG B CB  1 
ATOM   5589 C CG  . ARG B 1 177 ? 14.697  13.007  -54.222 1.00 34.91  ? 177  ARG B CG  1 
ATOM   5590 C CD  . ARG B 1 177 ? 16.149  13.331  -54.107 1.00 30.35  ? 177  ARG B CD  1 
ATOM   5591 N NE  . ARG B 1 177 ? 16.452  13.697  -52.728 1.00 50.39  ? 177  ARG B NE  1 
ATOM   5592 C CZ  . ARG B 1 177 ? 17.666  13.710  -52.178 1.00 57.19  ? 177  ARG B CZ  1 
ATOM   5593 N NH1 . ARG B 1 177 ? 18.753  13.368  -52.879 1.00 51.71  ? 177  ARG B NH1 1 
ATOM   5594 N NH2 . ARG B 1 177 ? 17.784  14.068  -50.905 1.00 54.36  ? 177  ARG B NH2 1 
ATOM   5595 N N   . LEU B 1 178 ? 12.345  10.386  -55.713 1.00 33.03  ? 178  LEU B N   1 
ATOM   5596 C CA  . LEU B 1 178 ? 11.873  10.418  -57.088 1.00 38.83  ? 178  LEU B CA  1 
ATOM   5597 C C   . LEU B 1 178 ? 10.347  10.555  -57.122 1.00 46.13  ? 178  LEU B C   1 
ATOM   5598 O O   . LEU B 1 178 ? 9.806   11.357  -57.872 1.00 50.71  ? 178  LEU B O   1 
ATOM   5599 C CB  . LEU B 1 178 ? 12.365  9.204   -57.883 1.00 36.00  ? 178  LEU B CB  1 
ATOM   5600 C CG  . LEU B 1 178 ? 11.894  9.064   -59.343 1.00 40.80  ? 178  LEU B CG  1 
ATOM   5601 C CD1 . LEU B 1 178 ? 12.296  10.237  -60.190 1.00 35.79  ? 178  LEU B CD1 1 
ATOM   5602 C CD2 . LEU B 1 178 ? 12.426  7.778   -59.954 1.00 47.28  ? 178  LEU B CD2 1 
ATOM   5603 N N   . ALA B 1 179 ? 9.663   9.786   -56.288 1.00 44.48  ? 179  ALA B N   1 
ATOM   5604 C CA  . ALA B 1 179 ? 8.224   9.906   -56.158 1.00 39.51  ? 179  ALA B CA  1 
ATOM   5605 C C   . ALA B 1 179 ? 7.862   11.317  -55.713 1.00 41.85  ? 179  ALA B C   1 
ATOM   5606 O O   . ALA B 1 179 ? 6.870   11.875  -56.145 1.00 36.68  ? 179  ALA B O   1 
ATOM   5607 C CB  . ALA B 1 179 ? 7.689   8.865   -55.165 1.00 33.84  ? 179  ALA B CB  1 
ATOM   5608 N N   . LEU B 1 180 ? 8.676   11.906  -54.847 1.00 47.31  ? 180  LEU B N   1 
ATOM   5609 C CA  . LEU B 1 180 ? 8.452   13.292  -54.456 1.00 42.25  ? 180  LEU B CA  1 
ATOM   5610 C C   . LEU B 1 180 ? 8.511   14.265  -55.661 1.00 46.39  ? 180  LEU B C   1 
ATOM   5611 O O   . LEU B 1 180 ? 7.669   15.152  -55.768 1.00 46.50  ? 180  LEU B O   1 
ATOM   5612 C CB  . LEU B 1 180 ? 9.431   13.693  -53.360 1.00 36.67  ? 180  LEU B CB  1 
ATOM   5613 C CG  . LEU B 1 180 ? 9.006   13.639  -51.886 1.00 40.84  ? 180  LEU B CG  1 
ATOM   5614 C CD1 . LEU B 1 180 ? 8.253   12.384  -51.509 1.00 35.74  ? 180  LEU B CD1 1 
ATOM   5615 C CD2 . LEU B 1 180 ? 10.220  13.817  -50.982 1.00 36.65  ? 180  LEU B CD2 1 
ATOM   5616 N N   . GLN B 1 181 ? 9.489   14.084  -56.560 1.00 42.84  ? 181  GLN B N   1 
ATOM   5617 C CA  . GLN B 1 181 ? 9.613   14.910  -57.771 1.00 47.29  ? 181  GLN B CA  1 
ATOM   5618 C C   . GLN B 1 181 ? 8.390   14.709  -58.635 1.00 45.79  ? 181  GLN B C   1 
ATOM   5619 O O   . GLN B 1 181 ? 7.861   15.645  -59.234 1.00 45.87  ? 181  GLN B O   1 
ATOM   5620 C CB  . GLN B 1 181 ? 10.860  14.536  -58.591 1.00 53.93  ? 181  GLN B CB  1 
ATOM   5621 C CG  . GLN B 1 181 ? 12.093  15.403  -58.361 1.00 56.48  ? 181  GLN B CG  1 
ATOM   5622 C CD  . GLN B 1 181 ? 13.376  14.576  -58.086 1.00 89.68  ? 181  GLN B CD  1 
ATOM   5623 O OE1 . GLN B 1 181 ? 13.441  13.374  -58.364 1.00 85.33  ? 181  GLN B OE1 1 
ATOM   5624 N NE2 . GLN B 1 181 ? 14.392  15.232  -57.531 1.00 91.25  ? 181  GLN B NE2 1 
ATOM   5625 N N   . TRP B 1 182 ? 7.944   13.464  -58.697 1.00 45.06  ? 182  TRP B N   1 
ATOM   5626 C CA  . TRP B 1 182 ? 6.815   13.111  -59.527 1.00 40.91  ? 182  TRP B CA  1 
ATOM   5627 C C   . TRP B 1 182 ? 5.596   13.850  -59.049 1.00 40.81  ? 182  TRP B C   1 
ATOM   5628 O O   . TRP B 1 182 ? 4.820   14.339  -59.857 1.00 43.00  ? 182  TRP B O   1 
ATOM   5629 C CB  . TRP B 1 182 ? 6.542   11.619  -59.453 1.00 36.98  ? 182  TRP B CB  1 
ATOM   5630 C CG  . TRP B 1 182 ? 5.478   11.157  -60.410 1.00 39.72  ? 182  TRP B CG  1 
ATOM   5631 C CD1 . TRP B 1 182 ? 5.667   10.641  -61.649 1.00 32.75  ? 182  TRP B CD1 1 
ATOM   5632 C CD2 . TRP B 1 182 ? 4.063   11.176  -60.196 1.00 43.84  ? 182  TRP B CD2 1 
ATOM   5633 N NE1 . TRP B 1 182 ? 4.465   10.335  -62.227 1.00 38.69  ? 182  TRP B NE1 1 
ATOM   5634 C CE2 . TRP B 1 182 ? 3.462   10.650  -61.356 1.00 42.21  ? 182  TRP B CE2 1 
ATOM   5635 C CE3 . TRP B 1 182 ? 3.246   11.573  -59.137 1.00 42.18  ? 182  TRP B CE3 1 
ATOM   5636 C CZ2 . TRP B 1 182 ? 2.095   10.511  -61.485 1.00 46.19  ? 182  TRP B CZ2 1 
ATOM   5637 C CZ3 . TRP B 1 182 ? 1.881   11.433  -59.268 1.00 43.61  ? 182  TRP B CZ3 1 
ATOM   5638 C CH2 . TRP B 1 182 ? 1.319   10.911  -60.431 1.00 48.40  ? 182  TRP B CH2 1 
ATOM   5639 N N   . VAL B 1 183 ? 5.425   13.914  -57.733 1.00 43.27  ? 183  VAL B N   1 
ATOM   5640 C CA  . VAL B 1 183 ? 4.277   14.602  -57.161 1.00 49.85  ? 183  VAL B CA  1 
ATOM   5641 C C   . VAL B 1 183 ? 4.352   16.079  -57.522 1.00 50.52  ? 183  VAL B C   1 
ATOM   5642 O O   . VAL B 1 183 ? 3.354   16.684  -57.896 1.00 45.54  ? 183  VAL B O   1 
ATOM   5643 C CB  . VAL B 1 183 ? 4.189   14.424  -55.635 1.00 47.55  ? 183  VAL B CB  1 
ATOM   5644 C CG1 . VAL B 1 183 ? 3.316   15.536  -54.993 1.00 19.13  ? 183  VAL B CG1 1 
ATOM   5645 C CG2 . VAL B 1 183 ? 3.645   13.047  -55.309 1.00 42.32  ? 183  VAL B CG2 1 
ATOM   5646 N N   . GLN B 1 184 ? 5.553   16.636  -57.422 1.00 47.21  ? 184  GLN B N   1 
ATOM   5647 C CA  . GLN B 1 184 ? 5.819   18.001  -57.824 1.00 47.88  ? 184  GLN B CA  1 
ATOM   5648 C C   . GLN B 1 184 ? 5.397   18.233  -59.255 1.00 51.40  ? 184  GLN B C   1 
ATOM   5649 O O   . GLN B 1 184 ? 4.801   19.258  -59.577 1.00 52.29  ? 184  GLN B O   1 
ATOM   5650 C CB  . GLN B 1 184 ? 7.306   18.271  -57.705 1.00 48.98  ? 184  GLN B CB  1 
ATOM   5651 C CG  . GLN B 1 184 ? 7.704   18.690  -56.344 1.00 60.53  ? 184  GLN B CG  1 
ATOM   5652 C CD  . GLN B 1 184 ? 7.097   20.010  -56.003 1.00 68.73  ? 184  GLN B CD  1 
ATOM   5653 O OE1 . GLN B 1 184 ? 6.119   20.084  -55.264 1.00 65.88  ? 184  GLN B OE1 1 
ATOM   5654 N NE2 . GLN B 1 184 ? 7.659   21.073  -56.564 1.00 73.98  ? 184  GLN B NE2 1 
ATOM   5655 N N   . GLU B 1 185 ? 5.698   17.265  -60.111 1.00 47.48  ? 185  GLU B N   1 
ATOM   5656 C CA  . GLU B 1 185 ? 5.534   17.450  -61.540 1.00 47.51  ? 185  GLU B CA  1 
ATOM   5657 C C   . GLU B 1 185 ? 4.151   17.105  -62.064 1.00 51.31  ? 185  GLU B C   1 
ATOM   5658 O O   . GLU B 1 185 ? 3.805   17.470  -63.189 1.00 56.40  ? 185  GLU B O   1 
ATOM   5659 C CB  . GLU B 1 185 ? 6.573   16.631  -62.293 1.00 53.50  ? 185  GLU B CB  1 
ATOM   5660 C CG  . GLU B 1 185 ? 7.971   17.184  -62.193 1.00 66.45  ? 185  GLU B CG  1 
ATOM   5661 C CD  . GLU B 1 185 ? 8.966   16.318  -62.928 1.00 74.05  ? 185  GLU B CD  1 
ATOM   5662 O OE1 . GLU B 1 185 ? 8.505   15.554  -63.810 1.00 81.32  ? 185  GLU B OE1 1 
ATOM   5663 O OE2 . GLU B 1 185 ? 10.187  16.400  -62.621 1.00 68.37  ? 185  GLU B OE2 1 
ATOM   5664 N N   . ASN B 1 186 ? 3.355   16.409  -61.264 1.00 49.94  ? 186  ASN B N   1 
ATOM   5665 C CA  . ASN B 1 186 ? 2.121   15.835  -61.791 1.00 49.37  ? 186  ASN B CA  1 
ATOM   5666 C C   . ASN B 1 186 ? 0.882   16.075  -60.950 1.00 50.11  ? 186  ASN B C   1 
ATOM   5667 O O   . ASN B 1 186 ? -0.238  15.958  -61.438 1.00 53.10  ? 186  ASN B O   1 
ATOM   5668 C CB  . ASN B 1 186 ? 2.314   14.337  -62.011 1.00 46.57  ? 186  ASN B CB  1 
ATOM   5669 C CG  . ASN B 1 186 ? 3.299   14.047  -63.110 1.00 53.51  ? 186  ASN B CG  1 
ATOM   5670 O OD1 . ASN B 1 186 ? 3.045   14.351  -64.270 1.00 50.28  ? 186  ASN B OD1 1 
ATOM   5671 N ND2 . ASN B 1 186 ? 4.439   13.472  -62.753 1.00 59.71  ? 186  ASN B ND2 1 
ATOM   5672 N N   . ILE B 1 187 ? 1.077   16.409  -59.684 1.00 45.47  ? 187  ILE B N   1 
ATOM   5673 C CA  . ILE B 1 187 ? -0.033  16.394  -58.758 1.00 47.22  ? 187  ILE B CA  1 
ATOM   5674 C C   . ILE B 1 187 ? -1.078  17.466  -59.121 1.00 54.04  ? 187  ILE B C   1 
ATOM   5675 O O   . ILE B 1 187 ? -2.283  17.294  -58.863 1.00 51.89  ? 187  ILE B O   1 
ATOM   5676 C CB  . ILE B 1 187 ? 0.456   16.511  -57.291 1.00 47.77  ? 187  ILE B CB  1 
ATOM   5677 C CG1 . ILE B 1 187 ? -0.520  15.799  -56.349 1.00 49.44  ? 187  ILE B CG1 1 
ATOM   5678 C CG2 . ILE B 1 187 ? 0.680   17.974  -56.891 1.00 41.61  ? 187  ILE B CG2 1 
ATOM   5679 C CD1 . ILE B 1 187 ? -0.679  14.330  -56.644 1.00 45.25  ? 187  ILE B CD1 1 
ATOM   5680 N N   . ALA B 1 188 ? -0.629  18.557  -59.743 1.00 42.20  ? 188  ALA B N   1 
ATOM   5681 C CA  . ALA B 1 188 ? -1.567  19.611  -60.112 1.00 42.47  ? 188  ALA B CA  1 
ATOM   5682 C C   . ALA B 1 188 ? -2.719  19.075  -60.981 1.00 46.46  ? 188  ALA B C   1 
ATOM   5683 O O   . ALA B 1 188 ? -3.802  19.645  -61.005 1.00 46.76  ? 188  ALA B O   1 
ATOM   5684 C CB  . ALA B 1 188 ? -0.855  20.777  -60.796 1.00 32.53  ? 188  ALA B CB  1 
ATOM   5685 N N   . ALA B 1 189 ? -2.481  17.958  -61.656 1.00 35.95  ? 189  ALA B N   1 
ATOM   5686 C CA  . ALA B 1 189 ? -3.423  17.401  -62.595 1.00 38.61  ? 189  ALA B CA  1 
ATOM   5687 C C   . ALA B 1 189 ? -4.528  16.610  -61.910 1.00 50.43  ? 189  ALA B C   1 
ATOM   5688 O O   . ALA B 1 189 ? -5.513  16.244  -62.550 1.00 55.63  ? 189  ALA B O   1 
ATOM   5689 C CB  . ALA B 1 189 ? -2.688  16.512  -63.603 1.00 36.24  ? 189  ALA B CB  1 
ATOM   5690 N N   . PHE B 1 190 ? -4.354  16.324  -60.622 1.00 48.30  ? 190  PHE B N   1 
ATOM   5691 C CA  . PHE B 1 190 ? -5.332  15.547  -59.873 1.00 42.26  ? 190  PHE B CA  1 
ATOM   5692 C C   . PHE B 1 190 ? -6.021  16.496  -58.928 1.00 47.38  ? 190  PHE B C   1 
ATOM   5693 O O   . PHE B 1 190 ? -6.815  16.080  -58.081 1.00 50.48  ? 190  PHE B O   1 
ATOM   5694 C CB  . PHE B 1 190 ? -4.653  14.461  -59.042 1.00 39.75  ? 190  PHE B CB  1 
ATOM   5695 C CG  . PHE B 1 190 ? -3.874  13.463  -59.844 1.00 49.87  ? 190  PHE B CG  1 
ATOM   5696 C CD1 . PHE B 1 190 ? -2.607  13.772  -60.328 1.00 58.55  ? 190  PHE B CD1 1 
ATOM   5697 C CD2 . PHE B 1 190 ? -4.390  12.198  -60.083 1.00 52.73  ? 190  PHE B CD2 1 
ATOM   5698 C CE1 . PHE B 1 190 ? -1.881  12.841  -61.060 1.00 60.31  ? 190  PHE B CE1 1 
ATOM   5699 C CE2 . PHE B 1 190 ? -3.676  11.260  -60.812 1.00 51.13  ? 190  PHE B CE2 1 
ATOM   5700 C CZ  . PHE B 1 190 ? -2.415  11.583  -61.300 1.00 56.60  ? 190  PHE B CZ  1 
ATOM   5701 N N   . GLY B 1 191 ? -5.681  17.774  -59.068 1.00 46.77  ? 191  GLY B N   1 
ATOM   5702 C CA  . GLY B 1 191 ? -6.176  18.816  -58.192 1.00 42.77  ? 191  GLY B CA  1 
ATOM   5703 C C   . GLY B 1 191 ? -5.217  19.170  -57.069 1.00 50.37  ? 191  GLY B C   1 
ATOM   5704 O O   . GLY B 1 191 ? -5.435  20.146  -56.366 1.00 54.27  ? 191  GLY B O   1 
ATOM   5705 N N   . GLY B 1 192 ? -4.151  18.386  -56.904 1.00 53.88  ? 192  GLY B N   1 
ATOM   5706 C CA  . GLY B 1 192 ? -3.162  18.624  -55.861 1.00 42.94  ? 192  GLY B CA  1 
ATOM   5707 C C   . GLY B 1 192 ? -2.379  19.931  -55.963 1.00 48.81  ? 192  GLY B C   1 
ATOM   5708 O O   . GLY B 1 192 ? -2.106  20.426  -57.044 1.00 58.49  ? 192  GLY B O   1 
ATOM   5709 N N   . ASP B 1 193 ? -2.018  20.489  -54.817 1.00 45.93  ? 193  ASP B N   1 
ATOM   5710 C CA  . ASP B 1 193 ? -1.242  21.716  -54.748 1.00 47.81  ? 193  ASP B CA  1 
ATOM   5711 C C   . ASP B 1 193 ? 0.236   21.372  -54.474 1.00 55.17  ? 193  ASP B C   1 
ATOM   5712 O O   . ASP B 1 193 ? 0.621   21.037  -53.347 1.00 50.97  ? 193  ASP B O   1 
ATOM   5713 C CB  . ASP B 1 193 ? -1.816  22.581  -53.630 1.00 49.71  ? 193  ASP B CB  1 
ATOM   5714 C CG  . ASP B 1 193 ? -1.205  23.976  -53.573 1.00 60.35  ? 193  ASP B CG  1 
ATOM   5715 O OD1 . ASP B 1 193 ? -0.233  24.248  -54.314 1.00 55.61  ? 193  ASP B OD1 1 
ATOM   5716 O OD2 . ASP B 1 193 ? -1.716  24.799  -52.768 1.00 63.68  ? 193  ASP B OD2 1 
ATOM   5717 N N   . PRO B 1 194 ? 1.070   21.424  -55.518 1.00 54.80  ? 194  PRO B N   1 
ATOM   5718 C CA  . PRO B 1 194 ? 2.484   21.089  -55.334 1.00 52.57  ? 194  PRO B CA  1 
ATOM   5719 C C   . PRO B 1 194 ? 3.161   22.094  -54.406 1.00 50.01  ? 194  PRO B C   1 
ATOM   5720 O O   . PRO B 1 194 ? 4.282   21.873  -53.930 1.00 45.32  ? 194  PRO B O   1 
ATOM   5721 C CB  . PRO B 1 194 ? 3.055   21.191  -56.755 1.00 53.37  ? 194  PRO B CB  1 
ATOM   5722 C CG  . PRO B 1 194 ? 2.097   22.107  -57.459 1.00 55.72  ? 194  PRO B CG  1 
ATOM   5723 C CD  . PRO B 1 194 ? 0.758   21.722  -56.924 1.00 52.67  ? 194  PRO B CD  1 
ATOM   5724 N N   . MET B 1 195 ? 2.476   23.196  -54.129 1.00 50.29  ? 195  MET B N   1 
ATOM   5725 C CA  . MET B 1 195 ? 3.037   24.177  -53.204 1.00 49.24  ? 195  MET B CA  1 
ATOM   5726 C C   . MET B 1 195 ? 2.675   23.946  -51.740 1.00 46.80  ? 195  MET B C   1 
ATOM   5727 O O   . MET B 1 195 ? 3.197   24.632  -50.864 1.00 51.06  ? 195  MET B O   1 
ATOM   5728 C CB  . MET B 1 195 ? 2.737   25.601  -53.645 1.00 44.90  ? 195  MET B CB  1 
ATOM   5729 C CG  . MET B 1 195 ? 3.538   25.994  -54.864 1.00 48.30  ? 195  MET B CG  1 
ATOM   5730 S SD  . MET B 1 195 ? 3.488   27.735  -55.243 1.00 73.94  ? 195  MET B SD  1 
ATOM   5731 C CE  . MET B 1 195 ? 1.711   28.025  -55.227 1.00 57.96  ? 195  MET B CE  1 
ATOM   5732 N N   . SER B 1 196 ? 1.822   22.958  -51.481 1.00 39.48  ? 196  SER B N   1 
ATOM   5733 C CA  . SER B 1 196 ? 1.513   22.539  -50.123 1.00 42.72  ? 196  SER B CA  1 
ATOM   5734 C C   . SER B 1 196 ? 1.641   21.014  -49.978 1.00 50.42  ? 196  SER B C   1 
ATOM   5735 O O   . SER B 1 196 ? 0.656   20.257  -50.073 1.00 48.76  ? 196  SER B O   1 
ATOM   5736 C CB  . SER B 1 196 ? 0.108   23.006  -49.726 1.00 45.16  ? 196  SER B CB  1 
ATOM   5737 O OG  . SER B 1 196 ? -0.138  22.752  -48.353 1.00 50.13  ? 196  SER B OG  1 
ATOM   5738 N N   . VAL B 1 197 ? 2.862   20.558  -49.744 1.00 42.78  ? 197  VAL B N   1 
ATOM   5739 C CA  . VAL B 1 197 ? 3.092   19.131  -49.657 1.00 38.54  ? 197  VAL B CA  1 
ATOM   5740 C C   . VAL B 1 197 ? 3.615   18.736  -48.301 1.00 37.60  ? 197  VAL B C   1 
ATOM   5741 O O   . VAL B 1 197 ? 4.705   19.127  -47.910 1.00 48.28  ? 197  VAL B O   1 
ATOM   5742 C CB  . VAL B 1 197 ? 4.032   18.655  -50.784 1.00 37.28  ? 197  VAL B CB  1 
ATOM   5743 C CG1 . VAL B 1 197 ? 4.596   17.279  -50.488 1.00 24.13  ? 197  VAL B CG1 1 
ATOM   5744 C CG2 . VAL B 1 197 ? 3.260   18.657  -52.119 1.00 38.40  ? 197  VAL B CG2 1 
ATOM   5745 N N   . THR B 1 198 ? 2.815   17.969  -47.577 1.00 30.58  ? 198  THR B N   1 
ATOM   5746 C CA  . THR B 1 198 ? 3.213   17.458  -46.274 1.00 30.46  ? 198  THR B CA  1 
ATOM   5747 C C   . THR B 1 198 ? 3.569   15.968  -46.367 1.00 37.85  ? 198  THR B C   1 
ATOM   5748 O O   . THR B 1 198 ? 2.739   15.151  -46.783 1.00 48.33  ? 198  THR B O   1 
ATOM   5749 C CB  . THR B 1 198 ? 2.069   17.621  -45.270 1.00 36.84  ? 198  THR B CB  1 
ATOM   5750 O OG1 . THR B 1 198 ? 1.719   19.005  -45.155 1.00 49.27  ? 198  THR B OG1 1 
ATOM   5751 C CG2 . THR B 1 198 ? 2.458   17.102  -43.915 1.00 36.28  ? 198  THR B CG2 1 
ATOM   5752 N N   . LEU B 1 199 ? 4.807   15.628  -46.011 1.00 20.93  ? 199  LEU B N   1 
ATOM   5753 C CA  . LEU B 1 199 ? 5.218   14.235  -45.818 1.00 29.32  ? 199  LEU B CA  1 
ATOM   5754 C C   . LEU B 1 199 ? 4.782   13.739  -44.452 1.00 38.95  ? 199  LEU B C   1 
ATOM   5755 O O   . LEU B 1 199 ? 4.911   14.457  -43.468 1.00 52.63  ? 199  LEU B O   1 
ATOM   5756 C CB  . LEU B 1 199 ? 6.750   14.092  -45.881 1.00 30.42  ? 199  LEU B CB  1 
ATOM   5757 C CG  . LEU B 1 199 ? 7.477   14.782  -47.033 1.00 37.69  ? 199  LEU B CG  1 
ATOM   5758 C CD1 . LEU B 1 199 ? 8.959   14.691  -46.827 1.00 32.94  ? 199  LEU B CD1 1 
ATOM   5759 C CD2 . LEU B 1 199 ? 7.060   14.189  -48.390 1.00 35.12  ? 199  LEU B CD2 1 
ATOM   5760 N N   . PHE B 1 200 ? 4.285   12.512  -44.373 1.00 34.33  ? 200  PHE B N   1 
ATOM   5761 C CA  . PHE B 1 200 ? 4.099   11.889  -43.068 1.00 40.05  ? 200  PHE B CA  1 
ATOM   5762 C C   . PHE B 1 200 ? 4.387   10.432  -43.180 1.00 44.25  ? 200  PHE B C   1 
ATOM   5763 O O   . PHE B 1 200 ? 4.183   9.838   -44.226 1.00 52.62  ? 200  PHE B O   1 
ATOM   5764 C CB  . PHE B 1 200 ? 2.712   12.159  -42.464 1.00 37.81  ? 200  PHE B CB  1 
ATOM   5765 C CG  . PHE B 1 200 ? 1.557   11.440  -43.150 1.00 40.57  ? 200  PHE B CG  1 
ATOM   5766 C CD1 . PHE B 1 200 ? 1.392   11.481  -44.515 1.00 43.01  ? 200  PHE B CD1 1 
ATOM   5767 C CD2 . PHE B 1 200 ? 0.582   10.801  -42.392 1.00 32.20  ? 200  PHE B CD2 1 
ATOM   5768 C CE1 . PHE B 1 200 ? 0.312   10.862  -45.105 1.00 48.21  ? 200  PHE B CE1 1 
ATOM   5769 C CE2 . PHE B 1 200 ? -0.486  10.191  -42.974 1.00 33.26  ? 200  PHE B CE2 1 
ATOM   5770 C CZ  . PHE B 1 200 ? -0.627  10.208  -44.328 1.00 44.93  ? 200  PHE B CZ  1 
ATOM   5771 N N   . GLY B 1 201 ? 4.898   9.862   -42.105 1.00 38.12  ? 201  GLY B N   1 
ATOM   5772 C CA  . GLY B 1 201 ? 5.323   8.483   -42.128 1.00 37.20  ? 201  GLY B CA  1 
ATOM   5773 C C   . GLY B 1 201 ? 5.512   7.968   -40.725 1.00 45.20  ? 201  GLY B C   1 
ATOM   5774 O O   . GLY B 1 201 ? 5.549   8.731   -39.749 1.00 40.10  ? 201  GLY B O   1 
ATOM   5775 N N   . GLU B 1 202 ? 5.636   6.657   -40.608 1.00 44.82  ? 202  GLU B N   1 
ATOM   5776 C CA  . GLU B 1 202 ? 5.721   6.079   -39.284 1.00 42.70  ? 202  GLU B CA  1 
ATOM   5777 C C   . GLU B 1 202 ? 6.915   5.148   -39.120 1.00 44.61  ? 202  GLU B C   1 
ATOM   5778 O O   . GLU B 1 202 ? 7.203   4.338   -39.982 1.00 35.48  ? 202  GLU B O   1 
ATOM   5779 C CB  . GLU B 1 202 ? 4.413   5.361   -38.961 1.00 27.42  ? 202  GLU B CB  1 
ATOM   5780 C CG  . GLU B 1 202 ? 4.286   4.939   -37.511 1.00 36.18  ? 202  GLU B CG  1 
ATOM   5781 C CD  . GLU B 1 202 ? 4.636   3.492   -37.328 1.00 48.95  ? 202  GLU B CD  1 
ATOM   5782 O OE1 . GLU B 1 202 ? 4.753   2.785   -38.354 1.00 42.44  ? 202  GLU B OE1 1 
ATOM   5783 O OE2 . GLU B 1 202 ? 4.781   3.069   -36.165 1.00 58.36  ? 202  GLU B OE2 1 
HETATM 5784 N N   A SXE B 1 203 ? 7.633   5.275   -37.994 0.50 50.34  ? 203  SXE B N   1 
HETATM 5785 N N   B SXE B 1 203 ? 7.635   5.292   -37.998 0.50 50.32  ? 203  SXE B N   1 
HETATM 5786 C CA  A SXE B 1 203 ? 8.653   4.300   -37.670 0.50 47.49  ? 203  SXE B CA  1 
HETATM 5787 C CA  B SXE B 1 203 ? 8.679   4.349   -37.671 0.50 47.64  ? 203  SXE B CA  1 
HETATM 5788 C C   A SXE B 1 203 ? 9.777   4.481   -38.683 0.50 42.16  ? 203  SXE B C   1 
HETATM 5789 C C   B SXE B 1 203 ? 9.778   4.503   -38.712 0.50 42.14  ? 203  SXE B C   1 
HETATM 5790 O O   A SXE B 1 203 ? 10.307  5.568   -38.778 0.50 37.87  ? 203  SXE B O   1 
HETATM 5791 O O   B SXE B 1 203 ? 10.290  5.593   -38.857 0.50 37.55  ? 203  SXE B O   1 
HETATM 5792 C CB  A SXE B 1 203 ? 7.830   3.029   -37.756 0.50 47.15  ? 203  SXE B CB  1 
HETATM 5793 C CB  B SXE B 1 203 ? 7.912   3.042   -37.692 0.50 47.44  ? 203  SXE B CB  1 
HETATM 5794 O OG  A SXE B 1 203 ? 8.701   1.910   -37.466 0.50 55.52  ? 203  SXE B OG  1 
HETATM 5795 O OG  B SXE B 1 203 ? 8.846   1.971   -37.402 0.50 52.52  ? 203  SXE B OG  1 
HETATM 5796 O O1  A SXE B 1 203 ? 9.453   0.364   -39.462 0.50 64.26  ? 203  SXE B O1  1 
HETATM 5797 O O1  B SXE B 1 203 ? 9.572   0.378   -39.373 0.50 64.11  ? 203  SXE B O1  1 
HETATM 5798 P P1  A SXE B 1 203 ? 8.534   0.540   -38.313 0.50 67.19  ? 203  SXE B P1  1 
HETATM 5799 P P1  B SXE B 1 203 ? 8.699   0.564   -38.184 0.50 66.52  ? 203  SXE B P1  1 
HETATM 5800 N N1  A SXE B 1 203 ? 6.920   0.480   -38.717 0.50 54.36  ? 203  SXE B N1  1 
HETATM 5801 N N1  B SXE B 1 203 ? 8.896   -0.600  -37.010 0.50 52.32  ? 203  SXE B N1  1 
HETATM 5802 C C1  A SXE B 1 203 ? 6.192   -0.789  -38.928 0.50 57.46  ? 203  SXE B C1  1 
HETATM 5803 C C1  B SXE B 1 203 ? 9.021   -2.028  -37.347 0.50 52.10  ? 203  SXE B C1  1 
HETATM 5804 C C3  A SXE B 1 203 ? 5.235   -1.030  -37.757 0.50 59.81  ? 203  SXE B C3  1 
HETATM 5805 C C3  B SXE B 1 203 ? 10.390  -2.616  -36.997 0.50 59.68  ? 203  SXE B C3  1 
HETATM 5806 C C2  A SXE B 1 203 ? 5.465   -0.822  -40.280 0.50 55.57  ? 203  SXE B C2  1 
HETATM 5807 C C2  B SXE B 1 203 ? 7.854   -2.824  -36.766 0.50 42.37  ? 203  SXE B C2  1 
HETATM 5808 O O2  A SXE B 1 203 ? 8.672   -0.536  -37.108 0.50 56.52  ? 203  SXE B O2  1 
HETATM 5809 O O2  B SXE B 1 203 ? 7.104   0.575   -38.459 0.50 55.57  ? 203  SXE B O2  1 
HETATM 5810 C C4  A SXE B 1 203 ? 9.956   -1.166  -36.889 0.50 54.18  ? 203  SXE B C4  1 
HETATM 5811 C C4  B SXE B 1 203 ? 6.570   -0.298  -39.484 0.50 56.84  ? 203  SXE B C4  1 
HETATM 5812 C C5  A SXE B 1 203 ? 9.726   -2.662  -36.770 0.50 58.76  ? 203  SXE B C5  1 
HETATM 5813 C C5  B SXE B 1 203 ? 5.156   -0.683  -39.089 0.50 56.63  ? 203  SXE B C5  1 
ATOM   5814 N N   . ALA B 1 204 ? 10.128  3.459   -39.452 1.00 39.99  ? 204  ALA B N   1 
ATOM   5815 C CA  . ALA B 1 204 ? 11.162  3.627   -40.480 1.00 42.57  ? 204  ALA B CA  1 
ATOM   5816 C C   . ALA B 1 204 ? 10.751  4.693   -41.487 1.00 45.55  ? 204  ALA B C   1 
ATOM   5817 O O   . ALA B 1 204 ? 11.599  5.390   -42.046 1.00 48.89  ? 204  ALA B O   1 
ATOM   5818 C CB  . ALA B 1 204 ? 11.513  2.310   -41.182 1.00 37.55  ? 204  ALA B CB  1 
ATOM   5819 N N   . GLY B 1 205 ? 9.447   4.824   -41.707 1.00 44.38  ? 205  GLY B N   1 
ATOM   5820 C CA  . GLY B 1 205 ? 8.910   5.913   -42.516 1.00 52.57  ? 205  GLY B CA  1 
ATOM   5821 C C   . GLY B 1 205 ? 9.083   7.308   -41.900 1.00 54.57  ? 205  GLY B C   1 
ATOM   5822 O O   . GLY B 1 205 ? 9.327   8.289   -42.613 1.00 55.77  ? 205  GLY B O   1 
ATOM   5823 N N   . ALA B 1 206 ? 8.949   7.415   -40.578 1.00 42.93  ? 206  ALA B N   1 
ATOM   5824 C CA  . ALA B 1 206 ? 9.222   8.680   -39.913 1.00 36.51  ? 206  ALA B CA  1 
ATOM   5825 C C   . ALA B 1 206 ? 10.704  9.022   -40.052 1.00 36.48  ? 206  ALA B C   1 
ATOM   5826 O O   . ALA B 1 206 ? 11.066  10.167  -40.315 1.00 40.93  ? 206  ALA B O   1 
ATOM   5827 C CB  . ALA B 1 206 ? 8.803   8.635   -38.467 1.00 29.49  ? 206  ALA B CB  1 
ATOM   5828 N N   . ALA B 1 207 ? 11.558  8.018   -39.908 1.00 35.01  ? 207  ALA B N   1 
ATOM   5829 C CA  . ALA B 1 207 ? 12.982  8.201   -40.139 1.00 34.68  ? 207  ALA B CA  1 
ATOM   5830 C C   . ALA B 1 207 ? 13.241  8.694   -41.547 1.00 43.40  ? 207  ALA B C   1 
ATOM   5831 O O   . ALA B 1 207 ? 14.079  9.600   -41.764 1.00 40.02  ? 207  ALA B O   1 
ATOM   5832 C CB  . ALA B 1 207 ? 13.719  6.927   -39.893 1.00 35.92  ? 207  ALA B CB  1 
ATOM   5833 N N   . SER B 1 208 ? 12.525  8.110   -42.513 1.00 43.33  ? 208  SER B N   1 
ATOM   5834 C CA  . SER B 1 208 ? 12.725  8.502   -43.917 1.00 42.41  ? 208  SER B CA  1 
ATOM   5835 C C   . SER B 1 208 ? 12.401  9.984   -44.086 1.00 42.68  ? 208  SER B C   1 
ATOM   5836 O O   . SER B 1 208 ? 13.202  10.735  -44.628 1.00 37.10  ? 208  SER B O   1 
ATOM   5837 C CB  . SER B 1 208 ? 11.878  7.654   -44.875 1.00 40.91  ? 208  SER B CB  1 
ATOM   5838 O OG  . SER B 1 208 ? 12.293  6.304   -44.883 1.00 42.74  ? 208  SER B OG  1 
ATOM   5839 N N   . VAL B 1 209 ? 11.222  10.397  -43.617 1.00 37.39  ? 209  VAL B N   1 
ATOM   5840 C CA  . VAL B 1 209 ? 10.838  11.802  -43.635 1.00 30.23  ? 209  VAL B CA  1 
ATOM   5841 C C   . VAL B 1 209 ? 11.934  12.645  -42.987 1.00 40.50  ? 209  VAL B C   1 
ATOM   5842 O O   . VAL B 1 209 ? 12.337  13.702  -43.500 1.00 37.36  ? 209  VAL B O   1 
ATOM   5843 C CB  . VAL B 1 209 ? 9.568   12.012  -42.842 1.00 28.75  ? 209  VAL B CB  1 
ATOM   5844 C CG1 . VAL B 1 209 ? 9.429   13.479  -42.467 1.00 25.78  ? 209  VAL B CG1 1 
ATOM   5845 C CG2 . VAL B 1 209 ? 8.361   11.483  -43.613 1.00 32.01  ? 209  VAL B CG2 1 
ATOM   5846 N N   . GLY B 1 210 ? 12.430  12.161  -41.853 1.00 40.41  ? 210  GLY B N   1 
ATOM   5847 C CA  . GLY B 1 210 ? 13.501  12.848  -41.168 1.00 48.83  ? 210  GLY B CA  1 
ATOM   5848 C C   . GLY B 1 210 ? 14.702  13.031  -42.080 1.00 47.14  ? 210  GLY B C   1 
ATOM   5849 O O   . GLY B 1 210 ? 15.317  14.094  -42.121 1.00 37.85  ? 210  GLY B O   1 
ATOM   5850 N N   . MET B 1 211 ? 15.046  11.996  -42.828 1.00 43.85  ? 211  MET B N   1 
ATOM   5851 C CA  . MET B 1 211 ? 16.152  12.147  -43.744 1.00 44.21  ? 211  MET B CA  1 
ATOM   5852 C C   . MET B 1 211 ? 15.898  13.114  -44.900 1.00 44.19  ? 211  MET B C   1 
ATOM   5853 O O   . MET B 1 211 ? 16.821  13.779  -45.365 1.00 47.61  ? 211  MET B O   1 
ATOM   5854 C CB  . MET B 1 211 ? 16.669  10.797  -44.193 1.00 44.32  ? 211  MET B CB  1 
ATOM   5855 C CG  . MET B 1 211 ? 17.698  10.302  -43.211 1.00 48.02  ? 211  MET B CG  1 
ATOM   5856 S SD  . MET B 1 211 ? 17.630  8.542   -43.021 1.00 55.79  ? 211  MET B SD  1 
ATOM   5857 C CE  . MET B 1 211 ? 17.828  8.399   -41.254 1.00 82.05  ? 211  MET B CE  1 
ATOM   5858 N N   . HIS B 1 212 ? 14.655  13.249  -45.341 1.00 40.80  ? 212  HIS B N   1 
ATOM   5859 C CA  . HIS B 1 212 ? 14.406  14.216  -46.400 1.00 41.41  ? 212  HIS B CA  1 
ATOM   5860 C C   . HIS B 1 212 ? 14.592  15.627  -45.872 1.00 43.29  ? 212  HIS B C   1 
ATOM   5861 O O   . HIS B 1 212 ? 15.030  16.501  -46.608 1.00 45.20  ? 212  HIS B O   1 
ATOM   5862 C CB  . HIS B 1 212 ? 13.046  14.011  -47.080 1.00 30.81  ? 212  HIS B CB  1 
ATOM   5863 C CG  . HIS B 1 212 ? 12.937  12.708  -47.810 1.00 32.08  ? 212  HIS B CG  1 
ATOM   5864 N ND1 . HIS B 1 212 ? 13.560  12.477  -49.019 1.00 36.38  ? 212  HIS B ND1 1 
ATOM   5865 C CD2 . HIS B 1 212 ? 12.294  11.556  -47.496 1.00 34.26  ? 212  HIS B CD2 1 
ATOM   5866 C CE1 . HIS B 1 212 ? 13.307  11.241  -49.421 1.00 38.33  ? 212  HIS B CE1 1 
ATOM   5867 N NE2 . HIS B 1 212 ? 12.534  10.663  -48.519 1.00 38.03  ? 212  HIS B NE2 1 
ATOM   5868 N N   . ILE B 1 213 ? 14.275  15.837  -44.597 1.00 40.46  ? 213  ILE B N   1 
ATOM   5869 C CA  . ILE B 1 213 ? 14.544  17.112  -43.939 1.00 40.19  ? 213  ILE B CA  1 
ATOM   5870 C C   . ILE B 1 213 ? 16.054  17.423  -43.928 1.00 49.04  ? 213  ILE B C   1 
ATOM   5871 O O   . ILE B 1 213 ? 16.485  18.568  -44.105 1.00 51.10  ? 213  ILE B O   1 
ATOM   5872 C CB  . ILE B 1 213 ? 14.060  17.066  -42.490 1.00 39.48  ? 213  ILE B CB  1 
ATOM   5873 C CG1 . ILE B 1 213 ? 12.584  16.678  -42.442 1.00 43.18  ? 213  ILE B CG1 1 
ATOM   5874 C CG2 . ILE B 1 213 ? 14.321  18.390  -41.783 1.00 33.31  ? 213  ILE B CG2 1 
ATOM   5875 C CD1 . ILE B 1 213 ? 11.958  16.794  -41.079 1.00 38.59  ? 213  ILE B CD1 1 
ATOM   5876 N N   . LEU B 1 214 ? 16.852  16.384  -43.721 1.00 47.46  ? 214  LEU B N   1 
ATOM   5877 C CA  . LEU B 1 214 ? 18.276  16.547  -43.491 1.00 48.11  ? 214  LEU B CA  1 
ATOM   5878 C C   . LEU B 1 214 ? 19.087  16.455  -44.781 1.00 58.11  ? 214  LEU B C   1 
ATOM   5879 O O   . LEU B 1 214 ? 20.322  16.440  -44.738 1.00 63.76  ? 214  LEU B O   1 
ATOM   5880 C CB  . LEU B 1 214 ? 18.785  15.521  -42.463 1.00 40.14  ? 214  LEU B CB  1 
ATOM   5881 C CG  . LEU B 1 214 ? 18.204  15.669  -41.049 1.00 42.20  ? 214  LEU B CG  1 
ATOM   5882 C CD1 . LEU B 1 214 ? 18.672  14.567  -40.111 1.00 39.69  ? 214  LEU B CD1 1 
ATOM   5883 C CD2 . LEU B 1 214 ? 18.553  17.029  -40.466 1.00 40.46  ? 214  LEU B CD2 1 
ATOM   5884 N N   . SER B 1 215 ? 18.398  16.388  -45.919 1.00 49.27  ? 215  SER B N   1 
ATOM   5885 C CA  . SER B 1 215 ? 19.074  16.329  -47.217 1.00 41.55  ? 215  SER B CA  1 
ATOM   5886 C C   . SER B 1 215 ? 18.602  17.415  -48.204 1.00 52.21  ? 215  SER B C   1 
ATOM   5887 O O   . SER B 1 215 ? 17.460  17.384  -48.698 1.00 43.13  ? 215  SER B O   1 
ATOM   5888 C CB  . SER B 1 215 ? 18.939  14.938  -47.836 1.00 33.94  ? 215  SER B CB  1 
ATOM   5889 O OG  . SER B 1 215 ? 19.696  14.850  -49.033 1.00 45.67  ? 215  SER B OG  1 
ATOM   5890 N N   . LEU B 1 216 ? 19.490  18.368  -48.498 1.00 55.55  ? 216  LEU B N   1 
ATOM   5891 C CA  . LEU B 1 216 ? 19.092  19.562  -49.248 1.00 62.33  ? 216  LEU B CA  1 
ATOM   5892 C C   . LEU B 1 216 ? 18.253  19.282  -50.489 1.00 59.26  ? 216  LEU B C   1 
ATOM   5893 O O   . LEU B 1 216 ? 17.150  19.790  -50.617 1.00 65.29  ? 216  LEU B O   1 
ATOM   5894 C CB  . LEU B 1 216 ? 20.290  20.437  -49.593 1.00 77.01  ? 216  LEU B CB  1 
ATOM   5895 C CG  . LEU B 1 216 ? 20.924  21.144  -48.392 1.00 93.13  ? 216  LEU B CG  1 
ATOM   5896 C CD1 . LEU B 1 216 ? 21.266  22.559  -48.811 1.00 102.06 ? 216  LEU B CD1 1 
ATOM   5897 C CD2 . LEU B 1 216 ? 20.008  21.162  -47.158 1.00 89.61  ? 216  LEU B CD2 1 
ATOM   5898 N N   . PRO B 1 217 ? 18.758  18.451  -51.398 1.00 51.07  ? 217  PRO B N   1 
ATOM   5899 C CA  . PRO B 1 217 ? 18.009  18.231  -52.635 1.00 46.56  ? 217  PRO B CA  1 
ATOM   5900 C C   . PRO B 1 217 ? 16.537  17.791  -52.407 1.00 50.58  ? 217  PRO B C   1 
ATOM   5901 O O   . PRO B 1 217 ? 15.722  17.961  -53.311 1.00 49.32  ? 217  PRO B O   1 
ATOM   5902 C CB  . PRO B 1 217 ? 18.796  17.095  -53.318 1.00 35.29  ? 217  PRO B CB  1 
ATOM   5903 C CG  . PRO B 1 217 ? 20.053  16.983  -52.594 1.00 36.29  ? 217  PRO B CG  1 
ATOM   5904 C CD  . PRO B 1 217 ? 19.809  17.437  -51.211 1.00 43.63  ? 217  PRO B CD  1 
ATOM   5905 N N   . SER B 1 218 ? 16.210  17.225  -51.241 1.00 49.28  ? 218  SER B N   1 
ATOM   5906 C CA  . SER B 1 218 ? 14.823  16.839  -50.924 1.00 47.51  ? 218  SER B CA  1 
ATOM   5907 C C   . SER B 1 218 ? 13.967  18.029  -50.531 1.00 52.49  ? 218  SER B C   1 
ATOM   5908 O O   . SER B 1 218 ? 12.765  18.027  -50.774 1.00 52.73  ? 218  SER B O   1 
ATOM   5909 C CB  . SER B 1 218 ? 14.765  15.840  -49.772 1.00 43.12  ? 218  SER B CB  1 
ATOM   5910 O OG  . SER B 1 218 ? 14.764  14.508  -50.226 1.00 48.45  ? 218  SER B OG  1 
ATOM   5911 N N   . ARG B 1 219 ? 14.607  19.030  -49.923 1.00 50.10  ? 219  ARG B N   1 
ATOM   5912 C CA  . ARG B 1 219 ? 13.929  20.137  -49.265 1.00 42.32  ? 219  ARG B CA  1 
ATOM   5913 C C   . ARG B 1 219 ? 13.090  21.016  -50.199 1.00 46.56  ? 219  ARG B C   1 
ATOM   5914 O O   . ARG B 1 219 ? 12.150  21.686  -49.769 1.00 53.97  ? 219  ARG B O   1 
ATOM   5915 C CB  . ARG B 1 219 ? 14.933  20.969  -48.472 1.00 47.54  ? 219  ARG B CB  1 
ATOM   5916 C CG  . ARG B 1 219 ? 15.503  20.244  -47.237 1.00 55.45  ? 219  ARG B CG  1 
ATOM   5917 C CD  . ARG B 1 219 ? 14.435  20.017  -46.141 1.00 69.10  ? 219  ARG B CD  1 
ATOM   5918 N NE  . ARG B 1 219 ? 13.739  21.239  -45.714 1.00 77.34  ? 219  ARG B NE  1 
ATOM   5919 C CZ  . ARG B 1 219 ? 14.195  22.098  -44.797 1.00 78.42  ? 219  ARG B CZ  1 
ATOM   5920 N NH1 . ARG B 1 219 ? 15.368  21.887  -44.197 1.00 78.30  ? 219  ARG B NH1 1 
ATOM   5921 N NH2 . ARG B 1 219 ? 13.481  23.179  -44.481 1.00 72.63  ? 219  ARG B NH2 1 
ATOM   5922 N N   . SER B 1 220 ? 13.403  20.998  -51.482 1.00 44.92  ? 220  SER B N   1 
ATOM   5923 C CA  . SER B 1 220 ? 12.590  21.742  -52.425 1.00 54.49  ? 220  SER B CA  1 
ATOM   5924 C C   . SER B 1 220 ? 11.327  20.971  -52.827 1.00 54.57  ? 220  SER B C   1 
ATOM   5925 O O   . SER B 1 220 ? 10.625  21.374  -53.742 1.00 56.03  ? 220  SER B O   1 
ATOM   5926 C CB  . SER B 1 220 ? 13.414  22.079  -53.670 1.00 59.56  ? 220  SER B CB  1 
ATOM   5927 O OG  . SER B 1 220 ? 13.934  20.904  -54.267 1.00 63.71  ? 220  SER B OG  1 
ATOM   5928 N N   . LEU B 1 221 ? 11.029  19.866  -52.157 1.00 48.83  ? 221  LEU B N   1 
ATOM   5929 C CA  . LEU B 1 221 ? 9.973   18.983  -52.649 1.00 52.41  ? 221  LEU B CA  1 
ATOM   5930 C C   . LEU B 1 221 ? 8.835   18.832  -51.663 1.00 47.41  ? 221  LEU B C   1 
ATOM   5931 O O   . LEU B 1 221 ? 7.887   18.099  -51.909 1.00 51.11  ? 221  LEU B O   1 
ATOM   5932 C CB  . LEU B 1 221 ? 10.533  17.591  -52.985 1.00 57.04  ? 221  LEU B CB  1 
ATOM   5933 C CG  . LEU B 1 221 ? 11.757  17.529  -53.892 1.00 48.83  ? 221  LEU B CG  1 
ATOM   5934 C CD1 . LEU B 1 221 ? 12.207  16.079  -54.058 1.00 43.96  ? 221  LEU B CD1 1 
ATOM   5935 C CD2 . LEU B 1 221 ? 11.406  18.153  -55.225 1.00 42.03  ? 221  LEU B CD2 1 
ATOM   5936 N N   . PHE B 1 222 ? 8.942   19.506  -50.532 1.00 46.02  ? 222  PHE B N   1 
ATOM   5937 C CA  . PHE B 1 222 ? 7.892   19.448  -49.525 1.00 45.25  ? 222  PHE B CA  1 
ATOM   5938 C C   . PHE B 1 222 ? 8.000   20.637  -48.565 1.00 46.03  ? 222  PHE B C   1 
ATOM   5939 O O   . PHE B 1 222 ? 9.002   21.370  -48.570 1.00 41.46  ? 222  PHE B O   1 
ATOM   5940 C CB  . PHE B 1 222 ? 7.967   18.120  -48.764 1.00 37.83  ? 222  PHE B CB  1 
ATOM   5941 C CG  . PHE B 1 222 ? 9.162   17.995  -47.861 1.00 33.70  ? 222  PHE B CG  1 
ATOM   5942 C CD1 . PHE B 1 222 ? 10.400  17.602  -48.373 1.00 34.99  ? 222  PHE B CD1 1 
ATOM   5943 C CD2 . PHE B 1 222 ? 9.048   18.255  -46.496 1.00 30.76  ? 222  PHE B CD2 1 
ATOM   5944 C CE1 . PHE B 1 222 ? 11.503  17.429  -47.531 1.00 38.84  ? 222  PHE B CE1 1 
ATOM   5945 C CE2 . PHE B 1 222 ? 10.147  18.116  -45.645 1.00 37.96  ? 222  PHE B CE2 1 
ATOM   5946 C CZ  . PHE B 1 222 ? 11.386  17.696  -46.165 1.00 38.65  ? 222  PHE B CZ  1 
ATOM   5947 N N   . HIS B 1 223 ? 6.977   20.820  -47.732 1.00 46.70  ? 223  HIS B N   1 
ATOM   5948 C CA  . HIS B 1 223 ? 6.899   22.014  -46.892 1.00 43.12  ? 223  HIS B CA  1 
ATOM   5949 C C   . HIS B 1 223 ? 6.745   21.723  -45.406 1.00 44.67  ? 223  HIS B C   1 
ATOM   5950 O O   . HIS B 1 223 ? 7.219   22.484  -44.575 1.00 55.81  ? 223  HIS B O   1 
ATOM   5951 C CB  . HIS B 1 223 ? 5.784   22.911  -47.407 1.00 35.39  ? 223  HIS B CB  1 
ATOM   5952 C CG  . HIS B 1 223 ? 5.753   22.997  -48.900 1.00 38.58  ? 223  HIS B CG  1 
ATOM   5953 N ND1 . HIS B 1 223 ? 4.946   22.192  -49.676 1.00 52.76  ? 223  HIS B ND1 1 
ATOM   5954 C CD2 . HIS B 1 223 ? 6.473   23.750  -49.763 1.00 35.62  ? 223  HIS B CD2 1 
ATOM   5955 C CE1 . HIS B 1 223 ? 5.151   22.468  -50.952 1.00 53.07  ? 223  HIS B CE1 1 
ATOM   5956 N NE2 . HIS B 1 223 ? 6.079   23.405  -51.030 1.00 45.34  ? 223  HIS B NE2 1 
ATOM   5957 N N   . ARG B 1 224 ? 6.113   20.605  -45.083 1.00 41.63  ? 224  ARG B N   1 
ATOM   5958 C CA  . ARG B 1 224 ? 5.929   20.202  -43.698 1.00 45.87  ? 224  ARG B CA  1 
ATOM   5959 C C   . ARG B 1 224 ? 6.199   18.705  -43.558 1.00 43.83  ? 224  ARG B C   1 
ATOM   5960 O O   . ARG B 1 224 ? 6.110   17.966  -44.529 1.00 42.92  ? 224  ARG B O   1 
ATOM   5961 C CB  . ARG B 1 224 ? 4.509   20.525  -43.256 1.00 44.55  ? 224  ARG B CB  1 
ATOM   5962 C CG  . ARG B 1 224 ? 4.240   21.997  -43.184 1.00 45.87  ? 224  ARG B CG  1 
ATOM   5963 C CD  . ARG B 1 224 ? 2.773   22.282  -42.994 1.00 49.64  ? 224  ARG B CD  1 
ATOM   5964 N NE  . ARG B 1 224 ? 2.093   22.522  -44.257 1.00 48.50  ? 224  ARG B NE  1 
ATOM   5965 C CZ  . ARG B 1 224 ? 2.398   23.521  -45.071 1.00 52.37  ? 224  ARG B CZ  1 
ATOM   5966 N NH1 . ARG B 1 224 ? 3.386   24.341  -44.740 1.00 44.32  ? 224  ARG B NH1 1 
ATOM   5967 N NH2 . ARG B 1 224 ? 1.738   23.685  -46.221 1.00 56.77  ? 224  ARG B NH2 1 
ATOM   5968 N N   . ALA B 1 225 ? 6.531   18.267  -42.352 1.00 31.10  ? 225  ALA B N   1 
ATOM   5969 C CA  . ALA B 1 225 ? 6.817   16.867  -42.116 1.00 29.56  ? 225  ALA B CA  1 
ATOM   5970 C C   . ALA B 1 225 ? 6.137   16.399  -40.853 1.00 40.64  ? 225  ALA B C   1 
ATOM   5971 O O   . ALA B 1 225 ? 5.971   17.164  -39.908 1.00 51.19  ? 225  ALA B O   1 
ATOM   5972 C CB  . ALA B 1 225 ? 8.303   16.651  -42.009 1.00 43.65  ? 225  ALA B CB  1 
ATOM   5973 N N   . VAL B 1 226 ? 5.745   15.135  -40.842 1.00 39.63  ? 226  VAL B N   1 
ATOM   5974 C CA  . VAL B 1 226 ? 5.185   14.517  -39.653 1.00 36.97  ? 226  VAL B CA  1 
ATOM   5975 C C   . VAL B 1 226 ? 5.966   13.259  -39.494 1.00 38.24  ? 226  VAL B C   1 
ATOM   5976 O O   . VAL B 1 226 ? 6.075   12.487  -40.445 1.00 41.77  ? 226  VAL B O   1 
ATOM   5977 C CB  . VAL B 1 226 ? 3.718   14.131  -39.840 1.00 34.13  ? 226  VAL B CB  1 
ATOM   5978 C CG1 . VAL B 1 226 ? 3.193   13.326  -38.632 1.00 30.46  ? 226  VAL B CG1 1 
ATOM   5979 C CG2 . VAL B 1 226 ? 2.900   15.362  -40.120 1.00 29.63  ? 226  VAL B CG2 1 
ATOM   5980 N N   . LEU B 1 227 ? 6.545   13.075  -38.314 1.00 31.69  ? 227  LEU B N   1 
ATOM   5981 C CA  . LEU B 1 227 ? 7.271   11.859  -38.020 1.00 34.56  ? 227  LEU B CA  1 
ATOM   5982 C C   . LEU B 1 227 ? 6.523   11.123  -36.929 1.00 34.84  ? 227  LEU B C   1 
ATOM   5983 O O   . LEU B 1 227 ? 6.512   11.570  -35.791 1.00 31.94  ? 227  LEU B O   1 
ATOM   5984 C CB  . LEU B 1 227 ? 8.687   12.201  -37.544 1.00 35.82  ? 227  LEU B CB  1 
ATOM   5985 C CG  . LEU B 1 227 ? 9.698   12.717  -38.574 1.00 34.65  ? 227  LEU B CG  1 
ATOM   5986 C CD1 . LEU B 1 227 ? 9.412   14.138  -38.999 1.00 26.05  ? 227  LEU B CD1 1 
ATOM   5987 C CD2 . LEU B 1 227 ? 11.109  12.628  -38.018 1.00 27.92  ? 227  LEU B CD2 1 
ATOM   5988 N N   . GLN B 1 228 ? 5.884   10.001  -37.250 1.00 33.49  ? 228  GLN B N   1 
ATOM   5989 C CA  . GLN B 1 228 ? 5.246   9.224   -36.185 1.00 33.07  ? 228  GLN B CA  1 
ATOM   5990 C C   . GLN B 1 228 ? 6.091   8.047   -35.713 1.00 39.08  ? 228  GLN B C   1 
ATOM   5991 O O   . GLN B 1 228 ? 6.423   7.145   -36.474 1.00 43.99  ? 228  GLN B O   1 
ATOM   5992 C CB  . GLN B 1 228 ? 3.860   8.748   -36.598 1.00 34.75  ? 228  GLN B CB  1 
ATOM   5993 C CG  . GLN B 1 228 ? 2.989   9.809   -37.264 1.00 38.46  ? 228  GLN B CG  1 
ATOM   5994 C CD  . GLN B 1 228 ? 1.904   9.146   -38.075 1.00 46.94  ? 228  GLN B CD  1 
ATOM   5995 O OE1 . GLN B 1 228 ? 1.641   7.969   -37.879 1.00 47.95  ? 228  GLN B OE1 1 
ATOM   5996 N NE2 . GLN B 1 228 ? 1.279   9.878   -38.991 1.00 44.86  ? 228  GLN B NE2 1 
ATOM   5997 N N   . SER B 1 229 ? 6.457   8.072   -34.446 1.00 36.52  ? 229  SER B N   1 
ATOM   5998 C CA  . SER B 1 229 ? 7.212   6.970   -33.852 1.00 39.38  ? 229  SER B CA  1 
ATOM   5999 C C   . SER B 1 229 ? 8.541   6.592   -34.512 1.00 38.49  ? 229  SER B C   1 
ATOM   6000 O O   . SER B 1 229 ? 8.949   5.444   -34.434 1.00 42.41  ? 229  SER B O   1 
ATOM   6001 C CB  . SER B 1 229 ? 6.339   5.728   -33.728 1.00 41.93  ? 229  SER B CB  1 
ATOM   6002 O OG  . SER B 1 229 ? 5.275   5.972   -32.829 1.00 42.91  ? 229  SER B OG  1 
ATOM   6003 N N   . GLY B 1 230 ? 9.235   7.553   -35.105 1.00 36.84  ? 230  GLY B N   1 
ATOM   6004 C CA  . GLY B 1 230 ? 10.570  7.302   -35.626 1.00 37.12  ? 230  GLY B CA  1 
ATOM   6005 C C   . GLY B 1 230 ? 11.334  8.564   -36.000 1.00 37.54  ? 230  GLY B C   1 
ATOM   6006 O O   . GLY B 1 230 ? 10.746  9.625   -36.218 1.00 40.96  ? 230  GLY B O   1 
ATOM   6007 N N   . THR B 1 231 ? 12.653  8.442   -36.086 1.00 38.54  ? 231  THR B N   1 
ATOM   6008 C CA  . THR B 1 231 ? 13.545  9.595   -36.222 1.00 35.38  ? 231  THR B CA  1 
ATOM   6009 C C   . THR B 1 231 ? 14.740  9.214   -37.077 1.00 35.63  ? 231  THR B C   1 
ATOM   6010 O O   . THR B 1 231 ? 15.045  8.023   -37.198 1.00 40.11  ? 231  THR B O   1 
ATOM   6011 C CB  . THR B 1 231 ? 14.056  10.083  -34.832 1.00 37.18  ? 231  THR B CB  1 
ATOM   6012 O OG1 . THR B 1 231 ? 14.795  9.042   -34.190 1.00 38.01  ? 231  THR B OG1 1 
ATOM   6013 C CG2 . THR B 1 231 ? 12.902  10.479  -33.918 1.00 31.55  ? 231  THR B CG2 1 
ATOM   6014 N N   . PRO B 1 232 ? 15.413  10.212  -37.697 1.00 42.64  ? 232  PRO B N   1 
ATOM   6015 C CA  . PRO B 1 232 ? 16.662  9.919   -38.433 1.00 42.09  ? 232  PRO B CA  1 
ATOM   6016 C C   . PRO B 1 232 ? 17.795  9.662   -37.454 1.00 41.24  ? 232  PRO B C   1 
ATOM   6017 O O   . PRO B 1 232 ? 18.654  8.814   -37.678 1.00 54.15  ? 232  PRO B O   1 
ATOM   6018 C CB  . PRO B 1 232 ? 16.940  11.202  -39.218 1.00 40.73  ? 232  PRO B CB  1 
ATOM   6019 C CG  . PRO B 1 232 ? 15.798  12.159  -38.925 1.00 30.94  ? 232  PRO B CG  1 
ATOM   6020 C CD  . PRO B 1 232 ? 15.078  11.644  -37.720 1.00 39.90  ? 232  PRO B CD  1 
ATOM   6021 N N   . ASN B 1 233 ? 17.763  10.388  -36.344 1.00 39.99  ? 233  ASN B N   1 
ATOM   6022 C CA  . ASN B 1 233 ? 18.745  10.216  -35.295 1.00 41.67  ? 233  ASN B CA  1 
ATOM   6023 C C   . ASN B 1 233 ? 18.384  8.970   -34.524 1.00 43.37  ? 233  ASN B C   1 
ATOM   6024 O O   . ASN B 1 233 ? 17.315  8.419   -34.727 1.00 40.82  ? 233  ASN B O   1 
ATOM   6025 C CB  . ASN B 1 233 ? 18.780  11.433  -34.375 1.00 34.43  ? 233  ASN B CB  1 
ATOM   6026 C CG  . ASN B 1 233 ? 17.442  11.722  -33.748 1.00 41.95  ? 233  ASN B CG  1 
ATOM   6027 O OD1 . ASN B 1 233 ? 16.454  11.961  -34.443 1.00 39.42  ? 233  ASN B OD1 1 
ATOM   6028 N ND2 . ASN B 1 233 ? 17.402  11.712  -32.422 1.00 44.04  ? 233  ASN B ND2 1 
ATOM   6029 N N   . GLY B 1 234 ? 19.282  8.521   -33.653 1.00 45.54  ? 234  GLY B N   1 
ATOM   6030 C CA  . GLY B 1 234 ? 19.021  7.351   -32.831 1.00 46.96  ? 234  GLY B CA  1 
ATOM   6031 C C   . GLY B 1 234 ? 19.789  6.116   -33.266 1.00 42.36  ? 234  GLY B C   1 
ATOM   6032 O O   . GLY B 1 234 ? 20.464  6.126   -34.290 1.00 48.65  ? 234  GLY B O   1 
ATOM   6033 N N   . PRO B 1 235 ? 19.639  5.030   -32.512 1.00 41.08  ? 235  PRO B N   1 
ATOM   6034 C CA  . PRO B 1 235 ? 20.478  3.831   -32.610 1.00 52.58  ? 235  PRO B CA  1 
ATOM   6035 C C   . PRO B 1 235 ? 20.246  2.976   -33.862 1.00 56.68  ? 235  PRO B C   1 
ATOM   6036 O O   . PRO B 1 235 ? 21.183  2.271   -34.282 1.00 52.71  ? 235  PRO B O   1 
ATOM   6037 C CB  . PRO B 1 235 ? 20.092  3.019   -31.364 1.00 48.60  ? 235  PRO B CB  1 
ATOM   6038 C CG  . PRO B 1 235 ? 19.060  3.821   -30.640 1.00 44.43  ? 235  PRO B CG  1 
ATOM   6039 C CD  . PRO B 1 235 ? 18.522  4.842   -31.579 1.00 42.47  ? 235  PRO B CD  1 
ATOM   6040 N N   . TRP B 1 236 ? 19.044  3.029   -34.445 1.00 42.36  ? 236  TRP B N   1 
ATOM   6041 C CA  . TRP B 1 236 ? 18.679  2.049   -35.476 1.00 33.80  ? 236  TRP B CA  1 
ATOM   6042 C C   . TRP B 1 236 ? 18.561  2.536   -36.918 1.00 42.46  ? 236  TRP B C   1 
ATOM   6043 O O   . TRP B 1 236 ? 18.580  1.709   -37.833 1.00 46.47  ? 236  TRP B O   1 
ATOM   6044 C CB  . TRP B 1 236 ? 17.385  1.325   -35.095 1.00 31.68  ? 236  TRP B CB  1 
ATOM   6045 C CG  . TRP B 1 236 ? 16.196  2.249   -34.916 1.00 36.41  ? 236  TRP B CG  1 
ATOM   6046 C CD1 . TRP B 1 236 ? 15.764  2.814   -33.744 1.00 42.49  ? 236  TRP B CD1 1 
ATOM   6047 C CD2 . TRP B 1 236 ? 15.316  2.727   -35.935 1.00 37.36  ? 236  TRP B CD2 1 
ATOM   6048 N NE1 . TRP B 1 236 ? 14.663  3.601   -33.972 1.00 36.85  ? 236  TRP B NE1 1 
ATOM   6049 C CE2 . TRP B 1 236 ? 14.354  3.561   -35.303 1.00 38.53  ? 236  TRP B CE2 1 
ATOM   6050 C CE3 . TRP B 1 236 ? 15.223  2.520   -37.317 1.00 42.92  ? 236  TRP B CE3 1 
ATOM   6051 C CZ2 . TRP B 1 236 ? 13.315  4.190   -36.010 1.00 38.35  ? 236  TRP B CZ2 1 
ATOM   6052 C CZ3 . TRP B 1 236 ? 14.179  3.156   -38.025 1.00 48.26  ? 236  TRP B CZ3 1 
ATOM   6053 C CH2 . TRP B 1 236 ? 13.248  3.979   -37.366 1.00 40.44  ? 236  TRP B CH2 1 
ATOM   6054 N N   . ALA B 1 237 ? 18.431  3.850   -37.124 1.00 49.49  ? 237  ALA B N   1 
ATOM   6055 C CA  . ALA B 1 237 ? 18.009  4.402   -38.427 1.00 44.38  ? 237  ALA B CA  1 
ATOM   6056 C C   . ALA B 1 237 ? 19.113  4.629   -39.462 1.00 44.21  ? 237  ALA B C   1 
ATOM   6057 O O   . ALA B 1 237 ? 18.827  4.774   -40.657 1.00 53.71  ? 237  ALA B O   1 
ATOM   6058 C CB  . ALA B 1 237 ? 17.160  5.681   -38.247 1.00 42.14  ? 237  ALA B CB  1 
ATOM   6059 N N   . THR B 1 238 ? 20.365  4.639   -39.016 1.00 39.24  ? 238  THR B N   1 
ATOM   6060 C CA  . THR B 1 238 ? 21.504  4.784   -39.922 1.00 37.51  ? 238  THR B CA  1 
ATOM   6061 C C   . THR B 1 238 ? 22.630  3.842   -39.566 1.00 42.72  ? 238  THR B C   1 
ATOM   6062 O O   . THR B 1 238 ? 22.658  3.267   -38.494 1.00 48.03  ? 238  THR B O   1 
ATOM   6063 C CB  . THR B 1 238 ? 22.093  6.199   -39.876 1.00 36.94  ? 238  THR B CB  1 
ATOM   6064 O OG1 . THR B 1 238 ? 22.493  6.518   -38.529 1.00 41.24  ? 238  THR B OG1 1 
ATOM   6065 C CG2 . THR B 1 238 ? 21.067  7.192   -40.357 1.00 32.19  ? 238  THR B CG2 1 
ATOM   6066 N N   . VAL B 1 239 ? 23.571  3.702   -40.483 1.00 43.27  ? 239  VAL B N   1 
ATOM   6067 C CA  . VAL B 1 239 ? 24.812  3.031   -40.181 1.00 40.59  ? 239  VAL B CA  1 
ATOM   6068 C C   . VAL B 1 239 ? 25.940  3.861   -40.771 1.00 51.78  ? 239  VAL B C   1 
ATOM   6069 O O   . VAL B 1 239 ? 25.716  4.697   -41.668 1.00 43.61  ? 239  VAL B O   1 
ATOM   6070 C CB  . VAL B 1 239 ? 24.870  1.613   -40.771 1.00 38.66  ? 239  VAL B CB  1 
ATOM   6071 C CG1 . VAL B 1 239 ? 24.231  0.627   -39.830 1.00 38.55  ? 239  VAL B CG1 1 
ATOM   6072 C CG2 . VAL B 1 239 ? 24.202  1.576   -42.139 1.00 26.78  ? 239  VAL B CG2 1 
ATOM   6073 N N   . SER B 1 240 ? 27.145  3.627   -40.251 1.00 53.75  ? 240  SER B N   1 
ATOM   6074 C CA  . SER B 1 240 ? 28.340  4.299   -40.724 1.00 50.83  ? 240  SER B CA  1 
ATOM   6075 C C   . SER B 1 240 ? 28.644  3.654   -42.044 1.00 50.45  ? 240  SER B C   1 
ATOM   6076 O O   . SER B 1 240 ? 28.141  2.562   -42.312 1.00 51.38  ? 240  SER B O   1 
ATOM   6077 C CB  . SER B 1 240 ? 29.481  4.019   -39.777 1.00 56.90  ? 240  SER B CB  1 
ATOM   6078 O OG  . SER B 1 240 ? 29.665  2.619   -39.657 1.00 68.87  ? 240  SER B OG  1 
ATOM   6079 N N   . ALA B 1 241 ? 29.450  4.311   -42.873 1.00 47.00  ? 241  ALA B N   1 
ATOM   6080 C CA  . ALA B 1 241 ? 29.806  3.721   -44.167 1.00 52.36  ? 241  ALA B CA  1 
ATOM   6081 C C   . ALA B 1 241 ? 30.664  2.477   -43.965 1.00 63.83  ? 241  ALA B C   1 
ATOM   6082 O O   . ALA B 1 241 ? 30.620  1.537   -44.764 1.00 64.09  ? 241  ALA B O   1 
ATOM   6083 C CB  . ALA B 1 241 ? 30.510  4.729   -45.063 1.00 35.27  ? 241  ALA B CB  1 
ATOM   6084 N N   . GLY B 1 242 ? 31.437  2.486   -42.882 1.00 64.03  ? 242  GLY B N   1 
ATOM   6085 C CA  . GLY B 1 242 ? 32.233  1.342   -42.515 1.00 60.78  ? 242  GLY B CA  1 
ATOM   6086 C C   . GLY B 1 242 ? 31.371  0.140   -42.195 1.00 56.35  ? 242  GLY B C   1 
ATOM   6087 O O   . GLY B 1 242 ? 31.608  -0.952  -42.717 1.00 57.37  ? 242  GLY B O   1 
ATOM   6088 N N   . GLU B 1 243 ? 30.375  0.321   -41.334 1.00 49.20  ? 243  GLU B N   1 
ATOM   6089 C CA  . GLU B 1 243 ? 29.529  -0.818  -40.975 1.00 55.53  ? 243  GLU B CA  1 
ATOM   6090 C C   . GLU B 1 243 ? 28.671  -1.339  -42.143 1.00 53.91  ? 243  GLU B C   1 
ATOM   6091 O O   . GLU B 1 243 ? 28.288  -2.511  -42.154 1.00 56.37  ? 243  GLU B O   1 
ATOM   6092 C CB  . GLU B 1 243 ? 28.660  -0.539  -39.746 1.00 48.52  ? 243  GLU B CB  1 
ATOM   6093 C CG  . GLU B 1 243 ? 27.708  -1.695  -39.383 1.00 51.87  ? 243  GLU B CG  1 
ATOM   6094 C CD  . GLU B 1 243 ? 28.406  -2.912  -38.749 1.00 66.49  ? 243  GLU B CD  1 
ATOM   6095 O OE1 . GLU B 1 243 ? 27.685  -3.708  -38.102 1.00 71.97  ? 243  GLU B OE1 1 
ATOM   6096 O OE2 . GLU B 1 243 ? 29.650  -3.079  -38.888 1.00 64.72  ? 243  GLU B OE2 1 
ATOM   6097 N N   . ALA B 1 244 ? 28.385  -0.488  -43.127 1.00 47.71  ? 244  ALA B N   1 
ATOM   6098 C CA  . ALA B 1 244 ? 27.596  -0.920  -44.285 1.00 54.71  ? 244  ALA B CA  1 
ATOM   6099 C C   . ALA B 1 244 ? 28.481  -1.740  -45.195 1.00 55.16  ? 244  ALA B C   1 
ATOM   6100 O O   . ALA B 1 244 ? 28.108  -2.813  -45.641 1.00 55.67  ? 244  ALA B O   1 
ATOM   6101 C CB  . ALA B 1 244 ? 26.986  0.269   -45.037 1.00 45.22  ? 244  ALA B CB  1 
ATOM   6102 N N   . ARG B 1 245 ? 29.677  -1.232  -45.439 1.00 59.88  ? 245  ARG B N   1 
ATOM   6103 C CA  . ARG B 1 245 ? 30.654  -1.967  -46.209 1.00 62.23  ? 245  ARG B CA  1 
ATOM   6104 C C   . ARG B 1 245 ? 30.905  -3.357  -45.604 1.00 67.79  ? 245  ARG B C   1 
ATOM   6105 O O   . ARG B 1 245 ? 31.090  -4.353  -46.319 1.00 67.54  ? 245  ARG B O   1 
ATOM   6106 C CB  . ARG B 1 245 ? 31.958  -1.185  -46.292 1.00 50.43  ? 245  ARG B CB  1 
ATOM   6107 C CG  . ARG B 1 245 ? 33.029  -1.945  -47.060 1.00 47.40  ? 245  ARG B CG  1 
ATOM   6108 C CD  . ARG B 1 245 ? 34.118  -1.023  -47.476 1.00 48.80  ? 245  ARG B CD  1 
ATOM   6109 N NE  . ARG B 1 245 ? 33.731  -0.187  -48.602 1.00 59.63  ? 245  ARG B NE  1 
ATOM   6110 C CZ  . ARG B 1 245 ? 33.699  -0.620  -49.857 1.00 69.53  ? 245  ARG B CZ  1 
ATOM   6111 N NH1 . ARG B 1 245 ? 33.356  0.201   -50.844 1.00 73.23  ? 245  ARG B NH1 1 
ATOM   6112 N NH2 . ARG B 1 245 ? 34.009  -1.882  -50.122 1.00 68.82  ? 245  ARG B NH2 1 
ATOM   6113 N N   . ARG B 1 246 ? 30.906  -3.416  -44.281 1.00 66.02  ? 246  ARG B N   1 
ATOM   6114 C CA  . ARG B 1 246 ? 31.159  -4.666  -43.589 1.00 66.41  ? 246  ARG B CA  1 
ATOM   6115 C C   . ARG B 1 246 ? 30.001  -5.643  -43.833 1.00 66.75  ? 246  ARG B C   1 
ATOM   6116 O O   . ARG B 1 246 ? 30.228  -6.799  -44.187 1.00 68.76  ? 246  ARG B O   1 
ATOM   6117 C CB  . ARG B 1 246 ? 31.389  -4.403  -42.095 1.00 62.27  ? 246  ARG B CB  1 
ATOM   6118 C CG  . ARG B 1 246 ? 31.673  -5.634  -41.260 1.00 58.11  ? 246  ARG B CG  1 
ATOM   6119 C CD  . ARG B 1 246 ? 30.910  -5.571  -39.937 1.00 60.24  ? 246  ARG B CD  1 
ATOM   6120 N NE  . ARG B 1 246 ? 30.389  -6.886  -39.572 1.00 61.63  ? 246  ARG B NE  1 
ATOM   6121 C CZ  . ARG B 1 246 ? 29.158  -7.120  -39.122 1.00 65.71  ? 246  ARG B CZ  1 
ATOM   6122 N NH1 . ARG B 1 246 ? 28.291  -6.124  -38.980 1.00 60.73  ? 246  ARG B NH1 1 
ATOM   6123 N NH2 . ARG B 1 246 ? 28.787  -8.364  -38.821 1.00 70.17  ? 246  ARG B NH2 1 
ATOM   6124 N N   . ARG B 1 247 ? 28.763  -5.175  -43.682 1.00 57.09  ? 247  ARG B N   1 
ATOM   6125 C CA  . ARG B 1 247 ? 27.604  -6.055  -43.851 1.00 57.42  ? 247  ARG B CA  1 
ATOM   6126 C C   . ARG B 1 247 ? 27.379  -6.487  -45.301 1.00 58.62  ? 247  ARG B C   1 
ATOM   6127 O O   . ARG B 1 247 ? 26.964  -7.616  -45.555 1.00 62.87  ? 247  ARG B O   1 
ATOM   6128 C CB  . ARG B 1 247 ? 26.327  -5.409  -43.305 1.00 56.73  ? 247  ARG B CB  1 
ATOM   6129 C CG  . ARG B 1 247 ? 26.470  -4.774  -41.920 1.00 55.72  ? 247  ARG B CG  1 
ATOM   6130 C CD  . ARG B 1 247 ? 25.115  -4.411  -41.353 1.00 44.56  ? 247  ARG B CD  1 
ATOM   6131 N NE  . ARG B 1 247 ? 25.192  -3.717  -40.075 1.00 54.37  ? 247  ARG B NE  1 
ATOM   6132 C CZ  . ARG B 1 247 ? 24.127  -3.292  -39.398 1.00 60.36  ? 247  ARG B CZ  1 
ATOM   6133 N NH1 . ARG B 1 247 ? 22.904  -3.487  -39.890 1.00 50.35  ? 247  ARG B NH1 1 
ATOM   6134 N NH2 . ARG B 1 247 ? 24.282  -2.671  -38.229 1.00 59.69  ? 247  ARG B NH2 1 
ATOM   6135 N N   . ALA B 1 248 ? 27.640  -5.587  -46.246 1.00 56.35  ? 248  ALA B N   1 
ATOM   6136 C CA  . ALA B 1 248 ? 27.489  -5.894  -47.668 1.00 56.39  ? 248  ALA B CA  1 
ATOM   6137 C C   . ALA B 1 248 ? 28.470  -6.982  -48.068 1.00 66.97  ? 248  ALA B C   1 
ATOM   6138 O O   . ALA B 1 248 ? 28.132  -7.892  -48.821 1.00 62.93  ? 248  ALA B O   1 
ATOM   6139 C CB  . ALA B 1 248 ? 27.726  -4.665  -48.498 1.00 53.09  ? 248  ALA B CB  1 
ATOM   6140 N N   . THR B 1 249 ? 29.693  -6.881  -47.554 1.00 69.24  ? 249  THR B N   1 
ATOM   6141 C CA  . THR B 1 249 ? 30.697  -7.899  -47.788 1.00 66.87  ? 249  THR B CA  1 
ATOM   6142 C C   . THR B 1 249 ? 30.304  -9.215  -47.137 1.00 61.97  ? 249  THR B C   1 
ATOM   6143 O O   . THR B 1 249 ? 30.392  -10.282 -47.741 1.00 62.62  ? 249  THR B O   1 
ATOM   6144 C CB  . THR B 1 249 ? 32.050  -7.466  -47.238 1.00 71.18  ? 249  THR B CB  1 
ATOM   6145 O OG1 . THR B 1 249 ? 32.424  -6.218  -47.837 1.00 74.97  ? 249  THR B OG1 1 
ATOM   6146 C CG2 . THR B 1 249 ? 33.101  -8.527  -47.555 1.00 66.22  ? 249  THR B CG2 1 
ATOM   6147 N N   . LEU B 1 250 ? 29.870  -9.141  -45.890 1.00 65.90  ? 250  LEU B N   1 
ATOM   6148 C CA  . LEU B 1 250 ? 29.460  -10.346 -45.183 1.00 69.77  ? 250  LEU B CA  1 
ATOM   6149 C C   . LEU B 1 250 ? 28.339  -11.083 -45.919 1.00 69.57  ? 250  LEU B C   1 
ATOM   6150 O O   . LEU B 1 250 ? 28.349  -12.318 -46.035 1.00 69.87  ? 250  LEU B O   1 
ATOM   6151 C CB  . LEU B 1 250 ? 29.017  -10.027 -43.755 1.00 59.23  ? 250  LEU B CB  1 
ATOM   6152 C CG  . LEU B 1 250 ? 28.668  -11.321 -43.028 1.00 51.81  ? 250  LEU B CG  1 
ATOM   6153 C CD1 . LEU B 1 250 ? 29.842  -12.317 -43.188 1.00 52.64  ? 250  LEU B CD1 1 
ATOM   6154 C CD2 . LEU B 1 250 ? 28.328  -11.074 -41.580 1.00 36.48  ? 250  LEU B CD2 1 
ATOM   6155 N N   . LEU B 1 251 ? 27.367  -10.323 -46.406 1.00 61.88  ? 251  LEU B N   1 
ATOM   6156 C CA  . LEU B 1 251 ? 26.248  -10.936 -47.089 1.00 62.25  ? 251  LEU B CA  1 
ATOM   6157 C C   . LEU B 1 251 ? 26.707  -11.584 -48.400 1.00 65.37  ? 251  LEU B C   1 
ATOM   6158 O O   . LEU B 1 251 ? 26.264  -12.682 -48.751 1.00 62.52  ? 251  LEU B O   1 
ATOM   6159 C CB  . LEU B 1 251 ? 25.137  -9.917  -47.335 1.00 56.70  ? 251  LEU B CB  1 
ATOM   6160 C CG  . LEU B 1 251 ? 24.053  -10.528 -48.218 1.00 54.47  ? 251  LEU B CG  1 
ATOM   6161 C CD1 . LEU B 1 251 ? 23.085  -11.378 -47.392 1.00 50.33  ? 251  LEU B CD1 1 
ATOM   6162 C CD2 . LEU B 1 251 ? 23.346  -9.449  -48.967 1.00 53.56  ? 251  LEU B CD2 1 
ATOM   6163 N N   . ALA B 1 252 ? 27.601  -10.901 -49.112 1.00 63.55  ? 252  ALA B N   1 
ATOM   6164 C CA  . ALA B 1 252 ? 28.156  -11.420 -50.351 1.00 66.77  ? 252  ALA B CA  1 
ATOM   6165 C C   . ALA B 1 252 ? 28.970  -12.689 -50.110 1.00 63.86  ? 252  ALA B C   1 
ATOM   6166 O O   . ALA B 1 252 ? 28.970  -13.590 -50.939 1.00 59.95  ? 252  ALA B O   1 
ATOM   6167 C CB  . ALA B 1 252 ? 29.010  -10.378 -51.017 1.00 74.53  ? 252  ALA B CB  1 
ATOM   6168 N N   . ARG B 1 253 ? 29.676  -12.754 -48.986 1.00 64.72  ? 253  ARG B N   1 
ATOM   6169 C CA  . ARG B 1 253 ? 30.360  -13.990 -48.631 1.00 75.77  ? 253  ARG B CA  1 
ATOM   6170 C C   . ARG B 1 253 ? 29.310  -15.072 -48.378 1.00 71.10  ? 253  ARG B C   1 
ATOM   6171 O O   . ARG B 1 253 ? 29.401  -16.178 -48.907 1.00 66.66  ? 253  ARG B O   1 
ATOM   6172 C CB  . ARG B 1 253 ? 31.272  -13.806 -47.413 1.00 77.72  ? 253  ARG B CB  1 
ATOM   6173 C CG  . ARG B 1 253 ? 31.707  -15.110 -46.752 1.00 80.17  ? 253  ARG B CG  1 
ATOM   6174 C CD  . ARG B 1 253 ? 32.263  -14.888 -45.345 1.00 94.24  ? 253  ARG B CD  1 
ATOM   6175 N NE  . ARG B 1 253 ? 32.176  -16.092 -44.508 1.00 105.80 ? 253  ARG B NE  1 
ATOM   6176 C CZ  . ARG B 1 253 ? 32.347  -16.104 -43.186 1.00 106.84 ? 253  ARG B CZ  1 
ATOM   6177 N NH1 . ARG B 1 253 ? 32.618  -14.977 -42.535 1.00 100.42 ? 253  ARG B NH1 1 
ATOM   6178 N NH2 . ARG B 1 253 ? 32.246  -17.243 -42.512 1.00 110.58 ? 253  ARG B NH2 1 
ATOM   6179 N N   . LEU B 1 254 ? 28.300  -14.732 -47.587 1.00 63.99  ? 254  LEU B N   1 
ATOM   6180 C CA  . LEU B 1 254 ? 27.197  -15.649 -47.289 1.00 66.15  ? 254  LEU B CA  1 
ATOM   6181 C C   . LEU B 1 254 ? 26.470  -16.279 -48.494 1.00 69.60  ? 254  LEU B C   1 
ATOM   6182 O O   . LEU B 1 254 ? 25.914  -17.371 -48.366 1.00 69.80  ? 254  LEU B O   1 
ATOM   6183 C CB  . LEU B 1 254 ? 26.173  -14.949 -46.402 1.00 60.50  ? 254  LEU B CB  1 
ATOM   6184 C CG  . LEU B 1 254 ? 26.551  -14.918 -44.935 1.00 60.58  ? 254  LEU B CG  1 
ATOM   6185 C CD1 . LEU B 1 254 ? 25.625  -13.990 -44.164 1.00 59.69  ? 254  LEU B CD1 1 
ATOM   6186 C CD2 . LEU B 1 254 ? 26.480  -16.342 -44.417 1.00 58.87  ? 254  LEU B CD2 1 
ATOM   6187 N N   . VAL B 1 255 ? 26.445  -15.596 -49.640 1.00 59.10  ? 255  VAL B N   1 
ATOM   6188 C CA  . VAL B 1 255 ? 25.747  -16.132 -50.808 1.00 59.79  ? 255  VAL B CA  1 
ATOM   6189 C C   . VAL B 1 255 ? 26.656  -16.556 -51.971 1.00 71.17  ? 255  VAL B C   1 
ATOM   6190 O O   . VAL B 1 255 ? 26.158  -16.914 -53.038 1.00 80.41  ? 255  VAL B O   1 
ATOM   6191 C CB  . VAL B 1 255 ? 24.672  -15.144 -51.372 1.00 55.75  ? 255  VAL B CB  1 
ATOM   6192 C CG1 . VAL B 1 255 ? 23.569  -14.866 -50.339 1.00 46.52  ? 255  VAL B CG1 1 
ATOM   6193 C CG2 . VAL B 1 255 ? 25.315  -13.859 -51.875 1.00 49.10  ? 255  VAL B CG2 1 
ATOM   6194 N N   . GLY B 1 256 ? 27.974  -16.476 -51.787 1.00 69.13  ? 256  GLY B N   1 
ATOM   6195 C CA  . GLY B 1 256 ? 28.914  -16.969 -52.780 1.00 69.04  ? 256  GLY B CA  1 
ATOM   6196 C C   . GLY B 1 256 ? 29.762  -15.984 -53.580 1.00 74.23  ? 256  GLY B C   1 
ATOM   6197 O O   . GLY B 1 256 ? 30.322  -16.351 -54.611 1.00 76.30  ? 256  GLY B O   1 
ATOM   6198 N N   . CYS B 1 257 ? 29.916  -14.754 -53.111 1.00 75.93  ? 257  CYS B N   1 
ATOM   6199 C CA  . CYS B 1 257 ? 30.582  -13.750 -53.933 1.00 79.32  ? 257  CYS B CA  1 
ATOM   6200 C C   . CYS B 1 257 ? 31.922  -13.228 -53.393 1.00 80.69  ? 257  CYS B C   1 
ATOM   6201 O O   . CYS B 1 257 ? 32.992  -13.578 -53.914 1.00 79.00  ? 257  CYS B O   1 
ATOM   6202 C CB  . CYS B 1 257 ? 29.602  -12.610 -54.206 1.00 84.85  ? 257  CYS B CB  1 
ATOM   6203 S SG  . CYS B 1 257 ? 27.993  -13.182 -54.899 1.00 93.12  ? 257  CYS B SG  1 
ATOM   6204 N N   . ASN B 1 265 ? 37.658  -6.513  -54.995 1.00 105.09 ? 265  ASN B N   1 
ATOM   6205 C CA  . ASN B 1 265 ? 37.228  -5.204  -55.498 1.00 110.34 ? 265  ASN B CA  1 
ATOM   6206 C C   . ASN B 1 265 ? 35.701  -5.090  -55.684 1.00 103.20 ? 265  ASN B C   1 
ATOM   6207 O O   . ASN B 1 265 ? 35.026  -6.097  -55.879 1.00 104.52 ? 265  ASN B O   1 
ATOM   6208 C CB  . ASN B 1 265 ? 38.000  -4.835  -56.780 1.00 114.02 ? 265  ASN B CB  1 
ATOM   6209 C CG  . ASN B 1 265 ? 37.149  -4.918  -58.046 1.00 112.88 ? 265  ASN B CG  1 
ATOM   6210 O OD1 . ASN B 1 265 ? 36.143  -5.625  -58.102 1.00 111.25 ? 265  ASN B OD1 1 
ATOM   6211 N ND2 . ASN B 1 265 ? 37.566  -4.191  -59.077 1.00 112.25 ? 265  ASN B ND2 1 
ATOM   6212 N N   . ASP B 1 266 ? 35.168  -3.868  -55.630 1.00 92.22  ? 266  ASP B N   1 
ATOM   6213 C CA  . ASP B 1 266 ? 33.713  -3.647  -55.580 1.00 86.03  ? 266  ASP B CA  1 
ATOM   6214 C C   . ASP B 1 266 ? 32.889  -4.136  -56.771 1.00 82.46  ? 266  ASP B C   1 
ATOM   6215 O O   . ASP B 1 266 ? 31.940  -4.899  -56.608 1.00 68.76  ? 266  ASP B O   1 
ATOM   6216 C CB  . ASP B 1 266 ? 33.410  -2.169  -55.354 1.00 83.63  ? 266  ASP B CB  1 
ATOM   6217 C CG  . ASP B 1 266 ? 33.518  -1.780  -53.903 1.00 88.82  ? 266  ASP B CG  1 
ATOM   6218 O OD1 . ASP B 1 266 ? 33.788  -2.681  -53.076 1.00 88.65  ? 266  ASP B OD1 1 
ATOM   6219 O OD2 . ASP B 1 266 ? 33.335  -0.582  -53.588 1.00 88.55  ? 266  ASP B OD2 1 
ATOM   6220 N N   . THR B 1 267 ? 33.243  -3.661  -57.960 1.00 87.16  ? 267  THR B N   1 
ATOM   6221 C CA  . THR B 1 267 ? 32.485  -3.948  -59.171 1.00 80.92  ? 267  THR B CA  1 
ATOM   6222 C C   . THR B 1 267 ? 32.219  -5.428  -59.333 1.00 79.81  ? 267  THR B C   1 
ATOM   6223 O O   . THR B 1 267 ? 31.100  -5.852  -59.657 1.00 70.74  ? 267  THR B O   1 
ATOM   6224 C CB  . THR B 1 267 ? 33.254  -3.510  -60.410 1.00 77.19  ? 267  THR B CB  1 
ATOM   6225 O OG1 . THR B 1 267 ? 33.709  -2.165  -60.240 1.00 84.61  ? 267  THR B OG1 1 
ATOM   6226 C CG2 . THR B 1 267 ? 32.371  -3.605  -61.632 1.00 65.96  ? 267  THR B CG2 1 
ATOM   6227 N N   . GLU B 1 268 ? 33.267  -6.217  -59.130 1.00 85.12  ? 268  GLU B N   1 
ATOM   6228 C CA  . GLU B 1 268 ? 33.153  -7.653  -59.321 1.00 84.14  ? 268  GLU B CA  1 
ATOM   6229 C C   . GLU B 1 268 ? 32.166  -8.219  -58.301 1.00 77.38  ? 268  GLU B C   1 
ATOM   6230 O O   . GLU B 1 268 ? 31.339  -9.071  -58.629 1.00 74.23  ? 268  GLU B O   1 
ATOM   6231 C CB  . GLU B 1 268 ? 34.527  -8.343  -59.253 1.00 78.15  ? 268  GLU B CB  1 
ATOM   6232 N N   . LEU B 1 269 ? 32.220  -7.707  -57.076 1.00 70.58  ? 269  LEU B N   1 
ATOM   6233 C CA  . LEU B 1 269 ? 31.364  -8.226  -56.013 1.00 65.15  ? 269  LEU B CA  1 
ATOM   6234 C C   . LEU B 1 269 ? 29.868  -7.905  -56.211 1.00 69.93  ? 269  LEU B C   1 
ATOM   6235 O O   . LEU B 1 269 ? 29.009  -8.785  -56.073 1.00 67.75  ? 269  LEU B O   1 
ATOM   6236 C CB  . LEU B 1 269 ? 31.873  -7.774  -54.643 1.00 56.31  ? 269  LEU B CB  1 
ATOM   6237 C CG  . LEU B 1 269 ? 31.068  -8.271  -53.448 1.00 59.27  ? 269  LEU B CG  1 
ATOM   6238 C CD1 . LEU B 1 269 ? 31.923  -8.423  -52.220 1.00 58.14  ? 269  LEU B CD1 1 
ATOM   6239 C CD2 . LEU B 1 269 ? 29.896  -7.322  -53.175 1.00 55.99  ? 269  LEU B CD2 1 
ATOM   6240 N N   . ILE B 1 270 ? 29.559  -6.654  -56.541 1.00 70.27  ? 270  ILE B N   1 
ATOM   6241 C CA  . ILE B 1 270 ? 28.182  -6.258  -56.818 1.00 66.89  ? 270  ILE B CA  1 
ATOM   6242 C C   . ILE B 1 270 ? 27.643  -7.002  -58.034 1.00 68.21  ? 270  ILE B C   1 
ATOM   6243 O O   . ILE B 1 270 ? 26.449  -7.308  -58.123 1.00 65.63  ? 270  ILE B O   1 
ATOM   6244 C CB  . ILE B 1 270 ? 28.096  -4.753  -57.074 1.00 63.53  ? 270  ILE B CB  1 
ATOM   6245 C CG1 . ILE B 1 270 ? 28.421  -4.002  -55.792 1.00 66.25  ? 270  ILE B CG1 1 
ATOM   6246 C CG2 . ILE B 1 270 ? 26.714  -4.356  -57.588 1.00 56.89  ? 270  ILE B CG2 1 
ATOM   6247 C CD1 . ILE B 1 270 ? 29.129  -2.706  -56.032 1.00 72.78  ? 270  ILE B CD1 1 
ATOM   6248 N N   . ALA B 1 271 ? 28.535  -7.288  -58.974 1.00 69.90  ? 271  ALA B N   1 
ATOM   6249 C CA  . ALA B 1 271 ? 28.162  -8.018  -60.174 1.00 66.41  ? 271  ALA B CA  1 
ATOM   6250 C C   . ALA B 1 271 ? 27.556  -9.368  -59.818 1.00 64.10  ? 271  ALA B C   1 
ATOM   6251 O O   . ALA B 1 271 ? 26.475  -9.717  -60.284 1.00 56.94  ? 271  ALA B O   1 
ATOM   6252 C CB  . ALA B 1 271 ? 29.361  -8.202  -61.048 1.00 60.05  ? 271  ALA B CB  1 
ATOM   6253 N N   . CYS B 1 272 ? 28.261  -10.121 -58.983 1.00 70.15  ? 272  CYS B N   1 
ATOM   6254 C CA  . CYS B 1 272 ? 27.808  -11.451 -58.578 1.00 68.96  ? 272  CYS B CA  1 
ATOM   6255 C C   . CYS B 1 272 ? 26.498  -11.394 -57.787 1.00 68.84  ? 272  CYS B C   1 
ATOM   6256 O O   . CYS B 1 272 ? 25.616  -12.241 -57.971 1.00 71.22  ? 272  CYS B O   1 
ATOM   6257 C CB  . CYS B 1 272 ? 28.915  -12.190 -57.798 1.00 57.05  ? 272  CYS B CB  1 
ATOM   6258 S SG  . CYS B 1 272 ? 28.390  -13.648 -56.859 1.00 82.34  ? 272  CYS B SG  1 
ATOM   6259 N N   . LEU B 1 273 ? 26.372  -10.401 -56.908 1.00 61.96  ? 273  LEU B N   1 
ATOM   6260 C CA  . LEU B 1 273 ? 25.115  -10.198 -56.182 1.00 57.37  ? 273  LEU B CA  1 
ATOM   6261 C C   . LEU B 1 273 ? 23.955  -9.976  -57.166 1.00 56.84  ? 273  LEU B C   1 
ATOM   6262 O O   . LEU B 1 273 ? 22.847  -10.477 -56.959 1.00 58.36  ? 273  LEU B O   1 
ATOM   6263 C CB  . LEU B 1 273 ? 25.218  -9.046  -55.165 1.00 45.68  ? 273  LEU B CB  1 
ATOM   6264 C CG  . LEU B 1 273 ? 25.961  -9.313  -53.850 1.00 49.23  ? 273  LEU B CG  1 
ATOM   6265 C CD1 . LEU B 1 273 ? 26.260  -8.039  -53.104 1.00 47.82  ? 273  LEU B CD1 1 
ATOM   6266 C CD2 . LEU B 1 273 ? 25.210  -10.265 -52.941 1.00 53.73  ? 273  LEU B CD2 1 
ATOM   6267 N N   . ARG B 1 274 ? 24.223  -9.254  -58.248 1.00 50.26  ? 274  ARG B N   1 
ATOM   6268 C CA  . ARG B 1 274 ? 23.201  -9.036  -59.266 1.00 54.17  ? 274  ARG B CA  1 
ATOM   6269 C C   . ARG B 1 274 ? 22.684  -10.324 -59.919 1.00 54.41  ? 274  ARG B C   1 
ATOM   6270 O O   . ARG B 1 274 ? 21.562  -10.360 -60.448 1.00 56.59  ? 274  ARG B O   1 
ATOM   6271 C CB  . ARG B 1 274 ? 23.674  -8.032  -60.312 1.00 52.77  ? 274  ARG B CB  1 
ATOM   6272 C CG  . ARG B 1 274 ? 23.605  -6.616  -59.822 1.00 54.07  ? 274  ARG B CG  1 
ATOM   6273 C CD  . ARG B 1 274 ? 23.534  -5.699  -60.971 1.00 62.53  ? 274  ARG B CD  1 
ATOM   6274 N NE  . ARG B 1 274 ? 24.864  -5.464  -61.493 1.00 73.77  ? 274  ARG B NE  1 
ATOM   6275 C CZ  . ARG B 1 274 ? 25.543  -4.346  -61.280 1.00 90.84  ? 274  ARG B CZ  1 
ATOM   6276 N NH1 . ARG B 1 274 ? 25.006  -3.356  -60.555 1.00 84.51  ? 274  ARG B NH1 1 
ATOM   6277 N NH2 . ARG B 1 274 ? 26.761  -4.224  -61.794 1.00 100.78 ? 274  ARG B NH2 1 
ATOM   6278 N N   . THR B 1 275 ? 23.482  -11.386 -59.852 1.00 51.51  ? 275  THR B N   1 
ATOM   6279 C CA  . THR B 1 275 ? 23.092  -12.668 -60.444 1.00 55.26  ? 275  THR B CA  1 
ATOM   6280 C C   . THR B 1 275 ? 22.165  -13.459 -59.532 1.00 60.77  ? 275  THR B C   1 
ATOM   6281 O O   . THR B 1 275 ? 21.367  -14.260 -60.004 1.00 63.57  ? 275  THR B O   1 
ATOM   6282 C CB  . THR B 1 275 ? 24.310  -13.569 -60.807 1.00 58.52  ? 275  THR B CB  1 
ATOM   6283 O OG1 . THR B 1 275 ? 24.879  -14.145 -59.614 1.00 63.40  ? 275  THR B OG1 1 
ATOM   6284 C CG2 . THR B 1 275 ? 25.371  -12.785 -61.598 1.00 46.05  ? 275  THR B CG2 1 
ATOM   6285 N N   . ARG B 1 276 ? 22.262  -13.238 -58.227 1.00 56.11  ? 276  ARG B N   1 
ATOM   6286 C CA  . ARG B 1 276 ? 21.467  -14.022 -57.292 1.00 60.05  ? 276  ARG B CA  1 
ATOM   6287 C C   . ARG B 1 276 ? 19.964  -13.716 -57.350 1.00 55.11  ? 276  ARG B C   1 
ATOM   6288 O O   . ARG B 1 276 ? 19.577  -12.552 -57.414 1.00 54.10  ? 276  ARG B O   1 
ATOM   6289 C CB  . ARG B 1 276 ? 22.009  -13.822 -55.882 1.00 63.14  ? 276  ARG B CB  1 
ATOM   6290 C CG  . ARG B 1 276 ? 23.443  -14.278 -55.731 1.00 64.98  ? 276  ARG B CG  1 
ATOM   6291 C CD  . ARG B 1 276 ? 23.500  -15.752 -55.411 1.00 66.08  ? 276  ARG B CD  1 
ATOM   6292 N NE  . ARG B 1 276 ? 24.875  -16.231 -55.373 1.00 76.51  ? 276  ARG B NE  1 
ATOM   6293 C CZ  . ARG B 1 276 ? 25.602  -16.465 -56.459 1.00 73.45  ? 276  ARG B CZ  1 
ATOM   6294 N NH1 . ARG B 1 276 ? 25.072  -16.244 -57.658 1.00 75.00  ? 276  ARG B NH1 1 
ATOM   6295 N NH2 . ARG B 1 276 ? 26.853  -16.906 -56.349 1.00 62.54  ? 276  ARG B NH2 1 
ATOM   6296 N N   . PRO B 1 277 ? 19.121  -14.763 -57.335 1.00 53.12  ? 277  PRO B N   1 
ATOM   6297 C CA  . PRO B 1 277 ? 17.668  -14.609 -57.199 1.00 56.70  ? 277  PRO B CA  1 
ATOM   6298 C C   . PRO B 1 277 ? 17.333  -13.839 -55.927 1.00 57.45  ? 277  PRO B C   1 
ATOM   6299 O O   . PRO B 1 277 ? 18.065  -13.939 -54.945 1.00 61.33  ? 277  PRO B O   1 
ATOM   6300 C CB  . PRO B 1 277 ? 17.158  -16.057 -57.066 1.00 55.40  ? 277  PRO B CB  1 
ATOM   6301 C CG  . PRO B 1 277 ? 18.205  -16.894 -57.651 1.00 50.51  ? 277  PRO B CG  1 
ATOM   6302 C CD  . PRO B 1 277 ? 19.515  -16.183 -57.395 1.00 53.52  ? 277  PRO B CD  1 
ATOM   6303 N N   . ALA B 1 278 ? 16.239  -13.087 -55.938 1.00 54.72  ? 278  ALA B N   1 
ATOM   6304 C CA  . ALA B 1 278 ? 15.906  -12.233 -54.798 1.00 49.40  ? 278  ALA B CA  1 
ATOM   6305 C C   . ALA B 1 278 ? 15.764  -12.983 -53.460 1.00 56.61  ? 278  ALA B C   1 
ATOM   6306 O O   . ALA B 1 278 ? 16.154  -12.463 -52.406 1.00 51.70  ? 278  ALA B O   1 
ATOM   6307 C CB  . ALA B 1 278 ? 14.658  -11.450 -55.086 1.00 37.74  ? 278  ALA B CB  1 
ATOM   6308 N N   . GLN B 1 279 ? 15.205  -14.192 -53.495 1.00 59.73  ? 279  GLN B N   1 
ATOM   6309 C CA  . GLN B 1 279 ? 14.972  -14.917 -52.254 1.00 55.65  ? 279  GLN B CA  1 
ATOM   6310 C C   . GLN B 1 279 ? 16.276  -15.282 -51.572 1.00 51.31  ? 279  GLN B C   1 
ATOM   6311 O O   . GLN B 1 279 ? 16.322  -15.391 -50.352 1.00 47.93  ? 279  GLN B O   1 
ATOM   6312 C CB  . GLN B 1 279 ? 14.096  -16.157 -52.446 1.00 50.21  ? 279  GLN B CB  1 
ATOM   6313 C CG  . GLN B 1 279 ? 13.578  -16.708 -51.116 1.00 49.96  ? 279  GLN B CG  1 
ATOM   6314 C CD  . GLN B 1 279 ? 13.021  -15.627 -50.175 1.00 54.94  ? 279  GLN B CD  1 
ATOM   6315 O OE1 . GLN B 1 279 ? 12.365  -14.675 -50.607 1.00 58.07  ? 279  GLN B OE1 1 
ATOM   6316 N NE2 . GLN B 1 279 ? 13.277  -15.782 -48.883 1.00 52.75  ? 279  GLN B NE2 1 
ATOM   6317 N N   . ASP B 1 280 ? 17.342  -15.429 -52.352 1.00 51.17  ? 280  ASP B N   1 
ATOM   6318 C CA  . ASP B 1 280 ? 18.641  -15.787 -51.782 1.00 51.36  ? 280  ASP B CA  1 
ATOM   6319 C C   . ASP B 1 280 ? 19.197  -14.652 -50.945 1.00 53.86  ? 280  ASP B C   1 
ATOM   6320 O O   . ASP B 1 280 ? 19.726  -14.887 -49.876 1.00 56.32  ? 280  ASP B O   1 
ATOM   6321 C CB  . ASP B 1 280 ? 19.627  -16.221 -52.868 1.00 61.93  ? 280  ASP B CB  1 
ATOM   6322 C CG  . ASP B 1 280 ? 19.205  -17.516 -53.543 1.00 79.33  ? 280  ASP B CG  1 
ATOM   6323 O OD1 . ASP B 1 280 ? 18.254  -18.146 -53.032 1.00 89.67  ? 280  ASP B OD1 1 
ATOM   6324 O OD2 . ASP B 1 280 ? 19.804  -17.904 -54.575 1.00 81.79  ? 280  ASP B OD2 1 
ATOM   6325 N N   . LEU B 1 281 ? 19.060  -13.413 -51.405 1.00 62.44  ? 281  LEU B N   1 
ATOM   6326 C CA  . LEU B 1 281 ? 19.520  -12.280 -50.596 1.00 56.94  ? 281  LEU B CA  1 
ATOM   6327 C C   . LEU B 1 281 ? 18.668  -12.142 -49.332 1.00 53.00  ? 281  LEU B C   1 
ATOM   6328 O O   . LEU B 1 281 ? 19.195  -12.084 -48.224 1.00 45.07  ? 281  LEU B O   1 
ATOM   6329 C CB  . LEU B 1 281 ? 19.559  -10.985 -51.412 1.00 50.76  ? 281  LEU B CB  1 
ATOM   6330 C CG  . LEU B 1 281 ? 20.393  -11.127 -52.690 1.00 46.82  ? 281  LEU B CG  1 
ATOM   6331 C CD1 . LEU B 1 281 ? 20.548  -9.826  -53.436 1.00 39.23  ? 281  LEU B CD1 1 
ATOM   6332 C CD2 . LEU B 1 281 ? 21.747  -11.719 -52.363 1.00 50.62  ? 281  LEU B CD2 1 
ATOM   6333 N N   . VAL B 1 282 ? 17.349  -12.133 -49.492 1.00 56.27  ? 282  VAL B N   1 
ATOM   6334 C CA  . VAL B 1 282 ? 16.456  -12.099 -48.335 1.00 55.78  ? 282  VAL B CA  1 
ATOM   6335 C C   . VAL B 1 282 ? 16.737  -13.240 -47.333 1.00 61.11  ? 282  VAL B C   1 
ATOM   6336 O O   . VAL B 1 282 ? 16.687  -13.040 -46.121 1.00 56.35  ? 282  VAL B O   1 
ATOM   6337 C CB  . VAL B 1 282 ? 14.998  -12.094 -48.780 1.00 48.29  ? 282  VAL B CB  1 
ATOM   6338 C CG1 . VAL B 1 282 ? 14.084  -12.412 -47.626 1.00 51.80  ? 282  VAL B CG1 1 
ATOM   6339 C CG2 . VAL B 1 282 ? 14.667  -10.752 -49.361 1.00 47.65  ? 282  VAL B CG2 1 
ATOM   6340 N N   . ASP B 1 283 ? 17.068  -14.424 -47.840 1.00 65.04  ? 283  ASP B N   1 
ATOM   6341 C CA  . ASP B 1 283 ? 17.427  -15.559 -46.980 1.00 69.03  ? 283  ASP B CA  1 
ATOM   6342 C C   . ASP B 1 283 ? 18.580  -15.268 -46.010 1.00 61.90  ? 283  ASP B C   1 
ATOM   6343 O O   . ASP B 1 283 ? 18.606  -15.792 -44.895 1.00 58.29  ? 283  ASP B O   1 
ATOM   6344 C CB  . ASP B 1 283 ? 17.747  -16.817 -47.814 1.00 72.35  ? 283  ASP B CB  1 
ATOM   6345 C CG  . ASP B 1 283 ? 16.496  -17.573 -48.247 1.00 72.60  ? 283  ASP B CG  1 
ATOM   6346 O OD1 . ASP B 1 283 ? 15.427  -17.321 -47.662 1.00 79.37  ? 283  ASP B OD1 1 
ATOM   6347 O OD2 . ASP B 1 283 ? 16.576  -18.417 -49.168 1.00 72.99  ? 283  ASP B OD2 1 
ATOM   6348 N N   . HIS B 1 284 ? 19.529  -14.438 -46.426 1.00 58.13  ? 284  HIS B N   1 
ATOM   6349 C CA  . HIS B 1 284 ? 20.696  -14.165 -45.586 1.00 61.56  ? 284  HIS B CA  1 
ATOM   6350 C C   . HIS B 1 284 ? 20.764  -12.759 -45.014 1.00 57.11  ? 284  HIS B C   1 
ATOM   6351 O O   . HIS B 1 284 ? 21.634  -12.473 -44.213 1.00 52.85  ? 284  HIS B O   1 
ATOM   6352 C CB  . HIS B 1 284 ? 21.980  -14.480 -46.351 1.00 67.67  ? 284  HIS B CB  1 
ATOM   6353 C CG  . HIS B 1 284 ? 22.201  -15.943 -46.551 1.00 71.56  ? 284  HIS B CG  1 
ATOM   6354 N ND1 . HIS B 1 284 ? 22.478  -16.798 -45.505 1.00 80.37  ? 284  HIS B ND1 1 
ATOM   6355 C CD2 . HIS B 1 284 ? 22.156  -16.706 -47.666 1.00 66.74  ? 284  HIS B CD2 1 
ATOM   6356 C CE1 . HIS B 1 284 ? 22.603  -18.026 -45.971 1.00 83.87  ? 284  HIS B CE1 1 
ATOM   6357 N NE2 . HIS B 1 284 ? 22.413  -17.998 -47.278 1.00 78.89  ? 284  HIS B NE2 1 
ATOM   6358 N N   . GLU B 1 285 ? 19.852  -11.900 -45.464 1.00 63.39  ? 285  GLU B N   1 
ATOM   6359 C CA  . GLU B 1 285 ? 19.699  -10.511 -45.029 1.00 55.01  ? 285  GLU B CA  1 
ATOM   6360 C C   . GLU B 1 285 ? 20.008  -10.319 -43.536 1.00 60.16  ? 285  GLU B C   1 
ATOM   6361 O O   . GLU B 1 285 ? 20.791  -9.444  -43.150 1.00 51.52  ? 285  GLU B O   1 
ATOM   6362 C CB  . GLU B 1 285 ? 18.241  -10.126 -45.290 1.00 48.18  ? 285  GLU B CB  1 
ATOM   6363 C CG  . GLU B 1 285 ? 17.914  -8.655  -45.431 1.00 48.64  ? 285  GLU B CG  1 
ATOM   6364 C CD  . GLU B 1 285 ? 16.543  -8.456  -46.035 1.00 62.87  ? 285  GLU B CD  1 
ATOM   6365 O OE1 . GLU B 1 285 ? 15.528  -8.658  -45.314 1.00 52.85  ? 285  GLU B OE1 1 
ATOM   6366 O OE2 . GLU B 1 285 ? 16.492  -8.123  -47.252 1.00 81.51  ? 285  GLU B OE2 1 
ATOM   6367 N N   . TRP B 1 286 ? 19.392  -11.166 -42.714 1.00 64.82  ? 286  TRP B N   1 
ATOM   6368 C CA  . TRP B 1 286 ? 19.313  -10.963 -41.278 1.00 65.55  ? 286  TRP B CA  1 
ATOM   6369 C C   . TRP B 1 286 ? 20.478  -11.613 -40.522 1.00 73.46  ? 286  TRP B C   1 
ATOM   6370 O O   . TRP B 1 286 ? 20.701  -11.330 -39.344 1.00 82.09  ? 286  TRP B O   1 
ATOM   6371 C CB  . TRP B 1 286 ? 17.955  -11.474 -40.785 1.00 72.09  ? 286  TRP B CB  1 
ATOM   6372 C CG  . TRP B 1 286 ? 17.494  -10.911 -39.470 1.00 88.12  ? 286  TRP B CG  1 
ATOM   6373 C CD1 . TRP B 1 286 ? 18.044  -9.867  -38.775 1.00 91.80  ? 286  TRP B CD1 1 
ATOM   6374 C CD2 . TRP B 1 286 ? 16.353  -11.338 -38.708 1.00 98.86  ? 286  TRP B CD2 1 
ATOM   6375 N NE1 . TRP B 1 286 ? 17.333  -9.637  -37.614 1.00 89.74  ? 286  TRP B NE1 1 
ATOM   6376 C CE2 . TRP B 1 286 ? 16.292  -10.525 -37.550 1.00 97.78  ? 286  TRP B CE2 1 
ATOM   6377 C CE3 . TRP B 1 286 ? 15.378  -12.328 -38.889 1.00 103.17 ? 286  TRP B CE3 1 
ATOM   6378 C CZ2 . TRP B 1 286 ? 15.301  -10.684 -36.575 1.00 105.70 ? 286  TRP B CZ2 1 
ATOM   6379 C CZ3 . TRP B 1 286 ? 14.394  -12.485 -37.919 1.00 105.07 ? 286  TRP B CZ3 1 
ATOM   6380 C CH2 . TRP B 1 286 ? 14.368  -11.672 -36.774 1.00 106.65 ? 286  TRP B CH2 1 
ATOM   6381 N N   . HIS B 1 287 ? 21.243  -12.465 -41.193 1.00 73.92  ? 287  HIS B N   1 
ATOM   6382 C CA  . HIS B 1 287 ? 22.390  -13.086 -40.534 1.00 74.54  ? 287  HIS B CA  1 
ATOM   6383 C C   . HIS B 1 287 ? 23.605  -12.163 -40.446 1.00 79.64  ? 287  HIS B C   1 
ATOM   6384 O O   . HIS B 1 287 ? 24.693  -12.630 -40.134 1.00 86.75  ? 287  HIS B O   1 
ATOM   6385 C CB  . HIS B 1 287 ? 22.824  -14.393 -41.220 1.00 78.80  ? 287  HIS B CB  1 
ATOM   6386 C CG  . HIS B 1 287 ? 21.745  -15.426 -41.323 1.00 86.63  ? 287  HIS B CG  1 
ATOM   6387 N ND1 . HIS B 1 287 ? 20.623  -15.421 -40.523 1.00 90.40  ? 287  HIS B ND1 1 
ATOM   6388 C CD2 . HIS B 1 287 ? 21.634  -16.517 -42.120 1.00 88.34  ? 287  HIS B CD2 1 
ATOM   6389 C CE1 . HIS B 1 287 ? 19.854  -16.450 -40.836 1.00 90.25  ? 287  HIS B CE1 1 
ATOM   6390 N NE2 . HIS B 1 287 ? 20.449  -17.134 -41.798 1.00 91.46  ? 287  HIS B NE2 1 
ATOM   6391 N N   . VAL B 1 288 ? 23.455  -10.870 -40.728 1.00 79.00  ? 288  VAL B N   1 
ATOM   6392 C CA  . VAL B 1 288 ? 24.633  -9.983  -40.679 1.00 80.36  ? 288  VAL B CA  1 
ATOM   6393 C C   . VAL B 1 288 ? 24.629  -8.952  -39.549 1.00 75.42  ? 288  VAL B C   1 
ATOM   6394 O O   . VAL B 1 288 ? 25.484  -8.068  -39.529 1.00 71.04  ? 288  VAL B O   1 
ATOM   6395 C CB  . VAL B 1 288 ? 24.912  -9.224  -42.021 1.00 54.15  ? 288  VAL B CB  1 
ATOM   6396 C CG1 . VAL B 1 288 ? 25.177  -10.188 -43.159 1.00 45.11  ? 288  VAL B CG1 1 
ATOM   6397 C CG2 . VAL B 1 288 ? 23.767  -8.256  -42.357 1.00 56.36  ? 288  VAL B CG2 1 
ATOM   6398 N N   . LEU B 1 289 ? 23.671  -9.039  -38.629 1.00 73.33  ? 289  LEU B N   1 
ATOM   6399 C CA  . LEU B 1 289 ? 23.669  -8.118  -37.496 1.00 67.92  ? 289  LEU B CA  1 
ATOM   6400 C C   . LEU B 1 289 ? 24.824  -8.506  -36.586 1.00 71.12  ? 289  LEU B C   1 
ATOM   6401 O O   . LEU B 1 289 ? 25.039  -9.697  -36.326 1.00 62.65  ? 289  LEU B O   1 
ATOM   6402 C CB  . LEU B 1 289 ? 22.325  -8.125  -36.747 1.00 59.02  ? 289  LEU B CB  1 
ATOM   6403 C CG  . LEU B 1 289 ? 21.214  -7.328  -37.447 1.00 54.88  ? 289  LEU B CG  1 
ATOM   6404 C CD1 . LEU B 1 289 ? 19.816  -7.589  -36.859 1.00 41.20  ? 289  LEU B CD1 1 
ATOM   6405 C CD2 . LEU B 1 289 ? 21.552  -5.839  -37.447 1.00 52.31  ? 289  LEU B CD2 1 
ATOM   6406 N N   . PRO B 1 290 ? 25.597  -7.502  -36.129 1.00 77.42  ? 290  PRO B N   1 
ATOM   6407 C CA  . PRO B 1 290 ? 26.756  -7.728  -35.251 1.00 79.43  ? 290  PRO B CA  1 
ATOM   6408 C C   . PRO B 1 290 ? 26.411  -8.504  -33.972 1.00 79.89  ? 290  PRO B C   1 
ATOM   6409 O O   . PRO B 1 290 ? 27.164  -9.393  -33.582 1.00 84.37  ? 290  PRO B O   1 
ATOM   6410 C CB  . PRO B 1 290 ? 27.242  -6.295  -34.930 1.00 68.08  ? 290  PRO B CB  1 
ATOM   6411 C CG  . PRO B 1 290 ? 26.107  -5.404  -35.330 1.00 65.42  ? 290  PRO B CG  1 
ATOM   6412 C CD  . PRO B 1 290 ? 25.514  -6.089  -36.527 1.00 71.27  ? 290  PRO B CD  1 
ATOM   6413 N N   . GLN B 1 291 ? 25.290  -8.175  -33.337 1.00 74.58  ? 291  GLN B N   1 
ATOM   6414 C CA  . GLN B 1 291 ? 24.890  -8.829  -32.099 1.00 73.82  ? 291  GLN B CA  1 
ATOM   6415 C C   . GLN B 1 291 ? 23.477  -9.375  -32.212 1.00 81.10  ? 291  GLN B C   1 
ATOM   6416 O O   . GLN B 1 291 ? 22.757  -9.103  -33.176 1.00 85.19  ? 291  GLN B O   1 
ATOM   6417 C CB  . GLN B 1 291 ? 24.956  -7.852  -30.913 1.00 78.87  ? 291  GLN B CB  1 
ATOM   6418 C CG  . GLN B 1 291 ? 26.313  -7.161  -30.691 1.00 88.46  ? 291  GLN B CG  1 
ATOM   6419 C CD  . GLN B 1 291 ? 26.402  -5.771  -31.330 1.00 90.83  ? 291  GLN B CD  1 
ATOM   6420 O OE1 . GLN B 1 291 ? 27.477  -5.158  -31.362 1.00 90.14  ? 291  GLN B OE1 1 
ATOM   6421 N NE2 . GLN B 1 291 ? 25.269  -5.269  -31.835 1.00 86.80  ? 291  GLN B NE2 1 
ATOM   6422 N N   . GLU B 1 292 ? 23.077  -10.155 -31.220 1.00 84.57  ? 292  GLU B N   1 
ATOM   6423 C CA  . GLU B 1 292 ? 21.686  -10.542 -31.123 1.00 87.39  ? 292  GLU B CA  1 
ATOM   6424 C C   . GLU B 1 292 ? 20.926  -9.304  -30.654 1.00 84.97  ? 292  GLU B C   1 
ATOM   6425 O O   . GLU B 1 292 ? 21.023  -8.904  -29.493 1.00 85.54  ? 292  GLU B O   1 
ATOM   6426 C CB  . GLU B 1 292 ? 21.508  -11.698 -30.139 1.00 90.40  ? 292  GLU B CB  1 
ATOM   6427 C CG  . GLU B 1 292 ? 20.266  -12.546 -30.398 1.00 97.10  ? 292  GLU B CG  1 
ATOM   6428 C CD  . GLU B 1 292 ? 19.767  -13.251 -29.142 1.00 107.56 ? 292  GLU B CD  1 
ATOM   6429 O OE1 . GLU B 1 292 ? 20.592  -13.508 -28.230 1.00 111.78 ? 292  GLU B OE1 1 
ATOM   6430 O OE2 . GLU B 1 292 ? 18.550  -13.547 -29.070 1.00 106.42 ? 292  GLU B OE2 1 
ATOM   6431 N N   . SER B 1 293 ? 20.185  -8.686  -31.565 1.00 79.21  ? 293  SER B N   1 
ATOM   6432 C CA  . SER B 1 293 ? 19.515  -7.436  -31.261 1.00 71.81  ? 293  SER B CA  1 
ATOM   6433 C C   . SER B 1 293 ? 18.004  -7.635  -31.320 1.00 71.93  ? 293  SER B C   1 
ATOM   6434 O O   . SER B 1 293 ? 17.533  -8.670  -31.796 1.00 71.77  ? 293  SER B O   1 
ATOM   6435 C CB  . SER B 1 293 ? 19.941  -6.360  -32.277 1.00 67.35  ? 293  SER B CB  1 
ATOM   6436 O OG  . SER B 1 293 ? 21.321  -6.448  -32.641 1.00 57.02  ? 293  SER B OG  1 
ATOM   6437 N N   . ILE B 1 294 ? 17.257  -6.671  -30.781 1.00 71.60  ? 294  ILE B N   1 
ATOM   6438 C CA  . ILE B 1 294 ? 15.913  -6.364  -31.276 1.00 64.48  ? 294  ILE B CA  1 
ATOM   6439 C C   . ILE B 1 294 ? 15.910  -4.879  -31.591 1.00 61.24  ? 294  ILE B C   1 
ATOM   6440 O O   . ILE B 1 294 ? 16.708  -4.117  -31.033 1.00 50.26  ? 294  ILE B O   1 
ATOM   6441 C CB  . ILE B 1 294 ? 14.759  -6.642  -30.289 1.00 59.67  ? 294  ILE B CB  1 
ATOM   6442 C CG1 . ILE B 1 294 ? 15.017  -5.971  -28.942 1.00 60.61  ? 294  ILE B CG1 1 
ATOM   6443 C CG2 . ILE B 1 294 ? 14.481  -8.122  -30.159 1.00 54.13  ? 294  ILE B CG2 1 
ATOM   6444 C CD1 . ILE B 1 294 ? 13.771  -5.823  -28.114 1.00 59.40  ? 294  ILE B CD1 1 
ATOM   6445 N N   . PHE B 1 295 ? 15.015  -4.481  -32.488 1.00 62.74  ? 295  PHE B N   1 
ATOM   6446 C CA  . PHE B 1 295 ? 14.961  -3.113  -32.971 1.00 54.95  ? 295  PHE B CA  1 
ATOM   6447 C C   . PHE B 1 295 ? 16.302  -2.677  -33.525 1.00 60.17  ? 295  PHE B C   1 
ATOM   6448 O O   . PHE B 1 295 ? 16.847  -1.645  -33.133 1.00 67.99  ? 295  PHE B O   1 
ATOM   6449 C CB  . PHE B 1 295 ? 14.534  -2.153  -31.869 1.00 52.93  ? 295  PHE B CB  1 
ATOM   6450 C CG  . PHE B 1 295 ? 13.656  -1.044  -32.362 1.00 58.30  ? 295  PHE B CG  1 
ATOM   6451 C CD1 . PHE B 1 295 ? 14.015  -0.315  -33.493 1.00 58.62  ? 295  PHE B CD1 1 
ATOM   6452 C CD2 . PHE B 1 295 ? 12.458  -0.754  -31.726 1.00 49.85  ? 295  PHE B CD2 1 
ATOM   6453 C CE1 . PHE B 1 295 ? 13.207  0.675   -33.976 1.00 53.05  ? 295  PHE B CE1 1 
ATOM   6454 C CE2 . PHE B 1 295 ? 11.661  0.253   -32.188 1.00 53.75  ? 295  PHE B CE2 1 
ATOM   6455 C CZ  . PHE B 1 295 ? 12.035  0.971   -33.316 1.00 58.12  ? 295  PHE B CZ  1 
ATOM   6456 N N   . ARG B 1 296 ? 16.826  -3.481  -34.436 1.00 54.06  ? 296  ARG B N   1 
ATOM   6457 C CA  . ARG B 1 296 ? 18.091  -3.202  -35.073 1.00 55.98  ? 296  ARG B CA  1 
ATOM   6458 C C   . ARG B 1 296 ? 18.019  -3.920  -36.420 1.00 63.21  ? 296  ARG B C   1 
ATOM   6459 O O   . ARG B 1 296 ? 17.682  -5.106  -36.479 1.00 67.56  ? 296  ARG B O   1 
ATOM   6460 C CB  . ARG B 1 296 ? 19.247  -3.730  -34.210 1.00 53.61  ? 296  ARG B CB  1 
ATOM   6461 C CG  . ARG B 1 296 ? 20.590  -3.000  -34.390 1.00 51.72  ? 296  ARG B CG  1 
ATOM   6462 C CD  . ARG B 1 296 ? 20.935  -2.159  -33.188 1.00 52.11  ? 296  ARG B CD  1 
ATOM   6463 N NE  . ARG B 1 296 ? 19.740  -1.565  -32.608 1.00 56.04  ? 296  ARG B NE  1 
ATOM   6464 C CZ  . ARG B 1 296 ? 19.744  -0.687  -31.609 1.00 56.55  ? 296  ARG B CZ  1 
ATOM   6465 N NH1 . ARG B 1 296 ? 20.891  -0.289  -31.064 1.00 51.92  ? 296  ARG B NH1 1 
ATOM   6466 N NH2 . ARG B 1 296 ? 18.594  -0.211  -31.157 1.00 50.03  ? 296  ARG B NH2 1 
ATOM   6467 N N   . PHE B 1 297 ? 18.313  -3.203  -37.504 1.00 60.04  ? 297  PHE B N   1 
ATOM   6468 C CA  . PHE B 1 297 ? 18.028  -3.735  -38.838 1.00 59.52  ? 297  PHE B CA  1 
ATOM   6469 C C   . PHE B 1 297 ? 19.261  -3.813  -39.742 1.00 54.76  ? 297  PHE B C   1 
ATOM   6470 O O   . PHE B 1 297 ? 20.146  -2.985  -39.649 1.00 57.20  ? 297  PHE B O   1 
ATOM   6471 C CB  . PHE B 1 297 ? 16.888  -2.924  -39.456 1.00 60.62  ? 297  PHE B CB  1 
ATOM   6472 C CG  . PHE B 1 297 ? 15.741  -2.693  -38.493 1.00 58.84  ? 297  PHE B CG  1 
ATOM   6473 C CD1 . PHE B 1 297 ? 15.017  -3.776  -37.980 1.00 59.22  ? 297  PHE B CD1 1 
ATOM   6474 C CD2 . PHE B 1 297 ? 15.409  -1.412  -38.069 1.00 54.88  ? 297  PHE B CD2 1 
ATOM   6475 C CE1 . PHE B 1 297 ? 13.968  -3.580  -37.078 1.00 58.26  ? 297  PHE B CE1 1 
ATOM   6476 C CE2 . PHE B 1 297 ? 14.368  -1.210  -37.164 1.00 55.96  ? 297  PHE B CE2 1 
ATOM   6477 C CZ  . PHE B 1 297 ? 13.647  -2.301  -36.673 1.00 58.26  ? 297  PHE B CZ  1 
ATOM   6478 N N   . SER B 1 298 ? 19.325  -4.827  -40.598 1.00 53.87  ? 298  SER B N   1 
ATOM   6479 C CA  . SER B 1 298 ? 20.557  -5.142  -41.336 1.00 59.74  ? 298  SER B CA  1 
ATOM   6480 C C   . SER B 1 298 ? 20.908  -4.143  -42.436 1.00 59.13  ? 298  SER B C   1 
ATOM   6481 O O   . SER B 1 298 ? 22.079  -3.787  -42.612 1.00 59.95  ? 298  SER B O   1 
ATOM   6482 C CB  . SER B 1 298 ? 20.489  -6.548  -41.945 1.00 64.40  ? 298  SER B CB  1 
ATOM   6483 O OG  . SER B 1 298 ? 20.558  -7.548  -40.947 1.00 69.42  ? 298  SER B OG  1 
ATOM   6484 N N   . PHE B 1 299 ? 19.897  -3.706  -43.186 1.00 47.85  ? 299  PHE B N   1 
ATOM   6485 C CA  . PHE B 1 299 ? 20.124  -2.791  -44.295 1.00 44.83  ? 299  PHE B CA  1 
ATOM   6486 C C   . PHE B 1 299 ? 19.256  -1.548  -44.204 1.00 46.31  ? 299  PHE B C   1 
ATOM   6487 O O   . PHE B 1 299 ? 18.033  -1.613  -44.345 1.00 50.13  ? 299  PHE B O   1 
ATOM   6488 C CB  . PHE B 1 299 ? 20.016  -3.539  -45.628 1.00 43.75  ? 299  PHE B CB  1 
ATOM   6489 C CG  . PHE B 1 299 ? 21.121  -4.540  -45.807 1.00 42.53  ? 299  PHE B CG  1 
ATOM   6490 C CD1 . PHE B 1 299 ? 22.376  -4.125  -46.223 1.00 38.81  ? 299  PHE B CD1 1 
ATOM   6491 C CD2 . PHE B 1 299 ? 20.938  -5.880  -45.443 1.00 41.64  ? 299  PHE B CD2 1 
ATOM   6492 C CE1 . PHE B 1 299 ? 23.426  -5.041  -46.331 1.00 50.59  ? 299  PHE B CE1 1 
ATOM   6493 C CE2 . PHE B 1 299 ? 21.968  -6.793  -45.539 1.00 43.55  ? 299  PHE B CE2 1 
ATOM   6494 C CZ  . PHE B 1 299 ? 23.222  -6.377  -45.988 1.00 47.33  ? 299  PHE B CZ  1 
ATOM   6495 N N   . VAL B 1 300 ? 19.927  -0.428  -43.926 1.00 38.78  ? 300  VAL B N   1 
ATOM   6496 C CA  . VAL B 1 300 ? 19.291  0.844   -43.570 1.00 36.86  ? 300  VAL B CA  1 
ATOM   6497 C C   . VAL B 1 300 ? 20.081  1.965   -44.224 1.00 42.29  ? 300  VAL B C   1 
ATOM   6498 O O   . VAL B 1 300 ? 21.148  1.721   -44.791 1.00 53.66  ? 300  VAL B O   1 
ATOM   6499 C CB  . VAL B 1 300 ? 19.266  1.087   -42.038 1.00 39.44  ? 300  VAL B CB  1 
ATOM   6500 C CG1 . VAL B 1 300 ? 18.565  -0.099  -41.279 1.00 17.74  ? 300  VAL B CG1 1 
ATOM   6501 C CG2 . VAL B 1 300 ? 20.706  1.345   -41.524 1.00 29.33  ? 300  VAL B CG2 1 
ATOM   6502 N N   . PRO B 1 301 ? 19.542  3.192   -44.181 1.00 44.30  ? 301  PRO B N   1 
ATOM   6503 C CA  . PRO B 1 301 ? 20.217  4.345   -44.782 1.00 38.82  ? 301  PRO B CA  1 
ATOM   6504 C C   . PRO B 1 301 ? 21.616  4.450   -44.217 1.00 48.88  ? 301  PRO B C   1 
ATOM   6505 O O   . PRO B 1 301 ? 21.820  4.208   -43.018 1.00 54.91  ? 301  PRO B O   1 
ATOM   6506 C CB  . PRO B 1 301 ? 19.362  5.524   -44.316 1.00 30.53  ? 301  PRO B CB  1 
ATOM   6507 C CG  . PRO B 1 301 ? 18.024  4.946   -44.119 1.00 31.48  ? 301  PRO B CG  1 
ATOM   6508 C CD  . PRO B 1 301 ? 18.241  3.565   -43.598 1.00 43.08  ? 301  PRO B CD  1 
ATOM   6509 N N   . VAL B 1 302 ? 22.578  4.779   -45.069 1.00 43.75  ? 302  VAL B N   1 
ATOM   6510 C CA  . VAL B 1 302 ? 23.963  4.824   -44.635 1.00 47.61  ? 302  VAL B CA  1 
ATOM   6511 C C   . VAL B 1 302 ? 24.450  6.256   -44.699 1.00 46.64  ? 302  VAL B C   1 
ATOM   6512 O O   . VAL B 1 302 ? 24.103  6.981   -45.619 1.00 52.94  ? 302  VAL B O   1 
ATOM   6513 C CB  . VAL B 1 302 ? 24.862  3.899   -45.511 1.00 41.55  ? 302  VAL B CB  1 
ATOM   6514 C CG1 . VAL B 1 302 ? 24.568  4.112   -46.970 1.00 35.55  ? 302  VAL B CG1 1 
ATOM   6515 C CG2 . VAL B 1 302 ? 26.358  4.116   -45.206 1.00 35.83  ? 302  VAL B CG2 1 
ATOM   6516 N N   . VAL B 1 303 ? 25.244  6.668   -43.721 1.00 48.81  ? 303  VAL B N   1 
ATOM   6517 C CA  . VAL B 1 303 ? 25.851  7.991   -43.769 1.00 49.57  ? 303  VAL B CA  1 
ATOM   6518 C C   . VAL B 1 303 ? 26.926  7.995   -44.847 1.00 53.56  ? 303  VAL B C   1 
ATOM   6519 O O   . VAL B 1 303 ? 28.064  7.612   -44.605 1.00 61.75  ? 303  VAL B O   1 
ATOM   6520 C CB  . VAL B 1 303 ? 26.450  8.392   -42.416 1.00 41.73  ? 303  VAL B CB  1 
ATOM   6521 C CG1 . VAL B 1 303 ? 26.829  9.862   -42.428 1.00 36.26  ? 303  VAL B CG1 1 
ATOM   6522 C CG2 . VAL B 1 303 ? 25.451  8.112   -41.307 1.00 43.45  ? 303  VAL B CG2 1 
ATOM   6523 N N   . ASP B 1 304 ? 26.540  8.434   -46.039 1.00 52.69  ? 304  ASP B N   1 
ATOM   6524 C CA  . ASP B 1 304 ? 27.371  8.317   -47.231 1.00 49.79  ? 304  ASP B CA  1 
ATOM   6525 C C   . ASP B 1 304 ? 28.158  9.581   -47.542 1.00 47.40  ? 304  ASP B C   1 
ATOM   6526 O O   . ASP B 1 304 ? 28.977  9.599   -48.463 1.00 46.20  ? 304  ASP B O   1 
ATOM   6527 C CB  . ASP B 1 304 ? 26.507  7.942   -48.448 1.00 45.52  ? 304  ASP B CB  1 
ATOM   6528 C CG  . ASP B 1 304 ? 25.465  9.008   -48.796 1.00 50.20  ? 304  ASP B CG  1 
ATOM   6529 O OD1 . ASP B 1 304 ? 25.217  9.915   -47.976 1.00 41.58  ? 304  ASP B OD1 1 
ATOM   6530 O OD2 . ASP B 1 304 ? 24.876  8.931   -49.896 1.00 55.81  ? 304  ASP B OD2 1 
ATOM   6531 N N   . GLY B 1 305 ? 27.901  10.632  -46.772 1.00 45.68  ? 305  GLY B N   1 
ATOM   6532 C CA  . GLY B 1 305 ? 28.374  11.958  -47.104 1.00 40.60  ? 305  GLY B CA  1 
ATOM   6533 C C   . GLY B 1 305 ? 27.821  12.466  -48.426 1.00 43.87  ? 305  GLY B C   1 
ATOM   6534 O O   . GLY B 1 305 ? 28.354  13.399  -49.004 1.00 47.59  ? 305  GLY B O   1 
ATOM   6535 N N   . ASP B 1 306 ? 26.749  11.860  -48.920 1.00 55.95  ? 306  ASP B N   1 
ATOM   6536 C CA  . ASP B 1 306 ? 26.089  12.361  -50.130 1.00 55.42  ? 306  ASP B CA  1 
ATOM   6537 C C   . ASP B 1 306 ? 24.648  12.749  -49.793 1.00 51.35  ? 306  ASP B C   1 
ATOM   6538 O O   . ASP B 1 306 ? 24.342  13.935  -49.599 1.00 45.49  ? 306  ASP B O   1 
ATOM   6539 C CB  . ASP B 1 306 ? 26.149  11.322  -51.259 1.00 56.98  ? 306  ASP B CB  1 
ATOM   6540 C CG  . ASP B 1 306 ? 25.702  11.873  -52.612 1.00 65.57  ? 306  ASP B CG  1 
ATOM   6541 O OD1 . ASP B 1 306 ? 25.272  13.047  -52.694 1.00 62.30  ? 306  ASP B OD1 1 
ATOM   6542 O OD2 . ASP B 1 306 ? 25.773  11.109  -53.603 1.00 73.16  ? 306  ASP B OD2 1 
ATOM   6543 N N   . PHE B 1 307 ? 23.771  11.749  -49.718 1.00 57.65  ? 307  PHE B N   1 
ATOM   6544 C CA  . PHE B 1 307 ? 22.391  11.994  -49.316 1.00 60.53  ? 307  PHE B CA  1 
ATOM   6545 C C   . PHE B 1 307 ? 22.428  12.602  -47.927 1.00 57.31  ? 307  PHE B C   1 
ATOM   6546 O O   . PHE B 1 307 ? 21.843  13.659  -47.678 1.00 46.62  ? 307  PHE B O   1 
ATOM   6547 C CB  . PHE B 1 307 ? 21.587  10.696  -49.297 1.00 53.19  ? 307  PHE B CB  1 
ATOM   6548 C CG  . PHE B 1 307 ? 20.099  10.902  -49.327 1.00 45.92  ? 307  PHE B CG  1 
ATOM   6549 C CD1 . PHE B 1 307 ? 19.417  11.322  -48.198 1.00 43.97  ? 307  PHE B CD1 1 
ATOM   6550 C CD2 . PHE B 1 307 ? 19.379  10.674  -50.481 1.00 49.21  ? 307  PHE B CD2 1 
ATOM   6551 C CE1 . PHE B 1 307 ? 18.042  11.507  -48.216 1.00 42.61  ? 307  PHE B CE1 1 
ATOM   6552 C CE2 . PHE B 1 307 ? 17.994  10.850  -50.503 1.00 48.94  ? 307  PHE B CE2 1 
ATOM   6553 C CZ  . PHE B 1 307 ? 17.331  11.272  -49.372 1.00 44.76  ? 307  PHE B CZ  1 
ATOM   6554 N N   . LEU B 1 308 ? 23.136  11.908  -47.040 1.00 60.87  ? 308  LEU B N   1 
ATOM   6555 C CA  . LEU B 1 308 ? 23.467  12.387  -45.705 1.00 57.52  ? 308  LEU B CA  1 
ATOM   6556 C C   . LEU B 1 308 ? 24.908  12.864  -45.700 1.00 61.47  ? 308  LEU B C   1 
ATOM   6557 O O   . LEU B 1 308 ? 25.822  12.067  -45.855 1.00 72.19  ? 308  LEU B O   1 
ATOM   6558 C CB  . LEU B 1 308 ? 23.332  11.243  -44.700 1.00 47.39  ? 308  LEU B CB  1 
ATOM   6559 C CG  . LEU B 1 308 ? 21.942  10.616  -44.604 1.00 44.96  ? 308  LEU B CG  1 
ATOM   6560 C CD1 . LEU B 1 308 ? 21.917  9.520   -43.568 1.00 44.55  ? 308  LEU B CD1 1 
ATOM   6561 C CD2 . LEU B 1 308 ? 20.903  11.660  -44.282 1.00 33.95  ? 308  LEU B CD2 1 
ATOM   6562 N N   . SER B 1 309 ? 25.127  14.155  -45.506 1.00 58.92  ? 309  SER B N   1 
ATOM   6563 C CA  . SER B 1 309 ? 26.496  14.683  -45.515 1.00 59.37  ? 309  SER B CA  1 
ATOM   6564 C C   . SER B 1 309 ? 27.243  14.457  -44.194 1.00 63.01  ? 309  SER B C   1 
ATOM   6565 O O   . SER B 1 309 ? 28.448  14.660  -44.109 1.00 70.51  ? 309  SER B O   1 
ATOM   6566 C CB  . SER B 1 309 ? 26.473  16.166  -45.849 1.00 55.03  ? 309  SER B CB  1 
ATOM   6567 O OG  . SER B 1 309 ? 25.683  16.875  -44.908 1.00 58.97  ? 309  SER B OG  1 
ATOM   6568 N N   . ASP B 1 310 ? 26.516  14.036  -43.169 1.00 62.72  ? 310  ASP B N   1 
ATOM   6569 C CA  . ASP B 1 310 ? 27.080  13.779  -41.854 1.00 62.43  ? 310  ASP B CA  1 
ATOM   6570 C C   . ASP B 1 310 ? 26.021  13.008  -41.059 1.00 60.50  ? 310  ASP B C   1 
ATOM   6571 O O   . ASP B 1 310 ? 24.895  12.873  -41.522 1.00 59.10  ? 310  ASP B O   1 
ATOM   6572 C CB  . ASP B 1 310 ? 27.410  15.108  -41.183 1.00 67.35  ? 310  ASP B CB  1 
ATOM   6573 C CG  . ASP B 1 310 ? 28.473  14.983  -40.092 1.00 68.52  ? 310  ASP B CG  1 
ATOM   6574 O OD1 . ASP B 1 310 ? 28.679  13.864  -39.566 1.00 68.75  ? 310  ASP B OD1 1 
ATOM   6575 O OD2 . ASP B 1 310 ? 29.081  16.029  -39.755 1.00 58.15  ? 310  ASP B OD2 1 
ATOM   6576 N N   . THR B 1 311 ? 26.359  12.496  -39.880 1.00 56.56  ? 311  THR B N   1 
ATOM   6577 C CA  . THR B 1 311 ? 25.377  11.754  -39.094 1.00 55.84  ? 311  THR B CA  1 
ATOM   6578 C C   . THR B 1 311 ? 24.133  12.599  -38.886 1.00 51.82  ? 311  THR B C   1 
ATOM   6579 O O   . THR B 1 311 ? 24.217  13.812  -38.888 1.00 51.64  ? 311  THR B O   1 
ATOM   6580 C CB  . THR B 1 311 ? 25.926  11.347  -37.712 1.00 55.07  ? 311  THR B CB  1 
ATOM   6581 O OG1 . THR B 1 311 ? 26.213  12.510  -36.930 1.00 52.39  ? 311  THR B OG1 1 
ATOM   6582 C CG2 . THR B 1 311 ? 27.187  10.536  -37.878 1.00 54.78  ? 311  THR B CG2 1 
ATOM   6583 N N   . PRO B 1 312 ? 22.969  11.963  -38.736 1.00 54.47  ? 312  PRO B N   1 
ATOM   6584 C CA  . PRO B 1 312 ? 21.815  12.776  -38.372 1.00 50.91  ? 312  PRO B CA  1 
ATOM   6585 C C   . PRO B 1 312 ? 22.102  13.626  -37.139 1.00 51.89  ? 312  PRO B C   1 
ATOM   6586 O O   . PRO B 1 312 ? 21.658  14.778  -37.091 1.00 47.05  ? 312  PRO B O   1 
ATOM   6587 C CB  . PRO B 1 312 ? 20.741  11.731  -38.079 1.00 44.60  ? 312  PRO B CB  1 
ATOM   6588 C CG  . PRO B 1 312 ? 21.051  10.662  -39.037 1.00 49.85  ? 312  PRO B CG  1 
ATOM   6589 C CD  . PRO B 1 312 ? 22.566  10.600  -39.123 1.00 56.97  ? 312  PRO B CD  1 
ATOM   6590 N N   . GLU B 1 313 ? 22.833  13.100  -36.160 1.00 49.91  ? 313  GLU B N   1 
ATOM   6591 C CA  . GLU B 1 313 ? 22.989  13.884  -34.936 1.00 51.38  ? 313  GLU B CA  1 
ATOM   6592 C C   . GLU B 1 313 ? 23.759  15.133  -35.291 1.00 54.27  ? 313  GLU B C   1 
ATOM   6593 O O   . GLU B 1 313 ? 23.347  16.236  -34.963 1.00 55.26  ? 313  GLU B O   1 
ATOM   6594 C CB  . GLU B 1 313 ? 23.627  13.101  -33.792 1.00 55.89  ? 313  GLU B CB  1 
ATOM   6595 C CG  . GLU B 1 313 ? 22.650  12.126  -33.078 1.00 75.61  ? 313  GLU B CG  1 
ATOM   6596 C CD  . GLU B 1 313 ? 22.459  10.767  -33.808 1.00 89.84  ? 313  GLU B CD  1 
ATOM   6597 O OE1 . GLU B 1 313 ? 22.872  10.612  -34.999 1.00 86.63  ? 313  GLU B OE1 1 
ATOM   6598 O OE2 . GLU B 1 313 ? 21.893  9.847   -33.168 1.00 85.32  ? 313  GLU B OE2 1 
ATOM   6599 N N   . ALA B 1 314 ? 24.847  14.962  -36.024 1.00 51.74  ? 314  ALA B N   1 
ATOM   6600 C CA  . ALA B 1 314 ? 25.589  16.107  -36.524 1.00 52.58  ? 314  ALA B CA  1 
ATOM   6601 C C   . ALA B 1 314 ? 24.665  17.139  -37.169 1.00 62.87  ? 314  ALA B C   1 
ATOM   6602 O O   . ALA B 1 314 ? 24.724  18.328  -36.852 1.00 69.61  ? 314  ALA B O   1 
ATOM   6603 C CB  . ALA B 1 314 ? 26.660  15.663  -37.517 1.00 48.02  ? 314  ALA B CB  1 
ATOM   6604 N N   . LEU B 1 315 ? 23.804  16.683  -38.072 1.00 60.39  ? 315  LEU B N   1 
ATOM   6605 C CA  . LEU B 1 315 ? 22.985  17.594  -38.862 1.00 55.69  ? 315  LEU B CA  1 
ATOM   6606 C C   . LEU B 1 315 ? 21.796  18.215  -38.096 1.00 59.02  ? 315  LEU B C   1 
ATOM   6607 O O   . LEU B 1 315 ? 21.422  19.364  -38.353 1.00 56.06  ? 315  LEU B O   1 
ATOM   6608 C CB  . LEU B 1 315 ? 22.510  16.894  -40.125 1.00 49.76  ? 315  LEU B CB  1 
ATOM   6609 C CG  . LEU B 1 315 ? 23.592  16.341  -41.040 1.00 42.80  ? 315  LEU B CG  1 
ATOM   6610 C CD1 . LEU B 1 315 ? 22.939  15.459  -42.089 1.00 36.93  ? 315  LEU B CD1 1 
ATOM   6611 C CD2 . LEU B 1 315 ? 24.337  17.491  -41.710 1.00 44.19  ? 315  LEU B CD2 1 
ATOM   6612 N N   . ILE B 1 316 ? 21.202  17.477  -37.159 1.00 56.71  ? 316  ILE B N   1 
ATOM   6613 C CA  . ILE B 1 316 ? 20.153  18.089  -36.344 1.00 56.76  ? 316  ILE B CA  1 
ATOM   6614 C C   . ILE B 1 316 ? 20.750  19.063  -35.332 1.00 58.95  ? 316  ILE B C   1 
ATOM   6615 O O   . ILE B 1 316 ? 20.068  19.982  -34.910 1.00 61.70  ? 316  ILE B O   1 
ATOM   6616 C CB  . ILE B 1 316 ? 19.177  17.069  -35.650 1.00 46.82  ? 316  ILE B CB  1 
ATOM   6617 C CG1 . ILE B 1 316 ? 19.797  16.411  -34.415 1.00 55.65  ? 316  ILE B CG1 1 
ATOM   6618 C CG2 . ILE B 1 316 ? 18.719  16.022  -36.617 1.00 49.81  ? 316  ILE B CG2 1 
ATOM   6619 C CD1 . ILE B 1 316 ? 19.048  15.167  -33.939 1.00 59.64  ? 316  ILE B CD1 1 
ATOM   6620 N N   . ASN B 1 317 ? 22.019  18.870  -34.958 1.00 62.57  ? 317  ASN B N   1 
ATOM   6621 C CA  . ASN B 1 317 ? 22.696  19.758  -33.993 1.00 61.13  ? 317  ASN B CA  1 
ATOM   6622 C C   . ASN B 1 317 ? 23.111  21.083  -34.629 1.00 57.63  ? 317  ASN B C   1 
ATOM   6623 O O   . ASN B 1 317 ? 23.409  22.039  -33.925 1.00 59.34  ? 317  ASN B O   1 
ATOM   6624 C CB  . ASN B 1 317 ? 23.951  19.109  -33.381 1.00 61.14  ? 317  ASN B CB  1 
ATOM   6625 C CG  . ASN B 1 317 ? 23.645  18.060  -32.312 1.00 72.06  ? 317  ASN B CG  1 
ATOM   6626 O OD1 . ASN B 1 317 ? 22.504  17.880  -31.878 1.00 74.83  ? 317  ASN B OD1 1 
ATOM   6627 N ND2 . ASN B 1 317 ? 24.688  17.352  -31.883 1.00 79.67  ? 317  ASN B ND2 1 
ATOM   6628 N N   . THR B 1 318 ? 23.135  21.135  -35.956 1.00 50.17  ? 318  THR B N   1 
ATOM   6629 C CA  . THR B 1 318 ? 23.705  22.283  -36.643 1.00 59.62  ? 318  THR B CA  1 
ATOM   6630 C C   . THR B 1 318 ? 22.883  22.768  -37.823 1.00 67.11  ? 318  THR B C   1 
ATOM   6631 O O   . THR B 1 318 ? 23.343  23.611  -38.585 1.00 70.12  ? 318  THR B O   1 
ATOM   6632 C CB  . THR B 1 318 ? 25.102  21.950  -37.191 1.00 69.40  ? 318  THR B CB  1 
ATOM   6633 O OG1 . THR B 1 318 ? 24.982  21.069  -38.324 1.00 65.19  ? 318  THR B OG1 1 
ATOM   6634 C CG2 . THR B 1 318 ? 25.968  21.305  -36.101 1.00 71.38  ? 318  THR B CG2 1 
ATOM   6635 N N   . GLY B 1 319 ? 21.685  22.224  -38.001 1.00 70.07  ? 319  GLY B N   1 
ATOM   6636 C CA  . GLY B 1 319 ? 20.859  22.613  -39.127 1.00 67.37  ? 319  GLY B CA  1 
ATOM   6637 C C   . GLY B 1 319 ? 20.230  23.975  -38.902 1.00 69.81  ? 319  GLY B C   1 
ATOM   6638 O O   . GLY B 1 319 ? 20.172  24.451  -37.766 1.00 60.57  ? 319  GLY B O   1 
ATOM   6639 N N   . ASP B 1 320 ? 19.790  24.606  -39.992 1.00 79.60  ? 320  ASP B N   1 
ATOM   6640 C CA  . ASP B 1 320 ? 18.886  25.758  -39.931 1.00 87.51  ? 320  ASP B CA  1 
ATOM   6641 C C   . ASP B 1 320 ? 17.493  25.341  -40.430 1.00 77.00  ? 320  ASP B C   1 
ATOM   6642 O O   . ASP B 1 320 ? 17.319  24.905  -41.592 1.00 62.69  ? 320  ASP B O   1 
ATOM   6643 C CB  . ASP B 1 320 ? 19.421  26.944  -40.746 1.00 100.76 ? 320  ASP B CB  1 
ATOM   6644 C CG  . ASP B 1 320 ? 18.600  28.217  -40.541 1.00 106.23 ? 320  ASP B CG  1 
ATOM   6645 O OD1 . ASP B 1 320 ? 17.945  28.341  -39.483 1.00 108.34 ? 320  ASP B OD1 1 
ATOM   6646 O OD2 . ASP B 1 320 ? 18.615  29.093  -41.434 1.00 106.19 ? 320  ASP B OD2 1 
ATOM   6647 N N   . PHE B 1 321 ? 16.508  25.467  -39.541 1.00 69.91  ? 321  PHE B N   1 
ATOM   6648 C CA  . PHE B 1 321 ? 15.183  24.911  -39.794 1.00 68.28  ? 321  PHE B CA  1 
ATOM   6649 C C   . PHE B 1 321 ? 14.073  25.934  -39.646 1.00 74.35  ? 321  PHE B C   1 
ATOM   6650 O O   . PHE B 1 321 ? 12.955  25.581  -39.263 1.00 69.42  ? 321  PHE B O   1 
ATOM   6651 C CB  . PHE B 1 321 ? 14.907  23.747  -38.846 1.00 51.38  ? 321  PHE B CB  1 
ATOM   6652 C CG  . PHE B 1 321 ? 15.885  22.611  -38.971 1.00 49.45  ? 321  PHE B CG  1 
ATOM   6653 C CD1 . PHE B 1 321 ? 15.968  21.877  -40.136 1.00 51.73  ? 321  PHE B CD1 1 
ATOM   6654 C CD2 . PHE B 1 321 ? 16.705  22.263  -37.923 1.00 49.18  ? 321  PHE B CD2 1 
ATOM   6655 C CE1 . PHE B 1 321 ? 16.850  20.825  -40.254 1.00 44.36  ? 321  PHE B CE1 1 
ATOM   6656 C CE2 . PHE B 1 321 ? 17.586  21.199  -38.042 1.00 48.99  ? 321  PHE B CE2 1 
ATOM   6657 C CZ  . PHE B 1 321 ? 17.658  20.489  -39.211 1.00 42.81  ? 321  PHE B CZ  1 
ATOM   6658 N N   . GLN B 1 322 ? 14.372  27.186  -39.974 1.00 77.03  ? 322  GLN B N   1 
ATOM   6659 C CA  . GLN B 1 322 ? 13.455  28.271  -39.675 1.00 80.83  ? 322  GLN B CA  1 
ATOM   6660 C C   . GLN B 1 322 ? 12.118  28.188  -40.411 1.00 80.44  ? 322  GLN B C   1 
ATOM   6661 O O   . GLN B 1 322 ? 11.059  28.389  -39.797 1.00 84.28  ? 322  GLN B O   1 
ATOM   6662 C CB  . GLN B 1 322 ? 14.120  29.633  -39.869 1.00 93.58  ? 322  GLN B CB  1 
ATOM   6663 C CG  . GLN B 1 322 ? 15.522  29.691  -39.304 1.00 105.36 ? 322  GLN B CG  1 
ATOM   6664 C CD  . GLN B 1 322 ? 15.744  30.877  -38.388 1.00 111.33 ? 322  GLN B CD  1 
ATOM   6665 O OE1 . GLN B 1 322 ? 14.798  31.411  -37.802 1.00 111.06 ? 322  GLN B OE1 1 
ATOM   6666 N NE2 . GLN B 1 322 ? 17.002  31.285  -38.242 1.00 112.47 ? 322  GLN B NE2 1 
ATOM   6667 N N   . ASP B 1 323 ? 12.125  27.886  -41.704 1.00 72.09  ? 323  ASP B N   1 
ATOM   6668 C CA  . ASP B 1 323 ? 10.826  27.803  -42.366 1.00 82.31  ? 323  ASP B CA  1 
ATOM   6669 C C   . ASP B 1 323 ? 10.303  26.380  -42.451 1.00 76.78  ? 323  ASP B C   1 
ATOM   6670 O O   . ASP B 1 323 ? 9.873   25.913  -43.506 1.00 89.99  ? 323  ASP B O   1 
ATOM   6671 C CB  . ASP B 1 323 ? 10.776  28.568  -43.693 1.00 101.19 ? 323  ASP B CB  1 
ATOM   6672 C CG  . ASP B 1 323 ? 10.269  30.005  -43.510 1.00 116.97 ? 323  ASP B CG  1 
ATOM   6673 O OD1 . ASP B 1 323 ? 9.226   30.186  -42.829 1.00 118.46 ? 323  ASP B OD1 1 
ATOM   6674 O OD2 . ASP B 1 323 ? 10.915  30.947  -44.029 1.00 123.30 ? 323  ASP B OD2 1 
ATOM   6675 N N   . LEU B 1 324 ? 10.328  25.719  -41.297 1.00 60.88  ? 324  LEU B N   1 
ATOM   6676 C CA  . LEU B 1 324 ? 9.907   24.340  -41.160 1.00 49.86  ? 324  LEU B CA  1 
ATOM   6677 C C   . LEU B 1 324 ? 8.818   24.171  -40.115 1.00 46.47  ? 324  LEU B C   1 
ATOM   6678 O O   . LEU B 1 324 ? 8.910   24.744  -39.033 1.00 54.43  ? 324  LEU B O   1 
ATOM   6679 C CB  . LEU B 1 324 ? 11.091  23.487  -40.735 1.00 45.80  ? 324  LEU B CB  1 
ATOM   6680 C CG  . LEU B 1 324 ? 10.760  22.012  -40.963 1.00 50.39  ? 324  LEU B CG  1 
ATOM   6681 C CD1 . LEU B 1 324 ? 10.244  21.835  -42.394 1.00 46.01  ? 324  LEU B CD1 1 
ATOM   6682 C CD2 . LEU B 1 324 ? 11.971  21.128  -40.704 1.00 51.93  ? 324  LEU B CD2 1 
ATOM   6683 N N   . GLN B 1 325 ? 7.798   23.382  -40.433 1.00 30.79  ? 325  GLN B N   1 
ATOM   6684 C CA  . GLN B 1 325 ? 6.860   22.929  -39.412 1.00 35.52  ? 325  GLN B CA  1 
ATOM   6685 C C   . GLN B 1 325 ? 6.834   21.427  -39.369 1.00 35.44  ? 325  GLN B C   1 
ATOM   6686 O O   . GLN B 1 325 ? 6.760   20.771  -40.405 1.00 41.47  ? 325  GLN B O   1 
ATOM   6687 C CB  . GLN B 1 325 ? 5.445   23.448  -39.640 1.00 44.81  ? 325  GLN B CB  1 
ATOM   6688 C CG  . GLN B 1 325 ? 5.355   24.946  -39.863 1.00 52.01  ? 325  GLN B CG  1 
ATOM   6689 C CD  . GLN B 1 325 ? 5.300   25.283  -41.333 1.00 55.33  ? 325  GLN B CD  1 
ATOM   6690 O OE1 . GLN B 1 325 ? 4.366   24.891  -42.029 1.00 48.20  ? 325  GLN B OE1 1 
ATOM   6691 N NE2 . GLN B 1 325 ? 6.320   25.985  -41.824 1.00 63.48  ? 325  GLN B NE2 1 
ATOM   6692 N N   . VAL B 1 326 ? 6.881   20.893  -38.155 1.00 36.01  ? 326  VAL B N   1 
ATOM   6693 C CA  . VAL B 1 326 ? 6.972   19.456  -37.932 1.00 42.80  ? 326  VAL B CA  1 
ATOM   6694 C C   . VAL B 1 326 ? 6.008   19.020  -36.836 1.00 40.89  ? 326  VAL B C   1 
ATOM   6695 O O   . VAL B 1 326 ? 5.883   19.690  -35.833 1.00 43.45  ? 326  VAL B O   1 
ATOM   6696 C CB  . VAL B 1 326 ? 8.401   19.052  -37.488 1.00 41.47  ? 326  VAL B CB  1 
ATOM   6697 C CG1 . VAL B 1 326 ? 8.402   17.644  -37.006 1.00 48.14  ? 326  VAL B CG1 1 
ATOM   6698 C CG2 . VAL B 1 326 ? 9.375   19.185  -38.623 1.00 38.61  ? 326  VAL B CG2 1 
ATOM   6699 N N   . LEU B 1 327 ? 5.342   17.888  -37.016 1.00 36.49  ? 327  LEU B N   1 
ATOM   6700 C CA  . LEU B 1 327 ? 4.521   17.310  -35.955 1.00 38.53  ? 327  LEU B CA  1 
ATOM   6701 C C   . LEU B 1 327 ? 5.091   15.914  -35.632 1.00 34.16  ? 327  LEU B C   1 
ATOM   6702 O O   . LEU B 1 327 ? 5.310   15.116  -36.532 1.00 36.09  ? 327  LEU B O   1 
ATOM   6703 C CB  . LEU B 1 327 ? 3.034   17.247  -36.378 1.00 35.94  ? 327  LEU B CB  1 
ATOM   6704 C CG  . LEU B 1 327 ? 2.231   16.107  -35.727 1.00 36.32  ? 327  LEU B CG  1 
ATOM   6705 C CD1 . LEU B 1 327 ? 1.836   16.478  -34.322 1.00 34.04  ? 327  LEU B CD1 1 
ATOM   6706 C CD2 . LEU B 1 327 ? 1.020   15.765  -36.527 1.00 33.36  ? 327  LEU B CD2 1 
ATOM   6707 N N   . VAL B 1 328 ? 5.343   15.635  -34.355 1.00 27.70  ? 328  VAL B N   1 
ATOM   6708 C CA  . VAL B 1 328 ? 6.080   14.440  -33.954 1.00 30.52  ? 328  VAL B CA  1 
ATOM   6709 C C   . VAL B 1 328 ? 5.447   13.842  -32.732 1.00 37.93  ? 328  VAL B C   1 
ATOM   6710 O O   . VAL B 1 328 ? 4.833   14.556  -31.904 1.00 37.67  ? 328  VAL B O   1 
ATOM   6711 C CB  . VAL B 1 328 ? 7.564   14.725  -33.606 1.00 33.27  ? 328  VAL B CB  1 
ATOM   6712 C CG1 . VAL B 1 328 ? 8.247   15.380  -34.741 1.00 44.00  ? 328  VAL B CG1 1 
ATOM   6713 C CG2 . VAL B 1 328 ? 7.680   15.640  -32.399 1.00 31.84  ? 328  VAL B CG2 1 
ATOM   6714 N N   . GLY B 1 329 ? 5.617   12.532  -32.602 1.00 31.10  ? 329  GLY B N   1 
ATOM   6715 C CA  . GLY B 1 329 ? 4.879   11.804  -31.602 1.00 39.38  ? 329  GLY B CA  1 
ATOM   6716 C C   . GLY B 1 329 ? 5.270   10.364  -31.447 1.00 50.31  ? 329  GLY B C   1 
ATOM   6717 O O   . GLY B 1 329 ? 6.090   9.850   -32.205 1.00 48.73  ? 329  GLY B O   1 
ATOM   6718 N N   . VAL B 1 330 ? 4.657   9.723   -30.453 1.00 49.68  ? 330  VAL B N   1 
ATOM   6719 C CA  . VAL B 1 330 ? 4.995   8.375   -30.044 1.00 36.49  ? 330  VAL B CA  1 
ATOM   6720 C C   . VAL B 1 330 ? 3.752   7.783   -29.467 1.00 39.28  ? 330  VAL B C   1 
ATOM   6721 O O   . VAL B 1 330 ? 2.808   8.509   -29.205 1.00 48.02  ? 330  VAL B O   1 
ATOM   6722 C CB  . VAL B 1 330 ? 6.078   8.370   -28.943 1.00 39.60  ? 330  VAL B CB  1 
ATOM   6723 C CG1 . VAL B 1 330 ? 7.320   9.120   -29.395 1.00 41.49  ? 330  VAL B CG1 1 
ATOM   6724 C CG2 . VAL B 1 330 ? 5.543   8.973   -27.674 1.00 31.64  ? 330  VAL B CG2 1 
ATOM   6725 N N   . VAL B 1 331 ? 3.745   6.467   -29.264 1.00 40.86  ? 331  VAL B N   1 
ATOM   6726 C CA  . VAL B 1 331 ? 2.608   5.796   -28.647 1.00 34.47  ? 331  VAL B CA  1 
ATOM   6727 C C   . VAL B 1 331 ? 2.970   5.451   -27.208 1.00 43.09  ? 331  VAL B C   1 
ATOM   6728 O O   . VAL B 1 331 ? 4.150   5.516   -26.835 1.00 40.45  ? 331  VAL B O   1 
ATOM   6729 C CB  . VAL B 1 331 ? 2.210   4.538   -29.425 1.00 43.18  ? 331  VAL B CB  1 
ATOM   6730 C CG1 . VAL B 1 331 ? 1.818   4.917   -30.834 1.00 53.14  ? 331  VAL B CG1 1 
ATOM   6731 C CG2 . VAL B 1 331 ? 3.348   3.532   -29.451 1.00 35.14  ? 331  VAL B CG2 1 
ATOM   6732 N N   . LYS B 1 332 ? 1.961   5.104   -26.405 1.00 46.41  ? 332  LYS B N   1 
ATOM   6733 C CA  . LYS B 1 332 ? 2.147   4.898   -24.965 1.00 42.05  ? 332  LYS B CA  1 
ATOM   6734 C C   . LYS B 1 332 ? 3.140   3.772   -24.661 1.00 42.60  ? 332  LYS B C   1 
ATOM   6735 O O   . LYS B 1 332 ? 3.888   3.853   -23.691 1.00 49.25  ? 332  LYS B O   1 
ATOM   6736 C CB  . LYS B 1 332 ? 0.794   4.651   -24.270 1.00 45.27  ? 332  LYS B CB  1 
ATOM   6737 C CG  . LYS B 1 332 ? 0.839   4.622   -22.731 1.00 52.34  ? 332  LYS B CG  1 
ATOM   6738 C CD  . LYS B 1 332 ? -0.570  4.503   -22.122 1.00 61.71  ? 332  LYS B CD  1 
ATOM   6739 C CE  . LYS B 1 332 ? -0.660  3.388   -21.053 1.00 67.94  ? 332  LYS B CE  1 
ATOM   6740 N NZ  . LYS B 1 332 ? -0.927  1.983   -21.592 1.00 58.69  ? 332  LYS B NZ  1 
ATOM   6741 N N   . ASP B 1 333 ? 3.179   2.749   -25.513 1.00 33.10  ? 333  ASP B N   1 
ATOM   6742 C CA  . ASP B 1 333 ? 3.929   1.529   -25.218 1.00 34.57  ? 333  ASP B CA  1 
ATOM   6743 C C   . ASP B 1 333 ? 4.753   1.082   -26.404 1.00 39.93  ? 333  ASP B C   1 
ATOM   6744 O O   . ASP B 1 333 ? 4.558   -0.006  -26.941 1.00 48.61  ? 333  ASP B O   1 
ATOM   6745 C CB  . ASP B 1 333 ? 2.969   0.412   -24.782 1.00 42.18  ? 333  ASP B CB  1 
ATOM   6746 C CG  . ASP B 1 333 ? 2.220   0.762   -23.503 1.00 51.50  ? 333  ASP B CG  1 
ATOM   6747 O OD1 . ASP B 1 333 ? 1.035   1.157   -23.587 1.00 52.41  ? 333  ASP B OD1 1 
ATOM   6748 O OD2 . ASP B 1 333 ? 2.826   0.658   -22.412 1.00 53.73  ? 333  ASP B OD2 1 
ATOM   6749 N N   . GLU B 1 334 ? 5.679   1.940   -26.804 1.00 50.07  ? 334  GLU B N   1 
ATOM   6750 C CA  . GLU B 1 334 ? 6.477   1.745   -28.006 1.00 44.58  ? 334  GLU B CA  1 
ATOM   6751 C C   . GLU B 1 334 ? 7.182   0.411   -27.988 1.00 47.86  ? 334  GLU B C   1 
ATOM   6752 O O   . GLU B 1 334 ? 7.230   -0.265  -29.005 1.00 56.81  ? 334  GLU B O   1 
ATOM   6753 C CB  . GLU B 1 334 ? 7.502   2.872   -28.139 1.00 42.34  ? 334  GLU B CB  1 
ATOM   6754 C CG  . GLU B 1 334 ? 6.896   4.206   -28.516 1.00 46.20  ? 334  GLU B CG  1 
ATOM   6755 C CD  . GLU B 1 334 ? 6.568   4.322   -30.000 1.00 46.84  ? 334  GLU B CD  1 
ATOM   6756 O OE1 . GLU B 1 334 ? 6.970   3.427   -30.772 1.00 37.68  ? 334  GLU B OE1 1 
ATOM   6757 O OE2 . GLU B 1 334 ? 5.920   5.323   -30.390 1.00 47.13  ? 334  GLU B OE2 1 
ATOM   6758 N N   . GLY B 1 335 ? 7.703   0.021   -26.827 1.00 46.40  ? 335  GLY B N   1 
ATOM   6759 C CA  . GLY B 1 335 ? 8.554   -1.151  -26.728 1.00 48.28  ? 335  GLY B CA  1 
ATOM   6760 C C   . GLY B 1 335 ? 7.889   -2.521  -26.781 1.00 58.22  ? 335  GLY B C   1 
ATOM   6761 O O   . GLY B 1 335 ? 8.486   -3.486  -27.267 1.00 66.04  ? 335  GLY B O   1 
ATOM   6762 N N   . SER B 1 336 ? 6.661   -2.624  -26.285 1.00 54.35  ? 336  SER B N   1 
ATOM   6763 C CA  . SER B 1 336 ? 6.053   -3.934  -26.060 1.00 55.76  ? 336  SER B CA  1 
ATOM   6764 C C   . SER B 1 336 ? 6.112   -4.854  -27.302 1.00 60.91  ? 336  SER B C   1 
ATOM   6765 O O   . SER B 1 336 ? 6.692   -5.940  -27.258 1.00 61.14  ? 336  SER B O   1 
ATOM   6766 C CB  . SER B 1 336 ? 4.623   -3.779  -25.533 1.00 52.54  ? 336  SER B CB  1 
ATOM   6767 O OG  . SER B 1 336 ? 3.750   -3.388  -26.568 1.00 59.05  ? 336  SER B OG  1 
ATOM   6768 N N   . TYR B 1 337 ? 5.521   -4.416  -28.404 1.00 58.56  ? 337  TYR B N   1 
ATOM   6769 C CA  . TYR B 1 337 ? 5.627   -5.135  -29.671 1.00 53.91  ? 337  TYR B CA  1 
ATOM   6770 C C   . TYR B 1 337 ? 6.935   -5.920  -29.891 1.00 49.87  ? 337  TYR B C   1 
ATOM   6771 O O   . TYR B 1 337 ? 6.909   -7.073  -30.305 1.00 53.63  ? 337  TYR B O   1 
ATOM   6772 C CB  . TYR B 1 337 ? 5.457   -4.139  -30.808 1.00 61.26  ? 337  TYR B CB  1 
ATOM   6773 C CG  . TYR B 1 337 ? 5.085   -4.750  -32.117 1.00 62.81  ? 337  TYR B CG  1 
ATOM   6774 C CD1 . TYR B 1 337 ? 3.761   -4.869  -32.479 1.00 73.51  ? 337  TYR B CD1 1 
ATOM   6775 C CD2 . TYR B 1 337 ? 6.047   -5.196  -33.001 1.00 69.21  ? 337  TYR B CD2 1 
ATOM   6776 C CE1 . TYR B 1 337 ? 3.389   -5.426  -33.691 1.00 81.64  ? 337  TYR B CE1 1 
ATOM   6777 C CE2 . TYR B 1 337 ? 5.689   -5.762  -34.225 1.00 80.23  ? 337  TYR B CE2 1 
ATOM   6778 C CZ  . TYR B 1 337 ? 4.353   -5.873  -34.565 1.00 82.76  ? 337  TYR B CZ  1 
ATOM   6779 O OH  . TYR B 1 337 ? 3.962   -6.427  -35.774 1.00 78.65  ? 337  TYR B OH  1 
ATOM   6780 N N   . PHE B 1 338 ? 8.080   -5.306  -29.613 1.00 48.12  ? 338  PHE B N   1 
ATOM   6781 C CA  . PHE B 1 338 ? 9.372   -5.885  -30.008 1.00 49.03  ? 338  PHE B CA  1 
ATOM   6782 C C   . PHE B 1 338 ? 9.900   -6.992  -29.118 1.00 55.73  ? 338  PHE B C   1 
ATOM   6783 O O   . PHE B 1 338 ? 10.828  -7.719  -29.506 1.00 56.92  ? 338  PHE B O   1 
ATOM   6784 C CB  . PHE B 1 338 ? 10.429  -4.797  -30.083 1.00 47.53  ? 338  PHE B CB  1 
ATOM   6785 C CG  . PHE B 1 338 ? 10.086  -3.725  -31.037 1.00 56.48  ? 338  PHE B CG  1 
ATOM   6786 C CD1 . PHE B 1 338 ? 9.334   -2.641  -30.628 1.00 53.56  ? 338  PHE B CD1 1 
ATOM   6787 C CD2 . PHE B 1 338 ? 10.480  -3.814  -32.361 1.00 60.46  ? 338  PHE B CD2 1 
ATOM   6788 C CE1 . PHE B 1 338 ? 8.998   -1.650  -31.517 1.00 54.47  ? 338  PHE B CE1 1 
ATOM   6789 C CE2 . PHE B 1 338 ? 10.150  -2.823  -33.260 1.00 58.73  ? 338  PHE B CE2 1 
ATOM   6790 C CZ  . PHE B 1 338 ? 9.403   -1.742  -32.837 1.00 59.34  ? 338  PHE B CZ  1 
ATOM   6791 N N   . LEU B 1 339 ? 9.330   -7.103  -27.922 1.00 55.90  ? 339  LEU B N   1 
ATOM   6792 C CA  . LEU B 1 339 ? 9.841   -8.030  -26.926 1.00 61.41  ? 339  LEU B CA  1 
ATOM   6793 C C   . LEU B 1 339 ? 9.580   -9.492  -27.322 1.00 68.41  ? 339  LEU B C   1 
ATOM   6794 O O   . LEU B 1 339 ? 10.422  -10.367 -27.089 1.00 68.31  ? 339  LEU B O   1 
ATOM   6795 C CB  . LEU B 1 339 ? 9.266   -7.695  -25.544 1.00 58.09  ? 339  LEU B CB  1 
ATOM   6796 C CG  . LEU B 1 339 ? 9.569   -6.275  -25.066 1.00 54.00  ? 339  LEU B CG  1 
ATOM   6797 C CD1 . LEU B 1 339 ? 9.068   -6.056  -23.645 1.00 53.63  ? 339  LEU B CD1 1 
ATOM   6798 C CD2 . LEU B 1 339 ? 11.045  -5.966  -25.170 1.00 51.13  ? 339  LEU B CD2 1 
ATOM   6799 N N   . VAL B 1 340 ? 8.425   -9.742  -27.937 1.00 68.56  ? 340  VAL B N   1 
ATOM   6800 C CA  . VAL B 1 340 ? 8.064   -11.085 -28.394 1.00 72.68  ? 340  VAL B CA  1 
ATOM   6801 C C   . VAL B 1 340 ? 8.913   -11.567 -29.582 1.00 77.35  ? 340  VAL B C   1 
ATOM   6802 O O   . VAL B 1 340 ? 8.856   -12.735 -29.967 1.00 73.46  ? 340  VAL B O   1 
ATOM   6803 C CB  . VAL B 1 340 ? 6.580   -11.155 -28.780 1.00 63.74  ? 340  VAL B CB  1 
ATOM   6804 C CG1 . VAL B 1 340 ? 5.773   -10.310 -27.826 1.00 58.77  ? 340  VAL B CG1 1 
ATOM   6805 C CG2 . VAL B 1 340 ? 6.387   -10.669 -30.201 1.00 60.34  ? 340  VAL B CG2 1 
ATOM   6806 N N   . TYR B 1 341 ? 9.709   -10.664 -30.146 1.00 84.35  ? 341  TYR B N   1 
ATOM   6807 C CA  . TYR B 1 341 ? 10.466  -10.945 -31.363 1.00 92.20  ? 341  TYR B CA  1 
ATOM   6808 C C   . TYR B 1 341 ? 11.939  -11.211 -31.090 1.00 94.61  ? 341  TYR B C   1 
ATOM   6809 O O   . TYR B 1 341 ? 12.770  -11.096 -31.995 1.00 101.54 ? 341  TYR B O   1 
ATOM   6810 C CB  . TYR B 1 341 ? 10.360  -9.771  -32.347 1.00 94.78  ? 341  TYR B CB  1 
ATOM   6811 C CG  . TYR B 1 341 ? 9.189   -9.835  -33.303 1.00 97.41  ? 341  TYR B CG  1 
ATOM   6812 C CD1 . TYR B 1 341 ? 8.039   -9.078  -33.082 1.00 96.06  ? 341  TYR B CD1 1 
ATOM   6813 C CD2 . TYR B 1 341 ? 9.242   -10.635 -34.440 1.00 96.28  ? 341  TYR B CD2 1 
ATOM   6814 C CE1 . TYR B 1 341 ? 6.972   -9.128  -33.961 1.00 97.00  ? 341  TYR B CE1 1 
ATOM   6815 C CE2 . TYR B 1 341 ? 8.183   -10.690 -35.325 1.00 96.62  ? 341  TYR B CE2 1 
ATOM   6816 C CZ  . TYR B 1 341 ? 7.050   -9.937  -35.083 1.00 96.38  ? 341  TYR B CZ  1 
ATOM   6817 O OH  . TYR B 1 341 ? 5.999   -9.996  -35.970 1.00 91.93  ? 341  TYR B OH  1 
ATOM   6818 N N   . GLY B 1 342 ? 12.278  -11.547 -29.852 1.00 86.79  ? 342  GLY B N   1 
ATOM   6819 C CA  . GLY B 1 342 ? 13.669  -11.812 -29.543 1.00 85.02  ? 342  GLY B CA  1 
ATOM   6820 C C   . GLY B 1 342 ? 14.021  -11.876 -28.072 1.00 88.68  ? 342  GLY B C   1 
ATOM   6821 O O   . GLY B 1 342 ? 15.153  -12.203 -27.719 1.00 91.85  ? 342  GLY B O   1 
ATOM   6822 N N   . VAL B 1 343 ? 13.068  -11.570 -27.201 1.00 84.87  ? 343  VAL B N   1 
ATOM   6823 C CA  . VAL B 1 343 ? 13.379  -11.519 -25.778 1.00 75.36  ? 343  VAL B CA  1 
ATOM   6824 C C   . VAL B 1 343 ? 12.705  -12.650 -24.991 1.00 74.44  ? 343  VAL B C   1 
ATOM   6825 O O   . VAL B 1 343 ? 11.479  -12.667 -24.835 1.00 71.47  ? 343  VAL B O   1 
ATOM   6826 C CB  . VAL B 1 343 ? 13.036  -10.148 -25.173 1.00 67.68  ? 343  VAL B CB  1 
ATOM   6827 C CG1 . VAL B 1 343 ? 13.742  -9.984  -23.840 1.00 65.32  ? 343  VAL B CG1 1 
ATOM   6828 C CG2 . VAL B 1 343 ? 13.447  -9.039  -26.122 1.00 62.60  ? 343  VAL B CG2 1 
ATOM   6829 N N   . PRO B 1 344 ? 13.519  -13.602 -24.491 1.00 70.73  ? 344  PRO B N   1 
ATOM   6830 C CA  . PRO B 1 344 ? 13.030  -14.804 -23.803 1.00 66.28  ? 344  PRO B CA  1 
ATOM   6831 C C   . PRO B 1 344 ? 12.141  -14.441 -22.628 1.00 69.69  ? 344  PRO B C   1 
ATOM   6832 O O   . PRO B 1 344 ? 12.524  -13.591 -21.820 1.00 67.92  ? 344  PRO B O   1 
ATOM   6833 C CB  . PRO B 1 344 ? 14.315  -15.457 -23.292 1.00 54.51  ? 344  PRO B CB  1 
ATOM   6834 C CG  . PRO B 1 344 ? 15.363  -14.974 -24.189 1.00 53.64  ? 344  PRO B CG  1 
ATOM   6835 C CD  . PRO B 1 344 ? 14.989  -13.568 -24.539 1.00 58.26  ? 344  PRO B CD  1 
ATOM   6836 N N   . GLY B 1 345 ? 10.971  -15.070 -22.544 1.00 63.23  ? 345  GLY B N   1 
ATOM   6837 C CA  . GLY B 1 345 ? 10.047  -14.802 -21.461 1.00 59.80  ? 345  GLY B CA  1 
ATOM   6838 C C   . GLY B 1 345 ? 8.849   -14.032 -21.967 1.00 67.13  ? 345  GLY B C   1 
ATOM   6839 O O   . GLY B 1 345 ? 7.834   -13.915 -21.277 1.00 76.63  ? 345  GLY B O   1 
ATOM   6840 N N   . PHE B 1 346 ? 8.962   -13.508 -23.183 1.00 61.06  ? 346  PHE B N   1 
ATOM   6841 C CA  . PHE B 1 346 ? 7.901   -12.681 -23.742 1.00 59.32  ? 346  PHE B CA  1 
ATOM   6842 C C   . PHE B 1 346 ? 7.142   -13.407 -24.853 1.00 70.62  ? 346  PHE B C   1 
ATOM   6843 O O   . PHE B 1 346 ? 7.742   -13.992 -25.770 1.00 71.35  ? 346  PHE B O   1 
ATOM   6844 C CB  . PHE B 1 346 ? 8.454   -11.329 -24.223 1.00 55.05  ? 346  PHE B CB  1 
ATOM   6845 C CG  . PHE B 1 346 ? 8.924   -10.428 -23.101 1.00 56.19  ? 346  PHE B CG  1 
ATOM   6846 C CD1 . PHE B 1 346 ? 10.206  -10.551 -22.582 1.00 57.18  ? 346  PHE B CD1 1 
ATOM   6847 C CD2 . PHE B 1 346 ? 8.083   -9.465  -22.566 1.00 54.09  ? 346  PHE B CD2 1 
ATOM   6848 C CE1 . PHE B 1 346 ? 10.640  -9.730  -21.556 1.00 55.18  ? 346  PHE B CE1 1 
ATOM   6849 C CE2 . PHE B 1 346 ? 8.504   -8.656  -21.535 1.00 53.05  ? 346  PHE B CE2 1 
ATOM   6850 C CZ  . PHE B 1 346 ? 9.792   -8.786  -21.031 1.00 54.86  ? 346  PHE B CZ  1 
ATOM   6851 N N   . SER B 1 347 ? 5.816   -13.367 -24.744 1.00 69.84  ? 347  SER B N   1 
ATOM   6852 C CA  . SER B 1 347 ? 4.920   -14.003 -25.697 1.00 70.66  ? 347  SER B CA  1 
ATOM   6853 C C   . SER B 1 347 ? 3.616   -13.237 -25.690 1.00 69.82  ? 347  SER B C   1 
ATOM   6854 O O   . SER B 1 347 ? 3.251   -12.647 -24.668 1.00 67.04  ? 347  SER B O   1 
ATOM   6855 C CB  . SER B 1 347 ? 4.648   -15.457 -25.289 1.00 72.77  ? 347  SER B CB  1 
ATOM   6856 O OG  . SER B 1 347 ? 3.426   -15.934 -25.837 1.00 69.37  ? 347  SER B OG  1 
ATOM   6857 N N   . LYS B 1 348 ? 2.906   -13.266 -26.816 1.00 68.18  ? 348  LYS B N   1 
ATOM   6858 C CA  . LYS B 1 348 ? 1.600   -12.620 -26.913 1.00 65.92  ? 348  LYS B CA  1 
ATOM   6859 C C   . LYS B 1 348 ? 0.516   -13.474 -26.267 1.00 73.99  ? 348  LYS B C   1 
ATOM   6860 O O   . LYS B 1 348 ? -0.596  -13.011 -26.004 1.00 75.94  ? 348  LYS B O   1 
ATOM   6861 C CB  . LYS B 1 348 ? 1.240   -12.355 -28.376 1.00 57.79  ? 348  LYS B CB  1 
ATOM   6862 C CG  . LYS B 1 348 ? 0.906   -13.588 -29.155 1.00 54.31  ? 348  LYS B CG  1 
ATOM   6863 C CD  . LYS B 1 348 ? 0.359   -13.242 -30.517 1.00 55.22  ? 348  LYS B CD  1 
ATOM   6864 C CE  . LYS B 1 348 ? -0.243  -14.470 -31.186 1.00 64.70  ? 348  LYS B CE  1 
ATOM   6865 N NZ  . LYS B 1 348 ? -1.295  -15.130 -30.352 1.00 73.17  ? 348  LYS B NZ  1 
ATOM   6866 N N   . ASP B 1 349 ? 0.854   -14.727 -26.004 1.00 78.74  ? 349  ASP B N   1 
ATOM   6867 C CA  . ASP B 1 349 ? -0.129  -15.667 -25.502 1.00 82.42  ? 349  ASP B CA  1 
ATOM   6868 C C   . ASP B 1 349 ? -0.218  -15.715 -23.979 1.00 88.84  ? 349  ASP B C   1 
ATOM   6869 O O   . ASP B 1 349 ? -1.313  -15.846 -23.435 1.00 94.63  ? 349  ASP B O   1 
ATOM   6870 C CB  . ASP B 1 349 ? 0.090   -17.035 -26.139 1.00 76.88  ? 349  ASP B CB  1 
ATOM   6871 C CG  . ASP B 1 349 ? -0.070  -16.985 -27.654 1.00 83.88  ? 349  ASP B CG  1 
ATOM   6872 O OD1 . ASP B 1 349 ? -1.064  -16.373 -28.120 1.00 82.21  ? 349  ASP B OD1 1 
ATOM   6873 O OD2 . ASP B 1 349 ? 0.794   -17.534 -28.377 1.00 84.76  ? 349  ASP B OD2 1 
ATOM   6874 N N   . ASN B 1 350 ? 0.910   -15.588 -23.283 1.00 85.53  ? 350  ASN B N   1 
ATOM   6875 C CA  . ASN B 1 350 ? 0.824   -15.477 -21.832 1.00 82.15  ? 350  ASN B CA  1 
ATOM   6876 C C   . ASN B 1 350 ? 0.743   -14.031 -21.361 1.00 80.23  ? 350  ASN B C   1 
ATOM   6877 O O   . ASN B 1 350 ? 0.026   -13.228 -21.950 1.00 79.87  ? 350  ASN B O   1 
ATOM   6878 C CB  . ASN B 1 350 ? 1.862   -16.342 -21.066 1.00 63.06  ? 350  ASN B CB  1 
ATOM   6879 C CG  . ASN B 1 350 ? 3.312   -16.134 -21.519 1.00 70.43  ? 350  ASN B CG  1 
ATOM   6880 O OD1 . ASN B 1 350 ? 4.008   -17.095 -21.881 1.00 70.24  ? 350  ASN B OD1 1 
ATOM   6881 N ND2 . ASN B 1 350 ? 3.791   -14.899 -21.432 1.00 71.24  ? 350  ASN B ND2 1 
ATOM   6882 N N   . GLU B 1 351 ? 1.449   -13.710 -20.290 1.00 78.19  ? 351  GLU B N   1 
ATOM   6883 C CA  . GLU B 1 351 ? 1.457   -12.356 -19.777 1.00 74.13  ? 351  GLU B CA  1 
ATOM   6884 C C   . GLU B 1 351 ? 2.869   -11.899 -19.496 1.00 69.39  ? 351  GLU B C   1 
ATOM   6885 O O   . GLU B 1 351 ? 3.093   -10.894 -18.814 1.00 65.83  ? 351  GLU B O   1 
ATOM   6886 C CB  . GLU B 1 351 ? 0.656   -12.275 -18.502 1.00 74.33  ? 351  GLU B CB  1 
ATOM   6887 C CG  . GLU B 1 351 ? -0.776  -11.971 -18.718 1.00 85.66  ? 351  GLU B CG  1 
ATOM   6888 C CD  . GLU B 1 351 ? -1.475  -11.813 -17.403 1.00 101.81 ? 351  GLU B CD  1 
ATOM   6889 O OE1 . GLU B 1 351 ? -0.766  -11.516 -16.413 1.00 103.70 ? 351  GLU B OE1 1 
ATOM   6890 O OE2 . GLU B 1 351 ? -2.713  -11.998 -17.354 1.00 108.74 ? 351  GLU B OE2 1 
ATOM   6891 N N   . SER B 1 352 ? 3.818   -12.665 -20.006 1.00 65.39  ? 352  SER B N   1 
ATOM   6892 C CA  . SER B 1 352 ? 5.198   -12.239 -20.024 1.00 65.84  ? 352  SER B CA  1 
ATOM   6893 C C   . SER B 1 352 ? 5.628   -11.623 -18.702 1.00 62.86  ? 352  SER B C   1 
ATOM   6894 O O   . SER B 1 352 ? 6.139   -10.512 -18.681 1.00 64.72  ? 352  SER B O   1 
ATOM   6895 C CB  . SER B 1 352 ? 5.396   -11.224 -21.156 1.00 67.09  ? 352  SER B CB  1 
ATOM   6896 O OG  . SER B 1 352 ? 4.800   -11.677 -22.363 1.00 68.59  ? 352  SER B OG  1 
ATOM   6897 N N   . LEU B 1 353 ? 5.399   -12.328 -17.599 1.00 63.84  ? 353  LEU B N   1 
ATOM   6898 C CA  . LEU B 1 353 ? 5.960   -11.921 -16.314 1.00 58.92  ? 353  LEU B CA  1 
ATOM   6899 C C   . LEU B 1 353 ? 7.350   -12.518 -16.247 1.00 61.75  ? 353  LEU B C   1 
ATOM   6900 O O   . LEU B 1 353 ? 7.539   -13.688 -16.560 1.00 61.69  ? 353  LEU B O   1 
ATOM   6901 C CB  . LEU B 1 353 ? 5.104   -12.419 -15.158 1.00 56.07  ? 353  LEU B CB  1 
ATOM   6902 C CG  . LEU B 1 353 ? 3.644   -11.973 -15.266 1.00 67.39  ? 353  LEU B CG  1 
ATOM   6903 C CD1 . LEU B 1 353 ? 2.675   -13.032 -14.721 1.00 72.56  ? 353  LEU B CD1 1 
ATOM   6904 C CD2 . LEU B 1 353 ? 3.412   -10.622 -14.600 1.00 61.81  ? 353  LEU B CD2 1 
ATOM   6905 N N   . ILE B 1 354 ? 8.337   -11.720 -15.871 1.00 58.52  ? 354  ILE B N   1 
ATOM   6906 C CA  . ILE B 1 354 ? 9.710   -12.173 -16.008 1.00 56.68  ? 354  ILE B CA  1 
ATOM   6907 C C   . ILE B 1 354 ? 10.518  -12.099 -14.719 1.00 60.40  ? 354  ILE B C   1 
ATOM   6908 O O   . ILE B 1 354 ? 10.151  -11.398 -13.776 1.00 60.57  ? 354  ILE B O   1 
ATOM   6909 C CB  . ILE B 1 354 ? 10.403  -11.415 -17.136 1.00 50.50  ? 354  ILE B CB  1 
ATOM   6910 C CG1 . ILE B 1 354 ? 10.244  -9.903  -16.942 1.00 51.40  ? 354  ILE B CG1 1 
ATOM   6911 C CG2 . ILE B 1 354 ? 9.768   -11.802 -18.448 1.00 50.32  ? 354  ILE B CG2 1 
ATOM   6912 C CD1 . ILE B 1 354 ? 11.145  -9.070  -17.821 1.00 45.78  ? 354  ILE B CD1 1 
ATOM   6913 N N   . SER B 1 355 ? 11.614  -12.849 -14.681 1.00 63.74  ? 355  SER B N   1 
ATOM   6914 C CA  . SER B 1 355 ? 12.490  -12.835 -13.524 1.00 67.92  ? 355  SER B CA  1 
ATOM   6915 C C   . SER B 1 355 ? 13.468  -11.686 -13.655 1.00 67.14  ? 355  SER B C   1 
ATOM   6916 O O   . SER B 1 355 ? 13.698  -11.178 -14.752 1.00 63.41  ? 355  SER B O   1 
ATOM   6917 C CB  . SER B 1 355 ? 13.267  -14.140 -13.429 1.00 73.89  ? 355  SER B CB  1 
ATOM   6918 O OG  . SER B 1 355 ? 14.055  -14.338 -14.592 1.00 80.02  ? 355  SER B OG  1 
ATOM   6919 N N   . ARG B 1 356 ? 14.034  -11.273 -12.533 1.00 66.57  ? 356  ARG B N   1 
ATOM   6920 C CA  . ARG B 1 356 ? 15.128  -10.318 -12.554 1.00 65.78  ? 356  ARG B CA  1 
ATOM   6921 C C   . ARG B 1 356 ? 16.196  -10.740 -13.584 1.00 74.63  ? 356  ARG B C   1 
ATOM   6922 O O   . ARG B 1 356 ? 16.795  -9.897  -14.254 1.00 77.12  ? 356  ARG B O   1 
ATOM   6923 C CB  . ARG B 1 356 ? 15.730  -10.205 -11.154 1.00 58.84  ? 356  ARG B CB  1 
ATOM   6924 C CG  . ARG B 1 356 ? 16.891  -9.240  -11.042 1.00 64.95  ? 356  ARG B CG  1 
ATOM   6925 C CD  . ARG B 1 356 ? 16.534  -7.962  -10.302 1.00 70.47  ? 356  ARG B CD  1 
ATOM   6926 N NE  . ARG B 1 356 ? 17.713  -7.102  -10.213 1.00 87.85  ? 356  ARG B NE  1 
ATOM   6927 C CZ  . ARG B 1 356 ? 17.751  -5.820  -10.579 1.00 88.05  ? 356  ARG B CZ  1 
ATOM   6928 N NH1 . ARG B 1 356 ? 16.652  -5.230  -11.040 1.00 75.21  ? 356  ARG B NH1 1 
ATOM   6929 N NH2 . ARG B 1 356 ? 18.886  -5.125  -10.461 1.00 85.49  ? 356  ARG B NH2 1 
ATOM   6930 N N   . ALA B 1 357 ? 16.401  -12.052 -13.725 1.00 73.90  ? 357  ALA B N   1 
ATOM   6931 C CA  . ALA B 1 357 ? 17.455  -12.611 -14.579 1.00 60.54  ? 357  ALA B CA  1 
ATOM   6932 C C   . ALA B 1 357 ? 17.206  -12.357 -16.044 1.00 65.51  ? 357  ALA B C   1 
ATOM   6933 O O   . ALA B 1 357 ? 18.088  -11.909 -16.776 1.00 66.09  ? 357  ALA B O   1 
ATOM   6934 C CB  . ALA B 1 357 ? 17.555  -14.085 -14.353 1.00 43.29  ? 357  ALA B CB  1 
ATOM   6935 N N   . GLN B 1 358 ? 15.993  -12.706 -16.455 1.00 67.17  ? 358  GLN B N   1 
ATOM   6936 C CA  . GLN B 1 358 ? 15.507  -12.487 -17.797 1.00 63.77  ? 358  GLN B CA  1 
ATOM   6937 C C   . GLN B 1 358 ? 15.500  -11.011 -18.112 1.00 64.98  ? 358  GLN B C   1 
ATOM   6938 O O   . GLN B 1 358 ? 15.640  -10.607 -19.264 1.00 61.29  ? 358  GLN B O   1 
ATOM   6939 C CB  . GLN B 1 358 ? 14.095  -13.030 -17.885 1.00 59.69  ? 358  GLN B CB  1 
ATOM   6940 C CG  . GLN B 1 358 ? 14.050  -14.504 -17.600 1.00 64.48  ? 358  GLN B CG  1 
ATOM   6941 C CD  . GLN B 1 358 ? 12.677  -15.081 -17.767 1.00 61.27  ? 358  GLN B CD  1 
ATOM   6942 O OE1 . GLN B 1 358 ? 12.454  -15.928 -18.627 1.00 53.38  ? 358  GLN B OE1 1 
ATOM   6943 N NE2 . GLN B 1 358 ? 11.737  -14.621 -16.948 1.00 64.43  ? 358  GLN B NE2 1 
ATOM   6944 N N   . PHE B 1 359 ? 15.342  -10.195 -17.079 1.00 66.04  ? 359  PHE B N   1 
ATOM   6945 C CA  . PHE B 1 359 ? 15.340  -8.764  -17.289 1.00 61.95  ? 359  PHE B CA  1 
ATOM   6946 C C   . PHE B 1 359 ? 16.739  -8.270  -17.630 1.00 59.50  ? 359  PHE B C   1 
ATOM   6947 O O   . PHE B 1 359 ? 16.887  -7.502  -18.572 1.00 62.69  ? 359  PHE B O   1 
ATOM   6948 C CB  . PHE B 1 359 ? 14.718  -8.008  -16.112 1.00 61.78  ? 359  PHE B CB  1 
ATOM   6949 C CG  . PHE B 1 359 ? 14.853  -6.520  -16.220 1.00 58.55  ? 359  PHE B CG  1 
ATOM   6950 C CD1 . PHE B 1 359 ? 15.704  -5.826  -15.386 1.00 57.49  ? 359  PHE B CD1 1 
ATOM   6951 C CD2 . PHE B 1 359 ? 14.154  -5.815  -17.177 1.00 59.42  ? 359  PHE B CD2 1 
ATOM   6952 C CE1 . PHE B 1 359 ? 15.839  -4.461  -15.504 1.00 57.38  ? 359  PHE B CE1 1 
ATOM   6953 C CE2 . PHE B 1 359 ? 14.286  -4.435  -17.294 1.00 54.50  ? 359  PHE B CE2 1 
ATOM   6954 C CZ  . PHE B 1 359 ? 15.128  -3.767  -16.466 1.00 52.88  ? 359  PHE B CZ  1 
ATOM   6955 N N   . LEU B 1 360 ? 17.767  -8.719  -16.908 1.00 60.05  ? 360  LEU B N   1 
ATOM   6956 C CA  . LEU B 1 360 ? 19.143  -8.309  -17.254 1.00 58.06  ? 360  LEU B CA  1 
ATOM   6957 C C   . LEU B 1 360 ? 19.519  -8.869  -18.626 1.00 61.22  ? 360  LEU B C   1 
ATOM   6958 O O   . LEU B 1 360 ? 20.153  -8.194  -19.446 1.00 54.24  ? 360  LEU B O   1 
ATOM   6959 C CB  . LEU B 1 360 ? 20.164  -8.714  -16.191 1.00 52.20  ? 360  LEU B CB  1 
ATOM   6960 C CG  . LEU B 1 360 ? 19.790  -8.442  -14.717 1.00 66.06  ? 360  LEU B CG  1 
ATOM   6961 C CD1 . LEU B 1 360 ? 21.012  -8.245  -13.835 1.00 62.15  ? 360  LEU B CD1 1 
ATOM   6962 C CD2 . LEU B 1 360 ? 18.868  -7.239  -14.555 1.00 74.00  ? 360  LEU B CD2 1 
ATOM   6963 N N   . ALA B 1 361 ? 19.085  -10.097 -18.882 1.00 63.64  ? 361  ALA B N   1 
ATOM   6964 C CA  . ALA B 1 361 ? 19.279  -10.724 -20.180 1.00 61.63  ? 361  ALA B CA  1 
ATOM   6965 C C   . ALA B 1 361 ? 18.651  -9.881  -21.289 1.00 64.94  ? 361  ALA B C   1 
ATOM   6966 O O   . ALA B 1 361 ? 19.267  -9.646  -22.339 1.00 63.44  ? 361  ALA B O   1 
ATOM   6967 C CB  . ALA B 1 361 ? 18.684  -12.116 -20.176 1.00 56.78  ? 361  ALA B CB  1 
ATOM   6968 N N   . GLY B 1 362 ? 17.421  -9.432  -21.046 1.00 64.54  ? 362  GLY B N   1 
ATOM   6969 C CA  . GLY B 1 362 ? 16.657  -8.687  -22.035 1.00 55.68  ? 362  GLY B CA  1 
ATOM   6970 C C   . GLY B 1 362 ? 17.287  -7.351  -22.356 1.00 56.56  ? 362  GLY B C   1 
ATOM   6971 O O   . GLY B 1 362 ? 17.140  -6.844  -23.462 1.00 52.91  ? 362  GLY B O   1 
ATOM   6972 N N   . VAL B 1 363 ? 18.004  -6.790  -21.385 1.00 56.87  ? 363  VAL B N   1 
ATOM   6973 C CA  . VAL B 1 363 ? 18.665  -5.506  -21.561 1.00 52.00  ? 363  VAL B CA  1 
ATOM   6974 C C   . VAL B 1 363 ? 19.900  -5.579  -22.478 1.00 57.90  ? 363  VAL B C   1 
ATOM   6975 O O   . VAL B 1 363 ? 20.133  -4.656  -23.250 1.00 65.00  ? 363  VAL B O   1 
ATOM   6976 C CB  . VAL B 1 363 ? 18.995  -4.857  -20.203 1.00 46.53  ? 363  VAL B CB  1 
ATOM   6977 C CG1 . VAL B 1 363 ? 20.015  -3.741  -20.356 1.00 38.86  ? 363  VAL B CG1 1 
ATOM   6978 C CG2 . VAL B 1 363 ? 17.726  -4.343  -19.552 1.00 47.50  ? 363  VAL B CG2 1 
ATOM   6979 N N   . ARG B 1 364 ? 20.667  -6.671  -22.434 1.00 54.39  ? 364  ARG B N   1 
ATOM   6980 C CA  . ARG B 1 364 ? 21.828  -6.803  -23.329 1.00 49.32  ? 364  ARG B CA  1 
ATOM   6981 C C   . ARG B 1 364 ? 21.384  -6.977  -24.779 1.00 55.96  ? 364  ARG B C   1 
ATOM   6982 O O   . ARG B 1 364 ? 22.177  -6.844  -25.711 1.00 56.47  ? 364  ARG B O   1 
ATOM   6983 C CB  . ARG B 1 364 ? 22.723  -7.967  -22.926 1.00 45.30  ? 364  ARG B CB  1 
ATOM   6984 C CG  . ARG B 1 364 ? 23.032  -8.063  -21.444 1.00 61.84  ? 364  ARG B CG  1 
ATOM   6985 C CD  . ARG B 1 364 ? 23.750  -6.826  -20.892 1.00 73.59  ? 364  ARG B CD  1 
ATOM   6986 N NE  . ARG B 1 364 ? 24.925  -6.432  -21.675 1.00 81.48  ? 364  ARG B NE  1 
ATOM   6987 C CZ  . ARG B 1 364 ? 26.186  -6.502  -21.244 1.00 87.28  ? 364  ARG B CZ  1 
ATOM   6988 N NH1 . ARG B 1 364 ? 26.463  -6.957  -20.021 1.00 81.29  ? 364  ARG B NH1 1 
ATOM   6989 N NH2 . ARG B 1 364 ? 27.176  -6.111  -22.044 1.00 90.53  ? 364  ARG B NH2 1 
ATOM   6990 N N   . ILE B 1 365 ? 20.101  -7.265  -24.957 1.00 55.62  ? 365  ILE B N   1 
ATOM   6991 C CA  . ILE B 1 365 ? 19.526  -7.438  -26.275 1.00 53.19  ? 365  ILE B CA  1 
ATOM   6992 C C   . ILE B 1 365 ? 18.880  -6.157  -26.782 1.00 56.80  ? 365  ILE B C   1 
ATOM   6993 O O   . ILE B 1 365 ? 18.983  -5.831  -27.972 1.00 63.05  ? 365  ILE B O   1 
ATOM   6994 C CB  . ILE B 1 365 ? 18.446  -8.524  -26.264 1.00 55.57  ? 365  ILE B CB  1 
ATOM   6995 C CG1 . ILE B 1 365 ? 19.072  -9.907  -26.125 1.00 50.16  ? 365  ILE B CG1 1 
ATOM   6996 C CG2 . ILE B 1 365 ? 17.586  -8.456  -27.540 1.00 54.39  ? 365  ILE B CG2 1 
ATOM   6997 C CD1 . ILE B 1 365 ? 18.041  -11.022 -26.150 1.00 45.34  ? 365  ILE B CD1 1 
ATOM   6998 N N   . GLY B 1 366 ? 18.196  -5.443  -25.891 1.00 48.05  ? 366  GLY B N   1 
ATOM   6999 C CA  . GLY B 1 366 ? 17.479  -4.239  -26.290 1.00 53.02  ? 366  GLY B CA  1 
ATOM   7000 C C   . GLY B 1 366 ? 18.434  -3.097  -26.589 1.00 51.14  ? 366  GLY B C   1 
ATOM   7001 O O   . GLY B 1 366 ? 18.207  -2.272  -27.488 1.00 53.36  ? 366  GLY B O   1 
ATOM   7002 N N   . VAL B 1 367 ? 19.518  -3.089  -25.823 1.00 45.34  ? 367  VAL B N   1 
ATOM   7003 C CA  . VAL B 1 367 ? 20.622  -2.155  -25.970 1.00 54.98  ? 367  VAL B CA  1 
ATOM   7004 C C   . VAL B 1 367 ? 21.868  -2.969  -26.326 1.00 50.08  ? 367  VAL B C   1 
ATOM   7005 O O   . VAL B 1 367 ? 22.850  -2.966  -25.595 1.00 45.58  ? 367  VAL B O   1 
ATOM   7006 C CB  . VAL B 1 367 ? 20.850  -1.408  -24.633 1.00 52.30  ? 367  VAL B CB  1 
ATOM   7007 C CG1 . VAL B 1 367 ? 21.875  -0.274  -24.764 1.00 34.59  ? 367  VAL B CG1 1 
ATOM   7008 C CG2 . VAL B 1 367 ? 19.528  -0.899  -24.114 1.00 55.95  ? 367  VAL B CG2 1 
ATOM   7009 N N   . PRO B 1 368 ? 21.824  -3.663  -27.467 1.00 54.34  ? 368  PRO B N   1 
ATOM   7010 C CA  . PRO B 1 368 ? 22.785  -4.700  -27.869 1.00 57.73  ? 368  PRO B CA  1 
ATOM   7011 C C   . PRO B 1 368 ? 24.189  -4.148  -27.941 1.00 56.99  ? 368  PRO B C   1 
ATOM   7012 O O   . PRO B 1 368 ? 25.171  -4.895  -27.899 1.00 62.39  ? 368  PRO B O   1 
ATOM   7013 C CB  . PRO B 1 368 ? 22.332  -5.043  -29.282 1.00 66.02  ? 368  PRO B CB  1 
ATOM   7014 C CG  . PRO B 1 368 ? 21.699  -3.760  -29.760 1.00 65.91  ? 368  PRO B CG  1 
ATOM   7015 C CD  . PRO B 1 368 ? 20.904  -3.340  -28.565 1.00 56.38  ? 368  PRO B CD  1 
ATOM   7016 N N   . GLN B 1 369 ? 24.275  -2.829  -28.024 1.00 53.54  ? 369  GLN B N   1 
ATOM   7017 C CA  . GLN B 1 369 ? 25.544  -2.172  -28.253 1.00 66.70  ? 369  GLN B CA  1 
ATOM   7018 C C   . GLN B 1 369 ? 26.145  -1.673  -26.965 1.00 69.53  ? 369  GLN B C   1 
ATOM   7019 O O   . GLN B 1 369 ? 27.211  -1.060  -26.972 1.00 73.21  ? 369  GLN B O   1 
ATOM   7020 C CB  . GLN B 1 369 ? 25.354  -1.034  -29.245 1.00 79.79  ? 369  GLN B CB  1 
ATOM   7021 C CG  . GLN B 1 369 ? 23.885  -0.806  -29.616 1.00 91.46  ? 369  GLN B CG  1 
ATOM   7022 C CD  . GLN B 1 369 ? 23.141  0.038   -28.587 1.00 86.42  ? 369  GLN B CD  1 
ATOM   7023 O OE1 . GLN B 1 369 ? 23.758  0.822   -27.867 1.00 77.93  ? 369  GLN B OE1 1 
ATOM   7024 N NE2 . GLN B 1 369 ? 21.808  -0.101  -28.535 1.00 81.53  ? 369  GLN B NE2 1 
ATOM   7025 N N   . ALA B 1 370 ? 25.472  -1.974  -25.856 1.00 62.53  ? 370  ALA B N   1 
ATOM   7026 C CA  . ALA B 1 370 ? 25.913  -1.527  -24.536 1.00 60.55  ? 370  ALA B CA  1 
ATOM   7027 C C   . ALA B 1 370 ? 27.146  -2.260  -24.039 1.00 54.93  ? 370  ALA B C   1 
ATOM   7028 O O   . ALA B 1 370 ? 27.327  -3.433  -24.331 1.00 63.51  ? 370  ALA B O   1 
ATOM   7029 C CB  . ALA B 1 370 ? 24.790  -1.684  -23.529 1.00 57.83  ? 370  ALA B CB  1 
ATOM   7030 N N   . SER B 1 371 ? 27.980  -1.554  -23.279 1.00 48.40  ? 371  SER B N   1 
ATOM   7031 C CA  . SER B 1 371 ? 29.086  -2.165  -22.542 1.00 59.24  ? 371  SER B CA  1 
ATOM   7032 C C   . SER B 1 371 ? 28.552  -2.791  -21.257 1.00 59.78  ? 371  SER B C   1 
ATOM   7033 O O   . SER B 1 371 ? 27.397  -2.611  -20.923 1.00 58.53  ? 371  SER B O   1 
ATOM   7034 C CB  . SER B 1 371 ? 30.181  -1.136  -22.223 1.00 62.48  ? 371  SER B CB  1 
ATOM   7035 O OG  . SER B 1 371 ? 29.744  -0.176  -21.280 1.00 59.54  ? 371  SER B OG  1 
ATOM   7036 N N   . ASP B 1 372 ? 29.371  -3.538  -20.534 1.00 66.84  ? 372  ASP B N   1 
ATOM   7037 C CA  . ASP B 1 372 ? 28.839  -4.196  -19.354 1.00 72.01  ? 372  ASP B CA  1 
ATOM   7038 C C   . ASP B 1 372 ? 28.296  -3.143  -18.416 1.00 70.87  ? 372  ASP B C   1 
ATOM   7039 O O   . ASP B 1 372 ? 27.196  -3.290  -17.878 1.00 75.12  ? 372  ASP B O   1 
ATOM   7040 C CB  . ASP B 1 372 ? 29.897  -5.048  -18.656 1.00 76.23  ? 372  ASP B CB  1 
ATOM   7041 C CG  . ASP B 1 372 ? 30.169  -6.351  -19.386 1.00 86.04  ? 372  ASP B CG  1 
ATOM   7042 O OD1 . ASP B 1 372 ? 29.902  -6.427  -20.609 1.00 92.35  ? 372  ASP B OD1 1 
ATOM   7043 O OD2 . ASP B 1 372 ? 30.660  -7.298  -18.736 1.00 85.57  ? 372  ASP B OD2 1 
ATOM   7044 N N   . LEU B 1 373 ? 29.059  -2.065  -18.250 1.00 61.84  ? 373  LEU B N   1 
ATOM   7045 C CA  . LEU B 1 373 ? 28.728  -1.043  -17.256 1.00 60.14  ? 373  LEU B CA  1 
ATOM   7046 C C   . LEU B 1 373 ? 27.513  -0.212  -17.641 1.00 62.57  ? 373  LEU B C   1 
ATOM   7047 O O   . LEU B 1 373 ? 26.717  0.184   -16.781 1.00 60.86  ? 373  LEU B O   1 
ATOM   7048 C CB  . LEU B 1 373 ? 29.925  -0.125  -17.011 1.00 57.23  ? 373  LEU B CB  1 
ATOM   7049 C CG  . LEU B 1 373 ? 29.731  1.062   -16.064 1.00 56.53  ? 373  LEU B CG  1 
ATOM   7050 C CD1 . LEU B 1 373 ? 29.420  0.646   -14.623 1.00 55.08  ? 373  LEU B CD1 1 
ATOM   7051 C CD2 . LEU B 1 373 ? 30.963  1.921   -16.104 1.00 54.15  ? 373  LEU B CD2 1 
ATOM   7052 N N   . ALA B 1 374 ? 27.394  0.061   -18.936 1.00 58.92  ? 374  ALA B N   1 
ATOM   7053 C CA  . ALA B 1 374 ? 26.269  0.803   -19.475 1.00 53.30  ? 374  ALA B CA  1 
ATOM   7054 C C   . ALA B 1 374 ? 24.981  0.006   -19.313 1.00 56.54  ? 374  ALA B C   1 
ATOM   7055 O O   . ALA B 1 374 ? 23.913  0.574   -19.081 1.00 59.96  ? 374  ALA B O   1 
ATOM   7056 C CB  . ALA B 1 374 ? 26.512  1.131   -20.927 1.00 47.15  ? 374  ALA B CB  1 
ATOM   7057 N N   . ALA B 1 375 ? 25.086  -1.310  -19.431 1.00 54.74  ? 375  ALA B N   1 
ATOM   7058 C CA  . ALA B 1 375 ? 23.928  -2.175  -19.302 1.00 46.63  ? 375  ALA B CA  1 
ATOM   7059 C C   . ALA B 1 375 ? 23.524  -2.238  -17.841 1.00 52.62  ? 375  ALA B C   1 
ATOM   7060 O O   . ALA B 1 375 ? 22.340  -2.310  -17.523 1.00 60.78  ? 375  ALA B O   1 
ATOM   7061 C CB  . ALA B 1 375 ? 24.245  -3.539  -19.819 1.00 38.08  ? 375  ALA B CB  1 
ATOM   7062 N N   . GLU B 1 376 ? 24.511  -2.205  -16.952 1.00 48.37  ? 376  GLU B N   1 
ATOM   7063 C CA  . GLU B 1 376 ? 24.226  -2.159  -15.518 1.00 57.66  ? 376  GLU B CA  1 
ATOM   7064 C C   . GLU B 1 376 ? 23.479  -0.889  -15.149 1.00 58.92  ? 376  GLU B C   1 
ATOM   7065 O O   . GLU B 1 376 ? 22.553  -0.909  -14.341 1.00 59.69  ? 376  GLU B O   1 
ATOM   7066 C CB  . GLU B 1 376 ? 25.512  -2.236  -14.702 1.00 58.94  ? 376  GLU B CB  1 
ATOM   7067 C CG  . GLU B 1 376 ? 25.719  -3.553  -14.010 1.00 76.39  ? 376  GLU B CG  1 
ATOM   7068 C CD  . GLU B 1 376 ? 27.193  -3.879  -13.842 1.00 94.96  ? 376  GLU B CD  1 
ATOM   7069 O OE1 . GLU B 1 376 ? 27.648  -4.063  -12.686 1.00 104.64 ? 376  GLU B OE1 1 
ATOM   7070 O OE2 . GLU B 1 376 ? 27.900  -3.938  -14.874 1.00 93.18  ? 376  GLU B OE2 1 
ATOM   7071 N N   . ALA B 1 377 ? 23.918  0.217   -15.738 1.00 56.84  ? 377  ALA B N   1 
ATOM   7072 C CA  . ALA B 1 377 ? 23.313  1.512   -15.517 1.00 46.63  ? 377  ALA B CA  1 
ATOM   7073 C C   . ALA B 1 377 ? 21.862  1.485   -15.964 1.00 52.48  ? 377  ALA B C   1 
ATOM   7074 O O   . ALA B 1 377 ? 20.992  2.054   -15.316 1.00 61.80  ? 377  ALA B O   1 
ATOM   7075 C CB  . ALA B 1 377 ? 24.070  2.573   -16.277 1.00 37.63  ? 377  ALA B CB  1 
ATOM   7076 N N   . VAL B 1 378 ? 21.593  0.824   -17.078 1.00 48.26  ? 378  VAL B N   1 
ATOM   7077 C CA  . VAL B 1 378 ? 20.231  0.761   -17.568 1.00 40.54  ? 378  VAL B CA  1 
ATOM   7078 C C   . VAL B 1 378 ? 19.397  -0.011  -16.585 1.00 47.71  ? 378  VAL B C   1 
ATOM   7079 O O   . VAL B 1 378 ? 18.351  0.450   -16.152 1.00 57.60  ? 378  VAL B O   1 
ATOM   7080 C CB  . VAL B 1 378 ? 20.165  0.107   -18.923 1.00 38.62  ? 378  VAL B CB  1 
ATOM   7081 C CG1 . VAL B 1 378 ? 18.752  -0.354  -19.226 1.00 41.95  ? 378  VAL B CG1 1 
ATOM   7082 C CG2 . VAL B 1 378 ? 20.643  1.090   -19.964 1.00 39.20  ? 378  VAL B CG2 1 
ATOM   7083 N N   . VAL B 1 379 ? 19.878  -1.183  -16.211 1.00 48.06  ? 379  VAL B N   1 
ATOM   7084 C CA  . VAL B 1 379 ? 19.200  -1.983  -15.206 1.00 52.84  ? 379  VAL B CA  1 
ATOM   7085 C C   . VAL B 1 379 ? 18.904  -1.198  -13.928 1.00 49.61  ? 379  VAL B C   1 
ATOM   7086 O O   . VAL B 1 379 ? 17.796  -1.263  -13.400 1.00 52.32  ? 379  VAL B O   1 
ATOM   7087 C CB  . VAL B 1 379 ? 20.012  -3.235  -14.867 1.00 52.13  ? 379  VAL B CB  1 
ATOM   7088 C CG1 . VAL B 1 379 ? 19.326  -4.018  -13.758 1.00 44.19  ? 379  VAL B CG1 1 
ATOM   7089 C CG2 . VAL B 1 379 ? 20.204  -4.092  -16.136 1.00 48.29  ? 379  VAL B CG2 1 
ATOM   7090 N N   . LEU B 1 380 ? 19.880  -0.441  -13.446 1.00 39.82  ? 380  LEU B N   1 
ATOM   7091 C CA  . LEU B 1 380 ? 19.719  0.256   -12.179 1.00 53.08  ? 380  LEU B CA  1 
ATOM   7092 C C   . LEU B 1 380 ? 18.697  1.374   -12.281 1.00 57.15  ? 380  LEU B C   1 
ATOM   7093 O O   . LEU B 1 380 ? 17.961  1.655   -11.340 1.00 62.59  ? 380  LEU B O   1 
ATOM   7094 C CB  . LEU B 1 380 ? 21.065  0.785   -11.658 1.00 57.75  ? 380  LEU B CB  1 
ATOM   7095 C CG  . LEU B 1 380 ? 22.101  -0.323  -11.375 1.00 65.91  ? 380  LEU B CG  1 
ATOM   7096 C CD1 . LEU B 1 380 ? 23.198  0.187   -10.471 1.00 73.57  ? 380  LEU B CD1 1 
ATOM   7097 C CD2 . LEU B 1 380 ? 21.484  -1.592  -10.755 1.00 63.23  ? 380  LEU B CD2 1 
ATOM   7098 N N   . HIS B 1 381 ? 18.643  2.001   -13.444 1.00 52.56  ? 381  HIS B N   1 
ATOM   7099 C CA  . HIS B 1 381 ? 17.738  3.117   -13.669 1.00 48.30  ? 381  HIS B CA  1 
ATOM   7100 C C   . HIS B 1 381 ? 16.271  2.680   -13.764 1.00 49.64  ? 381  HIS B C   1 
ATOM   7101 O O   . HIS B 1 381 ? 15.377  3.342   -13.239 1.00 52.16  ? 381  HIS B O   1 
ATOM   7102 C CB  . HIS B 1 381 ? 18.142  3.850   -14.948 1.00 45.50  ? 381  HIS B CB  1 
ATOM   7103 C CG  . HIS B 1 381 ? 17.313  5.055   -15.232 1.00 46.57  ? 381  HIS B CG  1 
ATOM   7104 N ND1 . HIS B 1 381 ? 17.612  6.299   -14.720 1.00 52.46  ? 381  HIS B ND1 1 
ATOM   7105 C CD2 . HIS B 1 381 ? 16.176  5.205   -15.953 1.00 45.64  ? 381  HIS B CD2 1 
ATOM   7106 C CE1 . HIS B 1 381 ? 16.706  7.169   -15.129 1.00 56.02  ? 381  HIS B CE1 1 
ATOM   7107 N NE2 . HIS B 1 381 ? 15.822  6.533   -15.880 1.00 53.05  ? 381  HIS B NE2 1 
ATOM   7108 N N   . TYR B 1 382 ? 16.041  1.560   -14.441 1.00 51.02  ? 382  TYR B N   1 
ATOM   7109 C CA  . TYR B 1 382 ? 14.697  1.043   -14.665 1.00 52.25  ? 382  TYR B CA  1 
ATOM   7110 C C   . TYR B 1 382 ? 14.188  0.096   -13.568 1.00 57.15  ? 382  TYR B C   1 
ATOM   7111 O O   . TYR B 1 382 ? 12.990  -0.127  -13.455 1.00 66.63  ? 382  TYR B O   1 
ATOM   7112 C CB  . TYR B 1 382 ? 14.598  0.376   -16.047 1.00 49.76  ? 382  TYR B CB  1 
ATOM   7113 C CG  . TYR B 1 382 ? 14.513  1.366   -17.188 1.00 48.32  ? 382  TYR B CG  1 
ATOM   7114 C CD1 . TYR B 1 382 ? 15.662  1.885   -17.771 1.00 51.11  ? 382  TYR B CD1 1 
ATOM   7115 C CD2 . TYR B 1 382 ? 13.285  1.790   -17.675 1.00 43.44  ? 382  TYR B CD2 1 
ATOM   7116 C CE1 . TYR B 1 382 ? 15.594  2.788   -18.817 1.00 51.29  ? 382  TYR B CE1 1 
ATOM   7117 C CE2 . TYR B 1 382 ? 13.201  2.692   -18.728 1.00 48.69  ? 382  TYR B CE2 1 
ATOM   7118 C CZ  . TYR B 1 382 ? 14.361  3.197   -19.297 1.00 54.33  ? 382  TYR B CZ  1 
ATOM   7119 O OH  . TYR B 1 382 ? 14.293  4.118   -20.341 1.00 51.47  ? 382  TYR B OH  1 
ATOM   7120 N N   . THR B 1 383 ? 15.081  -0.463  -12.758 1.00 53.63  ? 383  THR B N   1 
ATOM   7121 C CA  . THR B 1 383 ? 14.634  -1.254  -11.622 1.00 48.50  ? 383  THR B CA  1 
ATOM   7122 C C   . THR B 1 383 ? 13.851  -0.366  -10.666 1.00 51.77  ? 383  THR B C   1 
ATOM   7123 O O   . THR B 1 383 ? 14.282  0.758   -10.377 1.00 47.07  ? 383  THR B O   1 
ATOM   7124 C CB  . THR B 1 383 ? 15.826  -1.901  -10.893 1.00 50.33  ? 383  THR B CB  1 
ATOM   7125 O OG1 . THR B 1 383 ? 16.428  -2.868  -11.757 1.00 53.34  ? 383  THR B OG1 1 
ATOM   7126 C CG2 . THR B 1 383 ? 15.392  -2.605  -9.620  1.00 50.61  ? 383  THR B CG2 1 
ATOM   7127 N N   . ASP B 1 384 ? 12.684  -0.851  -10.220 1.00 57.33  ? 384  ASP B N   1 
ATOM   7128 C CA  . ASP B 1 384 ? 11.938  -0.215  -9.121  1.00 63.59  ? 384  ASP B CA  1 
ATOM   7129 C C   . ASP B 1 384 ? 12.402  -0.814  -7.787  1.00 63.03  ? 384  ASP B C   1 
ATOM   7130 O O   . ASP B 1 384 ? 12.044  -1.938  -7.428  1.00 56.45  ? 384  ASP B O   1 
ATOM   7131 C CB  . ASP B 1 384 ? 10.413  -0.358  -9.287  1.00 67.12  ? 384  ASP B CB  1 
ATOM   7132 C CG  . ASP B 1 384 ? 9.621   0.404   -8.212  1.00 75.92  ? 384  ASP B CG  1 
ATOM   7133 O OD1 . ASP B 1 384 ? 10.186  0.720   -7.138  1.00 76.54  ? 384  ASP B OD1 1 
ATOM   7134 O OD2 . ASP B 1 384 ? 8.424   0.690   -8.437  1.00 76.90  ? 384  ASP B OD2 1 
ATOM   7135 N N   . TRP B 1 385 ? 13.204  -0.051  -7.056  1.00 65.94  ? 385  TRP B N   1 
ATOM   7136 C CA  . TRP B 1 385 ? 13.859  -0.565  -5.855  1.00 66.40  ? 385  TRP B CA  1 
ATOM   7137 C C   . TRP B 1 385 ? 12.933  -0.818  -4.663  1.00 66.23  ? 385  TRP B C   1 
ATOM   7138 O O   . TRP B 1 385 ? 13.364  -1.344  -3.640  1.00 68.14  ? 385  TRP B O   1 
ATOM   7139 C CB  . TRP B 1 385 ? 15.069  0.305   -5.504  1.00 60.83  ? 385  TRP B CB  1 
ATOM   7140 C CG  . TRP B 1 385 ? 16.055  0.261   -6.629  1.00 60.55  ? 385  TRP B CG  1 
ATOM   7141 C CD1 . TRP B 1 385 ? 16.208  1.181   -7.620  1.00 61.99  ? 385  TRP B CD1 1 
ATOM   7142 C CD2 . TRP B 1 385 ? 16.969  -0.795  -6.922  1.00 56.63  ? 385  TRP B CD2 1 
ATOM   7143 N NE1 . TRP B 1 385 ? 17.181  0.777   -8.502  1.00 54.77  ? 385  TRP B NE1 1 
ATOM   7144 C CE2 . TRP B 1 385 ? 17.663  -0.436  -8.101  1.00 58.10  ? 385  TRP B CE2 1 
ATOM   7145 C CE3 . TRP B 1 385 ? 17.272  -2.010  -6.307  1.00 51.95  ? 385  TRP B CE3 1 
ATOM   7146 C CZ2 . TRP B 1 385 ? 18.648  -1.248  -8.672  1.00 61.21  ? 385  TRP B CZ2 1 
ATOM   7147 C CZ3 . TRP B 1 385 ? 18.252  -2.818  -6.877  1.00 56.58  ? 385  TRP B CZ3 1 
ATOM   7148 C CH2 . TRP B 1 385 ? 18.927  -2.433  -8.048  1.00 59.25  ? 385  TRP B CH2 1 
ATOM   7149 N N   . LEU B 1 386 ? 11.657  -0.476  -4.810  1.00 68.57  ? 386  LEU B N   1 
ATOM   7150 C CA  . LEU B 1 386 ? 10.652  -0.919  -3.850  1.00 76.63  ? 386  LEU B CA  1 
ATOM   7151 C C   . LEU B 1 386 ? 10.181  -2.323  -4.208  1.00 78.81  ? 386  LEU B C   1 
ATOM   7152 O O   . LEU B 1 386 ? 9.804   -3.114  -3.333  1.00 80.97  ? 386  LEU B O   1 
ATOM   7153 C CB  . LEU B 1 386 ? 9.477   0.048   -3.824  1.00 77.20  ? 386  LEU B CB  1 
ATOM   7154 C CG  . LEU B 1 386 ? 9.922   1.352   -3.179  1.00 77.22  ? 386  LEU B CG  1 
ATOM   7155 C CD1 . LEU B 1 386 ? 8.969   2.509   -3.493  1.00 74.43  ? 386  LEU B CD1 1 
ATOM   7156 C CD2 . LEU B 1 386 ? 10.073  1.104   -1.683  1.00 75.89  ? 386  LEU B CD2 1 
ATOM   7157 N N   . HIS B 1 387 ? 10.225  -2.624  -5.504  1.00 77.33  ? 387  HIS B N   1 
ATOM   7158 C CA  . HIS B 1 387 ? 9.755   -3.895  -6.033  1.00 76.81  ? 387  HIS B CA  1 
ATOM   7159 C C   . HIS B 1 387 ? 10.750  -4.463  -7.038  1.00 72.24  ? 387  HIS B C   1 
ATOM   7160 O O   . HIS B 1 387 ? 10.367  -4.812  -8.146  1.00 75.51  ? 387  HIS B O   1 
ATOM   7161 C CB  . HIS B 1 387 ? 8.400   -3.697  -6.716  1.00 79.03  ? 387  HIS B CB  1 
ATOM   7162 C CG  . HIS B 1 387 ? 7.456   -2.823  -5.947  1.00 85.58  ? 387  HIS B CG  1 
ATOM   7163 N ND1 . HIS B 1 387 ? 7.234   -1.498  -6.271  1.00 86.63  ? 387  HIS B ND1 1 
ATOM   7164 C CD2 . HIS B 1 387 ? 6.682   -3.080  -4.865  1.00 81.93  ? 387  HIS B CD2 1 
ATOM   7165 C CE1 . HIS B 1 387 ? 6.364   -0.979  -5.420  1.00 81.57  ? 387  HIS B CE1 1 
ATOM   7166 N NE2 . HIS B 1 387 ? 6.016   -1.917  -4.557  1.00 80.16  ? 387  HIS B NE2 1 
ATOM   7167 N N   . PRO B 1 388 ? 12.032  -4.563  -6.649  1.00 65.37  ? 388  PRO B N   1 
ATOM   7168 C CA  . PRO B 1 388 ? 13.136  -4.924  -7.548  1.00 61.24  ? 388  PRO B CA  1 
ATOM   7169 C C   . PRO B 1 388 ? 12.975  -6.272  -8.213  1.00 65.15  ? 388  PRO B C   1 
ATOM   7170 O O   . PRO B 1 388 ? 13.632  -6.524  -9.226  1.00 67.54  ? 388  PRO B O   1 
ATOM   7171 C CB  . PRO B 1 388 ? 14.349  -4.973  -6.605  1.00 61.02  ? 388  PRO B CB  1 
ATOM   7172 C CG  . PRO B 1 388 ? 13.770  -5.099  -5.255  1.00 56.71  ? 388  PRO B CG  1 
ATOM   7173 C CD  . PRO B 1 388 ? 12.536  -4.275  -5.299  1.00 59.99  ? 388  PRO B CD  1 
ATOM   7174 N N   . GLU B 1 389 ? 12.133  -7.131  -7.649  1.00 72.66  ? 389  GLU B N   1 
ATOM   7175 C CA  . GLU B 1 389 ? 11.978  -8.490  -8.170  1.00 72.72  ? 389  GLU B CA  1 
ATOM   7176 C C   . GLU B 1 389 ? 10.563  -8.786  -8.658  1.00 73.15  ? 389  GLU B C   1 
ATOM   7177 O O   . GLU B 1 389 ? 10.283  -9.879  -9.153  1.00 73.90  ? 389  GLU B O   1 
ATOM   7178 C CB  . GLU B 1 389 ? 12.448  -9.526  -7.145  1.00 61.28  ? 389  GLU B CB  1 
ATOM   7179 C CG  . GLU B 1 389 ? 13.943  -9.421  -6.871  1.00 75.97  ? 389  GLU B CG  1 
ATOM   7180 C CD  . GLU B 1 389 ? 14.603  -10.761 -6.562  1.00 90.13  ? 389  GLU B CD  1 
ATOM   7181 O OE1 . GLU B 1 389 ? 15.298  -11.312 -7.453  1.00 84.33  ? 389  GLU B OE1 1 
ATOM   7182 O OE2 . GLU B 1 389 ? 14.427  -11.264 -5.426  1.00 100.26 ? 389  GLU B OE2 1 
ATOM   7183 N N   . ASP B 1 390 ? 9.682   -7.795  -8.540  1.00 65.10  ? 390  ASP B N   1 
ATOM   7184 C CA  . ASP B 1 390 ? 8.317   -7.936  -9.018  1.00 63.64  ? 390  ASP B CA  1 
ATOM   7185 C C   . ASP B 1 390 ? 8.296   -8.152  -10.522 1.00 65.38  ? 390  ASP B C   1 
ATOM   7186 O O   . ASP B 1 390 ? 8.820   -7.331  -11.275 1.00 66.25  ? 390  ASP B O   1 
ATOM   7187 C CB  . ASP B 1 390 ? 7.503   -6.698  -8.687  1.00 67.41  ? 390  ASP B CB  1 
ATOM   7188 C CG  . ASP B 1 390 ? 6.062   -6.842  -9.090  1.00 77.86  ? 390  ASP B CG  1 
ATOM   7189 O OD1 . ASP B 1 390 ? 5.406   -7.775  -8.595  1.00 84.09  ? 390  ASP B OD1 1 
ATOM   7190 O OD2 . ASP B 1 390 ? 5.575   -6.034  -9.903  1.00 79.25  ? 390  ASP B OD2 1 
ATOM   7191 N N   . PRO B 1 391 ? 7.689   -9.260  -10.971 1.00 61.91  ? 391  PRO B N   1 
ATOM   7192 C CA  . PRO B 1 391 ? 7.681   -9.580  -12.405 1.00 62.48  ? 391  PRO B CA  1 
ATOM   7193 C C   . PRO B 1 391 ? 6.776   -8.698  -13.272 1.00 60.70  ? 391  PRO B C   1 
ATOM   7194 O O   . PRO B 1 391 ? 7.042   -8.619  -14.459 1.00 66.72  ? 391  PRO B O   1 
ATOM   7195 C CB  . PRO B 1 391 ? 7.222   -11.045 -12.443 1.00 62.01  ? 391  PRO B CB  1 
ATOM   7196 C CG  . PRO B 1 391 ? 7.475   -11.559 -11.044 1.00 57.70  ? 391  PRO B CG  1 
ATOM   7197 C CD  . PRO B 1 391 ? 7.191   -10.380 -10.162 1.00 54.27  ? 391  PRO B CD  1 
ATOM   7198 N N   . THR B 1 392 ? 5.749   -8.054  -12.726 1.00 62.42  ? 392  THR B N   1 
ATOM   7199 C CA  . THR B 1 392 ? 4.982   -7.115  -13.547 1.00 65.29  ? 392  THR B CA  1 
ATOM   7200 C C   . THR B 1 392 ? 5.847   -5.894  -13.873 1.00 66.36  ? 392  THR B C   1 
ATOM   7201 O O   . THR B 1 392 ? 5.932   -5.489  -15.032 1.00 60.17  ? 392  THR B O   1 
ATOM   7202 C CB  . THR B 1 392 ? 3.619   -6.675  -12.916 1.00 50.26  ? 392  THR B CB  1 
ATOM   7203 O OG1 . THR B 1 392 ? 2.707   -7.774  -12.894 1.00 53.55  ? 392  THR B OG1 1 
ATOM   7204 C CG2 . THR B 1 392 ? 2.979   -5.601  -13.740 1.00 48.87  ? 392  THR B CG2 1 
ATOM   7205 N N   . HIS B 1 393 ? 6.490   -5.314  -12.856 1.00 70.00  ? 393  HIS B N   1 
ATOM   7206 C CA  . HIS B 1 393 ? 7.379   -4.167  -13.076 1.00 70.06  ? 393  HIS B CA  1 
ATOM   7207 C C   . HIS B 1 393 ? 8.482   -4.539  -14.042 1.00 62.27  ? 393  HIS B C   1 
ATOM   7208 O O   . HIS B 1 393 ? 8.749   -3.808  -14.996 1.00 60.04  ? 393  HIS B O   1 
ATOM   7209 C CB  . HIS B 1 393 ? 8.019   -3.665  -11.779 1.00 72.77  ? 393  HIS B CB  1 
ATOM   7210 C CG  . HIS B 1 393 ? 7.063   -2.982  -10.858 1.00 85.76  ? 393  HIS B CG  1 
ATOM   7211 N ND1 . HIS B 1 393 ? 6.076   -3.656  -10.175 1.00 91.41  ? 393  HIS B ND1 1 
ATOM   7212 C CD2 . HIS B 1 393 ? 6.952   -1.683  -10.494 1.00 95.24  ? 393  HIS B CD2 1 
ATOM   7213 C CE1 . HIS B 1 393 ? 5.389   -2.803  -9.438  1.00 94.34  ? 393  HIS B CE1 1 
ATOM   7214 N NE2 . HIS B 1 393 ? 5.901   -1.600  -9.611  1.00 98.76  ? 393  HIS B NE2 1 
ATOM   7215 N N   . LEU B 1 394 ? 9.130   -5.669  -13.783 1.00 52.51  ? 394  LEU B N   1 
ATOM   7216 C CA  . LEU B 1 394 ? 10.243  -6.092  -14.612 1.00 56.24  ? 394  LEU B CA  1 
ATOM   7217 C C   . LEU B 1 394 ? 9.827   -6.162  -16.085 1.00 56.82  ? 394  LEU B C   1 
ATOM   7218 O O   . LEU B 1 394 ? 10.535  -5.669  -16.960 1.00 51.48  ? 394  LEU B O   1 
ATOM   7219 C CB  . LEU B 1 394 ? 10.824  -7.408  -14.094 1.00 62.71  ? 394  LEU B CB  1 
ATOM   7220 C CG  . LEU B 1 394 ? 11.663  -7.167  -12.833 1.00 60.44  ? 394  LEU B CG  1 
ATOM   7221 C CD1 . LEU B 1 394 ? 11.779  -8.409  -11.968 1.00 64.02  ? 394  LEU B CD1 1 
ATOM   7222 C CD2 . LEU B 1 394 ? 13.031  -6.649  -13.217 1.00 53.56  ? 394  LEU B CD2 1 
ATOM   7223 N N   . ARG B 1 395 ? 8.654   -6.729  -16.349 1.00 59.28  ? 395  ARG B N   1 
ATOM   7224 C CA  . ARG B 1 395 ? 8.121   -6.792  -17.707 1.00 53.86  ? 395  ARG B CA  1 
ATOM   7225 C C   . ARG B 1 395 ? 7.832   -5.388  -18.281 1.00 55.48  ? 395  ARG B C   1 
ATOM   7226 O O   . ARG B 1 395 ? 8.387   -5.007  -19.311 1.00 49.24  ? 395  ARG B O   1 
ATOM   7227 C CB  . ARG B 1 395 ? 6.897   -7.709  -17.748 1.00 47.35  ? 395  ARG B CB  1 
ATOM   7228 C CG  . ARG B 1 395 ? 6.049   -7.611  -18.989 1.00 52.95  ? 395  ARG B CG  1 
ATOM   7229 C CD  . ARG B 1 395 ? 4.749   -6.887  -18.690 1.00 57.71  ? 395  ARG B CD  1 
ATOM   7230 N NE  . ARG B 1 395 ? 3.671   -7.802  -18.334 1.00 61.46  ? 395  ARG B NE  1 
ATOM   7231 C CZ  . ARG B 1 395 ? 2.516   -7.421  -17.790 1.00 67.36  ? 395  ARG B CZ  1 
ATOM   7232 N NH1 . ARG B 1 395 ? 2.274   -6.134  -17.538 1.00 49.83  ? 395  ARG B NH1 1 
ATOM   7233 N NH2 . ARG B 1 395 ? 1.598   -8.334  -17.487 1.00 78.87  ? 395  ARG B NH2 1 
ATOM   7234 N N   . ASP B 1 396 ? 6.985   -4.613  -17.609 1.00 59.60  ? 396  ASP B N   1 
ATOM   7235 C CA  . ASP B 1 396 ? 6.700   -3.243  -18.054 1.00 49.97  ? 396  ASP B CA  1 
ATOM   7236 C C   . ASP B 1 396 ? 7.986   -2.432  -18.263 1.00 50.55  ? 396  ASP B C   1 
ATOM   7237 O O   . ASP B 1 396 ? 8.081   -1.679  -19.240 1.00 56.46  ? 396  ASP B O   1 
ATOM   7238 C CB  . ASP B 1 396 ? 5.737   -2.513  -17.099 1.00 44.48  ? 396  ASP B CB  1 
ATOM   7239 C CG  . ASP B 1 396 ? 4.319   -3.125  -17.096 1.00 62.17  ? 396  ASP B CG  1 
ATOM   7240 O OD1 . ASP B 1 396 ? 3.991   -3.901  -18.033 1.00 60.93  ? 396  ASP B OD1 1 
ATOM   7241 O OD2 . ASP B 1 396 ? 3.538   -2.833  -16.153 1.00 60.73  ? 396  ASP B OD2 1 
ATOM   7242 N N   . ALA B 1 397 ? 8.972   -2.593  -17.374 1.00 37.86  ? 397  ALA B N   1 
ATOM   7243 C CA  . ALA B 1 397 ? 10.238  -1.854  -17.503 1.00 45.12  ? 397  ALA B CA  1 
ATOM   7244 C C   . ALA B 1 397 ? 10.994  -2.235  -18.767 1.00 50.80  ? 397  ALA B C   1 
ATOM   7245 O O   . ALA B 1 397 ? 11.415  -1.363  -19.521 1.00 55.43  ? 397  ALA B O   1 
ATOM   7246 C CB  . ALA B 1 397 ? 11.142  -2.046  -16.280 1.00 44.46  ? 397  ALA B CB  1 
ATOM   7247 N N   . MET B 1 398 ? 11.179  -3.536  -18.981 1.00 47.27  ? 398  MET B N   1 
ATOM   7248 C CA  . MET B 1 398 ? 11.782  -4.058  -20.214 1.00 47.60  ? 398  MET B CA  1 
ATOM   7249 C C   . MET B 1 398 ? 11.214  -3.379  -21.465 1.00 47.87  ? 398  MET B C   1 
ATOM   7250 O O   . MET B 1 398 ? 11.970  -2.928  -22.325 1.00 54.57  ? 398  MET B O   1 
ATOM   7251 C CB  . MET B 1 398 ? 11.592  -5.584  -20.302 1.00 47.72  ? 398  MET B CB  1 
ATOM   7252 C CG  . MET B 1 398 ? 12.401  -6.282  -21.401 1.00 47.91  ? 398  MET B CG  1 
ATOM   7253 S SD  . MET B 1 398 ? 14.200  -6.113  -21.245 1.00 63.03  ? 398  MET B SD  1 
ATOM   7254 C CE  . MET B 1 398 ? 14.609  -5.031  -22.599 1.00 46.19  ? 398  MET B CE  1 
ATOM   7255 N N   . SER B 1 399 ? 9.884   -3.307  -21.544 1.00 43.38  ? 399  SER B N   1 
ATOM   7256 C CA  . SER B 1 399 ? 9.154   -2.581  -22.589 1.00 41.73  ? 399  SER B CA  1 
ATOM   7257 C C   . SER B 1 399 ? 9.570   -1.119  -22.759 1.00 45.71  ? 399  SER B C   1 
ATOM   7258 O O   . SER B 1 399 ? 9.815   -0.647  -23.876 1.00 45.95  ? 399  SER B O   1 
ATOM   7259 C CB  . SER B 1 399 ? 7.682   -2.599  -22.236 1.00 44.01  ? 399  SER B CB  1 
ATOM   7260 O OG  . SER B 1 399 ? 6.889   -1.975  -23.224 1.00 46.14  ? 399  SER B OG  1 
ATOM   7261 N N   . ALA B 1 400 ? 9.619   -0.400  -21.641 1.00 39.74  ? 400  ALA B N   1 
ATOM   7262 C CA  . ALA B 1 400 ? 10.063  0.995   -21.638 1.00 37.96  ? 400  ALA B CA  1 
ATOM   7263 C C   . ALA B 1 400 ? 11.526  1.160   -22.058 1.00 47.00  ? 400  ALA B C   1 
ATOM   7264 O O   . ALA B 1 400 ? 11.835  2.082   -22.805 1.00 52.27  ? 400  ALA B O   1 
ATOM   7265 C CB  . ALA B 1 400 ? 9.834   1.637   -20.267 1.00 23.36  ? 400  ALA B CB  1 
ATOM   7266 N N   . VAL B 1 401 ? 12.425  0.300   -21.569 1.00 39.64  ? 401  VAL B N   1 
ATOM   7267 C CA  . VAL B 1 401 ? 13.823  0.381   -21.993 1.00 46.63  ? 401  VAL B CA  1 
ATOM   7268 C C   . VAL B 1 401 ? 13.934  0.340   -23.509 1.00 48.71  ? 401  VAL B C   1 
ATOM   7269 O O   . VAL B 1 401 ? 14.699  1.111   -24.109 1.00 39.76  ? 401  VAL B O   1 
ATOM   7270 C CB  . VAL B 1 401 ? 14.681  -0.774  -21.467 1.00 43.06  ? 401  VAL B CB  1 
ATOM   7271 C CG1 . VAL B 1 401 ? 15.953  -0.910  -22.324 1.00 25.96  ? 401  VAL B CG1 1 
ATOM   7272 C CG2 . VAL B 1 401 ? 15.014  -0.553  -20.022 1.00 38.94  ? 401  VAL B CG2 1 
ATOM   7273 N N   . VAL B 1 402 ? 13.172  -0.571  -24.115 1.00 39.27  ? 402  VAL B N   1 
ATOM   7274 C CA  . VAL B 1 402 ? 13.203  -0.747  -25.558 1.00 42.17  ? 402  VAL B CA  1 
ATOM   7275 C C   . VAL B 1 402 ? 12.571  0.443   -26.296 1.00 43.64  ? 402  VAL B C   1 
ATOM   7276 O O   . VAL B 1 402 ? 13.153  0.939   -27.271 1.00 38.19  ? 402  VAL B O   1 
ATOM   7277 C CB  . VAL B 1 402 ? 12.545  -2.093  -25.996 1.00 38.61  ? 402  VAL B CB  1 
ATOM   7278 C CG1 . VAL B 1 402 ? 12.194  -2.077  -27.487 1.00 26.85  ? 402  VAL B CG1 1 
ATOM   7279 C CG2 . VAL B 1 402 ? 13.450  -3.240  -25.675 1.00 40.50  ? 402  VAL B CG2 1 
ATOM   7280 N N   . GLY B 1 403 ? 11.387  0.882   -25.848 1.00 34.64  ? 403  GLY B N   1 
ATOM   7281 C CA  . GLY B 1 403 ? 10.727  2.039   -26.439 1.00 38.10  ? 403  GLY B CA  1 
ATOM   7282 C C   . GLY B 1 403 ? 11.501  3.349   -26.233 1.00 46.83  ? 403  GLY B C   1 
ATOM   7283 O O   . GLY B 1 403 ? 11.675  4.149   -27.147 1.00 50.89  ? 403  GLY B O   1 
ATOM   7284 N N   . ASP B 1 404 ? 11.995  3.553   -25.022 1.00 38.67  ? 404  ASP B N   1 
ATOM   7285 C CA  . ASP B 1 404 ? 12.667  4.780   -24.675 1.00 43.09  ? 404  ASP B CA  1 
ATOM   7286 C C   . ASP B 1 404 ? 13.951  4.928   -25.478 1.00 46.62  ? 404  ASP B C   1 
ATOM   7287 O O   . ASP B 1 404 ? 14.259  6.008   -26.005 1.00 46.42  ? 404  ASP B O   1 
ATOM   7288 C CB  . ASP B 1 404 ? 12.942  4.819   -23.159 1.00 45.29  ? 404  ASP B CB  1 
ATOM   7289 C CG  . ASP B 1 404 ? 11.677  5.078   -22.341 1.00 49.16  ? 404  ASP B CG  1 
ATOM   7290 O OD1 . ASP B 1 404 ? 10.700  5.567   -22.940 1.00 56.28  ? 404  ASP B OD1 1 
ATOM   7291 O OD2 . ASP B 1 404 ? 11.650  4.816   -21.111 1.00 48.07  ? 404  ASP B OD2 1 
ATOM   7292 N N   . HIS B 1 405 ? 14.695  3.834   -25.574 1.00 45.10  ? 405  HIS B N   1 
ATOM   7293 C CA  . HIS B 1 405 ? 15.997  3.841   -26.229 1.00 42.22  ? 405  HIS B CA  1 
ATOM   7294 C C   . HIS B 1 405 ? 15.841  4.103   -27.725 1.00 44.33  ? 405  HIS B C   1 
ATOM   7295 O O   . HIS B 1 405 ? 16.622  4.845   -28.310 1.00 48.38  ? 405  HIS B O   1 
ATOM   7296 C CB  . HIS B 1 405 ? 16.705  2.507   -25.967 1.00 41.38  ? 405  HIS B CB  1 
ATOM   7297 C CG  . HIS B 1 405 ? 17.964  2.303   -26.761 1.00 50.22  ? 405  HIS B CG  1 
ATOM   7298 N ND1 . HIS B 1 405 ? 18.976  3.237   -26.821 1.00 44.71  ? 405  HIS B ND1 1 
ATOM   7299 C CD2 . HIS B 1 405 ? 18.385  1.246   -27.499 1.00 51.04  ? 405  HIS B CD2 1 
ATOM   7300 C CE1 . HIS B 1 405 ? 19.957  2.772   -27.573 1.00 44.31  ? 405  HIS B CE1 1 
ATOM   7301 N NE2 . HIS B 1 405 ? 19.624  1.566   -27.995 1.00 52.55  ? 405  HIS B NE2 1 
ATOM   7302 N N   . ASN B 1 406 ? 14.800  3.533   -28.323 1.00 43.60  ? 406  ASN B N   1 
ATOM   7303 C CA  . ASN B 1 406 ? 14.677  3.510   -29.778 1.00 49.58  ? 406  ASN B CA  1 
ATOM   7304 C C   . ASN B 1 406 ? 13.758  4.571   -30.373 1.00 44.47  ? 406  ASN B C   1 
ATOM   7305 O O   . ASN B 1 406 ? 13.993  5.056   -31.476 1.00 46.47  ? 406  ASN B O   1 
ATOM   7306 C CB  . ASN B 1 406 ? 14.266  2.107   -30.256 1.00 49.57  ? 406  ASN B CB  1 
ATOM   7307 C CG  . ASN B 1 406 ? 15.399  1.104   -30.136 1.00 50.49  ? 406  ASN B CG  1 
ATOM   7308 O OD1 . ASN B 1 406 ? 16.491  1.334   -30.637 1.00 55.57  ? 406  ASN B OD1 1 
ATOM   7309 N ND2 . ASN B 1 406 ? 15.147  -0.003  -29.452 1.00 50.41  ? 406  ASN B ND2 1 
ATOM   7310 N N   . VAL B 1 407 ? 12.719  4.935   -29.638 1.00 32.66  ? 407  VAL B N   1 
ATOM   7311 C CA  . VAL B 1 407 ? 11.725  5.865   -30.160 1.00 32.78  ? 407  VAL B CA  1 
ATOM   7312 C C   . VAL B 1 407 ? 11.556  7.132   -29.295 1.00 34.45  ? 407  VAL B C   1 
ATOM   7313 O O   . VAL B 1 407 ? 11.897  8.239   -29.726 1.00 37.76  ? 407  VAL B O   1 
ATOM   7314 C CB  . VAL B 1 407 ? 10.347  5.165   -30.336 1.00 34.07  ? 407  VAL B CB  1 
ATOM   7315 C CG1 . VAL B 1 407 ? 9.332   6.135   -30.899 1.00 38.92  ? 407  VAL B CG1 1 
ATOM   7316 C CG2 . VAL B 1 407 ? 10.468  3.990   -31.240 1.00 30.95  ? 407  VAL B CG2 1 
ATOM   7317 N N   . VAL B 1 408 ? 11.044  6.972   -28.073 1.00 30.94  ? 408  VAL B N   1 
ATOM   7318 C CA  . VAL B 1 408 ? 10.718  8.129   -27.238 1.00 40.70  ? 408  VAL B CA  1 
ATOM   7319 C C   . VAL B 1 408 ? 11.836  9.150   -27.061 1.00 42.59  ? 408  VAL B C   1 
ATOM   7320 O O   . VAL B 1 408 ? 11.638  10.330  -27.282 1.00 41.91  ? 408  VAL B O   1 
ATOM   7321 C CB  . VAL B 1 408 ? 10.249  7.748   -25.846 1.00 43.77  ? 408  VAL B CB  1 
ATOM   7322 C CG1 . VAL B 1 408 ? 9.655   8.991   -25.177 1.00 34.56  ? 408  VAL B CG1 1 
ATOM   7323 C CG2 . VAL B 1 408 ? 9.243   6.602   -25.911 1.00 40.61  ? 408  VAL B CG2 1 
ATOM   7324 N N   . CYS B 1 409 ? 13.012  8.705   -26.649 1.00 49.57  ? 409  CYS B N   1 
ATOM   7325 C CA  . CYS B 1 409 ? 14.085  9.646   -26.374 1.00 36.03  ? 409  CYS B CA  1 
ATOM   7326 C C   . CYS B 1 409 ? 14.678  10.260  -27.640 1.00 36.60  ? 409  CYS B C   1 
ATOM   7327 O O   . CYS B 1 409 ? 14.906  11.478  -27.693 1.00 42.91  ? 409  CYS B O   1 
ATOM   7328 C CB  . CYS B 1 409 ? 15.122  9.004   -25.475 1.00 32.13  ? 409  CYS B CB  1 
ATOM   7329 S SG  . CYS B 1 409 ? 14.483  8.669   -23.816 1.00 41.26  ? 409  CYS B SG  1 
ATOM   7330 N N   . PRO B 1 410 ? 14.891  9.441   -28.682 1.00 30.93  ? 410  PRO B N   1 
ATOM   7331 C CA  . PRO B 1 410 ? 15.266  10.009  -29.988 1.00 33.89  ? 410  PRO B CA  1 
ATOM   7332 C C   . PRO B 1 410 ? 14.245  11.044  -30.503 1.00 40.71  ? 410  PRO B C   1 
ATOM   7333 O O   . PRO B 1 410 ? 14.623  12.094  -31.056 1.00 36.24  ? 410  PRO B O   1 
ATOM   7334 C CB  . PRO B 1 410 ? 15.308  8.792   -30.901 1.00 25.95  ? 410  PRO B CB  1 
ATOM   7335 C CG  . PRO B 1 410 ? 15.566  7.679   -30.006 1.00 34.27  ? 410  PRO B CG  1 
ATOM   7336 C CD  . PRO B 1 410 ? 14.911  7.973   -28.695 1.00 30.44  ? 410  PRO B CD  1 
ATOM   7337 N N   . VAL B 1 411 ? 12.959  10.758  -30.316 1.00 37.33  ? 411  VAL B N   1 
ATOM   7338 C CA  . VAL B 1 411 ? 11.931  11.761  -30.609 1.00 38.04  ? 411  VAL B CA  1 
ATOM   7339 C C   . VAL B 1 411 ? 12.083  13.038  -29.748 1.00 38.17  ? 411  VAL B C   1 
ATOM   7340 O O   . VAL B 1 411 ? 11.973  14.156  -30.253 1.00 37.85  ? 411  VAL B O   1 
ATOM   7341 C CB  . VAL B 1 411 ? 10.500  11.197  -30.483 1.00 26.55  ? 411  VAL B CB  1 
ATOM   7342 C CG1 . VAL B 1 411 ? 9.527   12.320  -30.353 1.00 25.74  ? 411  VAL B CG1 1 
ATOM   7343 C CG2 . VAL B 1 411 ? 10.145  10.407  -31.701 1.00 13.27  ? 411  VAL B CG2 1 
ATOM   7344 N N   . ALA B 1 412 ? 12.341  12.867  -28.455 1.00 30.98  ? 412  ALA B N   1 
ATOM   7345 C CA  . ALA B 1 412 ? 12.526  14.004  -27.553 1.00 40.44  ? 412  ALA B CA  1 
ATOM   7346 C C   . ALA B 1 412 ? 13.677  14.869  -28.021 1.00 40.04  ? 412  ALA B C   1 
ATOM   7347 O O   . ALA B 1 412 ? 13.562  16.096  -28.099 1.00 42.91  ? 412  ALA B O   1 
ATOM   7348 C CB  . ALA B 1 412 ? 12.777  13.534  -26.128 1.00 42.65  ? 412  ALA B CB  1 
ATOM   7349 N N   . GLN B 1 413 ? 14.786  14.215  -28.343 1.00 29.58  ? 413  GLN B N   1 
ATOM   7350 C CA  . GLN B 1 413 ? 15.947  14.921  -28.845 1.00 40.37  ? 413  GLN B CA  1 
ATOM   7351 C C   . GLN B 1 413 ? 15.697  15.643  -30.183 1.00 43.63  ? 413  GLN B C   1 
ATOM   7352 O O   . GLN B 1 413 ? 16.011  16.829  -30.355 1.00 34.38  ? 413  GLN B O   1 
ATOM   7353 C CB  . GLN B 1 413 ? 17.108  13.957  -28.971 1.00 41.02  ? 413  GLN B CB  1 
ATOM   7354 C CG  . GLN B 1 413 ? 18.243  14.506  -29.767 1.00 52.14  ? 413  GLN B CG  1 
ATOM   7355 C CD  . GLN B 1 413 ? 19.531  13.873  -29.356 1.00 73.58  ? 413  GLN B CD  1 
ATOM   7356 O OE1 . GLN B 1 413 ? 20.116  13.075  -30.102 1.00 75.08  ? 413  GLN B OE1 1 
ATOM   7357 N NE2 . GLN B 1 413 ? 19.982  14.199  -28.141 1.00 79.96  ? 413  GLN B NE2 1 
ATOM   7358 N N   . LEU B 1 414 ? 15.130  14.926  -31.137 1.00 47.30  ? 414  LEU B N   1 
ATOM   7359 C CA  . LEU B 1 414 ? 14.737  15.569  -32.372 1.00 50.08  ? 414  LEU B CA  1 
ATOM   7360 C C   . LEU B 1 414 ? 13.803  16.776  -32.154 1.00 47.37  ? 414  LEU B C   1 
ATOM   7361 O O   . LEU B 1 414 ? 13.982  17.810  -32.791 1.00 44.63  ? 414  LEU B O   1 
ATOM   7362 C CB  . LEU B 1 414 ? 14.082  14.564  -33.305 1.00 44.43  ? 414  LEU B CB  1 
ATOM   7363 C CG  . LEU B 1 414 ? 13.660  15.193  -34.630 1.00 36.15  ? 414  LEU B CG  1 
ATOM   7364 C CD1 . LEU B 1 414 ? 14.859  15.656  -35.405 1.00 38.65  ? 414  LEU B CD1 1 
ATOM   7365 C CD2 . LEU B 1 414 ? 12.933  14.180  -35.429 1.00 37.35  ? 414  LEU B CD2 1 
ATOM   7366 N N   . ALA B 1 415 ? 12.811  16.664  -31.272 1.00 37.23  ? 415  ALA B N   1 
ATOM   7367 C CA  . ALA B 1 415 ? 11.896  17.792  -31.087 1.00 42.66  ? 415  ALA B CA  1 
ATOM   7368 C C   . ALA B 1 415 ? 12.682  18.974  -30.548 1.00 45.34  ? 415  ALA B C   1 
ATOM   7369 O O   . ALA B 1 415 ? 12.662  20.058  -31.117 1.00 47.35  ? 415  ALA B O   1 
ATOM   7370 C CB  . ALA B 1 415 ? 10.772  17.440  -30.155 1.00 33.78  ? 415  ALA B CB  1 
ATOM   7371 N N   . GLY B 1 416 ? 13.391  18.734  -29.451 1.00 38.08  ? 416  GLY B N   1 
ATOM   7372 C CA  . GLY B 1 416 ? 14.253  19.726  -28.852 1.00 47.80  ? 416  GLY B CA  1 
ATOM   7373 C C   . GLY B 1 416 ? 15.239  20.393  -29.800 1.00 52.29  ? 416  GLY B C   1 
ATOM   7374 O O   . GLY B 1 416 ? 15.327  21.615  -29.827 1.00 49.75  ? 416  GLY B O   1 
ATOM   7375 N N   . ARG B 1 417 ? 15.980  19.611  -30.583 1.00 48.24  ? 417  ARG B N   1 
ATOM   7376 C CA  . ARG B 1 417 ? 16.945  20.211  -31.501 1.00 44.55  ? 417  ARG B CA  1 
ATOM   7377 C C   . ARG B 1 417 ? 16.279  21.032  -32.616 1.00 47.73  ? 417  ARG B C   1 
ATOM   7378 O O   . ARG B 1 417 ? 16.784  22.087  -33.002 1.00 49.80  ? 417  ARG B O   1 
ATOM   7379 C CB  . ARG B 1 417 ? 17.941  19.179  -32.056 1.00 46.30  ? 417  ARG B CB  1 
ATOM   7380 C CG  . ARG B 1 417 ? 18.871  18.532  -31.013 1.00 44.31  ? 417  ARG B CG  1 
ATOM   7381 C CD  . ARG B 1 417 ? 19.389  19.539  -30.005 1.00 55.17  ? 417  ARG B CD  1 
ATOM   7382 N NE  . ARG B 1 417 ? 20.271  20.518  -30.637 1.00 79.35  ? 417  ARG B NE  1 
ATOM   7383 C CZ  . ARG B 1 417 ? 21.542  20.735  -30.289 1.00 94.94  ? 417  ARG B CZ  1 
ATOM   7384 N NH1 . ARG B 1 417 ? 22.099  20.058  -29.277 1.00 98.10  ? 417  ARG B NH1 1 
ATOM   7385 N NH2 . ARG B 1 417 ? 22.256  21.644  -30.951 1.00 92.56  ? 417  ARG B NH2 1 
ATOM   7386 N N   . LEU B 1 418 ? 15.133  20.573  -33.110 1.00 46.52  ? 418  LEU B N   1 
ATOM   7387 C CA  . LEU B 1 418 ? 14.399  21.319  -34.130 1.00 43.31  ? 418  LEU B CA  1 
ATOM   7388 C C   . LEU B 1 418 ? 13.847  22.644  -33.608 1.00 51.17  ? 418  LEU B C   1 
ATOM   7389 O O   . LEU B 1 418 ? 13.955  23.682  -34.265 1.00 49.70  ? 418  LEU B O   1 
ATOM   7390 C CB  . LEU B 1 418 ? 13.243  20.491  -34.678 1.00 42.97  ? 418  LEU B CB  1 
ATOM   7391 C CG  . LEU B 1 418 ? 13.529  19.384  -35.690 1.00 47.24  ? 418  LEU B CG  1 
ATOM   7392 C CD1 . LEU B 1 418 ? 12.260  18.610  -35.985 1.00 38.32  ? 418  LEU B CD1 1 
ATOM   7393 C CD2 . LEU B 1 418 ? 14.074  20.004  -36.938 1.00 51.45  ? 418  LEU B CD2 1 
ATOM   7394 N N   . ALA B 1 419 ? 13.214  22.609  -32.444 1.00 50.20  ? 419  ALA B N   1 
ATOM   7395 C CA  . ALA B 1 419 ? 12.606  23.817  -31.919 1.00 53.09  ? 419  ALA B CA  1 
ATOM   7396 C C   . ALA B 1 419 ? 13.696  24.874  -31.637 1.00 55.78  ? 419  ALA B C   1 
ATOM   7397 O O   . ALA B 1 419 ? 13.557  26.041  -31.998 1.00 51.03  ? 419  ALA B O   1 
ATOM   7398 C CB  . ALA B 1 419 ? 11.789  23.503  -30.672 1.00 42.27  ? 419  ALA B CB  1 
ATOM   7399 N N   . ALA B 1 420 ? 14.787  24.443  -31.013 1.00 51.25  ? 420  ALA B N   1 
ATOM   7400 C CA  . ALA B 1 420 ? 15.927  25.310  -30.752 1.00 49.69  ? 420  ALA B CA  1 
ATOM   7401 C C   . ALA B 1 420 ? 16.536  25.919  -32.016 1.00 49.55  ? 420  ALA B C   1 
ATOM   7402 O O   . ALA B 1 420 ? 17.084  27.007  -31.969 1.00 54.06  ? 420  ALA B O   1 
ATOM   7403 C CB  . ALA B 1 420 ? 17.002  24.564  -29.958 1.00 47.88  ? 420  ALA B CB  1 
ATOM   7404 N N   . GLN B 1 421 ? 16.459  25.227  -33.143 1.00 41.75  ? 421  GLN B N   1 
ATOM   7405 C CA  . GLN B 1 421 ? 17.020  25.770  -34.367 1.00 38.80  ? 421  GLN B CA  1 
ATOM   7406 C C   . GLN B 1 421 ? 15.976  26.375  -35.331 1.00 46.93  ? 421  GLN B C   1 
ATOM   7407 O O   . GLN B 1 421 ? 16.136  26.293  -36.556 1.00 52.53  ? 421  GLN B O   1 
ATOM   7408 C CB  . GLN B 1 421 ? 17.870  24.714  -35.072 1.00 49.11  ? 421  GLN B CB  1 
ATOM   7409 C CG  . GLN B 1 421 ? 19.347  24.800  -34.715 1.00 66.43  ? 421  GLN B CG  1 
ATOM   7410 C CD  . GLN B 1 421 ? 19.831  23.634  -33.877 1.00 78.62  ? 421  GLN B CD  1 
ATOM   7411 O OE1 . GLN B 1 421 ? 20.025  23.752  -32.667 1.00 84.62  ? 421  GLN B OE1 1 
ATOM   7412 N NE2 . GLN B 1 421 ? 20.035  22.497  -34.522 1.00 81.82  ? 421  GLN B NE2 1 
ATOM   7413 N N   . GLY B 1 422 ? 14.913  26.973  -34.782 1.00 42.29  ? 422  GLY B N   1 
ATOM   7414 C CA  . GLY B 1 422 ? 13.948  27.717  -35.581 1.00 43.76  ? 422  GLY B CA  1 
ATOM   7415 C C   . GLY B 1 422 ? 12.699  26.992  -36.095 1.00 54.48  ? 422  GLY B C   1 
ATOM   7416 O O   . GLY B 1 422 ? 11.759  27.635  -36.567 1.00 54.58  ? 422  GLY B O   1 
ATOM   7417 N N   . ALA B 1 423 ? 12.665  25.664  -36.013 1.00 51.72  ? 423  ALA B N   1 
ATOM   7418 C CA  . ALA B 1 423 ? 11.505  24.937  -36.508 1.00 48.36  ? 423  ALA B CA  1 
ATOM   7419 C C   . ALA B 1 423 ? 10.322  25.167  -35.600 1.00 51.20  ? 423  ALA B C   1 
ATOM   7420 O O   . ALA B 1 423 ? 10.485  25.384  -34.398 1.00 61.21  ? 423  ALA B O   1 
ATOM   7421 C CB  . ALA B 1 423 ? 11.787  23.452  -36.606 1.00 41.32  ? 423  ALA B CB  1 
ATOM   7422 N N   . ARG B 1 424 ? 9.134   25.110  -36.188 1.00 39.52  ? 424  ARG B N   1 
ATOM   7423 C CA  . ARG B 1 424 ? 7.893   25.073  -35.436 1.00 42.41  ? 424  ARG B CA  1 
ATOM   7424 C C   . ARG B 1 424 ? 7.493   23.610  -35.216 1.00 44.68  ? 424  ARG B C   1 
ATOM   7425 O O   . ARG B 1 424 ? 7.319   22.854  -36.174 1.00 49.72  ? 424  ARG B O   1 
ATOM   7426 C CB  . ARG B 1 424 ? 6.819   25.806  -36.222 1.00 49.18  ? 424  ARG B CB  1 
ATOM   7427 C CG  . ARG B 1 424 ? 5.509   25.975  -35.519 1.00 60.27  ? 424  ARG B CG  1 
ATOM   7428 C CD  . ARG B 1 424 ? 4.713   27.057  -36.239 1.00 73.01  ? 424  ARG B CD  1 
ATOM   7429 N NE  . ARG B 1 424 ? 3.674   27.609  -35.386 1.00 75.65  ? 424  ARG B NE  1 
ATOM   7430 C CZ  . ARG B 1 424 ? 3.913   28.262  -34.257 1.00 69.93  ? 424  ARG B CZ  1 
ATOM   7431 N NH1 . ARG B 1 424 ? 5.159   28.446  -33.837 1.00 69.80  ? 424  ARG B NH1 1 
ATOM   7432 N NH2 . ARG B 1 424 ? 2.900   28.712  -33.543 1.00 72.44  ? 424  ARG B NH2 1 
ATOM   7433 N N   . VAL B 1 425 ? 7.353   23.216  -33.956 1.00 37.94  ? 425  VAL B N   1 
ATOM   7434 C CA  . VAL B 1 425 ? 7.141   21.812  -33.611 1.00 38.02  ? 425  VAL B CA  1 
ATOM   7435 C C   . VAL B 1 425 ? 5.912   21.563  -32.748 1.00 33.30  ? 425  VAL B C   1 
ATOM   7436 O O   . VAL B 1 425 ? 5.699   22.238  -31.743 1.00 33.29  ? 425  VAL B O   1 
ATOM   7437 C CB  . VAL B 1 425 ? 8.346   21.240  -32.821 1.00 39.10  ? 425  VAL B CB  1 
ATOM   7438 C CG1 . VAL B 1 425 ? 8.161   19.744  -32.589 1.00 30.00  ? 425  VAL B CG1 1 
ATOM   7439 C CG2 . VAL B 1 425 ? 9.671   21.573  -33.510 1.00 30.42  ? 425  VAL B CG2 1 
ATOM   7440 N N   . TYR B 1 426 ? 5.133   20.557  -33.120 1.00 36.42  ? 426  TYR B N   1 
ATOM   7441 C CA  . TYR B 1 426 ? 4.059   20.042  -32.273 1.00 36.33  ? 426  TYR B CA  1 
ATOM   7442 C C   . TYR B 1 426 ? 4.349   18.597  -31.905 1.00 42.65  ? 426  TYR B C   1 
ATOM   7443 O O   . TYR B 1 426 ? 4.788   17.804  -32.739 1.00 42.88  ? 426  TYR B O   1 
ATOM   7444 C CB  . TYR B 1 426 ? 2.724   20.145  -33.000 1.00 34.71  ? 426  TYR B CB  1 
ATOM   7445 C CG  . TYR B 1 426 ? 2.370   21.561  -33.308 1.00 33.86  ? 426  TYR B CG  1 
ATOM   7446 C CD1 . TYR B 1 426 ? 2.740   22.148  -34.518 1.00 29.26  ? 426  TYR B CD1 1 
ATOM   7447 C CD2 . TYR B 1 426 ? 1.703   22.338  -32.363 1.00 34.31  ? 426  TYR B CD2 1 
ATOM   7448 C CE1 . TYR B 1 426 ? 2.420   23.479  -34.780 1.00 41.42  ? 426  TYR B CE1 1 
ATOM   7449 C CE2 . TYR B 1 426 ? 1.389   23.649  -32.609 1.00 41.65  ? 426  TYR B CE2 1 
ATOM   7450 C CZ  . TYR B 1 426 ? 1.740   24.221  -33.816 1.00 43.59  ? 426  TYR B CZ  1 
ATOM   7451 O OH  . TYR B 1 426 ? 1.408   25.535  -34.030 1.00 36.95  ? 426  TYR B OH  1 
ATOM   7452 N N   . ALA B 1 427 ? 4.098   18.251  -30.654 1.00 36.56  ? 427  ALA B N   1 
ATOM   7453 C CA  . ALA B 1 427 ? 4.428   16.926  -30.182 1.00 33.43  ? 427  ALA B CA  1 
ATOM   7454 C C   . ALA B 1 427 ? 3.197   16.296  -29.569 1.00 41.16  ? 427  ALA B C   1 
ATOM   7455 O O   . ALA B 1 427 ? 2.318   17.003  -29.030 1.00 31.51  ? 427  ALA B O   1 
ATOM   7456 C CB  . ALA B 1 427 ? 5.521   17.014  -29.173 1.00 22.68  ? 427  ALA B CB  1 
ATOM   7457 N N   . TYR B 1 428 ? 3.132   14.968  -29.637 1.00 33.64  ? 428  TYR B N   1 
ATOM   7458 C CA  . TYR B 1 428 ? 2.003   14.256  -29.041 1.00 34.59  ? 428  TYR B CA  1 
ATOM   7459 C C   . TYR B 1 428 ? 2.429   12.919  -28.461 1.00 42.53  ? 428  TYR B C   1 
ATOM   7460 O O   . TYR B 1 428 ? 3.510   12.405  -28.738 1.00 37.88  ? 428  TYR B O   1 
ATOM   7461 C CB  . TYR B 1 428 ? 0.887   14.004  -30.075 1.00 34.27  ? 428  TYR B CB  1 
ATOM   7462 C CG  . TYR B 1 428 ? 1.298   12.994  -31.141 1.00 42.57  ? 428  TYR B CG  1 
ATOM   7463 C CD1 . TYR B 1 428 ? 1.243   11.622  -30.902 1.00 40.64  ? 428  TYR B CD1 1 
ATOM   7464 C CD2 . TYR B 1 428 ? 1.769   13.421  -32.377 1.00 38.82  ? 428  TYR B CD2 1 
ATOM   7465 C CE1 . TYR B 1 428 ? 1.641   10.725  -31.866 1.00 42.25  ? 428  TYR B CE1 1 
ATOM   7466 C CE2 . TYR B 1 428 ? 2.181   12.534  -33.335 1.00 35.50  ? 428  TYR B CE2 1 
ATOM   7467 C CZ  . TYR B 1 428 ? 2.115   11.186  -33.082 1.00 42.55  ? 428  TYR B CZ  1 
ATOM   7468 O OH  . TYR B 1 428 ? 2.519   10.308  -34.067 1.00 44.05  ? 428  TYR B OH  1 
ATOM   7469 N N   . ILE B 1 429 ? 1.547   12.354  -27.654 1.00 45.56  ? 429  ILE B N   1 
ATOM   7470 C CA  . ILE B 1 429 ? 1.649   10.966  -27.271 1.00 36.75  ? 429  ILE B CA  1 
ATOM   7471 C C   . ILE B 1 429 ? 0.271   10.346  -27.439 1.00 44.36  ? 429  ILE B C   1 
ATOM   7472 O O   . ILE B 1 429 ? -0.733  10.872  -26.967 1.00 50.41  ? 429  ILE B O   1 
ATOM   7473 C CB  . ILE B 1 429 ? 2.160   10.820  -25.863 1.00 40.33  ? 429  ILE B CB  1 
ATOM   7474 C CG1 . ILE B 1 429 ? 2.346   9.346   -25.533 1.00 43.79  ? 429  ILE B CG1 1 
ATOM   7475 C CG2 . ILE B 1 429 ? 1.234   11.523  -24.866 1.00 44.28  ? 429  ILE B CG2 1 
ATOM   7476 C CD1 . ILE B 1 429 ? 3.116   9.138   -24.215 1.00 49.41  ? 429  ILE B CD1 1 
ATOM   7477 N N   . PHE B 1 430 ? 0.234   9.249   -28.170 1.00 42.55  ? 430  PHE B N   1 
ATOM   7478 C CA  . PHE B 1 430 ? -1.000  8.585   -28.507 1.00 44.80  ? 430  PHE B CA  1 
ATOM   7479 C C   . PHE B 1 430 ? -1.288  7.501   -27.465 1.00 52.06  ? 430  PHE B C   1 
ATOM   7480 O O   . PHE B 1 430 ? -0.478  6.581   -27.265 1.00 53.52  ? 430  PHE B O   1 
ATOM   7481 C CB  . PHE B 1 430 ? -0.849  7.969   -29.889 1.00 45.56  ? 430  PHE B CB  1 
ATOM   7482 C CG  . PHE B 1 430 ? -2.125  7.459   -30.467 1.00 46.10  ? 430  PHE B CG  1 
ATOM   7483 C CD1 . PHE B 1 430 ? -2.463  6.114   -30.358 1.00 46.11  ? 430  PHE B CD1 1 
ATOM   7484 C CD2 . PHE B 1 430 ? -2.991  8.319   -31.127 1.00 43.52  ? 430  PHE B CD2 1 
ATOM   7485 C CE1 . PHE B 1 430 ? -3.643  5.627   -30.907 1.00 47.27  ? 430  PHE B CE1 1 
ATOM   7486 C CE2 . PHE B 1 430 ? -4.172  7.843   -31.672 1.00 50.84  ? 430  PHE B CE2 1 
ATOM   7487 C CZ  . PHE B 1 430 ? -4.499  6.491   -31.567 1.00 50.50  ? 430  PHE B CZ  1 
ATOM   7488 N N   . GLU B 1 431 ? -2.448  7.599   -26.818 1.00 47.11  ? 431  GLU B N   1 
ATOM   7489 C CA  . GLU B 1 431 ? -2.706  6.827   -25.603 1.00 45.82  ? 431  GLU B CA  1 
ATOM   7490 C C   . GLU B 1 431 ? -3.921  5.926   -25.643 1.00 49.12  ? 431  GLU B C   1 
ATOM   7491 O O   . GLU B 1 431 ? -4.257  5.314   -24.640 1.00 52.30  ? 431  GLU B O   1 
ATOM   7492 C CB  . GLU B 1 431 ? -2.834  7.753   -24.396 1.00 39.11  ? 431  GLU B CB  1 
ATOM   7493 C CG  . GLU B 1 431 ? -1.522  8.055   -23.716 1.00 50.09  ? 431  GLU B CG  1 
ATOM   7494 C CD  . GLU B 1 431 ? -1.681  8.940   -22.494 1.00 57.14  ? 431  GLU B CD  1 
ATOM   7495 O OE1 . GLU B 1 431 ? -2.770  9.545   -22.319 1.00 59.40  ? 431  GLU B OE1 1 
ATOM   7496 O OE2 . GLU B 1 431 ? -0.709  9.019   -21.709 1.00 54.94  ? 431  GLU B OE2 1 
ATOM   7497 N N   . HIS B 1 432 ? -4.585  5.850   -26.786 1.00 53.30  ? 432  HIS B N   1 
ATOM   7498 C CA  . HIS B 1 432 ? -5.772  5.013   -26.913 1.00 49.58  ? 432  HIS B CA  1 
ATOM   7499 C C   . HIS B 1 432 ? -5.510  3.632   -27.520 1.00 56.08  ? 432  HIS B C   1 
ATOM   7500 O O   . HIS B 1 432 ? -4.974  3.512   -28.617 1.00 61.57  ? 432  HIS B O   1 
ATOM   7501 C CB  . HIS B 1 432 ? -6.791  5.708   -27.771 1.00 47.03  ? 432  HIS B CB  1 
ATOM   7502 C CG  . HIS B 1 432 ? -7.970  4.856   -28.063 1.00 57.80  ? 432  HIS B CG  1 
ATOM   7503 N ND1 . HIS B 1 432 ? -9.003  4.693   -27.170 1.00 62.21  ? 432  HIS B ND1 1 
ATOM   7504 C CD2 . HIS B 1 432 ? -8.273  4.093   -29.141 1.00 61.67  ? 432  HIS B CD2 1 
ATOM   7505 C CE1 . HIS B 1 432 ? -9.906  3.884   -27.694 1.00 62.31  ? 432  HIS B CE1 1 
ATOM   7506 N NE2 . HIS B 1 432 ? -9.489  3.504   -28.889 1.00 60.39  ? 432  HIS B NE2 1 
ATOM   7507 N N   . ARG B 1 433 ? -5.903  2.581   -26.813 1.00 59.58  ? 433  ARG B N   1 
ATOM   7508 C CA  . ARG B 1 433 ? -5.712  1.222   -27.320 1.00 53.81  ? 433  ARG B CA  1 
ATOM   7509 C C   . ARG B 1 433 ? -6.961  0.755   -28.062 1.00 53.53  ? 433  ARG B C   1 
ATOM   7510 O O   . ARG B 1 433 ? -8.057  0.775   -27.501 1.00 53.29  ? 433  ARG B O   1 
ATOM   7511 C CB  . ARG B 1 433 ? -5.410  0.263   -26.170 1.00 54.16  ? 433  ARG B CB  1 
ATOM   7512 C CG  . ARG B 1 433 ? -5.265  -1.192  -26.594 1.00 64.54  ? 433  ARG B CG  1 
ATOM   7513 C CD  . ARG B 1 433 ? -5.504  -2.120  -25.413 1.00 66.59  ? 433  ARG B CD  1 
ATOM   7514 N NE  . ARG B 1 433 ? -5.611  -3.530  -25.780 1.00 60.26  ? 433  ARG B NE  1 
ATOM   7515 C CZ  . ARG B 1 433 ? -4.582  -4.369  -25.811 1.00 62.66  ? 433  ARG B CZ  1 
ATOM   7516 N NH1 . ARG B 1 433 ? -3.360  -3.937  -25.513 1.00 52.40  ? 433  ARG B NH1 1 
ATOM   7517 N NH2 . ARG B 1 433 ? -4.774  -5.641  -26.138 1.00 66.41  ? 433  ARG B NH2 1 
ATOM   7518 N N   . ALA B 1 434 ? -6.796  0.335   -29.316 1.00 49.53  ? 434  ALA B N   1 
ATOM   7519 C CA  . ALA B 1 434 ? -7.929  -0.097  -30.141 1.00 49.22  ? 434  ALA B CA  1 
ATOM   7520 C C   . ALA B 1 434 ? -8.786  -1.169  -29.472 1.00 55.40  ? 434  ALA B C   1 
ATOM   7521 O O   . ALA B 1 434 ? -8.270  -2.120  -28.882 1.00 57.48  ? 434  ALA B O   1 
ATOM   7522 C CB  . ALA B 1 434 ? -7.454  -0.583  -31.503 1.00 40.35  ? 434  ALA B CB  1 
ATOM   7523 N N   . SER B 1 435 ? -10.101 -1.005  -29.568 1.00 53.72  ? 435  SER B N   1 
ATOM   7524 C CA  . SER B 1 435 ? -11.023 -2.012  -29.067 1.00 54.24  ? 435  SER B CA  1 
ATOM   7525 C C   . SER B 1 435 ? -10.892 -3.287  -29.891 1.00 63.86  ? 435  SER B C   1 
ATOM   7526 O O   . SER B 1 435 ? -11.135 -4.383  -29.386 1.00 69.59  ? 435  SER B O   1 
ATOM   7527 C CB  . SER B 1 435 ? -12.467 -1.501  -29.086 1.00 54.01  ? 435  SER B CB  1 
ATOM   7528 O OG  . SER B 1 435 ? -12.925 -1.256  -30.405 1.00 63.72  ? 435  SER B OG  1 
ATOM   7529 N N   . THR B 1 436 ? -10.476 -3.136  -31.147 1.00 61.00  ? 436  THR B N   1 
ATOM   7530 C CA  . THR B 1 436 ? -10.308 -4.270  -32.049 1.00 64.70  ? 436  THR B CA  1 
ATOM   7531 C C   . THR B 1 436 ? -8.940  -4.977  -31.989 1.00 64.43  ? 436  THR B C   1 
ATOM   7532 O O   . THR B 1 436 ? -8.685  -5.894  -32.769 1.00 64.52  ? 436  THR B O   1 
ATOM   7533 C CB  . THR B 1 436 ? -10.524 -3.839  -33.509 1.00 68.07  ? 436  THR B CB  1 
ATOM   7534 O OG1 . THR B 1 436 ? -9.567  -2.825  -33.860 1.00 68.20  ? 436  THR B OG1 1 
ATOM   7535 C CG2 . THR B 1 436 ? -11.945 -3.331  -33.719 1.00 62.66  ? 436  THR B CG2 1 
ATOM   7536 N N   . LEU B 1 437 ? -8.068  -4.564  -31.076 1.00 63.52  ? 437  LEU B N   1 
ATOM   7537 C CA  . LEU B 1 437 ? -6.680  -5.037  -31.069 1.00 62.82  ? 437  LEU B CA  1 
ATOM   7538 C C   . LEU B 1 437 ? -6.508  -6.525  -30.751 1.00 64.97  ? 437  LEU B C   1 
ATOM   7539 O O   . LEU B 1 437 ? -7.075  -7.028  -29.783 1.00 61.93  ? 437  LEU B O   1 
ATOM   7540 C CB  . LEU B 1 437 ? -5.859  -4.220  -30.080 1.00 62.17  ? 437  LEU B CB  1 
ATOM   7541 C CG  . LEU B 1 437 ? -4.403  -4.004  -30.457 1.00 61.90  ? 437  LEU B CG  1 
ATOM   7542 C CD1 . LEU B 1 437 ? -4.296  -2.675  -31.143 1.00 63.59  ? 437  LEU B CD1 1 
ATOM   7543 C CD2 . LEU B 1 437 ? -3.535  -4.023  -29.224 1.00 68.87  ? 437  LEU B CD2 1 
ATOM   7544 N N   . THR B 1 438 ? -5.689  -7.209  -31.549 1.00 70.75  ? 438  THR B N   1 
ATOM   7545 C CA  . THR B 1 438 ? -5.477  -8.655  -31.410 1.00 74.58  ? 438  THR B CA  1 
ATOM   7546 C C   . THR B 1 438 ? -4.301  -9.061  -30.518 1.00 76.49  ? 438  THR B C   1 
ATOM   7547 O O   . THR B 1 438 ? -3.929  -10.229 -30.499 1.00 76.64  ? 438  THR B O   1 
ATOM   7548 C CB  . THR B 1 438 ? -5.258  -9.328  -32.783 1.00 75.69  ? 438  THR B CB  1 
ATOM   7549 O OG1 . THR B 1 438 ? -4.276  -8.595  -33.537 1.00 70.62  ? 438  THR B OG1 1 
ATOM   7550 C CG2 . THR B 1 438 ? -6.576  -9.398  -33.563 1.00 76.32  ? 438  THR B CG2 1 
ATOM   7551 N N   . TRP B 1 439 ? -3.699  -8.107  -29.808 1.00 79.36  ? 439  TRP B N   1 
ATOM   7552 C CA  . TRP B 1 439 ? -2.593  -8.410  -28.889 1.00 77.28  ? 439  TRP B CA  1 
ATOM   7553 C C   . TRP B 1 439 ? -3.092  -8.399  -27.431 1.00 79.38  ? 439  TRP B C   1 
ATOM   7554 O O   . TRP B 1 439 ? -4.176  -7.884  -27.149 1.00 81.73  ? 439  TRP B O   1 
ATOM   7555 C CB  . TRP B 1 439 ? -1.423  -7.422  -29.059 1.00 69.20  ? 439  TRP B CB  1 
ATOM   7556 C CG  . TRP B 1 439 ? -0.770  -7.365  -30.432 1.00 63.30  ? 439  TRP B CG  1 
ATOM   7557 C CD1 . TRP B 1 439 ? -1.073  -6.498  -31.441 1.00 61.29  ? 439  TRP B CD1 1 
ATOM   7558 C CD2 . TRP B 1 439 ? 0.325   -8.173  -30.918 1.00 63.28  ? 439  TRP B CD2 1 
ATOM   7559 N NE1 . TRP B 1 439 ? -0.262  -6.734  -32.533 1.00 58.44  ? 439  TRP B NE1 1 
ATOM   7560 C CE2 . TRP B 1 439 ? 0.605   -7.752  -32.238 1.00 63.03  ? 439  TRP B CE2 1 
ATOM   7561 C CE3 . TRP B 1 439 ? 1.083   -9.218  -30.374 1.00 70.64  ? 439  TRP B CE3 1 
ATOM   7562 C CZ2 . TRP B 1 439 ? 1.615   -8.340  -33.021 1.00 73.70  ? 439  TRP B CZ2 1 
ATOM   7563 C CZ3 . TRP B 1 439 ? 2.090   -9.805  -31.156 1.00 70.62  ? 439  TRP B CZ3 1 
ATOM   7564 C CH2 . TRP B 1 439 ? 2.342   -9.363  -32.463 1.00 73.29  ? 439  TRP B CH2 1 
ATOM   7565 N N   . PRO B 1 440 ? -2.305  -8.974  -26.501 1.00 71.31  ? 440  PRO B N   1 
ATOM   7566 C CA  . PRO B 1 440 ? -2.695  -9.081  -25.085 1.00 65.77  ? 440  PRO B CA  1 
ATOM   7567 C C   . PRO B 1 440 ? -2.658  -7.724  -24.411 1.00 67.92  ? 440  PRO B C   1 
ATOM   7568 O O   . PRO B 1 440 ? -2.037  -6.799  -24.947 1.00 73.80  ? 440  PRO B O   1 
ATOM   7569 C CB  . PRO B 1 440 ? -1.600  -9.972  -24.495 1.00 61.37  ? 440  PRO B CB  1 
ATOM   7570 C CG  . PRO B 1 440 ? -0.430  -9.714  -25.387 1.00 65.57  ? 440  PRO B CG  1 
ATOM   7571 C CD  . PRO B 1 440 ? -1.025  -9.650  -26.756 1.00 65.86  ? 440  PRO B CD  1 
ATOM   7572 N N   . LEU B 1 441 ? -3.287  -7.601  -23.248 1.00 63.80  ? 441  LEU B N   1 
ATOM   7573 C CA  . LEU B 1 441 ? -3.385  -6.290  -22.610 1.00 67.68  ? 441  LEU B CA  1 
ATOM   7574 C C   . LEU B 1 441 ? -2.042  -5.724  -22.172 1.00 66.43  ? 441  LEU B C   1 
ATOM   7575 O O   . LEU B 1 441 ? -1.826  -4.518  -22.233 1.00 67.85  ? 441  LEU B O   1 
ATOM   7576 C CB  . LEU B 1 441 ? -4.359  -6.298  -21.430 1.00 71.56  ? 441  LEU B CB  1 
ATOM   7577 C CG  . LEU B 1 441 ? -5.848  -6.227  -21.775 1.00 76.35  ? 441  LEU B CG  1 
ATOM   7578 C CD1 . LEU B 1 441 ? -6.646  -5.707  -20.588 1.00 70.59  ? 441  LEU B CD1 1 
ATOM   7579 C CD2 . LEU B 1 441 ? -6.067  -5.339  -22.987 1.00 79.43  ? 441  LEU B CD2 1 
ATOM   7580 N N   . TRP B 1 442 ? -1.143  -6.594  -21.728 1.00 67.57  ? 442  TRP B N   1 
ATOM   7581 C CA  . TRP B 1 442 ? 0.127   -6.145  -21.166 1.00 64.20  ? 442  TRP B CA  1 
ATOM   7582 C C   . TRP B 1 442 ? 0.957   -5.366  -22.197 1.00 61.63  ? 442  TRP B C   1 
ATOM   7583 O O   . TRP B 1 442 ? 1.921   -4.668  -21.845 1.00 58.96  ? 442  TRP B O   1 
ATOM   7584 C CB  . TRP B 1 442 ? 0.926   -7.329  -20.597 1.00 66.48  ? 442  TRP B CB  1 
ATOM   7585 C CG  . TRP B 1 442 ? 1.509   -8.227  -21.655 1.00 72.26  ? 442  TRP B CG  1 
ATOM   7586 C CD1 . TRP B 1 442 ? 0.970   -9.392  -22.130 1.00 77.41  ? 442  TRP B CD1 1 
ATOM   7587 C CD2 . TRP B 1 442 ? 2.741   -8.031  -22.379 1.00 61.34  ? 442  TRP B CD2 1 
ATOM   7588 N NE1 . TRP B 1 442 ? 1.792   -9.927  -23.098 1.00 76.87  ? 442  TRP B NE1 1 
ATOM   7589 C CE2 . TRP B 1 442 ? 2.880   -9.107  -23.269 1.00 67.87  ? 442  TRP B CE2 1 
ATOM   7590 C CE3 . TRP B 1 442 ? 3.737   -7.053  -22.350 1.00 55.74  ? 442  TRP B CE3 1 
ATOM   7591 C CZ2 . TRP B 1 442 ? 3.979   -9.231  -24.125 1.00 63.33  ? 442  TRP B CZ2 1 
ATOM   7592 C CZ3 . TRP B 1 442 ? 4.818   -7.176  -23.203 1.00 54.51  ? 442  TRP B CZ3 1 
ATOM   7593 C CH2 . TRP B 1 442 ? 4.931   -8.254  -24.079 1.00 54.12  ? 442  TRP B CH2 1 
ATOM   7594 N N   . MET B 1 443 ? 0.577   -5.481  -23.467 1.00 55.72  ? 443  MET B N   1 
ATOM   7595 C CA  . MET B 1 443 ? 1.286   -4.783  -24.529 1.00 53.59  ? 443  MET B CA  1 
ATOM   7596 C C   . MET B 1 443 ? 0.869   -3.318  -24.633 1.00 54.26  ? 443  MET B C   1 
ATOM   7597 O O   . MET B 1 443 ? 1.500   -2.541  -25.348 1.00 58.86  ? 443  MET B O   1 
ATOM   7598 C CB  . MET B 1 443 ? 1.074   -5.488  -25.861 1.00 55.28  ? 443  MET B CB  1 
ATOM   7599 C CG  . MET B 1 443 ? 1.820   -6.795  -25.976 1.00 61.44  ? 443  MET B CG  1 
ATOM   7600 S SD  . MET B 1 443 ? 2.118   -7.170  -27.710 1.00 65.37  ? 443  MET B SD  1 
ATOM   7601 C CE  . MET B 1 443 ? 3.343   -8.456  -27.571 1.00 74.28  ? 443  MET B CE  1 
ATOM   7602 N N   . GLY B 1 444 ? -0.189  -2.956  -23.910 1.00 45.17  ? 444  GLY B N   1 
ATOM   7603 C CA  . GLY B 1 444 ? -0.721  -1.603  -23.909 1.00 51.06  ? 444  GLY B CA  1 
ATOM   7604 C C   . GLY B 1 444 ? -1.226  -1.065  -25.244 1.00 55.74  ? 444  GLY B C   1 
ATOM   7605 O O   . GLY B 1 444 ? -2.161  -1.604  -25.844 1.00 49.45  ? 444  GLY B O   1 
ATOM   7606 N N   . VAL B 1 445 ? -0.617  0.038   -25.682 1.00 59.01  ? 445  VAL B N   1 
ATOM   7607 C CA  . VAL B 1 445 ? -0.840  0.607   -27.007 1.00 51.22  ? 445  VAL B CA  1 
ATOM   7608 C C   . VAL B 1 445 ? 0.446   0.440   -27.782 1.00 52.17  ? 445  VAL B C   1 
ATOM   7609 O O   . VAL B 1 445 ? 1.368   1.218   -27.591 1.00 59.12  ? 445  VAL B O   1 
ATOM   7610 C CB  . VAL B 1 445 ? -1.093  2.105   -26.928 1.00 42.35  ? 445  VAL B CB  1 
ATOM   7611 C CG1 . VAL B 1 445 ? -1.325  2.669   -28.326 1.00 35.76  ? 445  VAL B CG1 1 
ATOM   7612 C CG2 . VAL B 1 445 ? -2.241  2.404   -25.988 1.00 35.74  ? 445  VAL B CG2 1 
ATOM   7613 N N   . PRO B 1 446 ? 0.529   -0.582  -28.647 1.00 50.90  ? 446  PRO B N   1 
ATOM   7614 C CA  . PRO B 1 446 ? 1.861   -0.892  -29.183 1.00 47.00  ? 446  PRO B CA  1 
ATOM   7615 C C   . PRO B 1 446 ? 2.242   -0.099  -30.426 1.00 44.27  ? 446  PRO B C   1 
ATOM   7616 O O   . PRO B 1 446 ? 1.400   0.434   -31.141 1.00 40.21  ? 446  PRO B O   1 
ATOM   7617 C CB  . PRO B 1 446 ? 1.767   -2.400  -29.516 1.00 46.41  ? 446  PRO B CB  1 
ATOM   7618 C CG  . PRO B 1 446 ? 0.444   -2.872  -28.925 1.00 45.36  ? 446  PRO B CG  1 
ATOM   7619 C CD  . PRO B 1 446 ? -0.436  -1.658  -28.937 1.00 47.25  ? 446  PRO B CD  1 
ATOM   7620 N N   . HIS B 1 447 ? 3.544   -0.034  -30.661 1.00 52.13  ? 447  HIS B N   1 
ATOM   7621 C CA  . HIS B 1 447 ? 4.124   0.549   -31.868 1.00 39.86  ? 447  HIS B CA  1 
ATOM   7622 C C   . HIS B 1 447 ? 3.265   0.236   -33.109 1.00 46.16  ? 447  HIS B C   1 
ATOM   7623 O O   . HIS B 1 447 ? 3.000   -0.917  -33.418 1.00 49.43  ? 447  HIS B O   1 
ATOM   7624 C CB  . HIS B 1 447 ? 5.544   -0.015  -31.998 1.00 34.52  ? 447  HIS B CB  1 
ATOM   7625 C CG  . HIS B 1 447 ? 6.335   0.549   -33.128 1.00 45.38  ? 447  HIS B CG  1 
ATOM   7626 N ND1 . HIS B 1 447 ? 6.937   1.787   -33.072 1.00 56.51  ? 447  HIS B ND1 1 
ATOM   7627 C CD2 . HIS B 1 447 ? 6.654   0.028   -34.335 1.00 47.90  ? 447  HIS B CD2 1 
ATOM   7628 C CE1 . HIS B 1 447 ? 7.577   2.014   -34.202 1.00 56.65  ? 447  HIS B CE1 1 
ATOM   7629 N NE2 . HIS B 1 447 ? 7.422   0.963   -34.987 1.00 54.69  ? 447  HIS B NE2 1 
ATOM   7630 N N   . GLY B 1 448 ? 2.801   1.269   -33.800 1.00 53.68  ? 448  GLY B N   1 
ATOM   7631 C CA  . GLY B 1 448 ? 2.083   1.079   -35.047 1.00 52.41  ? 448  GLY B CA  1 
ATOM   7632 C C   . GLY B 1 448 ? 0.565   1.169   -35.011 1.00 52.84  ? 448  GLY B C   1 
ATOM   7633 O O   . GLY B 1 448 ? -0.072  1.203   -36.061 1.00 60.42  ? 448  GLY B O   1 
ATOM   7634 N N   . TYR B 1 449 ? -0.034  1.223   -33.828 1.00 45.00  ? 449  TYR B N   1 
ATOM   7635 C CA  . TYR B 1 449 ? -1.496  1.184   -33.758 1.00 43.50  ? 449  TYR B CA  1 
ATOM   7636 C C   . TYR B 1 449 ? -2.213  2.527   -33.543 1.00 41.92  ? 449  TYR B C   1 
ATOM   7637 O O   . TYR B 1 449 ? -3.339  2.577   -33.075 1.00 48.27  ? 449  TYR B O   1 
ATOM   7638 C CB  . TYR B 1 449 ? -1.937  0.104   -32.778 1.00 46.12  ? 449  TYR B CB  1 
ATOM   7639 C CG  . TYR B 1 449 ? -1.543  -1.246  -33.305 1.00 50.70  ? 449  TYR B CG  1 
ATOM   7640 C CD1 . TYR B 1 449 ? -0.241  -1.696  -33.185 1.00 40.00  ? 449  TYR B CD1 1 
ATOM   7641 C CD2 . TYR B 1 449 ? -2.463  -2.050  -33.984 1.00 55.26  ? 449  TYR B CD2 1 
ATOM   7642 C CE1 . TYR B 1 449 ? 0.127   -2.919  -33.692 1.00 44.17  ? 449  TYR B CE1 1 
ATOM   7643 C CE2 . TYR B 1 449 ? -2.104  -3.285  -34.491 1.00 49.45  ? 449  TYR B CE2 1 
ATOM   7644 C CZ  . TYR B 1 449 ? -0.801  -3.709  -34.347 1.00 48.84  ? 449  TYR B CZ  1 
ATOM   7645 O OH  . TYR B 1 449 ? -0.410  -4.921  -34.856 1.00 51.58  ? 449  TYR B OH  1 
ATOM   7646 N N   . GLU B 1 450 ? -1.545  3.608   -33.919 1.00 38.93  ? 450  GLU B N   1 
ATOM   7647 C CA  . GLU B 1 450 ? -2.179  4.907   -34.095 1.00 42.18  ? 450  GLU B CA  1 
ATOM   7648 C C   . GLU B 1 450 ? -2.570  5.075   -35.578 1.00 42.59  ? 450  GLU B C   1 
ATOM   7649 O O   . GLU B 1 450 ? -3.501  5.796   -35.924 1.00 41.68  ? 450  GLU B O   1 
ATOM   7650 C CB  . GLU B 1 450 ? -1.196  6.023   -33.690 1.00 43.92  ? 450  GLU B CB  1 
ATOM   7651 C CG  . GLU B 1 450 ? -0.142  6.417   -34.762 1.00 37.95  ? 450  GLU B CG  1 
ATOM   7652 C CD  . GLU B 1 450 ? 1.118   5.536   -34.757 1.00 45.06  ? 450  GLU B CD  1 
ATOM   7653 O OE1 . GLU B 1 450 ? 1.023   4.344   -34.372 1.00 43.92  ? 450  GLU B OE1 1 
ATOM   7654 O OE2 . GLU B 1 450 ? 2.207   6.042   -35.145 1.00 41.36  ? 450  GLU B OE2 1 
ATOM   7655 N N   . ILE B 1 451 ? -1.831  4.406   -36.453 1.00 34.50  ? 451  ILE B N   1 
ATOM   7656 C CA  . ILE B 1 451 ? -2.007  4.564   -37.883 1.00 35.22  ? 451  ILE B CA  1 
ATOM   7657 C C   . ILE B 1 451 ? -3.448  4.374   -38.370 1.00 43.59  ? 451  ILE B C   1 
ATOM   7658 O O   . ILE B 1 451 ? -3.946  5.192   -39.149 1.00 44.71  ? 451  ILE B O   1 
ATOM   7659 C CB  . ILE B 1 451 ? -1.037  3.657   -38.666 1.00 38.79  ? 451  ILE B CB  1 
ATOM   7660 C CG1 . ILE B 1 451 ? 0.420   4.035   -38.338 1.00 41.42  ? 451  ILE B CG1 1 
ATOM   7661 C CG2 . ILE B 1 451 ? -1.271  3.800   -40.155 1.00 37.87  ? 451  ILE B CG2 1 
ATOM   7662 C CD1 . ILE B 1 451 ? 1.428   3.096   -38.899 1.00 37.51  ? 451  ILE B CD1 1 
ATOM   7663 N N   . GLU B 1 452 ? -4.120  3.315   -37.921 1.00 40.24  ? 452  GLU B N   1 
ATOM   7664 C CA  . GLU B 1 452 ? -5.465  3.060   -38.398 1.00 45.53  ? 452  GLU B CA  1 
ATOM   7665 C C   . GLU B 1 452 ? -6.368  4.231   -38.070 1.00 48.34  ? 452  GLU B C   1 
ATOM   7666 O O   . GLU B 1 452 ? -7.260  4.561   -38.843 1.00 54.55  ? 452  GLU B O   1 
ATOM   7667 C CB  . GLU B 1 452 ? -6.022  1.768   -37.821 1.00 48.72  ? 452  GLU B CB  1 
ATOM   7668 C CG  . GLU B 1 452 ? -5.794  1.620   -36.354 1.00 60.63  ? 452  GLU B CG  1 
ATOM   7669 C CD  . GLU B 1 452 ? -5.938  0.184   -35.894 1.00 64.18  ? 452  GLU B CD  1 
ATOM   7670 O OE1 . GLU B 1 452 ? -6.910  -0.123  -35.186 1.00 62.33  ? 452  GLU B OE1 1 
ATOM   7671 O OE2 . GLU B 1 452 ? -5.077  -0.645  -36.238 1.00 70.41  ? 452  GLU B OE2 1 
ATOM   7672 N N   . PHE B 1 453 ? -6.120  4.861   -36.926 1.00 41.43  ? 453  PHE B N   1 
ATOM   7673 C CA  . PHE B 1 453 ? -6.902  6.018   -36.491 1.00 35.82  ? 453  PHE B CA  1 
ATOM   7674 C C   . PHE B 1 453 ? -6.651  7.271   -37.298 1.00 45.40  ? 453  PHE B C   1 
ATOM   7675 O O   . PHE B 1 453 ? -7.609  7.900   -37.742 1.00 53.84  ? 453  PHE B O   1 
ATOM   7676 C CB  . PHE B 1 453 ? -6.715  6.273   -34.994 1.00 36.61  ? 453  PHE B CB  1 
ATOM   7677 C CG  . PHE B 1 453 ? -7.265  5.176   -34.157 1.00 42.50  ? 453  PHE B CG  1 
ATOM   7678 C CD1 . PHE B 1 453 ? -8.622  5.128   -33.874 1.00 45.49  ? 453  PHE B CD1 1 
ATOM   7679 C CD2 . PHE B 1 453 ? -6.452  4.136   -33.740 1.00 45.57  ? 453  PHE B CD2 1 
ATOM   7680 C CE1 . PHE B 1 453 ? -9.150  4.090   -33.146 1.00 53.58  ? 453  PHE B CE1 1 
ATOM   7681 C CE2 . PHE B 1 453 ? -6.969  3.091   -33.009 1.00 50.85  ? 453  PHE B CE2 1 
ATOM   7682 C CZ  . PHE B 1 453 ? -8.322  3.070   -32.707 1.00 59.19  ? 453  PHE B CZ  1 
ATOM   7683 N N   . ILE B 1 454 ? -5.378  7.634   -37.483 1.00 42.05  ? 454  ILE B N   1 
ATOM   7684 C CA  . ILE B 1 454 ? -5.025  8.765   -38.338 1.00 31.06  ? 454  ILE B CA  1 
ATOM   7685 C C   . ILE B 1 454 ? -5.619  8.645   -39.737 1.00 36.04  ? 454  ILE B C   1 
ATOM   7686 O O   . ILE B 1 454 ? -6.158  9.622   -40.256 1.00 39.22  ? 454  ILE B O   1 
ATOM   7687 C CB  . ILE B 1 454 ? -3.522  8.903   -38.533 1.00 35.23  ? 454  ILE B CB  1 
ATOM   7688 C CG1 . ILE B 1 454 ? -2.764  8.916   -37.190 1.00 40.93  ? 454  ILE B CG1 1 
ATOM   7689 C CG2 . ILE B 1 454 ? -3.236  10.111  -39.392 1.00 27.88  ? 454  ILE B CG2 1 
ATOM   7690 C CD1 . ILE B 1 454 ? -3.025  10.107  -36.341 1.00 41.79  ? 454  ILE B CD1 1 
ATOM   7691 N N   . PHE B 1 455 ? -5.507  7.457   -40.349 1.00 40.41  ? 455  PHE B N   1 
ATOM   7692 C CA  . PHE B 1 455 ? -5.992  7.212   -41.730 1.00 37.72  ? 455  PHE B CA  1 
ATOM   7693 C C   . PHE B 1 455 ? -7.517  7.072   -41.839 1.00 38.49  ? 455  PHE B C   1 
ATOM   7694 O O   . PHE B 1 455 ? -8.060  6.989   -42.932 1.00 34.68  ? 455  PHE B O   1 
ATOM   7695 C CB  . PHE B 1 455 ? -5.344  5.978   -42.347 1.00 37.34  ? 455  PHE B CB  1 
ATOM   7696 C CG  . PHE B 1 455 ? -4.041  6.246   -43.023 1.00 36.76  ? 455  PHE B CG  1 
ATOM   7697 C CD1 . PHE B 1 455 ? -2.864  6.256   -42.305 1.00 42.10  ? 455  PHE B CD1 1 
ATOM   7698 C CD2 . PHE B 1 455 ? -3.986  6.454   -44.380 1.00 42.51  ? 455  PHE B CD2 1 
ATOM   7699 C CE1 . PHE B 1 455 ? -1.643  6.505   -42.931 1.00 48.10  ? 455  PHE B CE1 1 
ATOM   7700 C CE2 . PHE B 1 455 ? -2.775  6.703   -45.011 1.00 50.92  ? 455  PHE B CE2 1 
ATOM   7701 C CZ  . PHE B 1 455 ? -1.599  6.729   -44.284 1.00 47.94  ? 455  PHE B CZ  1 
ATOM   7702 N N   . GLY B 1 456 ? -8.190  7.041   -40.695 1.00 39.01  ? 456  GLY B N   1 
ATOM   7703 C CA  . GLY B 1 456 ? -9.636  7.131   -40.654 1.00 50.33  ? 456  GLY B CA  1 
ATOM   7704 C C   . GLY B 1 456 ? -10.402 5.825   -40.734 1.00 55.08  ? 456  GLY B C   1 
ATOM   7705 O O   . GLY B 1 456 ? -11.586 5.836   -41.044 1.00 53.30  ? 456  GLY B O   1 
ATOM   7706 N N   . LEU B 1 457 ? -9.743  4.706   -40.444 1.00 54.19  ? 457  LEU B N   1 
ATOM   7707 C CA  . LEU B 1 457 ? -10.359 3.396   -40.655 1.00 57.48  ? 457  LEU B CA  1 
ATOM   7708 C C   . LEU B 1 457 ? -11.681 3.171   -39.896 1.00 60.39  ? 457  LEU B C   1 
ATOM   7709 O O   . LEU B 1 457 ? -12.621 2.605   -40.441 1.00 60.91  ? 457  LEU B O   1 
ATOM   7710 C CB  . LEU B 1 457 ? -9.360  2.262   -40.396 1.00 49.41  ? 457  LEU B CB  1 
ATOM   7711 C CG  . LEU B 1 457 ? -8.700  1.789   -41.685 1.00 50.24  ? 457  LEU B CG  1 
ATOM   7712 C CD1 . LEU B 1 457 ? -7.887  2.904   -42.351 1.00 47.33  ? 457  LEU B CD1 1 
ATOM   7713 C CD2 . LEU B 1 457 ? -7.821  0.624   -41.374 1.00 53.11  ? 457  LEU B CD2 1 
ATOM   7714 N N   . PRO B 1 458 ? -11.745 3.593   -38.631 1.00 53.43  ? 458  PRO B N   1 
ATOM   7715 C CA  . PRO B 1 458 ? -12.957 3.490   -37.822 1.00 56.27  ? 458  PRO B CA  1 
ATOM   7716 C C   . PRO B 1 458 ? -14.253 3.968   -38.505 1.00 58.91  ? 458  PRO B C   1 
ATOM   7717 O O   . PRO B 1 458 ? -15.336 3.533   -38.100 1.00 64.39  ? 458  PRO B O   1 
ATOM   7718 C CB  . PRO B 1 458 ? -12.627 4.376   -36.628 1.00 56.34  ? 458  PRO B CB  1 
ATOM   7719 C CG  . PRO B 1 458 ? -11.163 4.160   -36.455 1.00 57.13  ? 458  PRO B CG  1 
ATOM   7720 C CD  . PRO B 1 458 ? -10.590 4.029   -37.828 1.00 52.20  ? 458  PRO B CD  1 
ATOM   7721 N N   . LEU B 1 459 ? -14.150 4.819   -39.521 1.00 47.35  ? 459  LEU B N   1 
ATOM   7722 C CA  . LEU B 1 459 ? -15.335 5.344   -40.191 1.00 55.21  ? 459  LEU B CA  1 
ATOM   7723 C C   . LEU B 1 459 ? -15.995 4.286   -41.071 1.00 69.57  ? 459  LEU B C   1 
ATOM   7724 O O   . LEU B 1 459 ? -17.166 4.403   -41.451 1.00 69.78  ? 459  LEU B O   1 
ATOM   7725 C CB  . LEU B 1 459 ? -14.990 6.569   -41.036 1.00 50.22  ? 459  LEU B CB  1 
ATOM   7726 C CG  . LEU B 1 459 ? -14.828 7.936   -40.365 1.00 48.50  ? 459  LEU B CG  1 
ATOM   7727 C CD1 . LEU B 1 459 ? -13.813 7.919   -39.249 1.00 47.29  ? 459  LEU B CD1 1 
ATOM   7728 C CD2 . LEU B 1 459 ? -14.386 8.907   -41.416 1.00 51.50  ? 459  LEU B CD2 1 
ATOM   7729 N N   . ASP B 1 460 ? -15.220 3.271   -41.423 1.00 73.50  ? 460  ASP B N   1 
ATOM   7730 C CA  . ASP B 1 460 ? -15.762 2.104   -42.078 1.00 74.59  ? 460  ASP B CA  1 
ATOM   7731 C C   . ASP B 1 460 ? -16.462 1.309   -40.998 1.00 76.06  ? 460  ASP B C   1 
ATOM   7732 O O   . ASP B 1 460 ? -15.817 0.789   -40.077 1.00 66.79  ? 460  ASP B O   1 
ATOM   7733 C CB  . ASP B 1 460 ? -14.650 1.278   -42.710 1.00 78.07  ? 460  ASP B CB  1 
ATOM   7734 C CG  . ASP B 1 460 ? -15.173 0.065   -43.447 1.00 87.21  ? 460  ASP B CG  1 
ATOM   7735 O OD1 . ASP B 1 460 ? -16.385 -0.253  -43.321 1.00 88.12  ? 460  ASP B OD1 1 
ATOM   7736 O OD2 . ASP B 1 460 ? -14.363 -0.568  -44.155 1.00 90.20  ? 460  ASP B OD2 1 
ATOM   7737 N N   . PRO B 1 461 ? -17.795 1.224   -41.104 1.00 84.63  ? 461  PRO B N   1 
ATOM   7738 C CA  . PRO B 1 461 ? -18.689 0.634   -40.096 1.00 79.08  ? 461  PRO B CA  1 
ATOM   7739 C C   . PRO B 1 461 ? -18.471 -0.862  -39.962 1.00 71.43  ? 461  PRO B C   1 
ATOM   7740 O O   . PRO B 1 461 ? -18.468 -1.388  -38.849 1.00 76.19  ? 461  PRO B O   1 
ATOM   7741 C CB  . PRO B 1 461 ? -20.085 0.914   -40.660 1.00 78.48  ? 461  PRO B CB  1 
ATOM   7742 C CG  . PRO B 1 461 ? -19.881 1.990   -41.712 1.00 78.53  ? 461  PRO B CG  1 
ATOM   7743 C CD  . PRO B 1 461 ? -18.535 1.707   -42.282 1.00 81.09  ? 461  PRO B CD  1 
ATOM   7744 N N   . SER B 1 462 ? -18.271 -1.525  -41.097 1.00 65.26  ? 462  SER B N   1 
ATOM   7745 C CA  . SER B 1 462 ? -18.046 -2.966  -41.130 1.00 72.86  ? 462  SER B CA  1 
ATOM   7746 C C   . SER B 1 462 ? -16.790 -3.379  -40.369 1.00 75.96  ? 462  SER B C   1 
ATOM   7747 O O   . SER B 1 462 ? -16.472 -4.567  -40.279 1.00 76.88  ? 462  SER B O   1 
ATOM   7748 C CB  . SER B 1 462 ? -17.944 -3.452  -42.577 1.00 71.60  ? 462  SER B CB  1 
ATOM   7749 O OG  . SER B 1 462 ? -16.786 -2.934  -43.208 1.00 67.88  ? 462  SER B OG  1 
ATOM   7750 N N   . LEU B 1 463 ? -16.080 -2.398  -39.821 1.00 71.98  ? 463  LEU B N   1 
ATOM   7751 C CA  . LEU B 1 463 ? -14.811 -2.674  -39.177 1.00 69.84  ? 463  LEU B CA  1 
ATOM   7752 C C   . LEU B 1 463 ? -14.950 -2.953  -37.700 1.00 81.08  ? 463  LEU B C   1 
ATOM   7753 O O   . LEU B 1 463 ? -13.981 -3.355  -37.042 1.00 88.82  ? 463  LEU B O   1 
ATOM   7754 C CB  . LEU B 1 463 ? -13.824 -1.554  -39.430 1.00 66.93  ? 463  LEU B CB  1 
ATOM   7755 C CG  . LEU B 1 463 ? -12.938 -1.932  -40.607 1.00 61.66  ? 463  LEU B CG  1 
ATOM   7756 C CD1 . LEU B 1 463 ? -12.198 -0.713  -41.107 1.00 63.89  ? 463  LEU B CD1 1 
ATOM   7757 C CD2 . LEU B 1 463 ? -11.981 -3.015  -40.150 1.00 57.40  ? 463  LEU B CD2 1 
ATOM   7758 N N   . ASN B 1 464 ? -16.162 -2.759  -37.192 1.00 82.80  ? 464  ASN B N   1 
ATOM   7759 C CA  . ASN B 1 464 ? -16.495 -3.155  -35.828 1.00 87.82  ? 464  ASN B CA  1 
ATOM   7760 C C   . ASN B 1 464 ? -15.759 -2.314  -34.751 1.00 76.03  ? 464  ASN B C   1 
ATOM   7761 O O   . ASN B 1 464 ? -15.656 -2.729  -33.591 1.00 77.41  ? 464  ASN B O   1 
ATOM   7762 C CB  . ASN B 1 464 ? -16.296 -4.682  -35.630 1.00 107.76 ? 464  ASN B CB  1 
ATOM   7763 C CG  . ASN B 1 464 ? -17.238 -5.542  -36.513 1.00 109.85 ? 464  ASN B CG  1 
ATOM   7764 O OD1 . ASN B 1 464 ? -18.303 -5.087  -36.945 1.00 109.93 ? 464  ASN B OD1 1 
ATOM   7765 N ND2 . ASN B 1 464 ? -16.838 -6.789  -36.773 1.00 107.97 ? 464  ASN B ND2 1 
ATOM   7766 N N   . TYR B 1 465 ? -15.258 -1.135  -35.142 1.00 64.05  ? 465  TYR B N   1 
ATOM   7767 C CA  . TYR B 1 465 ? -14.764 -0.127  -34.190 1.00 56.73  ? 465  TYR B CA  1 
ATOM   7768 C C   . TYR B 1 465 ? -15.919 0.517   -33.413 1.00 49.62  ? 465  TYR B C   1 
ATOM   7769 O O   . TYR B 1 465 ? -16.972 0.739   -33.980 1.00 45.72  ? 465  TYR B O   1 
ATOM   7770 C CB  . TYR B 1 465 ? -14.037 1.000   -34.931 1.00 60.63  ? 465  TYR B CB  1 
ATOM   7771 C CG  . TYR B 1 465 ? -12.645 0.672   -35.409 1.00 57.51  ? 465  TYR B CG  1 
ATOM   7772 C CD1 . TYR B 1 465 ? -11.566 0.690   -34.532 1.00 54.28  ? 465  TYR B CD1 1 
ATOM   7773 C CD2 . TYR B 1 465 ? -12.408 0.373   -36.743 1.00 53.98  ? 465  TYR B CD2 1 
ATOM   7774 C CE1 . TYR B 1 465 ? -10.300 0.391   -34.968 1.00 54.54  ? 465  TYR B CE1 1 
ATOM   7775 C CE2 . TYR B 1 465 ? -11.161 0.077   -37.184 1.00 52.20  ? 465  TYR B CE2 1 
ATOM   7776 C CZ  . TYR B 1 465 ? -10.103 0.082   -36.298 1.00 53.73  ? 465  TYR B CZ  1 
ATOM   7777 O OH  . TYR B 1 465 ? -8.843  -0.203  -36.761 1.00 52.25  ? 465  TYR B OH  1 
ATOM   7778 N N   . THR B 1 466 ? -15.718 0.860   -32.140 1.00 52.74  ? 466  THR B N   1 
ATOM   7779 C CA  . THR B 1 466 ? -16.766 1.532   -31.347 1.00 50.45  ? 466  THR B CA  1 
ATOM   7780 C C   . THR B 1 466 ? -17.114 2.898   -31.898 1.00 55.27  ? 466  THR B C   1 
ATOM   7781 O O   . THR B 1 466 ? -16.441 3.409   -32.774 1.00 66.55  ? 466  THR B O   1 
ATOM   7782 C CB  . THR B 1 466 ? -16.376 1.736   -29.856 1.00 59.61  ? 466  THR B CB  1 
ATOM   7783 O OG1 . THR B 1 466 ? -15.516 2.885   -29.712 1.00 60.29  ? 466  THR B OG1 1 
ATOM   7784 C CG2 . THR B 1 466 ? -15.722 0.484   -29.279 1.00 46.51  ? 466  THR B CG2 1 
ATOM   7785 N N   . THR B 1 467 ? -18.154 3.514   -31.370 1.00 64.68  ? 467  THR B N   1 
ATOM   7786 C CA  . THR B 1 467 ? -18.572 4.792   -31.928 1.00 73.65  ? 467  THR B CA  1 
ATOM   7787 C C   . THR B 1 467 ? -17.733 5.993   -31.443 1.00 66.96  ? 467  THR B C   1 
ATOM   7788 O O   . THR B 1 467 ? -17.536 6.956   -32.183 1.00 59.73  ? 467  THR B O   1 
ATOM   7789 C CB  . THR B 1 467 ? -20.089 5.036   -31.740 1.00 71.79  ? 467  THR B CB  1 
ATOM   7790 O OG1 . THR B 1 467 ? -20.388 6.399   -32.062 1.00 62.01  ? 467  THR B OG1 1 
ATOM   7791 C CG2 . THR B 1 467 ? -20.501 4.739   -30.308 1.00 79.28  ? 467  THR B CG2 1 
ATOM   7792 N N   . GLU B 1 468 ? -17.241 5.931   -30.210 1.00 66.30  ? 468  GLU B N   1 
ATOM   7793 C CA  . GLU B 1 468 ? -16.387 6.993   -29.683 1.00 72.40  ? 468  GLU B CA  1 
ATOM   7794 C C   . GLU B 1 468 ? -15.065 6.975   -30.448 1.00 75.81  ? 468  GLU B C   1 
ATOM   7795 O O   . GLU B 1 468 ? -14.369 7.987   -30.544 1.00 77.45  ? 468  GLU B O   1 
ATOM   7796 C CB  . GLU B 1 468 ? -16.135 6.820   -28.173 1.00 79.01  ? 468  GLU B CB  1 
ATOM   7797 C CG  . GLU B 1 468 ? -17.387 6.526   -27.336 1.00 97.16  ? 468  GLU B CG  1 
ATOM   7798 C CD  . GLU B 1 468 ? -17.590 5.030   -27.051 1.00 104.74 ? 468  GLU B CD  1 
ATOM   7799 O OE1 . GLU B 1 468 ? -18.596 4.449   -27.540 1.00 100.16 ? 468  GLU B OE1 1 
ATOM   7800 O OE2 . GLU B 1 468 ? -16.737 4.444   -26.337 1.00 107.03 ? 468  GLU B OE2 1 
ATOM   7801 N N   . GLU B 1 469 ? -14.734 5.806   -30.989 1.00 67.05  ? 469  GLU B N   1 
ATOM   7802 C CA  . GLU B 1 469 ? -13.520 5.616   -31.757 1.00 57.43  ? 469  GLU B CA  1 
ATOM   7803 C C   . GLU B 1 469 ? -13.639 6.238   -33.141 1.00 56.66  ? 469  GLU B C   1 
ATOM   7804 O O   . GLU B 1 469 ? -12.645 6.686   -33.725 1.00 62.10  ? 469  GLU B O   1 
ATOM   7805 C CB  . GLU B 1 469 ? -13.215 4.129   -31.883 1.00 55.06  ? 469  GLU B CB  1 
ATOM   7806 C CG  . GLU B 1 469 ? -12.260 3.620   -30.844 1.00 59.93  ? 469  GLU B CG  1 
ATOM   7807 C CD  . GLU B 1 469 ? -12.074 2.130   -30.934 1.00 67.67  ? 469  GLU B CD  1 
ATOM   7808 O OE1 . GLU B 1 469 ? -12.960 1.459   -31.497 1.00 68.55  ? 469  GLU B OE1 1 
ATOM   7809 O OE2 . GLU B 1 469 ? -11.047 1.622   -30.442 1.00 72.57  ? 469  GLU B OE2 1 
ATOM   7810 N N   . ARG B 1 470 ? -14.856 6.256   -33.665 1.00 50.24  ? 470  ARG B N   1 
ATOM   7811 C CA  . ARG B 1 470 ? -15.117 6.858   -34.955 1.00 54.28  ? 470  ARG B CA  1 
ATOM   7812 C C   . ARG B 1 470 ? -15.022 8.373   -34.772 1.00 56.87  ? 470  ARG B C   1 
ATOM   7813 O O   . ARG B 1 470 ? -14.513 9.085   -35.622 1.00 65.67  ? 470  ARG B O   1 
ATOM   7814 C CB  . ARG B 1 470 ? -16.493 6.417   -35.468 1.00 60.61  ? 470  ARG B CB  1 
ATOM   7815 C CG  . ARG B 1 470 ? -16.832 6.829   -36.900 1.00 69.82  ? 470  ARG B CG  1 
ATOM   7816 C CD  . ARG B 1 470 ? -17.806 8.002   -36.950 1.00 81.79  ? 470  ARG B CD  1 
ATOM   7817 N NE  . ARG B 1 470 ? -18.948 7.799   -36.056 1.00 96.73  ? 470  ARG B NE  1 
ATOM   7818 C CZ  . ARG B 1 470 ? -19.857 8.729   -35.760 1.00 94.89  ? 470  ARG B CZ  1 
ATOM   7819 N NH1 . ARG B 1 470 ? -19.769 9.939   -36.297 1.00 96.65  ? 470  ARG B NH1 1 
ATOM   7820 N NH2 . ARG B 1 470 ? -20.851 8.452   -34.923 1.00 84.03  ? 470  ARG B NH2 1 
ATOM   7821 N N   . ILE B 1 471 ? -15.480 8.861   -33.633 1.00 58.35  ? 471  ILE B N   1 
ATOM   7822 C CA  . ILE B 1 471 ? -15.408 10.285  -33.330 1.00 60.32  ? 471  ILE B CA  1 
ATOM   7823 C C   . ILE B 1 471 ? -13.953 10.739  -33.139 1.00 58.40  ? 471  ILE B C   1 
ATOM   7824 O O   . ILE B 1 471 ? -13.557 11.835  -33.553 1.00 52.68  ? 471  ILE B O   1 
ATOM   7825 C CB  . ILE B 1 471 ? -16.221 10.589  -32.067 1.00 52.86  ? 471  ILE B CB  1 
ATOM   7826 C CG1 . ILE B 1 471 ? -17.698 10.665  -32.425 1.00 55.70  ? 471  ILE B CG1 1 
ATOM   7827 C CG2 . ILE B 1 471 ? -15.741 11.875  -31.410 1.00 44.95  ? 471  ILE B CG2 1 
ATOM   7828 C CD1 . ILE B 1 471 ? -18.606 10.490  -31.231 1.00 62.10  ? 471  ILE B CD1 1 
ATOM   7829 N N   . PHE B 1 472 ? -13.178 9.867   -32.502 1.00 50.25  ? 472  PHE B N   1 
ATOM   7830 C CA  . PHE B 1 472 ? -11.780 10.089  -32.219 1.00 43.31  ? 472  PHE B CA  1 
ATOM   7831 C C   . PHE B 1 472 ? -11.025 10.113  -33.532 1.00 53.15  ? 472  PHE B C   1 
ATOM   7832 O O   . PHE B 1 472 ? -10.107 10.926  -33.718 1.00 52.18  ? 472  PHE B O   1 
ATOM   7833 C CB  . PHE B 1 472 ? -11.286 8.943   -31.337 1.00 44.72  ? 472  PHE B CB  1 
ATOM   7834 C CG  . PHE B 1 472 ? -9.835  9.028   -30.949 1.00 49.02  ? 472  PHE B CG  1 
ATOM   7835 C CD1 . PHE B 1 472 ? -9.313  10.173  -30.402 1.00 45.74  ? 472  PHE B CD1 1 
ATOM   7836 C CD2 . PHE B 1 472 ? -8.999  7.931   -31.112 1.00 52.43  ? 472  PHE B CD2 1 
ATOM   7837 C CE1 . PHE B 1 472 ? -7.983  10.230  -30.043 1.00 50.81  ? 472  PHE B CE1 1 
ATOM   7838 C CE2 . PHE B 1 472 ? -7.680  7.985   -30.754 1.00 50.06  ? 472  PHE B CE2 1 
ATOM   7839 C CZ  . PHE B 1 472 ? -7.171  9.139   -30.218 1.00 55.16  ? 472  PHE B CZ  1 
ATOM   7840 N N   . ALA B 1 473 ? -11.411 9.223   -34.450 1.00 50.78  ? 473  ALA B N   1 
ATOM   7841 C CA  . ALA B 1 473 ? -10.693 9.118   -35.714 1.00 50.43  ? 473  ALA B CA  1 
ATOM   7842 C C   . ALA B 1 473 ? -10.809 10.434  -36.475 1.00 55.26  ? 473  ALA B C   1 
ATOM   7843 O O   . ALA B 1 473 ? -9.848  10.912  -37.103 1.00 56.20  ? 473  ALA B O   1 
ATOM   7844 C CB  . ALA B 1 473 ? -11.205 7.964   -36.527 1.00 33.63  ? 473  ALA B CB  1 
ATOM   7845 N N   . GLN B 1 474 ? -11.986 11.037  -36.377 1.00 53.32  ? 474  GLN B N   1 
ATOM   7846 C CA  . GLN B 1 474 ? -12.239 12.302  -37.053 1.00 56.41  ? 474  GLN B CA  1 
ATOM   7847 C C   . GLN B 1 474 ? -11.430 13.446  -36.438 1.00 54.32  ? 474  GLN B C   1 
ATOM   7848 O O   . GLN B 1 474 ? -10.978 14.338  -37.154 1.00 59.83  ? 474  GLN B O   1 
ATOM   7849 C CB  . GLN B 1 474 ? -13.739 12.626  -37.068 1.00 57.20  ? 474  GLN B CB  1 
ATOM   7850 C CG  . GLN B 1 474 ? -14.633 11.441  -37.445 1.00 62.29  ? 474  GLN B CG  1 
ATOM   7851 C CD  . GLN B 1 474 ? -16.047 11.851  -37.831 1.00 67.95  ? 474  GLN B CD  1 
ATOM   7852 O OE1 . GLN B 1 474 ? -17.039 11.360  -37.272 1.00 63.97  ? 474  GLN B OE1 1 
ATOM   7853 N NE2 . GLN B 1 474 ? -16.145 12.765  -38.789 1.00 74.86  ? 474  GLN B NE2 1 
ATOM   7854 N N   . ARG B 1 475 ? -11.237 13.427  -35.121 1.00 44.13  ? 475  ARG B N   1 
ATOM   7855 C CA  . ARG B 1 475 ? -10.400 14.443  -34.514 1.00 45.68  ? 475  ARG B CA  1 
ATOM   7856 C C   . ARG B 1 475 ? -8.995  14.366  -35.093 1.00 49.79  ? 475  ARG B C   1 
ATOM   7857 O O   . ARG B 1 475 ? -8.425  15.384  -35.498 1.00 58.26  ? 475  ARG B O   1 
ATOM   7858 C CB  . ARG B 1 475 ? -10.359 14.319  -32.999 1.00 48.61  ? 475  ARG B CB  1 
ATOM   7859 C CG  . ARG B 1 475 ? -11.558 14.927  -32.286 1.00 57.96  ? 475  ARG B CG  1 
ATOM   7860 C CD  . ARG B 1 475 ? -11.541 14.614  -30.785 1.00 57.91  ? 475  ARG B CD  1 
ATOM   7861 N NE  . ARG B 1 475 ? -10.287 15.033  -30.168 1.00 55.28  ? 475  ARG B NE  1 
ATOM   7862 C CZ  . ARG B 1 475 ? -9.691  14.381  -29.178 1.00 49.99  ? 475  ARG B CZ  1 
ATOM   7863 N NH1 . ARG B 1 475 ? -10.238 13.270  -28.692 1.00 46.33  ? 475  ARG B NH1 1 
ATOM   7864 N NH2 . ARG B 1 475 ? -8.545  14.837  -28.685 1.00 46.24  ? 475  ARG B NH2 1 
ATOM   7865 N N   . LEU B 1 476 ? -8.446  13.158  -35.153 1.00 40.08  ? 476  LEU B N   1 
ATOM   7866 C CA  . LEU B 1 476 ? -7.097  12.986  -35.670 1.00 42.47  ? 476  LEU B CA  1 
ATOM   7867 C C   . LEU B 1 476 ? -6.991  13.425  -37.131 1.00 44.35  ? 476  LEU B C   1 
ATOM   7868 O O   . LEU B 1 476 ? -6.077  14.163  -37.516 1.00 44.37  ? 476  LEU B O   1 
ATOM   7869 C CB  . LEU B 1 476 ? -6.628  11.543  -35.498 1.00 38.67  ? 476  LEU B CB  1 
ATOM   7870 C CG  . LEU B 1 476 ? -6.593  11.054  -34.047 1.00 42.03  ? 476  LEU B CG  1 
ATOM   7871 C CD1 . LEU B 1 476 ? -5.723  9.835   -33.953 1.00 48.46  ? 476  LEU B CD1 1 
ATOM   7872 C CD2 . LEU B 1 476 ? -6.072  12.107  -33.114 1.00 36.41  ? 476  LEU B CD2 1 
ATOM   7873 N N   . MET B 1 477 ? -7.929  12.982  -37.952 1.00 34.44  ? 477  MET B N   1 
ATOM   7874 C CA  . MET B 1 477 ? -7.843  13.338  -39.350 1.00 39.38  ? 477  MET B CA  1 
ATOM   7875 C C   . MET B 1 477 ? -7.795  14.848  -39.451 1.00 50.66  ? 477  MET B C   1 
ATOM   7876 O O   . MET B 1 477 ? -7.102  15.406  -40.301 1.00 47.93  ? 477  MET B O   1 
ATOM   7877 C CB  . MET B 1 477 ? -9.018  12.755  -40.119 1.00 46.79  ? 477  MET B CB  1 
ATOM   7878 C CG  . MET B 1 477 ? -8.955  11.237  -40.247 1.00 51.48  ? 477  MET B CG  1 
ATOM   7879 S SD  . MET B 1 477 ? -10.393 10.548  -41.084 1.00 56.03  ? 477  MET B SD  1 
ATOM   7880 C CE  . MET B 1 477 ? -10.386 11.460  -42.607 1.00 78.99  ? 477  MET B CE  1 
ATOM   7881 N N   . LYS B 1 478 ? -8.517  15.496  -38.542 1.00 57.54  ? 478  LYS B N   1 
ATOM   7882 C CA  . LYS B 1 478 ? -8.567  16.946  -38.468 1.00 56.10  ? 478  LYS B CA  1 
ATOM   7883 C C   . LYS B 1 478 ? -7.235  17.575  -38.075 1.00 49.06  ? 478  LYS B C   1 
ATOM   7884 O O   . LYS B 1 478 ? -6.825  18.545  -38.683 1.00 49.54  ? 478  LYS B O   1 
ATOM   7885 C CB  . LYS B 1 478 ? -9.646  17.390  -37.492 1.00 61.17  ? 478  LYS B CB  1 
ATOM   7886 C CG  . LYS B 1 478 ? -10.908 17.894  -38.136 1.00 66.82  ? 478  LYS B CG  1 
ATOM   7887 C CD  . LYS B 1 478 ? -10.742 19.295  -38.679 1.00 70.48  ? 478  LYS B CD  1 
ATOM   7888 C CE  . LYS B 1 478 ? -12.062 19.765  -39.281 1.00 78.69  ? 478  LYS B CE  1 
ATOM   7889 N NZ  . LYS B 1 478 ? -12.651 18.780  -40.260 1.00 72.08  ? 478  LYS B NZ  1 
ATOM   7890 N N   . TYR B 1 479 ? -6.572  17.050  -37.050 1.00 40.63  ? 479  TYR B N   1 
ATOM   7891 C CA  . TYR B 1 479 ? -5.280  17.608  -36.663 1.00 41.47  ? 479  TYR B CA  1 
ATOM   7892 C C   . TYR B 1 479 ? -4.309  17.422  -37.819 1.00 39.77  ? 479  TYR B C   1 
ATOM   7893 O O   . TYR B 1 479 ? -3.669  18.378  -38.273 1.00 42.44  ? 479  TYR B O   1 
ATOM   7894 C CB  . TYR B 1 479 ? -4.705  16.928  -35.424 1.00 38.29  ? 479  TYR B CB  1 
ATOM   7895 C CG  . TYR B 1 479 ? -5.510  17.089  -34.157 1.00 42.02  ? 479  TYR B CG  1 
ATOM   7896 C CD1 . TYR B 1 479 ? -6.011  18.322  -33.782 1.00 44.30  ? 479  TYR B CD1 1 
ATOM   7897 C CD2 . TYR B 1 479 ? -5.735  16.012  -33.310 1.00 38.04  ? 479  TYR B CD2 1 
ATOM   7898 C CE1 . TYR B 1 479 ? -6.741  18.481  -32.610 1.00 38.62  ? 479  TYR B CE1 1 
ATOM   7899 C CE2 . TYR B 1 479 ? -6.463  16.165  -32.127 1.00 38.71  ? 479  TYR B CE2 1 
ATOM   7900 C CZ  . TYR B 1 479 ? -6.967  17.405  -31.787 1.00 42.99  ? 479  TYR B CZ  1 
ATOM   7901 O OH  . TYR B 1 479 ? -7.688  17.579  -30.613 1.00 51.31  ? 479  TYR B OH  1 
ATOM   7902 N N   . TRP B 1 480 ? -4.202  16.187  -38.299 1.00 34.69  ? 480  TRP B N   1 
ATOM   7903 C CA  . TRP B 1 480 ? -3.241  15.889  -39.348 1.00 35.24  ? 480  TRP B CA  1 
ATOM   7904 C C   . TRP B 1 480 ? -3.481  16.769  -40.563 1.00 42.08  ? 480  TRP B C   1 
ATOM   7905 O O   . TRP B 1 480 ? -2.543  17.385  -41.068 1.00 34.55  ? 480  TRP B O   1 
ATOM   7906 C CB  . TRP B 1 480 ? -3.242  14.412  -39.719 1.00 30.46  ? 480  TRP B CB  1 
ATOM   7907 C CG  . TRP B 1 480 ? -2.151  13.614  -39.048 1.00 41.79  ? 480  TRP B CG  1 
ATOM   7908 C CD1 . TRP B 1 480 ? -1.145  12.894  -39.663 1.00 42.77  ? 480  TRP B CD1 1 
ATOM   7909 C CD2 . TRP B 1 480 ? -1.948  13.455  -37.642 1.00 40.27  ? 480  TRP B CD2 1 
ATOM   7910 N NE1 . TRP B 1 480 ? -0.337  12.302  -38.722 1.00 37.38  ? 480  TRP B NE1 1 
ATOM   7911 C CE2 . TRP B 1 480 ? -0.805  12.623  -37.475 1.00 39.46  ? 480  TRP B CE2 1 
ATOM   7912 C CE3 . TRP B 1 480 ? -2.610  13.935  -36.508 1.00 34.19  ? 480  TRP B CE3 1 
ATOM   7913 C CZ2 . TRP B 1 480 ? -0.315  12.269  -36.219 1.00 28.91  ? 480  TRP B CZ2 1 
ATOM   7914 C CZ3 . TRP B 1 480 ? -2.138  13.572  -35.270 1.00 40.33  ? 480  TRP B CZ3 1 
ATOM   7915 C CH2 . TRP B 1 480 ? -0.984  12.758  -35.129 1.00 36.19  ? 480  TRP B CH2 1 
ATOM   7916 N N   . THR B 1 481 ? -4.736  16.870  -41.006 1.00 42.41  ? 481  THR B N   1 
ATOM   7917 C CA  . THR B 1 481 ? -5.011  17.614  -42.235 1.00 37.69  ? 481  THR B CA  1 
ATOM   7918 C C   . THR B 1 481 ? -4.878  19.101  -42.003 1.00 35.75  ? 481  THR B C   1 
ATOM   7919 O O   . THR B 1 481 ? -4.441  19.819  -42.897 1.00 40.22  ? 481  THR B O   1 
ATOM   7920 C CB  . THR B 1 481 ? -6.380  17.288  -42.885 1.00 37.50  ? 481  THR B CB  1 
ATOM   7921 O OG1 . THR B 1 481 ? -7.436  17.596  -41.973 1.00 45.03  ? 481  THR B OG1 1 
ATOM   7922 C CG2 . THR B 1 481 ? -6.464  15.830  -43.274 1.00 31.27  ? 481  THR B CG2 1 
ATOM   7923 N N   . ASN B 1 482 ? -5.240  19.566  -40.810 1.00 37.38  ? 482  ASN B N   1 
ATOM   7924 C CA  . ASN B 1 482 ? -5.055  20.987  -40.477 1.00 45.10  ? 482  ASN B CA  1 
ATOM   7925 C C   . ASN B 1 482 ? -3.605  21.277  -40.524 1.00 42.42  ? 482  ASN B C   1 
ATOM   7926 O O   . ASN B 1 482 ? -3.166  22.296  -41.074 1.00 41.34  ? 482  ASN B O   1 
ATOM   7927 C CB  . ASN B 1 482 ? -5.548  21.349  -39.080 1.00 39.91  ? 482  ASN B CB  1 
ATOM   7928 C CG  . ASN B 1 482 ? -7.033  21.638  -39.045 1.00 43.21  ? 482  ASN B CG  1 
ATOM   7929 O OD1 . ASN B 1 482 ? -7.650  21.957  -40.070 1.00 41.25  ? 482  ASN B OD1 1 
ATOM   7930 N ND2 . ASN B 1 482 ? -7.619  21.518  -37.858 1.00 42.69  ? 482  ASN B ND2 1 
ATOM   7931 N N   . PHE B 1 483 ? -2.855  20.363  -39.935 1.00 39.84  ? 483  PHE B N   1 
ATOM   7932 C CA  . PHE B 1 483 ? -1.431  20.509  -39.987 1.00 49.01  ? 483  PHE B CA  1 
ATOM   7933 C C   . PHE B 1 483 ? -0.987  20.661  -41.444 1.00 49.91  ? 483  PHE B C   1 
ATOM   7934 O O   . PHE B 1 483 ? -0.194  21.536  -41.759 1.00 55.82  ? 483  PHE B O   1 
ATOM   7935 C CB  . PHE B 1 483 ? -0.705  19.363  -39.297 1.00 44.48  ? 483  PHE B CB  1 
ATOM   7936 C CG  . PHE B 1 483 ? 0.783   19.549  -39.270 1.00 45.15  ? 483  PHE B CG  1 
ATOM   7937 C CD1 . PHE B 1 483 ? 1.358   20.520  -38.443 1.00 49.95  ? 483  PHE B CD1 1 
ATOM   7938 C CD2 . PHE B 1 483 ? 1.605   18.801  -40.098 1.00 36.31  ? 483  PHE B CD2 1 
ATOM   7939 C CE1 . PHE B 1 483 ? 2.737   20.723  -38.412 1.00 45.86  ? 483  PHE B CE1 1 
ATOM   7940 C CE2 . PHE B 1 483 ? 2.981   19.000  -40.073 1.00 47.61  ? 483  PHE B CE2 1 
ATOM   7941 C CZ  . PHE B 1 483 ? 3.547   19.964  -39.220 1.00 45.96  ? 483  PHE B CZ  1 
ATOM   7942 N N   . ALA B 1 484 ? -1.512  19.834  -42.337 1.00 41.53  ? 484  ALA B N   1 
ATOM   7943 C CA  . ALA B 1 484 ? -1.044  19.864  -43.718 1.00 36.51  ? 484  ALA B CA  1 
ATOM   7944 C C   . ALA B 1 484 ? -1.418  21.185  -44.394 1.00 40.46  ? 484  ALA B C   1 
ATOM   7945 O O   . ALA B 1 484 ? -0.609  21.762  -45.130 1.00 37.91  ? 484  ALA B O   1 
ATOM   7946 C CB  . ALA B 1 484 ? -1.572  18.644  -44.513 1.00 23.15  ? 484  ALA B CB  1 
ATOM   7947 N N   . ARG B 1 485 ? -2.632  21.666  -44.120 1.00 37.21  ? 485  ARG B N   1 
ATOM   7948 C CA  . ARG B 1 485 ? -3.103  22.943  -44.667 1.00 46.65  ? 485  ARG B CA  1 
ATOM   7949 C C   . ARG B 1 485 ? -2.242  24.103  -44.219 1.00 46.59  ? 485  ARG B C   1 
ATOM   7950 O O   . ARG B 1 485 ? -1.905  24.966  -45.027 1.00 38.86  ? 485  ARG B O   1 
ATOM   7951 C CB  . ARG B 1 485 ? -4.565  23.237  -44.276 1.00 48.50  ? 485  ARG B CB  1 
ATOM   7952 C CG  . ARG B 1 485 ? -5.589  22.563  -45.161 1.00 59.17  ? 485  ARG B CG  1 
ATOM   7953 C CD  . ARG B 1 485 ? -7.000  22.710  -44.631 1.00 68.17  ? 485  ARG B CD  1 
ATOM   7954 N NE  . ARG B 1 485 ? -7.337  21.690  -43.642 1.00 76.87  ? 485  ARG B NE  1 
ATOM   7955 C CZ  . ARG B 1 485 ? -8.079  20.612  -43.889 1.00 85.36  ? 485  ARG B CZ  1 
ATOM   7956 N NH1 . ARG B 1 485 ? -8.577  20.396  -45.106 1.00 85.94  ? 485  ARG B NH1 1 
ATOM   7957 N NH2 . ARG B 1 485 ? -8.327  19.750  -42.910 1.00 85.18  ? 485  ARG B NH2 1 
ATOM   7958 N N   . THR B 1 486 ? -1.870  24.105  -42.937 1.00 40.49  ? 486  THR B N   1 
ATOM   7959 C CA  . THR B 1 486 ? -1.410  25.326  -42.293 1.00 39.61  ? 486  THR B CA  1 
ATOM   7960 C C   . THR B 1 486 ? -0.168  25.223  -41.436 1.00 47.62  ? 486  THR B C   1 
ATOM   7961 O O   . THR B 1 486 ? 0.281   26.227  -40.891 1.00 48.78  ? 486  THR B O   1 
ATOM   7962 C CB  . THR B 1 486 ? -2.493  25.860  -41.325 1.00 40.82  ? 486  THR B CB  1 
ATOM   7963 O OG1 . THR B 1 486 ? -2.850  24.844  -40.367 1.00 47.69  ? 486  THR B OG1 1 
ATOM   7964 C CG2 . THR B 1 486 ? -3.699  26.280  -42.077 1.00 22.28  ? 486  THR B CG2 1 
ATOM   7965 N N   . GLY B 1 487 ? 0.355   24.027  -41.236 1.00 50.88  ? 487  GLY B N   1 
ATOM   7966 C CA  . GLY B 1 487 ? 1.465   23.880  -40.303 1.00 51.14  ? 487  GLY B CA  1 
ATOM   7967 C C   . GLY B 1 487 ? 1.082   24.066  -38.842 1.00 50.49  ? 487  GLY B C   1 
ATOM   7968 O O   . GLY B 1 487 ? 1.968   24.174  -38.001 1.00 47.82  ? 487  GLY B O   1 
ATOM   7969 N N   . ASP B 1 488 ? -0.228  24.113  -38.556 1.00 50.25  ? 488  ASP B N   1 
ATOM   7970 C CA  . ASP B 1 488 ? -0.773  24.186  -37.192 1.00 39.92  ? 488  ASP B CA  1 
ATOM   7971 C C   . ASP B 1 488 ? -1.958  23.222  -37.068 1.00 42.03  ? 488  ASP B C   1 
ATOM   7972 O O   . ASP B 1 488 ? -2.950  23.367  -37.770 1.00 54.58  ? 488  ASP B O   1 
ATOM   7973 C CB  . ASP B 1 488 ? -1.196  25.625  -36.881 1.00 33.97  ? 488  ASP B CB  1 
ATOM   7974 C CG  . ASP B 1 488 ? -1.618  25.842  -35.424 1.00 44.86  ? 488  ASP B CG  1 
ATOM   7975 O OD1 . ASP B 1 488 ? -2.128  24.908  -34.769 1.00 50.84  ? 488  ASP B OD1 1 
ATOM   7976 O OD2 . ASP B 1 488 ? -1.462  26.981  -34.932 1.00 47.53  ? 488  ASP B OD2 1 
ATOM   7977 N N   . PRO B 1 489 ? -1.855  22.224  -36.179 1.00 44.17  ? 489  PRO B N   1 
ATOM   7978 C CA  . PRO B 1 489 ? -2.856  21.152  -36.087 1.00 44.07  ? 489  PRO B CA  1 
ATOM   7979 C C   . PRO B 1 489 ? -4.187  21.628  -35.489 1.00 44.71  ? 489  PRO B C   1 
ATOM   7980 O O   . PRO B 1 489 ? -5.212  20.944  -35.594 1.00 54.80  ? 489  PRO B O   1 
ATOM   7981 C CB  . PRO B 1 489 ? -2.187  20.155  -35.137 1.00 33.02  ? 489  PRO B CB  1 
ATOM   7982 C CG  . PRO B 1 489 ? -1.359  21.038  -34.258 1.00 37.65  ? 489  PRO B CG  1 
ATOM   7983 C CD  . PRO B 1 489 ? -0.746  21.995  -35.236 1.00 42.16  ? 489  PRO B CD  1 
ATOM   7984 N N   . ASN B 1 490 ? -4.163  22.796  -34.863 1.00 32.50  ? 490  ASN B N   1 
ATOM   7985 C CA  . ASN B 1 490 ? -5.354  23.364  -34.244 1.00 40.45  ? 490  ASN B CA  1 
ATOM   7986 C C   . ASN B 1 490 ? -6.396  23.834  -35.277 1.00 56.36  ? 490  ASN B C   1 
ATOM   7987 O O   . ASN B 1 490 ? -6.035  24.435  -36.313 1.00 50.77  ? 490  ASN B O   1 
ATOM   7988 C CB  . ASN B 1 490 ? -4.976  24.530  -33.313 1.00 32.70  ? 490  ASN B CB  1 
ATOM   7989 C CG  . ASN B 1 490 ? -4.253  24.075  -32.040 1.00 41.68  ? 490  ASN B CG  1 
ATOM   7990 O OD1 . ASN B 1 490 ? -4.874  23.563  -31.109 1.00 45.31  ? 490  ASN B OD1 1 
ATOM   7991 N ND2 . ASN B 1 490 ? -2.941  24.285  -31.995 1.00 45.00  ? 490  ASN B ND2 1 
ATOM   7992 N N   . ASP B 1 491 ? -7.672  23.538  -34.991 1.00 63.49  ? 491  ASP B N   1 
ATOM   7993 C CA  . ASP B 1 491 ? -8.808  24.025  -35.782 1.00 72.87  ? 491  ASP B CA  1 
ATOM   7994 C C   . ASP B 1 491 ? -8.787  25.558  -35.813 1.00 71.48  ? 491  ASP B C   1 
ATOM   7995 O O   . ASP B 1 491 ? -8.836  26.185  -34.765 1.00 70.83  ? 491  ASP B O   1 
ATOM   7996 C CB  . ASP B 1 491 ? -10.128 23.530  -35.169 1.00 80.36  ? 491  ASP B CB  1 
ATOM   7997 C CG  . ASP B 1 491 ? -11.066 22.881  -36.199 1.00 82.26  ? 491  ASP B CG  1 
ATOM   7998 O OD1 . ASP B 1 491 ? -11.104 23.303  -37.381 1.00 82.66  ? 491  ASP B OD1 1 
ATOM   7999 O OD2 . ASP B 1 491 ? -11.779 21.932  -35.812 1.00 79.61  ? 491  ASP B OD2 1 
ATOM   8000 N N   . PRO B 1 492 ? -8.727  26.159  -37.020 1.00 78.91  ? 492  PRO B N   1 
ATOM   8001 C CA  . PRO B 1 492 ? -8.433  27.582  -37.275 1.00 81.53  ? 492  PRO B CA  1 
ATOM   8002 C C   . PRO B 1 492 ? -9.592  28.488  -36.915 1.00 92.32  ? 492  PRO B C   1 
ATOM   8003 O O   . PRO B 1 492 ? -9.454  29.715  -36.903 1.00 90.81  ? 492  PRO B O   1 
ATOM   8004 C CB  . PRO B 1 492 ? -8.241  27.643  -38.794 1.00 79.17  ? 492  PRO B CB  1 
ATOM   8005 C CG  . PRO B 1 492 ? -8.307  26.205  -39.284 1.00 83.17  ? 492  PRO B CG  1 
ATOM   8006 C CD  . PRO B 1 492 ? -9.087  25.459  -38.261 1.00 82.49  ? 492  PRO B CD  1 
ATOM   8007 N N   . ARG B 1 493 ? -10.737 27.872  -36.660 1.00 101.76 ? 493  ARG B N   1 
ATOM   8008 C CA  . ARG B 1 493 ? -11.929 28.571  -36.222 1.00 106.21 ? 493  ARG B CA  1 
ATOM   8009 C C   . ARG B 1 493 ? -12.716 27.509  -35.467 1.00 108.38 ? 493  ARG B C   1 
ATOM   8010 O O   . ARG B 1 493 ? -13.027 26.447  -36.021 1.00 108.89 ? 493  ARG B O   1 
ATOM   8011 C CB  . ARG B 1 493 ? -12.690 29.142  -37.425 1.00 110.29 ? 493  ARG B CB  1 
ATOM   8012 C CG  . ARG B 1 493 ? -11.811 29.986  -38.379 1.00 107.49 ? 493  ARG B CG  1 
ATOM   8013 C CD  . ARG B 1 493 ? -12.603 30.737  -39.444 1.00 101.20 ? 493  ARG B CD  1 
ATOM   8014 N NE  . ARG B 1 493 ? -13.859 31.234  -38.899 1.00 105.07 ? 493  ARG B NE  1 
ATOM   8015 C CZ  . ARG B 1 493 ? -13.955 32.199  -37.990 1.00 110.32 ? 493  ARG B CZ  1 
ATOM   8016 N NH1 . ARG B 1 493 ? -12.862 32.785  -37.519 1.00 112.43 ? 493  ARG B NH1 1 
ATOM   8017 N NH2 . ARG B 1 493 ? -15.148 32.574  -37.547 1.00 112.53 ? 493  ARG B NH2 1 
ATOM   8018 N N   . ASP B 1 494 ? -12.995 27.796  -34.197 1.00 107.32 ? 494  ASP B N   1 
ATOM   8019 C CA  . ASP B 1 494 ? -13.380 26.791  -33.209 1.00 112.70 ? 494  ASP B CA  1 
ATOM   8020 C C   . ASP B 1 494 ? -12.640 27.098  -31.915 1.00 113.18 ? 494  ASP B C   1 
ATOM   8021 O O   . ASP B 1 494 ? -11.459 26.757  -31.771 1.00 110.12 ? 494  ASP B O   1 
ATOM   8022 C CB  . ASP B 1 494 ? -12.996 25.377  -33.662 1.00 118.28 ? 494  ASP B CB  1 
ATOM   8023 C CG  . ASP B 1 494 ? -12.919 24.389  -32.503 1.00 122.09 ? 494  ASP B CG  1 
ATOM   8024 O OD1 . ASP B 1 494 ? -13.980 23.914  -32.046 1.00 122.93 ? 494  ASP B OD1 1 
ATOM   8025 O OD2 . ASP B 1 494 ? -11.795 24.083  -32.050 1.00 122.46 ? 494  ASP B OD2 1 
ATOM   8026 N N   . SER B 1 495 ? -13.332 27.741  -30.981 1.00 115.39 ? 495  SER B N   1 
ATOM   8027 C CA  . SER B 1 495 ? -12.742 28.104  -29.695 1.00 119.47 ? 495  SER B CA  1 
ATOM   8028 C C   . SER B 1 495 ? -12.468 26.876  -28.813 1.00 133.63 ? 495  SER B C   1 
ATOM   8029 O O   . SER B 1 495 ? -12.541 25.733  -29.280 1.00 134.68 ? 495  SER B O   1 
ATOM   8030 C CB  . SER B 1 495 ? -13.662 29.090  -28.961 1.00 107.31 ? 495  SER B CB  1 
ATOM   8031 O OG  . SER B 1 495 ? -13.050 29.609  -27.790 1.00 94.89  ? 495  SER B OG  1 
ATOM   8032 N N   . LYS B 1 496 ? -12.110 27.136  -27.555 1.00 142.22 ? 496  LYS B N   1 
ATOM   8033 C CA  . LYS B 1 496 ? -12.163 26.141  -26.488 1.00 147.36 ? 496  LYS B CA  1 
ATOM   8034 C C   . LYS B 1 496 ? -11.750 24.753  -26.970 1.00 155.83 ? 496  LYS B C   1 
ATOM   8035 O O   . LYS B 1 496 ? -12.508 24.082  -27.677 1.00 155.26 ? 496  LYS B O   1 
ATOM   8036 C CB  . LYS B 1 496 ? -13.594 26.091  -25.939 1.00 143.85 ? 496  LYS B CB  1 
ATOM   8037 C CG  . LYS B 1 496 ? -13.738 25.674  -24.480 1.00 138.20 ? 496  LYS B CG  1 
ATOM   8038 C CD  . LYS B 1 496 ? -13.615 26.859  -23.517 1.00 129.61 ? 496  LYS B CD  1 
ATOM   8039 C CE  . LYS B 1 496 ? -14.405 28.085  -23.983 1.00 122.99 ? 496  LYS B CE  1 
ATOM   8040 N NZ  . LYS B 1 496 ? -15.886 27.884  -24.079 1.00 116.65 ? 496  LYS B NZ  1 
ATOM   8041 N N   . SER B 1 497 ? -10.558 24.310  -26.584 1.00 161.70 ? 497  SER B N   1 
ATOM   8042 C CA  . SER B 1 497 ? -10.092 22.992  -27.023 1.00 164.97 ? 497  SER B CA  1 
ATOM   8043 C C   . SER B 1 497 ? -9.658  22.014  -25.895 1.00 104.65 ? 497  SER B C   1 
ATOM   8044 O O   . SER B 1 497 ? -10.181 20.898  -25.818 1.00 100.91 ? 497  SER B O   1 
ATOM   8045 C CB  . SER B 1 497 ? -9.040  23.122  -28.138 1.00 166.36 ? 497  SER B CB  1 
ATOM   8046 O OG  . SER B 1 497 ? -9.626  23.079  -29.425 1.00 168.73 ? 497  SER B OG  1 
ATOM   8047 N N   . PRO B 1 498 ? -8.692  22.408  -25.037 1.00 102.43 ? 498  PRO B N   1 
ATOM   8048 C CA  . PRO B 1 498 ? -7.873  23.621  -25.148 1.00 93.94  ? 498  PRO B CA  1 
ATOM   8049 C C   . PRO B 1 498 ? -6.893  23.455  -26.305 1.00 74.46  ? 498  PRO B C   1 
ATOM   8050 O O   . PRO B 1 498 ? -6.919  22.438  -26.990 1.00 58.10  ? 498  PRO B O   1 
ATOM   8051 C CB  . PRO B 1 498 ? -7.121  23.667  -23.818 1.00 96.71  ? 498  PRO B CB  1 
ATOM   8052 C CG  . PRO B 1 498 ? -7.099  22.254  -23.324 1.00 95.46  ? 498  PRO B CG  1 
ATOM   8053 C CD  . PRO B 1 498 ? -8.339  21.597  -23.852 1.00 97.19  ? 498  PRO B CD  1 
ATOM   8054 N N   . GLN B 1 499 ? -6.036  24.435  -26.524 1.00 67.75  ? 499  GLN B N   1 
ATOM   8055 C CA  . GLN B 1 499 ? -5.218  24.427  -27.724 1.00 51.14  ? 499  GLN B CA  1 
ATOM   8056 C C   . GLN B 1 499 ? -3.985  23.503  -27.618 1.00 41.69  ? 499  GLN B C   1 
ATOM   8057 O O   . GLN B 1 499 ? -3.479  23.233  -26.530 1.00 39.36  ? 499  GLN B O   1 
ATOM   8058 C CB  . GLN B 1 499 ? -4.827  25.861  -28.049 1.00 56.89  ? 499  GLN B CB  1 
ATOM   8059 C CG  . GLN B 1 499 ? -6.019  26.792  -28.199 1.00 58.71  ? 499  GLN B CG  1 
ATOM   8060 C CD  . GLN B 1 499 ? -6.652  26.711  -29.579 1.00 64.74  ? 499  GLN B CD  1 
ATOM   8061 O OE1 . GLN B 1 499 ? -5.983  26.938  -30.589 1.00 63.94  ? 499  GLN B OE1 1 
ATOM   8062 N NE2 . GLN B 1 499 ? -7.954  26.398  -29.629 1.00 67.82  ? 499  GLN B NE2 1 
ATOM   8063 N N   . TRP B 1 500 ? -3.531  22.996  -28.757 1.00 34.68  ? 500  TRP B N   1 
ATOM   8064 C CA  . TRP B 1 500 ? -2.319  22.202  -28.828 1.00 36.94  ? 500  TRP B CA  1 
ATOM   8065 C C   . TRP B 1 500 ? -1.120  23.142  -29.006 1.00 43.62  ? 500  TRP B C   1 
ATOM   8066 O O   . TRP B 1 500 ? -0.908  23.684  -30.088 1.00 49.10  ? 500  TRP B O   1 
ATOM   8067 C CB  . TRP B 1 500 ? -2.420  21.283  -30.026 1.00 37.44  ? 500  TRP B CB  1 
ATOM   8068 C CG  . TRP B 1 500 ? -1.332  20.291  -30.150 1.00 41.93  ? 500  TRP B CG  1 
ATOM   8069 C CD1 . TRP B 1 500 ? -0.105  20.343  -29.576 1.00 40.03  ? 500  TRP B CD1 1 
ATOM   8070 C CD2 . TRP B 1 500 ? -1.360  19.104  -30.943 1.00 43.52  ? 500  TRP B CD2 1 
ATOM   8071 N NE1 . TRP B 1 500 ? 0.637   19.252  -29.953 1.00 46.01  ? 500  TRP B NE1 1 
ATOM   8072 C CE2 . TRP B 1 500 ? -0.109  18.476  -30.796 1.00 42.65  ? 500  TRP B CE2 1 
ATOM   8073 C CE3 . TRP B 1 500 ? -2.324  18.509  -31.762 1.00 45.59  ? 500  TRP B CE3 1 
ATOM   8074 C CZ2 . TRP B 1 500 ? 0.206   17.280  -31.431 1.00 49.32  ? 500  TRP B CZ2 1 
ATOM   8075 C CZ3 . TRP B 1 500 ? -2.009  17.315  -32.393 1.00 51.88  ? 500  TRP B CZ3 1 
ATOM   8076 C CH2 . TRP B 1 500 ? -0.755  16.717  -32.225 1.00 53.50  ? 500  TRP B CH2 1 
ATOM   8077 N N   . PRO B 1 501 ? -0.351  23.364  -27.933 1.00 36.07  ? 501  PRO B N   1 
ATOM   8078 C CA  . PRO B 1 501 ? 0.754   24.328  -27.949 1.00 39.18  ? 501  PRO B CA  1 
ATOM   8079 C C   . PRO B 1 501 ? 1.970   23.771  -28.680 1.00 41.46  ? 501  PRO B C   1 
ATOM   8080 O O   . PRO B 1 501 ? 2.167   22.539  -28.690 1.00 35.93  ? 501  PRO B O   1 
ATOM   8081 C CB  . PRO B 1 501 ? 1.112   24.490  -26.473 1.00 31.34  ? 501  PRO B CB  1 
ATOM   8082 C CG  . PRO B 1 501 ? 0.137   23.640  -25.689 1.00 35.44  ? 501  PRO B CG  1 
ATOM   8083 C CD  . PRO B 1 501 ? -0.459  22.668  -26.647 1.00 35.46  ? 501  PRO B CD  1 
ATOM   8084 N N   . PRO B 1 502 ? 2.775   24.663  -29.284 1.00 31.89  ? 502  PRO B N   1 
ATOM   8085 C CA  . PRO B 1 502 ? 4.041   24.269  -29.925 1.00 36.34  ? 502  PRO B CA  1 
ATOM   8086 C C   . PRO B 1 502 ? 5.049   23.744  -28.901 1.00 39.63  ? 502  PRO B C   1 
ATOM   8087 O O   . PRO B 1 502 ? 5.276   24.404  -27.885 1.00 41.10  ? 502  PRO B O   1 
ATOM   8088 C CB  . PRO B 1 502 ? 4.540   25.576  -30.552 1.00 34.98  ? 502  PRO B CB  1 
ATOM   8089 C CG  . PRO B 1 502 ? 3.236   26.456  -30.716 1.00 30.67  ? 502  PRO B CG  1 
ATOM   8090 C CD  . PRO B 1 502 ? 2.444   26.084  -29.502 1.00 25.45  ? 502  PRO B CD  1 
ATOM   8091 N N   . TYR B 1 503 ? 5.616   22.560  -29.137 1.00 39.96  ? 503  TYR B N   1 
ATOM   8092 C CA  . TYR B 1 503 ? 6.740   22.086  -28.311 1.00 45.80  ? 503  TYR B CA  1 
ATOM   8093 C C   . TYR B 1 503 ? 7.926   23.078  -28.405 1.00 41.17  ? 503  TYR B C   1 
ATOM   8094 O O   . TYR B 1 503 ? 8.258   23.583  -29.488 1.00 34.49  ? 503  TYR B O   1 
ATOM   8095 C CB  . TYR B 1 503 ? 7.170   20.649  -28.698 1.00 39.36  ? 503  TYR B CB  1 
ATOM   8096 C CG  . TYR B 1 503 ? 8.317   20.063  -27.874 1.00 42.69  ? 503  TYR B CG  1 
ATOM   8097 C CD1 . TYR B 1 503 ? 9.646   20.282  -28.228 1.00 39.77  ? 503  TYR B CD1 1 
ATOM   8098 C CD2 . TYR B 1 503 ? 8.061   19.278  -26.738 1.00 44.74  ? 503  TYR B CD2 1 
ATOM   8099 C CE1 . TYR B 1 503 ? 10.678  19.748  -27.467 1.00 43.85  ? 503  TYR B CE1 1 
ATOM   8100 C CE2 . TYR B 1 503 ? 9.092   18.747  -25.962 1.00 36.24  ? 503  TYR B CE2 1 
ATOM   8101 C CZ  . TYR B 1 503 ? 10.393  18.980  -26.329 1.00 41.16  ? 503  TYR B CZ  1 
ATOM   8102 O OH  . TYR B 1 503 ? 11.419  18.436  -25.583 1.00 40.07  ? 503  TYR B OH  1 
ATOM   8103 N N   . THR B 1 504 ? 8.526   23.369  -27.256 1.00 33.92  ? 504  THR B N   1 
ATOM   8104 C CA  . THR B 1 504 ? 9.632   24.308  -27.146 1.00 37.95  ? 504  THR B CA  1 
ATOM   8105 C C   . THR B 1 504 ? 10.618  23.761  -26.151 1.00 46.95  ? 504  THR B C   1 
ATOM   8106 O O   . THR B 1 504 ? 10.257  22.957  -25.298 1.00 52.55  ? 504  THR B O   1 
ATOM   8107 C CB  . THR B 1 504 ? 9.155   25.648  -26.594 1.00 41.05  ? 504  THR B CB  1 
ATOM   8108 O OG1 . THR B 1 504 ? 8.559   25.466  -25.294 1.00 45.22  ? 504  THR B OG1 1 
ATOM   8109 C CG2 . THR B 1 504 ? 8.154   26.262  -27.530 1.00 19.51  ? 504  THR B CG2 1 
ATOM   8110 N N   . THR B 1 505 ? 11.863  24.202  -26.225 1.00 51.69  ? 505  THR B N   1 
ATOM   8111 C CA  . THR B 1 505 ? 12.863  23.650  -25.321 1.00 52.55  ? 505  THR B CA  1 
ATOM   8112 C C   . THR B 1 505 ? 12.592  24.129  -23.915 1.00 52.16  ? 505  THR B C   1 
ATOM   8113 O O   . THR B 1 505 ? 12.734  23.357  -22.963 1.00 52.12  ? 505  THR B O   1 
ATOM   8114 C CB  . THR B 1 505 ? 14.281  24.010  -25.750 1.00 58.90  ? 505  THR B CB  1 
ATOM   8115 O OG1 . THR B 1 505 ? 14.283  25.323  -26.320 1.00 64.02  ? 505  THR B OG1 1 
ATOM   8116 C CG2 . THR B 1 505 ? 14.761  23.021  -26.801 1.00 57.00  ? 505  THR B CG2 1 
ATOM   8117 N N   . ALA B 1 506 ? 12.170  25.392  -23.796 1.00 46.09  ? 506  ALA B N   1 
ATOM   8118 C CA  . ALA B 1 506 ? 11.822  25.981  -22.493 1.00 41.54  ? 506  ALA B CA  1 
ATOM   8119 C C   . ALA B 1 506 ? 10.729  25.201  -21.751 1.00 59.62  ? 506  ALA B C   1 
ATOM   8120 O O   . ALA B 1 506 ? 10.989  24.615  -20.687 1.00 70.44  ? 506  ALA B O   1 
ATOM   8121 C CB  . ALA B 1 506 ? 11.417  27.436  -22.651 1.00 31.06  ? 506  ALA B CB  1 
ATOM   8122 N N   . ALA B 1 507 ? 9.519   25.174  -22.317 1.00 50.30  ? 507  ALA B N   1 
ATOM   8123 C CA  . ALA B 1 507 ? 8.396   24.520  -21.641 1.00 50.02  ? 507  ALA B CA  1 
ATOM   8124 C C   . ALA B 1 507 ? 8.179   23.035  -21.973 1.00 43.20  ? 507  ALA B C   1 
ATOM   8125 O O   . ALA B 1 507 ? 7.503   22.349  -21.237 1.00 50.14  ? 507  ALA B O   1 
ATOM   8126 C CB  . ALA B 1 507 ? 7.097   25.314  -21.837 1.00 47.15  ? 507  ALA B CB  1 
ATOM   8127 N N   . GLN B 1 508 ? 8.734   22.546  -23.073 1.00 33.55  ? 508  GLN B N   1 
ATOM   8128 C CA  . GLN B 1 508 ? 8.584   21.128  -23.456 1.00 45.36  ? 508  GLN B CA  1 
ATOM   8129 C C   . GLN B 1 508 ? 7.152   20.537  -23.407 1.00 45.52  ? 508  GLN B C   1 
ATOM   8130 O O   . GLN B 1 508 ? 6.941   19.429  -22.919 1.00 50.88  ? 508  GLN B O   1 
ATOM   8131 C CB  . GLN B 1 508 ? 9.565   20.249  -22.658 1.00 44.16  ? 508  GLN B CB  1 
ATOM   8132 C CG  . GLN B 1 508 ? 10.888  20.943  -22.434 1.00 49.91  ? 508  GLN B CG  1 
ATOM   8133 C CD  . GLN B 1 508 ? 11.864  20.140  -21.605 1.00 54.63  ? 508  GLN B CD  1 
ATOM   8134 O OE1 . GLN B 1 508 ? 11.884  18.906  -21.667 1.00 57.60  ? 508  GLN B OE1 1 
ATOM   8135 N NE2 . GLN B 1 508 ? 12.693  20.842  -20.824 1.00 49.30  ? 508  GLN B NE2 1 
ATOM   8136 N N   . GLN B 1 509 ? 6.183   21.265  -23.951 1.00 44.51  ? 509  GLN B N   1 
ATOM   8137 C CA  . GLN B 1 509 ? 4.781   20.831  -23.941 1.00 40.60  ? 509  GLN B CA  1 
ATOM   8138 C C   . GLN B 1 509 ? 4.379   19.969  -25.132 1.00 35.58  ? 509  GLN B C   1 
ATOM   8139 O O   . GLN B 1 509 ? 4.801   20.188  -26.276 1.00 41.46  ? 509  GLN B O   1 
ATOM   8140 C CB  . GLN B 1 509 ? 3.840   22.036  -23.889 1.00 33.92  ? 509  GLN B CB  1 
ATOM   8141 C CG  . GLN B 1 509 ? 4.350   23.183  -23.065 1.00 40.71  ? 509  GLN B CG  1 
ATOM   8142 C CD  . GLN B 1 509 ? 3.346   24.318  -22.993 1.00 47.75  ? 509  GLN B CD  1 
ATOM   8143 O OE1 . GLN B 1 509 ? 3.547   25.388  -23.584 1.00 38.54  ? 509  GLN B OE1 1 
ATOM   8144 N NE2 . GLN B 1 509 ? 2.246   24.086  -22.277 1.00 46.22  ? 509  GLN B NE2 1 
ATOM   8145 N N   . TYR B 1 510 ? 3.516   19.009  -24.851 1.00 19.27  ? 510  TYR B N   1 
ATOM   8146 C CA  . TYR B 1 510 ? 3.019   18.083  -25.858 1.00 32.33  ? 510  TYR B CA  1 
ATOM   8147 C C   . TYR B 1 510 ? 1.640   17.602  -25.369 1.00 26.80  ? 510  TYR B C   1 
ATOM   8148 O O   . TYR B 1 510 ? 1.339   17.715  -24.197 1.00 30.78  ? 510  TYR B O   1 
ATOM   8149 C CB  . TYR B 1 510 ? 4.009   16.917  -26.007 1.00 33.31  ? 510  TYR B CB  1 
ATOM   8150 C CG  . TYR B 1 510 ? 4.048   16.058  -24.777 1.00 37.93  ? 510  TYR B CG  1 
ATOM   8151 C CD1 . TYR B 1 510 ? 4.897   16.368  -23.725 1.00 40.29  ? 510  TYR B CD1 1 
ATOM   8152 C CD2 . TYR B 1 510 ? 3.186   14.968  -24.634 1.00 42.58  ? 510  TYR B CD2 1 
ATOM   8153 C CE1 . TYR B 1 510 ? 4.906   15.601  -22.569 1.00 41.13  ? 510  TYR B CE1 1 
ATOM   8154 C CE2 . TYR B 1 510 ? 3.201   14.184  -23.486 1.00 42.88  ? 510  TYR B CE2 1 
ATOM   8155 C CZ  . TYR B 1 510 ? 4.069   14.507  -22.461 1.00 41.18  ? 510  TYR B CZ  1 
ATOM   8156 O OH  . TYR B 1 510 ? 4.100   13.743  -21.321 1.00 39.86  ? 510  TYR B OH  1 
ATOM   8157 N N   . VAL B 1 511 ? 0.790   17.086  -26.244 1.00 28.49  ? 511  VAL B N   1 
ATOM   8158 C CA  . VAL B 1 511 ? -0.569  16.686  -25.808 1.00 25.32  ? 511  VAL B CA  1 
ATOM   8159 C C   . VAL B 1 511 ? -0.773  15.178  -25.797 1.00 23.16  ? 511  VAL B C   1 
ATOM   8160 O O   . VAL B 1 511 ? -0.130  14.447  -26.536 1.00 36.70  ? 511  VAL B O   1 
ATOM   8161 C CB  . VAL B 1 511 ? -1.617  17.267  -26.743 1.00 34.83  ? 511  VAL B CB  1 
ATOM   8162 C CG1 . VAL B 1 511 ? -1.482  18.788  -26.809 1.00 33.09  ? 511  VAL B CG1 1 
ATOM   8163 C CG2 . VAL B 1 511 ? -1.487  16.616  -28.170 1.00 20.47  ? 511  VAL B CG2 1 
ATOM   8164 N N   . SER B 1 512 ? -1.660  14.694  -24.951 1.00 35.12  ? 512  SER B N   1 
ATOM   8165 C CA  . SER B 1 512 ? -2.104  13.305  -25.092 1.00 39.77  ? 512  SER B CA  1 
ATOM   8166 C C   . SER B 1 512 ? -3.227  13.231  -26.115 1.00 44.33  ? 512  SER B C   1 
ATOM   8167 O O   . SER B 1 512 ? -4.159  14.020  -26.061 1.00 39.14  ? 512  SER B O   1 
ATOM   8168 C CB  . SER B 1 512 ? -2.626  12.770  -23.770 1.00 34.88  ? 512  SER B CB  1 
ATOM   8169 O OG  . SER B 1 512 ? -3.567  13.675  -23.227 1.00 47.12  ? 512  SER B OG  1 
ATOM   8170 N N   . LEU B 1 513 ? -3.135  12.283  -27.041 1.00 50.14  ? 513  LEU B N   1 
ATOM   8171 C CA  . LEU B 1 513 ? -4.233  11.970  -27.954 1.00 42.85  ? 513  LEU B CA  1 
ATOM   8172 C C   . LEU B 1 513 ? -4.976  10.723  -27.473 1.00 41.08  ? 513  LEU B C   1 
ATOM   8173 O O   . LEU B 1 513 ? -4.470  9.618   -27.593 1.00 54.27  ? 513  LEU B O   1 
ATOM   8174 C CB  . LEU B 1 513 ? -3.682  11.729  -29.359 1.00 36.24  ? 513  LEU B CB  1 
ATOM   8175 C CG  . LEU B 1 513 ? -2.946  12.938  -29.913 1.00 31.83  ? 513  LEU B CG  1 
ATOM   8176 C CD1 . LEU B 1 513 ? -2.198  12.660  -31.227 1.00 27.32  ? 513  LEU B CD1 1 
ATOM   8177 C CD2 . LEU B 1 513 ? -3.964  14.047  -30.092 1.00 36.28  ? 513  LEU B CD2 1 
ATOM   8178 N N   . ASN B 1 514 ? -6.162  10.902  -26.910 1.00 38.14  ? 514  ASN B N   1 
ATOM   8179 C CA  . ASN B 1 514 ? -6.986  9.772   -26.457 1.00 44.49  ? 514  ASN B CA  1 
ATOM   8180 C C   . ASN B 1 514 ? -8.456  10.141  -26.558 1.00 46.91  ? 514  ASN B C   1 
ATOM   8181 O O   . ASN B 1 514 ? -8.811  11.079  -27.263 1.00 45.46  ? 514  ASN B O   1 
ATOM   8182 C CB  . ASN B 1 514 ? -6.635  9.341   -25.021 1.00 43.59  ? 514  ASN B CB  1 
ATOM   8183 C CG  . ASN B 1 514 ? -6.612  10.512  -24.046 1.00 57.92  ? 514  ASN B CG  1 
ATOM   8184 O OD1 . ASN B 1 514 ? -5.740  10.606  -23.180 1.00 62.46  ? 514  ASN B OD1 1 
ATOM   8185 N ND2 . ASN B 1 514 ? -7.568  11.415  -24.190 1.00 63.49  ? 514  ASN B ND2 1 
ATOM   8186 N N   . LEU B 1 515 ? -9.324  9.441   -25.844 1.00 46.37  ? 515  LEU B N   1 
ATOM   8187 C CA  . LEU B 1 515 ? -10.740 9.671   -26.086 1.00 47.40  ? 515  LEU B CA  1 
ATOM   8188 C C   . LEU B 1 515 ? -11.243 10.915  -25.372 1.00 56.65  ? 515  LEU B C   1 
ATOM   8189 O O   . LEU B 1 515 ? -12.252 11.504  -25.787 1.00 50.38  ? 515  LEU B O   1 
ATOM   8190 C CB  . LEU B 1 515 ? -11.565 8.448   -25.732 1.00 44.56  ? 515  LEU B CB  1 
ATOM   8191 C CG  . LEU B 1 515 ? -11.266 7.233   -26.610 1.00 52.25  ? 515  LEU B CG  1 
ATOM   8192 C CD1 . LEU B 1 515 ? -12.053 6.057   -26.131 1.00 48.74  ? 515  LEU B CD1 1 
ATOM   8193 C CD2 . LEU B 1 515 ? -11.584 7.491   -28.063 1.00 54.30  ? 515  LEU B CD2 1 
ATOM   8194 N N   . LYS B 1 516 ? -10.524 11.310  -24.314 1.00 61.68  ? 516  LYS B N   1 
ATOM   8195 C CA  . LYS B 1 516 ? -10.778 12.569  -23.603 1.00 58.12  ? 516  LYS B CA  1 
ATOM   8196 C C   . LYS B 1 516 ? -10.222 13.739  -24.406 1.00 54.58  ? 516  LYS B C   1 
ATOM   8197 O O   . LYS B 1 516 ? -9.458  13.551  -25.350 1.00 52.46  ? 516  LYS B O   1 
ATOM   8198 C CB  . LYS B 1 516 ? -10.143 12.533  -22.221 1.00 55.84  ? 516  LYS B CB  1 
ATOM   8199 C CG  . LYS B 1 516 ? -10.752 11.489  -21.311 1.00 64.20  ? 516  LYS B CG  1 
ATOM   8200 C CD  . LYS B 1 516 ? -9.814  11.095  -20.185 1.00 74.11  ? 516  LYS B CD  1 
ATOM   8201 C CE  . LYS B 1 516 ? -8.925  9.925   -20.602 1.00 85.35  ? 516  LYS B CE  1 
ATOM   8202 N NZ  . LYS B 1 516 ? -8.007  9.485   -19.500 1.00 90.76  ? 516  LYS B NZ  1 
ATOM   8203 N N   . PRO B 1 517 ? -10.624 14.957  -24.061 1.00 56.82  ? 517  PRO B N   1 
ATOM   8204 C CA  . PRO B 1 517 ? -10.083 16.102  -24.806 1.00 58.26  ? 517  PRO B CA  1 
ATOM   8205 C C   . PRO B 1 517 ? -8.574  16.284  -24.588 1.00 55.75  ? 517  PRO B C   1 
ATOM   8206 O O   . PRO B 1 517 ? -8.014  15.853  -23.574 1.00 55.17  ? 517  PRO B O   1 
ATOM   8207 C CB  . PRO B 1 517 ? -10.841 17.299  -24.218 1.00 54.38  ? 517  PRO B CB  1 
ATOM   8208 C CG  . PRO B 1 517 ? -12.047 16.722  -23.573 1.00 49.22  ? 517  PRO B CG  1 
ATOM   8209 C CD  . PRO B 1 517 ? -11.657 15.352  -23.095 1.00 53.78  ? 517  PRO B CD  1 
ATOM   8210 N N   . LEU B 1 518 ? -7.925  16.899  -25.568 1.00 50.72  ? 518  LEU B N   1 
ATOM   8211 C CA  . LEU B 1 518 ? -6.529  17.282  -25.455 1.00 44.83  ? 518  LEU B CA  1 
ATOM   8212 C C   . LEU B 1 518 ? -6.161  17.710  -24.036 1.00 48.26  ? 518  LEU B C   1 
ATOM   8213 O O   . LEU B 1 518 ? -6.813  18.568  -23.425 1.00 49.76  ? 518  LEU B O   1 
ATOM   8214 C CB  . LEU B 1 518 ? -6.247  18.468  -26.366 1.00 40.16  ? 518  LEU B CB  1 
ATOM   8215 C CG  . LEU B 1 518 ? -5.907  18.243  -27.817 1.00 46.99  ? 518  LEU B CG  1 
ATOM   8216 C CD1 . LEU B 1 518 ? -5.325  19.533  -28.328 1.00 50.77  ? 518  LEU B CD1 1 
ATOM   8217 C CD2 . LEU B 1 518 ? -4.904  17.119  -27.933 1.00 40.24  ? 518  LEU B CD2 1 
ATOM   8218 N N   . GLU B 1 519 ? -5.091  17.135  -23.522 1.00 41.82  ? 519  GLU B N   1 
ATOM   8219 C CA  . GLU B 1 519 ? -4.543  17.605  -22.270 1.00 43.96  ? 519  GLU B CA  1 
ATOM   8220 C C   . GLU B 1 519 ? -3.055  17.925  -22.502 1.00 54.21  ? 519  GLU B C   1 
ATOM   8221 O O   . GLU B 1 519 ? -2.324  17.171  -23.162 1.00 59.52  ? 519  GLU B O   1 
ATOM   8222 C CB  . GLU B 1 519 ? -4.790  16.543  -21.213 1.00 47.75  ? 519  GLU B CB  1 
ATOM   8223 C CG  . GLU B 1 519 ? -3.815  16.432  -20.071 1.00 62.87  ? 519  GLU B CG  1 
ATOM   8224 C CD  . GLU B 1 519 ? -4.091  15.163  -19.267 1.00 77.07  ? 519  GLU B CD  1 
ATOM   8225 O OE1 . GLU B 1 519 ? -5.292  14.912  -18.964 1.00 82.53  ? 519  GLU B OE1 1 
ATOM   8226 O OE2 . GLU B 1 519 ? -3.126  14.414  -18.966 1.00 72.51  ? 519  GLU B OE2 1 
ATOM   8227 N N   . VAL B 1 520 ? -2.622  19.082  -22.022 1.00 44.40  ? 520  VAL B N   1 
ATOM   8228 C CA  . VAL B 1 520 ? -1.237  19.474  -22.214 1.00 40.96  ? 520  VAL B CA  1 
ATOM   8229 C C   . VAL B 1 520 ? -0.351  18.943  -21.095 1.00 36.79  ? 520  VAL B C   1 
ATOM   8230 O O   . VAL B 1 520 ? -0.668  19.108  -19.939 1.00 42.98  ? 520  VAL B O   1 
ATOM   8231 C CB  . VAL B 1 520 ? -1.103  21.005  -22.319 1.00 38.41  ? 520  VAL B CB  1 
ATOM   8232 C CG1 . VAL B 1 520 ? 0.339   21.378  -22.611 1.00 46.76  ? 520  VAL B CG1 1 
ATOM   8233 C CG2 . VAL B 1 520 ? -2.011  21.529  -23.422 1.00 32.40  ? 520  VAL B CG2 1 
ATOM   8234 N N   . ARG B 1 521 ? 0.753   18.292  -21.443 1.00 41.05  ? 521  ARG B N   1 
ATOM   8235 C CA  . ARG B 1 521 ? 1.725   17.830  -20.456 1.00 36.80  ? 521  ARG B CA  1 
ATOM   8236 C C   . ARG B 1 521 ? 3.077   18.462  -20.717 1.00 44.29  ? 521  ARG B C   1 
ATOM   8237 O O   . ARG B 1 521 ? 3.335   18.966  -21.806 1.00 53.76  ? 521  ARG B O   1 
ATOM   8238 C CB  . ARG B 1 521 ? 1.857   16.324  -20.514 1.00 39.60  ? 521  ARG B CB  1 
ATOM   8239 C CG  . ARG B 1 521 ? 0.595   15.605  -20.118 1.00 41.15  ? 521  ARG B CG  1 
ATOM   8240 C CD  . ARG B 1 521 ? 0.744   14.094  -20.180 1.00 36.54  ? 521  ARG B CD  1 
ATOM   8241 N NE  . ARG B 1 521 ? -0.577  13.501  -20.128 1.00 40.91  ? 521  ARG B NE  1 
ATOM   8242 C CZ  . ARG B 1 521 ? -0.873  12.274  -20.534 1.00 43.69  ? 521  ARG B CZ  1 
ATOM   8243 N NH1 . ARG B 1 521 ? 0.090   11.506  -21.019 1.00 43.20  ? 521  ARG B NH1 1 
ATOM   8244 N NH2 . ARG B 1 521 ? -2.136  11.829  -20.475 1.00 40.40  ? 521  ARG B NH2 1 
ATOM   8245 N N   . ARG B 1 522 ? 3.949   18.461  -19.719 1.00 44.03  ? 522  ARG B N   1 
ATOM   8246 C CA  . ARG B 1 522 ? 5.271   19.044  -19.927 1.00 41.61  ? 522  ARG B CA  1 
ATOM   8247 C C   . ARG B 1 522 ? 6.337   17.988  -19.690 1.00 47.66  ? 522  ARG B C   1 
ATOM   8248 O O   . ARG B 1 522 ? 6.344   17.323  -18.644 1.00 46.81  ? 522  ARG B O   1 
ATOM   8249 C CB  . ARG B 1 522 ? 5.484   20.297  -19.059 1.00 29.78  ? 522  ARG B CB  1 
ATOM   8250 C CG  . ARG B 1 522 ? 4.451   21.429  -19.325 1.00 48.63  ? 522  ARG B CG  1 
ATOM   8251 C CD  . ARG B 1 522 ? 4.595   22.642  -18.402 1.00 50.48  ? 522  ARG B CD  1 
ATOM   8252 N NE  . ARG B 1 522 ? 5.955   23.187  -18.446 1.00 65.05  ? 522  ARG B NE  1 
ATOM   8253 C CZ  . ARG B 1 522 ? 6.355   24.326  -17.881 1.00 62.08  ? 522  ARG B CZ  1 
ATOM   8254 N NH1 . ARG B 1 522 ? 5.500   25.084  -17.208 1.00 60.49  ? 522  ARG B NH1 1 
ATOM   8255 N NH2 . ARG B 1 522 ? 7.621   24.702  -18.003 1.00 61.59  ? 522  ARG B NH2 1 
ATOM   8256 N N   . GLY B 1 523 ? 7.203   17.813  -20.688 1.00 42.59  ? 523  GLY B N   1 
ATOM   8257 C CA  . GLY B 1 523 ? 8.337   16.928  -20.567 1.00 41.22  ? 523  GLY B CA  1 
ATOM   8258 C C   . GLY B 1 523 ? 8.026   15.549  -21.080 1.00 52.72  ? 523  GLY B C   1 
ATOM   8259 O O   . GLY B 1 523 ? 7.145   14.853  -20.581 1.00 55.51  ? 523  GLY B O   1 
ATOM   8260 N N   . LEU B 1 524 ? 8.773   15.151  -22.098 1.00 59.88  ? 524  LEU B N   1 
ATOM   8261 C CA  . LEU B 1 524 ? 8.612   13.854  -22.714 1.00 55.11  ? 524  LEU B CA  1 
ATOM   8262 C C   . LEU B 1 524 ? 9.617   12.910  -22.060 1.00 55.72  ? 524  LEU B C   1 
ATOM   8263 O O   . LEU B 1 524 ? 10.752  12.826  -22.520 1.00 52.97  ? 524  LEU B O   1 
ATOM   8264 C CB  . LEU B 1 524 ? 8.902   13.996  -24.200 1.00 56.11  ? 524  LEU B CB  1 
ATOM   8265 C CG  . LEU B 1 524 ? 7.980   13.211  -25.115 1.00 58.44  ? 524  LEU B CG  1 
ATOM   8266 C CD1 . LEU B 1 524 ? 6.765   12.779  -24.331 1.00 65.28  ? 524  LEU B CD1 1 
ATOM   8267 C CD2 . LEU B 1 524 ? 7.599   14.063  -26.306 1.00 52.22  ? 524  LEU B CD2 1 
ATOM   8268 N N   . ARG B 1 525 ? 9.197   12.218  -20.991 1.00 48.28  ? 525  ARG B N   1 
ATOM   8269 C CA  . ARG B 1 525 ? 10.101  11.471  -20.108 1.00 48.89  ? 525  ARG B CA  1 
ATOM   8270 C C   . ARG B 1 525 ? 11.452  12.176  -19.921 1.00 54.29  ? 525  ARG B C   1 
ATOM   8271 O O   . ARG B 1 525 ? 12.485  11.625  -20.293 1.00 58.70  ? 525  ARG B O   1 
ATOM   8272 C CB  . ARG B 1 525 ? 10.321  10.049  -20.629 1.00 45.60  ? 525  ARG B CB  1 
ATOM   8273 C CG  . ARG B 1 525 ? 9.069   9.462   -21.180 1.00 48.74  ? 525  ARG B CG  1 
ATOM   8274 C CD  . ARG B 1 525 ? 9.016   7.968   -21.069 1.00 52.49  ? 525  ARG B CD  1 
ATOM   8275 N NE  . ARG B 1 525 ? 7.645   7.507   -21.283 1.00 60.23  ? 525  ARG B NE  1 
ATOM   8276 C CZ  . ARG B 1 525 ? 7.298   6.255   -21.584 1.00 71.65  ? 525  ARG B CZ  1 
ATOM   8277 N NH1 . ARG B 1 525 ? 8.230   5.315   -21.711 1.00 70.62  ? 525  ARG B NH1 1 
ATOM   8278 N NH2 . ARG B 1 525 ? 6.011   5.937   -21.757 1.00 73.67  ? 525  ARG B NH2 1 
ATOM   8279 N N   . ALA B 1 526 ? 11.450  13.375  -19.333 1.00 43.54  ? 526  ALA B N   1 
ATOM   8280 C CA  . ALA B 1 526 ? 12.622  14.238  -19.443 1.00 40.89  ? 526  ALA B CA  1 
ATOM   8281 C C   . ALA B 1 526 ? 13.809  13.750  -18.647 1.00 44.85  ? 526  ALA B C   1 
ATOM   8282 O O   . ALA B 1 526 ? 14.936  13.858  -19.119 1.00 49.01  ? 526  ALA B O   1 
ATOM   8283 C CB  . ALA B 1 526 ? 12.300  15.675  -19.087 1.00 39.98  ? 526  ALA B CB  1 
ATOM   8284 N N   . GLN B 1 527 ? 13.562  13.229  -17.444 1.00 40.71  ? 527  GLN B N   1 
ATOM   8285 C CA  . GLN B 1 527 ? 14.641  12.704  -16.605 1.00 41.35  ? 527  GLN B CA  1 
ATOM   8286 C C   . GLN B 1 527 ? 15.282  11.508  -17.268 1.00 46.95  ? 527  GLN B C   1 
ATOM   8287 O O   . GLN B 1 527 ? 16.506  11.444  -17.426 1.00 58.34  ? 527  GLN B O   1 
ATOM   8288 C CB  . GLN B 1 527 ? 14.124  12.277  -15.237 1.00 41.62  ? 527  GLN B CB  1 
ATOM   8289 C CG  . GLN B 1 527 ? 13.722  13.417  -14.356 1.00 43.15  ? 527  GLN B CG  1 
ATOM   8290 C CD  . GLN B 1 527 ? 14.817  14.452  -14.223 1.00 52.33  ? 527  GLN B CD  1 
ATOM   8291 O OE1 . GLN B 1 527 ? 14.697  15.579  -14.741 1.00 50.39  ? 527  GLN B OE1 1 
ATOM   8292 N NE2 . GLN B 1 527 ? 15.904  14.076  -13.530 1.00 54.65  ? 527  GLN B NE2 1 
ATOM   8293 N N   . THR B 1 528 ? 14.430  10.569  -17.653 1.00 36.80  ? 528  THR B N   1 
ATOM   8294 C CA  . THR B 1 528 ? 14.848  9.342   -18.303 1.00 46.23  ? 528  THR B CA  1 
ATOM   8295 C C   . THR B 1 528 ? 15.535  9.575   -19.661 1.00 46.53  ? 528  THR B C   1 
ATOM   8296 O O   . THR B 1 528 ? 16.458  8.858   -20.035 1.00 51.82  ? 528  THR B O   1 
ATOM   8297 C CB  . THR B 1 528 ? 13.628  8.417   -18.455 1.00 54.41  ? 528  THR B CB  1 
ATOM   8298 O OG1 . THR B 1 528 ? 13.288  7.883   -17.168 1.00 52.39  ? 528  THR B OG1 1 
ATOM   8299 C CG2 . THR B 1 528 ? 13.891  7.284   -19.473 1.00 47.93  ? 528  THR B CG2 1 
ATOM   8300 N N   . CYS B 1 529 ? 15.101  10.581  -20.400 1.00 43.58  ? 529  CYS B N   1 
ATOM   8301 C CA  . CYS B 1 529 ? 15.691  10.816  -21.698 1.00 40.45  ? 529  CYS B CA  1 
ATOM   8302 C C   . CYS B 1 529 ? 17.011  11.531  -21.549 1.00 38.22  ? 529  CYS B C   1 
ATOM   8303 O O   . CYS B 1 529 ? 17.925  11.331  -22.341 1.00 41.71  ? 529  CYS B O   1 
ATOM   8304 C CB  . CYS B 1 529 ? 14.714  11.531  -22.633 1.00 43.88  ? 529  CYS B CB  1 
ATOM   8305 S SG  . CYS B 1 529 ? 13.465  10.355  -23.286 1.00 44.84  ? 529  CYS B SG  1 
ATOM   8306 N N   . ALA B 1 530 ? 17.136  12.321  -20.494 1.00 30.45  ? 530  ALA B N   1 
ATOM   8307 C CA  . ALA B 1 530 ? 18.430  12.895  -20.166 1.00 38.90  ? 530  ALA B CA  1 
ATOM   8308 C C   . ALA B 1 530 ? 19.460  11.784  -19.960 1.00 45.79  ? 530  ALA B C   1 
ATOM   8309 O O   . ALA B 1 530 ? 20.624  11.929  -20.323 1.00 50.41  ? 530  ALA B O   1 
ATOM   8310 C CB  . ALA B 1 530 ? 18.332  13.751  -18.928 1.00 46.27  ? 530  ALA B CB  1 
ATOM   8311 N N   . PHE B 1 531 ? 19.034  10.681  -19.357 1.00 37.99  ? 531  PHE B N   1 
ATOM   8312 C CA  . PHE B 1 531 ? 19.936  9.572   -19.156 1.00 39.08  ? 531  PHE B CA  1 
ATOM   8313 C C   . PHE B 1 531 ? 20.425  9.043   -20.504 1.00 43.77  ? 531  PHE B C   1 
ATOM   8314 O O   . PHE B 1 531 ? 21.645  8.958   -20.746 1.00 44.57  ? 531  PHE B O   1 
ATOM   8315 C CB  . PHE B 1 531 ? 19.278  8.467   -18.337 1.00 37.74  ? 531  PHE B CB  1 
ATOM   8316 C CG  . PHE B 1 531 ? 20.030  7.160   -18.372 1.00 48.41  ? 531  PHE B CG  1 
ATOM   8317 C CD1 . PHE B 1 531 ? 21.293  7.054   -17.819 1.00 63.15  ? 531  PHE B CD1 1 
ATOM   8318 C CD2 . PHE B 1 531 ? 19.482  6.047   -18.965 1.00 49.89  ? 531  PHE B CD2 1 
ATOM   8319 C CE1 . PHE B 1 531 ? 21.989  5.845   -17.851 1.00 66.39  ? 531  PHE B CE1 1 
ATOM   8320 C CE2 . PHE B 1 531 ? 20.171  4.844   -19.006 1.00 60.76  ? 531  PHE B CE2 1 
ATOM   8321 C CZ  . PHE B 1 531 ? 21.422  4.739   -18.444 1.00 63.03  ? 531  PHE B CZ  1 
ATOM   8322 N N   . TRP B 1 532 ? 19.476  8.712   -21.380 1.00 32.66  ? 532  TRP B N   1 
ATOM   8323 C CA  . TRP B 1 532 ? 19.793  8.201   -22.716 1.00 37.12  ? 532  TRP B CA  1 
ATOM   8324 C C   . TRP B 1 532 ? 20.502  9.195   -23.628 1.00 41.16  ? 532  TRP B C   1 
ATOM   8325 O O   . TRP B 1 532 ? 21.455  8.835   -24.300 1.00 52.58  ? 532  TRP B O   1 
ATOM   8326 C CB  . TRP B 1 532 ? 18.540  7.757   -23.430 1.00 37.18  ? 532  TRP B CB  1 
ATOM   8327 C CG  . TRP B 1 532 ? 17.917  6.564   -22.868 1.00 42.82  ? 532  TRP B CG  1 
ATOM   8328 C CD1 . TRP B 1 532 ? 16.795  6.516   -22.117 1.00 44.62  ? 532  TRP B CD1 1 
ATOM   8329 C CD2 . TRP B 1 532 ? 18.353  5.211   -23.033 1.00 47.19  ? 532  TRP B CD2 1 
ATOM   8330 N NE1 . TRP B 1 532 ? 16.498  5.211   -21.788 1.00 46.41  ? 532  TRP B NE1 1 
ATOM   8331 C CE2 . TRP B 1 532 ? 17.443  4.392   -22.339 1.00 40.13  ? 532  TRP B CE2 1 
ATOM   8332 C CE3 . TRP B 1 532 ? 19.431  4.613   -23.688 1.00 46.55  ? 532  TRP B CE3 1 
ATOM   8333 C CZ2 . TRP B 1 532 ? 17.573  3.012   -22.284 1.00 39.55  ? 532  TRP B CZ2 1 
ATOM   8334 C CZ3 . TRP B 1 532 ? 19.558  3.227   -23.637 1.00 44.46  ? 532  TRP B CZ3 1 
ATOM   8335 C CH2 . TRP B 1 532 ? 18.631  2.445   -22.946 1.00 38.43  ? 532  TRP B CH2 1 
ATOM   8336 N N   . ASN B 1 533 ? 20.029  10.435  -23.666 1.00 39.75  ? 533  ASN B N   1 
ATOM   8337 C CA  . ASN B 1 533 ? 20.542  11.409  -24.624 1.00 37.51  ? 533  ASN B CA  1 
ATOM   8338 C C   . ASN B 1 533 ? 21.809  12.068  -24.121 1.00 50.81  ? 533  ASN B C   1 
ATOM   8339 O O   . ASN B 1 533 ? 22.658  12.479  -24.911 1.00 52.15  ? 533  ASN B O   1 
ATOM   8340 C CB  . ASN B 1 533 ? 19.505  12.501  -24.957 1.00 38.35  ? 533  ASN B CB  1 
ATOM   8341 C CG  . ASN B 1 533 ? 18.171  11.936  -25.502 1.00 41.21  ? 533  ASN B CG  1 
ATOM   8342 O OD1 . ASN B 1 533 ? 18.078  10.793  -25.921 1.00 39.12  ? 533  ASN B OD1 1 
ATOM   8343 N ND2 . ASN B 1 533 ? 17.148  12.757  -25.482 1.00 45.46  ? 533  ASN B ND2 1 
ATOM   8344 N N   . ARG B 1 534 ? 21.941  12.181  -22.803 1.00 56.44  ? 534  ARG B N   1 
ATOM   8345 C CA  . ARG B 1 534 ? 23.083  12.895  -22.230 1.00 50.30  ? 534  ARG B CA  1 
ATOM   8346 C C   . ARG B 1 534 ? 24.091  12.002  -21.494 1.00 52.01  ? 534  ARG B C   1 
ATOM   8347 O O   . ARG B 1 534 ? 25.273  12.042  -21.765 1.00 50.40  ? 534  ARG B O   1 
ATOM   8348 C CB  . ARG B 1 534 ? 22.612  13.982  -21.282 1.00 46.89  ? 534  ARG B CB  1 
ATOM   8349 C CG  . ARG B 1 534 ? 21.806  15.069  -21.914 1.00 48.59  ? 534  ARG B CG  1 
ATOM   8350 C CD  . ARG B 1 534 ? 21.280  15.989  -20.841 1.00 52.60  ? 534  ARG B CD  1 
ATOM   8351 N NE  . ARG B 1 534 ? 20.152  16.767  -21.323 1.00 67.65  ? 534  ARG B NE  1 
ATOM   8352 C CZ  . ARG B 1 534 ? 20.258  17.970  -21.876 1.00 68.37  ? 534  ARG B CZ  1 
ATOM   8353 N NH1 . ARG B 1 534 ? 21.465  18.530  -22.010 1.00 57.35  ? 534  ARG B NH1 1 
ATOM   8354 N NH2 . ARG B 1 534 ? 19.155  18.604  -22.282 1.00 62.83  ? 534  ARG B NH2 1 
ATOM   8355 N N   . PHE B 1 535 ? 23.647  11.209  -20.539 1.00 52.50  ? 535  PHE B N   1 
ATOM   8356 C CA  . PHE B 1 535 ? 24.635  10.487  -19.774 1.00 48.49  ? 535  PHE B CA  1 
ATOM   8357 C C   . PHE B 1 535 ? 25.158  9.288   -20.533 1.00 49.97  ? 535  PHE B C   1 
ATOM   8358 O O   . PHE B 1 535 ? 26.354  9.118   -20.693 1.00 47.26  ? 535  PHE B O   1 
ATOM   8359 C CB  . PHE B 1 535 ? 24.097  10.019  -18.434 1.00 43.44  ? 535  PHE B CB  1 
ATOM   8360 C CG  . PHE B 1 535 ? 25.131  9.334   -17.614 1.00 38.03  ? 535  PHE B CG  1 
ATOM   8361 C CD1 . PHE B 1 535 ? 26.199  10.062  -17.095 1.00 41.86  ? 535  PHE B CD1 1 
ATOM   8362 C CD2 . PHE B 1 535 ? 25.077  7.962   -17.407 1.00 34.96  ? 535  PHE B CD2 1 
ATOM   8363 C CE1 . PHE B 1 535 ? 27.186  9.446   -16.368 1.00 45.47  ? 535  PHE B CE1 1 
ATOM   8364 C CE2 . PHE B 1 535 ? 26.043  7.333   -16.669 1.00 42.49  ? 535  PHE B CE2 1 
ATOM   8365 C CZ  . PHE B 1 535 ? 27.107  8.077   -16.145 1.00 51.37  ? 535  PHE B CZ  1 
ATOM   8366 N N   . LEU B 1 536 ? 24.251  8.448   -20.997 1.00 54.87  ? 536  LEU B N   1 
ATOM   8367 C CA  . LEU B 1 536 ? 24.649  7.204   -21.628 1.00 52.31  ? 536  LEU B CA  1 
ATOM   8368 C C   . LEU B 1 536 ? 25.837  7.316   -22.618 1.00 57.48  ? 536  LEU B C   1 
ATOM   8369 O O   . LEU B 1 536 ? 26.758  6.499   -22.584 1.00 59.72  ? 536  LEU B O   1 
ATOM   8370 C CB  . LEU B 1 536 ? 23.448  6.553   -22.303 1.00 45.74  ? 536  LEU B CB  1 
ATOM   8371 C CG  . LEU B 1 536 ? 23.769  5.068   -22.368 1.00 51.94  ? 536  LEU B CG  1 
ATOM   8372 C CD1 . LEU B 1 536 ? 23.269  4.435   -21.084 1.00 48.41  ? 536  LEU B CD1 1 
ATOM   8373 C CD2 . LEU B 1 536 ? 23.229  4.385   -23.651 1.00 43.19  ? 536  LEU B CD2 1 
ATOM   8374 N N   . PRO B 1 537 ? 25.809  8.315   -23.510 1.00 57.33  ? 537  PRO B N   1 
ATOM   8375 C CA  . PRO B 1 537 ? 26.866  8.509   -24.504 1.00 53.18  ? 537  PRO B CA  1 
ATOM   8376 C C   . PRO B 1 537 ? 28.228  8.862   -23.892 1.00 62.59  ? 537  PRO B C   1 
ATOM   8377 O O   . PRO B 1 537 ? 29.254  8.485   -24.454 1.00 69.72  ? 537  PRO B O   1 
ATOM   8378 C CB  . PRO B 1 537 ? 26.354  9.693   -25.325 1.00 43.36  ? 537  PRO B CB  1 
ATOM   8379 C CG  . PRO B 1 537 ? 24.907  9.711   -25.123 1.00 47.88  ? 537  PRO B CG  1 
ATOM   8380 C CD  . PRO B 1 537 ? 24.690  9.248   -23.728 1.00 62.23  ? 537  PRO B CD  1 
ATOM   8381 N N   . LYS B 1 538 ? 28.243  9.598   -22.783 1.00 58.86  ? 538  LYS B N   1 
ATOM   8382 C CA  . LYS B 1 538 ? 29.495  9.914   -22.103 1.00 54.49  ? 538  LYS B CA  1 
ATOM   8383 C C   . LYS B 1 538 ? 30.034  8.625   -21.491 1.00 57.22  ? 538  LYS B C   1 
ATOM   8384 O O   . LYS B 1 538 ? 31.238  8.390   -21.432 1.00 62.10  ? 538  LYS B O   1 
ATOM   8385 C CB  . LYS B 1 538 ? 29.272  10.965  -21.016 1.00 51.85  ? 538  LYS B CB  1 
ATOM   8386 C CG  . LYS B 1 538 ? 28.907  12.350  -21.536 1.00 59.70  ? 538  LYS B CG  1 
ATOM   8387 C CD  . LYS B 1 538 ? 28.356  13.269  -20.430 1.00 71.58  ? 538  LYS B CD  1 
ATOM   8388 C CE  . LYS B 1 538 ? 28.434  14.742  -20.844 1.00 80.20  ? 538  LYS B CE  1 
ATOM   8389 N NZ  . LYS B 1 538 ? 29.819  15.121  -21.304 1.00 84.30  ? 538  LYS B NZ  1 
ATOM   8390 N N   . LEU B 1 539 ? 29.114  7.784   -21.054 1.00 51.46  ? 539  LEU B N   1 
ATOM   8391 C CA  . LEU B 1 539 ? 29.461  6.556   -20.371 1.00 62.38  ? 539  LEU B CA  1 
ATOM   8392 C C   . LEU B 1 539 ? 30.276  5.648   -21.261 1.00 79.02  ? 539  LEU B C   1 
ATOM   8393 O O   . LEU B 1 539 ? 31.137  4.912   -20.799 1.00 79.83  ? 539  LEU B O   1 
ATOM   8394 C CB  . LEU B 1 539 ? 28.192  5.827   -19.968 1.00 59.33  ? 539  LEU B CB  1 
ATOM   8395 C CG  . LEU B 1 539 ? 28.443  4.629   -19.082 1.00 54.97  ? 539  LEU B CG  1 
ATOM   8396 C CD1 . LEU B 1 539 ? 29.423  5.058   -18.020 1.00 58.60  ? 539  LEU B CD1 1 
ATOM   8397 C CD2 . LEU B 1 539 ? 27.140  4.144   -18.481 1.00 52.56  ? 539  LEU B CD2 1 
ATOM   8398 N N   . LEU B 1 540 ? 29.986  5.692   -22.551 1.00 88.72  ? 540  LEU B N   1 
ATOM   8399 C CA  . LEU B 1 540 ? 30.644  4.815   -23.503 1.00 83.36  ? 540  LEU B CA  1 
ATOM   8400 C C   . LEU B 1 540 ? 31.850  5.509   -24.136 1.00 83.15  ? 540  LEU B C   1 
ATOM   8401 O O   . LEU B 1 540 ? 32.880  4.878   -24.349 1.00 86.69  ? 540  LEU B O   1 
ATOM   8402 C CB  . LEU B 1 540 ? 29.639  4.349   -24.546 1.00 80.89  ? 540  LEU B CB  1 
ATOM   8403 C CG  . LEU B 1 540 ? 28.503  3.530   -23.923 1.00 74.66  ? 540  LEU B CG  1 
ATOM   8404 C CD1 . LEU B 1 540 ? 27.312  3.348   -24.894 1.00 51.55  ? 540  LEU B CD1 1 
ATOM   8405 C CD2 . LEU B 1 540 ? 29.051  2.192   -23.417 1.00 77.10  ? 540  LEU B CD2 1 
ATOM   8406 N N   . SER B 1 541 ? 31.732  6.808   -24.414 1.00 82.96  ? 541  SER B N   1 
ATOM   8407 C CA  . SER B 1 541 ? 32.880  7.605   -24.861 1.00 92.24  ? 541  SER B CA  1 
ATOM   8408 C C   . SER B 1 541 ? 33.902  7.736   -23.722 1.00 103.96 ? 541  SER B C   1 
ATOM   8409 O O   . SER B 1 541 ? 34.459  8.814   -23.449 1.00 104.78 ? 541  SER B O   1 
ATOM   8410 C CB  . SER B 1 541 ? 32.440  8.978   -25.387 1.00 96.91  ? 541  SER B CB  1 
ATOM   8411 O OG  . SER B 1 541 ? 32.041  9.859   -24.349 1.00 102.91 ? 541  SER B OG  1 
ATOM   8412 N N   . ALA B 1 542 ? 34.112  6.602   -23.062 1.00 105.24 ? 542  ALA B N   1 
ATOM   8413 C CA  . ALA B 1 542 ? 35.059  6.425   -21.979 1.00 101.18 ? 542  ALA B CA  1 
ATOM   8414 C C   . ALA B 1 542 ? 34.820  4.977   -21.572 1.00 102.85 ? 542  ALA B C   1 
ATOM   8415 O O   . ALA B 1 542 ? 34.723  4.675   -20.392 1.00 90.76  ? 542  ALA B O   1 
ATOM   8416 C CB  . ALA B 1 542 ? 34.753  7.378   -20.834 1.00 89.67  ? 542  ALA B CB  1 
ATOM   8417 N N   . THR B 1 543 ? 34.752  4.103   -22.587 1.00 117.64 ? 543  THR B N   1 
ATOM   8418 C CA  . THR B 1 543 ? 34.080  2.778   -22.547 1.00 127.14 ? 543  THR B CA  1 
ATOM   8419 C C   . THR B 1 543 ? 33.439  2.344   -21.201 1.00 88.97  ? 543  THR B C   1 
ATOM   8420 O O   . THR B 1 543 ? 32.479  1.559   -21.168 1.00 80.11  ? 543  THR B O   1 
ATOM   8421 C CB  . THR B 1 543 ? 34.943  1.604   -23.168 1.00 103.44 ? 543  THR B CB  1 
ATOM   8422 O OG1 . THR B 1 543 ? 35.616  2.037   -24.359 1.00 101.92 ? 543  THR B OG1 1 
ATOM   8423 C CG2 . THR B 1 543 ? 34.053  0.423   -23.516 1.00 98.29  ? 543  THR B CG2 1 
HETATM 8424 O O3  . HI6 C 2 .   ? 38.316  18.154  9.985   1.00 56.42  ? 601  HI6 A O3  1 
HETATM 8425 C C14 . HI6 C 2 .   ? 38.495  19.312  10.334  1.00 64.61  ? 601  HI6 A C14 1 
HETATM 8426 N N4  . HI6 C 2 .   ? 39.571  19.708  11.016  1.00 71.48  ? 601  HI6 A N4  1 
HETATM 8427 C C11 . HI6 C 2 .   ? 37.453  20.326  9.979   1.00 64.72  ? 601  HI6 A C11 1 
HETATM 8428 C C10 . HI6 C 2 .   ? 37.355  21.558  10.635  1.00 61.71  ? 601  HI6 A C10 1 
HETATM 8429 C C9  . HI6 C 2 .   ? 36.347  22.444  10.250  1.00 60.02  ? 601  HI6 A C9  1 
HETATM 8430 N N3  . HI6 C 2 .   ? 35.484  22.086  9.283   1.00 66.27  ? 601  HI6 A N3  1 
HETATM 8431 C C13 . HI6 C 2 .   ? 35.575  20.921  8.628   1.00 64.58  ? 601  HI6 A C13 1 
HETATM 8432 C C12 . HI6 C 2 .   ? 36.559  20.007  8.968   1.00 64.71  ? 601  HI6 A C12 1 
HETATM 8433 C C8  . HI6 C 2 .   ? 34.457  22.993  8.812   1.00 74.22  ? 601  HI6 A C8  1 
HETATM 8434 O O2  . HI6 C 2 .   ? 33.782  23.678  9.831   1.00 83.96  ? 601  HI6 A O2  1 
HETATM 8435 C C7  . HI6 C 2 .   ? 32.593  24.089  9.184   1.00 86.82  ? 601  HI6 A C7  1 
HETATM 8436 N N2  . HI6 C 2 .   ? 31.522  23.242  9.692   1.00 89.49  ? 601  HI6 A N2  1 
HETATM 8437 C C2  . HI6 C 2 .   ? 31.055  22.249  8.925   1.00 88.93  ? 601  HI6 A C2  1 
HETATM 8438 C C3  . HI6 C 2 .   ? 30.035  21.448  9.411   1.00 88.40  ? 601  HI6 A C3  1 
HETATM 8439 C C4  . HI6 C 2 .   ? 29.519  21.695  10.681  1.00 87.05  ? 601  HI6 A C4  1 
HETATM 8440 C C5  . HI6 C 2 .   ? 30.022  22.718  11.464  1.00 83.76  ? 601  HI6 A C5  1 
HETATM 8441 C C6  . HI6 C 2 .   ? 31.038  23.485  10.923  1.00 88.40  ? 601  HI6 A C6  1 
HETATM 8442 C C1  . NAG D 3 .   ? 24.508  35.232  -1.042  1.00 99.32  ? 602  NAG A C1  1 
HETATM 8443 C C2  . NAG D 3 .   ? 24.672  35.601  -2.511  1.00 110.76 ? 602  NAG A C2  1 
HETATM 8444 C C3  . NAG D 3 .   ? 25.951  34.907  -2.987  1.00 115.04 ? 602  NAG A C3  1 
HETATM 8445 C C4  . NAG D 3 .   ? 27.121  35.354  -2.102  1.00 111.38 ? 602  NAG A C4  1 
HETATM 8446 C C5  . NAG D 3 .   ? 26.904  35.036  -0.614  1.00 104.90 ? 602  NAG A C5  1 
HETATM 8447 C C6  . NAG D 3 .   ? 27.994  35.621  0.304   1.00 97.63  ? 602  NAG A C6  1 
HETATM 8448 C C7  . NAG D 3 .   ? 22.308  35.673  -3.339  1.00 118.39 ? 602  NAG A C7  1 
HETATM 8449 C C8  . NAG D 3 .   ? 21.178  34.889  -3.955  1.00 116.64 ? 602  NAG A C8  1 
HETATM 8450 N N2  . NAG D 3 .   ? 23.470  35.008  -3.130  1.00 117.19 ? 602  NAG A N2  1 
HETATM 8451 O O3  . NAG D 3 .   ? 26.268  35.188  -4.361  1.00 114.92 ? 602  NAG A O3  1 
HETATM 8452 O O4  . NAG D 3 .   ? 28.341  34.753  -2.571  1.00 110.83 ? 602  NAG A O4  1 
HETATM 8453 O O5  . NAG D 3 .   ? 25.614  35.475  -0.164  1.00 100.56 ? 602  NAG A O5  1 
HETATM 8454 O O6  . NAG D 3 .   ? 27.675  36.937  0.797   1.00 87.56  ? 602  NAG A O6  1 
HETATM 8455 O O7  . NAG D 3 .   ? 22.141  36.854  -3.067  1.00 117.00 ? 602  NAG A O7  1 
HETATM 8456 C C1  . NAG E 3 .   ? 11.289  34.216  25.540  1.00 108.27 ? 603  NAG A C1  1 
HETATM 8457 C C2  . NAG E 3 .   ? 12.679  34.881  25.455  1.00 121.81 ? 603  NAG A C2  1 
HETATM 8458 C C3  . NAG E 3 .   ? 12.916  36.025  26.464  1.00 126.37 ? 603  NAG A C3  1 
HETATM 8459 C C4  . NAG E 3 .   ? 11.737  36.996  26.444  1.00 124.89 ? 603  NAG A C4  1 
HETATM 8460 C C5  . NAG E 3 .   ? 10.471  36.210  26.799  1.00 124.18 ? 603  NAG A C5  1 
HETATM 8461 C C6  . NAG E 3 .   ? 9.228   37.102  26.973  1.00 126.14 ? 603  NAG A C6  1 
HETATM 8462 C C7  . NAG E 3 .   ? 14.011  32.929  24.835  1.00 112.35 ? 603  NAG A C7  1 
HETATM 8463 C C8  . NAG E 3 .   ? 14.974  31.874  25.298  1.00 106.95 ? 603  NAG A C8  1 
HETATM 8464 N N2  . NAG E 3 .   ? 13.618  33.800  25.768  1.00 119.96 ? 603  NAG A N2  1 
HETATM 8465 O O3  . NAG E 3 .   ? 14.138  36.747  26.205  1.00 124.00 ? 603  NAG A O3  1 
HETATM 8466 O O4  . NAG E 3 .   ? 11.966  38.098  27.347  1.00 117.34 ? 603  NAG A O4  1 
HETATM 8467 O O5  . NAG E 3 .   ? 10.220  35.132  25.869  1.00 116.91 ? 603  NAG A O5  1 
HETATM 8468 O O6  . NAG E 3 .   ? 8.666   37.560  25.734  1.00 123.73 ? 603  NAG A O6  1 
HETATM 8469 O O7  . NAG E 3 .   ? 13.619  32.984  23.676  1.00 108.61 ? 603  NAG A O7  1 
HETATM 8470 O O1  . P6G F 4 .   ? 16.885  10.874  -12.582 1.00 93.98  ? 604  P6G A O1  1 
HETATM 8471 C C2  . P6G F 4 .   ? 17.854  10.272  -13.274 1.00 96.17  ? 604  P6G A C2  1 
HETATM 8472 C C3  . P6G F 4 .   ? 18.611  10.946  -14.149 1.00 100.82 ? 604  P6G A C3  1 
HETATM 8473 O O4  . P6G F 4 .   ? 19.665  10.245  -14.880 1.00 100.60 ? 604  P6G A O4  1 
HETATM 8474 C C5  . P6G F 4 .   ? 20.931  10.857  -15.285 1.00 86.41  ? 604  P6G A C5  1 
HETATM 8475 C C6  . P6G F 4 .   ? 22.090  10.266  -14.959 1.00 76.55  ? 604  P6G A C6  1 
HETATM 8476 O O7  . P6G F 4 .   ? 22.164  9.019   -14.174 1.00 70.12  ? 604  P6G A O7  1 
HETATM 8477 C C8  . P6G F 4 .   ? 23.299  8.091   -14.304 1.00 59.63  ? 604  P6G A C8  1 
HETATM 8478 C C9  . P6G F 4 .   ? 23.320  6.810   -13.903 1.00 46.69  ? 604  P6G A C9  1 
HETATM 8479 O O10 . P6G F 4 .   ? 22.183  6.200   -13.236 1.00 58.49  ? 604  P6G A O10 1 
HETATM 8480 C C11 . P6G F 4 .   ? 21.988  4.791   -13.209 1.00 66.43  ? 604  P6G A C11 1 
HETATM 8481 C C12 . P6G F 4 .   ? 21.388  4.343   -11.872 1.00 72.97  ? 604  P6G A C12 1 
HETATM 8482 O O13 . P6G F 4 .   ? 20.257  5.141   -11.517 1.00 79.53  ? 604  P6G A O13 1 
HETATM 8483 C C14 . P6G F 4 .   ? 19.453  4.780   -10.348 1.00 83.10  ? 604  P6G A C14 1 
HETATM 8484 C C15 . P6G F 4 .   ? 18.269  5.345   -10.078 1.00 82.10  ? 604  P6G A C15 1 
HETATM 8485 O O16 . P6G F 4 .   ? 17.693  6.370   -10.941 1.00 81.43  ? 604  P6G A O16 1 
HETATM 8486 C C17 . P6G F 4 .   ? 16.362  6.232   -11.531 1.00 88.33  ? 604  P6G A C17 1 
HETATM 8487 C C18 . P6G F 4 .   ? 15.524  7.275   -11.564 1.00 94.36  ? 604  P6G A C18 1 
HETATM 8488 O O19 . P6G F 4 .   ? 14.306  7.179   -12.101 1.00 94.05  ? 604  P6G A O19 1 
HETATM 8489 C C   . CO3 G 5 .   ? 39.578  24.980  4.813   1.00 86.59  ? 605  CO3 A C   1 
HETATM 8490 O O1  . CO3 G 5 .   ? 40.248  25.801  5.603   1.00 82.88  ? 605  CO3 A O1  1 
HETATM 8491 O O2  . CO3 G 5 .   ? 38.308  25.215  4.595   1.00 82.76  ? 605  CO3 A O2  1 
HETATM 8492 O O3  . CO3 G 5 .   ? 40.143  23.927  4.241   1.00 78.21  ? 605  CO3 A O3  1 
HETATM 8493 O O3  . HI6 H 2 .   ? 17.417  -6.349  -40.558 1.00 101.66 ? 601  HI6 B O3  1 
HETATM 8494 C C14 . HI6 H 2 .   ? 16.657  -7.111  -41.119 1.00 93.97  ? 601  HI6 B C14 1 
HETATM 8495 N N4  . HI6 H 2 .   ? 16.724  -7.330  -42.434 1.00 96.79  ? 601  HI6 B N4  1 
HETATM 8496 C C11 . HI6 H 2 .   ? 15.601  -7.783  -40.298 1.00 82.87  ? 601  HI6 B C11 1 
HETATM 8497 C C10 . HI6 H 2 .   ? 14.871  -8.833  -40.833 1.00 88.05  ? 601  HI6 B C10 1 
HETATM 8498 C C9  . HI6 H 2 .   ? 13.890  -9.435  -40.054 1.00 90.09  ? 601  HI6 B C9  1 
HETATM 8499 N N3  . HI6 H 2 .   ? 13.636  -9.001  -38.809 1.00 86.89  ? 601  HI6 B N3  1 
HETATM 8500 C C13 . HI6 H 2 .   ? 14.336  -7.987  -38.268 1.00 80.50  ? 601  HI6 B C13 1 
HETATM 8501 C C12 . HI6 H 2 .   ? 15.332  -7.351  -39.004 1.00 78.00  ? 601  HI6 B C12 1 
HETATM 8502 C C8  . HI6 H 2 .   ? 12.595  -9.674  -38.023 1.00 86.90  ? 601  HI6 B C8  1 
HETATM 8503 O O2  . HI6 H 2 .   ? 11.680  -8.701  -37.575 1.00 87.14  ? 601  HI6 B O2  1 
HETATM 8504 C C7  . HI6 H 2 .   ? 11.300  -8.802  -36.214 1.00 95.60  ? 601  HI6 B C7  1 
HETATM 8505 N N2  . HI6 H 2 .   ? 10.208  -7.835  -36.120 1.00 104.35 ? 601  HI6 B N2  1 
HETATM 8506 C C2  . HI6 H 2 .   ? 10.342  -6.741  -35.359 1.00 100.66 ? 601  HI6 B C2  1 
HETATM 8507 C C3  . HI6 H 2 .   ? 9.294   -5.836  -35.298 1.00 103.17 ? 601  HI6 B C3  1 
HETATM 8508 C C4  . HI6 H 2 .   ? 8.120   -6.058  -36.018 1.00 105.33 ? 601  HI6 B C4  1 
HETATM 8509 C C5  . HI6 H 2 .   ? 8.006   -7.195  -36.799 1.00 106.51 ? 601  HI6 B C5  1 
HETATM 8510 C C6  . HI6 H 2 .   ? 9.087   -8.071  -36.829 1.00 108.84 ? 601  HI6 B C6  1 
HETATM 8511 C C   . CO3 I 5 .   ? 18.038  -13.863 -36.686 1.00 94.51  ? 602  CO3 B C   1 
HETATM 8512 O O1  . CO3 I 5 .   ? 16.955  -14.248 -36.059 1.00 87.64  ? 602  CO3 B O1  1 
HETATM 8513 O O2  . CO3 I 5 .   ? 18.803  -12.911 -36.188 1.00 87.02  ? 602  CO3 B O2  1 
HETATM 8514 O O3  . CO3 I 5 .   ? 18.343  -14.445 -37.820 1.00 98.73  ? 602  CO3 B O3  1 
HETATM 8515 O O   . HOH J 6 .   ? 41.820  0.492   44.757  1.00 39.28  ? 2001 HOH A O   1 
HETATM 8516 O O   . HOH J 6 .   ? 39.500  20.143  16.427  1.00 40.08  ? 2002 HOH A O   1 
HETATM 8517 O O   . HOH J 6 .   ? 53.055  25.747  8.737   1.00 35.75  ? 2003 HOH A O   1 
HETATM 8518 O O   . HOH J 6 .   ? 29.959  16.139  1.008   1.00 42.60  ? 2004 HOH A O   1 
HETATM 8519 O O   . HOH J 6 .   ? 24.685  18.675  28.850  1.00 33.30  ? 2005 HOH A O   1 
HETATM 8520 O O   . HOH J 6 .   ? 39.882  -1.814  23.828  1.00 39.18  ? 2006 HOH A O   1 
HETATM 8521 O O   . HOH J 6 .   ? 19.186  -5.706  28.344  1.00 48.03  ? 2007 HOH A O   1 
HETATM 8522 O O   . HOH J 6 .   ? 34.731  16.000  -7.516  1.00 40.01  ? 2008 HOH A O   1 
HETATM 8523 O O   . HOH J 6 .   ? 19.673  17.935  2.459   1.00 33.51  ? 2009 HOH A O   1 
HETATM 8524 O O   . HOH J 6 .   ? 41.706  13.718  31.468  1.00 56.14  ? 2010 HOH A O   1 
HETATM 8525 O O   . HOH J 6 .   ? 29.012  17.831  20.070  1.00 35.28  ? 2011 HOH A O   1 
HETATM 8526 O O   . HOH J 6 .   ? 18.407  12.082  13.221  1.00 33.74  ? 2012 HOH A O   1 
HETATM 8527 O O   . HOH J 6 .   ? 20.120  7.734   -13.115 1.00 54.74  ? 2013 HOH A O   1 
HETATM 8528 O O   . HOH J 6 .   ? 33.249  4.746   6.591   1.00 45.28  ? 2014 HOH A O   1 
HETATM 8529 O O   . HOH J 6 .   ? 50.559  3.298   7.374   1.00 54.12  ? 2015 HOH A O   1 
HETATM 8530 O O   . HOH J 6 .   ? 16.738  3.171   -0.020  1.00 47.17  ? 2016 HOH A O   1 
HETATM 8531 O O   . HOH J 6 .   ? 11.187  1.275   10.765  1.00 40.45  ? 2017 HOH A O   1 
HETATM 8532 O O   . HOH J 6 .   ? 2.811   6.553   18.298  1.00 49.39  ? 2018 HOH A O   1 
HETATM 8533 O O   . HOH J 6 .   ? 3.145   0.412   4.590   1.00 48.76  ? 2019 HOH A O   1 
HETATM 8534 O O   . HOH J 6 .   ? 45.196  0.951   15.611  1.00 46.07  ? 2020 HOH A O   1 
HETATM 8535 O O   . HOH J 6 .   ? 16.241  -2.713  33.688  1.00 40.14  ? 2021 HOH A O   1 
HETATM 8536 O O   . HOH J 6 .   ? 52.230  9.226   21.915  1.00 52.34  ? 2022 HOH A O   1 
HETATM 8537 O O   . HOH J 6 .   ? 25.570  -6.253  21.355  1.00 51.44  ? 2023 HOH A O   1 
HETATM 8538 O O   . HOH J 6 .   ? 34.116  23.578  18.487  1.00 45.82  ? 2024 HOH A O   1 
HETATM 8539 O O   . HOH J 6 .   ? 19.011  0.458   27.768  1.00 38.78  ? 2025 HOH A O   1 
HETATM 8540 O O   . HOH J 6 .   ? 17.113  14.959  28.956  1.00 39.98  ? 2026 HOH A O   1 
HETATM 8541 O O   . HOH J 6 .   ? 18.739  19.795  18.413  1.00 58.51  ? 2027 HOH A O   1 
HETATM 8542 O O   . HOH J 6 .   ? 27.991  -0.478  29.510  1.00 42.75  ? 2028 HOH A O   1 
HETATM 8543 O O   . HOH J 6 .   ? 40.664  12.298  33.463  1.00 40.29  ? 2029 HOH A O   1 
HETATM 8544 O O   . HOH J 6 .   ? 32.482  0.772   -1.860  1.00 47.93  ? 2030 HOH A O   1 
HETATM 8545 O O   . HOH J 6 .   ? 3.303   11.892  11.157  1.00 43.90  ? 2031 HOH A O   1 
HETATM 8546 O O   . HOH J 6 .   ? 42.437  7.404   14.202  1.00 41.93  ? 2032 HOH A O   1 
HETATM 8547 O O   . HOH J 6 .   ? 29.215  27.407  -6.203  1.00 47.63  ? 2033 HOH A O   1 
HETATM 8548 O O   . HOH J 6 .   ? 38.639  3.097   45.181  1.00 49.63  ? 2034 HOH A O   1 
HETATM 8549 O O   . HOH J 6 .   ? 10.783  17.652  34.290  1.00 48.36  ? 2035 HOH A O   1 
HETATM 8550 O O   . HOH J 6 .   ? 40.937  6.472   2.765   1.00 39.29  ? 2036 HOH A O   1 
HETATM 8551 O O   . HOH J 6 .   ? 23.539  8.666   48.263  1.00 45.64  ? 2037 HOH A O   1 
HETATM 8552 O O   . HOH J 6 .   ? 38.364  15.331  12.505  1.00 34.75  ? 2038 HOH A O   1 
HETATM 8553 O O   . HOH J 6 .   ? 14.891  1.946   1.716   1.00 40.80  ? 2039 HOH A O   1 
HETATM 8554 O O   . HOH J 6 .   ? 57.668  8.323   20.043  1.00 45.82  ? 2040 HOH A O   1 
HETATM 8555 O O   . HOH J 6 .   ? 46.879  7.582   18.060  1.00 47.49  ? 2041 HOH A O   1 
HETATM 8556 O O   . HOH J 6 .   ? 45.861  12.725  22.864  1.00 54.35  ? 2042 HOH A O   1 
HETATM 8557 O O   . HOH J 6 .   ? 21.088  20.391  7.207   1.00 32.88  ? 2043 HOH A O   1 
HETATM 8558 O O   . HOH J 6 .   ? 42.851  9.605   11.297  1.00 35.92  ? 2044 HOH A O   1 
HETATM 8559 O O   . HOH J 6 .   ? 29.455  32.633  -1.315  1.00 62.01  ? 2045 HOH A O   1 
HETATM 8560 O O   . HOH J 6 .   ? 32.543  19.252  29.111  1.00 34.85  ? 2046 HOH A O   1 
HETATM 8561 O O   . HOH J 6 .   ? 48.110  11.308  32.966  1.00 56.71  ? 2047 HOH A O   1 
HETATM 8562 O O   . HOH J 6 .   ? 43.309  0.549   6.074   1.00 48.60  ? 2048 HOH A O   1 
HETATM 8563 O O   . HOH J 6 .   ? 62.308  8.919   8.446   1.00 54.71  ? 2049 HOH A O   1 
HETATM 8564 O O   . HOH J 6 .   ? 13.171  3.481   32.980  1.00 51.07  ? 2050 HOH A O   1 
HETATM 8565 O O   . HOH J 6 .   ? 36.809  9.678   4.261   1.00 30.12  ? 2051 HOH A O   1 
HETATM 8566 O O   . HOH J 6 .   ? 30.340  34.416  -4.381  1.00 60.37  ? 2052 HOH A O   1 
HETATM 8567 O O   . HOH J 6 .   ? 45.354  10.625  38.297  1.00 57.54  ? 2053 HOH A O   1 
HETATM 8568 O O   . HOH J 6 .   ? 36.196  -4.932  13.925  1.00 48.80  ? 2054 HOH A O   1 
HETATM 8569 O O   . HOH J 6 .   ? 32.017  16.770  32.531  1.00 40.27  ? 2055 HOH A O   1 
HETATM 8570 O O   . HOH J 6 .   ? 46.260  10.391  10.963  1.00 29.72  ? 2056 HOH A O   1 
HETATM 8571 O O   . HOH J 6 .   ? 27.370  -1.341  37.330  1.00 42.83  ? 2057 HOH A O   1 
HETATM 8572 O O   . HOH J 6 .   ? 13.858  21.164  14.178  1.00 44.51  ? 2058 HOH A O   1 
HETATM 8573 O O   . HOH J 6 .   ? 56.003  2.107   12.830  1.00 47.33  ? 2059 HOH A O   1 
HETATM 8574 O O   . HOH J 6 .   ? 31.647  16.910  29.609  1.00 24.37  ? 2060 HOH A O   1 
HETATM 8575 O O   . HOH J 6 .   ? 37.849  8.286   47.440  1.00 51.69  ? 2061 HOH A O   1 
HETATM 8576 O O   . HOH J 6 .   ? 35.154  17.176  24.484  1.00 28.76  ? 2062 HOH A O   1 
HETATM 8577 O O   . HOH J 6 .   ? 31.885  0.027   41.624  1.00 40.21  ? 2063 HOH A O   1 
HETATM 8578 O O   . HOH J 6 .   ? 24.776  22.350  30.167  1.00 47.50  ? 2064 HOH A O   1 
HETATM 8579 O O   . HOH J 6 .   ? 30.861  20.947  16.616  1.00 27.52  ? 2065 HOH A O   1 
HETATM 8580 O O   . HOH J 6 .   ? 9.531   -3.078  6.585   1.00 40.91  ? 2066 HOH A O   1 
HETATM 8581 O O   . HOH J 6 .   ? 42.447  23.654  11.403  1.00 52.33  ? 2067 HOH A O   1 
HETATM 8582 O O   . HOH J 6 .   ? 33.009  14.487  17.069  1.00 37.53  ? 2068 HOH A O   1 
HETATM 8583 O O   . HOH J 6 .   ? 26.189  8.560   7.737   1.00 41.97  ? 2069 HOH A O   1 
HETATM 8584 O O   . HOH J 6 .   ? 13.473  4.643   37.006  1.00 45.75  ? 2070 HOH A O   1 
HETATM 8585 O O   . HOH J 6 .   ? 37.964  29.926  16.688  1.00 50.77  ? 2071 HOH A O   1 
HETATM 8586 O O   . HOH J 6 .   ? 48.237  4.547   35.013  1.00 55.42  ? 2072 HOH A O   1 
HETATM 8587 O O   . HOH J 6 .   ? 34.309  -2.762  32.558  1.00 49.27  ? 2073 HOH A O   1 
HETATM 8588 O O   . HOH J 6 .   ? 43.113  15.699  36.251  1.00 44.66  ? 2074 HOH A O   1 
HETATM 8589 O O   . HOH J 6 .   ? 45.350  8.062   29.643  1.00 32.77  ? 2075 HOH A O   1 
HETATM 8590 O O   . HOH J 6 .   ? 50.696  7.289   3.136   1.00 49.88  ? 2076 HOH A O   1 
HETATM 8591 O O   . HOH J 6 .   ? 30.671  8.015   6.602   1.00 34.31  ? 2077 HOH A O   1 
HETATM 8592 O O   . HOH J 6 .   ? 38.385  15.752  1.053   1.00 41.84  ? 2078 HOH A O   1 
HETATM 8593 O O   . HOH J 6 .   ? 43.285  15.626  24.965  1.00 41.82  ? 2079 HOH A O   1 
HETATM 8594 O O   . HOH J 6 .   ? 51.945  16.097  24.500  1.00 34.35  ? 2080 HOH A O   1 
HETATM 8595 O O   . HOH J 6 .   ? 47.806  6.279   -12.071 1.00 55.62  ? 2081 HOH A O   1 
HETATM 8596 O O   . HOH J 6 .   ? 46.416  8.032   0.159   1.00 47.01  ? 2082 HOH A O   1 
HETATM 8597 O O   . HOH J 6 .   ? 29.134  12.194  24.624  1.00 32.31  ? 2083 HOH A O   1 
HETATM 8598 O O   . HOH J 6 .   ? 32.012  -9.916  9.996   1.00 53.41  ? 2084 HOH A O   1 
HETATM 8599 O O   . HOH J 6 .   ? 5.322   5.105   1.057   1.00 35.69  ? 2085 HOH A O   1 
HETATM 8600 O O   . HOH J 6 .   ? 32.023  20.316  6.495   1.00 20.68  ? 2086 HOH A O   1 
HETATM 8601 O O   . HOH J 6 .   ? 40.871  16.681  22.212  1.00 44.36  ? 2087 HOH A O   1 
HETATM 8602 O O   . HOH J 6 .   ? 12.538  8.788   -13.778 1.00 49.46  ? 2088 HOH A O   1 
HETATM 8603 O O   . HOH J 6 .   ? 16.327  20.511  -20.702 1.00 50.99  ? 2089 HOH A O   1 
HETATM 8604 O O   . HOH J 6 .   ? 1.796   26.918  22.262  1.00 56.53  ? 2090 HOH A O   1 
HETATM 8605 O O   . HOH J 6 .   ? 37.835  12.125  4.566   1.00 44.27  ? 2091 HOH A O   1 
HETATM 8606 O O   . HOH J 6 .   ? 49.857  22.133  24.943  1.00 46.86  ? 2092 HOH A O   1 
HETATM 8607 O O   . HOH J 6 .   ? 33.725  -2.051  41.682  1.00 32.55  ? 2093 HOH A O   1 
HETATM 8608 O O   . HOH J 6 .   ? 41.391  19.033  18.044  1.00 28.46  ? 2094 HOH A O   1 
HETATM 8609 O O   . HOH J 6 .   ? 27.711  3.361   2.149   1.00 54.10  ? 2095 HOH A O   1 
HETATM 8610 O O   . HOH J 6 .   ? 11.719  12.091  2.110   1.00 56.86  ? 2096 HOH A O   1 
HETATM 8611 O O   . HOH J 6 .   ? 39.462  5.423   46.719  1.00 44.42  ? 2097 HOH A O   1 
HETATM 8612 O O   . HOH J 6 .   ? 37.039  -6.066  16.396  1.00 54.79  ? 2098 HOH A O   1 
HETATM 8613 O O   . HOH J 6 .   ? 52.306  13.522  3.724   1.00 54.85  ? 2099 HOH A O   1 
HETATM 8614 O O   . HOH J 6 .   ? 43.874  11.155  9.367   1.00 39.99  ? 2100 HOH A O   1 
HETATM 8615 O O   . HOH J 6 .   ? 18.091  35.143  -2.320  1.00 46.91  ? 2101 HOH A O   1 
HETATM 8616 O O   . HOH J 6 .   ? 23.655  23.426  23.563  1.00 62.38  ? 2102 HOH A O   1 
HETATM 8617 O O   . HOH J 6 .   ? 25.189  29.354  -14.581 1.00 40.35  ? 2103 HOH A O   1 
HETATM 8618 O O   . HOH J 6 .   ? 10.730  26.388  -8.813  1.00 57.56  ? 2104 HOH A O   1 
HETATM 8619 O O   . HOH J 6 .   ? 10.888  22.531  6.753   1.00 34.32  ? 2105 HOH A O   1 
HETATM 8620 O O   . HOH J 6 .   ? 36.071  25.682  32.816  1.00 45.17  ? 2106 HOH A O   1 
HETATM 8621 O O   . HOH J 6 .   ? 10.017  3.377   33.552  1.00 57.55  ? 2107 HOH A O   1 
HETATM 8622 O O   . HOH J 6 .   ? 14.031  7.826   -4.641  1.00 52.77  ? 2108 HOH A O   1 
HETATM 8623 O O   . HOH J 6 .   ? 36.097  1.722   37.168  1.00 33.16  ? 2109 HOH A O   1 
HETATM 8624 O O   . HOH J 6 .   ? 35.793  7.156   -14.034 1.00 41.42  ? 2110 HOH A O   1 
HETATM 8625 O O   . HOH J 6 .   ? 56.434  2.746   15.708  1.00 60.00  ? 2111 HOH A O   1 
HETATM 8626 O O   . HOH J 6 .   ? 6.258   25.406  26.781  1.00 44.42  ? 2112 HOH A O   1 
HETATM 8627 O O   . HOH J 6 .   ? 49.757  5.686   27.820  1.00 61.20  ? 2113 HOH A O   1 
HETATM 8628 O O   . HOH J 6 .   ? 41.468  13.039  35.761  1.00 40.32  ? 2114 HOH A O   1 
HETATM 8629 O O   . HOH J 6 .   ? 39.316  27.701  26.633  1.00 48.19  ? 2115 HOH A O   1 
HETATM 8630 O O   . HOH J 6 .   ? 38.547  21.796  2.538   1.00 50.94  ? 2116 HOH A O   1 
HETATM 8631 O O   . HOH J 6 .   ? 46.561  8.298   27.158  1.00 41.82  ? 2117 HOH A O   1 
HETATM 8632 O O   . HOH J 6 .   ? 40.207  1.613   26.023  1.00 54.55  ? 2118 HOH A O   1 
HETATM 8633 O O   . HOH J 6 .   ? 4.772   18.697  11.867  1.00 62.51  ? 2119 HOH A O   1 
HETATM 8634 O O   . HOH J 6 .   ? 13.120  23.586  35.421  1.00 48.73  ? 2120 HOH A O   1 
HETATM 8635 O O   . HOH J 6 .   ? 19.073  14.832  2.192   1.00 48.40  ? 2121 HOH A O   1 
HETATM 8636 O O   . HOH J 6 .   ? 44.791  11.263  -1.091  1.00 45.97  ? 2122 HOH A O   1 
HETATM 8637 O O   . HOH J 6 .   ? 40.220  16.961  12.606  1.00 37.70  ? 2123 HOH A O   1 
HETATM 8638 O O   . HOH J 6 .   ? 15.277  23.363  33.539  1.00 61.19  ? 2124 HOH A O   1 
HETATM 8639 O O   . HOH J 6 .   ? 40.146  27.415  17.062  1.00 33.90  ? 2125 HOH A O   1 
HETATM 8640 O O   . HOH J 6 .   ? 26.063  -7.707  25.265  1.00 58.89  ? 2126 HOH A O   1 
HETATM 8641 O O   . HOH J 6 .   ? 22.753  19.801  45.970  1.00 47.69  ? 2127 HOH A O   1 
HETATM 8642 O O   . HOH J 6 .   ? 11.823  23.038  -9.985  1.00 42.98  ? 2128 HOH A O   1 
HETATM 8643 O O   . HOH J 6 .   ? 8.471   11.831  38.322  1.00 49.27  ? 2129 HOH A O   1 
HETATM 8644 O O   . HOH J 6 .   ? 38.278  13.220  2.108   1.00 42.77  ? 2130 HOH A O   1 
HETATM 8645 O O   . HOH J 6 .   ? 19.210  23.534  38.738  1.00 38.47  ? 2131 HOH A O   1 
HETATM 8646 O O   . HOH J 6 .   ? 6.267   24.720  -13.739 1.00 60.14  ? 2132 HOH A O   1 
HETATM 8647 O O   . HOH J 6 .   ? 38.931  13.136  -13.254 1.00 55.99  ? 2133 HOH A O   1 
HETATM 8648 O O   . HOH J 6 .   ? 42.371  6.685   -0.059  1.00 39.34  ? 2134 HOH A O   1 
HETATM 8649 O O   . HOH J 6 .   ? 39.558  14.594  45.466  1.00 40.23  ? 2135 HOH A O   1 
HETATM 8650 O O   . HOH J 6 .   ? 31.223  23.715  16.683  1.00 53.54  ? 2136 HOH A O   1 
HETATM 8651 O O   . HOH J 6 .   ? 12.154  9.035   42.031  1.00 48.50  ? 2137 HOH A O   1 
HETATM 8652 O O   . HOH J 6 .   ? 12.924  11.800  -1.897  1.00 46.10  ? 2138 HOH A O   1 
HETATM 8653 O O   . HOH J 6 .   ? 59.307  3.463   11.189  1.00 53.48  ? 2139 HOH A O   1 
HETATM 8654 O O   . HOH J 6 .   ? 21.514  -13.883 9.088   1.00 59.27  ? 2140 HOH A O   1 
HETATM 8655 O O   . HOH J 6 .   ? 14.558  26.627  -16.072 1.00 59.81  ? 2141 HOH A O   1 
HETATM 8656 O O   . HOH J 6 .   ? 39.293  15.592  -9.674  1.00 69.64  ? 2142 HOH A O   1 
HETATM 8657 O O   . HOH J 6 .   ? 15.765  14.568  -8.713  1.00 46.42  ? 2143 HOH A O   1 
HETATM 8658 O O   . HOH J 6 .   ? 43.959  -3.179  7.659   1.00 34.68  ? 2144 HOH A O   1 
HETATM 8659 O O   . HOH J 6 .   ? 14.957  -7.704  23.708  1.00 41.18  ? 2145 HOH A O   1 
HETATM 8660 O O   . HOH J 6 .   ? 39.188  16.106  47.355  1.00 42.65  ? 2146 HOH A O   1 
HETATM 8661 O O   . HOH J 6 .   ? 56.212  14.579  26.002  1.00 52.34  ? 2147 HOH A O   1 
HETATM 8662 O O   . HOH J 6 .   ? 41.000  15.060  50.000  1.00 61.21  ? 2148 HOH A O   1 
HETATM 8663 O O   . HOH J 6 .   ? 56.319  -0.771  13.802  1.00 54.37  ? 2149 HOH A O   1 
HETATM 8664 O O   . HOH J 6 .   ? 10.948  3.580   -11.022 1.00 35.95  ? 2150 HOH A O   1 
HETATM 8665 O O   . HOH J 6 .   ? 13.086  22.761  1.542   1.00 45.07  ? 2151 HOH A O   1 
HETATM 8666 O O   . HOH J 6 .   ? 16.470  -12.134 7.594   1.00 62.27  ? 2152 HOH A O   1 
HETATM 8667 O O   . HOH J 6 .   ? 18.275  -13.526 9.144   1.00 54.08  ? 2153 HOH A O   1 
HETATM 8668 O O   . HOH J 6 .   ? 44.000  23.745  2.763   1.00 55.02  ? 2154 HOH A O   1 
HETATM 8669 O O   . HOH J 6 .   ? 11.695  24.796  1.776   1.00 50.65  ? 2155 HOH A O   1 
HETATM 8670 O O   . HOH J 6 .   ? 50.358  2.916   4.876   1.00 61.03  ? 2156 HOH A O   1 
HETATM 8671 O O   . HOH J 6 .   ? 41.164  5.166   -2.720  1.00 59.21  ? 2157 HOH A O   1 
HETATM 8672 O O   . HOH J 6 .   ? 8.823   8.530   36.575  1.00 53.05  ? 2158 HOH A O   1 
HETATM 8673 O O   . HOH J 6 .   ? 53.044  20.681  25.551  1.00 49.95  ? 2159 HOH A O   1 
HETATM 8674 O O   . HOH J 6 .   ? 14.893  -6.911  26.444  1.00 54.06  ? 2160 HOH A O   1 
HETATM 8675 O O   . HOH J 6 .   ? 11.336  28.271  1.417   1.00 55.32  ? 2161 HOH A O   1 
HETATM 8676 O O   . HOH J 6 .   ? 33.386  -1.957  -8.583  1.00 48.40  ? 2162 HOH A O   1 
HETATM 8677 O O   . HOH J 6 .   ? 15.178  18.346  -5.014  1.00 58.67  ? 2163 HOH A O   1 
HETATM 8678 O O   . HOH J 6 .   ? 16.145  16.341  -6.369  1.00 52.61  ? 2164 HOH A O   1 
HETATM 8679 O O   . HOH J 6 .   ? 53.228  6.097   -0.511  1.00 52.70  ? 2165 HOH A O   1 
HETATM 8680 O O   . HOH K 6 .   ? -0.304  7.480   -73.030 1.00 49.07  ? 701  HOH B O   1 
HETATM 8681 O O   . HOH K 6 .   ? 15.379  15.374  -21.038 1.00 40.83  ? 702  HOH B O   1 
HETATM 8682 O O   . HOH K 6 .   ? 38.656  -4.099  -61.329 1.00 59.04  ? 703  HOH B O   1 
HETATM 8683 O O   . HOH K 6 .   ? -9.697  13.314  -60.038 1.00 46.47  ? 704  HOH B O   1 
HETATM 8684 O O   . HOH K 6 .   ? 5.386   14.631  -18.766 1.00 42.83  ? 705  HOH B O   1 
HETATM 8685 O O   . HOH K 6 .   ? -5.320  -1.866  -49.214 1.00 48.13  ? 706  HOH B O   1 
HETATM 8686 O O   . HOH K 6 .   ? -7.853  7.745   -45.347 1.00 43.54  ? 707  HOH B O   1 
HETATM 8687 O O   . HOH K 6 .   ? 3.121   7.984   -33.228 1.00 29.25  ? 708  HOH B O   1 
HETATM 8688 O O   . HOH K 6 .   ? 3.917   4.122   -33.942 1.00 35.36  ? 709  HOH B O   1 
HETATM 8689 O O   . HOH K 6 .   ? -6.004  -3.449  -55.899 1.00 49.66  ? 710  HOH B O   1 
HETATM 8690 O O   . HOH K 6 .   ? 4.553   4.794   -48.559 1.00 36.05  ? 711  HOH B O   1 
HETATM 8691 O O   . HOH K 6 .   ? 4.976   1.729   -69.529 1.00 30.40  ? 712  HOH B O   1 
HETATM 8692 O O   . HOH K 6 .   ? 2.815   11.583  -20.682 1.00 45.36  ? 713  HOH B O   1 
HETATM 8693 O O   . HOH K 6 .   ? -13.651 31.123  -25.772 1.00 43.89  ? 714  HOH B O   1 
HETATM 8694 O O   . HOH K 6 .   ? -1.553  25.163  -47.596 1.00 34.50  ? 715  HOH B O   1 
HETATM 8695 O O   . HOH K 6 .   ? 1.597   23.742  -19.778 1.00 40.84  ? 716  HOH B O   1 
HETATM 8696 O O   . HOH K 6 .   ? 22.879  0.708   -53.219 1.00 51.12  ? 717  HOH B O   1 
HETATM 8697 O O   . HOH K 6 .   ? 4.436   -0.763  -44.041 1.00 44.01  ? 718  HOH B O   1 
HETATM 8698 O O   . HOH K 6 .   ? 8.025   24.702  -31.850 1.00 28.66  ? 719  HOH B O   1 
HETATM 8699 O O   . HOH K 6 .   ? 0.506   0.415   -56.240 1.00 39.35  ? 720  HOH B O   1 
HETATM 8700 O O   . HOH K 6 .   ? 24.542  -5.612  -24.181 1.00 48.19  ? 721  HOH B O   1 
HETATM 8701 O O   . HOH K 6 .   ? -3.805  1.066   -48.946 1.00 50.79  ? 722  HOH B O   1 
HETATM 8702 O O   . HOH K 6 .   ? 10.909  -0.002  -44.348 1.00 43.68  ? 723  HOH B O   1 
HETATM 8703 O O   . HOH K 6 .   ? -1.322  3.975   -48.940 1.00 42.36  ? 724  HOH B O   1 
HETATM 8704 O O   . HOH K 6 .   ? 8.182   0.811   -62.210 1.00 49.72  ? 725  HOH B O   1 
HETATM 8705 O O   . HOH K 6 .   ? -2.965  1.067   -36.999 1.00 57.88  ? 726  HOH B O   1 
HETATM 8706 O O   . HOH K 6 .   ? 23.512  -8.340  -27.510 1.00 53.97  ? 727  HOH B O   1 
HETATM 8707 O O   . HOH K 6 .   ? 17.345  15.428  -25.129 1.00 45.38  ? 728  HOH B O   1 
HETATM 8708 O O   . HOH K 6 .   ? 4.702   -3.676  -43.054 1.00 41.17  ? 729  HOH B O   1 
HETATM 8709 O O   . HOH K 6 .   ? 11.651  22.641  -46.724 1.00 48.57  ? 730  HOH B O   1 
HETATM 8710 O O   . HOH K 6 .   ? 18.670  10.664  -30.266 1.00 57.05  ? 731  HOH B O   1 
HETATM 8711 O O   . HOH K 6 .   ? 18.935  12.823  -55.530 1.00 47.32  ? 732  HOH B O   1 
HETATM 8712 O O   . HOH K 6 .   ? 10.948  16.831  -23.147 1.00 35.62  ? 733  HOH B O   1 
HETATM 8713 O O   . HOH K 6 .   ? 3.507   20.172  -28.806 1.00 41.90  ? 734  HOH B O   1 
HETATM 8714 O O   . HOH K 6 .   ? 17.690  -2.687  -56.213 1.00 53.88  ? 735  HOH B O   1 
HETATM 8715 O O   . HOH K 6 .   ? 7.838   3.254   -71.826 1.00 44.49  ? 736  HOH B O   1 
HETATM 8716 O O   . HOH K 6 .   ? -8.113  19.895  -47.757 1.00 53.40  ? 737  HOH B O   1 
HETATM 8717 O O   . HOH K 6 .   ? -2.478  -0.113  -61.691 1.00 44.13  ? 738  HOH B O   1 
HETATM 8718 O O   . HOH K 6 .   ? 28.450  5.500   -51.779 1.00 49.00  ? 739  HOH B O   1 
HETATM 8719 O O   . HOH K 6 .   ? 33.678  2.137   -47.104 1.00 55.59  ? 740  HOH B O   1 
HETATM 8720 O O   . HOH K 6 .   ? 0.182   19.890  -47.373 1.00 37.41  ? 741  HOH B O   1 
HETATM 8721 O O   . HOH K 6 .   ? 16.669  -3.732  -43.202 1.00 35.74  ? 742  HOH B O   1 
HETATM 8722 O O   . HOH K 6 .   ? 21.729  2.287   -47.976 1.00 44.81  ? 743  HOH B O   1 
HETATM 8723 O O   . HOH K 6 .   ? -7.005  13.535  -26.652 1.00 28.90  ? 744  HOH B O   1 
HETATM 8724 O O   . HOH K 6 .   ? 5.193   8.532   -64.305 1.00 48.79  ? 745  HOH B O   1 
HETATM 8725 O O   . HOH K 6 .   ? 31.551  -4.554  -21.951 1.00 60.93  ? 746  HOH B O   1 
HETATM 8726 O O   . HOH K 6 .   ? 8.868   9.550   -63.082 1.00 51.27  ? 747  HOH B O   1 
HETATM 8727 O O   . HOH K 6 .   ? 6.777   -2.524  -51.106 1.00 43.83  ? 748  HOH B O   1 
HETATM 8728 O O   . HOH K 6 .   ? 15.735  2.662   -62.078 1.00 48.07  ? 749  HOH B O   1 
HETATM 8729 O O   . HOH K 6 .   ? 22.832  15.995  -45.910 1.00 40.39  ? 750  HOH B O   1 
HETATM 8730 O O   . HOH K 6 .   ? 25.331  -2.574  -47.138 1.00 51.20  ? 751  HOH B O   1 
HETATM 8731 O O   . HOH K 6 .   ? 11.950  26.363  -28.026 1.00 50.45  ? 752  HOH B O   1 
HETATM 8732 O O   . HOH K 6 .   ? -0.402  26.972  -32.320 1.00 35.99  ? 753  HOH B O   1 
HETATM 8733 O O   . HOH K 6 .   ? 1.774   7.885   -21.000 1.00 54.28  ? 754  HOH B O   1 
HETATM 8734 O O   . HOH K 6 .   ? 17.073  5.606   -34.817 1.00 34.37  ? 755  HOH B O   1 
HETATM 8735 O O   . HOH K 6 .   ? 6.170   23.966  -25.069 1.00 33.26  ? 756  HOH B O   1 
HETATM 8736 O O   . HOH K 6 .   ? 6.061   16.914  -53.740 1.00 32.17  ? 757  HOH B O   1 
HETATM 8737 O O   . HOH K 6 .   ? 6.300   4.585   -25.010 1.00 29.88  ? 758  HOH B O   1 
HETATM 8738 O O   . HOH K 6 .   ? 22.176  17.557  -47.986 1.00 42.33  ? 759  HOH B O   1 
HETATM 8739 O O   . HOH K 6 .   ? 11.828  27.669  -25.482 1.00 58.52  ? 760  HOH B O   1 
HETATM 8740 O O   . HOH K 6 .   ? 12.778  14.830  -22.838 1.00 28.11  ? 761  HOH B O   1 
HETATM 8741 O O   . HOH K 6 .   ? 4.866   -13.233 -53.874 1.00 39.84  ? 762  HOH B O   1 
HETATM 8742 O O   . HOH K 6 .   ? 17.726  15.429  -22.145 1.00 50.23  ? 763  HOH B O   1 
HETATM 8743 O O   . HOH K 6 .   ? 22.506  0.965   -36.498 1.00 37.42  ? 764  HOH B O   1 
HETATM 8744 O O   . HOH K 6 .   ? 13.213  6.636   -33.772 1.00 33.68  ? 765  HOH B O   1 
HETATM 8745 O O   . HOH K 6 .   ? 13.658  -7.652  -47.681 1.00 49.89  ? 766  HOH B O   1 
HETATM 8746 O O   . HOH K 6 .   ? -4.317  21.120  -20.827 1.00 49.16  ? 767  HOH B O   1 
HETATM 8747 O O   . HOH K 6 .   ? 32.130  -2.260  -37.604 1.00 54.98  ? 768  HOH B O   1 
HETATM 8748 O O   . HOH K 6 .   ? 23.916  17.635  -20.711 1.00 47.24  ? 769  HOH B O   1 
HETATM 8749 O O   . HOH K 6 .   ? 17.994  8.695   -27.963 1.00 45.38  ? 770  HOH B O   1 
HETATM 8750 O O   . HOH K 6 .   ? 14.595  17.839  -21.313 1.00 49.17  ? 771  HOH B O   1 
HETATM 8751 O O   . HOH K 6 .   ? -8.282  15.736  -20.637 1.00 60.71  ? 772  HOH B O   1 
HETATM 8752 O O   . HOH K 6 .   ? 1.650   0.280   -53.460 1.00 46.61  ? 773  HOH B O   1 
HETATM 8753 O O   . HOH K 6 .   ? 8.603   14.015  -18.143 1.00 46.35  ? 774  HOH B O   1 
HETATM 8754 O O   . HOH K 6 .   ? 16.029  10.231  -56.923 1.00 46.86  ? 775  HOH B O   1 
HETATM 8755 O O   . HOH K 6 .   ? 20.826  16.379  -26.282 1.00 47.91  ? 776  HOH B O   1 
HETATM 8756 O O   . HOH K 6 .   ? -6.126  12.917  -21.027 1.00 48.62  ? 777  HOH B O   1 
HETATM 8757 O O   . HOH K 6 .   ? -17.822 31.778  -36.463 1.00 55.25  ? 778  HOH B O   1 
HETATM 8758 O O   . HOH K 6 .   ? -9.076  7.160   -23.916 1.00 59.10  ? 779  HOH B O   1 
HETATM 8759 O O   . HOH K 6 .   ? 23.280  -4.558  -33.980 1.00 49.68  ? 780  HOH B O   1 
HETATM 8760 O O   . HOH K 6 .   ? 5.045   8.900   -20.634 1.00 43.27  ? 781  HOH B O   1 
HETATM 8761 O O   . HOH K 6 .   ? 6.852   0.093   -64.993 1.00 49.81  ? 782  HOH B O   1 
HETATM 8762 O O   . HOH K 6 .   ? -2.681  22.937  -58.683 1.00 57.90  ? 783  HOH B O   1 
HETATM 8763 O O   . HOH K 6 .   ? 12.924  -4.328  -55.568 1.00 41.10  ? 784  HOH B O   1 
HETATM 8764 O O   . HOH K 6 .   ? -3.624  0.831   -22.469 1.00 58.00  ? 785  HOH B O   1 
HETATM 8765 O O   . HOH K 6 .   ? -7.768  22.427  -32.118 1.00 53.28  ? 786  HOH B O   1 
HETATM 8766 O O   . HOH K 6 .   ? 36.806  -1.546  -56.846 1.00 63.94  ? 787  HOH B O   1 
HETATM 8767 O O   . HOH K 6 .   ? -10.244 18.064  -27.312 1.00 56.28  ? 788  HOH B O   1 
HETATM 8768 O O   . HOH K 6 .   ? 13.061  -6.291  -34.139 1.00 36.99  ? 789  HOH B O   1 
HETATM 8769 O O   . HOH K 6 .   ? 10.174  -7.196  -5.189  1.00 57.27  ? 790  HOH B O   1 
HETATM 8770 O O   . HOH K 6 .   ? -9.130  -0.421  -45.446 1.00 46.38  ? 791  HOH B O   1 
HETATM 8771 O O   . HOH K 6 .   ? 8.532   -8.901  -39.927 1.00 48.81  ? 792  HOH B O   1 
HETATM 8772 O O   . HOH K 6 .   ? 3.015   17.071  -17.020 1.00 42.37  ? 793  HOH B O   1 
HETATM 8773 O O   . HOH K 6 .   ? 27.155  1.837   -37.616 1.00 45.76  ? 794  HOH B O   1 
HETATM 8774 O O   . HOH K 6 .   ? 5.028   10.891  -65.508 1.00 53.90  ? 795  HOH B O   1 
HETATM 8775 O O   . HOH K 6 .   ? -9.491  22.675  -52.047 1.00 53.69  ? 796  HOH B O   1 
HETATM 8776 O O   . HOH K 6 .   ? 11.298  11.028  -16.781 1.00 50.36  ? 797  HOH B O   1 
HETATM 8777 O O   . HOH K 6 .   ? 6.184   11.783  -19.765 1.00 45.15  ? 798  HOH B O   1 
HETATM 8778 O O   . HOH K 6 .   ? 33.225  -16.112 -56.129 1.00 67.44  ? 799  HOH B O   1 
HETATM 8779 O O   . HOH K 6 .   ? 30.665  -3.977  -35.869 1.00 41.79  ? 800  HOH B O   1 
HETATM 8780 O O   . HOH K 6 .   ? 21.681  -11.590 -35.206 1.00 60.19  ? 801  HOH B O   1 
HETATM 8781 O O   . HOH K 6 .   ? -15.361 0.285   -53.430 1.00 53.73  ? 802  HOH B O   1 
HETATM 8782 O O   . HOH K 6 .   ? 22.083  19.353  -26.034 1.00 63.41  ? 803  HOH B O   1 
HETATM 8783 O O   . HOH K 6 .   ? 22.010  6.234   -30.483 1.00 48.49  ? 804  HOH B O   1 
HETATM 8784 O O   . HOH K 6 .   ? 8.628   3.451   -24.529 1.00 49.97  ? 805  HOH B O   1 
HETATM 8785 O O   . HOH K 6 .   ? 5.168   -4.045  -37.949 0.50 13.80  ? 806  HOH B O   1 
HETATM 8786 O O   . HOH K 6 .   ? 30.597  1.584   -36.483 1.00 52.88  ? 807  HOH B O   1 
HETATM 8787 O O   . HOH K 6 .   ? 0.845   16.919  -68.258 1.00 52.58  ? 808  HOH B O   1 
HETATM 8788 O O   . HOH K 6 .   ? 11.959  4.389   -13.228 1.00 41.16  ? 809  HOH B O   1 
HETATM 8789 O O   . HOH K 6 .   ? 15.995  -17.113 -16.095 1.00 44.46  ? 810  HOH B O   1 
HETATM 8790 O O   . HOH K 6 .   ? 24.021  6.745   -35.141 1.00 55.00  ? 811  HOH B O   1 
HETATM 8791 O O   . HOH K 6 .   ? 1.142   17.342  -65.896 1.00 46.24  ? 812  HOH B O   1 
HETATM 8792 O O   . HOH K 6 .   ? 30.917  11.724  -43.996 1.00 38.01  ? 813  HOH B O   1 
HETATM 8793 O O   . HOH K 6 .   ? 31.607  9.826   -45.674 1.00 52.07  ? 814  HOH B O   1 
HETATM 8794 O O   . HOH K 6 .   ? 16.620  -20.116 -45.297 1.00 56.69  ? 815  HOH B O   1 
HETATM 8795 O O   . HOH K 6 .   ? 30.511  -3.554  -26.560 1.00 64.01  ? 816  HOH B O   1 
HETATM 8796 O O   . HOH K 6 .   ? 14.452  15.888  -10.264 1.00 52.90  ? 817  HOH B O   1 
HETATM 8797 O O   . HOH K 6 .   ? 32.063  13.804  -42.525 1.00 58.30  ? 818  HOH B O   1 
HETATM 8798 O O   . HOH K 6 .   ? 18.754  -7.219  -6.288  1.00 58.12  ? 819  HOH B O   1 
HETATM 8799 O O   . HOH K 6 .   ? 30.976  -3.955  -29.374 1.00 59.96  ? 820  HOH B O   1 
HETATM 8800 O O   . HOH K 6 .   ? 31.232  -3.545  -32.658 1.00 60.76  ? 821  HOH B O   1 
HETATM 8801 O O   . HOH K 6 .   ? 0.318   -13.201 -50.951 1.00 60.19  ? 822  HOH B O   1 
HETATM 8802 O O   . HOH K 6 .   ? 37.741  -1.500  -25.871 1.00 50.70  ? 823  HOH B O   1 
HETATM 8803 O O   . HOH K 6 .   ? 33.026  -2.292  -34.526 1.00 58.30  ? 824  HOH B O   1 
HETATM 8804 O O   . HOH K 6 .   ? 36.697  -4.205  -25.934 1.00 57.19  ? 825  HOH B O   1 
HETATM 8805 O O   . HOH K 6 .   ? 18.426  -19.223 -19.097 1.00 49.22  ? 826  HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.5743 1.3946 1.2280 0.0773  -0.0562 -0.0084 1   GLU A N   
2    C CA  . GLU A 1   ? 1.4716 1.2950 1.1242 0.0792  -0.0429 -0.0063 1   GLU A CA  
3    C C   . GLU A 1   ? 1.3758 1.1916 1.0021 0.0850  -0.0389 -0.0072 1   GLU A C   
4    O O   . GLU A 1   ? 1.3787 1.1867 0.9880 0.0872  -0.0464 -0.0084 1   GLU A O   
5    C CB  . GLU A 1   ? 1.4503 1.2823 1.1163 0.0761  -0.0358 0.0020  1   GLU A CB  
6    C CG  . GLU A 1   ? 1.3920 1.2210 1.0464 0.0770  -0.0368 0.0087  1   GLU A CG  
7    C CD  . GLU A 1   ? 1.0412 0.8762 0.7081 0.0733  -0.0299 0.0168  1   GLU A CD  
8    O OE1 . GLU A 1   ? 0.8839 0.7202 0.5443 0.0734  -0.0197 0.0213  1   GLU A OE1 
9    O OE2 . GLU A 1   ? 1.1028 0.9413 0.7858 0.0703  -0.0347 0.0186  1   GLU A OE2 
10   N N   . GLY A 2   ? 1.2735 1.0926 0.8966 0.0877  -0.0270 -0.0063 2   GLY A N   
11   C CA  . GLY A 2   ? 1.1366 0.9505 0.7352 0.0937  -0.0211 -0.0064 2   GLY A CA  
12   C C   . GLY A 2   ? 1.1682 0.9851 0.7667 0.0977  -0.0117 -0.0103 2   GLY A C   
13   O O   . GLY A 2   ? 1.0361 0.8584 0.6279 0.1007  -0.0002 -0.0066 2   GLY A O   
14   N N   . ARG A 3   ? 1.3170 1.1307 0.9236 0.0977  -0.0167 -0.0173 3   ARG A N   
15   C CA  . ARG A 3   ? 1.2353 1.0494 0.8415 0.1026  -0.0099 -0.0223 3   ARG A CA  
16   C C   . ARG A 3   ? 1.1281 0.9547 0.7610 0.0985  -0.0047 -0.0196 3   ARG A C   
17   O O   . ARG A 3   ? 1.1203 0.9523 0.7565 0.1024  0.0039  -0.0207 3   ARG A O   
18   C CB  . ARG A 3   ? 1.2793 1.0787 0.8741 0.1053  -0.0195 -0.0320 3   ARG A CB  
19   C CG  . ARG A 3   ? 1.3836 1.1697 0.9493 0.1098  -0.0248 -0.0355 3   ARG A CG  
20   C CD  . ARG A 3   ? 1.5196 1.2981 1.0645 0.1192  -0.0177 -0.0413 3   ARG A CD  
21   N NE  . ARG A 3   ? 1.5342 1.3102 1.0545 0.1250  -0.0122 -0.0393 3   ARG A NE  
22   C CZ  . ARG A 3   ? 1.3938 1.1812 0.9130 0.1283  0.0015  -0.0332 3   ARG A CZ  
23   N NH1 . ARG A 3   ? 1.3964 1.1989 0.9383 0.1261  0.0103  -0.0288 3   ARG A NH1 
24   N NH2 . ARG A 3   ? 1.1676 0.9519 0.6630 0.1334  0.0061  -0.0315 3   ARG A NH2 
25   N N   . GLU A 4   ? 1.1023 0.9337 0.7536 0.0912  -0.0100 -0.0158 4   GLU A N   
26   C CA  . GLU A 4   ? 1.0072 0.8504 0.6838 0.0862  -0.0060 -0.0123 4   GLU A CA  
27   C C   . GLU A 4   ? 0.8844 0.7397 0.5656 0.0873  0.0073  -0.0069 4   GLU A C   
28   O O   . GLU A 4   ? 0.9557 0.8113 0.6210 0.0918  0.0142  -0.0053 4   GLU A O   
29   C CB  . GLU A 4   ? 1.1604 1.0069 0.8499 0.0794  -0.0115 -0.0071 4   GLU A CB  
30   C CG  . GLU A 4   ? 1.2642 1.1138 0.9750 0.0743  -0.0175 -0.0087 4   GLU A CG  
31   C CD  . GLU A 4   ? 1.4039 1.2456 1.1118 0.0726  -0.0305 -0.0124 4   GLU A CD  
32   O OE1 . GLU A 4   ? 1.4095 1.2503 1.1134 0.0713  -0.0351 -0.0089 4   GLU A OE1 
33   O OE2 . GLU A 4   ? 1.4384 1.2747 1.1476 0.0726  -0.0362 -0.0187 4   GLU A OE2 
34   N N   . ASP A 5   ? 0.7303 0.5962 0.4333 0.0828  0.0108  -0.0040 5   ASP A N   
35   C CA  . ASP A 5   ? 0.7194 0.5989 0.4307 0.0816  0.0222  0.0021  5   ASP A CA  
36   C C   . ASP A 5   ? 0.8571 0.7397 0.5740 0.0747  0.0223  0.0098  5   ASP A C   
37   O O   . ASP A 5   ? 0.8776 0.7600 0.6084 0.0694  0.0165  0.0108  5   ASP A O   
38   C CB  . ASP A 5   ? 0.7124 0.6011 0.4439 0.0803  0.0250  0.0009  5   ASP A CB  
39   C CG  . ASP A 5   ? 0.8190 0.7235 0.5629 0.0768  0.0352  0.0079  5   ASP A CG  
40   O OD1 . ASP A 5   ? 0.8857 0.7932 0.6240 0.0739  0.0396  0.0141  5   ASP A OD1 
41   O OD2 . ASP A 5   ? 0.8322 0.7459 0.5912 0.0764  0.0385  0.0075  5   ASP A OD2 
42   N N   . PRO A 6   ? 0.9149 0.7999 0.6202 0.0749  0.0292  0.0154  6   PRO A N   
43   C CA  . PRO A 6   ? 0.9195 0.8039 0.6260 0.0688  0.0290  0.0229  6   PRO A CA  
44   C C   . PRO A 6   ? 0.8537 0.7469 0.5820 0.0614  0.0312  0.0273  6   PRO A C   
45   O O   . PRO A 6   ? 0.7810 0.6705 0.5123 0.0566  0.0282  0.0317  6   PRO A O   
46   C CB  . PRO A 6   ? 0.9219 0.8091 0.6126 0.0705  0.0383  0.0281  6   PRO A CB  
47   C CG  . PRO A 6   ? 0.9418 0.8372 0.6313 0.0763  0.0457  0.0244  6   PRO A CG  
48   C CD  . PRO A 6   ? 0.9265 0.8132 0.6147 0.0812  0.0372  0.0152  6   PRO A CD  
49   N N   . GLN A 7   ? 0.8649 0.7688 0.6074 0.0610  0.0360  0.0259  7   GLN A N   
50   C CA  . GLN A 7   ? 0.8645 0.7767 0.6260 0.0537  0.0383  0.0302  7   GLN A CA  
51   C C   . GLN A 7   ? 0.8258 0.7351 0.6024 0.0513  0.0300  0.0265  7   GLN A C   
52   O O   . GLN A 7   ? 0.8068 0.7219 0.5990 0.0457  0.0309  0.0291  7   GLN A O   
53   C CB  . GLN A 7   ? 0.9961 0.9236 0.7662 0.0536  0.0481  0.0319  7   GLN A CB  
54   C CG  . GLN A 7   ? 1.1474 1.0842 0.9377 0.0460  0.0498  0.0355  7   GLN A CG  
55   C CD  . GLN A 7   ? 1.1538 1.0922 0.9437 0.0381  0.0538  0.0437  7   GLN A CD  
56   O OE1 . GLN A 7   ? 1.1349 1.0734 0.9365 0.0314  0.0517  0.0462  7   GLN A OE1 
57   N NE2 . GLN A 7   ? 1.2336 1.1726 1.0091 0.0388  0.0598  0.0480  7   GLN A NE2 
58   N N   . LEU A 8   ? 0.8290 0.7293 0.6004 0.0552  0.0217  0.0206  8   LEU A N   
59   C CA  . LEU A 8   ? 0.7290 0.6278 0.5146 0.0531  0.0141  0.0172  8   LEU A CA  
60   C C   . LEU A 8   ? 0.7854 0.6760 0.5689 0.0515  0.0053  0.0178  8   LEU A C   
61   O O   . LEU A 8   ? 0.9362 0.8262 0.7309 0.0497  -0.0012 0.0153  8   LEU A O   
62   C CB  . LEU A 8   ? 0.6122 0.5090 0.3980 0.0576  0.0111  0.0099  8   LEU A CB  
63   C CG  . LEU A 8   ? 0.6121 0.5186 0.4049 0.0595  0.0190  0.0093  8   LEU A CG  
64   C CD1 . LEU A 8   ? 0.5992 0.5004 0.3864 0.0657  0.0166  0.0022  8   LEU A CD1 
65   C CD2 . LEU A 8   ? 0.5470 0.4627 0.3605 0.0538  0.0205  0.0121  8   LEU A CD2 
66   N N   . LEU A 9   ? 0.6400 0.5247 0.4092 0.0523  0.0052  0.0214  9   LEU A N   
67   C CA  . LEU A 9   ? 0.6547 0.5324 0.4215 0.0521  -0.0034 0.0220  9   LEU A CA  
68   C C   . LEU A 9   ? 0.6456 0.5230 0.4171 0.0478  -0.0014 0.0288  9   LEU A C   
69   O O   . LEU A 9   ? 0.6738 0.5506 0.4375 0.0464  0.0052  0.0340  9   LEU A O   
70   C CB  . LEU A 9   ? 0.6175 0.4867 0.3636 0.0569  -0.0074 0.0207  9   LEU A CB  
71   C CG  . LEU A 9   ? 0.7152 0.5819 0.4522 0.0615  -0.0088 0.0138  9   LEU A CG  
72   C CD1 . LEU A 9   ? 0.6439 0.5018 0.3576 0.0662  -0.0113 0.0130  9   LEU A CD1 
73   C CD2 . LEU A 9   ? 0.7861 0.6523 0.5340 0.0609  -0.0170 0.0076  9   LEU A CD2 
74   N N   . VAL A 10  ? 0.5386 0.4163 0.3227 0.0457  -0.0068 0.0287  10  VAL A N   
75   C CA  . VAL A 10  ? 0.4443 0.3197 0.2325 0.0423  -0.0055 0.0344  10  VAL A CA  
76   C C   . VAL A 10  ? 0.7450 0.6156 0.5343 0.0445  -0.0144 0.0345  10  VAL A C   
77   O O   . VAL A 10  ? 0.7468 0.6199 0.5418 0.0465  -0.0214 0.0299  10  VAL A O   
78   C CB  . VAL A 10  ? 0.6788 0.5616 0.4839 0.0372  -0.0006 0.0351  10  VAL A CB  
79   C CG1 . VAL A 10  ? 0.7114 0.5899 0.5201 0.0339  -0.0004 0.0400  10  VAL A CG1 
80   C CG2 . VAL A 10  ? 0.6004 0.4896 0.4042 0.0351  0.0084  0.0365  10  VAL A CG2 
81   N N   . ARG A 11  ? 0.6017 0.4653 0.3848 0.0444  -0.0143 0.0400  11  ARG A N   
82   C CA  . ARG A 11  ? 0.6076 0.4681 0.3934 0.0473  -0.0220 0.0405  11  ARG A CA  
83   C C   . ARG A 11  ? 0.6866 0.5483 0.4859 0.0443  -0.0203 0.0423  11  ARG A C   
84   O O   . ARG A 11  ? 0.7754 0.6345 0.5744 0.0402  -0.0136 0.0458  11  ARG A O   
85   C CB  . ARG A 11  ? 0.5120 0.3623 0.2804 0.0511  -0.0246 0.0451  11  ARG A CB  
86   C CG  . ARG A 11  ? 0.5045 0.3519 0.2759 0.0549  -0.0317 0.0467  11  ARG A CG  
87   C CD  . ARG A 11  ? 0.6318 0.4699 0.3849 0.0599  -0.0359 0.0504  11  ARG A CD  
88   N NE  . ARG A 11  ? 0.7434 0.5839 0.4880 0.0626  -0.0408 0.0466  11  ARG A NE  
89   C CZ  . ARG A 11  ? 0.7816 0.6253 0.5271 0.0667  -0.0504 0.0441  11  ARG A CZ  
90   N NH1 . ARG A 11  ? 0.7911 0.6354 0.5271 0.0683  -0.0547 0.0404  11  ARG A NH1 
91   N NH2 . ARG A 11  ? 0.7891 0.6356 0.5447 0.0693  -0.0558 0.0454  11  ARG A NH2 
92   N N   . VAL A 12  ? 0.6905 0.5566 0.5016 0.0461  -0.0263 0.0400  12  VAL A N   
93   C CA  . VAL A 12  ? 0.7051 0.5709 0.5267 0.0450  -0.0256 0.0417  12  VAL A CA  
94   C C   . VAL A 12  ? 0.7368 0.6002 0.5572 0.0508  -0.0328 0.0431  12  VAL A C   
95   O O   . VAL A 12  ? 0.8072 0.6710 0.6209 0.0548  -0.0387 0.0422  12  VAL A O   
96   C CB  . VAL A 12  ? 0.5683 0.4443 0.4080 0.0416  -0.0247 0.0378  12  VAL A CB  
97   C CG1 . VAL A 12  ? 0.4944 0.3724 0.3361 0.0362  -0.0169 0.0379  12  VAL A CG1 
98   C CG2 . VAL A 12  ? 0.5645 0.4487 0.4106 0.0432  -0.0306 0.0328  12  VAL A CG2 
99   N N   . ARG A 13  ? 0.6680 0.5288 0.4943 0.0516  -0.0322 0.0451  13  ARG A N   
100  C CA  . ARG A 13  ? 0.6145 0.4722 0.4389 0.0581  -0.0378 0.0473  13  ARG A CA  
101  C C   . ARG A 13  ? 0.6224 0.4918 0.4551 0.0619  -0.0460 0.0440  13  ARG A C   
102  O O   . ARG A 13  ? 0.5451 0.4137 0.3730 0.0680  -0.0521 0.0458  13  ARG A O   
103  C CB  . ARG A 13  ? 0.5953 0.4497 0.4269 0.0581  -0.0350 0.0487  13  ARG A CB  
104  C CG  . ARG A 13  ? 0.6994 0.5533 0.5332 0.0656  -0.0399 0.0502  13  ARG A CG  
105  C CD  . ARG A 13  ? 0.6750 0.5157 0.4917 0.0714  -0.0423 0.0550  13  ARG A CD  
106  N NE  . ARG A 13  ? 0.7608 0.6093 0.5779 0.0777  -0.0503 0.0545  13  ARG A NE  
107  C CZ  . ARG A 13  ? 0.8438 0.6928 0.6617 0.0859  -0.0554 0.0565  13  ARG A CZ  
108  N NH1 . ARG A 13  ? 0.8460 0.6863 0.6630 0.0894  -0.0527 0.0589  13  ARG A NH1 
109  N NH2 . ARG A 13  ? 0.8926 0.7507 0.7115 0.0909  -0.0631 0.0562  13  ARG A NH2 
110  N N   . GLY A 14  ? 0.6166 0.4968 0.4612 0.0580  -0.0465 0.0394  14  GLY A N   
111  C CA  . GLY A 14  ? 0.5255 0.4166 0.3781 0.0595  -0.0542 0.0362  14  GLY A CA  
112  C C   . GLY A 14  ? 0.7147 0.6039 0.5552 0.0602  -0.0586 0.0346  14  GLY A C   
113  O O   . GLY A 14  ? 0.8050 0.7003 0.6471 0.0626  -0.0667 0.0332  14  GLY A O   
114  N N   . GLY A 15  ? 0.7300 0.6111 0.5579 0.0581  -0.0533 0.0348  15  GLY A N   
115  C CA  . GLY A 15  ? 0.7892 0.6675 0.6039 0.0588  -0.0563 0.0328  15  GLY A CA  
116  C C   . GLY A 15  ? 0.7743 0.6501 0.5838 0.0551  -0.0496 0.0304  15  GLY A C   
117  O O   . GLY A 15  ? 0.8280 0.7022 0.6398 0.0521  -0.0417 0.0322  15  GLY A O   
118  N N   . GLN A 16  ? 0.6873 0.5630 0.4894 0.0554  -0.0530 0.0264  16  GLN A N   
119  C CA  . GLN A 16  ? 0.7557 0.6286 0.5502 0.0537  -0.0467 0.0242  16  GLN A CA  
120  C C   . GLN A 16  ? 0.7544 0.6333 0.5615 0.0502  -0.0448 0.0194  16  GLN A C   
121  O O   . GLN A 16  ? 0.7955 0.6790 0.6116 0.0492  -0.0513 0.0156  16  GLN A O   
122  C CB  . GLN A 16  ? 0.6628 0.5295 0.4382 0.0570  -0.0502 0.0225  16  GLN A CB  
123  C CG  . GLN A 16  ? 0.6491 0.5079 0.4077 0.0591  -0.0451 0.0277  16  GLN A CG  
124  C CD  . GLN A 16  ? 0.7303 0.5828 0.4696 0.0632  -0.0504 0.0270  16  GLN A CD  
125  O OE1 . GLN A 16  ? 0.6496 0.4966 0.3729 0.0645  -0.0452 0.0279  16  GLN A OE1 
126  N NE2 . GLN A 16  ? 0.8623 0.7163 0.6028 0.0653  -0.0609 0.0255  16  GLN A NE2 
127  N N   . LEU A 17  ? 0.6131 0.4923 0.4205 0.0483  -0.0361 0.0198  17  LEU A N   
128  C CA  . LEU A 17  ? 0.5869 0.4711 0.4049 0.0459  -0.0339 0.0156  17  LEU A CA  
129  C C   . LEU A 17  ? 0.6202 0.5017 0.4272 0.0475  -0.0290 0.0130  17  LEU A C   
130  O O   . LEU A 17  ? 0.7494 0.6286 0.5455 0.0487  -0.0228 0.0161  17  LEU A O   
131  C CB  . LEU A 17  ? 0.6609 0.5506 0.4935 0.0422  -0.0279 0.0182  17  LEU A CB  
132  C CG  . LEU A 17  ? 0.6267 0.5188 0.4702 0.0409  -0.0305 0.0211  17  LEU A CG  
133  C CD1 . LEU A 17  ? 0.7220 0.6172 0.5749 0.0373  -0.0233 0.0236  17  LEU A CD1 
134  C CD2 . LEU A 17  ? 0.6055 0.5028 0.4604 0.0405  -0.0382 0.0177  17  LEU A CD2 
135  N N   . ARG A 18  ? 0.6194 0.5011 0.4288 0.0478  -0.0317 0.0074  18  ARG A N   
136  C CA  . ARG A 18  ? 0.6488 0.5288 0.4501 0.0501  -0.0262 0.0046  18  ARG A CA  
137  C C   . ARG A 18  ? 0.7134 0.5997 0.5301 0.0478  -0.0220 0.0034  18  ARG A C   
138  O O   . ARG A 18  ? 0.7399 0.6267 0.5661 0.0460  -0.0271 0.0001  18  ARG A O   
139  C CB  . ARG A 18  ? 0.6155 0.4875 0.4033 0.0534  -0.0324 -0.0013 18  ARG A CB  
140  C CG  . ARG A 18  ? 0.6958 0.5649 0.4746 0.0572  -0.0268 -0.0051 18  ARG A CG  
141  C CD  . ARG A 18  ? 0.7346 0.5930 0.4964 0.0608  -0.0333 -0.0110 18  ARG A CD  
142  N NE  . ARG A 18  ? 0.9733 0.8290 0.7412 0.0573  -0.0443 -0.0139 18  ARG A NE  
143  C CZ  . ARG A 18  ? 1.0579 0.9104 0.8187 0.0568  -0.0527 -0.0139 18  ARG A CZ  
144  N NH1 . ARG A 18  ? 0.9592 0.8087 0.7047 0.0601  -0.0514 -0.0113 18  ARG A NH1 
145  N NH2 . ARG A 18  ? 1.1372 0.9899 0.9059 0.0530  -0.0625 -0.0162 18  ARG A NH2 
146  N N   . GLY A 19  ? 0.5890 0.4806 0.4082 0.0474  -0.0129 0.0066  19  GLY A N   
147  C CA  . GLY A 19  ? 0.6113 0.5097 0.4437 0.0458  -0.0086 0.0057  19  GLY A CA  
148  C C   . GLY A 19  ? 0.6881 0.5854 0.5140 0.0504  -0.0053 0.0016  19  GLY A C   
149  O O   . GLY A 19  ? 0.6899 0.5797 0.5004 0.0548  -0.0073 -0.0019 19  GLY A O   
150  N N   . ILE A 20  ? 0.5925 0.4971 0.4296 0.0498  -0.0003 0.0018  20  ILE A N   
151  C CA  . ILE A 20  ? 0.6279 0.5316 0.4608 0.0550  0.0026  -0.0022 20  ILE A CA  
152  C C   . ILE A 20  ? 0.6295 0.5449 0.4680 0.0562  0.0125  0.0010  20  ILE A C   
153  O O   . ILE A 20  ? 0.5870 0.5116 0.4390 0.0513  0.0154  0.0053  20  ILE A O   
154  C CB  . ILE A 20  ? 0.7002 0.5999 0.5415 0.0542  -0.0034 -0.0065 20  ILE A CB  
155  C CG1 . ILE A 20  ? 0.7041 0.6011 0.5404 0.0603  -0.0005 -0.0107 20  ILE A CG1 
156  C CG2 . ILE A 20  ? 0.6413 0.5494 0.5017 0.0484  -0.0031 -0.0033 20  ILE A CG2 
157  C CD1 . ILE A 20  ? 0.6431 0.5304 0.4807 0.0600  -0.0079 -0.0158 20  ILE A CD1 
158  N N   . ARG A 21  ? 0.5378 0.4533 0.3656 0.0629  0.0174  -0.0011 21  ARG A N   
159  C CA  . ARG A 21  ? 0.5517 0.4803 0.3843 0.0649  0.0270  0.0021  21  ARG A CA  
160  C C   . ARG A 21  ? 0.5512 0.4841 0.3949 0.0674  0.0277  -0.0003 21  ARG A C   
161  O O   . ARG A 21  ? 0.7970 0.7248 0.6328 0.0748  0.0281  -0.0049 21  ARG A O   
162  C CB  . ARG A 21  ? 0.6766 0.6048 0.4920 0.0719  0.0328  0.0013  21  ARG A CB  
163  C CG  . ARG A 21  ? 0.7193 0.6636 0.5391 0.0744  0.0435  0.0053  21  ARG A CG  
164  C CD  . ARG A 21  ? 0.8146 0.7579 0.6172 0.0839  0.0491  0.0028  21  ARG A CD  
165  N NE  . ARG A 21  ? 1.0806 1.0340 0.8896 0.0905  0.0550  0.0015  21  ARG A NE  
166  C CZ  . ARG A 21  ? 1.1229 1.0914 0.9315 0.0949  0.0650  0.0047  21  ARG A CZ  
167  N NH1 . ARG A 21  ? 1.0815 1.0561 0.8825 0.0928  0.0708  0.0097  21  ARG A NH1 
168  N NH2 . ARG A 21  ? 1.0326 1.0104 0.8482 0.1017  0.0693  0.0033  21  ARG A NH2 
169  N N   . LEU A 22  ? 0.4960 0.4373 0.3568 0.0616  0.0277  0.0028  22  LEU A N   
170  C CA  . LEU A 22  ? 0.6025 0.5483 0.4744 0.0637  0.0281  0.0013  22  LEU A CA  
171  C C   . LEU A 22  ? 0.5961 0.5571 0.4729 0.0676  0.0369  0.0039  22  LEU A C   
172  O O   . LEU A 22  ? 0.6380 0.6106 0.5172 0.0646  0.0428  0.0091  22  LEU A O   
173  C CB  . LEU A 22  ? 0.6043 0.5530 0.4921 0.0560  0.0242  0.0035  22  LEU A CB  
174  C CG  . LEU A 22  ? 0.5506 0.4874 0.4380 0.0522  0.0154  0.0010  22  LEU A CG  
175  C CD1 . LEU A 22  ? 0.4611 0.4032 0.3645 0.0459  0.0135  0.0035  22  LEU A CD1 
176  C CD2 . LEU A 22  ? 0.4584 0.3825 0.3373 0.0573  0.0104  -0.0052 22  LEU A CD2 
177  N N   . LYS A 23  ? 0.6262 0.5874 0.5053 0.0741  0.0374  0.0008  23  LYS A N   
178  C CA  . LYS A 23  ? 0.5032 0.4807 0.3893 0.0788  0.0451  0.0033  23  LYS A CA  
179  C C   . LYS A 23  ? 0.5982 0.5876 0.5033 0.0732  0.0450  0.0070  23  LYS A C   
180  O O   . LYS A 23  ? 0.6225 0.6050 0.5337 0.0720  0.0393  0.0049  23  LYS A O   
181  C CB  . LYS A 23  ? 0.6497 0.6210 0.5267 0.0905  0.0463  -0.0019 23  LYS A CB  
182  C CG  . LYS A 23  ? 1.0719 1.0603 0.9496 0.0978  0.0560  0.0006  23  LYS A CG  
183  C CD  . LYS A 23  ? 1.3450 1.3242 1.2034 0.1093  0.0588  -0.0044 23  LYS A CD  
184  C CE  . LYS A 23  ? 1.4748 1.4401 1.3282 0.1180  0.0548  -0.0106 23  LYS A CE  
185  N NZ  . LYS A 23  ? 1.4992 1.4766 1.3702 0.1187  0.0558  -0.0080 23  LYS A NZ  
186  N N   . ALA A 24  ? 0.6218 0.6289 0.5359 0.0691  0.0510  0.0128  24  ALA A N   
187  C CA  . ALA A 24  ? 0.5899 0.6110 0.5212 0.0652  0.0518  0.0163  24  ALA A CA  
188  C C   . ALA A 24  ? 0.6953 0.7337 0.6306 0.0728  0.0591  0.0180  24  ALA A C   
189  O O   . ALA A 24  ? 0.6848 0.7268 0.6105 0.0790  0.0648  0.0178  24  ALA A O   
190  C CB  . ALA A 24  ? 0.4189 0.4473 0.3582 0.0537  0.0521  0.0218  24  ALA A CB  
191  N N   . PRO A 25  ? 0.7503 0.8000 0.6995 0.0729  0.0590  0.0198  25  PRO A N   
192  C CA  . PRO A 25  ? 0.5964 0.6644 0.5517 0.0810  0.0654  0.0216  25  PRO A CA  
193  C C   . PRO A 25  ? 0.6784 0.7634 0.6325 0.0808  0.0738  0.0260  25  PRO A C   
194  O O   . PRO A 25  ? 0.7504 0.8435 0.7001 0.0913  0.0798  0.0252  25  PRO A O   
195  C CB  . PRO A 25  ? 0.6275 0.7077 0.6001 0.0754  0.0632  0.0251  25  PRO A CB  
196  C CG  . PRO A 25  ? 0.7168 0.7779 0.6887 0.0703  0.0547  0.0220  25  PRO A CG  
197  C CD  . PRO A 25  ? 0.7639 0.8091 0.7233 0.0663  0.0526  0.0199  25  PRO A CD  
198  N N   . GLY A 26  ? 0.6657 0.7553 0.6227 0.0694  0.0745  0.0305  26  GLY A N   
199  C CA  . GLY A 26  ? 0.5952 0.7019 0.5523 0.0671  0.0826  0.0359  26  GLY A CA  
200  C C   . GLY A 26  ? 0.7375 0.8331 0.6777 0.0671  0.0848  0.0353  26  GLY A C   
201  O O   . GLY A 26  ? 0.6844 0.7931 0.6233 0.0646  0.0916  0.0401  26  GLY A O   
202  N N   . GLY A 27  ? 0.8148 0.8871 0.7421 0.0696  0.0789  0.0297  27  GLY A N   
203  C CA  . GLY A 27  ? 0.7430 0.8032 0.6534 0.0695  0.0796  0.0289  27  GLY A CA  
204  C C   . GLY A 27  ? 0.7369 0.7740 0.6395 0.0660  0.0707  0.0249  27  GLY A C   
205  O O   . GLY A 27  ? 0.6948 0.7250 0.6052 0.0633  0.0642  0.0227  27  GLY A O   
206  N N   . PRO A 28  ? 0.6717 0.6974 0.5588 0.0659  0.0704  0.0243  28  PRO A N   
207  C CA  . PRO A 28  ? 0.7116 0.7166 0.5905 0.0637  0.0618  0.0204  28  PRO A CA  
208  C C   . PRO A 28  ? 0.6647 0.6671 0.5507 0.0525  0.0580  0.0242  28  PRO A C   
209  O O   . PRO A 28  ? 0.6877 0.7000 0.5778 0.0459  0.0624  0.0302  28  PRO A O   
210  C CB  . PRO A 28  ? 0.6585 0.6551 0.5178 0.0683  0.0638  0.0192  28  PRO A CB  
211  C CG  . PRO A 28  ? 0.5939 0.6079 0.4520 0.0715  0.0743  0.0234  28  PRO A CG  
212  C CD  . PRO A 28  ? 0.5293 0.5624 0.4067 0.0667  0.0780  0.0281  28  PRO A CD  
213  N N   . VAL A 29  ? 0.6372 0.6262 0.5242 0.0504  0.0497  0.0209  29  VAL A N   
214  C CA  . VAL A 29  ? 0.7074 0.6908 0.5972 0.0416  0.0457  0.0238  29  VAL A CA  
215  C C   . VAL A 29  ? 0.6026 0.5694 0.4801 0.0430  0.0393  0.0206  29  VAL A C   
216  O O   . VAL A 29  ? 0.5458 0.5043 0.4154 0.0493  0.0361  0.0154  29  VAL A O   
217  C CB  . VAL A 29  ? 0.6318 0.6174 0.5371 0.0365  0.0418  0.0239  29  VAL A CB  
218  C CG1 . VAL A 29  ? 0.5281 0.5308 0.4457 0.0337  0.0474  0.0278  29  VAL A CG1 
219  C CG2 . VAL A 29  ? 0.7067 0.6845 0.6136 0.0412  0.0361  0.0181  29  VAL A CG2 
220  N N   . SER A 30  ? 0.6003 0.5619 0.4756 0.0371  0.0373  0.0239  30  SER A N   
221  C CA  . SER A 30  ? 0.6236 0.5712 0.4898 0.0379  0.0303  0.0215  30  SER A CA  
222  C C   . SER A 30  ? 0.5607 0.5048 0.4385 0.0349  0.0235  0.0194  30  SER A C   
223  O O   . SER A 30  ? 0.5795 0.5282 0.4683 0.0294  0.0241  0.0223  30  SER A O   
224  C CB  . SER A 30  ? 0.7047 0.6481 0.5626 0.0340  0.0313  0.0265  30  SER A CB  
225  O OG  . SER A 30  ? 0.7850 0.7296 0.6296 0.0368  0.0368  0.0285  30  SER A OG  
226  N N   . ALA A 31  ? 0.4710 0.4070 0.3462 0.0382  0.0170  0.0144  31  ALA A N   
227  C CA  . ALA A 31  ? 0.5239 0.4571 0.4094 0.0348  0.0107  0.0131  31  ALA A CA  
228  C C   . ALA A 31  ? 0.5645 0.4882 0.4427 0.0352  0.0037  0.0118  31  ALA A C   
229  O O   . ALA A 31  ? 0.6116 0.5287 0.4775 0.0393  0.0012  0.0089  31  ALA A O   
230  C CB  . ALA A 31  ? 0.4692 0.4034 0.3624 0.0366  0.0086  0.0092  31  ALA A CB  
231  N N   . PHE A 32  ? 0.6060 0.5292 0.4913 0.0313  0.0005  0.0139  32  PHE A N   
232  C CA  . PHE A 32  ? 0.5909 0.5077 0.4725 0.0318  -0.0067 0.0130  32  PHE A CA  
233  C C   . PHE A 32  ? 0.6196 0.5388 0.5147 0.0292  -0.0114 0.0116  32  PHE A C   
234  O O   . PHE A 32  ? 0.6316 0.5541 0.5356 0.0260  -0.0104 0.0143  32  PHE A O   
235  C CB  . PHE A 32  ? 0.5066 0.4205 0.3822 0.0307  -0.0057 0.0175  32  PHE A CB  
236  C CG  . PHE A 32  ? 0.5155 0.4270 0.3771 0.0327  -0.0009 0.0195  32  PHE A CG  
237  C CD1 . PHE A 32  ? 0.5994 0.5166 0.4620 0.0307  0.0070  0.0226  32  PHE A CD1 
238  C CD2 . PHE A 32  ? 0.4776 0.3824 0.3250 0.0365  -0.0043 0.0185  32  PHE A CD2 
239  C CE1 . PHE A 32  ? 0.5053 0.4220 0.3555 0.0322  0.0121  0.0249  32  PHE A CE1 
240  C CE2 . PHE A 32  ? 0.5530 0.4559 0.3868 0.0385  0.0006  0.0204  32  PHE A CE2 
241  C CZ  . PHE A 32  ? 0.5293 0.4385 0.3647 0.0363  0.0092  0.0238  32  PHE A CZ  
242  N N   . LEU A 33  ? 0.6125 0.5294 0.5084 0.0303  -0.0163 0.0073  33  LEU A N   
243  C CA  . LEU A 33  ? 0.5566 0.4766 0.4656 0.0274  -0.0198 0.0062  33  LEU A CA  
244  C C   . LEU A 33  ? 0.4911 0.4095 0.4017 0.0265  -0.0278 0.0051  33  LEU A C   
245  O O   . LEU A 33  ? 0.4417 0.3548 0.3422 0.0286  -0.0324 0.0031  33  LEU A O   
246  C CB  . LEU A 33  ? 0.4920 0.4110 0.4025 0.0284  -0.0194 0.0027  33  LEU A CB  
247  C CG  . LEU A 33  ? 0.5008 0.4232 0.4101 0.0303  -0.0118 0.0036  33  LEU A CG  
248  C CD1 . LEU A 33  ? 0.5158 0.4350 0.4244 0.0329  -0.0126 -0.0003 33  LEU A CD1 
249  C CD2 . LEU A 33  ? 0.4886 0.4192 0.4094 0.0266  -0.0074 0.0075  33  LEU A CD2 
250  N N   . GLY A 34  ? 0.3722 0.2959 0.2955 0.0235  -0.0296 0.0064  34  GLY A N   
251  C CA  . GLY A 34  ? 0.4439 0.3695 0.3712 0.0225  -0.0365 0.0064  34  GLY A CA  
252  C C   . GLY A 34  ? 0.4704 0.3950 0.3913 0.0251  -0.0386 0.0087  34  GLY A C   
253  O O   . GLY A 34  ? 0.5026 0.4266 0.4204 0.0259  -0.0451 0.0076  34  GLY A O   
254  N N   . ILE A 35  ? 0.5056 0.4296 0.4242 0.0261  -0.0335 0.0121  35  ILE A N   
255  C CA  . ILE A 35  ? 0.5313 0.4534 0.4444 0.0289  -0.0355 0.0149  35  ILE A CA  
256  C C   . ILE A 35  ? 0.5546 0.4829 0.4791 0.0288  -0.0381 0.0167  35  ILE A C   
257  O O   . ILE A 35  ? 0.5505 0.4813 0.4827 0.0272  -0.0340 0.0182  35  ILE A O   
258  C CB  . ILE A 35  ? 0.4733 0.3908 0.3791 0.0295  -0.0291 0.0183  35  ILE A CB  
259  C CG1 . ILE A 35  ? 0.4819 0.3959 0.3781 0.0295  -0.0245 0.0173  35  ILE A CG1 
260  C CG2 . ILE A 35  ? 0.3408 0.2542 0.2391 0.0329  -0.0317 0.0211  35  ILE A CG2 
261  C CD1 . ILE A 35  ? 0.3164 0.2282 0.2082 0.0282  -0.0172 0.0211  35  ILE A CD1 
262  N N   . PRO A 36  ? 0.5750 0.5062 0.5001 0.0308  -0.0449 0.0166  36  PRO A N   
263  C CA  . PRO A 36  ? 0.6258 0.5652 0.5629 0.0314  -0.0472 0.0183  36  PRO A CA  
264  C C   . PRO A 36  ? 0.5912 0.5270 0.5248 0.0349  -0.0437 0.0219  36  PRO A C   
265  O O   . PRO A 36  ? 0.5539 0.4818 0.4748 0.0378  -0.0433 0.0234  36  PRO A O   
266  C CB  . PRO A 36  ? 0.7073 0.6511 0.6440 0.0331  -0.0557 0.0176  36  PRO A CB  
267  C CG  . PRO A 36  ? 0.6312 0.5665 0.5530 0.0338  -0.0578 0.0157  36  PRO A CG  
268  C CD  . PRO A 36  ? 0.5019 0.4289 0.4152 0.0335  -0.0502 0.0158  36  PRO A CD  
269  N N   . PHE A 37  ? 0.6258 0.5661 0.5690 0.0350  -0.0412 0.0232  37  PHE A N   
270  C CA  . PHE A 37  ? 0.5233 0.4576 0.4617 0.0385  -0.0378 0.0263  37  PHE A CA  
271  C C   . PHE A 37  ? 0.5763 0.5180 0.5232 0.0428  -0.0404 0.0278  37  PHE A C   
272  O O   . PHE A 37  ? 0.7594 0.6957 0.7022 0.0471  -0.0383 0.0301  37  PHE A O   
273  C CB  . PHE A 37  ? 0.5745 0.5036 0.5125 0.0348  -0.0307 0.0266  37  PHE A CB  
274  C CG  . PHE A 37  ? 0.5710 0.5080 0.5221 0.0317  -0.0289 0.0254  37  PHE A CG  
275  C CD1 . PHE A 37  ? 0.5022 0.4417 0.4590 0.0342  -0.0278 0.0266  37  PHE A CD1 
276  C CD2 . PHE A 37  ? 0.4593 0.4004 0.4161 0.0270  -0.0280 0.0231  37  PHE A CD2 
277  C CE1 . PHE A 37  ? 0.4629 0.4096 0.4308 0.0314  -0.0257 0.0257  37  PHE A CE1 
278  C CE2 . PHE A 37  ? 0.4553 0.4031 0.4232 0.0241  -0.0264 0.0224  37  PHE A CE2 
279  C CZ  . PHE A 37  ? 0.3828 0.3338 0.3564 0.0261  -0.0252 0.0237  37  PHE A CZ  
280  N N   . ALA A 38  ? 0.5584 0.5124 0.5169 0.0417  -0.0448 0.0265  38  ALA A N   
281  C CA  . ALA A 38  ? 0.5503 0.5148 0.5183 0.0461  -0.0474 0.0281  38  ALA A CA  
282  C C   . ALA A 38  ? 0.6165 0.5925 0.5913 0.0452  -0.0550 0.0273  38  ALA A C   
283  O O   . ALA A 38  ? 0.6847 0.6597 0.6578 0.0403  -0.0577 0.0249  38  ALA A O   
284  C CB  . ALA A 38  ? 0.4989 0.4699 0.4783 0.0442  -0.0431 0.0280  38  ALA A CB  
285  N N   . GLU A 39  ? 0.6128 0.5997 0.5949 0.0501  -0.0586 0.0293  39  GLU A N   
286  C CA  . GLU A 39  ? 0.5820 0.5835 0.5744 0.0478  -0.0658 0.0289  39  GLU A CA  
287  C C   . GLU A 39  ? 0.5638 0.5742 0.5695 0.0406  -0.0642 0.0275  39  GLU A C   
288  O O   . GLU A 39  ? 0.5665 0.5778 0.5774 0.0404  -0.0582 0.0280  39  GLU A O   
289  C CB  . GLU A 39  ? 0.4977 0.5113 0.4966 0.0551  -0.0694 0.0320  39  GLU A CB  
290  C CG  . GLU A 39  ? 0.6080 0.6140 0.5938 0.0618  -0.0731 0.0335  39  GLU A CG  
291  C CD  . GLU A 39  ? 0.6788 0.6845 0.6590 0.0582  -0.0808 0.0318  39  GLU A CD  
292  O OE1 . GLU A 39  ? 0.8021 0.8220 0.7934 0.0541  -0.0870 0.0311  39  GLU A OE1 
293  O OE2 . GLU A 39  ? 0.5903 0.5814 0.5546 0.0592  -0.0806 0.0313  39  GLU A OE2 
294  N N   . PRO A 40  ? 0.4436 0.4591 0.4533 0.0345  -0.0700 0.0257  40  PRO A N   
295  C CA  . PRO A 40  ? 0.3858 0.4093 0.4077 0.0272  -0.0694 0.0249  40  PRO A CA  
296  C C   . PRO A 40  ? 0.4521 0.4912 0.4886 0.0293  -0.0669 0.0278  40  PRO A C   
297  O O   . PRO A 40  ? 0.5518 0.6049 0.5962 0.0324  -0.0713 0.0300  40  PRO A O   
298  C CB  . PRO A 40  ? 0.4240 0.4524 0.4478 0.0219  -0.0782 0.0234  40  PRO A CB  
299  C CG  . PRO A 40  ? 0.3757 0.3923 0.3839 0.0250  -0.0814 0.0219  40  PRO A CG  
300  C CD  . PRO A 40  ? 0.4103 0.4239 0.4128 0.0338  -0.0777 0.0245  40  PRO A CD  
301  N N   . PRO A 41  ? 0.5066 0.5442 0.5467 0.0280  -0.0598 0.0280  41  PRO A N   
302  C CA  . PRO A 41  ? 0.5343 0.5867 0.5869 0.0310  -0.0570 0.0308  41  PRO A CA  
303  C C   . PRO A 41  ? 0.4526 0.5222 0.5205 0.0241  -0.0609 0.0319  41  PRO A C   
304  O O   . PRO A 41  ? 0.4708 0.5461 0.5470 0.0204  -0.0569 0.0327  41  PRO A O   
305  C CB  . PRO A 41  ? 0.3472 0.3908 0.3967 0.0308  -0.0487 0.0302  41  PRO A CB  
306  C CG  . PRO A 41  ? 0.4292 0.4588 0.4702 0.0251  -0.0482 0.0274  41  PRO A CG  
307  C CD  . PRO A 41  ? 0.4373 0.4638 0.4731 0.0229  -0.0552 0.0259  41  PRO A CD  
308  N N   . VAL A 42  ? 0.3878 0.4655 0.4592 0.0220  -0.0689 0.0322  42  VAL A N   
309  C CA  . VAL A 42  ? 0.4902 0.5829 0.5752 0.0137  -0.0736 0.0333  42  VAL A CA  
310  C C   . VAL A 42  ? 0.4758 0.5927 0.5758 0.0168  -0.0768 0.0372  42  VAL A C   
311  O O   . VAL A 42  ? 0.3518 0.4729 0.4505 0.0265  -0.0762 0.0388  42  VAL A O   
312  C CB  . VAL A 42  ? 0.4926 0.5771 0.5715 0.0062  -0.0813 0.0305  42  VAL A CB  
313  C CG1 . VAL A 42  ? 0.4759 0.5375 0.5394 0.0051  -0.0778 0.0267  42  VAL A CG1 
314  C CG2 . VAL A 42  ? 0.2595 0.3474 0.3344 0.0103  -0.0886 0.0306  42  VAL A CG2 
315  N N   . GLY A 43  ? 0.5014 0.6342 0.6155 0.0086  -0.0801 0.0391  43  GLY A N   
316  C CA  . GLY A 43  ? 0.4273 0.5860 0.5575 0.0107  -0.0830 0.0433  43  GLY A CA  
317  C C   . GLY A 43  ? 0.5510 0.7187 0.6853 0.0221  -0.0756 0.0458  43  GLY A C   
318  O O   . GLY A 43  ? 0.6028 0.7668 0.7372 0.0231  -0.0674 0.0459  43  GLY A O   
319  N N   . SER A 44  ? 0.5668 0.7455 0.7036 0.0312  -0.0787 0.0478  44  SER A N   
320  C CA  . SER A 44  ? 0.5584 0.7443 0.6975 0.0438  -0.0723 0.0501  44  SER A CA  
321  C C   . SER A 44  ? 0.5184 0.6799 0.6408 0.0504  -0.0646 0.0474  44  SER A C   
322  O O   . SER A 44  ? 0.5086 0.6719 0.6309 0.0595  -0.0580 0.0486  44  SER A O   
323  C CB  . SER A 44  ? 0.6283 0.8260 0.7697 0.0530  -0.0781 0.0523  44  SER A CB  
324  O OG  . SER A 44  ? 0.7427 0.9190 0.8663 0.0568  -0.0811 0.0496  44  SER A OG  
325  N N   . ARG A 45  ? 0.5112 0.6502 0.6193 0.0456  -0.0654 0.0438  45  ARG A N   
326  C CA  . ARG A 45  ? 0.5375 0.6543 0.6304 0.0501  -0.0587 0.0416  45  ARG A CA  
327  C C   . ARG A 45  ? 0.5215 0.6321 0.6149 0.0439  -0.0519 0.0403  45  ARG A C   
328  O O   . ARG A 45  ? 0.4700 0.5644 0.5526 0.0468  -0.0460 0.0387  45  ARG A O   
329  C CB  . ARG A 45  ? 0.6160 0.7127 0.6927 0.0494  -0.0622 0.0390  45  ARG A CB  
330  C CG  . ARG A 45  ? 0.7314 0.8311 0.8045 0.0558  -0.0689 0.0402  45  ARG A CG  
331  C CD  . ARG A 45  ? 0.9649 1.0483 1.0230 0.0659  -0.0655 0.0403  45  ARG A CD  
332  N NE  . ARG A 45  ? 1.0987 1.1670 1.1422 0.0654  -0.0700 0.0389  45  ARG A NE  
333  C CZ  . ARG A 45  ? 1.1671 1.2418 1.2102 0.0665  -0.0783 0.0397  45  ARG A CZ  
334  N NH1 . ARG A 45  ? 1.1932 1.2905 1.2512 0.0678  -0.0834 0.0421  45  ARG A NH1 
335  N NH2 . ARG A 45  ? 1.1831 1.2424 1.2110 0.0662  -0.0814 0.0383  45  ARG A NH2 
336  N N   . ARG A 46  ? 0.5457 0.6687 0.6514 0.0349  -0.0530 0.0412  46  ARG A N   
337  C CA  . ARG A 46  ? 0.4997 0.6178 0.6061 0.0294  -0.0468 0.0406  46  ARG A CA  
338  C C   . ARG A 46  ? 0.5151 0.6357 0.6218 0.0374  -0.0387 0.0417  46  ARG A C   
339  O O   . ARG A 46  ? 0.6088 0.7460 0.7242 0.0442  -0.0379 0.0444  46  ARG A O   
340  C CB  . ARG A 46  ? 0.3345 0.4667 0.4544 0.0189  -0.0494 0.0423  46  ARG A CB  
341  C CG  . ARG A 46  ? 0.2778 0.4081 0.3998 0.0142  -0.0429 0.0427  46  ARG A CG  
342  C CD  . ARG A 46  ? 0.2911 0.4364 0.4269 0.0041  -0.0451 0.0454  46  ARG A CD  
343  N NE  . ARG A 46  ? 0.3204 0.4585 0.4543 -0.0056 -0.0524 0.0438  46  ARG A NE  
344  C CZ  . ARG A 46  ? 0.3646 0.5122 0.5085 -0.0158 -0.0559 0.0459  46  ARG A CZ  
345  N NH1 . ARG A 46  ? 0.4256 0.5918 0.5826 -0.0177 -0.0522 0.0501  46  ARG A NH1 
346  N NH2 . ARG A 46  ? 0.3484 0.4868 0.4886 -0.0243 -0.0628 0.0441  46  ARG A NH2 
347  N N   . PHE A 47  ? 0.4302 0.5347 0.5272 0.0367  -0.0329 0.0397  47  PHE A N   
348  C CA  . PHE A 47  ? 0.4021 0.5039 0.4955 0.0438  -0.0253 0.0399  47  PHE A CA  
349  C C   . PHE A 47  ? 0.4834 0.5742 0.5653 0.0548  -0.0240 0.0391  47  PHE A C   
350  O O   . PHE A 47  ? 0.3939 0.4759 0.4683 0.0602  -0.0182 0.0383  47  PHE A O   
351  C CB  . PHE A 47  ? 0.2589 0.3825 0.3663 0.0457  -0.0220 0.0430  47  PHE A CB  
352  C CG  . PHE A 47  ? 0.3571 0.4925 0.4760 0.0350  -0.0229 0.0447  47  PHE A CG  
353  C CD1 . PHE A 47  ? 0.3742 0.4974 0.4882 0.0271  -0.0209 0.0431  47  PHE A CD1 
354  C CD2 . PHE A 47  ? 0.2902 0.4494 0.4253 0.0328  -0.0260 0.0483  47  PHE A CD2 
355  C CE1 . PHE A 47  ? 0.2949 0.4272 0.4185 0.0173  -0.0218 0.0451  47  PHE A CE1 
356  C CE2 . PHE A 47  ? 0.1662 0.3354 0.3116 0.0219  -0.0270 0.0503  47  PHE A CE2 
357  C CZ  . PHE A 47  ? 0.4128 0.5676 0.5518 0.0143  -0.0248 0.0487  47  PHE A CZ  
358  N N   . MET A 48  ? 0.5029 0.5937 0.5827 0.0581  -0.0298 0.0394  48  MET A N   
359  C CA  . MET A 48  ? 0.4261 0.5051 0.4941 0.0683  -0.0295 0.0392  48  MET A CA  
360  C C   . MET A 48  ? 0.5126 0.5667 0.5636 0.0660  -0.0286 0.0366  48  MET A C   
361  O O   . MET A 48  ? 0.4318 0.4794 0.4807 0.0573  -0.0303 0.0350  48  MET A O   
362  C CB  . MET A 48  ? 0.3903 0.4804 0.4629 0.0728  -0.0363 0.0412  48  MET A CB  
363  C CG  . MET A 48  ? 0.5390 0.6562 0.6294 0.0754  -0.0373 0.0443  48  MET A CG  
364  S SD  . MET A 48  ? 0.8401 0.9613 0.9288 0.0916  -0.0321 0.0461  48  MET A SD  
365  C CE  . MET A 48  ? 0.7209 0.8352 0.8007 0.0996  -0.0392 0.0469  48  MET A CE  
366  N N   . PRO A 49  ? 0.5608 0.6004 0.5993 0.0740  -0.0256 0.0363  49  PRO A N   
367  C CA  . PRO A 49  ? 0.4512 0.4676 0.4731 0.0725  -0.0247 0.0347  49  PRO A CA  
368  C C   . PRO A 49  ? 0.4278 0.4413 0.4461 0.0697  -0.0308 0.0347  49  PRO A C   
369  O O   . PRO A 49  ? 0.4944 0.5184 0.5175 0.0740  -0.0358 0.0364  49  PRO A O   
370  C CB  . PRO A 49  ? 0.3824 0.3880 0.3938 0.0833  -0.0223 0.0354  49  PRO A CB  
371  C CG  . PRO A 49  ? 0.4173 0.4385 0.4389 0.0900  -0.0195 0.0365  49  PRO A CG  
372  C CD  . PRO A 49  ? 0.4768 0.5220 0.5163 0.0854  -0.0229 0.0379  49  PRO A CD  
373  N N   . PRO A 50  ? 0.4425 0.4427 0.4525 0.0628  -0.0303 0.0330  50  PRO A N   
374  C CA  . PRO A 50  ? 0.4825 0.4788 0.4873 0.0599  -0.0354 0.0327  50  PRO A CA  
375  C C   . PRO A 50  ? 0.6147 0.6036 0.6094 0.0683  -0.0381 0.0345  50  PRO A C   
376  O O   . PRO A 50  ? 0.6481 0.6237 0.6324 0.0735  -0.0345 0.0352  50  PRO A O   
377  C CB  . PRO A 50  ? 0.5460 0.5270 0.5412 0.0535  -0.0319 0.0309  50  PRO A CB  
378  C CG  . PRO A 50  ? 0.4376 0.4090 0.4273 0.0562  -0.0258 0.0310  50  PRO A CG  
379  C CD  . PRO A 50  ? 0.4311 0.4177 0.4337 0.0586  -0.0247 0.0314  50  PRO A CD  
380  N N   . GLU A 51  ? 0.6168 0.6134 0.6137 0.0693  -0.0446 0.0353  51  GLU A N   
381  C CA  . GLU A 51  ? 0.6760 0.6639 0.6611 0.0758  -0.0480 0.0370  51  GLU A CA  
382  C C   . GLU A 51  ? 0.6860 0.6605 0.6589 0.0703  -0.0490 0.0358  51  GLU A C   
383  O O   . GLU A 51  ? 0.7252 0.7043 0.7021 0.0630  -0.0511 0.0337  51  GLU A O   
384  C CB  . GLU A 51  ? 0.8712 0.8759 0.8651 0.0806  -0.0551 0.0388  51  GLU A CB  
385  C CG  . GLU A 51  ? 1.1799 1.2013 1.1872 0.0869  -0.0541 0.0405  51  GLU A CG  
386  C CD  . GLU A 51  ? 1.4016 1.4408 1.4174 0.0924  -0.0615 0.0429  51  GLU A CD  
387  O OE1 . GLU A 51  ? 1.4591 1.4984 1.4714 0.0895  -0.0680 0.0427  51  GLU A OE1 
388  O OE2 . GLU A 51  ? 1.4558 1.5095 1.4817 0.0997  -0.0607 0.0450  51  GLU A OE2 
389  N N   . PRO A 52  ? 0.7151 0.6724 0.6722 0.0738  -0.0473 0.0371  52  PRO A N   
390  C CA  . PRO A 52  ? 0.7156 0.6601 0.6596 0.0696  -0.0474 0.0367  52  PRO A CA  
391  C C   . PRO A 52  ? 0.6332 0.5849 0.5776 0.0678  -0.0543 0.0358  52  PRO A C   
392  O O   . PRO A 52  ? 0.5818 0.5442 0.5315 0.0725  -0.0602 0.0370  52  PRO A O   
393  C CB  . PRO A 52  ? 0.5876 0.5160 0.5161 0.0762  -0.0462 0.0397  52  PRO A CB  
394  C CG  . PRO A 52  ? 0.6378 0.5653 0.5701 0.0807  -0.0424 0.0403  52  PRO A CG  
395  C CD  . PRO A 52  ? 0.6598 0.6083 0.6098 0.0825  -0.0450 0.0395  52  PRO A CD  
396  N N   . LYS A 53  ? 0.5101 0.4558 0.4484 0.0615  -0.0535 0.0338  53  LYS A N   
397  C CA  . LYS A 53  ? 0.5870 0.5372 0.5240 0.0590  -0.0596 0.0321  53  LYS A CA  
398  C C   . LYS A 53  ? 0.6790 0.6242 0.6039 0.0648  -0.0646 0.0343  53  LYS A C   
399  O O   . LYS A 53  ? 0.7661 0.6971 0.6762 0.0668  -0.0617 0.0361  53  LYS A O   
400  C CB  . LYS A 53  ? 0.6466 0.5895 0.5776 0.0523  -0.0564 0.0294  53  LYS A CB  
401  C CG  . LYS A 53  ? 0.7015 0.6454 0.6272 0.0504  -0.0625 0.0271  53  LYS A CG  
402  C CD  . LYS A 53  ? 0.6452 0.6037 0.5844 0.0484  -0.0695 0.0255  53  LYS A CD  
403  C CE  . LYS A 53  ? 0.5774 0.5348 0.5110 0.0447  -0.0753 0.0223  53  LYS A CE  
404  N NZ  . LYS A 53  ? 0.4983 0.4686 0.4451 0.0405  -0.0818 0.0206  53  LYS A NZ  
405  N N   . ARG A 54  ? 0.6861 0.6433 0.6171 0.0670  -0.0724 0.0343  54  ARG A N   
406  C CA  . ARG A 54  ? 0.7094 0.6633 0.6290 0.0724  -0.0786 0.0363  54  ARG A CA  
407  C C   . ARG A 54  ? 0.7501 0.6933 0.6553 0.0684  -0.0790 0.0342  54  ARG A C   
408  O O   . ARG A 54  ? 0.8241 0.7693 0.7326 0.0617  -0.0789 0.0305  54  ARG A O   
409  C CB  . ARG A 54  ? 0.6484 0.6199 0.5793 0.0744  -0.0875 0.0365  54  ARG A CB  
410  C CG  . ARG A 54  ? 0.7389 0.7225 0.6828 0.0805  -0.0872 0.0393  54  ARG A CG  
411  C CD  . ARG A 54  ? 0.9758 0.9755 0.9268 0.0848  -0.0967 0.0410  54  ARG A CD  
412  N NE  . ARG A 54  ? 1.2140 1.2331 1.1848 0.0862  -0.0967 0.0420  54  ARG A NE  
413  C CZ  . ARG A 54  ? 1.3664 1.4019 1.3526 0.0789  -0.1001 0.0403  54  ARG A CZ  
414  N NH1 . ARG A 54  ? 1.4436 1.4764 1.4264 0.0703  -0.1042 0.0370  54  ARG A NH1 
415  N NH2 . ARG A 54  ? 1.3596 1.4136 1.3637 0.0804  -0.0993 0.0419  54  ARG A NH2 
416  N N   . PRO A 55  ? 0.6505 0.5815 0.5386 0.0728  -0.0793 0.0367  55  PRO A N   
417  C CA  . PRO A 55  ? 0.6360 0.5562 0.5081 0.0700  -0.0789 0.0353  55  PRO A CA  
418  C C   . PRO A 55  ? 0.6431 0.5707 0.5162 0.0671  -0.0868 0.0317  55  PRO A C   
419  O O   . PRO A 55  ? 0.6488 0.5878 0.5296 0.0693  -0.0946 0.0321  55  PRO A O   
420  C CB  . PRO A 55  ? 0.4861 0.3953 0.3417 0.0767  -0.0798 0.0398  55  PRO A CB  
421  C CG  . PRO A 55  ? 0.5549 0.4625 0.4155 0.0813  -0.0764 0.0432  55  PRO A CG  
422  C CD  . PRO A 55  ? 0.5512 0.4751 0.4327 0.0805  -0.0780 0.0414  55  PRO A CD  
423  N N   . TRP A 56  ? 0.6123 0.5335 0.4775 0.0623  -0.0847 0.0282  56  TRP A N   
424  C CA  . TRP A 56  ? 0.6382 0.5626 0.5014 0.0590  -0.0919 0.0240  56  TRP A CA  
425  C C   . TRP A 56  ? 0.7356 0.6489 0.5774 0.0615  -0.0941 0.0238  56  TRP A C   
426  O O   . TRP A 56  ? 0.7134 0.6167 0.5423 0.0651  -0.0892 0.0273  56  TRP A O   
427  C CB  . TRP A 56  ? 0.7066 0.6309 0.5760 0.0523  -0.0879 0.0196  56  TRP A CB  
428  C CG  . TRP A 56  ? 0.7835 0.6966 0.6433 0.0516  -0.0782 0.0196  56  TRP A CG  
429  C CD1 . TRP A 56  ? 0.8547 0.7580 0.6979 0.0518  -0.0763 0.0179  56  TRP A CD1 
430  C CD2 . TRP A 56  ? 0.6995 0.6117 0.5661 0.0503  -0.0693 0.0215  56  TRP A CD2 
431  N NE1 . TRP A 56  ? 0.7927 0.6905 0.6332 0.0507  -0.0665 0.0190  56  TRP A NE1 
432  C CE2 . TRP A 56  ? 0.7228 0.6257 0.5776 0.0494  -0.0625 0.0211  56  TRP A CE2 
433  C CE3 . TRP A 56  ? 0.7019 0.6206 0.5832 0.0498  -0.0665 0.0233  56  TRP A CE3 
434  C CZ2 . TRP A 56  ? 0.7176 0.6182 0.5756 0.0474  -0.0537 0.0228  56  TRP A CZ2 
435  C CZ3 . TRP A 56  ? 0.6947 0.6091 0.5775 0.0480  -0.0578 0.0246  56  TRP A CZ3 
436  C CH2 . TRP A 56  ? 0.6647 0.5706 0.5363 0.0465  -0.0518 0.0244  56  TRP A CH2 
437  N N   . SER A 57  ? 0.7271 0.6410 0.5636 0.0591  -0.1013 0.0197  57  SER A N   
438  C CA  . SER A 57  ? 0.8271 0.7304 0.6419 0.0618  -0.1037 0.0192  57  SER A CA  
439  C C   . SER A 57  ? 0.8062 0.7009 0.6110 0.0583  -0.1002 0.0142  57  SER A C   
440  O O   . SER A 57  ? 0.8027 0.7006 0.6163 0.0533  -0.1013 0.0097  57  SER A O   
441  C CB  . SER A 57  ? 0.8456 0.7543 0.6567 0.0639  -0.1159 0.0191  57  SER A CB  
442  O OG  . SER A 57  ? 0.9675 0.8816 0.7848 0.0582  -0.1230 0.0138  57  SER A OG  
443  N N   . GLY A 58  ? 0.7302 0.6137 0.5158 0.0612  -0.0957 0.0151  58  GLY A N   
444  C CA  . GLY A 58  ? 0.7220 0.5975 0.4961 0.0595  -0.0919 0.0105  58  GLY A CA  
445  C C   . GLY A 58  ? 0.7911 0.6665 0.5735 0.0570  -0.0810 0.0106  58  GLY A C   
446  O O   . GLY A 58  ? 0.6524 0.5317 0.4456 0.0567  -0.0756 0.0147  58  GLY A O   
447  N N   . VAL A 59  ? 0.7360 0.6068 0.5126 0.0556  -0.0780 0.0058  59  VAL A N   
448  C CA  . VAL A 59  ? 0.6874 0.5584 0.4698 0.0539  -0.0676 0.0058  59  VAL A CA  
449  C C   . VAL A 59  ? 0.6232 0.5006 0.4238 0.0495  -0.0692 0.0026  59  VAL A C   
450  O O   . VAL A 59  ? 0.7241 0.5991 0.5231 0.0479  -0.0744 -0.0027 59  VAL A O   
451  C CB  . VAL A 59  ? 0.7350 0.5980 0.5002 0.0562  -0.0622 0.0030  59  VAL A CB  
452  C CG1 . VAL A 59  ? 0.7096 0.5751 0.4833 0.0545  -0.0531 0.0021  59  VAL A CG1 
453  C CG2 . VAL A 59  ? 0.6449 0.5023 0.3925 0.0601  -0.0583 0.0076  59  VAL A CG2 
454  N N   . LEU A 60  ? 0.5693 0.4538 0.3862 0.0474  -0.0649 0.0058  60  LEU A N   
455  C CA  . LEU A 60  ? 0.6048 0.4955 0.4390 0.0432  -0.0653 0.0036  60  LEU A CA  
456  C C   . LEU A 60  ? 0.7097 0.5972 0.5427 0.0423  -0.0582 0.0007  60  LEU A C   
457  O O   . LEU A 60  ? 0.8116 0.6983 0.6415 0.0436  -0.0496 0.0032  60  LEU A O   
458  C CB  . LEU A 60  ? 0.5861 0.4849 0.4362 0.0420  -0.0626 0.0079  60  LEU A CB  
459  C CG  . LEU A 60  ? 0.5374 0.4438 0.4060 0.0376  -0.0626 0.0066  60  LEU A CG  
460  C CD1 . LEU A 60  ? 0.4478 0.3621 0.3291 0.0378  -0.0629 0.0106  60  LEU A CD1 
461  C CD2 . LEU A 60  ? 0.5270 0.4321 0.3986 0.0360  -0.0542 0.0059  60  LEU A CD2 
462  N N   . ASP A 61  ? 0.6147 0.5003 0.4500 0.0402  -0.0619 -0.0042 61  ASP A N   
463  C CA  . ASP A 61  ? 0.6115 0.4940 0.4459 0.0405  -0.0555 -0.0069 61  ASP A CA  
464  C C   . ASP A 61  ? 0.6042 0.4946 0.4564 0.0375  -0.0500 -0.0045 61  ASP A C   
465  O O   . ASP A 61  ? 0.6517 0.5473 0.5178 0.0337  -0.0540 -0.0044 61  ASP A O   
466  C CB  . ASP A 61  ? 0.6718 0.5467 0.5003 0.0398  -0.0612 -0.0131 61  ASP A CB  
467  C CG  . ASP A 61  ? 0.8201 0.6915 0.6479 0.0413  -0.0545 -0.0157 61  ASP A CG  
468  O OD1 . ASP A 61  ? 0.7834 0.6600 0.6263 0.0383  -0.0522 -0.0148 61  ASP A OD1 
469  O OD2 . ASP A 61  ? 0.8941 0.7580 0.7061 0.0461  -0.0512 -0.0183 61  ASP A OD2 
470  N N   . ALA A 62  ? 0.4638 0.3555 0.3151 0.0390  -0.0409 -0.0024 62  ALA A N   
471  C CA  . ALA A 62  ? 0.4874 0.3863 0.3535 0.0363  -0.0353 0.0002  62  ALA A CA  
472  C C   . ALA A 62  ? 0.6085 0.5071 0.4745 0.0375  -0.0293 -0.0019 62  ALA A C   
473  O O   . ALA A 62  ? 0.6613 0.5648 0.5311 0.0374  -0.0218 0.0010  62  ALA A O   
474  C CB  . ALA A 62  ? 0.4573 0.3594 0.3240 0.0362  -0.0302 0.0057  62  ALA A CB  
475  N N   . THR A 63  ? 0.5960 0.4885 0.4575 0.0387  -0.0330 -0.0069 63  THR A N   
476  C CA  . THR A 63  ? 0.6938 0.5846 0.5530 0.0416  -0.0278 -0.0092 63  THR A CA  
477  C C   . THR A 63  ? 0.6943 0.5866 0.5665 0.0387  -0.0292 -0.0106 63  THR A C   
478  O O   . THR A 63  ? 0.6585 0.5502 0.5311 0.0413  -0.0250 -0.0120 63  THR A O   
479  C CB  . THR A 63  ? 0.7648 0.6449 0.6057 0.0466  -0.0297 -0.0141 63  THR A CB  
480  O OG1 . THR A 63  ? 0.7767 0.6487 0.6161 0.0445  -0.0388 -0.0185 63  THR A OG1 
481  C CG2 . THR A 63  ? 0.7217 0.5996 0.5487 0.0490  -0.0296 -0.0127 63  THR A CG2 
482  N N   . THR A 64  ? 0.6327 0.5275 0.5157 0.0337  -0.0349 -0.0098 64  THR A N   
483  C CA  . THR A 64  ? 0.6330 0.5290 0.5279 0.0304  -0.0365 -0.0105 64  THR A CA  
484  C C   . THR A 64  ? 0.6632 0.5689 0.5738 0.0257  -0.0364 -0.0065 64  THR A C   
485  O O   . THR A 64  ? 0.5367 0.4466 0.4489 0.0248  -0.0376 -0.0039 64  THR A O   
486  C CB  . THR A 64  ? 0.5580 0.4451 0.4490 0.0284  -0.0450 -0.0147 64  THR A CB  
487  O OG1 . THR A 64  ? 0.6286 0.5188 0.5222 0.0249  -0.0515 -0.0136 64  THR A OG1 
488  C CG2 . THR A 64  ? 0.4190 0.2940 0.2920 0.0334  -0.0458 -0.0195 64  THR A CG2 
489  N N   . PHE A 65  ? 0.7738 0.6827 0.6952 0.0234  -0.0349 -0.0059 65  PHE A N   
490  C CA  . PHE A 65  ? 0.5982 0.5160 0.5336 0.0192  -0.0346 -0.0024 65  PHE A CA  
491  C C   . PHE A 65  ? 0.6387 0.5569 0.5783 0.0156  -0.0424 -0.0029 65  PHE A C   
492  O O   . PHE A 65  ? 0.7448 0.6563 0.6805 0.0142  -0.0479 -0.0061 65  PHE A O   
493  C CB  . PHE A 65  ? 0.5113 0.4322 0.4561 0.0176  -0.0313 -0.0015 65  PHE A CB  
494  C CG  . PHE A 65  ? 0.5832 0.5081 0.5281 0.0201  -0.0237 0.0003  65  PHE A CG  
495  C CD1 . PHE A 65  ? 0.6114 0.5426 0.5589 0.0194  -0.0197 0.0038  65  PHE A CD1 
496  C CD2 . PHE A 65  ? 0.4361 0.3587 0.3787 0.0231  -0.0208 -0.0012 65  PHE A CD2 
497  C CE1 . PHE A 65  ? 0.6243 0.5601 0.5723 0.0204  -0.0131 0.0058  65  PHE A CE1 
498  C CE2 . PHE A 65  ? 0.3670 0.2959 0.3112 0.0251  -0.0140 0.0008  65  PHE A CE2 
499  C CZ  . PHE A 65  ? 0.6079 0.5439 0.5552 0.0232  -0.0103 0.0044  65  PHE A CZ  
500  N N   . GLN A 66  ? 0.5858 0.5118 0.5328 0.0140  -0.0428 0.0002  66  GLN A N   
501  C CA  . GLN A 66  ? 0.4851 0.4158 0.4393 0.0107  -0.0493 0.0008  66  GLN A CA  
502  C C   . GLN A 66  ? 0.5425 0.4788 0.5100 0.0060  -0.0496 0.0020  66  GLN A C   
503  O O   . GLN A 66  ? 0.5027 0.4379 0.4730 0.0057  -0.0451 0.0022  66  GLN A O   
504  C CB  . GLN A 66  ? 0.3897 0.3271 0.3462 0.0124  -0.0490 0.0039  66  GLN A CB  
505  C CG  . GLN A 66  ? 0.5012 0.4352 0.4474 0.0151  -0.0533 0.0031  66  GLN A CG  
506  C CD  . GLN A 66  ? 0.6820 0.6175 0.6301 0.0122  -0.0623 0.0014  66  GLN A CD  
507  O OE1 . GLN A 66  ? 0.6328 0.5677 0.5741 0.0140  -0.0671 0.0011  66  GLN A OE1 
508  N NE2 . GLN A 66  ? 0.6355 0.5732 0.5925 0.0071  -0.0648 0.0005  66  GLN A NE2 
509  N N   . ASN A 67  ? 0.4987 0.4418 0.4744 0.0026  -0.0548 0.0031  67  ASN A N   
510  C CA  . ASN A 67  ? 0.4553 0.4046 0.4435 -0.0024 -0.0555 0.0047  67  ASN A CA  
511  C C   . ASN A 67  ? 0.3805 0.3355 0.3763 -0.0018 -0.0487 0.0075  67  ASN A C   
512  O O   . ASN A 67  ? 0.4609 0.4175 0.4548 0.0018  -0.0442 0.0089  67  ASN A O   
513  C CB  . ASN A 67  ? 0.4469 0.4061 0.4436 -0.0056 -0.0615 0.0063  67  ASN A CB  
514  C CG  . ASN A 67  ? 0.5556 0.5097 0.5460 -0.0080 -0.0697 0.0035  67  ASN A CG  
515  O OD1 . ASN A 67  ? 0.6316 0.5753 0.6159 -0.0107 -0.0723 0.0006  67  ASN A OD1 
516  N ND2 . ASN A 67  ? 0.6096 0.5703 0.6005 -0.0068 -0.0741 0.0044  67  ASN A ND2 
517  N N   . VAL A 68  ? 0.3549 0.3119 0.3585 -0.0058 -0.0482 0.0084  68  VAL A N   
518  C CA  . VAL A 68  ? 0.3551 0.3188 0.3669 -0.0062 -0.0427 0.0113  68  VAL A CA  
519  C C   . VAL A 68  ? 0.4280 0.4038 0.4510 -0.0085 -0.0442 0.0141  68  VAL A C   
520  O O   . VAL A 68  ? 0.4581 0.4377 0.4862 -0.0128 -0.0496 0.0144  68  VAL A O   
521  C CB  . VAL A 68  ? 0.4326 0.3917 0.4455 -0.0085 -0.0409 0.0111  68  VAL A CB  
522  C CG1 . VAL A 68  ? 0.2890 0.2556 0.3106 -0.0097 -0.0364 0.0141  68  VAL A CG1 
523  C CG2 . VAL A 68  ? 0.4406 0.3904 0.4435 -0.0046 -0.0382 0.0087  68  VAL A CG2 
524  N N   . CYS A 69  ? 0.2819 0.2637 0.3084 -0.0059 -0.0395 0.0163  69  CYS A N   
525  C CA  . CYS A 69  ? 0.3063 0.3001 0.3428 -0.0064 -0.0396 0.0190  69  CYS A CA  
526  C C   . CYS A 69  ? 0.4892 0.4889 0.5352 -0.0122 -0.0405 0.0207  69  CYS A C   
527  O O   . CYS A 69  ? 0.3768 0.3718 0.4223 -0.0144 -0.0379 0.0207  69  CYS A O   
528  C CB  . CYS A 69  ? 0.1817 0.1776 0.2179 -0.0022 -0.0337 0.0205  69  CYS A CB  
529  S SG  . CYS A 69  ? 0.5823 0.5710 0.6072 0.0042  -0.0325 0.0196  69  CYS A SG  
530  N N   . TYR A 70  ? 0.4235 0.4341 0.4782 -0.0148 -0.0443 0.0224  70  TYR A N   
531  C CA  . TYR A 70  ? 0.4873 0.5039 0.5510 -0.0214 -0.0455 0.0246  70  TYR A CA  
532  C C   . TYR A 70  ? 0.5375 0.5556 0.6042 -0.0217 -0.0392 0.0266  70  TYR A C   
533  O O   . TYR A 70  ? 0.5167 0.5411 0.5856 -0.0176 -0.0345 0.0279  70  TYR A O   
534  C CB  . TYR A 70  ? 0.5099 0.5422 0.5846 -0.0239 -0.0493 0.0272  70  TYR A CB  
535  C CG  . TYR A 70  ? 0.5048 0.5370 0.5833 -0.0325 -0.0552 0.0276  70  TYR A CG  
536  C CD1 . TYR A 70  ? 0.5877 0.6169 0.6630 -0.0349 -0.0627 0.0256  70  TYR A CD1 
537  C CD2 . TYR A 70  ? 0.5612 0.5947 0.6451 -0.0386 -0.0537 0.0300  70  TYR A CD2 
538  C CE1 . TYR A 70  ? 0.5766 0.6035 0.6540 -0.0437 -0.0688 0.0257  70  TYR A CE1 
539  C CE2 . TYR A 70  ? 0.5074 0.5386 0.5937 -0.0472 -0.0593 0.0306  70  TYR A CE2 
540  C CZ  . TYR A 70  ? 0.6235 0.6511 0.7064 -0.0499 -0.0670 0.0284  70  TYR A CZ  
541  O OH  . TYR A 70  ? 0.8520 0.8757 0.9362 -0.0594 -0.0732 0.0288  70  TYR A OH  
542  N N   . GLN A 71  ? 0.5432 0.5545 0.6090 -0.0264 -0.0393 0.0267  71  GLN A N   
543  C CA  . GLN A 71  ? 0.6469 0.6577 0.7133 -0.0262 -0.0337 0.0283  71  GLN A CA  
544  C C   . GLN A 71  ? 0.5554 0.5626 0.6239 -0.0325 -0.0348 0.0300  71  GLN A C   
545  O O   . GLN A 71  ? 0.5053 0.5057 0.5719 -0.0367 -0.0399 0.0290  71  GLN A O   
546  C CB  . GLN A 71  ? 0.3087 0.3100 0.3660 -0.0211 -0.0300 0.0260  71  GLN A CB  
547  C CG  . GLN A 71  ? 0.3733 0.3616 0.4225 -0.0215 -0.0323 0.0233  71  GLN A CG  
548  C CD  . GLN A 71  ? 0.4494 0.4313 0.4908 -0.0165 -0.0288 0.0214  71  GLN A CD  
549  O OE1 . GLN A 71  ? 0.5117 0.4890 0.5506 -0.0162 -0.0263 0.0214  71  GLN A OE1 
550  N NE2 . GLN A 71  ? 0.4480 0.4301 0.4855 -0.0127 -0.0286 0.0201  71  GLN A NE2 
551  N N   . TYR A 72  ? 0.5604 0.5711 0.6316 -0.0330 -0.0302 0.0325  72  TYR A N   
552  C CA  . TYR A 72  ? 0.5973 0.6041 0.6695 -0.0382 -0.0303 0.0348  72  TYR A CA  
553  C C   . TYR A 72  ? 0.5866 0.5781 0.6494 -0.0365 -0.0310 0.0322  72  TYR A C   
554  O O   . TYR A 72  ? 0.6239 0.6122 0.6815 -0.0310 -0.0282 0.0301  72  TYR A O   
555  C CB  . TYR A 72  ? 0.6470 0.6622 0.7233 -0.0379 -0.0247 0.0380  72  TYR A CB  
556  C CG  . TYR A 72  ? 0.7823 0.7930 0.8582 -0.0425 -0.0241 0.0408  72  TYR A CG  
557  C CD1 . TYR A 72  ? 0.5479 0.5486 0.6167 -0.0402 -0.0223 0.0400  72  TYR A CD1 
558  C CD2 . TYR A 72  ? 0.7783 0.7951 0.8610 -0.0495 -0.0256 0.0448  72  TYR A CD2 
559  C CE1 . TYR A 72  ? 0.6145 0.6105 0.6824 -0.0439 -0.0221 0.0430  72  TYR A CE1 
560  C CE2 . TYR A 72  ? 0.6788 0.6903 0.7603 -0.0541 -0.0252 0.0479  72  TYR A CE2 
561  C CZ  . TYR A 72  ? 0.7172 0.7177 0.7908 -0.0509 -0.0235 0.0470  72  TYR A CZ  
562  O OH  . TYR A 72  ? 0.7167 0.7116 0.7886 -0.0551 -0.0234 0.0506  72  TYR A OH  
563  N N   . VAL A 73  ? 0.5954 0.5776 0.6559 -0.0409 -0.0347 0.0326  73  VAL A N   
564  C CA  . VAL A 73  ? 0.6565 0.6242 0.7080 -0.0382 -0.0352 0.0303  73  VAL A CA  
565  C C   . VAL A 73  ? 0.7173 0.6812 0.7684 -0.0400 -0.0332 0.0334  73  VAL A C   
566  O O   . VAL A 73  ? 0.5923 0.5568 0.6470 -0.0461 -0.0347 0.0367  73  VAL A O   
567  C CB  . VAL A 73  ? 0.5753 0.5307 0.6209 -0.0404 -0.0412 0.0277  73  VAL A CB  
568  C CG1 . VAL A 73  ? 0.4804 0.4213 0.5166 -0.0364 -0.0411 0.0257  73  VAL A CG1 
569  C CG2 . VAL A 73  ? 0.5579 0.5155 0.6020 -0.0383 -0.0437 0.0245  73  VAL A CG2 
570  N N   . ASP A 74  ? 0.8278 0.7882 0.8744 -0.0349 -0.0299 0.0327  74  ASP A N   
571  C CA  . ASP A 74  ? 0.8847 0.8429 0.9309 -0.0359 -0.0280 0.0359  74  ASP A CA  
572  C C   . ASP A 74  ? 0.9200 0.8633 0.9602 -0.0371 -0.0317 0.0361  74  ASP A C   
573  O O   . ASP A 74  ? 0.8845 0.8177 0.9180 -0.0331 -0.0337 0.0326  74  ASP A O   
574  C CB  . ASP A 74  ? 0.9559 0.9188 1.0010 -0.0308 -0.0234 0.0358  74  ASP A CB  
575  C CG  . ASP A 74  ? 1.0266 1.0024 1.0771 -0.0317 -0.0195 0.0376  74  ASP A CG  
576  O OD1 . ASP A 74  ? 1.0593 1.0394 1.1134 -0.0357 -0.0185 0.0413  74  ASP A OD1 
577  O OD2 . ASP A 74  ? 0.8520 0.8328 0.9025 -0.0283 -0.0174 0.0354  74  ASP A OD2 
578  N N   . THR A 75  ? 1.0593 1.0009 1.1013 -0.0425 -0.0324 0.0402  75  THR A N   
579  C CA  . THR A 75  ? 1.1634 1.0891 1.1991 -0.0448 -0.0363 0.0411  75  THR A CA  
580  C C   . THR A 75  ? 1.2394 1.1630 1.2740 -0.0452 -0.0343 0.0455  75  THR A C   
581  O O   . THR A 75  ? 1.2622 1.1790 1.2958 -0.0512 -0.0365 0.0492  75  THR A O   
582  C CB  . THR A 75  ? 1.0252 0.9487 1.0637 -0.0536 -0.0407 0.0428  75  THR A CB  
583  O OG1 . THR A 75  ? 0.9191 0.8594 0.9675 -0.0584 -0.0379 0.0465  75  THR A OG1 
584  C CG2 . THR A 75  ? 0.9084 0.8271 0.9442 -0.0534 -0.0450 0.0380  75  THR A CG2 
585  N N   . LEU A 76  ? 1.1846 1.1141 1.2189 -0.0393 -0.0304 0.0455  76  LEU A N   
586  C CA  . LEU A 76  ? 1.1257 1.0535 1.1581 -0.0390 -0.0288 0.0496  76  LEU A CA  
587  C C   . LEU A 76  ? 1.1385 1.0503 1.1626 -0.0345 -0.0316 0.0489  76  LEU A C   
588  O O   . LEU A 76  ? 1.0630 0.9646 1.0831 -0.0370 -0.0335 0.0525  76  LEU A O   
589  C CB  . LEU A 76  ? 1.1169 1.0574 1.1520 -0.0351 -0.0242 0.0498  76  LEU A CB  
590  C CG  . LEU A 76  ? 1.1843 1.1245 1.2175 -0.0357 -0.0229 0.0546  76  LEU A CG  
591  C CD1 . LEU A 76  ? 1.2314 1.1731 1.2671 -0.0435 -0.0227 0.0593  76  LEU A CD1 
592  C CD2 . LEU A 76  ? 1.1360 1.0873 1.1703 -0.0321 -0.0192 0.0543  76  LEU A CD2 
593  N N   . TYR A 77  ? 1.2019 1.1111 1.2227 -0.0274 -0.0317 0.0444  77  TYR A N   
594  C CA  . TYR A 77  ? 1.1737 1.0680 1.1862 -0.0214 -0.0341 0.0430  77  TYR A CA  
595  C C   . TYR A 77  ? 1.2333 1.1171 1.2406 -0.0202 -0.0373 0.0381  77  TYR A C   
596  O O   . TYR A 77  ? 1.2245 1.1112 1.2305 -0.0140 -0.0359 0.0341  77  TYR A O   
597  C CB  . TYR A 77  ? 1.0716 0.9725 1.0839 -0.0131 -0.0311 0.0424  77  TYR A CB  
598  C CG  . TYR A 77  ? 1.0863 0.9955 1.1017 -0.0143 -0.0290 0.0471  77  TYR A CG  
599  C CD1 . TYR A 77  ? 1.0333 0.9328 1.0442 -0.0144 -0.0308 0.0513  77  TYR A CD1 
600  C CD2 . TYR A 77  ? 1.1564 1.0817 1.1780 -0.0153 -0.0254 0.0474  77  TYR A CD2 
601  C CE1 . TYR A 77  ? 1.0518 0.9587 1.0645 -0.0155 -0.0291 0.0557  77  TYR A CE1 
602  C CE2 . TYR A 77  ? 1.1493 1.0813 1.1723 -0.0164 -0.0238 0.0513  77  TYR A CE2 
603  C CZ  . TYR A 77  ? 1.0962 1.0195 1.1148 -0.0165 -0.0256 0.0555  77  TYR A CZ  
604  O OH  . TYR A 77  ? 1.0648 0.9945 1.0837 -0.0176 -0.0242 0.0596  77  TYR A OH  
605  N N   . PRO A 78  ? 1.3061 1.1776 1.3101 -0.0265 -0.0416 0.0387  78  PRO A N   
606  C CA  . PRO A 78  ? 1.3082 1.1685 1.3063 -0.0268 -0.0456 0.0340  78  PRO A CA  
607  C C   . PRO A 78  ? 1.2145 1.0604 1.2018 -0.0172 -0.0466 0.0300  78  PRO A C   
608  O O   . PRO A 78  ? 1.1644 0.9938 1.1436 -0.0152 -0.0490 0.0311  78  PRO A O   
609  C CB  . PRO A 78  ? 1.3771 1.2261 1.3734 -0.0367 -0.0504 0.0368  78  PRO A CB  
610  C CG  . PRO A 78  ? 1.3534 1.2161 1.3590 -0.0429 -0.0475 0.0427  78  PRO A CG  
611  C CD  . PRO A 78  ? 1.3411 1.2103 1.3472 -0.0351 -0.0430 0.0441  78  PRO A CD  
612  N N   . GLY A 79  ? 1.1634 1.0154 1.1501 -0.0109 -0.0445 0.0256  79  GLY A N   
613  C CA  . GLY A 79  ? 1.1452 0.9861 1.1220 -0.0010 -0.0446 0.0215  79  GLY A CA  
614  C C   . GLY A 79  ? 1.0414 0.8947 1.0216 0.0078  -0.0393 0.0220  79  GLY A C   
615  O O   . GLY A 79  ? 0.8722 0.7236 0.8470 0.0165  -0.0377 0.0186  79  GLY A O   
616  N N   . PHE A 80  ? 1.0388 0.9055 1.0277 0.0053  -0.0366 0.0264  80  PHE A N   
617  C CA  . PHE A 80  ? 0.9681 0.8481 0.9613 0.0118  -0.0323 0.0277  80  PHE A CA  
618  C C   . PHE A 80  ? 0.9672 0.8613 0.9646 0.0137  -0.0288 0.0249  80  PHE A C   
619  O O   . PHE A 80  ? 0.9260 0.8281 0.9285 0.0076  -0.0282 0.0247  80  PHE A O   
620  C CB  . PHE A 80  ? 0.9041 0.7938 0.9046 0.0068  -0.0311 0.0329  80  PHE A CB  
621  C CG  . PHE A 80  ? 0.9313 0.8353 0.9366 0.0116  -0.0275 0.0346  80  PHE A CG  
622  C CD1 . PHE A 80  ? 0.9544 0.8567 0.9563 0.0209  -0.0269 0.0342  80  PHE A CD1 
623  C CD2 . PHE A 80  ? 0.8883 0.8077 0.9013 0.0070  -0.0249 0.0364  80  PHE A CD2 
624  C CE1 . PHE A 80  ? 0.8833 0.8007 0.8907 0.0246  -0.0241 0.0361  80  PHE A CE1 
625  C CE2 . PHE A 80  ? 0.8726 0.8047 0.8896 0.0104  -0.0223 0.0379  80  PHE A CE2 
626  C CZ  . PHE A 80  ? 0.8896 0.8216 0.9044 0.0188  -0.0221 0.0379  80  PHE A CZ  
627  N N   . GLU A 81  ? 1.0141 0.9116 1.0092 0.0223  -0.0262 0.0230  81  GLU A N   
628  C CA  . GLU A 81  ? 1.0800 0.9896 1.0778 0.0242  -0.0228 0.0206  81  GLU A CA  
629  C C   . GLU A 81  ? 1.0776 1.0047 1.0849 0.0195  -0.0197 0.0232  81  GLU A C   
630  O O   . GLU A 81  ? 1.0418 0.9764 1.0513 0.0175  -0.0179 0.0218  81  GLU A O   
631  C CB  . GLU A 81  ? 1.2112 1.1220 1.2049 0.0345  -0.0202 0.0188  81  GLU A CB  
632  C CG  . GLU A 81  ? 1.3594 1.2820 1.3548 0.0364  -0.0163 0.0167  81  GLU A CG  
633  C CD  . GLU A 81  ? 1.4986 1.4120 1.4867 0.0353  -0.0179 0.0124  81  GLU A CD  
634  O OE1 . GLU A 81  ? 1.5784 1.4750 1.5587 0.0352  -0.0220 0.0103  81  GLU A OE1 
635  O OE2 . GLU A 81  ? 1.4544 1.3766 1.4440 0.0343  -0.0153 0.0114  81  GLU A OE2 
636  N N   . GLY A 82  ? 1.0337 0.9661 1.0457 0.0180  -0.0195 0.0271  82  GLY A N   
637  C CA  . GLY A 82  ? 0.9259 0.8727 0.9452 0.0136  -0.0171 0.0293  82  GLY A CA  
638  C C   . GLY A 82  ? 0.9112 0.8589 0.9328 0.0061  -0.0175 0.0290  82  GLY A C   
639  O O   . GLY A 82  ? 0.9242 0.8820 0.9497 0.0035  -0.0152 0.0292  82  GLY A O   
640  N N   . THR A 83  ? 0.8023 0.7397 0.8216 0.0026  -0.0206 0.0288  83  THR A N   
641  C CA  . THR A 83  ? 0.6843 0.6245 0.7067 -0.0039 -0.0211 0.0286  83  THR A CA  
642  C C   . THR A 83  ? 0.8335 0.7686 0.8525 -0.0036 -0.0228 0.0248  83  THR A C   
643  O O   . THR A 83  ? 0.8632 0.8047 0.8849 -0.0060 -0.0219 0.0240  83  THR A O   
644  C CB  . THR A 83  ? 0.8727 0.8103 0.8975 -0.0101 -0.0229 0.0320  83  THR A CB  
645  O OG1 . THR A 83  ? 0.9596 0.8834 0.9797 -0.0113 -0.0269 0.0317  83  THR A OG1 
646  C CG2 . THR A 83  ? 0.8562 0.7982 0.8829 -0.0099 -0.0214 0.0358  83  THR A CG2 
647  N N   . GLU A 84  ? 0.7656 0.6885 0.7777 -0.0003 -0.0253 0.0224  84  GLU A N   
648  C CA  . GLU A 84  ? 0.7594 0.6761 0.7663 0.0003  -0.0275 0.0185  84  GLU A CA  
649  C C   . GLU A 84  ? 0.7975 0.7222 0.8039 0.0040  -0.0243 0.0163  84  GLU A C   
650  O O   . GLU A 84  ? 0.7728 0.6962 0.7768 0.0028  -0.0257 0.0140  84  GLU A O   
651  C CB  . GLU A 84  ? 0.8798 0.7803 0.8772 0.0045  -0.0305 0.0160  84  GLU A CB  
652  C CG  . GLU A 84  ? 1.0873 0.9761 1.0828 0.0006  -0.0343 0.0182  84  GLU A CG  
653  C CD  . GLU A 84  ? 1.1770 1.0627 1.1744 -0.0082 -0.0385 0.0185  84  GLU A CD  
654  O OE1 . GLU A 84  ? 1.2103 1.1024 1.2099 -0.0103 -0.0388 0.0167  84  GLU A OE1 
655  O OE2 . GLU A 84  ? 1.1670 1.0443 1.1638 -0.0131 -0.0415 0.0210  84  GLU A OE2 
656  N N   . MET A 85  ? 0.7501 0.6831 0.7584 0.0081  -0.0202 0.0173  85  MET A N   
657  C CA  . MET A 85  ? 0.6565 0.5969 0.6640 0.0108  -0.0169 0.0158  85  MET A CA  
658  C C   . MET A 85  ? 0.6509 0.5983 0.6625 0.0057  -0.0163 0.0165  85  MET A C   
659  O O   . MET A 85  ? 0.6828 0.6322 0.6918 0.0068  -0.0152 0.0149  85  MET A O   
660  C CB  . MET A 85  ? 0.5713 0.5211 0.5815 0.0148  -0.0129 0.0175  85  MET A CB  
661  C CG  . MET A 85  ? 0.6310 0.5899 0.6485 0.0106  -0.0117 0.0210  85  MET A CG  
662  S SD  . MET A 85  ? 0.7577 0.7289 0.7792 0.0141  -0.0081 0.0233  85  MET A SD  
663  C CE  . MET A 85  ? 0.7060 0.6860 0.7279 0.0124  -0.0046 0.0226  85  MET A CE  
664  N N   . TRP A 86  ? 0.5233 0.4740 0.5407 0.0007  -0.0170 0.0190  86  TRP A N   
665  C CA  . TRP A 86  ? 0.4603 0.4174 0.4815 -0.0031 -0.0164 0.0197  86  TRP A CA  
666  C C   . TRP A 86  ? 0.5492 0.5022 0.5702 -0.0062 -0.0202 0.0186  86  TRP A C   
667  O O   . TRP A 86  ? 0.6064 0.5641 0.6294 -0.0077 -0.0201 0.0186  86  TRP A O   
668  C CB  . TRP A 86  ? 0.3655 0.3292 0.3924 -0.0063 -0.0147 0.0228  86  TRP A CB  
669  C CG  . TRP A 86  ? 0.5261 0.4944 0.5536 -0.0042 -0.0120 0.0241  86  TRP A CG  
670  C CD1 . TRP A 86  ? 0.6207 0.5885 0.6492 -0.0035 -0.0123 0.0260  86  TRP A CD1 
671  C CD2 . TRP A 86  ? 0.5841 0.5588 0.6112 -0.0031 -0.0088 0.0240  86  TRP A CD2 
672  N NE1 . TRP A 86  ? 0.6688 0.6436 0.6984 -0.0017 -0.0098 0.0270  86  TRP A NE1 
673  C CE2 . TRP A 86  ? 0.6567 0.6359 0.6856 -0.0019 -0.0077 0.0258  86  TRP A CE2 
674  C CE3 . TRP A 86  ? 0.5390 0.5158 0.5642 -0.0031 -0.0072 0.0228  86  TRP A CE3 
675  C CZ2 . TRP A 86  ? 0.6078 0.5947 0.6375 -0.0016 -0.0051 0.0264  86  TRP A CZ2 
676  C CZ3 . TRP A 86  ? 0.5162 0.4989 0.5412 -0.0030 -0.0043 0.0235  86  TRP A CZ3 
677  C CH2 . TRP A 86  ? 0.6063 0.5946 0.6340 -0.0026 -0.0033 0.0253  86  TRP A CH2 
678  N N   . ASN A 87  ? 0.4990 0.4433 0.5175 -0.0070 -0.0239 0.0178  87  ASN A N   
679  C CA  . ASN A 87  ? 0.6166 0.5574 0.6354 -0.0110 -0.0283 0.0171  87  ASN A CA  
680  C C   . ASN A 87  ? 0.6599 0.5987 0.6735 -0.0088 -0.0298 0.0139  87  ASN A C   
681  O O   . ASN A 87  ? 0.6484 0.5842 0.6557 -0.0038 -0.0281 0.0117  87  ASN A O   
682  C CB  . ASN A 87  ? 0.6111 0.5407 0.6269 -0.0131 -0.0322 0.0170  87  ASN A CB  
683  C CG  . ASN A 87  ? 0.6161 0.5488 0.6384 -0.0182 -0.0322 0.0211  87  ASN A CG  
684  O OD1 . ASN A 87  ? 0.6943 0.6380 0.7236 -0.0207 -0.0299 0.0236  87  ASN A OD1 
685  N ND2 . ASN A 87  ? 0.6224 0.5445 0.6413 -0.0193 -0.0347 0.0218  87  ASN A ND2 
686  N N   . PRO A 88  ? 0.5608 0.5024 0.5772 -0.0125 -0.0331 0.0139  88  PRO A N   
687  C CA  . PRO A 88  ? 0.5103 0.4506 0.5219 -0.0109 -0.0355 0.0113  88  PRO A CA  
688  C C   . PRO A 88  ? 0.5374 0.4649 0.5385 -0.0084 -0.0386 0.0076  88  PRO A C   
689  O O   . PRO A 88  ? 0.6014 0.5203 0.6007 -0.0106 -0.0415 0.0072  88  PRO A O   
690  C CB  . PRO A 88  ? 0.4105 0.3563 0.4286 -0.0164 -0.0398 0.0127  88  PRO A CB  
691  C CG  . PRO A 88  ? 0.4882 0.4423 0.5156 -0.0196 -0.0371 0.0165  88  PRO A CG  
692  C CD  . PRO A 88  ? 0.4747 0.4236 0.5001 -0.0180 -0.0340 0.0171  88  PRO A CD  
693  N N   . ASN A 89  ? 0.5651 0.4905 0.5587 -0.0039 -0.0378 0.0051  89  ASN A N   
694  C CA  . ASN A 89  ? 0.4339 0.3471 0.4158 0.0001  -0.0394 0.0013  89  ASN A CA  
695  C C   . ASN A 89  ? 0.5349 0.4440 0.5091 0.0005  -0.0436 -0.0016 89  ASN A C   
696  O O   . ASN A 89  ? 0.6572 0.5574 0.6200 0.0050  -0.0439 -0.0050 89  ASN A O   
697  C CB  . ASN A 89  ? 0.3584 0.2727 0.3366 0.0067  -0.0332 0.0010  89  ASN A CB  
698  C CG  . ASN A 89  ? 0.5904 0.5131 0.5681 0.0090  -0.0291 0.0018  89  ASN A CG  
699  O OD1 . ASN A 89  ? 0.4597 0.3888 0.4418 0.0062  -0.0298 0.0034  89  ASN A OD1 
700  N ND2 . ASN A 89  ? 0.5159 0.4384 0.4878 0.0144  -0.0248 0.0010  89  ASN A ND2 
701  N N   . ARG A 90  ? 0.6045 0.5209 0.5849 -0.0037 -0.0467 -0.0001 90  ARG A N   
702  C CA  . ARG A 90  ? 0.5723 0.4862 0.5467 -0.0043 -0.0519 -0.0023 90  ARG A CA  
703  C C   . ARG A 90  ? 0.4448 0.3655 0.4294 -0.0112 -0.0567 -0.0001 90  ARG A C   
704  O O   . ARG A 90  ? 0.3947 0.3220 0.3893 -0.0142 -0.0545 0.0030  90  ARG A O   
705  C CB  . ARG A 90  ? 0.5718 0.4923 0.5440 -0.0001 -0.0488 -0.0016 90  ARG A CB  
706  C CG  . ARG A 90  ? 0.5581 0.4710 0.5171 0.0060  -0.0461 -0.0044 90  ARG A CG  
707  C CD  . ARG A 90  ? 0.8126 0.7133 0.7595 0.0064  -0.0522 -0.0088 90  ARG A CD  
708  N NE  . ARG A 90  ? 1.0366 0.9306 0.9704 0.0130  -0.0488 -0.0114 90  ARG A NE  
709  C CZ  . ARG A 90  ? 1.2575 1.1474 1.1877 0.0174  -0.0439 -0.0124 90  ARG A CZ  
710  N NH1 . ARG A 90  ? 1.1376 1.0280 1.0756 0.0157  -0.0426 -0.0111 90  ARG A NH1 
711  N NH2 . ARG A 90  ? 1.4372 1.3232 1.3558 0.0238  -0.0402 -0.0144 90  ARG A NH2 
712  N N   . GLU A 91  ? 0.4618 0.3817 0.4439 -0.0139 -0.0634 -0.0016 91  GLU A N   
713  C CA  . GLU A 91  ? 0.4909 0.4191 0.4838 -0.0212 -0.0683 0.0008  91  GLU A CA  
714  C C   . GLU A 91  ? 0.5099 0.4554 0.5164 -0.0214 -0.0646 0.0053  91  GLU A C   
715  O O   . GLU A 91  ? 0.4889 0.4398 0.4946 -0.0163 -0.0611 0.0060  91  GLU A O   
716  C CB  . GLU A 91  ? 0.4851 0.4110 0.4728 -0.0237 -0.0764 -0.0015 91  GLU A CB  
717  C CG  . GLU A 91  ? 0.6114 0.5494 0.6116 -0.0310 -0.0816 0.0015  91  GLU A CG  
718  C CD  . GLU A 91  ? 0.7247 0.6642 0.7211 -0.0327 -0.0897 -0.0003 91  GLU A CD  
719  O OE1 . GLU A 91  ? 0.5763 0.5018 0.5580 -0.0306 -0.0930 -0.0047 91  GLU A OE1 
720  O OE2 . GLU A 91  ? 0.8402 0.7953 0.8481 -0.0357 -0.0925 0.0029  91  GLU A OE2 
721  N N   . LEU A 92  ? 0.5384 0.4916 0.5563 -0.0273 -0.0654 0.0085  92  LEU A N   
722  C CA  . LEU A 92  ? 0.5380 0.5079 0.5685 -0.0275 -0.0622 0.0126  92  LEU A CA  
723  C C   . LEU A 92  ? 0.4403 0.4212 0.4757 -0.0282 -0.0671 0.0134  92  LEU A C   
724  O O   . LEU A 92  ? 0.4819 0.4616 0.5166 -0.0330 -0.0743 0.0123  92  LEU A O   
725  C CB  . LEU A 92  ? 0.4725 0.4482 0.5133 -0.0334 -0.0610 0.0160  92  LEU A CB  
726  C CG  . LEU A 92  ? 0.4334 0.4006 0.4710 -0.0323 -0.0559 0.0161  92  LEU A CG  
727  C CD1 . LEU A 92  ? 0.3963 0.3712 0.4440 -0.0374 -0.0541 0.0202  92  LEU A CD1 
728  C CD2 . LEU A 92  ? 0.6002 0.5683 0.6344 -0.0249 -0.0493 0.0156  92  LEU A CD2 
729  N N   . SER A 93  ? 0.4419 0.4333 0.4817 -0.0233 -0.0634 0.0154  93  SER A N   
730  C CA  . SER A 93  ? 0.4549 0.4567 0.4984 -0.0219 -0.0677 0.0164  93  SER A CA  
731  C C   . SER A 93  ? 0.4813 0.4929 0.5291 -0.0154 -0.0625 0.0188  93  SER A C   
732  O O   . SER A 93  ? 0.4331 0.4387 0.4755 -0.0108 -0.0563 0.0185  93  SER A O   
733  C CB  . SER A 93  ? 0.4479 0.4396 0.4788 -0.0197 -0.0728 0.0128  93  SER A CB  
734  O OG  . SER A 93  ? 0.4124 0.4131 0.4447 -0.0160 -0.0758 0.0138  93  SER A OG  
735  N N   . GLU A 94  ? 0.4384 0.4650 0.4957 -0.0151 -0.0652 0.0214  94  GLU A N   
736  C CA  . GLU A 94  ? 0.3127 0.3477 0.3731 -0.0079 -0.0609 0.0236  94  GLU A CA  
737  C C   . GLU A 94  ? 0.3741 0.4010 0.4229 -0.0013 -0.0617 0.0219  94  GLU A C   
738  O O   . GLU A 94  ? 0.4380 0.4650 0.4844 0.0053  -0.0572 0.0231  94  GLU A O   
739  C CB  . GLU A 94  ? 0.3202 0.3749 0.3947 -0.0085 -0.0634 0.0270  94  GLU A CB  
740  C CG  . GLU A 94  ? 0.4111 0.4764 0.4977 -0.0136 -0.0604 0.0298  94  GLU A CG  
741  C CD  . GLU A 94  ? 0.5757 0.6622 0.6755 -0.0106 -0.0598 0.0337  94  GLU A CD  
742  O OE1 . GLU A 94  ? 0.5413 0.6303 0.6403 -0.0024 -0.0543 0.0346  94  GLU A OE1 
743  O OE2 . GLU A 94  ? 0.5679 0.6683 0.6785 -0.0164 -0.0651 0.0358  94  GLU A OE2 
744  N N   . ASP A 95  ? 0.3919 0.4109 0.4324 -0.0030 -0.0676 0.0193  95  ASP A N   
745  C CA  . ASP A 95  ? 0.4471 0.4562 0.4741 0.0025  -0.0684 0.0176  95  ASP A CA  
746  C C   . ASP A 95  ? 0.5514 0.5455 0.5678 0.0030  -0.0631 0.0152  95  ASP A C   
747  O O   . ASP A 95  ? 0.5815 0.5666 0.5921 -0.0006 -0.0650 0.0124  95  ASP A O   
748  C CB  . ASP A 95  ? 0.3977 0.4055 0.4198 0.0003  -0.0772 0.0157  95  ASP A CB  
749  C CG  . ASP A 95  ? 0.5531 0.5504 0.5601 0.0059  -0.0780 0.0141  95  ASP A CG  
750  O OD1 . ASP A 95  ? 0.5755 0.5688 0.5773 0.0118  -0.0722 0.0153  95  ASP A OD1 
751  O OD2 . ASP A 95  ? 0.7011 0.6938 0.7008 0.0042  -0.0847 0.0117  95  ASP A OD2 
752  N N   . CYS A 96  ? 0.4991 0.4903 0.5122 0.0077  -0.0566 0.0164  96  CYS A N   
753  C CA  . CYS A 96  ? 0.5201 0.5065 0.5333 0.0065  -0.0501 0.0163  96  CYS A CA  
754  C C   . CYS A 96  ? 0.5104 0.4886 0.5139 0.0112  -0.0447 0.0165  96  CYS A C   
755  O O   . CYS A 96  ? 0.5125 0.4843 0.5122 0.0102  -0.0402 0.0157  96  CYS A O   
756  C CB  . CYS A 96  ? 0.5257 0.5238 0.5516 0.0058  -0.0477 0.0190  96  CYS A CB  
757  S SG  . CYS A 96  ? 0.4604 0.4570 0.4897 0.0036  -0.0410 0.0196  96  CYS A SG  
758  N N   . LEU A 97  ? 0.4426 0.4216 0.4425 0.0160  -0.0455 0.0180  97  LEU A N   
759  C CA  . LEU A 97  ? 0.5005 0.4729 0.4929 0.0201  -0.0404 0.0194  97  LEU A CA  
760  C C   . LEU A 97  ? 0.5980 0.5597 0.5765 0.0216  -0.0402 0.0183  97  LEU A C   
761  O O   . LEU A 97  ? 0.5221 0.4814 0.4935 0.0252  -0.0432 0.0190  97  LEU A O   
762  C CB  . LEU A 97  ? 0.4635 0.4413 0.4586 0.0253  -0.0411 0.0219  97  LEU A CB  
763  C CG  . LEU A 97  ? 0.5143 0.5028 0.5222 0.0247  -0.0392 0.0232  97  LEU A CG  
764  C CD1 . LEU A 97  ? 0.3418 0.3347 0.3515 0.0312  -0.0385 0.0256  97  LEU A CD1 
765  C CD2 . LEU A 97  ? 0.5502 0.5343 0.5585 0.0214  -0.0333 0.0227  97  LEU A CD2 
766  N N   . TYR A 98  ? 0.5483 0.5043 0.5230 0.0190  -0.0365 0.0169  98  TYR A N   
767  C CA  . TYR A 98  ? 0.4649 0.4122 0.4269 0.0202  -0.0354 0.0159  98  TYR A CA  
768  C C   . TYR A 98  ? 0.4765 0.4202 0.4364 0.0190  -0.0285 0.0167  98  TYR A C   
769  O O   . TYR A 98  ? 0.6571 0.6045 0.6251 0.0164  -0.0259 0.0168  98  TYR A O   
770  C CB  . TYR A 98  ? 0.4735 0.4188 0.4326 0.0186  -0.0392 0.0126  98  TYR A CB  
771  C CG  . TYR A 98  ? 0.6321 0.5811 0.5932 0.0185  -0.0470 0.0117  98  TYR A CG  
772  C CD1 . TYR A 98  ? 0.6162 0.5613 0.5669 0.0214  -0.0512 0.0111  98  TYR A CD1 
773  C CD2 . TYR A 98  ? 0.6689 0.6262 0.6425 0.0151  -0.0504 0.0116  98  TYR A CD2 
774  C CE1 . TYR A 98  ? 0.5930 0.5426 0.5460 0.0209  -0.0592 0.0104  98  TYR A CE1 
775  C CE2 . TYR A 98  ? 0.6628 0.6253 0.6394 0.0140  -0.0580 0.0111  98  TYR A CE2 
776  C CZ  . TYR A 98  ? 0.6038 0.5627 0.5704 0.0168  -0.0626 0.0104  98  TYR A CZ  
777  O OH  . TYR A 98  ? 0.5022 0.4673 0.4724 0.0152  -0.0707 0.0100  98  TYR A OH  
778  N N   . LEU A 99  ? 0.4473 0.3846 0.3964 0.0205  -0.0255 0.0177  99  LEU A N   
779  C CA  . LEU A 99  ? 0.5276 0.4631 0.4753 0.0184  -0.0193 0.0187  99  LEU A CA  
780  C C   . LEU A 99  ? 0.5737 0.5062 0.5130 0.0189  -0.0175 0.0173  99  LEU A C   
781  O O   . LEU A 99  ? 0.6827 0.6121 0.6146 0.0213  -0.0209 0.0158  99  LEU A O   
782  C CB  . LEU A 99  ? 0.4083 0.3396 0.3519 0.0185  -0.0158 0.0219  99  LEU A CB  
783  C CG  . LEU A 99  ? 0.4286 0.3529 0.3604 0.0219  -0.0172 0.0237  99  LEU A CG  
784  C CD1 . LEU A 99  ? 0.4053 0.3255 0.3268 0.0212  -0.0137 0.0244  99  LEU A CD1 
785  C CD2 . LEU A 99  ? 0.3855 0.3048 0.3151 0.0231  -0.0161 0.0266  99  LEU A CD2 
786  N N   . ASN A 100 ? 0.4443 0.3784 0.3846 0.0169  -0.0122 0.0180  100 ASN A N   
787  C CA  . ASN A 100 ? 0.5194 0.4527 0.4528 0.0180  -0.0092 0.0170  100 ASN A CA  
788  C C   . ASN A 100 ? 0.5002 0.4330 0.4284 0.0165  -0.0033 0.0204  100 ASN A C   
789  O O   . ASN A 100 ? 0.6062 0.5400 0.5388 0.0133  -0.0011 0.0228  100 ASN A O   
790  C CB  . ASN A 100 ? 0.4250 0.3626 0.3656 0.0173  -0.0083 0.0147  100 ASN A CB  
791  C CG  . ASN A 100 ? 0.4406 0.3786 0.3881 0.0169  -0.0139 0.0123  100 ASN A CG  
792  O OD1 . ASN A 100 ? 0.4226 0.3647 0.3801 0.0143  -0.0139 0.0128  100 ASN A OD1 
793  N ND2 . ASN A 100 ? 0.3711 0.3048 0.3127 0.0189  -0.0188 0.0099  100 ASN A ND2 
794  N N   . VAL A 101 ? 0.4657 0.3968 0.3840 0.0185  -0.0009 0.0206  101 VAL A N   
795  C CA  . VAL A 101 ? 0.5435 0.4755 0.4568 0.0164  0.0051  0.0243  101 VAL A CA  
796  C C   . VAL A 101 ? 0.5225 0.4601 0.4335 0.0180  0.0098  0.0236  101 VAL A C   
797  O O   . VAL A 101 ? 0.6425 0.5778 0.5462 0.0224  0.0085  0.0209  101 VAL A O   
798  C CB  . VAL A 101 ? 0.5509 0.4752 0.4518 0.0175  0.0047  0.0269  101 VAL A CB  
799  C CG1 . VAL A 101 ? 0.5620 0.4872 0.4578 0.0140  0.0112  0.0313  101 VAL A CG1 
800  C CG2 . VAL A 101 ? 0.4909 0.4098 0.3936 0.0172  0.0005  0.0278  101 VAL A CG2 
801  N N   . TRP A 102 ? 0.4278 0.3731 0.3447 0.0146  0.0149  0.0259  102 TRP A N   
802  C CA  . TRP A 102 ? 0.5150 0.4678 0.4299 0.0164  0.0204  0.0264  102 TRP A CA  
803  C C   . TRP A 102 ? 0.5727 0.5281 0.4830 0.0122  0.0258  0.0316  102 TRP A C   
804  O O   . TRP A 102 ? 0.5646 0.5196 0.4791 0.0062  0.0263  0.0347  102 TRP A O   
805  C CB  . TRP A 102 ? 0.5579 0.5204 0.4847 0.0160  0.0221  0.0253  102 TRP A CB  
806  C CG  . TRP A 102 ? 0.6002 0.5608 0.5313 0.0201  0.0178  0.0206  102 TRP A CG  
807  C CD1 . TRP A 102 ? 0.6227 0.5839 0.5508 0.0259  0.0183  0.0174  102 TRP A CD1 
808  C CD2 . TRP A 102 ? 0.5503 0.5076 0.4890 0.0183  0.0126  0.0189  102 TRP A CD2 
809  N NE1 . TRP A 102 ? 0.5283 0.4855 0.4614 0.0272  0.0134  0.0139  102 TRP A NE1 
810  C CE2 . TRP A 102 ? 0.5501 0.5059 0.4902 0.0223  0.0100  0.0150  102 TRP A CE2 
811  C CE3 . TRP A 102 ? 0.5998 0.5551 0.5437 0.0139  0.0102  0.0204  102 TRP A CE3 
812  C CZ2 . TRP A 102 ? 0.5707 0.5237 0.5177 0.0211  0.0051  0.0131  102 TRP A CZ2 
813  C CZ3 . TRP A 102 ? 0.6155 0.5694 0.5666 0.0135  0.0057  0.0183  102 TRP A CZ3 
814  C CH2 . TRP A 102 ? 0.5973 0.5504 0.5502 0.0166  0.0032  0.0150  102 TRP A CH2 
815  N N   . THR A 103 ? 0.5346 0.4921 0.4358 0.0149  0.0300  0.0327  103 THR A N   
816  C CA  . THR A 103 ? 0.5192 0.4802 0.4157 0.0104  0.0358  0.0382  103 THR A CA  
817  C C   . THR A 103 ? 0.5849 0.5576 0.4804 0.0139  0.0420  0.0385  103 THR A C   
818  O O   . THR A 103 ? 0.5883 0.5613 0.4820 0.0210  0.0410  0.0340  103 THR A O   
819  C CB  . THR A 103 ? 0.5781 0.5274 0.4598 0.0107  0.0347  0.0404  103 THR A CB  
820  O OG1 . THR A 103 ? 0.6938 0.6406 0.5649 0.0178  0.0346  0.0376  103 THR A OG1 
821  C CG2 . THR A 103 ? 0.5664 0.5041 0.4476 0.0101  0.0281  0.0394  103 THR A CG2 
822  N N   . PRO A 104 ? 0.5937 0.5759 0.4901 0.0090  0.0484  0.0438  104 PRO A N   
823  C CA  . PRO A 104 ? 0.5504 0.5449 0.4444 0.0130  0.0552  0.0449  104 PRO A CA  
824  C C   . PRO A 104 ? 0.6426 0.6284 0.5206 0.0203  0.0552  0.0424  104 PRO A C   
825  O O   . PRO A 104 ? 0.6819 0.6535 0.5506 0.0202  0.0504  0.0418  104 PRO A O   
826  C CB  . PRO A 104 ? 0.5166 0.5189 0.4111 0.0046  0.0610  0.0521  104 PRO A CB  
827  C CG  . PRO A 104 ? 0.5381 0.5369 0.4414 -0.0037 0.0572  0.0537  104 PRO A CG  
828  C CD  . PRO A 104 ? 0.5895 0.5719 0.4893 -0.0006 0.0495  0.0491  104 PRO A CD  
829  N N   . TYR A 105 ? 0.6534 0.6476 0.5279 0.0271  0.0601  0.0409  105 TYR A N   
830  C CA  . TYR A 105 ? 0.6726 0.6594 0.5302 0.0342  0.0610  0.0388  105 TYR A CA  
831  C C   . TYR A 105 ? 0.8004 0.8011 0.6541 0.0350  0.0707  0.0434  105 TYR A C   
832  O O   . TYR A 105 ? 0.8825 0.8987 0.7453 0.0376  0.0759  0.0436  105 TYR A O   
833  C CB  . TYR A 105 ? 0.6300 0.6115 0.4852 0.0433  0.0572  0.0313  105 TYR A CB  
834  C CG  . TYR A 105 ? 0.6195 0.5919 0.4557 0.0512  0.0572  0.0279  105 TYR A CG  
835  C CD1 . TYR A 105 ? 0.6973 0.6532 0.5238 0.0532  0.0491  0.0235  105 TYR A CD1 
836  C CD2 . TYR A 105 ? 0.5966 0.5773 0.4245 0.0567  0.0652  0.0289  105 TYR A CD2 
837  C CE1 . TYR A 105 ? 0.7450 0.6919 0.5531 0.0601  0.0484  0.0201  105 TYR A CE1 
838  C CE2 . TYR A 105 ? 0.6387 0.6102 0.4477 0.0643  0.0653  0.0254  105 TYR A CE2 
839  C CZ  . TYR A 105 ? 0.6803 0.6343 0.4790 0.0658  0.0566  0.0208  105 TYR A CZ  
840  O OH  . TYR A 105 ? 0.6219 0.5661 0.4007 0.0730  0.0560  0.0171  105 TYR A OH  
841  N N   . PRO A 106 ? 0.7651 0.7610 0.6053 0.0328  0.0734  0.0475  106 PRO A N   
842  C CA  . PRO A 106 ? 0.6948 0.6725 0.5240 0.0306  0.0671  0.0476  106 PRO A CA  
843  C C   . PRO A 106 ? 0.7014 0.6764 0.5402 0.0207  0.0642  0.0515  106 PRO A C   
844  O O   . PRO A 106 ? 0.7170 0.7045 0.5697 0.0153  0.0674  0.0543  106 PRO A O   
845  C CB  . PRO A 106 ? 0.6350 0.6116 0.4477 0.0308  0.0727  0.0523  106 PRO A CB  
846  C CG  . PRO A 106 ? 0.6561 0.6514 0.4716 0.0337  0.0825  0.0542  106 PRO A CG  
847  C CD  . PRO A 106 ? 0.7228 0.7318 0.5585 0.0315  0.0831  0.0535  106 PRO A CD  
848  N N   . ARG A 107 ? 0.6813 0.6405 0.5125 0.0189  0.0582  0.0518  107 ARG A N   
849  C CA  . ARG A 107 ? 0.6168 0.5701 0.4553 0.0111  0.0544  0.0545  107 ARG A CA  
850  C C   . ARG A 107 ? 0.7167 0.6755 0.5561 0.0020  0.0605  0.0621  107 ARG A C   
851  O O   . ARG A 107 ? 0.7809 0.7451 0.6120 0.0015  0.0669  0.0662  107 ARG A O   
852  C CB  . ARG A 107 ? 0.5981 0.5337 0.4270 0.0129  0.0470  0.0532  107 ARG A CB  
853  C CG  . ARG A 107 ? 0.7677 0.6987 0.5987 0.0199  0.0398  0.0459  107 ARG A CG  
854  C CD  . ARG A 107 ? 0.8710 0.7881 0.6972 0.0204  0.0322  0.0454  107 ARG A CD  
855  N NE  . ARG A 107 ? 0.8517 0.7595 0.6600 0.0226  0.0320  0.0482  107 ARG A NE  
856  C CZ  . ARG A 107 ? 0.7660 0.6706 0.5630 0.0292  0.0299  0.0448  107 ARG A CZ  
857  N NH1 . ARG A 107 ? 0.8073 0.7161 0.6090 0.0338  0.0278  0.0386  107 ARG A NH1 
858  N NH2 . ARG A 107 ? 0.8042 0.7003 0.5843 0.0312  0.0297  0.0477  107 ARG A NH2 
859  N N   . PRO A 108 ? 0.8328 0.7904 0.6822 -0.0057 0.0585  0.0640  108 PRO A N   
860  C CA  . PRO A 108 ? 0.8913 0.8540 0.7430 -0.0160 0.0633  0.0710  108 PRO A CA  
861  C C   . PRO A 108 ? 0.9810 0.9326 0.8164 -0.0198 0.0656  0.0772  108 PRO A C   
862  O O   . PRO A 108 ? 0.9436 0.8783 0.7668 -0.0163 0.0609  0.0764  108 PRO A O   
863  C CB  . PRO A 108 ? 0.8530 0.8099 0.7147 -0.0217 0.0582  0.0701  108 PRO A CB  
864  C CG  . PRO A 108 ? 0.7355 0.6948 0.6063 -0.0146 0.0536  0.0630  108 PRO A CG  
865  C CD  . PRO A 108 ? 0.7922 0.7455 0.6523 -0.0052 0.0518  0.0594  108 PRO A CD  
866  N N   . ALA A 109 ? 1.0507 1.0127 0.8862 -0.0272 0.0727  0.0837  109 ALA A N   
867  C CA  . ALA A 109 ? 1.1773 1.1300 0.9981 -0.0331 0.0758  0.0910  109 ALA A CA  
868  C C   . ALA A 109 ? 1.1538 1.0872 0.9705 -0.0403 0.0706  0.0934  109 ALA A C   
869  O O   . ALA A 109 ? 1.0533 0.9678 0.8564 -0.0369 0.0663  0.0936  109 ALA A O   
870  C CB  . ALA A 109 ? 1.2065 1.1778 1.0319 -0.0410 0.0846  0.0976  109 ALA A CB  
871  N N   . SER A 110 ? 1.0435 0.9819 0.8717 -0.0498 0.0708  0.0954  110 SER A N   
872  C CA  . SER A 110 ? 0.9590 0.8792 0.7840 -0.0566 0.0659  0.0970  110 SER A CA  
873  C C   . SER A 110 ? 0.9021 0.8177 0.7362 -0.0508 0.0590  0.0895  110 SER A C   
874  O O   . SER A 110 ? 0.7715 0.7013 0.6179 -0.0455 0.0587  0.0844  110 SER A O   
875  C CB  . SER A 110 ? 1.0315 0.9596 0.8639 -0.0702 0.0693  0.1024  110 SER A CB  
876  O OG  . SER A 110 ? 1.1115 1.0657 0.9594 -0.0704 0.0738  0.1015  110 SER A OG  
877  N N   . PRO A 111 ? 0.8796 0.7749 0.7070 -0.0514 0.0534  0.0891  111 PRO A N   
878  C CA  . PRO A 111 ? 0.9577 0.8488 0.7935 -0.0467 0.0472  0.0828  111 PRO A CA  
879  C C   . PRO A 111 ? 0.8834 0.7895 0.7368 -0.0515 0.0477  0.0803  111 PRO A C   
880  O O   . PRO A 111 ? 0.8144 0.7229 0.6710 -0.0619 0.0496  0.0840  111 PRO A O   
881  C CB  . PRO A 111 ? 0.8724 0.7395 0.6966 -0.0492 0.0431  0.0848  111 PRO A CB  
882  C CG  . PRO A 111 ? 0.7694 0.6302 0.5823 -0.0584 0.0474  0.0926  111 PRO A CG  
883  C CD  . PRO A 111 ? 0.7407 0.6150 0.5512 -0.0554 0.0526  0.0945  111 PRO A CD  
884  N N   . THR A 112 ? 0.7702 0.6857 0.6342 -0.0439 0.0454  0.0742  112 THR A N   
885  C CA  . THR A 112 ? 0.7131 0.6439 0.5935 -0.0462 0.0456  0.0715  112 THR A CA  
886  C C   . THR A 112 ? 0.5905 0.5121 0.4756 -0.0455 0.0398  0.0675  112 THR A C   
887  O O   . THR A 112 ? 0.6531 0.5633 0.5333 -0.0385 0.0357  0.0644  112 THR A O   
888  C CB  . THR A 112 ? 0.7404 0.6867 0.6285 -0.0378 0.0470  0.0674  112 THR A CB  
889  O OG1 . THR A 112 ? 0.6920 0.6447 0.5729 -0.0361 0.0523  0.0705  112 THR A OG1 
890  C CG2 . THR A 112 ? 0.7209 0.6845 0.6255 -0.0401 0.0479  0.0657  112 THR A CG2 
891  N N   . PRO A 113 ? 0.5360 0.4635 0.4306 -0.0525 0.0396  0.0676  113 PRO A N   
892  C CA  . PRO A 113 ? 0.6535 0.5730 0.5521 -0.0519 0.0346  0.0638  113 PRO A CA  
893  C C   . PRO A 113 ? 0.6656 0.5920 0.5728 -0.0424 0.0320  0.0580  113 PRO A C   
894  O O   . PRO A 113 ? 0.6685 0.6100 0.5834 -0.0390 0.0341  0.0567  113 PRO A O   
895  C CB  . PRO A 113 ? 0.6367 0.5653 0.5441 -0.0617 0.0356  0.0653  113 PRO A CB  
896  C CG  . PRO A 113 ? 0.5480 0.4857 0.4537 -0.0690 0.0408  0.0712  113 PRO A CG  
897  C CD  . PRO A 113 ? 0.5152 0.4588 0.4177 -0.0611 0.0438  0.0712  113 PRO A CD  
898  N N   . VAL A 114 ? 0.6337 0.5489 0.5394 -0.0381 0.0276  0.0547  114 VAL A N   
899  C CA  . VAL A 114 ? 0.5113 0.4310 0.4235 -0.0295 0.0247  0.0499  114 VAL A CA  
900  C C   . VAL A 114 ? 0.4828 0.4079 0.4062 -0.0303 0.0225  0.0467  114 VAL A C   
901  O O   . VAL A 114 ? 0.6716 0.5890 0.5938 -0.0342 0.0211  0.0469  114 VAL A O   
902  C CB  . VAL A 114 ? 0.5255 0.4313 0.4289 -0.0231 0.0211  0.0486  114 VAL A CB  
903  C CG1 . VAL A 114 ? 0.5421 0.4535 0.4528 -0.0154 0.0178  0.0439  114 VAL A CG1 
904  C CG2 . VAL A 114 ? 0.5293 0.4281 0.4198 -0.0221 0.0227  0.0521  114 VAL A CG2 
905  N N   . LEU A 115 ? 0.4929 0.4303 0.4262 -0.0263 0.0223  0.0438  115 LEU A N   
906  C CA  . LEU A 115 ? 0.5287 0.4702 0.4717 -0.0256 0.0198  0.0407  115 LEU A CA  
907  C C   . LEU A 115 ? 0.5140 0.4519 0.4581 -0.0182 0.0161  0.0371  115 LEU A C   
908  O O   . LEU A 115 ? 0.5482 0.4884 0.4911 -0.0131 0.0157  0.0358  115 LEU A O   
909  C CB  . LEU A 115 ? 0.5293 0.4867 0.4830 -0.0267 0.0216  0.0403  115 LEU A CB  
910  C CG  . LEU A 115 ? 0.5691 0.5347 0.5256 -0.0346 0.0247  0.0438  115 LEU A CG  
911  C CD1 . LEU A 115 ? 0.5745 0.5571 0.5409 -0.0327 0.0268  0.0435  115 LEU A CD1 
912  C CD2 . LEU A 115 ? 0.6811 0.6422 0.6394 -0.0403 0.0225  0.0437  115 LEU A CD2 
913  N N   . ILE A 116 ? 0.3924 0.3250 0.3384 -0.0177 0.0135  0.0356  116 ILE A N   
914  C CA  . ILE A 116 ? 0.4386 0.3709 0.3881 -0.0116 0.0101  0.0325  116 ILE A CA  
915  C C   . ILE A 116 ? 0.4632 0.4033 0.4234 -0.0121 0.0091  0.0305  116 ILE A C   
916  O O   . ILE A 116 ? 0.5139 0.4522 0.4755 -0.0155 0.0093  0.0307  116 ILE A O   
917  C CB  . ILE A 116 ? 0.4448 0.3657 0.3881 -0.0090 0.0079  0.0326  116 ILE A CB  
918  C CG1 . ILE A 116 ? 0.4549 0.3660 0.3862 -0.0089 0.0088  0.0353  116 ILE A CG1 
919  C CG2 . ILE A 116 ? 0.3507 0.2743 0.2990 -0.0030 0.0045  0.0300  116 ILE A CG2 
920  C CD1 . ILE A 116 ? 0.5145 0.4144 0.4391 -0.0045 0.0063  0.0354  116 ILE A CD1 
921  N N   . TRP A 117 ? 0.4167 0.3639 0.3830 -0.0087 0.0079  0.0285  117 TRP A N   
922  C CA  . TRP A 117 ? 0.4738 0.4276 0.4494 -0.0090 0.0068  0.0269  117 TRP A CA  
923  C C   . TRP A 117 ? 0.5371 0.4885 0.5154 -0.0060 0.0037  0.0253  117 TRP A C   
924  O O   . TRP A 117 ? 0.5210 0.4698 0.4970 -0.0022 0.0016  0.0244  117 TRP A O   
925  C CB  . TRP A 117 ? 0.4920 0.4533 0.4721 -0.0069 0.0070  0.0257  117 TRP A CB  
926  C CG  . TRP A 117 ? 0.5084 0.4749 0.4971 -0.0067 0.0055  0.0244  117 TRP A CG  
927  C CD1 . TRP A 117 ? 0.4340 0.4007 0.4262 -0.0037 0.0027  0.0224  117 TRP A CD1 
928  C CD2 . TRP A 117 ? 0.5361 0.5080 0.5303 -0.0101 0.0065  0.0253  117 TRP A CD2 
929  N NE1 . TRP A 117 ? 0.4768 0.4480 0.4759 -0.0049 0.0022  0.0223  117 TRP A NE1 
930  C CE2 . TRP A 117 ? 0.5252 0.4999 0.5257 -0.0085 0.0045  0.0240  117 TRP A CE2 
931  C CE3 . TRP A 117 ? 0.5553 0.5297 0.5493 -0.0149 0.0086  0.0273  117 TRP A CE3 
932  C CZ2 . TRP A 117 ? 0.5663 0.5462 0.5723 -0.0107 0.0047  0.0247  117 TRP A CZ2 
933  C CZ3 . TRP A 117 ? 0.5318 0.5120 0.5318 -0.0174 0.0084  0.0276  117 TRP A CZ3 
934  C CH2 . TRP A 117 ? 0.5688 0.5517 0.5745 -0.0149 0.0065  0.0264  117 TRP A CH2 
935  N N   . ILE A 118 ? 0.5397 0.4926 0.5226 -0.0077 0.0036  0.0250  118 ILE A N   
936  C CA  . ILE A 118 ? 0.4630 0.4166 0.4502 -0.0051 0.0013  0.0238  118 ILE A CA  
937  C C   . ILE A 118 ? 0.5332 0.4940 0.5288 -0.0063 0.0008  0.0231  118 ILE A C   
938  O O   . ILE A 118 ? 0.5485 0.5111 0.5459 -0.0092 0.0021  0.0237  118 ILE A O   
939  C CB  . ILE A 118 ? 0.4425 0.3906 0.4263 -0.0051 0.0019  0.0242  118 ILE A CB  
940  C CG1 . ILE A 118 ? 0.3894 0.3278 0.3631 -0.0049 0.0028  0.0254  118 ILE A CG1 
941  C CG2 . ILE A 118 ? 0.2273 0.1777 0.2154 -0.0010 -0.0002 0.0234  118 ILE A CG2 
942  C CD1 . ILE A 118 ? 0.2416 0.1722 0.2103 -0.0017 0.0024  0.0254  118 ILE A CD1 
943  N N   . TYR A 119 ? 0.4331 0.3972 0.4330 -0.0042 -0.0015 0.0221  119 TYR A N   
944  C CA  . TYR A 119 ? 0.4601 0.4293 0.4668 -0.0053 -0.0022 0.0218  119 TYR A CA  
945  C C   . TYR A 119 ? 0.4913 0.4627 0.5022 -0.0066 -0.0020 0.0224  119 TYR A C   
946  O O   . TYR A 119 ? 0.4871 0.4569 0.4969 -0.0052 -0.0022 0.0225  119 TYR A O   
947  C CB  . TYR A 119 ? 0.5336 0.5032 0.5424 -0.0034 -0.0051 0.0205  119 TYR A CB  
948  C CG  . TYR A 119 ? 0.5095 0.4786 0.5193 -0.0019 -0.0081 0.0200  119 TYR A CG  
949  C CD1 . TYR A 119 ? 0.4273 0.4002 0.4430 -0.0027 -0.0090 0.0207  119 TYR A CD1 
950  C CD2 . TYR A 119 ? 0.3761 0.3419 0.3810 0.0005  -0.0101 0.0190  119 TYR A CD2 
951  C CE1 . TYR A 119 ? 0.5033 0.4782 0.5212 -0.0013 -0.0118 0.0206  119 TYR A CE1 
952  C CE2 . TYR A 119 ? 0.3640 0.3307 0.3703 0.0019  -0.0135 0.0187  119 TYR A CE2 
953  C CZ  . TYR A 119 ? 0.5499 0.5219 0.5634 0.0010  -0.0144 0.0196  119 TYR A CZ  
954  O OH  . TYR A 119 ? 0.4374 0.4127 0.4536 0.0023  -0.0178 0.0197  119 TYR A OH  
955  N N   . GLY A 120 ? 0.5428 0.5180 0.5579 -0.0086 -0.0017 0.0229  120 GLY A N   
956  C CA  . GLY A 120 ? 0.4752 0.4531 0.4943 -0.0096 -0.0017 0.0236  120 GLY A CA  
957  C C   . GLY A 120 ? 0.4857 0.4663 0.5104 -0.0093 -0.0041 0.0237  120 GLY A C   
958  O O   . GLY A 120 ? 0.3693 0.3485 0.3940 -0.0081 -0.0062 0.0228  120 GLY A O   
959  N N   . GLY A 121 ? 0.4870 0.4712 0.5157 -0.0109 -0.0038 0.0250  121 GLY A N   
960  C CA  . GLY A 121 ? 0.4088 0.3956 0.4429 -0.0119 -0.0059 0.0258  121 GLY A CA  
961  C C   . GLY A 121 ? 0.4219 0.4138 0.4598 -0.0125 -0.0049 0.0272  121 GLY A C   
962  O O   . GLY A 121 ? 0.4188 0.4144 0.4615 -0.0132 -0.0066 0.0280  121 GLY A O   
963  N N   . GLY A 122 ? 0.3192 0.3116 0.3544 -0.0123 -0.0020 0.0276  122 GLY A N   
964  C CA  . GLY A 122 ? 0.3088 0.3061 0.3461 -0.0121 0.0000  0.0289  122 GLY A CA  
965  C C   . GLY A 122 ? 0.4866 0.4872 0.5256 -0.0089 0.0003  0.0287  122 GLY A C   
966  O O   . GLY A 122 ? 0.4519 0.4590 0.4942 -0.0082 0.0020  0.0301  122 GLY A O   
967  N N   . PHE A 123 ? 0.4146 0.4118 0.4513 -0.0067 -0.0013 0.0272  123 PHE A N   
968  C CA  . PHE A 123 ? 0.4249 0.4258 0.4637 -0.0032 -0.0020 0.0272  123 PHE A CA  
969  C C   . PHE A 123 ? 0.5031 0.5128 0.5511 -0.0050 -0.0048 0.0288  123 PHE A C   
970  O O   . PHE A 123 ? 0.4616 0.4781 0.5137 -0.0024 -0.0056 0.0294  123 PHE A O   
971  C CB  . PHE A 123 ? 0.3495 0.3515 0.3855 0.0005  0.0015  0.0274  123 PHE A CB  
972  C CG  . PHE A 123 ? 0.4177 0.4092 0.4434 0.0021  0.0033  0.0257  123 PHE A CG  
973  C CD1 . PHE A 123 ? 0.4544 0.4392 0.4748 0.0047  0.0022  0.0247  123 PHE A CD1 
974  C CD2 . PHE A 123 ? 0.4288 0.4167 0.4496 0.0007  0.0059  0.0254  123 PHE A CD2 
975  C CE1 . PHE A 123 ? 0.4313 0.4056 0.4418 0.0053  0.0037  0.0236  123 PHE A CE1 
976  C CE2 . PHE A 123 ? 0.4431 0.4208 0.4542 0.0010  0.0070  0.0239  123 PHE A CE2 
977  C CZ  . PHE A 123 ? 0.4862 0.4568 0.4921 0.0031  0.0060  0.0231  123 PHE A CZ  
978  N N   . TYR A 124 ? 0.4476 0.4571 0.4986 -0.0094 -0.0066 0.0294  124 TYR A N   
979  C CA  . TYR A 124 ? 0.4684 0.4835 0.5267 -0.0127 -0.0100 0.0308  124 TYR A CA  
980  C C   . TYR A 124 ? 0.4117 0.4192 0.4674 -0.0149 -0.0140 0.0292  124 TYR A C   
981  O O   . TYR A 124 ? 0.4521 0.4609 0.5119 -0.0185 -0.0176 0.0299  124 TYR A O   
982  C CB  . TYR A 124 ? 0.5074 0.5287 0.5711 -0.0164 -0.0084 0.0337  124 TYR A CB  
983  C CG  . TYR A 124 ? 0.5735 0.5878 0.6339 -0.0194 -0.0083 0.0340  124 TYR A CG  
984  C CD1 . TYR A 124 ? 0.5195 0.5289 0.5806 -0.0230 -0.0120 0.0340  124 TYR A CD1 
985  C CD2 . TYR A 124 ? 0.5099 0.5218 0.5658 -0.0184 -0.0048 0.0341  124 TYR A CD2 
986  C CE1 . TYR A 124 ? 0.5705 0.5732 0.6284 -0.0246 -0.0120 0.0344  124 TYR A CE1 
987  C CE2 . TYR A 124 ? 0.5165 0.5232 0.5699 -0.0206 -0.0050 0.0346  124 TYR A CE2 
988  C CZ  . TYR A 124 ? 0.5719 0.5742 0.6266 -0.0233 -0.0085 0.0349  124 TYR A CZ  
989  O OH  . TYR A 124 ? 0.6258 0.6226 0.6776 -0.0243 -0.0089 0.0356  124 TYR A OH  
990  N N   . SER A 125 ? 0.3519 0.3512 0.4005 -0.0129 -0.0134 0.0271  125 SER A N   
991  C CA  . SER A 125 ? 0.4787 0.4708 0.5237 -0.0135 -0.0165 0.0253  125 SER A CA  
992  C C   . SER A 125 ? 0.5059 0.4920 0.5435 -0.0103 -0.0149 0.0234  125 SER A C   
993  O O   . SER A 125 ? 0.4055 0.3920 0.4405 -0.0085 -0.0118 0.0236  125 SER A O   
994  C CB  . SER A 125 ? 0.3808 0.3694 0.4267 -0.0167 -0.0173 0.0261  125 SER A CB  
995  O OG  . SER A 125 ? 0.3798 0.3698 0.4257 -0.0169 -0.0137 0.0276  125 SER A OG  
996  N N   . GLY A 126 ? 0.3914 0.3715 0.4248 -0.0097 -0.0171 0.0216  126 GLY A N   
997  C CA  . GLY A 126 ? 0.3414 0.3169 0.3678 -0.0068 -0.0156 0.0200  126 GLY A CA  
998  C C   . GLY A 126 ? 0.4066 0.3785 0.4282 -0.0048 -0.0185 0.0182  126 GLY A C   
999  O O   . GLY A 126 ? 0.5727 0.5468 0.5965 -0.0052 -0.0216 0.0181  126 GLY A O   
1000 N N   . ALA A 127 ? 0.5248 0.4919 0.5398 -0.0026 -0.0173 0.0168  127 ALA A N   
1001 C CA  . ALA A 127 ? 0.6129 0.5756 0.6210 -0.0003 -0.0194 0.0149  127 ALA A CA  
1002 C C   . ALA A 127 ? 0.5714 0.5317 0.5729 0.0021  -0.0155 0.0147  127 ALA A C   
1003 O O   . ALA A 127 ? 0.5369 0.4985 0.5397 0.0018  -0.0127 0.0153  127 ALA A O   
1004 C CB  . ALA A 127 ? 0.4501 0.4081 0.4568 -0.0009 -0.0238 0.0129  127 ALA A CB  
1005 N N   . ALA A 128 ? 0.5005 0.4582 0.4952 0.0043  -0.0154 0.0143  128 ALA A N   
1006 C CA  . ALA A 128 ? 0.4690 0.4254 0.4575 0.0058  -0.0114 0.0148  128 ALA A CA  
1007 C C   . ALA A 128 ? 0.5600 0.5132 0.5431 0.0084  -0.0115 0.0126  128 ALA A C   
1008 O O   . ALA A 128 ? 0.6173 0.5712 0.5960 0.0100  -0.0077 0.0130  128 ALA A O   
1009 C CB  . ALA A 128 ? 0.3594 0.3133 0.3415 0.0070  -0.0109 0.0158  128 ALA A CB  
1010 N N   . SER A 129 ? 0.4530 0.4026 0.4362 0.0087  -0.0158 0.0104  129 SER A N   
1011 C CA  . SER A 129 ? 0.4414 0.3852 0.4173 0.0119  -0.0167 0.0077  129 SER A CA  
1012 C C   . SER A 129 ? 0.4831 0.4267 0.4617 0.0129  -0.0152 0.0071  129 SER A C   
1013 O O   . SER A 129 ? 0.5415 0.4796 0.5135 0.0166  -0.0155 0.0047  129 SER A O   
1014 C CB  . SER A 129 ? 0.3325 0.2702 0.3047 0.0116  -0.0230 0.0051  129 SER A CB  
1015 O OG  . SER A 129 ? 0.3324 0.2716 0.3132 0.0077  -0.0263 0.0057  129 SER A OG  
1016 N N   . LEU A 130 ? 0.4648 0.4137 0.4522 0.0102  -0.0138 0.0094  130 LEU A N   
1017 C CA  . LEU A 130 ? 0.4693 0.4190 0.4594 0.0116  -0.0122 0.0096  130 LEU A CA  
1018 C C   . LEU A 130 ? 0.4572 0.4102 0.4435 0.0159  -0.0074 0.0097  130 LEU A C   
1019 O O   . LEU A 130 ? 0.4913 0.4496 0.4765 0.0155  -0.0040 0.0112  130 LEU A O   
1020 C CB  . LEU A 130 ? 0.5009 0.4569 0.5001 0.0079  -0.0111 0.0124  130 LEU A CB  
1021 C CG  . LEU A 130 ? 0.5178 0.4738 0.5224 0.0036  -0.0143 0.0133  130 LEU A CG  
1022 C CD1 . LEU A 130 ? 0.4217 0.3835 0.4332 0.0011  -0.0123 0.0159  130 LEU A CD1 
1023 C CD2 . LEU A 130 ? 0.5499 0.4984 0.5529 0.0031  -0.0190 0.0115  130 LEU A CD2 
1024 N N   . ASP A 131 ? 0.4813 0.4315 0.4657 0.0199  -0.0072 0.0084  131 ASP A N   
1025 C CA  . ASP A 131 ? 0.4677 0.4232 0.4499 0.0248  -0.0025 0.0087  131 ASP A CA  
1026 C C   . ASP A 131 ? 0.5511 0.5194 0.5408 0.0222  0.0018  0.0124  131 ASP A C   
1027 O O   . ASP A 131 ? 0.5729 0.5476 0.5606 0.0235  0.0059  0.0135  131 ASP A O   
1028 C CB  . ASP A 131 ? 0.4272 0.3776 0.4076 0.0299  -0.0034 0.0071  131 ASP A CB  
1029 C CG  . ASP A 131 ? 0.5919 0.5280 0.5617 0.0333  -0.0071 0.0028  131 ASP A CG  
1030 O OD1 . ASP A 131 ? 0.6377 0.5693 0.6013 0.0322  -0.0089 0.0010  131 ASP A OD1 
1031 O OD2 . ASP A 131 ? 0.7874 0.7160 0.7543 0.0373  -0.0087 0.0012  131 ASP A OD2 
1032 N N   . VAL A 132 ? 0.4773 0.4491 0.4749 0.0179  0.0007  0.0145  132 VAL A N   
1033 C CA  . VAL A 132 ? 0.4945 0.4773 0.4982 0.0147  0.0040  0.0177  132 VAL A CA  
1034 C C   . VAL A 132 ? 0.5242 0.5088 0.5260 0.0107  0.0057  0.0189  132 VAL A C   
1035 O O   . VAL A 132 ? 0.5183 0.5108 0.5232 0.0076  0.0085  0.0214  132 VAL A O   
1036 C CB  . VAL A 132 ? 0.3503 0.3358 0.3615 0.0109  0.0023  0.0196  132 VAL A CB  
1037 C CG1 . VAL A 132 ? 0.4710 0.4561 0.4843 0.0148  0.0013  0.0195  132 VAL A CG1 
1038 C CG2 . VAL A 132 ? 0.3783 0.3575 0.3899 0.0070  -0.0008 0.0191  132 VAL A CG2 
1039 N N   . TYR A 133 ? 0.4541 0.4311 0.4506 0.0105  0.0037  0.0173  133 TYR A N   
1040 C CA  . TYR A 133 ? 0.4606 0.4377 0.4537 0.0077  0.0052  0.0187  133 TYR A CA  
1041 C C   . TYR A 133 ? 0.4890 0.4644 0.4736 0.0111  0.0073  0.0179  133 TYR A C   
1042 O O   . TYR A 133 ? 0.5191 0.4914 0.4986 0.0096  0.0077  0.0187  133 TYR A O   
1043 C CB  . TYR A 133 ? 0.5190 0.4902 0.5120 0.0053  0.0018  0.0182  133 TYR A CB  
1044 C CG  . TYR A 133 ? 0.4801 0.4526 0.4803 0.0026  -0.0001 0.0187  133 TYR A CG  
1045 C CD1 . TYR A 133 ? 0.3515 0.3300 0.3569 0.0000  0.0019  0.0207  133 TYR A CD1 
1046 C CD2 . TYR A 133 ? 0.3913 0.3596 0.3931 0.0023  -0.0039 0.0175  133 TYR A CD2 
1047 C CE1 . TYR A 133 ? 0.3713 0.3507 0.3820 -0.0023 0.0003  0.0212  133 TYR A CE1 
1048 C CE2 . TYR A 133 ? 0.3287 0.2990 0.3368 -0.0002 -0.0051 0.0184  133 TYR A CE2 
1049 C CZ  . TYR A 133 ? 0.4309 0.4061 0.4429 -0.0023 -0.0028 0.0202  133 TYR A CZ  
1050 O OH  . TYR A 133 ? 0.3139 0.2908 0.3310 -0.0046 -0.0038 0.0212  133 TYR A OH  
1051 N N   . ASP A 134 ? 0.4921 0.4689 0.4745 0.0160  0.0087  0.0166  134 ASP A N   
1052 C CA  . ASP A 134 ? 0.5419 0.5174 0.5153 0.0201  0.0112  0.0157  134 ASP A CA  
1053 C C   . ASP A 134 ? 0.5651 0.5489 0.5381 0.0175  0.0163  0.0192  134 ASP A C   
1054 O O   . ASP A 134 ? 0.4789 0.4733 0.4577 0.0168  0.0199  0.0215  134 ASP A O   
1055 C CB  . ASP A 134 ? 0.4837 0.4590 0.4547 0.0269  0.0120  0.0133  134 ASP A CB  
1056 C CG  . ASP A 134 ? 0.5563 0.5291 0.5162 0.0322  0.0146  0.0116  134 ASP A CG  
1057 O OD1 . ASP A 134 ? 0.6950 0.6678 0.6495 0.0304  0.0163  0.0131  134 ASP A OD1 
1058 O OD2 . ASP A 134 ? 0.5584 0.5282 0.5139 0.0387  0.0149  0.0089  134 ASP A OD2 
1059 N N   . GLY A 135 ? 0.5452 0.5241 0.5111 0.0157  0.0165  0.0201  135 GLY A N   
1060 C CA  . GLY A 135 ? 0.5074 0.4920 0.4716 0.0122  0.0210  0.0238  135 GLY A CA  
1061 C C   . GLY A 135 ? 0.5176 0.5072 0.4754 0.0162  0.0259  0.0245  135 GLY A C   
1062 O O   . GLY A 135 ? 0.5048 0.4982 0.4595 0.0129  0.0297  0.0280  135 GLY A O   
1063 N N   . ARG A 136 ? 0.5000 0.4892 0.4551 0.0232  0.0260  0.0213  136 ARG A N   
1064 C CA  . ARG A 136 ? 0.5235 0.5174 0.4713 0.0282  0.0311  0.0216  136 ARG A CA  
1065 C C   . ARG A 136 ? 0.6224 0.6330 0.5778 0.0261  0.0373  0.0259  136 ARG A C   
1066 O O   . ARG A 136 ? 0.5180 0.5347 0.4683 0.0266  0.0425  0.0284  136 ARG A O   
1067 C CB  . ARG A 136 ? 0.3781 0.3662 0.3195 0.0371  0.0299  0.0167  136 ARG A CB  
1068 C CG  . ARG A 136 ? 0.4861 0.4822 0.4349 0.0420  0.0317  0.0159  136 ARG A CG  
1069 C CD  . ARG A 136 ? 0.5240 0.5103 0.4634 0.0511  0.0302  0.0107  136 ARG A CD  
1070 N NE  . ARG A 136 ? 0.6218 0.5923 0.5571 0.0495  0.0228  0.0071  136 ARG A NE  
1071 C CZ  . ARG A 136 ? 0.6836 0.6409 0.6071 0.0545  0.0195  0.0024  136 ARG A CZ  
1072 N NH1 . ARG A 136 ? 0.7067 0.6520 0.6286 0.0514  0.0124  -0.0002 136 ARG A NH1 
1073 N NH2 . ARG A 136 ? 0.5955 0.5516 0.5083 0.0624  0.0232  0.0002  136 ARG A NH2 
1074 N N   . PHE A 137 ? 0.6017 0.6202 0.5691 0.0231  0.0365  0.0272  137 PHE A N   
1075 C CA  . PHE A 137 ? 0.5339 0.5702 0.5101 0.0211  0.0414  0.0312  137 PHE A CA  
1076 C C   . PHE A 137 ? 0.5795 0.6210 0.5579 0.0114  0.0434  0.0362  137 PHE A C   
1077 O O   . PHE A 137 ? 0.5888 0.6430 0.5684 0.0096  0.0489  0.0400  137 PHE A O   
1078 C CB  . PHE A 137 ? 0.4274 0.4703 0.4149 0.0222  0.0393  0.0307  137 PHE A CB  
1079 C CG  . PHE A 137 ? 0.5656 0.6014 0.5503 0.0312  0.0370  0.0262  137 PHE A CG  
1080 C CD1 . PHE A 137 ? 0.5935 0.6341 0.5742 0.0402  0.0410  0.0250  137 PHE A CD1 
1081 C CD2 . PHE A 137 ? 0.6377 0.6613 0.6230 0.0308  0.0311  0.0233  137 PHE A CD2 
1082 C CE1 . PHE A 137 ? 0.6509 0.6821 0.6272 0.0487  0.0385  0.0205  137 PHE A CE1 
1083 C CE2 . PHE A 137 ? 0.5806 0.5960 0.5625 0.0382  0.0286  0.0193  137 PHE A CE2 
1084 C CZ  . PHE A 137 ? 0.5230 0.5408 0.4996 0.0471  0.0320  0.0177  137 PHE A CZ  
1085 N N   . LEU A 138 ? 0.4526 0.4844 0.4314 0.0050  0.0391  0.0362  138 LEU A N   
1086 C CA  . LEU A 138 ? 0.4405 0.4724 0.4188 -0.0043 0.0401  0.0403  138 LEU A CA  
1087 C C   . LEU A 138 ? 0.5669 0.5932 0.5334 -0.0045 0.0431  0.0420  138 LEU A C   
1088 O O   . LEU A 138 ? 0.6078 0.6390 0.5731 -0.0111 0.0465  0.0467  138 LEU A O   
1089 C CB  . LEU A 138 ? 0.4375 0.4578 0.4164 -0.0091 0.0349  0.0392  138 LEU A CB  
1090 C CG  . LEU A 138 ? 0.5059 0.5314 0.4953 -0.0122 0.0323  0.0390  138 LEU A CG  
1091 C CD1 . LEU A 138 ? 0.5247 0.5367 0.5122 -0.0136 0.0274  0.0367  138 LEU A CD1 
1092 C CD2 . LEU A 138 ? 0.6612 0.6976 0.6562 -0.0206 0.0344  0.0434  138 LEU A CD2 
1093 N N   . ALA A 139 ? 0.5266 0.5424 0.4840 0.0022  0.0415  0.0386  139 ALA A N   
1094 C CA  . ALA A 139 ? 0.6625 0.6725 0.6073 0.0029  0.0440  0.0401  139 ALA A CA  
1095 C C   . ALA A 139 ? 0.6795 0.7037 0.6235 0.0049  0.0512  0.0430  139 ALA A C   
1096 O O   . ALA A 139 ? 0.6724 0.7005 0.6129 -0.0005 0.0553  0.0478  139 ALA A O   
1097 C CB  . ALA A 139 ? 0.6074 0.6035 0.5423 0.0097  0.0400  0.0356  139 ALA A CB  
1098 N N   . GLN A 140 ? 0.6911 0.7231 0.6383 0.0129  0.0527  0.0401  140 GLN A N   
1099 C CA  . GLN A 140 ? 0.6936 0.7406 0.6406 0.0171  0.0599  0.0422  140 GLN A CA  
1100 C C   . GLN A 140 ? 0.7011 0.7670 0.6597 0.0099  0.0643  0.0480  140 GLN A C   
1101 O O   . GLN A 140 ? 0.7529 0.8278 0.7089 0.0064  0.0700  0.0528  140 GLN A O   
1102 C CB  . GLN A 140 ? 0.6408 0.6902 0.5890 0.0280  0.0598  0.0374  140 GLN A CB  
1103 C CG  . GLN A 140 ? 0.7312 0.7895 0.6727 0.0362  0.0667  0.0375  140 GLN A CG  
1104 C CD  . GLN A 140 ? 0.7664 0.8490 0.7187 0.0348  0.0738  0.0428  140 GLN A CD  
1105 O OE1 . GLN A 140 ? 0.7304 0.8246 0.6969 0.0318  0.0729  0.0444  140 GLN A OE1 
1106 N NE2 . GLN A 140 ? 0.7271 0.8183 0.6725 0.0372  0.0809  0.0456  140 GLN A NE2 
1107 N N   . VAL A 141 ? 0.6358 0.7081 0.6072 0.0072  0.0614  0.0478  141 VAL A N   
1108 C CA  . VAL A 141 ? 0.6567 0.7496 0.6404 0.0016  0.0650  0.0528  141 VAL A CA  
1109 C C   . VAL A 141 ? 0.6531 0.7452 0.6377 -0.0117 0.0646  0.0577  141 VAL A C   
1110 O O   . VAL A 141 ? 0.6521 0.7599 0.6416 -0.0177 0.0692  0.0631  141 VAL A O   
1111 C CB  . VAL A 141 ? 0.6195 0.7216 0.6162 0.0045  0.0622  0.0510  141 VAL A CB  
1112 C CG1 . VAL A 141 ? 0.4971 0.6210 0.5069 -0.0026 0.0649  0.0565  141 VAL A CG1 
1113 C CG2 . VAL A 141 ? 0.5558 0.6608 0.5511 0.0179  0.0640  0.0471  141 VAL A CG2 
1114 N N   . GLU A 142 ? 0.6135 0.6871 0.5929 -0.0162 0.0591  0.0560  142 GLU A N   
1115 C CA  . GLU A 142 ? 0.5984 0.6675 0.5765 -0.0282 0.0582  0.0603  142 GLU A CA  
1116 C C   . GLU A 142 ? 0.5874 0.6411 0.5508 -0.0306 0.0591  0.0619  142 GLU A C   
1117 O O   . GLU A 142 ? 0.5511 0.5986 0.5111 -0.0403 0.0586  0.0656  142 GLU A O   
1118 C CB  . GLU A 142 ? 0.6104 0.6707 0.5933 -0.0328 0.0519  0.0581  142 GLU A CB  
1119 C CG  . GLU A 142 ? 0.7300 0.8066 0.7273 -0.0344 0.0510  0.0585  142 GLU A CG  
1120 C CD  . GLU A 142 ? 0.8929 0.9874 0.8976 -0.0437 0.0545  0.0645  142 GLU A CD  
1121 O OE1 . GLU A 142 ? 0.9749 1.0637 0.9734 -0.0530 0.0555  0.0683  142 GLU A OE1 
1122 O OE2 . GLU A 142 ? 0.9478 1.0621 0.9644 -0.0418 0.0559  0.0656  142 GLU A OE2 
1123 N N   . GLY A 143 ? 0.6782 0.7247 0.6320 -0.0217 0.0600  0.0591  143 GLY A N   
1124 C CA  . GLY A 143 ? 0.6616 0.6929 0.6005 -0.0224 0.0601  0.0603  143 GLY A CA  
1125 C C   . GLY A 143 ? 0.6598 0.6707 0.5932 -0.0240 0.0535  0.0580  143 GLY A C   
1126 O O   . GLY A 143 ? 0.6428 0.6403 0.5642 -0.0258 0.0530  0.0598  143 GLY A O   
1127 N N   . ALA A 144 ? 0.6613 0.6703 0.6030 -0.0228 0.0487  0.0541  144 ALA A N   
1128 C CA  . ALA A 144 ? 0.6048 0.5971 0.5433 -0.0242 0.0428  0.0520  144 ALA A CA  
1129 C C   . ALA A 144 ? 0.6171 0.5965 0.5463 -0.0166 0.0396  0.0485  144 ALA A C   
1130 O O   . ALA A 144 ? 0.6495 0.6322 0.5773 -0.0092 0.0401  0.0455  144 ALA A O   
1131 C CB  . ALA A 144 ? 0.4459 0.4419 0.3960 -0.0247 0.0393  0.0491  144 ALA A CB  
1132 N N   . VAL A 145 ? 0.5325 0.4969 0.4549 -0.0183 0.0360  0.0487  145 VAL A N   
1133 C CA  . VAL A 145 ? 0.5741 0.5276 0.4904 -0.0116 0.0315  0.0451  145 VAL A CA  
1134 C C   . VAL A 145 ? 0.5877 0.5393 0.5130 -0.0106 0.0266  0.0415  145 VAL A C   
1135 O O   . VAL A 145 ? 0.5990 0.5461 0.5266 -0.0152 0.0253  0.0425  145 VAL A O   
1136 C CB  . VAL A 145 ? 0.5426 0.4816 0.4461 -0.0126 0.0303  0.0479  145 VAL A CB  
1137 C CG1 . VAL A 145 ? 0.4609 0.3900 0.3611 -0.0062 0.0244  0.0442  145 VAL A CG1 
1138 C CG2 . VAL A 145 ? 0.5169 0.4571 0.4099 -0.0125 0.0349  0.0513  145 VAL A CG2 
1139 N N   . LEU A 146 ? 0.5764 0.5308 0.5059 -0.0047 0.0241  0.0373  146 LEU A N   
1140 C CA  . LEU A 146 ? 0.5909 0.5453 0.5296 -0.0044 0.0202  0.0344  146 LEU A CA  
1141 C C   . LEU A 146 ? 0.5809 0.5273 0.5171 0.0005  0.0150  0.0313  146 LEU A C   
1142 O O   . LEU A 146 ? 0.5250 0.4701 0.4565 0.0054  0.0135  0.0292  146 LEU A O   
1143 C CB  . LEU A 146 ? 0.5341 0.5001 0.4829 -0.0034 0.0214  0.0327  146 LEU A CB  
1144 C CG  . LEU A 146 ? 0.5924 0.5597 0.5507 -0.0059 0.0188  0.0316  146 LEU A CG  
1145 C CD1 . LEU A 146 ? 0.5886 0.5681 0.5558 -0.0088 0.0215  0.0329  146 LEU A CD1 
1146 C CD2 . LEU A 146 ? 0.6222 0.5863 0.5835 -0.0012 0.0142  0.0277  146 LEU A CD2 
1147 N N   . VAL A 147 ? 0.4393 0.3809 0.3786 -0.0009 0.0121  0.0311  147 VAL A N   
1148 C CA  . VAL A 147 ? 0.4504 0.3868 0.3891 0.0031  0.0072  0.0289  147 VAL A CA  
1149 C C   . VAL A 147 ? 0.5351 0.4754 0.4845 0.0027  0.0048  0.0268  147 VAL A C   
1150 O O   . VAL A 147 ? 0.5928 0.5349 0.5470 -0.0011 0.0064  0.0278  147 VAL A O   
1151 C CB  . VAL A 147 ? 0.5257 0.4520 0.4569 0.0032  0.0059  0.0310  147 VAL A CB  
1152 C CG1 . VAL A 147 ? 0.5791 0.5029 0.5113 0.0080  0.0007  0.0290  147 VAL A CG1 
1153 C CG2 . VAL A 147 ? 0.4776 0.3986 0.3970 0.0030  0.0083  0.0339  147 VAL A CG2 
1154 N N   . SER A 148 ? 0.4491 0.3903 0.4017 0.0062  0.0009  0.0241  148 SER A N   
1155 C CA  . SER A 148 ? 0.4473 0.3919 0.4095 0.0057  -0.0016 0.0226  148 SER A CA  
1156 C C   . SER A 148 ? 0.4339 0.3770 0.3970 0.0088  -0.0065 0.0211  148 SER A C   
1157 O O   . SER A 148 ? 0.3723 0.3133 0.3303 0.0115  -0.0091 0.0200  148 SER A O   
1158 C CB  . SER A 148 ? 0.3804 0.3313 0.3494 0.0050  -0.0010 0.0210  148 SER A CB  
1159 O OG  . SER A 148 ? 0.4204 0.3705 0.3856 0.0082  -0.0025 0.0189  148 SER A OG  
1160 N N   . MET A 149 ? 0.4268 0.3717 0.3962 0.0084  -0.0079 0.0213  149 MET A N   
1161 C CA  . MET A 149 ? 0.5043 0.4500 0.4756 0.0113  -0.0124 0.0206  149 MET A CA  
1162 C C   . MET A 149 ? 0.5165 0.4691 0.4986 0.0100  -0.0145 0.0195  149 MET A C   
1163 O O   . MET A 149 ? 0.5869 0.5424 0.5745 0.0075  -0.0122 0.0198  149 MET A O   
1164 C CB  . MET A 149 ? 0.4740 0.4159 0.4422 0.0134  -0.0122 0.0225  149 MET A CB  
1165 C CG  . MET A 149 ? 0.6228 0.5675 0.5978 0.0123  -0.0106 0.0229  149 MET A CG  
1166 S SD  . MET A 149 ? 0.5232 0.4643 0.4960 0.0078  -0.0055 0.0239  149 MET A SD  
1167 C CE  . MET A 149 ? 0.2898 0.2191 0.2500 0.0091  -0.0041 0.0261  149 MET A CE  
1168 N N   . ASN A 150 ? 0.3796 0.3349 0.3642 0.0113  -0.0192 0.0184  150 ASN A N   
1169 C CA  . ASN A 150 ? 0.3388 0.3012 0.3337 0.0097  -0.0216 0.0182  150 ASN A CA  
1170 C C   . ASN A 150 ? 0.3636 0.3295 0.3619 0.0120  -0.0212 0.0200  150 ASN A C   
1171 O O   . ASN A 150 ? 0.3588 0.3216 0.3514 0.0157  -0.0220 0.0209  150 ASN A O   
1172 C CB  . ASN A 150 ? 0.3313 0.2954 0.3277 0.0092  -0.0271 0.0166  150 ASN A CB  
1173 C CG  . ASN A 150 ? 0.4908 0.4509 0.4846 0.0072  -0.0273 0.0144  150 ASN A CG  
1174 O OD1 . ASN A 150 ? 0.4704 0.4281 0.4623 0.0068  -0.0230 0.0145  150 ASN A OD1 
1175 N ND2 . ASN A 150 ? 0.3660 0.3250 0.3593 0.0063  -0.0325 0.0126  150 ASN A ND2 
1176 N N   . TYR A 151 ? 0.3058 0.2774 0.3121 0.0104  -0.0196 0.0207  151 TYR A N   
1177 C CA  . TYR A 151 ? 0.4396 0.4156 0.4495 0.0134  -0.0190 0.0222  151 TYR A CA  
1178 C C   . TYR A 151 ? 0.5024 0.4890 0.5237 0.0111  -0.0204 0.0227  151 TYR A C   
1179 O O   . TYR A 151 ? 0.4699 0.4574 0.4947 0.0068  -0.0202 0.0221  151 TYR A O   
1180 C CB  . TYR A 151 ? 0.4806 0.4506 0.4855 0.0144  -0.0142 0.0229  151 TYR A CB  
1181 C CG  . TYR A 151 ? 0.5226 0.4934 0.5305 0.0102  -0.0111 0.0226  151 TYR A CG  
1182 C CD1 . TYR A 151 ? 0.4604 0.4265 0.4644 0.0069  -0.0095 0.0220  151 TYR A CD1 
1183 C CD2 . TYR A 151 ? 0.5647 0.5420 0.5795 0.0097  -0.0097 0.0232  151 TYR A CD2 
1184 C CE1 . TYR A 151 ? 0.4046 0.3724 0.4117 0.0034  -0.0072 0.0220  151 TYR A CE1 
1185 C CE2 . TYR A 151 ? 0.5187 0.4965 0.5354 0.0060  -0.0073 0.0232  151 TYR A CE2 
1186 C CZ  . TYR A 151 ? 0.4026 0.3756 0.4156 0.0029  -0.0063 0.0226  151 TYR A CZ  
1187 O OH  . TYR A 151 ? 0.4139 0.3884 0.4292 -0.0004 -0.0044 0.0228  151 TYR A OH  
1188 N N   . ARG A 152 ? 0.3954 0.3903 0.4225 0.0141  -0.0216 0.0240  152 ARG A N   
1189 C CA  . ARG A 152 ? 0.3251 0.3319 0.3637 0.0112  -0.0229 0.0251  152 ARG A CA  
1190 C C   . ARG A 152 ? 0.3340 0.3426 0.3761 0.0088  -0.0183 0.0258  152 ARG A C   
1191 O O   . ARG A 152 ? 0.3752 0.3818 0.4143 0.0118  -0.0142 0.0262  152 ARG A O   
1192 C CB  . ARG A 152 ? 0.4773 0.4953 0.5224 0.0153  -0.0251 0.0268  152 ARG A CB  
1193 C CG  . ARG A 152 ? 0.5149 0.5355 0.5604 0.0154  -0.0316 0.0265  152 ARG A CG  
1194 C CD  . ARG A 152 ? 0.4749 0.5064 0.5255 0.0211  -0.0336 0.0284  152 ARG A CD  
1195 N NE  . ARG A 152 ? 0.4881 0.5116 0.5296 0.0286  -0.0306 0.0286  152 ARG A NE  
1196 C CZ  . ARG A 152 ? 0.4642 0.4944 0.5080 0.0358  -0.0306 0.0304  152 ARG A CZ  
1197 N NH1 . ARG A 152 ? 0.3890 0.4368 0.4454 0.0366  -0.0331 0.0323  152 ARG A NH1 
1198 N NH2 . ARG A 152 ? 0.3507 0.3700 0.3840 0.0423  -0.0281 0.0304  152 ARG A NH2 
1199 N N   . VAL A 153 ? 0.3424 0.3538 0.3898 0.0033  -0.0193 0.0260  153 VAL A N   
1200 C CA  . VAL A 153 ? 0.3523 0.3666 0.4033 0.0008  -0.0156 0.0271  153 VAL A CA  
1201 C C   . VAL A 153 ? 0.5037 0.5316 0.5658 -0.0011 -0.0162 0.0296  153 VAL A C   
1202 O O   . VAL A 153 ? 0.4964 0.5323 0.5643 -0.0012 -0.0201 0.0304  153 VAL A O   
1203 C CB  . VAL A 153 ? 0.3835 0.3906 0.4319 -0.0037 -0.0155 0.0262  153 VAL A CB  
1204 C CG1 . VAL A 153 ? 0.3520 0.3488 0.3908 -0.0018 -0.0136 0.0245  153 VAL A CG1 
1205 C CG2 . VAL A 153 ? 0.3260 0.3327 0.3769 -0.0075 -0.0204 0.0257  153 VAL A CG2 
1206 N N   . GLY A 154 ? 0.4432 0.4742 0.5079 -0.0028 -0.0124 0.0310  154 GLY A N   
1207 C CA  . GLY A 154 ? 0.4373 0.4817 0.5120 -0.0051 -0.0117 0.0339  154 GLY A CA  
1208 C C   . GLY A 154 ? 0.4976 0.5540 0.5776 0.0003  -0.0107 0.0354  154 GLY A C   
1209 O O   . GLY A 154 ? 0.4156 0.4685 0.4898 0.0070  -0.0084 0.0342  154 GLY A O   
1210 N N   . THR A 155 ? 0.5251 0.5961 0.6163 -0.0026 -0.0125 0.0381  155 THR A N   
1211 C CA  . THR A 155 ? 0.4270 0.5124 0.5252 0.0028  -0.0120 0.0399  155 THR A CA  
1212 C C   . THR A 155 ? 0.4747 0.5557 0.5683 0.0086  -0.0155 0.0379  155 THR A C   
1213 O O   . THR A 155 ? 0.5045 0.5854 0.5943 0.0168  -0.0129 0.0375  155 THR A O   
1214 C CB  . THR A 155 ? 0.5068 0.6105 0.6193 -0.0029 -0.0143 0.0436  155 THR A CB  
1215 O OG1 . THR A 155 ? 0.5078 0.6079 0.6220 -0.0104 -0.0209 0.0431  155 THR A OG1 
1216 C CG2 . THR A 155 ? 0.4426 0.5517 0.5587 -0.0068 -0.0094 0.0463  155 THR A CG2 
1217 N N   . PHE A 156 ? 0.3931 0.4690 0.4854 0.0046  -0.0214 0.0367  156 PHE A N   
1218 C CA  . PHE A 156 ? 0.3150 0.3872 0.4027 0.0092  -0.0254 0.0352  156 PHE A CA  
1219 C C   . PHE A 156 ? 0.4217 0.4810 0.4973 0.0165  -0.0219 0.0333  156 PHE A C   
1220 O O   . PHE A 156 ? 0.4413 0.5009 0.5142 0.0229  -0.0234 0.0333  156 PHE A O   
1221 C CB  . PHE A 156 ? 0.2044 0.2682 0.2886 0.0032  -0.0313 0.0333  156 PHE A CB  
1222 C CG  . PHE A 156 ? 0.3213 0.3926 0.4145 -0.0054 -0.0347 0.0347  156 PHE A CG  
1223 C CD1 . PHE A 156 ? 0.3326 0.4192 0.4364 -0.0078 -0.0398 0.0369  156 PHE A CD1 
1224 C CD2 . PHE A 156 ? 0.3229 0.3867 0.4145 -0.0114 -0.0331 0.0345  156 PHE A CD2 
1225 C CE1 . PHE A 156 ? 0.3175 0.4105 0.4294 -0.0169 -0.0432 0.0386  156 PHE A CE1 
1226 C CE2 . PHE A 156 ? 0.3847 0.4536 0.4836 -0.0197 -0.0363 0.0362  156 PHE A CE2 
1227 C CZ  . PHE A 156 ? 0.4634 0.5464 0.5723 -0.0229 -0.0413 0.0382  156 PHE A CZ  
1228 N N   . GLY A 157 ? 0.3999 0.4478 0.4683 0.0151  -0.0177 0.0319  157 GLY A N   
1229 C CA  . GLY A 157 ? 0.3530 0.3879 0.4097 0.0203  -0.0144 0.0303  157 GLY A CA  
1230 C C   . GLY A 157 ? 0.3833 0.4182 0.4378 0.0248  -0.0087 0.0307  157 GLY A C   
1231 O O   . GLY A 157 ? 0.4654 0.4897 0.5099 0.0301  -0.0067 0.0296  157 GLY A O   
1232 N N   . PHE A 158 ? 0.3515 0.3969 0.4137 0.0228  -0.0060 0.0323  158 PHE A N   
1233 C CA  . PHE A 158 ? 0.3590 0.4030 0.4172 0.0269  -0.0002 0.0322  158 PHE A CA  
1234 C C   . PHE A 158 ? 0.4191 0.4795 0.4864 0.0299  0.0029  0.0347  158 PHE A C   
1235 O O   . PHE A 158 ? 0.4432 0.5018 0.5057 0.0342  0.0079  0.0343  158 PHE A O   
1236 C CB  . PHE A 158 ? 0.3195 0.3529 0.3712 0.0217  0.0022  0.0309  158 PHE A CB  
1237 C CG  . PHE A 158 ? 0.4083 0.4262 0.4498 0.0204  0.0007  0.0287  158 PHE A CG  
1238 C CD1 . PHE A 158 ? 0.3845 0.3904 0.4149 0.0252  0.0027  0.0272  158 PHE A CD1 
1239 C CD2 . PHE A 158 ? 0.4451 0.4602 0.4879 0.0147  -0.0028 0.0283  158 PHE A CD2 
1240 C CE1 . PHE A 158 ? 0.5187 0.5115 0.5404 0.0232  0.0014  0.0258  158 PHE A CE1 
1241 C CE2 . PHE A 158 ? 0.4518 0.4546 0.4858 0.0140  -0.0037 0.0266  158 PHE A CE2 
1242 C CZ  . PHE A 158 ? 0.4641 0.4565 0.4881 0.0178  -0.0015 0.0256  158 PHE A CZ  
1243 N N   . LEU A 159 ? 0.4088 0.4855 0.4889 0.0275  0.0000  0.0372  159 LEU A N   
1244 C CA  . LEU A 159 ? 0.3105 0.4059 0.4009 0.0304  0.0031  0.0402  159 LEU A CA  
1245 C C   . LEU A 159 ? 0.3370 0.4346 0.4244 0.0420  0.0053  0.0399  159 LEU A C   
1246 O O   . LEU A 159 ? 0.3703 0.4650 0.4556 0.0463  0.0015  0.0392  159 LEU A O   
1247 C CB  . LEU A 159 ? 0.3597 0.4726 0.4649 0.0246  -0.0013 0.0432  159 LEU A CB  
1248 C CG  . LEU A 159 ? 0.4739 0.6096 0.5916 0.0273  0.0020  0.0470  159 LEU A CG  
1249 C CD1 . LEU A 159 ? 0.3856 0.5351 0.5162 0.0166  -0.0007 0.0505  159 LEU A CD1 
1250 C CD2 . LEU A 159 ? 0.2346 0.3819 0.3567 0.0374  0.0010  0.0479  159 LEU A CD2 
1251 N N   . ALA A 160 ? 0.3915 0.4935 0.4775 0.0477  0.0113  0.0404  160 ALA A N   
1252 C CA  . ALA A 160 ? 0.4339 0.5352 0.5147 0.0600  0.0138  0.0397  160 ALA A CA  
1253 C C   . ALA A 160 ? 0.4528 0.5726 0.5411 0.0669  0.0193  0.0421  160 ALA A C   
1254 O O   . ALA A 160 ? 0.4450 0.5706 0.5353 0.0637  0.0239  0.0431  160 ALA A O   
1255 C CB  . ALA A 160 ? 0.4060 0.4823 0.4682 0.0636  0.0158  0.0359  160 ALA A CB  
1256 N N   . LEU A 161 ? 0.5241 0.6540 0.6164 0.0769  0.0191  0.0433  161 LEU A N   
1257 C CA  . LEU A 161 ? 0.4687 0.6130 0.5646 0.0867  0.0253  0.0449  161 LEU A CA  
1258 C C   . LEU A 161 ? 0.4544 0.5802 0.5341 0.0992  0.0272  0.0417  161 LEU A C   
1259 O O   . LEU A 161 ? 0.4305 0.5592 0.5113 0.1076  0.0245  0.0423  161 LEU A O   
1260 C CB  . LEU A 161 ? 0.4026 0.5759 0.5177 0.0885  0.0233  0.0494  161 LEU A CB  
1261 C CG  . LEU A 161 ? 0.3982 0.5857 0.5267 0.0746  0.0217  0.0524  161 LEU A CG  
1262 C CD1 . LEU A 161 ? 0.5967 0.8026 0.7410 0.0700  0.0148  0.0555  161 LEU A CD1 
1263 C CD2 . LEU A 161 ? 0.4096 0.6132 0.5443 0.0751  0.0292  0.0551  161 LEU A CD2 
1264 N N   . PRO A 162 ? 0.4833 0.5885 0.5468 0.0998  0.0312  0.0383  162 PRO A N   
1265 C CA  . PRO A 162 ? 0.5072 0.5883 0.5521 0.1088  0.0318  0.0347  162 PRO A CA  
1266 C C   . PRO A 162 ? 0.5917 0.6809 0.6370 0.1246  0.0341  0.0357  162 PRO A C   
1267 O O   . PRO A 162 ? 0.5350 0.6441 0.5890 0.1307  0.0390  0.0377  162 PRO A O   
1268 C CB  . PRO A 162 ? 0.4254 0.4905 0.4563 0.1070  0.0368  0.0316  162 PRO A CB  
1269 C CG  . PRO A 162 ? 0.4534 0.5297 0.4943 0.0948  0.0370  0.0333  162 PRO A CG  
1270 C CD  . PRO A 162 ? 0.4495 0.5542 0.5110 0.0934  0.0358  0.0379  162 PRO A CD  
1271 N N   . GLY A 163 ? 0.6468 0.7214 0.6828 0.1315  0.0307  0.0345  163 GLY A N   
1272 C CA  . GLY A 163 ? 0.6026 0.6825 0.6375 0.1474  0.0322  0.0355  163 GLY A CA  
1273 C C   . GLY A 163 ? 0.6074 0.7093 0.6590 0.1495  0.0269  0.0394  163 GLY A C   
1274 O O   . GLY A 163 ? 0.7511 0.8522 0.7998 0.1617  0.0255  0.0402  163 GLY A O   
1275 N N   . SER A 164 ? 0.5508 0.6718 0.6193 0.1377  0.0236  0.0420  164 SER A N   
1276 C CA  . SER A 164 ? 0.5043 0.6471 0.5891 0.1379  0.0176  0.0457  164 SER A CA  
1277 C C   . SER A 164 ? 0.5404 0.6670 0.6174 0.1364  0.0102  0.0448  164 SER A C   
1278 O O   . SER A 164 ? 0.5478 0.6479 0.6093 0.1315  0.0092  0.0417  164 SER A O   
1279 C CB  . SER A 164 ? 0.4998 0.6652 0.6032 0.1244  0.0159  0.0485  164 SER A CB  
1280 O OG  . SER A 164 ? 0.4937 0.6438 0.5925 0.1109  0.0115  0.0466  164 SER A OG  
1281 N N   . ARG A 165 ? 0.5485 0.6926 0.6369 0.1402  0.0048  0.0479  165 ARG A N   
1282 C CA  . ARG A 165 ? 0.7177 0.8493 0.7993 0.1397  -0.0025 0.0476  165 ARG A CA  
1283 C C   . ARG A 165 ? 0.7489 0.8821 0.8369 0.1235  -0.0082 0.0475  165 ARG A C   
1284 O O   . ARG A 165 ? 0.6841 0.7973 0.7606 0.1188  -0.0120 0.0456  165 ARG A O   
1285 C CB  . ARG A 165 ? 0.8281 0.9787 0.9190 0.1512  -0.0064 0.0511  165 ARG A CB  
1286 C CG  . ARG A 165 ? 1.0079 1.1420 1.0872 0.1559  -0.0126 0.0509  165 ARG A CG  
1287 C CD  . ARG A 165 ? 1.1681 1.3275 1.2630 0.1582  -0.0200 0.0548  165 ARG A CD  
1288 N NE  . ARG A 165 ? 1.2588 1.4203 1.3588 0.1435  -0.0270 0.0547  165 ARG A NE  
1289 C CZ  . ARG A 165 ? 1.2431 1.4313 1.3619 0.1368  -0.0323 0.0573  165 ARG A CZ  
1290 N NH1 . ARG A 165 ? 1.2669 1.4848 1.4032 0.1428  -0.0310 0.0609  165 ARG A NH1 
1291 N NH2 . ARG A 165 ? 1.1483 1.3335 1.2683 0.1238  -0.0387 0.0565  165 ARG A NH2 
1292 N N   . GLU A 166 ? 0.7173 0.8738 0.8228 0.1153  -0.0084 0.0496  166 GLU A N   
1293 C CA  . GLU A 166 ? 0.6704 0.8324 0.7839 0.1015  -0.0148 0.0501  166 GLU A CA  
1294 C C   . GLU A 166 ? 0.6619 0.8097 0.7703 0.0888  -0.0129 0.0475  166 GLU A C   
1295 O O   . GLU A 166 ? 0.6088 0.7558 0.7204 0.0777  -0.0180 0.0472  166 GLU A O   
1296 C CB  . GLU A 166 ? 0.7071 0.9021 0.8428 0.0986  -0.0176 0.0542  166 GLU A CB  
1297 C CG  . GLU A 166 ? 0.8165 1.0306 0.9602 0.1119  -0.0189 0.0574  166 GLU A CG  
1298 C CD  . GLU A 166 ? 0.8932 1.1203 1.0413 0.1229  -0.0104 0.0589  166 GLU A CD  
1299 O OE1 . GLU A 166 ? 0.8820 1.0921 1.0179 0.1252  -0.0032 0.0562  166 GLU A OE1 
1300 O OE2 . GLU A 166 ? 0.8592 1.1142 1.0228 0.1293  -0.0110 0.0628  166 GLU A OE2 
1301 N N   . ALA A 167 ? 0.5254 0.6616 0.6250 0.0908  -0.0057 0.0457  167 ALA A N   
1302 C CA  . ALA A 167 ? 0.5469 0.6702 0.6413 0.0800  -0.0036 0.0435  167 ALA A CA  
1303 C C   . ALA A 167 ? 0.5035 0.6078 0.5827 0.0849  0.0029  0.0408  167 ALA A C   
1304 O O   . ALA A 167 ? 0.4633 0.5715 0.5439 0.0836  0.0084  0.0408  167 ALA A O   
1305 C CB  . ALA A 167 ? 0.5595 0.7024 0.6690 0.0711  -0.0024 0.0460  167 ALA A CB  
1306 N N   . PRO A 168 ? 0.4827 0.5656 0.5465 0.0899  0.0019  0.0386  168 PRO A N   
1307 C CA  . PRO A 168 ? 0.3917 0.4539 0.4388 0.0958  0.0070  0.0359  168 PRO A CA  
1308 C C   . PRO A 168 ? 0.5426 0.5911 0.5827 0.0859  0.0092  0.0336  168 PRO A C   
1309 O O   . PRO A 168 ? 0.6813 0.7154 0.7091 0.0890  0.0135  0.0314  168 PRO A O   
1310 C CB  . PRO A 168 ? 0.2773 0.3210 0.3114 0.1005  0.0034  0.0350  168 PRO A CB  
1311 C CG  . PRO A 168 ? 0.3414 0.3962 0.3853 0.0966  -0.0037 0.0369  168 PRO A CG  
1312 C CD  . PRO A 168 ? 0.4309 0.5063 0.4914 0.0876  -0.0047 0.0384  168 PRO A CD  
1313 N N   . GLY A 169 ? 0.5499 0.6019 0.5966 0.0746  0.0058  0.0339  169 GLY A N   
1314 C CA  . GLY A 169 ? 0.5341 0.5741 0.5749 0.0654  0.0072  0.0320  169 GLY A CA  
1315 C C   . GLY A 169 ? 0.5109 0.5296 0.5385 0.0626  0.0049  0.0299  169 GLY A C   
1316 O O   . GLY A 169 ? 0.5792 0.5891 0.5995 0.0684  0.0029  0.0297  169 GLY A O   
1317 N N   . ASN A 170 ? 0.3913 0.4022 0.4159 0.0537  0.0052  0.0286  170 ASN A N   
1318 C CA  . ASN A 170 ? 0.4207 0.4136 0.4339 0.0497  0.0037  0.0269  170 ASN A CA  
1319 C C   . ASN A 170 ? 0.5039 0.4950 0.5171 0.0488  -0.0012 0.0275  170 ASN A C   
1320 O O   . ASN A 170 ? 0.5942 0.5703 0.5967 0.0473  -0.0019 0.0266  170 ASN A O   
1321 C CB  . ASN A 170 ? 0.3518 0.3268 0.3497 0.0547  0.0067  0.0253  170 ASN A CB  
1322 C CG  . ASN A 170 ? 0.5460 0.5192 0.5407 0.0544  0.0113  0.0240  170 ASN A CG  
1323 O OD1 . ASN A 170 ? 0.5685 0.5460 0.5676 0.0470  0.0120  0.0239  170 ASN A OD1 
1324 N ND2 . ASN A 170 ? 0.4818 0.4473 0.4674 0.0627  0.0142  0.0230  170 ASN A ND2 
1325 N N   . VAL A 171 ? 0.3739 0.3799 0.3983 0.0492  -0.0048 0.0291  171 VAL A N   
1326 C CA  . VAL A 171 ? 0.3033 0.3067 0.3258 0.0493  -0.0097 0.0294  171 VAL A CA  
1327 C C   . VAL A 171 ? 0.4071 0.4026 0.4262 0.0408  -0.0112 0.0281  171 VAL A C   
1328 O O   . VAL A 171 ? 0.4210 0.4089 0.4336 0.0407  -0.0140 0.0279  171 VAL A O   
1329 C CB  . VAL A 171 ? 0.4176 0.4391 0.4525 0.0512  -0.0141 0.0313  171 VAL A CB  
1330 C CG1 . VAL A 171 ? 0.4273 0.4591 0.4668 0.0603  -0.0121 0.0329  171 VAL A CG1 
1331 C CG2 . VAL A 171 ? 0.4164 0.4502 0.4633 0.0426  -0.0158 0.0316  171 VAL A CG2 
1332 N N   . GLY A 172 ? 0.3535 0.3509 0.3764 0.0343  -0.0092 0.0274  172 GLY A N   
1333 C CA  . GLY A 172 ? 0.3411 0.3309 0.3602 0.0276  -0.0098 0.0262  172 GLY A CA  
1334 C C   . GLY A 172 ? 0.3958 0.3695 0.4017 0.0281  -0.0077 0.0254  172 GLY A C   
1335 O O   . GLY A 172 ? 0.3774 0.3444 0.3778 0.0260  -0.0092 0.0250  172 GLY A O   
1336 N N   . LEU A 173 ? 0.3226 0.2898 0.3228 0.0305  -0.0041 0.0251  173 LEU A N   
1337 C CA  . LEU A 173 ? 0.4214 0.3724 0.4083 0.0309  -0.0024 0.0246  173 LEU A CA  
1338 C C   . LEU A 173 ? 0.4947 0.4384 0.4741 0.0357  -0.0047 0.0256  173 LEU A C   
1339 O O   . LEU A 173 ? 0.5480 0.4803 0.5181 0.0333  -0.0048 0.0258  173 LEU A O   
1340 C CB  . LEU A 173 ? 0.4263 0.3707 0.4074 0.0336  0.0011  0.0239  173 LEU A CB  
1341 C CG  . LEU A 173 ? 0.4890 0.4385 0.4749 0.0281  0.0033  0.0231  173 LEU A CG  
1342 C CD1 . LEU A 173 ? 0.4245 0.3697 0.4051 0.0319  0.0066  0.0222  173 LEU A CD1 
1343 C CD2 . LEU A 173 ? 0.3559 0.2991 0.3381 0.0202  0.0034  0.0226  173 LEU A CD2 
1344 N N   . LEU A 174 ? 0.4186 0.3696 0.4023 0.0425  -0.0067 0.0265  174 LEU A N   
1345 C CA  . LEU A 174 ? 0.4429 0.3882 0.4199 0.0478  -0.0095 0.0277  174 LEU A CA  
1346 C C   . LEU A 174 ? 0.5244 0.4718 0.5023 0.0437  -0.0132 0.0279  174 LEU A C   
1347 O O   . LEU A 174 ? 0.5344 0.4716 0.5023 0.0452  -0.0144 0.0288  174 LEU A O   
1348 C CB  . LEU A 174 ? 0.4490 0.4039 0.4315 0.0566  -0.0110 0.0289  174 LEU A CB  
1349 C CG  . LEU A 174 ? 0.4896 0.4416 0.4692 0.0634  -0.0073 0.0287  174 LEU A CG  
1350 C CD1 . LEU A 174 ? 0.5109 0.4757 0.4977 0.0727  -0.0091 0.0303  174 LEU A CD1 
1351 C CD2 . LEU A 174 ? 0.4493 0.3791 0.4118 0.0658  -0.0051 0.0283  174 LEU A CD2 
1352 N N   . ASP A 175 ? 0.5276 0.4868 0.5160 0.0388  -0.0148 0.0272  175 ASP A N   
1353 C CA  . ASP A 175 ? 0.5008 0.4598 0.4882 0.0347  -0.0178 0.0266  175 ASP A CA  
1354 C C   . ASP A 175 ? 0.5803 0.5262 0.5571 0.0308  -0.0148 0.0264  175 ASP A C   
1355 O O   . ASP A 175 ? 0.5607 0.4998 0.5293 0.0309  -0.0160 0.0269  175 ASP A O   
1356 C CB  . ASP A 175 ? 0.4932 0.4634 0.4918 0.0293  -0.0192 0.0255  175 ASP A CB  
1357 C CG  . ASP A 175 ? 0.6347 0.6195 0.6448 0.0314  -0.0226 0.0263  175 ASP A CG  
1358 O OD1 . ASP A 175 ? 0.5772 0.5647 0.5868 0.0376  -0.0245 0.0276  175 ASP A OD1 
1359 O OD2 . ASP A 175 ? 0.6438 0.6377 0.6635 0.0268  -0.0234 0.0259  175 ASP A OD2 
1360 N N   . GLN A 176 ? 0.5613 0.5045 0.5384 0.0273  -0.0110 0.0258  176 GLN A N   
1361 C CA  . GLN A 176 ? 0.5789 0.5125 0.5480 0.0227  -0.0082 0.0259  176 GLN A CA  
1362 C C   . GLN A 176 ? 0.6174 0.5371 0.5735 0.0253  -0.0073 0.0274  176 GLN A C   
1363 O O   . GLN A 176 ? 0.5968 0.5095 0.5452 0.0222  -0.0065 0.0283  176 GLN A O   
1364 C CB  . GLN A 176 ? 0.6006 0.5350 0.5729 0.0185  -0.0050 0.0251  176 GLN A CB  
1365 C CG  . GLN A 176 ? 0.5844 0.5304 0.5679 0.0152  -0.0055 0.0241  176 GLN A CG  
1366 C CD  . GLN A 176 ? 0.6562 0.6032 0.6422 0.0120  -0.0026 0.0236  176 GLN A CD  
1367 O OE1 . GLN A 176 ? 0.6303 0.5859 0.6247 0.0099  -0.0028 0.0232  176 GLN A OE1 
1368 N NE2 . GLN A 176 ? 0.6229 0.5600 0.6004 0.0111  -0.0002 0.0238  176 GLN A NE2 
1369 N N   . ARG A 177 ? 0.5028 0.4182 0.4559 0.0310  -0.0072 0.0279  177 ARG A N   
1370 C CA  . ARG A 177 ? 0.5640 0.4634 0.5032 0.0337  -0.0065 0.0294  177 ARG A CA  
1371 C C   . ARG A 177 ? 0.6155 0.5127 0.5494 0.0369  -0.0095 0.0311  177 ARG A C   
1372 O O   . ARG A 177 ? 0.5592 0.4441 0.4815 0.0354  -0.0088 0.0328  177 ARG A O   
1373 C CB  . ARG A 177 ? 0.5897 0.4839 0.5258 0.0405  -0.0057 0.0293  177 ARG A CB  
1374 C CG  . ARG A 177 ? 0.6085 0.4845 0.5293 0.0446  -0.0057 0.0310  177 ARG A CG  
1375 C CD  . ARG A 177 ? 0.5375 0.4081 0.4548 0.0529  -0.0048 0.0306  177 ARG A CD  
1376 N NE  . ARG A 177 ? 0.5280 0.3920 0.4423 0.0495  -0.0015 0.0287  177 ARG A NE  
1377 C CZ  . ARG A 177 ? 0.6128 0.4759 0.5267 0.0559  0.0001  0.0273  177 ARG A CZ  
1378 N NH1 . ARG A 177 ? 0.6350 0.5052 0.5527 0.0661  -0.0011 0.0279  177 ARG A NH1 
1379 N NH2 . ARG A 177 ? 0.4688 0.3249 0.3784 0.0523  0.0028  0.0253  177 ARG A NH2 
1380 N N   . LEU A 178 ? 0.6441 0.5536 0.5866 0.0406  -0.0131 0.0307  178 LEU A N   
1381 C CA  . LEU A 178 ? 0.5842 0.4932 0.5221 0.0441  -0.0169 0.0320  178 LEU A CA  
1382 C C   . LEU A 178 ? 0.5228 0.4294 0.4563 0.0382  -0.0165 0.0320  178 LEU A C   
1383 O O   . LEU A 178 ? 0.5129 0.4115 0.4359 0.0395  -0.0175 0.0337  178 LEU A O   
1384 C CB  . LEU A 178 ? 0.4548 0.3793 0.4042 0.0478  -0.0215 0.0314  178 LEU A CB  
1385 C CG  . LEU A 178 ? 0.3683 0.2943 0.3140 0.0501  -0.0264 0.0322  178 LEU A CG  
1386 C CD1 . LEU A 178 ? 0.3277 0.2412 0.2602 0.0564  -0.0272 0.0349  178 LEU A CD1 
1387 C CD2 . LEU A 178 ? 0.4175 0.3599 0.3756 0.0522  -0.0314 0.0316  178 LEU A CD2 
1388 N N   . ALA A 179 ? 0.4834 0.3971 0.4244 0.0322  -0.0149 0.0301  179 ALA A N   
1389 C CA  . ALA A 179 ? 0.5449 0.4565 0.4815 0.0272  -0.0133 0.0301  179 ALA A CA  
1390 C C   . ALA A 179 ? 0.4871 0.3865 0.4131 0.0237  -0.0092 0.0321  179 ALA A C   
1391 O O   . ALA A 179 ? 0.5504 0.4450 0.4681 0.0223  -0.0084 0.0336  179 ALA A O   
1392 C CB  . ALA A 179 ? 0.2882 0.2104 0.2355 0.0225  -0.0127 0.0276  179 ALA A CB  
1393 N N   . LEU A 180 ? 0.4965 0.3905 0.4219 0.0222  -0.0067 0.0324  180 LEU A N   
1394 C CA  . LEU A 180 ? 0.6088 0.4899 0.5230 0.0181  -0.0036 0.0346  180 LEU A CA  
1395 C C   . LEU A 180 ? 0.6550 0.5235 0.5559 0.0222  -0.0048 0.0374  180 LEU A C   
1396 O O   . LEU A 180 ? 0.6206 0.4818 0.5122 0.0183  -0.0029 0.0399  180 LEU A O   
1397 C CB  . LEU A 180 ? 0.3639 0.2391 0.2777 0.0153  -0.0013 0.0341  180 LEU A CB  
1398 C CG  . LEU A 180 ? 0.5060 0.3930 0.4323 0.0119  -0.0003 0.0316  180 LEU A CG  
1399 C CD1 . LEU A 180 ? 0.4672 0.3470 0.3905 0.0082  0.0018  0.0312  180 LEU A CD1 
1400 C CD2 . LEU A 180 ? 0.4755 0.3731 0.4083 0.0068  0.0007  0.0312  180 LEU A CD2 
1401 N N   . GLN A 181 ? 0.5402 0.4072 0.4404 0.0301  -0.0080 0.0375  181 GLN A N   
1402 C CA  . GLN A 181 ? 0.6311 0.4862 0.5184 0.0351  -0.0098 0.0403  181 GLN A CA  
1403 C C   . GLN A 181 ? 0.6972 0.5560 0.5812 0.0342  -0.0111 0.0413  181 GLN A C   
1404 O O   . GLN A 181 ? 0.6795 0.5274 0.5506 0.0335  -0.0104 0.0444  181 GLN A O   
1405 C CB  . GLN A 181 ? 0.6130 0.4701 0.5027 0.0447  -0.0135 0.0401  181 GLN A CB  
1406 C CG  . GLN A 181 ? 0.7362 0.5841 0.6229 0.0482  -0.0120 0.0399  181 GLN A CG  
1407 C CD  . GLN A 181 ? 0.8302 0.6891 0.7267 0.0568  -0.0145 0.0385  181 GLN A CD  
1408 O OE1 . GLN A 181 ? 0.7704 0.6247 0.6661 0.0610  -0.0130 0.0378  181 GLN A OE1 
1409 N NE2 . GLN A 181 ? 0.8286 0.7026 0.7344 0.0593  -0.0182 0.0381  181 GLN A NE2 
1410 N N   . TRP A 182 ? 0.6231 0.4966 0.5180 0.0341  -0.0131 0.0387  182 TRP A N   
1411 C CA  . TRP A 182 ? 0.5367 0.4138 0.4282 0.0335  -0.0144 0.0388  182 TRP A CA  
1412 C C   . TRP A 182 ? 0.5152 0.3877 0.4000 0.0269  -0.0097 0.0403  182 TRP A C   
1413 O O   . TRP A 182 ? 0.4734 0.3413 0.3479 0.0272  -0.0095 0.0424  182 TRP A O   
1414 C CB  . TRP A 182 ? 0.4071 0.2990 0.3111 0.0333  -0.0171 0.0353  182 TRP A CB  
1415 C CG  . TRP A 182 ? 0.5135 0.4074 0.4121 0.0336  -0.0192 0.0347  182 TRP A CG  
1416 C CD1 . TRP A 182 ? 0.5069 0.4026 0.4027 0.0384  -0.0247 0.0344  182 TRP A CD1 
1417 C CD2 . TRP A 182 ? 0.5826 0.4770 0.4774 0.0293  -0.0157 0.0342  182 TRP A CD2 
1418 N NE1 . TRP A 182 ? 0.5268 0.4226 0.4160 0.0373  -0.0250 0.0334  182 TRP A NE1 
1419 C CE2 . TRP A 182 ? 0.6706 0.5659 0.5593 0.0321  -0.0193 0.0333  182 TRP A CE2 
1420 C CE3 . TRP A 182 ? 0.5241 0.4191 0.4203 0.0237  -0.0102 0.0346  182 TRP A CE3 
1421 C CZ2 . TRP A 182 ? 0.7692 0.6651 0.6522 0.0302  -0.0168 0.0324  182 TRP A CZ2 
1422 C CZ3 . TRP A 182 ? 0.6309 0.5284 0.5230 0.0218  -0.0077 0.0341  182 TRP A CZ3 
1423 C CH2 . TRP A 182 ? 0.6687 0.5661 0.5538 0.0253  -0.0107 0.0330  182 TRP A CH2 
1424 N N   . VAL A 183 ? 0.4298 0.3048 0.3205 0.0210  -0.0059 0.0396  183 VAL A N   
1425 C CA  . VAL A 183 ? 0.5566 0.4297 0.4424 0.0144  -0.0013 0.0416  183 VAL A CA  
1426 C C   . VAL A 183 ? 0.6186 0.4759 0.4897 0.0131  0.0003  0.0460  183 VAL A C   
1427 O O   . VAL A 183 ? 0.6032 0.4574 0.4659 0.0099  0.0030  0.0488  183 VAL A O   
1428 C CB  . VAL A 183 ? 0.5538 0.4342 0.4497 0.0083  0.0019  0.0401  183 VAL A CB  
1429 C CG1 . VAL A 183 ? 0.4339 0.3115 0.3244 0.0009  0.0066  0.0432  183 VAL A CG1 
1430 C CG2 . VAL A 183 ? 0.5127 0.4072 0.4202 0.0091  0.0009  0.0366  183 VAL A CG2 
1431 N N   . GLN A 184 ? 0.6532 0.4998 0.5204 0.0161  -0.0013 0.0467  184 GLN A N   
1432 C CA  . GLN A 184 ? 0.7104 0.5391 0.5622 0.0152  -0.0003 0.0508  184 GLN A CA  
1433 C C   . GLN A 184 ? 0.7206 0.5442 0.5611 0.0195  -0.0020 0.0536  184 GLN A C   
1434 O O   . GLN A 184 ? 0.5836 0.3994 0.4129 0.0152  0.0007  0.0575  184 GLN A O   
1435 C CB  . GLN A 184 ? 0.5737 0.3912 0.4227 0.0197  -0.0021 0.0504  184 GLN A CB  
1436 C CG  . GLN A 184 ? 0.6957 0.5123 0.5498 0.0138  0.0003  0.0488  184 GLN A CG  
1437 C CD  . GLN A 184 ? 0.7862 0.5927 0.6314 0.0041  0.0038  0.0520  184 GLN A CD  
1438 O OE1 . GLN A 184 ? 0.7246 0.5413 0.5767 -0.0036 0.0066  0.0518  184 GLN A OE1 
1439 N NE2 . GLN A 184 ? 0.7327 0.5192 0.5623 0.0044  0.0035  0.0554  184 GLN A NE2 
1440 N N   . GLU A 185 ? 0.5514 0.3805 0.3950 0.0276  -0.0066 0.0519  185 GLU A N   
1441 C CA  . GLU A 185 ? 0.5282 0.3532 0.3611 0.0324  -0.0093 0.0542  185 GLU A CA  
1442 C C   . GLU A 185 ? 0.5947 0.4266 0.4250 0.0287  -0.0072 0.0544  185 GLU A C   
1443 O O   . GLU A 185 ? 0.7232 0.5472 0.5398 0.0295  -0.0068 0.0580  185 GLU A O   
1444 C CB  . GLU A 185 ? 0.6799 0.5119 0.5188 0.0413  -0.0154 0.0519  185 GLU A CB  
1445 C CG  . GLU A 185 ? 0.8900 0.7190 0.7181 0.0468  -0.0194 0.0540  185 GLU A CG  
1446 C CD  . GLU A 185 ? 0.9610 0.7864 0.7872 0.0562  -0.0248 0.0550  185 GLU A CD  
1447 O OE1 . GLU A 185 ? 0.9558 0.7711 0.7680 0.0608  -0.0272 0.0586  185 GLU A OE1 
1448 O OE2 . GLU A 185 ? 0.9143 0.7473 0.7527 0.0593  -0.0265 0.0525  185 GLU A OE2 
1449 N N   . ASN A 186 ? 0.5126 0.3586 0.3549 0.0253  -0.0056 0.0509  186 ASN A N   
1450 C CA  . ASN A 186 ? 0.4949 0.3489 0.3356 0.0255  -0.0053 0.0497  186 ASN A CA  
1451 C C   . ASN A 186 ? 0.6424 0.5033 0.4857 0.0190  0.0006  0.0497  186 ASN A C   
1452 O O   . ASN A 186 ? 0.6671 0.5314 0.5047 0.0195  0.0020  0.0498  186 ASN A O   
1453 C CB  . ASN A 186 ? 0.4423 0.3074 0.2931 0.0301  -0.0105 0.0449  186 ASN A CB  
1454 C CG  . ASN A 186 ? 0.6156 0.4774 0.4647 0.0371  -0.0168 0.0451  186 ASN A CG  
1455 O OD1 . ASN A 186 ? 0.5774 0.4433 0.4369 0.0392  -0.0192 0.0434  186 ASN A OD1 
1456 N ND2 . ASN A 186 ? 0.5702 0.4252 0.4061 0.0411  -0.0194 0.0475  186 ASN A ND2 
1457 N N   . ILE A 187 ? 0.6037 0.4669 0.4550 0.0132  0.0039  0.0498  187 ILE A N   
1458 C CA  . ILE A 187 ? 0.5079 0.3807 0.3644 0.0075  0.0091  0.0497  187 ILE A CA  
1459 C C   . ILE A 187 ? 0.6314 0.5003 0.4755 0.0040  0.0139  0.0544  187 ILE A C   
1460 O O   . ILE A 187 ? 0.6279 0.5067 0.4738 0.0018  0.0181  0.0545  187 ILE A O   
1461 C CB  . ILE A 187 ? 0.5067 0.3831 0.3741 0.0018  0.0111  0.0490  187 ILE A CB  
1462 C CG1 . ILE A 187 ? 0.5662 0.4577 0.4443 -0.0012 0.0143  0.0469  187 ILE A CG1 
1463 C CG2 . ILE A 187 ? 0.5720 0.4370 0.4312 -0.0045 0.0139  0.0537  187 ILE A CG2 
1464 C CD1 . ILE A 187 ? 0.4203 0.3206 0.3047 0.0047  0.0114  0.0422  187 ILE A CD1 
1465 N N   . ALA A 188 ? 0.6359 0.4905 0.4669 0.0039  0.0133  0.0587  188 ALA A N   
1466 C CA  . ALA A 188 ? 0.6635 0.5137 0.4817 0.0002  0.0179  0.0640  188 ALA A CA  
1467 C C   . ALA A 188 ? 0.6761 0.5329 0.4883 0.0047  0.0187  0.0631  188 ALA A C   
1468 O O   . ALA A 188 ? 0.7644 0.6248 0.5706 0.0013  0.0241  0.0663  188 ALA A O   
1469 C CB  . ALA A 188 ? 0.5914 0.4224 0.3948 -0.0001 0.0165  0.0690  188 ALA A CB  
1470 N N   . ALA A 189 ? 0.6442 0.5029 0.4579 0.0122  0.0133  0.0587  189 ALA A N   
1471 C CA  . ALA A 189 ? 0.5318 0.3947 0.3384 0.0170  0.0128  0.0570  189 ALA A CA  
1472 C C   . ALA A 189 ? 0.6502 0.5274 0.4652 0.0156  0.0171  0.0539  189 ALA A C   
1473 O O   . ALA A 189 ? 0.9054 0.7861 0.7131 0.0189  0.0186  0.0528  189 ALA A O   
1474 C CB  . ALA A 189 ? 0.4312 0.2925 0.2384 0.0245  0.0047  0.0528  189 ALA A CB  
1475 N N   . PHE A 190 ? 0.5677 0.4527 0.3970 0.0114  0.0191  0.0526  190 PHE A N   
1476 C CA  . PHE A 190 ? 0.5784 0.4773 0.4169 0.0109  0.0228  0.0497  190 PHE A CA  
1477 C C   . PHE A 190 ? 0.6394 0.5447 0.4804 0.0036  0.0301  0.0542  190 PHE A C   
1478 O O   . PHE A 190 ? 0.7118 0.6299 0.5595 0.0032  0.0344  0.0531  190 PHE A O   
1479 C CB  . PHE A 190 ? 0.5067 0.4115 0.3607 0.0119  0.0190  0.0446  190 PHE A CB  
1480 C CG  . PHE A 190 ? 0.5670 0.4673 0.4209 0.0177  0.0116  0.0405  190 PHE A CG  
1481 C CD1 . PHE A 190 ? 0.5781 0.4697 0.4304 0.0187  0.0069  0.0416  190 PHE A CD1 
1482 C CD2 . PHE A 190 ? 0.6412 0.5459 0.4963 0.0221  0.0091  0.0357  190 PHE A CD2 
1483 C CE1 . PHE A 190 ? 0.6434 0.5337 0.4972 0.0237  0.0000  0.0383  190 PHE A CE1 
1484 C CE2 . PHE A 190 ? 0.6014 0.5029 0.4569 0.0261  0.0019  0.0322  190 PHE A CE2 
1485 C CZ  . PHE A 190 ? 0.6155 0.5111 0.4712 0.0268  -0.0027 0.0337  190 PHE A CZ  
1486 N N   . GLY A 191 ? 0.5678 0.4641 0.4032 -0.0020 0.0313  0.0594  191 GLY A N   
1487 C CA  . GLY A 191 ? 0.4344 0.3355 0.2715 -0.0106 0.0374  0.0645  191 GLY A CA  
1488 C C   . GLY A 191 ? 0.6040 0.5054 0.4527 -0.0166 0.0361  0.0641  191 GLY A C   
1489 O O   . GLY A 191 ? 0.6659 0.5739 0.5195 -0.0245 0.0402  0.0673  191 GLY A O   
1490 N N   . GLY A 192 ? 0.6762 0.5714 0.5294 -0.0128 0.0302  0.0602  192 GLY A N   
1491 C CA  . GLY A 192 ? 0.6439 0.5373 0.5060 -0.0175 0.0286  0.0595  192 GLY A CA  
1492 C C   . GLY A 192 ? 0.7144 0.5915 0.5660 -0.0226 0.0283  0.0640  192 GLY A C   
1493 O O   . GLY A 192 ? 0.7805 0.6454 0.6185 -0.0201 0.0275  0.0668  192 GLY A O   
1494 N N   . ASP A 193 ? 0.6260 0.5018 0.4830 -0.0296 0.0287  0.0647  193 ASP A N   
1495 C CA  . ASP A 193 ? 0.5629 0.4219 0.4096 -0.0357 0.0285  0.0688  193 ASP A CA  
1496 C C   . ASP A 193 ? 0.6400 0.4901 0.4897 -0.0325 0.0238  0.0651  193 ASP A C   
1497 O O   . ASP A 193 ? 0.6433 0.4999 0.5035 -0.0358 0.0235  0.0626  193 ASP A O   
1498 C CB  . ASP A 193 ? 0.7691 0.6352 0.6196 -0.0473 0.0328  0.0726  193 ASP A CB  
1499 C CG  . ASP A 193 ? 0.8369 0.6845 0.6767 -0.0558 0.0324  0.0767  193 ASP A CG  
1500 O OD1 . ASP A 193 ? 0.7787 0.6065 0.6079 -0.0521 0.0288  0.0765  193 ASP A OD1 
1501 O OD2 . ASP A 193 ? 0.8271 0.6805 0.6692 -0.0665 0.0356  0.0804  193 ASP A OD2 
1502 N N   . PRO A 194 ? 0.6630 0.4986 0.5033 -0.0254 0.0201  0.0648  194 PRO A N   
1503 C CA  . PRO A 194 ? 0.6641 0.4919 0.5066 -0.0202 0.0159  0.0613  194 PRO A CA  
1504 C C   . PRO A 194 ? 0.7214 0.5374 0.5605 -0.0272 0.0161  0.0623  194 PRO A C   
1505 O O   . PRO A 194 ? 0.7269 0.5387 0.5693 -0.0239 0.0135  0.0590  194 PRO A O   
1506 C CB  . PRO A 194 ? 0.5979 0.4114 0.4275 -0.0124 0.0128  0.0628  194 PRO A CB  
1507 C CG  . PRO A 194 ? 0.4925 0.3095 0.3157 -0.0122 0.0148  0.0658  194 PRO A CG  
1508 C CD  . PRO A 194 ? 0.5253 0.3508 0.3511 -0.0221 0.0201  0.0684  194 PRO A CD  
1509 N N   . MET A 195 ? 0.7559 0.5659 0.5876 -0.0368 0.0191  0.0670  195 MET A N   
1510 C CA  . MET A 195 ? 0.7120 0.5088 0.5386 -0.0449 0.0189  0.0681  195 MET A CA  
1511 C C   . MET A 195 ? 0.6958 0.5089 0.5362 -0.0529 0.0206  0.0666  195 MET A C   
1512 O O   . MET A 195 ? 0.7360 0.5411 0.5739 -0.0610 0.0201  0.0671  195 MET A O   
1513 C CB  . MET A 195 ? 0.6578 0.4377 0.4683 -0.0523 0.0206  0.0744  195 MET A CB  
1514 C CG  . MET A 195 ? 0.7470 0.5129 0.5434 -0.0447 0.0194  0.0770  195 MET A CG  
1515 S SD  . MET A 195 ? 0.9356 0.6708 0.7093 -0.0515 0.0192  0.0834  195 MET A SD  
1516 C CE  . MET A 195 ? 0.9052 0.6237 0.6769 -0.0489 0.0151  0.0785  195 MET A CE  
1517 N N   . SER A 196 ? 0.5881 0.4230 0.4422 -0.0504 0.0221  0.0645  196 SER A N   
1518 C CA  . SER A 196 ? 0.5709 0.4224 0.4392 -0.0559 0.0231  0.0626  196 SER A CA  
1519 C C   . SER A 196 ? 0.6486 0.5152 0.5304 -0.0477 0.0217  0.0575  196 SER A C   
1520 O O   . SER A 196 ? 0.6576 0.5399 0.5469 -0.0448 0.0236  0.0570  196 SER A O   
1521 C CB  . SER A 196 ? 0.5240 0.3892 0.3960 -0.0645 0.0275  0.0669  196 SER A CB  
1522 O OG  . SER A 196 ? 0.6354 0.5144 0.5197 -0.0706 0.0277  0.0657  196 SER A OG  
1523 N N   . VAL A 197 ? 0.5229 0.3839 0.4070 -0.0438 0.0185  0.0537  197 VAL A N   
1524 C CA  . VAL A 197 ? 0.5126 0.3852 0.4081 -0.0363 0.0168  0.0492  197 VAL A CA  
1525 C C   . VAL A 197 ? 0.6128 0.4907 0.5170 -0.0394 0.0158  0.0465  197 VAL A C   
1526 O O   . VAL A 197 ? 0.6791 0.5446 0.5777 -0.0416 0.0143  0.0458  197 VAL A O   
1527 C CB  . VAL A 197 ? 0.6094 0.4724 0.4999 -0.0263 0.0137  0.0472  197 VAL A CB  
1528 C CG1 . VAL A 197 ? 0.3817 0.2558 0.2842 -0.0202 0.0116  0.0428  197 VAL A CG1 
1529 C CG2 . VAL A 197 ? 0.3516 0.2115 0.2341 -0.0222 0.0141  0.0496  197 VAL A CG2 
1530 N N   . THR A 198 ? 0.5565 0.4520 0.4734 -0.0393 0.0166  0.0450  198 THR A N   
1531 C CA  . THR A 198 ? 0.5242 0.4269 0.4500 -0.0420 0.0156  0.0427  198 THR A CA  
1532 C C   . THR A 198 ? 0.5545 0.4653 0.4894 -0.0342 0.0139  0.0390  198 THR A C   
1533 O O   . THR A 198 ? 0.5819 0.5029 0.5224 -0.0303 0.0145  0.0385  198 THR A O   
1534 C CB  . THR A 198 ? 0.4990 0.4164 0.4324 -0.0492 0.0179  0.0448  198 THR A CB  
1535 O OG1 . THR A 198 ? 0.3917 0.3026 0.3172 -0.0578 0.0195  0.0488  198 THR A OG1 
1536 C CG2 . THR A 198 ? 0.5328 0.4574 0.4748 -0.0518 0.0163  0.0427  198 THR A CG2 
1537 N N   . LEU A 199 ? 0.5129 0.4187 0.4485 -0.0320 0.0119  0.0365  199 LEU A N   
1538 C CA  . LEU A 199 ? 0.5232 0.4375 0.4681 -0.0262 0.0103  0.0335  199 LEU A CA  
1539 C C   . LEU A 199 ? 0.5514 0.4782 0.5062 -0.0300 0.0107  0.0329  199 LEU A C   
1540 O O   . LEU A 199 ? 0.7044 0.6301 0.6581 -0.0363 0.0110  0.0337  199 LEU A O   
1541 C CB  . LEU A 199 ? 0.3862 0.2915 0.3280 -0.0218 0.0086  0.0315  199 LEU A CB  
1542 C CG  . LEU A 199 ? 0.5048 0.3960 0.4356 -0.0178 0.0080  0.0324  199 LEU A CG  
1543 C CD1 . LEU A 199 ? 0.4535 0.3355 0.3802 -0.0134 0.0068  0.0307  199 LEU A CD1 
1544 C CD2 . LEU A 199 ? 0.6723 0.5684 0.6051 -0.0120 0.0071  0.0326  199 LEU A CD2 
1545 N N   . PHE A 200 ? 0.4040 0.3420 0.3678 -0.0263 0.0104  0.0316  200 PHE A N   
1546 C CA  . PHE A 200 ? 0.4465 0.3947 0.4192 -0.0283 0.0101  0.0309  200 PHE A CA  
1547 C C   . PHE A 200 ? 0.4845 0.4379 0.4642 -0.0227 0.0085  0.0288  200 PHE A C   
1548 O O   . PHE A 200 ? 0.4811 0.4344 0.4608 -0.0181 0.0079  0.0281  200 PHE A O   
1549 C CB  . PHE A 200 ? 0.4593 0.4184 0.4365 -0.0326 0.0120  0.0329  200 PHE A CB  
1550 C CG  . PHE A 200 ? 0.4429 0.4099 0.4236 -0.0282 0.0132  0.0330  200 PHE A CG  
1551 C CD1 . PHE A 200 ? 0.5058 0.4671 0.4803 -0.0246 0.0137  0.0330  200 PHE A CD1 
1552 C CD2 . PHE A 200 ? 0.4074 0.3869 0.3965 -0.0275 0.0138  0.0330  200 PHE A CD2 
1553 C CE1 . PHE A 200 ? 0.4290 0.3964 0.4050 -0.0204 0.0148  0.0326  200 PHE A CE1 
1554 C CE2 . PHE A 200 ? 0.4197 0.4051 0.4104 -0.0228 0.0152  0.0327  200 PHE A CE2 
1555 C CZ  . PHE A 200 ? 0.4108 0.3898 0.3946 -0.0194 0.0157  0.0323  200 PHE A CZ  
1556 N N   . GLY A 201 ? 0.4329 0.3902 0.4178 -0.0236 0.0076  0.0279  201 GLY A N   
1557 C CA  . GLY A 201 ? 0.3679 0.3295 0.3592 -0.0194 0.0061  0.0264  201 GLY A CA  
1558 C C   . GLY A 201 ? 0.4904 0.4582 0.4873 -0.0216 0.0057  0.0263  201 GLY A C   
1559 O O   . GLY A 201 ? 0.4399 0.4083 0.4355 -0.0263 0.0061  0.0272  201 GLY A O   
1560 N N   . GLU A 202 ? 0.4915 0.4634 0.4943 -0.0187 0.0045  0.0256  202 GLU A N   
1561 C CA  . GLU A 202 ? 0.4271 0.4049 0.4348 -0.0204 0.0040  0.0260  202 GLU A CA  
1562 C C   . GLU A 202 ? 0.3793 0.3565 0.3892 -0.0186 0.0031  0.0254  202 GLU A C   
1563 O O   . GLU A 202 ? 0.4291 0.4053 0.4407 -0.0155 0.0023  0.0247  202 GLU A O   
1564 C CB  . GLU A 202 ? 0.4716 0.4568 0.4847 -0.0190 0.0038  0.0266  202 GLU A CB  
1565 C CG  . GLU A 202 ? 0.5798 0.5716 0.5976 -0.0206 0.0032  0.0277  202 GLU A CG  
1566 C CD  . GLU A 202 ? 0.6546 0.6465 0.6760 -0.0183 0.0016  0.0274  202 GLU A CD  
1567 O OE1 . GLU A 202 ? 0.5955 0.5838 0.6170 -0.0156 0.0009  0.0264  202 GLU A OE1 
1568 O OE2 . GLU A 202 ? 0.7145 0.7102 0.7385 -0.0195 0.0009  0.0285  202 GLU A OE2 
1569 N N   A SXE A 203 ? 0.4209 0.3988 0.4304 -0.0210 0.0031  0.0257  203 SXE A N   
1570 N N   B SXE A 203 ? 0.4206 0.3986 0.4301 -0.0210 0.0031  0.0257  203 SXE A N   
1571 C CA  A SXE A 203 ? 0.4597 0.4386 0.4714 -0.0196 0.0029  0.0257  203 SXE A CA  
1572 C CA  B SXE A 203 ? 0.4598 0.4387 0.4715 -0.0196 0.0029  0.0257  203 SXE A CA  
1573 C C   A SXE A 203 ? 0.4908 0.4646 0.4993 -0.0167 0.0036  0.0246  203 SXE A C   
1574 C C   B SXE A 203 ? 0.4914 0.4652 0.4998 -0.0167 0.0036  0.0246  203 SXE A C   
1575 O O   A SXE A 203 ? 0.5054 0.4727 0.5069 -0.0171 0.0046  0.0239  203 SXE A O   
1576 O O   B SXE A 203 ? 0.5033 0.4706 0.5049 -0.0171 0.0045  0.0239  203 SXE A O   
1577 C CB  A SXE A 203 ? 0.4659 0.4499 0.4842 -0.0181 0.0016  0.0264  203 SXE A CB  
1578 C CB  B SXE A 203 ? 0.4652 0.4493 0.4835 -0.0182 0.0016  0.0264  203 SXE A CB  
1579 O OG  A SXE A 203 ? 0.4943 0.4802 0.5159 -0.0175 0.0012  0.0270  203 SXE A OG  
1580 O OG  B SXE A 203 ? 0.4964 0.4823 0.5180 -0.0175 0.0012  0.0270  203 SXE A OG  
1581 O O1  A SXE A 203 ? 0.6927 0.6796 0.7202 -0.0139 -0.0003 0.0268  203 SXE A O1  
1582 O O1  B SXE A 203 ? 0.6903 0.6771 0.7177 -0.0138 -0.0003 0.0267  203 SXE A O1  
1583 P P1  A SXE A 203 ? 0.7381 0.7252 0.7648 -0.0155 -0.0004 0.0272  203 SXE A P1  
1584 P P1  B SXE A 203 ? 0.7364 0.7233 0.7630 -0.0154 -0.0004 0.0271  203 SXE A P1  
1585 N N1  A SXE A 203 ? 0.4973 0.4832 0.5239 -0.0141 -0.0015 0.0263  203 SXE A N1  
1586 N N1  B SXE A 203 ? 0.5917 0.5816 0.6223 -0.0166 -0.0015 0.0290  203 SXE A N1  
1587 C C1  A SXE A 203 ? 0.5128 0.4985 0.5425 -0.0130 -0.0036 0.0264  203 SXE A C1  
1588 C C1  B SXE A 203 ? 0.5675 0.5596 0.6007 -0.0177 -0.0014 0.0305  203 SXE A C1  
1589 C C3  A SXE A 203 ? 0.5915 0.5795 0.6220 -0.0130 -0.0035 0.0274  203 SXE A C3  
1590 C C3  B SXE A 203 ? 0.3758 0.3688 0.4057 -0.0181 0.0010  0.0306  203 SXE A C3  
1591 C C2  A SXE A 203 ? 0.4237 0.4061 0.4518 -0.0107 -0.0049 0.0247  203 SXE A C2  
1592 C C2  B SXE A 203 ? 0.5474 0.5402 0.5829 -0.0188 -0.0027 0.0326  203 SXE A C2  
1593 O O2  A SXE A 203 ? 0.6085 0.5986 0.6386 -0.0169 -0.0012 0.0291  203 SXE A O2  
1594 O O2  B SXE A 203 ? 0.4925 0.4781 0.5183 -0.0142 -0.0012 0.0262  203 SXE A O2  
1595 C C4  A SXE A 203 ? 0.5706 0.5626 0.6037 -0.0176 -0.0013 0.0305  203 SXE A C4  
1596 C C4  B SXE A 203 ? 0.5242 0.5109 0.5529 -0.0134 -0.0027 0.0266  203 SXE A C4  
1597 C C5  A SXE A 203 ? 0.5718 0.5632 0.6085 -0.0180 -0.0036 0.0317  203 SXE A C5  
1598 C C5  B SXE A 203 ? 0.4614 0.4451 0.4909 -0.0116 -0.0047 0.0255  203 SXE A C5  
1599 N N   . ALA A 204 ? 0.3743 0.3507 0.3873 -0.0138 0.0029  0.0247  204 ALA A N   
1600 C CA  . ALA A 204 ? 0.4659 0.4394 0.4766 -0.0103 0.0034  0.0240  204 ALA A CA  
1601 C C   . ALA A 204 ? 0.6082 0.5751 0.6132 -0.0090 0.0033  0.0233  204 ALA A C   
1602 O O   . ALA A 204 ? 0.6414 0.6030 0.6414 -0.0062 0.0040  0.0228  204 ALA A O   
1603 C CB  . ALA A 204 ? 0.4636 0.4431 0.4815 -0.0082 0.0022  0.0246  204 ALA A CB  
1604 N N   . GLY A 205 ? 0.4763 0.4434 0.4815 -0.0105 0.0026  0.0235  205 GLY A N   
1605 C CA  . GLY A 205 ? 0.4465 0.4076 0.4455 -0.0100 0.0028  0.0234  205 GLY A CA  
1606 C C   . GLY A 205 ? 0.5251 0.4794 0.5165 -0.0131 0.0044  0.0236  205 GLY A C   
1607 O O   . GLY A 205 ? 0.5837 0.5296 0.5679 -0.0116 0.0048  0.0235  205 GLY A O   
1608 N N   . ALA A 206 ? 0.3663 0.3236 0.3590 -0.0174 0.0048  0.0241  206 ALA A N   
1609 C CA  . ALA A 206 ? 0.5029 0.4540 0.4886 -0.0214 0.0055  0.0241  206 ALA A CA  
1610 C C   . ALA A 206 ? 0.5267 0.4690 0.5056 -0.0188 0.0060  0.0228  206 ALA A C   
1611 O O   . ALA A 206 ? 0.4420 0.3734 0.4115 -0.0198 0.0064  0.0225  206 ALA A O   
1612 C CB  . ALA A 206 ? 0.5138 0.4715 0.5032 -0.0256 0.0051  0.0246  206 ALA A CB  
1613 N N   . ALA A 207 ? 0.4554 0.4018 0.4384 -0.0153 0.0062  0.0222  207 ALA A N   
1614 C CA  . ALA A 207 ? 0.4378 0.3776 0.4149 -0.0113 0.0073  0.0210  207 ALA A CA  
1615 C C   . ALA A 207 ? 0.5792 0.5127 0.5523 -0.0063 0.0073  0.0209  207 ALA A C   
1616 O O   . ALA A 207 ? 0.5715 0.4941 0.5352 -0.0038 0.0081  0.0200  207 ALA A O   
1617 C CB  . ALA A 207 ? 0.2878 0.2358 0.2711 -0.0086 0.0079  0.0210  207 ALA A CB  
1618 N N   . SER A 208 ? 0.5712 0.5106 0.5505 -0.0046 0.0061  0.0217  208 SER A N   
1619 C CA  . SER A 208 ? 0.5495 0.4833 0.5247 0.0000  0.0055  0.0219  208 SER A CA  
1620 C C   . SER A 208 ? 0.6106 0.5318 0.5749 -0.0027 0.0059  0.0224  208 SER A C   
1621 O O   . SER A 208 ? 0.5718 0.4826 0.5276 0.0011  0.0060  0.0223  208 SER A O   
1622 C CB  . SER A 208 ? 0.4223 0.3642 0.4050 0.0017  0.0036  0.0226  208 SER A CB  
1623 O OG  . SER A 208 ? 0.4224 0.3751 0.4148 0.0028  0.0031  0.0225  208 SER A OG  
1624 N N   . VAL A 209 ? 0.5412 0.4636 0.5056 -0.0091 0.0060  0.0231  209 VAL A N   
1625 C CA  . VAL A 209 ? 0.4439 0.3556 0.3987 -0.0130 0.0064  0.0241  209 VAL A CA  
1626 C C   . VAL A 209 ? 0.6121 0.5113 0.5570 -0.0133 0.0069  0.0229  209 VAL A C   
1627 O O   . VAL A 209 ? 0.5271 0.4123 0.4610 -0.0123 0.0069  0.0233  209 VAL A O   
1628 C CB  . VAL A 209 ? 0.4626 0.3804 0.4206 -0.0202 0.0067  0.0253  209 VAL A CB  
1629 C CG1 . VAL A 209 ? 0.3176 0.2240 0.2652 -0.0264 0.0072  0.0265  209 VAL A CG1 
1630 C CG2 . VAL A 209 ? 0.4870 0.4128 0.4505 -0.0189 0.0067  0.0264  209 VAL A CG2 
1631 N N   . GLY A 210 ? 0.6558 0.5591 0.6035 -0.0143 0.0071  0.0215  210 GLY A N   
1632 C CA  . GLY A 210 ? 0.5257 0.4173 0.4633 -0.0143 0.0076  0.0198  210 GLY A CA  
1633 C C   . GLY A 210 ? 0.5162 0.3981 0.4467 -0.0060 0.0083  0.0189  210 GLY A C   
1634 O O   . GLY A 210 ? 0.5954 0.4608 0.5126 -0.0055 0.0085  0.0179  210 GLY A O   
1635 N N   . MET A 211 ? 0.4700 0.3617 0.4089 0.0007  0.0085  0.0192  211 MET A N   
1636 C CA  . MET A 211 ? 0.5367 0.4227 0.4709 0.0097  0.0092  0.0185  211 MET A CA  
1637 C C   . MET A 211 ? 0.5754 0.4498 0.5014 0.0127  0.0083  0.0197  211 MET A C   
1638 O O   . MET A 211 ? 0.5231 0.3860 0.4397 0.0194  0.0088  0.0190  211 MET A O   
1639 C CB  . MET A 211 ? 0.5739 0.4763 0.5208 0.0151  0.0096  0.0188  211 MET A CB  
1640 C CG  . MET A 211 ? 0.6566 0.5639 0.6054 0.0153  0.0115  0.0174  211 MET A CG  
1641 S SD  . MET A 211 ? 0.7295 0.6583 0.6954 0.0171  0.0116  0.0187  211 MET A SD  
1642 C CE  . MET A 211 ? 1.0860 1.0191 1.0533 0.0111  0.0129  0.0181  211 MET A CE  
1643 N N   . HIS A 212 ? 0.4650 0.3418 0.3935 0.0082  0.0071  0.0215  212 HIS A N   
1644 C CA  . HIS A 212 ? 0.5233 0.3874 0.4419 0.0095  0.0063  0.0231  212 HIS A CA  
1645 C C   . HIS A 212 ? 0.6171 0.4619 0.5207 0.0049  0.0067  0.0229  212 HIS A C   
1646 O O   . HIS A 212 ? 0.5998 0.4285 0.4912 0.0087  0.0064  0.0236  212 HIS A O   
1647 C CB  . HIS A 212 ? 0.5073 0.3788 0.4311 0.0057  0.0054  0.0251  212 HIS A CB  
1648 C CG  . HIS A 212 ? 0.4764 0.3629 0.4119 0.0104  0.0041  0.0252  212 HIS A CG  
1649 N ND1 . HIS A 212 ? 0.4718 0.3591 0.4077 0.0188  0.0029  0.0253  212 HIS A ND1 
1650 C CD2 . HIS A 212 ? 0.4895 0.3903 0.4361 0.0077  0.0035  0.0251  212 HIS A CD2 
1651 C CE1 . HIS A 212 ? 0.4915 0.3933 0.4386 0.0202  0.0013  0.0253  212 HIS A CE1 
1652 N NE2 . HIS A 212 ? 0.4900 0.3989 0.4430 0.0136  0.0017  0.0251  212 HIS A NE2 
1653 N N   . ILE A 213 ? 0.5772 0.4231 0.4813 -0.0035 0.0071  0.0223  213 ILE A N   
1654 C CA  . ILE A 213 ? 0.6290 0.4568 0.5189 -0.0091 0.0069  0.0218  213 ILE A CA  
1655 C C   . ILE A 213 ? 0.6563 0.4694 0.5350 -0.0018 0.0073  0.0194  213 ILE A C   
1656 O O   . ILE A 213 ? 0.6690 0.4615 0.5323 -0.0021 0.0069  0.0192  213 ILE A O   
1657 C CB  . ILE A 213 ? 0.5895 0.4238 0.4834 -0.0187 0.0066  0.0212  213 ILE A CB  
1658 C CG1 . ILE A 213 ? 0.5276 0.3764 0.4321 -0.0251 0.0065  0.0238  213 ILE A CG1 
1659 C CG2 . ILE A 213 ? 0.5203 0.3352 0.3989 -0.0251 0.0057  0.0204  213 ILE A CG2 
1660 C CD1 . ILE A 213 ? 0.4491 0.3028 0.3558 -0.0352 0.0059  0.0241  213 ILE A CD1 
1661 N N   . LEU A 214 ? 0.6698 0.4937 0.5561 0.0050  0.0084  0.0175  214 LEU A N   
1662 C CA  . LEU A 214 ? 0.6500 0.4629 0.5266 0.0126  0.0096  0.0148  214 LEU A CA  
1663 C C   . LEU A 214 ? 0.6499 0.4596 0.5243 0.0247  0.0102  0.0153  214 LEU A C   
1664 O O   . LEU A 214 ? 0.7072 0.5097 0.5745 0.0330  0.0116  0.0133  214 LEU A O   
1665 C CB  . LEU A 214 ? 0.6524 0.4795 0.5378 0.0137  0.0111  0.0129  214 LEU A CB  
1666 C CG  . LEU A 214 ? 0.7605 0.5890 0.6456 0.0036  0.0105  0.0118  214 LEU A CG  
1667 C CD1 . LEU A 214 ? 0.6870 0.5284 0.5792 0.0063  0.0121  0.0103  214 LEU A CD1 
1668 C CD2 . LEU A 214 ? 0.7586 0.5634 0.6249 -0.0008 0.0094  0.0101  214 LEU A CD2 
1669 N N   . SER A 215 ? 0.5840 0.4001 0.4644 0.0264  0.0090  0.0179  215 SER A N   
1670 C CA  . SER A 215 ? 0.6398 0.4561 0.5201 0.0380  0.0089  0.0187  215 SER A CA  
1671 C C   . SER A 215 ? 0.7001 0.4994 0.5683 0.0387  0.0072  0.0210  215 SER A C   
1672 O O   . SER A 215 ? 0.6749 0.4784 0.5467 0.0333  0.0059  0.0234  215 SER A O   
1673 C CB  . SER A 215 ? 0.6610 0.5021 0.5600 0.0406  0.0083  0.0199  215 SER A CB  
1674 O OG  . SER A 215 ? 0.5776 0.4226 0.4785 0.0519  0.0080  0.0207  215 SER A OG  
1675 N N   . LEU A 216 ? 0.8297 0.6091 0.6825 0.0459  0.0075  0.0203  216 LEU A N   
1676 C CA  . LEU A 216 ? 0.9406 0.6985 0.7780 0.0456  0.0059  0.0226  216 LEU A CA  
1677 C C   . LEU A 216 ? 0.8484 0.6137 0.6911 0.0458  0.0041  0.0263  216 LEU A C   
1678 O O   . LEU A 216 ? 0.7781 0.5355 0.6151 0.0374  0.0033  0.0287  216 LEU A O   
1679 C CB  . LEU A 216 ? 1.0798 0.8169 0.9011 0.0569  0.0063  0.0215  216 LEU A CB  
1680 C CG  . LEU A 216 ? 1.1751 0.8891 0.9796 0.0516  0.0069  0.0188  216 LEU A CG  
1681 C CD1 . LEU A 216 ? 1.2088 0.9038 0.9980 0.0645  0.0079  0.0164  216 LEU A CD1 
1682 C CD2 . LEU A 216 ? 1.1400 0.8363 0.9330 0.0398  0.0052  0.0213  216 LEU A CD2 
1683 N N   . PRO A 217 ? 0.7331 0.5145 0.5868 0.0550  0.0033  0.0269  217 PRO A N   
1684 C CA  . PRO A 217 ? 0.6361 0.4241 0.4936 0.0559  0.0010  0.0301  217 PRO A CA  
1685 C C   . PRO A 217 ? 0.7327 0.5327 0.5992 0.0445  0.0007  0.0311  217 PRO A C   
1686 O O   . PRO A 217 ? 0.8335 0.6342 0.6988 0.0435  -0.0008 0.0337  217 PRO A O   
1687 C CB  . PRO A 217 ? 0.5660 0.3730 0.4365 0.0664  -0.0001 0.0298  217 PRO A CB  
1688 C CG  . PRO A 217 ? 0.5889 0.3925 0.4568 0.0741  0.0021  0.0273  217 PRO A CG  
1689 C CD  . PRO A 217 ? 0.6645 0.4595 0.5274 0.0647  0.0044  0.0249  217 PRO A CD  
1690 N N   . SER A 218 ? 0.5766 0.3862 0.4514 0.0368  0.0023  0.0291  218 SER A N   
1691 C CA  . SER A 218 ? 0.6118 0.4330 0.4950 0.0274  0.0023  0.0301  218 SER A CA  
1692 C C   . SER A 218 ? 0.6978 0.5047 0.5700 0.0177  0.0032  0.0316  218 SER A C   
1693 O O   . SER A 218 ? 0.5748 0.3880 0.4503 0.0110  0.0034  0.0335  218 SER A O   
1694 C CB  . SER A 218 ? 0.5849 0.4238 0.4825 0.0237  0.0033  0.0278  218 SER A CB  
1695 O OG  . SER A 218 ? 0.6644 0.5204 0.5747 0.0295  0.0020  0.0274  218 SER A OG  
1696 N N   . ARG A 219 ? 0.8119 0.5996 0.6708 0.0170  0.0037  0.0310  219 ARG A N   
1697 C CA  . ARG A 219 ? 0.8380 0.6133 0.6877 0.0058  0.0043  0.0321  219 ARG A CA  
1698 C C   . ARG A 219 ? 0.7418 0.5089 0.5835 0.0020  0.0040  0.0363  219 ARG A C   
1699 O O   . ARG A 219 ? 0.8902 0.6594 0.7324 -0.0084 0.0049  0.0382  219 ARG A O   
1700 C CB  . ARG A 219 ? 0.9829 0.7371 0.8182 0.0059  0.0043  0.0301  219 ARG A CB  
1701 C CG  . ARG A 219 ? 0.9941 0.7561 0.8358 0.0051  0.0051  0.0262  219 ARG A CG  
1702 C CD  . ARG A 219 ? 1.0228 0.8007 0.8760 -0.0061 0.0055  0.0263  219 ARG A CD  
1703 N NE  . ARG A 219 ? 1.0806 0.8493 0.9264 -0.0181 0.0051  0.0286  219 ARG A NE  
1704 C CZ  . ARG A 219 ? 1.0433 0.8003 0.8804 -0.0264 0.0044  0.0276  219 ARG A CZ  
1705 N NH1 . ARG A 219 ? 0.9556 0.7066 0.7885 -0.0236 0.0041  0.0237  219 ARG A NH1 
1706 N NH2 . ARG A 219 ? 1.0051 0.7563 0.8373 -0.0380 0.0039  0.0304  219 ARG A NH2 
1707 N N   . SER A 220 ? 0.7313 0.4904 0.5661 0.0106  0.0028  0.0380  220 SER A N   
1708 C CA  . SER A 220 ? 0.7871 0.5382 0.6133 0.0077  0.0026  0.0423  220 SER A CA  
1709 C C   . SER A 220 ? 0.7774 0.5488 0.6156 0.0054  0.0030  0.0437  220 SER A C   
1710 O O   . SER A 220 ? 0.8054 0.5724 0.6369 0.0041  0.0030  0.0473  220 SER A O   
1711 C CB  . SER A 220 ? 0.8224 0.5582 0.6366 0.0187  0.0008  0.0439  220 SER A CB  
1712 O OG  . SER A 220 ? 0.7769 0.5289 0.6022 0.0292  -0.0007 0.0427  220 SER A OG  
1713 N N   . LEU A 221 ? 0.7013 0.4938 0.5560 0.0053  0.0033  0.0410  221 LEU A N   
1714 C CA  . LEU A 221 ? 0.5801 0.3906 0.4453 0.0050  0.0033  0.0415  221 LEU A CA  
1715 C C   . LEU A 221 ? 0.5845 0.4066 0.4576 -0.0050 0.0055  0.0416  221 LEU A C   
1716 O O   . LEU A 221 ? 0.5633 0.3996 0.4443 -0.0055 0.0059  0.0418  221 LEU A O   
1717 C CB  . LEU A 221 ? 0.5564 0.3827 0.4346 0.0131  0.0014  0.0387  221 LEU A CB  
1718 C CG  . LEU A 221 ? 0.6825 0.5041 0.5578 0.0243  -0.0010 0.0382  221 LEU A CG  
1719 C CD1 . LEU A 221 ? 0.6641 0.5044 0.5549 0.0293  -0.0023 0.0354  221 LEU A CD1 
1720 C CD2 . LEU A 221 ? 0.6569 0.4713 0.5230 0.0290  -0.0029 0.0413  221 LEU A CD2 
1721 N N   . PHE A 222 ? 0.5564 0.3725 0.4268 -0.0126 0.0068  0.0414  222 PHE A N   
1722 C CA  . PHE A 222 ? 0.6012 0.4294 0.4793 -0.0221 0.0087  0.0420  222 PHE A CA  
1723 C C   . PHE A 222 ? 0.6698 0.4864 0.5401 -0.0318 0.0094  0.0432  222 PHE A C   
1724 O O   . PHE A 222 ? 0.5824 0.3804 0.4410 -0.0309 0.0082  0.0427  222 PHE A O   
1725 C CB  . PHE A 222 ? 0.5250 0.3715 0.4187 -0.0205 0.0085  0.0387  222 PHE A CB  
1726 C CG  . PHE A 222 ? 0.4741 0.3168 0.3686 -0.0193 0.0076  0.0357  222 PHE A CG  
1727 C CD1 . PHE A 222 ? 0.4565 0.2929 0.3483 -0.0102 0.0062  0.0338  222 PHE A CD1 
1728 C CD2 . PHE A 222 ? 0.5081 0.3541 0.4059 -0.0269 0.0081  0.0348  222 PHE A CD2 
1729 C CE1 . PHE A 222 ? 0.5491 0.3824 0.4409 -0.0083 0.0060  0.0310  222 PHE A CE1 
1730 C CE2 . PHE A 222 ? 0.5794 0.4213 0.4764 -0.0256 0.0073  0.0319  222 PHE A CE2 
1731 C CZ  . PHE A 222 ? 0.5470 0.3825 0.4409 -0.0161 0.0066  0.0299  222 PHE A CZ  
1732 N N   . HIS A 223 ? 0.6884 0.5158 0.5647 -0.0410 0.0110  0.0448  223 HIS A N   
1733 C CA  . HIS A 223 ? 0.7048 0.5218 0.5733 -0.0518 0.0112  0.0467  223 HIS A CA  
1734 C C   . HIS A 223 ? 0.7748 0.6033 0.6529 -0.0586 0.0108  0.0448  223 HIS A C   
1735 O O   . HIS A 223 ? 0.8010 0.6176 0.6717 -0.0650 0.0094  0.0443  223 HIS A O   
1736 C CB  . HIS A 223 ? 0.6070 0.4229 0.4703 -0.0588 0.0133  0.0518  223 HIS A CB  
1737 C CG  . HIS A 223 ? 0.6476 0.4530 0.5011 -0.0519 0.0135  0.0540  223 HIS A CG  
1738 N ND1 . HIS A 223 ? 0.6906 0.5088 0.5501 -0.0458 0.0146  0.0544  223 HIS A ND1 
1739 C CD2 . HIS A 223 ? 0.7241 0.5064 0.5614 -0.0497 0.0123  0.0556  223 HIS A CD2 
1740 C CE1 . HIS A 223 ? 0.7668 0.5716 0.6146 -0.0406 0.0140  0.0565  223 HIS A CE1 
1741 N NE2 . HIS A 223 ? 0.7988 0.5817 0.6331 -0.0425 0.0126  0.0575  223 HIS A NE2 
1742 N N   . ARG A 224 ? 0.6767 0.5269 0.5699 -0.0569 0.0117  0.0438  224 ARG A N   
1743 C CA  . ARG A 224 ? 0.6216 0.4844 0.5246 -0.0619 0.0112  0.0422  224 ARG A CA  
1744 C C   . ARG A 224 ? 0.6999 0.5766 0.6150 -0.0536 0.0108  0.0389  224 ARG A C   
1745 O O   . ARG A 224 ? 0.7175 0.5961 0.6344 -0.0453 0.0111  0.0382  224 ARG A O   
1746 C CB  . ARG A 224 ? 0.6595 0.5373 0.5697 -0.0706 0.0130  0.0457  224 ARG A CB  
1747 C CG  . ARG A 224 ? 0.6961 0.5631 0.5962 -0.0812 0.0134  0.0496  224 ARG A CG  
1748 C CD  . ARG A 224 ? 0.7182 0.6037 0.6268 -0.0875 0.0163  0.0537  224 ARG A CD  
1749 N NE  . ARG A 224 ? 0.6984 0.5798 0.6003 -0.0865 0.0191  0.0574  224 ARG A NE  
1750 C CZ  . ARG A 224 ? 0.7877 0.6475 0.6742 -0.0876 0.0186  0.0593  224 ARG A CZ  
1751 N NH1 . ARG A 224 ? 0.8904 0.7299 0.7662 -0.0893 0.0156  0.0575  224 ARG A NH1 
1752 N NH2 . ARG A 224 ? 0.7615 0.6193 0.6423 -0.0866 0.0212  0.0629  224 ARG A NH2 
1753 N N   . ALA A 225 ? 0.6171 0.5035 0.5402 -0.0563 0.0099  0.0372  225 ALA A N   
1754 C CA  . ALA A 225 ? 0.5438 0.4403 0.4765 -0.0491 0.0093  0.0343  225 ALA A CA  
1755 C C   . ALA A 225 ? 0.5458 0.4583 0.4895 -0.0533 0.0090  0.0341  225 ALA A C   
1756 O O   . ALA A 225 ? 0.5591 0.4707 0.5009 -0.0611 0.0080  0.0347  225 ALA A O   
1757 C CB  . ALA A 225 ? 0.6171 0.5010 0.5432 -0.0445 0.0079  0.0314  225 ALA A CB  
1758 N N   . VAL A 226 ? 0.5037 0.4303 0.4583 -0.0481 0.0094  0.0334  226 VAL A N   
1759 C CA  . VAL A 226 ? 0.5771 0.5182 0.5420 -0.0502 0.0089  0.0332  226 VAL A CA  
1760 C C   . VAL A 226 ? 0.5922 0.5359 0.5620 -0.0440 0.0077  0.0305  226 VAL A C   
1761 O O   . VAL A 226 ? 0.6232 0.5682 0.5959 -0.0374 0.0080  0.0296  226 VAL A O   
1762 C CB  . VAL A 226 ? 0.5457 0.5023 0.5195 -0.0500 0.0106  0.0352  226 VAL A CB  
1763 C CG1 . VAL A 226 ? 0.6066 0.5776 0.5903 -0.0521 0.0097  0.0354  226 VAL A CG1 
1764 C CG2 . VAL A 226 ? 0.4076 0.3636 0.3772 -0.0556 0.0125  0.0383  226 VAL A CG2 
1765 N N   . LEU A 227 ? 0.5236 0.4680 0.4940 -0.0466 0.0063  0.0294  227 LEU A N   
1766 C CA  . LEU A 227 ? 0.5800 0.5278 0.5551 -0.0416 0.0055  0.0275  227 LEU A CA  
1767 C C   . LEU A 227 ? 0.5694 0.5314 0.5541 -0.0432 0.0047  0.0283  227 LEU A C   
1768 O O   . LEU A 227 ? 0.4794 0.4442 0.4638 -0.0487 0.0034  0.0289  227 LEU A O   
1769 C CB  . LEU A 227 ? 0.6124 0.5487 0.5789 -0.0418 0.0048  0.0255  227 LEU A CB  
1770 C CG  . LEU A 227 ? 0.5581 0.4803 0.5155 -0.0370 0.0055  0.0242  227 LEU A CG  
1771 C CD1 . LEU A 227 ? 0.4977 0.4097 0.4468 -0.0403 0.0058  0.0255  227 LEU A CD1 
1772 C CD2 . LEU A 227 ? 0.4467 0.3596 0.3964 -0.0358 0.0052  0.0219  227 LEU A CD2 
1773 N N   . GLN A 228 ? 0.5533 0.5237 0.5460 -0.0382 0.0051  0.0284  228 GLN A N   
1774 C CA  . GLN A 228 ? 0.4668 0.4494 0.4678 -0.0385 0.0043  0.0294  228 GLN A CA  
1775 C C   . GLN A 228 ? 0.5289 0.5120 0.5326 -0.0350 0.0032  0.0283  228 GLN A C   
1776 O O   . GLN A 228 ? 0.5596 0.5410 0.5651 -0.0301 0.0035  0.0275  228 GLN A O   
1777 C CB  . GLN A 228 ? 0.3728 0.3639 0.3799 -0.0355 0.0054  0.0305  228 GLN A CB  
1778 C CG  . GLN A 228 ? 0.4220 0.4116 0.4256 -0.0374 0.0072  0.0316  228 GLN A CG  
1779 C CD  . GLN A 228 ? 0.4458 0.4425 0.4538 -0.0329 0.0088  0.0321  228 GLN A CD  
1780 O OE1 . GLN A 228 ? 0.5263 0.5223 0.5312 -0.0333 0.0107  0.0330  228 GLN A OE1 
1781 N NE2 . GLN A 228 ? 0.4495 0.4520 0.4636 -0.0285 0.0079  0.0315  228 GLN A NE2 
1782 N N   . SER A 229 ? 0.4962 0.4818 0.4998 -0.0380 0.0019  0.0286  229 SER A N   
1783 C CA  . SER A 229 ? 0.4119 0.3984 0.4174 -0.0353 0.0012  0.0282  229 SER A CA  
1784 C C   . SER A 229 ? 0.4563 0.4348 0.4580 -0.0316 0.0023  0.0266  229 SER A C   
1785 O O   . SER A 229 ? 0.5043 0.4853 0.5104 -0.0279 0.0024  0.0267  229 SER A O   
1786 C CB  . SER A 229 ? 0.4252 0.4204 0.4391 -0.0319 0.0006  0.0295  229 SER A CB  
1787 O OG  . SER A 229 ? 0.4970 0.5010 0.5152 -0.0337 0.0000  0.0311  229 SER A OG  
1788 N N   . GLY A 230 ? 0.4811 0.4502 0.4745 -0.0327 0.0030  0.0252  230 GLY A N   
1789 C CA  . GLY A 230 ? 0.3381 0.3005 0.3276 -0.0284 0.0042  0.0238  230 GLY A CA  
1790 C C   . GLY A 230 ? 0.4254 0.3754 0.4040 -0.0293 0.0048  0.0223  230 GLY A C   
1791 O O   . GLY A 230 ? 0.4648 0.4103 0.4393 -0.0329 0.0044  0.0226  230 GLY A O   
1792 N N   . THR A 231 ? 0.4568 0.4011 0.4302 -0.0257 0.0060  0.0208  231 THR A N   
1793 C CA  . THR A 231 ? 0.5947 0.5250 0.5558 -0.0254 0.0065  0.0190  231 THR A CA  
1794 C C   . THR A 231 ? 0.5417 0.4690 0.5012 -0.0177 0.0085  0.0180  231 THR A C   
1795 O O   . THR A 231 ? 0.5341 0.4709 0.5014 -0.0144 0.0093  0.0186  231 THR A O   
1796 C CB  . THR A 231 ? 0.7010 0.6261 0.6538 -0.0297 0.0057  0.0177  231 THR A CB  
1797 O OG1 . THR A 231 ? 0.7056 0.6364 0.6607 -0.0265 0.0067  0.0174  231 THR A OG1 
1798 C CG2 . THR A 231 ? 0.5719 0.5025 0.5276 -0.0376 0.0033  0.0191  231 THR A CG2 
1799 N N   . PRO A 232 ? 0.6277 0.5418 0.5768 -0.0149 0.0092  0.0166  232 PRO A N   
1800 C CA  . PRO A 232 ? 0.4803 0.3935 0.4287 -0.0065 0.0111  0.0158  232 PRO A CA  
1801 C C   . PRO A 232 ? 0.4344 0.3466 0.3779 -0.0043 0.0129  0.0142  232 PRO A C   
1802 O O   . PRO A 232 ? 0.4916 0.4127 0.4410 0.0010  0.0149  0.0147  232 PRO A O   
1803 C CB  . PRO A 232 ? 0.5374 0.4350 0.4746 -0.0040 0.0111  0.0150  232 PRO A CB  
1804 C CG  . PRO A 232 ? 0.3985 0.2877 0.3294 -0.0125 0.0092  0.0153  232 PRO A CG  
1805 C CD  . PRO A 232 ? 0.5316 0.4308 0.4687 -0.0191 0.0082  0.0158  232 PRO A CD  
1806 N N   . ASN A 233 ? 0.4641 0.3659 0.3965 -0.0087 0.0122  0.0125  233 ASN A N   
1807 C CA  . ASN A 233 ? 0.4469 0.3477 0.3733 -0.0077 0.0136  0.0109  233 ASN A CA  
1808 C C   . ASN A 233 ? 0.4437 0.3610 0.3821 -0.0104 0.0134  0.0130  233 ASN A C   
1809 O O   . ASN A 233 ? 0.4996 0.4268 0.4493 -0.0131 0.0120  0.0152  233 ASN A O   
1810 C CB  . ASN A 233 ? 0.4126 0.2986 0.3247 -0.0135 0.0116  0.0087  233 ASN A CB  
1811 C CG  . ASN A 233 ? 0.4709 0.3606 0.3875 -0.0232 0.0082  0.0103  233 ASN A CG  
1812 O OD1 . ASN A 233 ? 0.4238 0.3160 0.3465 -0.0249 0.0074  0.0121  233 ASN A OD1 
1813 N ND2 . ASN A 233 ? 0.4264 0.3180 0.3406 -0.0293 0.0062  0.0100  233 ASN A ND2 
1814 N N   . GLY A 234 ? 0.4001 0.3193 0.3347 -0.0096 0.0148  0.0123  234 GLY A N   
1815 C CA  . GLY A 234 ? 0.4676 0.4010 0.4122 -0.0120 0.0145  0.0147  234 GLY A CA  
1816 C C   . GLY A 234 ? 0.5403 0.4842 0.4923 -0.0060 0.0179  0.0162  234 GLY A C   
1817 O O   . GLY A 234 ? 0.5551 0.4977 0.5066 0.0004  0.0203  0.0156  234 GLY A O   
1818 N N   . PRO A 235 ? 0.5114 0.4663 0.4706 -0.0081 0.0181  0.0187  235 PRO A N   
1819 C CA  . PRO A 235 ? 0.4914 0.4558 0.4553 -0.0035 0.0216  0.0204  235 PRO A CA  
1820 C C   . PRO A 235 ? 0.5358 0.5113 0.5140 -0.0019 0.0218  0.0230  235 PRO A C   
1821 O O   . PRO A 235 ? 0.5295 0.5140 0.5125 0.0013  0.0247  0.0247  235 PRO A O   
1822 C CB  . PRO A 235 ? 0.4699 0.4400 0.4344 -0.0077 0.0212  0.0225  235 PRO A CB  
1823 C CG  . PRO A 235 ? 0.3584 0.3253 0.3228 -0.0141 0.0167  0.0225  235 PRO A CG  
1824 C CD  . PRO A 235 ? 0.5208 0.4807 0.4848 -0.0145 0.0149  0.0206  235 PRO A CD  
1825 N N   . TRP A 236 ? 0.5277 0.5030 0.5120 -0.0043 0.0187  0.0233  236 TRP A N   
1826 C CA  . TRP A 236 ? 0.5010 0.4862 0.4980 -0.0037 0.0180  0.0256  236 TRP A CA  
1827 C C   . TRP A 236 ? 0.5425 0.5255 0.5417 -0.0004 0.0171  0.0246  236 TRP A C   
1828 O O   . TRP A 236 ? 0.6216 0.6131 0.6297 0.0016  0.0171  0.0262  236 TRP A O   
1829 C CB  . TRP A 236 ? 0.5296 0.5187 0.5335 -0.0092 0.0150  0.0276  236 TRP A CB  
1830 C CG  . TRP A 236 ? 0.5275 0.5096 0.5278 -0.0125 0.0123  0.0262  236 TRP A CG  
1831 C CD1 . TRP A 236 ? 0.5477 0.5263 0.5424 -0.0162 0.0111  0.0258  236 TRP A CD1 
1832 C CD2 . TRP A 236 ? 0.4840 0.4632 0.4862 -0.0125 0.0104  0.0254  236 TRP A CD2 
1833 N NE1 . TRP A 236 ? 0.4825 0.4575 0.4766 -0.0188 0.0088  0.0250  236 TRP A NE1 
1834 C CE2 . TRP A 236 ? 0.4517 0.4266 0.4500 -0.0165 0.0087  0.0248  236 TRP A CE2 
1835 C CE3 . TRP A 236 ? 0.4720 0.4525 0.4788 -0.0097 0.0099  0.0253  236 TRP A CE3 
1836 C CZ2 . TRP A 236 ? 0.3658 0.3378 0.3645 -0.0176 0.0072  0.0242  236 TRP A CZ2 
1837 C CZ3 . TRP A 236 ? 0.4532 0.4295 0.4593 -0.0106 0.0081  0.0245  236 TRP A CZ3 
1838 C CH2 . TRP A 236 ? 0.3923 0.3645 0.3943 -0.0145 0.0071  0.0241  236 TRP A CH2 
1839 N N   . ALA A 237 ? 0.5877 0.5594 0.5785 -0.0002 0.0162  0.0223  237 ALA A N   
1840 C CA  . ALA A 237 ? 0.5026 0.4707 0.4939 0.0026  0.0150  0.0217  237 ALA A CA  
1841 C C   . ALA A 237 ? 0.4950 0.4634 0.4850 0.0103  0.0170  0.0212  237 ALA A C   
1842 O O   . ALA A 237 ? 0.5201 0.4893 0.5134 0.0131  0.0157  0.0215  237 ALA A O   
1843 C CB  . ALA A 237 ? 0.3078 0.2637 0.2904 -0.0004 0.0134  0.0201  237 ALA A CB  
1844 N N   . THR A 238 ? 0.3906 0.3586 0.3754 0.0142  0.0203  0.0205  238 THR A N   
1845 C CA  . THR A 238 ? 0.4532 0.4230 0.4371 0.0228  0.0227  0.0202  238 THR A CA  
1846 C C   . THR A 238 ? 0.5262 0.5084 0.5149 0.0261  0.0265  0.0216  238 THR A C   
1847 O O   . THR A 238 ? 0.5962 0.5814 0.5848 0.0219  0.0276  0.0223  238 THR A O   
1848 C CB  . THR A 238 ? 0.4714 0.4238 0.4395 0.0274  0.0238  0.0172  238 THR A CB  
1849 O OG1 . THR A 238 ? 0.4961 0.4406 0.4537 0.0252  0.0254  0.0153  238 THR A OG1 
1850 C CG2 . THR A 238 ? 0.3543 0.2951 0.3178 0.0243  0.0205  0.0165  238 THR A CG2 
1851 N N   . VAL A 239 ? 0.4510 0.4410 0.4439 0.0337  0.0286  0.0224  239 VAL A N   
1852 C CA  . VAL A 239 ? 0.4449 0.4471 0.4412 0.0382  0.0332  0.0238  239 VAL A CA  
1853 C C   . VAL A 239 ? 0.4703 0.4694 0.4596 0.0494  0.0365  0.0222  239 VAL A C   
1854 O O   . VAL A 239 ? 0.5510 0.5434 0.5379 0.0539  0.0345  0.0212  239 VAL A O   
1855 C CB  . VAL A 239 ? 0.4193 0.4426 0.4334 0.0353  0.0328  0.0280  239 VAL A CB  
1856 C CG1 . VAL A 239 ? 0.3417 0.3668 0.3601 0.0253  0.0307  0.0296  239 VAL A CG1 
1857 C CG2 . VAL A 239 ? 0.3236 0.3527 0.3469 0.0370  0.0293  0.0290  239 VAL A CG2 
1858 N N   . SER A 240 ? 0.4349 0.4379 0.4199 0.0545  0.0416  0.0219  240 SER A N   
1859 C CA  . SER A 240 ? 0.5090 0.5100 0.4874 0.0666  0.0453  0.0204  240 SER A CA  
1860 C C   . SER A 240 ? 0.4747 0.4933 0.4682 0.0716  0.0447  0.0235  240 SER A C   
1861 O O   . SER A 240 ? 0.5022 0.5356 0.5109 0.0651  0.0421  0.0268  240 SER A O   
1862 C CB  . SER A 240 ? 0.5088 0.5153 0.4821 0.0712  0.0515  0.0202  240 SER A CB  
1863 O OG  . SER A 240 ? 0.6064 0.6373 0.5961 0.0696  0.0539  0.0247  240 SER A OG  
1864 N N   . ALA A 241 ? 0.3752 0.3914 0.3640 0.0831  0.0466  0.0224  241 ALA A N   
1865 C CA  . ALA A 241 ? 0.5226 0.5575 0.5259 0.0889  0.0460  0.0255  241 ALA A CA  
1866 C C   . ALA A 241 ? 0.5040 0.5648 0.5219 0.0887  0.0502  0.0293  241 ALA A C   
1867 O O   . ALA A 241 ? 0.5257 0.6059 0.5606 0.0858  0.0480  0.0331  241 ALA A O   
1868 C CB  . ALA A 241 ? 0.3554 0.3820 0.3495 0.1029  0.0475  0.0237  241 ALA A CB  
1869 N N   . GLY A 242 ? 0.5027 0.5635 0.5134 0.0912  0.0559  0.0285  242 GLY A N   
1870 C CA  . GLY A 242 ? 0.5581 0.6439 0.5817 0.0912  0.0606  0.0327  242 GLY A CA  
1871 C C   . GLY A 242 ? 0.5912 0.6874 0.6274 0.0773  0.0577  0.0362  242 GLY A C   
1872 O O   . GLY A 242 ? 0.6255 0.7446 0.6788 0.0743  0.0580  0.0408  242 GLY A O   
1873 N N   . GLU A 243 ? 0.6001 0.6792 0.6276 0.0687  0.0547  0.0340  243 GLU A N   
1874 C CA  . GLU A 243 ? 0.5704 0.6556 0.6074 0.0562  0.0516  0.0369  243 GLU A CA  
1875 C C   . GLU A 243 ? 0.5309 0.6238 0.5818 0.0519  0.0456  0.0389  243 GLU A C   
1876 O O   . GLU A 243 ? 0.4607 0.5696 0.5257 0.0454  0.0443  0.0430  243 GLU A O   
1877 C CB  . GLU A 243 ? 0.5325 0.5973 0.5561 0.0496  0.0495  0.0340  243 GLU A CB  
1878 C CG  . GLU A 243 ? 0.5636 0.6304 0.5945 0.0378  0.0456  0.0363  243 GLU A CG  
1879 C CD  . GLU A 243 ? 0.6015 0.6863 0.6430 0.0330  0.0485  0.0413  243 GLU A CD  
1880 O OE1 . GLU A 243 ? 0.6460 0.7319 0.6939 0.0237  0.0448  0.0435  243 GLU A OE1 
1881 O OE2 . GLU A 243 ? 0.4506 0.5479 0.4935 0.0382  0.0544  0.0432  243 GLU A OE2 
1882 N N   . ALA A 244 ? 0.5314 0.6123 0.5773 0.0554  0.0418  0.0361  244 ALA A N   
1883 C CA  . ALA A 244 ? 0.4804 0.5676 0.5375 0.0522  0.0360  0.0377  244 ALA A CA  
1884 C C   . ALA A 244 ? 0.4683 0.5801 0.5412 0.0560  0.0370  0.0416  244 ALA A C   
1885 O O   . ALA A 244 ? 0.4909 0.6152 0.5772 0.0491  0.0331  0.0445  244 ALA A O   
1886 C CB  . ALA A 244 ? 0.3930 0.4628 0.4404 0.0564  0.0325  0.0343  244 ALA A CB  
1887 N N   . ARG A 245 ? 0.4150 0.5340 0.4862 0.0671  0.0422  0.0416  245 ARG A N   
1888 C CA  . ARG A 245 ? 0.4950 0.6400 0.5820 0.0717  0.0437  0.0457  245 ARG A CA  
1889 C C   . ARG A 245 ? 0.5140 0.6781 0.6139 0.0626  0.0456  0.0503  245 ARG A C   
1890 O O   . ARG A 245 ? 0.4778 0.6624 0.5945 0.0582  0.0431  0.0545  245 ARG A O   
1891 C CB  . ARG A 245 ? 0.3965 0.5454 0.4778 0.0867  0.0499  0.0448  245 ARG A CB  
1892 C CG  . ARG A 245 ? 0.2944 0.4749 0.3934 0.0918  0.0531  0.0497  245 ARG A CG  
1893 C CD  . ARG A 245 ? 0.3205 0.5041 0.4149 0.1089  0.0573  0.0486  245 ARG A CD  
1894 N NE  . ARG A 245 ? 0.3463 0.5171 0.4357 0.1146  0.0517  0.0463  245 ARG A NE  
1895 C CZ  . ARG A 245 ? 0.4472 0.6343 0.5505 0.1163  0.0469  0.0492  245 ARG A CZ  
1896 N NH1 . ARG A 245 ? 0.4199 0.6371 0.5436 0.1122  0.0470  0.0543  245 ARG A NH1 
1897 N NH2 . ARG A 245 ? 0.4888 0.6625 0.5856 0.1215  0.0418  0.0472  245 ARG A NH2 
1898 N N   . ARG A 246 ? 0.4259 0.5829 0.5173 0.0595  0.0499  0.0498  246 ARG A N   
1899 C CA  . ARG A 246 ? 0.4290 0.6023 0.5305 0.0515  0.0525  0.0545  246 ARG A CA  
1900 C C   . ARG A 246 ? 0.4638 0.6363 0.5736 0.0378  0.0458  0.0565  246 ARG A C   
1901 O O   . ARG A 246 ? 0.4534 0.6448 0.5780 0.0312  0.0450  0.0614  246 ARG A O   
1902 C CB  . ARG A 246 ? 0.4808 0.6448 0.5691 0.0520  0.0584  0.0533  246 ARG A CB  
1903 C CG  . ARG A 246 ? 0.5246 0.7024 0.6208 0.0432  0.0611  0.0583  246 ARG A CG  
1904 C CD  . ARG A 246 ? 0.5479 0.7081 0.6297 0.0386  0.0623  0.0565  246 ARG A CD  
1905 N NE  . ARG A 246 ? 0.6433 0.8073 0.7330 0.0257  0.0592  0.0606  246 ARG A NE  
1906 C CZ  . ARG A 246 ? 0.5298 0.6770 0.6142 0.0181  0.0539  0.0589  246 ARG A CZ  
1907 N NH1 . ARG A 246 ? 0.5380 0.6649 0.6096 0.0213  0.0515  0.0535  246 ARG A NH1 
1908 N NH2 . ARG A 246 ? 0.4978 0.6483 0.5892 0.0074  0.0512  0.0629  246 ARG A NH2 
1909 N N   . ARG A 247 ? 0.4240 0.5748 0.5242 0.0337  0.0410  0.0528  247 ARG A N   
1910 C CA  . ARG A 247 ? 0.4110 0.5587 0.5173 0.0223  0.0346  0.0540  247 ARG A CA  
1911 C C   . ARG A 247 ? 0.4413 0.6004 0.5601 0.0211  0.0290  0.0555  247 ARG A C   
1912 O O   . ARG A 247 ? 0.4154 0.5822 0.5443 0.0117  0.0252  0.0585  247 ARG A O   
1913 C CB  . ARG A 247 ? 0.3904 0.5139 0.4838 0.0196  0.0311  0.0497  247 ARG A CB  
1914 C CG  . ARG A 247 ? 0.3760 0.4884 0.4583 0.0176  0.0345  0.0487  247 ARG A CG  
1915 C CD  . ARG A 247 ? 0.3612 0.4519 0.4316 0.0163  0.0310  0.0444  247 ARG A CD  
1916 N NE  . ARG A 247 ? 0.3531 0.4333 0.4118 0.0155  0.0341  0.0431  247 ARG A NE  
1917 C CZ  . ARG A 247 ? 0.4812 0.5454 0.5310 0.0119  0.0314  0.0405  247 ARG A CZ  
1918 N NH1 . ARG A 247 ? 0.4438 0.5006 0.4948 0.0093  0.0262  0.0390  247 ARG A NH1 
1919 N NH2 . ARG A 247 ? 0.3846 0.4411 0.4243 0.0110  0.0337  0.0396  247 ARG A NH2 
1920 N N   . ALA A 248 ? 0.4522 0.6112 0.5696 0.0304  0.0282  0.0534  248 ALA A N   
1921 C CA  . ALA A 248 ? 0.4228 0.5938 0.5519 0.0300  0.0226  0.0549  248 ALA A CA  
1922 C C   . ALA A 248 ? 0.4088 0.6077 0.5552 0.0275  0.0240  0.0604  248 ALA A C   
1923 O O   . ALA A 248 ? 0.3880 0.5977 0.5463 0.0200  0.0184  0.0630  248 ALA A O   
1924 C CB  . ALA A 248 ? 0.3750 0.5412 0.4985 0.0417  0.0219  0.0521  248 ALA A CB  
1925 N N   . THR A 249 ? 0.4241 0.6346 0.5715 0.0335  0.0316  0.0623  249 THR A N   
1926 C CA  . THR A 249 ? 0.4945 0.7343 0.6589 0.0327  0.0342  0.0680  249 THR A CA  
1927 C C   . THR A 249 ? 0.4816 0.7278 0.6540 0.0182  0.0329  0.0722  249 THR A C   
1928 O O   . THR A 249 ? 0.4426 0.7079 0.6307 0.0110  0.0295  0.0766  249 THR A O   
1929 C CB  . THR A 249 ? 0.4389 0.6892 0.6009 0.0438  0.0436  0.0688  249 THR A CB  
1930 O OG1 . THR A 249 ? 0.4644 0.7073 0.6182 0.0578  0.0444  0.0650  249 THR A OG1 
1931 C CG2 . THR A 249 ? 0.3372 0.6201 0.5179 0.0425  0.0465  0.0752  249 THR A CG2 
1932 N N   . LEU A 250 ? 0.3827 0.6122 0.5437 0.0139  0.0354  0.0709  250 LEU A N   
1933 C CA  . LEU A 250 ? 0.4163 0.6478 0.5818 0.0009  0.0345  0.0748  250 LEU A CA  
1934 C C   . LEU A 250 ? 0.4682 0.6938 0.6388 -0.0091 0.0253  0.0747  250 LEU A C   
1935 O O   . LEU A 250 ? 0.5055 0.7432 0.6876 -0.0193 0.0225  0.0793  250 LEU A O   
1936 C CB  . LEU A 250 ? 0.3625 0.5739 0.5128 -0.0007 0.0376  0.0727  250 LEU A CB  
1937 C CG  . LEU A 250 ? 0.4076 0.6184 0.5607 -0.0136 0.0366  0.0769  250 LEU A CG  
1938 C CD1 . LEU A 250 ? 0.2301 0.4674 0.3993 -0.0195 0.0390  0.0841  250 LEU A CD1 
1939 C CD2 . LEU A 250 ? 0.3791 0.5754 0.5180 -0.0132 0.0412  0.0759  250 LEU A CD2 
1940 N N   . LEU A 251 ? 0.4269 0.6333 0.5882 -0.0062 0.0205  0.0694  251 LEU A N   
1941 C CA  . LEU A 251 ? 0.3581 0.5569 0.5219 -0.0146 0.0119  0.0686  251 LEU A CA  
1942 C C   . LEU A 251 ? 0.3296 0.5495 0.5090 -0.0167 0.0076  0.0716  251 LEU A C   
1943 O O   . LEU A 251 ? 0.3423 0.5652 0.5288 -0.0277 0.0020  0.0740  251 LEU A O   
1944 C CB  . LEU A 251 ? 0.3036 0.4799 0.4546 -0.0102 0.0082  0.0625  251 LEU A CB  
1945 C CG  . LEU A 251 ? 0.3582 0.5315 0.5136 -0.0177 -0.0005 0.0621  251 LEU A CG  
1946 C CD1 . LEU A 251 ? 0.4274 0.5849 0.5774 -0.0277 -0.0034 0.0618  251 LEU A CD1 
1947 C CD2 . LEU A 251 ? 0.3970 0.5608 0.5461 -0.0109 -0.0043 0.0578  251 LEU A CD2 
1948 N N   . ALA A 252 ? 0.3001 0.5338 0.4840 -0.0061 0.0097  0.0715  252 ALA A N   
1949 C CA  . ALA A 252 ? 0.3488 0.6071 0.5492 -0.0070 0.0060  0.0752  252 ALA A CA  
1950 C C   . ALA A 252 ? 0.3511 0.6303 0.5661 -0.0178 0.0071  0.0817  252 ALA A C   
1951 O O   . ALA A 252 ? 0.3675 0.6540 0.5921 -0.0281 0.0002  0.0841  252 ALA A O   
1952 C CB  . ALA A 252 ? 0.2646 0.5370 0.4680 0.0076  0.0100  0.0750  252 ALA A CB  
1953 N N   . ARG A 253 ? 0.2796 0.5672 0.4949 -0.0158 0.0158  0.0846  253 ARG A N   
1954 C CA  . ARG A 253 ? 0.3638 0.6703 0.5914 -0.0263 0.0181  0.0915  253 ARG A CA  
1955 C C   . ARG A 253 ? 0.4680 0.7620 0.6951 -0.0422 0.0115  0.0928  253 ARG A C   
1956 O O   . ARG A 253 ? 0.4618 0.7716 0.7024 -0.0531 0.0074  0.0977  253 ARG A O   
1957 C CB  . ARG A 253 ? 0.2650 0.5751 0.4877 -0.0218 0.0285  0.0934  253 ARG A CB  
1958 C CG  . ARG A 253 ? 0.4437 0.7771 0.6734 -0.0093 0.0358  0.0952  253 ARG A CG  
1959 C CD  . ARG A 253 ? 0.6965 1.0361 0.9224 -0.0071 0.0461  0.0982  253 ARG A CD  
1960 N NE  . ARG A 253 ? 0.9046 1.2541 1.1278 0.0093  0.0539  0.0967  253 ARG A NE  
1961 C CZ  . ARG A 253 ? 0.9527 1.2818 1.1579 0.0202  0.0580  0.0909  253 ARG A CZ  
1962 N NH1 . ARG A 253 ? 0.9828 1.3213 1.1857 0.0353  0.0648  0.0898  253 ARG A NH1 
1963 N NH2 . ARG A 253 ? 0.7425 1.0418 0.9316 0.0164  0.0552  0.0864  253 ARG A NH2 
1964 N N   . LEU A 254 ? 0.4253 0.6910 0.6366 -0.0434 0.0105  0.0885  254 LEU A N   
1965 C CA  . LEU A 254 ? 0.4767 0.7266 0.6842 -0.0566 0.0051  0.0893  254 LEU A CA  
1966 C C   . LEU A 254 ? 0.5107 0.7597 0.7242 -0.0642 -0.0050 0.0886  254 LEU A C   
1967 O O   . LEU A 254 ? 0.4943 0.7355 0.7081 -0.0765 -0.0099 0.0905  254 LEU A O   
1968 C CB  . LEU A 254 ? 0.4789 0.6994 0.6683 -0.0538 0.0056  0.0841  254 LEU A CB  
1969 C CG  . LEU A 254 ? 0.4925 0.7101 0.6738 -0.0486 0.0144  0.0847  254 LEU A CG  
1970 C CD1 . LEU A 254 ? 0.4345 0.6257 0.5987 -0.0437 0.0143  0.0789  254 LEU A CD1 
1971 C CD2 . LEU A 254 ? 0.4344 0.6585 0.6198 -0.0590 0.0170  0.0911  254 LEU A CD2 
1972 N N   . VAL A 255 ? 0.4831 0.7380 0.6996 -0.0568 -0.0084 0.0856  255 VAL A N   
1973 C CA  . VAL A 255 ? 0.4622 0.7173 0.6837 -0.0632 -0.0184 0.0847  255 VAL A CA  
1974 C C   . VAL A 255 ? 0.5451 0.8315 0.7851 -0.0636 -0.0201 0.0891  255 VAL A C   
1975 O O   . VAL A 255 ? 0.6545 0.9448 0.8997 -0.0677 -0.0286 0.0885  255 VAL A O   
1976 C CB  . VAL A 255 ? 0.3687 0.6029 0.5775 -0.0558 -0.0229 0.0775  255 VAL A CB  
1977 C CG1 . VAL A 255 ? 0.3476 0.5537 0.5396 -0.0550 -0.0208 0.0735  255 VAL A CG1 
1978 C CG2 . VAL A 255 ? 0.2810 0.5247 0.4905 -0.0414 -0.0196 0.0757  255 VAL A CG2 
1979 N N   . GLY A 256 ? 0.5202 0.8293 0.7695 -0.0588 -0.0121 0.0936  256 GLY A N   
1980 C CA  . GLY A 256 ? 0.5829 0.9257 0.8518 -0.0594 -0.0126 0.0989  256 GLY A CA  
1981 C C   . GLY A 256 ? 0.5861 0.9435 0.8592 -0.0442 -0.0111 0.0973  256 GLY A C   
1982 O O   . GLY A 256 ? 0.5716 0.9431 0.8549 -0.0454 -0.0181 0.0982  256 GLY A O   
1983 N N   . CYS A 257 ? 0.5789 0.9330 0.8440 -0.0302 -0.0024 0.0952  257 CYS A N   
1984 C CA  . CYS A 257 ? 0.5067 0.8711 0.7734 -0.0145 -0.0007 0.0935  257 CYS A CA  
1985 C C   . CYS A 257 ? 0.6322 1.0114 0.9004 -0.0019 0.0106  0.0954  257 CYS A C   
1986 O O   . CYS A 257 ? 0.5470 0.9540 0.8286 0.0058  0.0129  0.0988  257 CYS A O   
1987 C CB  . CYS A 257 ? 0.4632 0.7984 0.7125 -0.0074 -0.0048 0.0861  257 CYS A CB  
1988 S SG  . CYS A 257 ? 0.5246 0.8447 0.7716 -0.0184 -0.0187 0.0832  257 CYS A SG  
1989 N N   . ASN A 265 ? 0.8340 1.2286 1.0654 0.1288  0.0450  0.0824  265 ASN A N   
1990 C CA  . ASN A 265 ? 0.8681 1.2476 1.0931 0.1337  0.0366  0.0795  265 ASN A CA  
1991 C C   . ASN A 265 ? 0.7790 1.1321 0.9952 0.1186  0.0285  0.0762  265 ASN A C   
1992 O O   . ASN A 265 ? 0.7715 1.1345 0.9995 0.1030  0.0237  0.0788  265 ASN A O   
1993 C CB  . ASN A 265 ? 0.9324 1.3453 1.1783 0.1386  0.0318  0.0846  265 ASN A CB  
1994 C CG  . ASN A 265 ? 0.9648 1.3648 1.2062 0.1403  0.0214  0.0825  265 ASN A CG  
1995 O OD1 . ASN A 265 ? 0.9757 1.3667 1.2179 0.1260  0.0133  0.0818  265 ASN A OD1 
1996 N ND2 . ASN A 265 ? 0.8993 1.2986 1.1357 0.1583  0.0217  0.0818  265 ASN A ND2 
1997 N N   . ASP A 266 ? 0.7151 1.0344 0.9101 0.1233  0.0273  0.0705  266 ASP A N   
1998 C CA  . ASP A 266 ? 0.5693 0.8618 0.7536 0.1105  0.0212  0.0670  266 ASP A CA  
1999 C C   . ASP A 266 ? 0.5373 0.8350 0.7302 0.1033  0.0107  0.0682  266 ASP A C   
2000 O O   . ASP A 266 ? 0.4826 0.7733 0.6767 0.0888  0.0055  0.0678  266 ASP A O   
2001 C CB  . ASP A 266 ? 0.5747 0.8320 0.7350 0.1181  0.0225  0.0613  266 ASP A CB  
2002 C CG  . ASP A 266 ? 0.6813 0.9255 0.8287 0.1217  0.0314  0.0588  266 ASP A CG  
2003 O OD1 . ASP A 266 ? 0.7812 1.0407 0.9369 0.1166  0.0365  0.0612  266 ASP A OD1 
2004 O OD2 . ASP A 266 ? 0.7611 0.9790 0.8892 0.1294  0.0332  0.0544  266 ASP A OD2 
2005 N N   . THR A 267 ? 0.5521 0.8605 0.7494 0.1144  0.0074  0.0695  267 THR A N   
2006 C CA  . THR A 267 ? 0.4725 0.7855 0.6760 0.1101  -0.0030 0.0705  267 THR A CA  
2007 C C   . THR A 267 ? 0.3866 0.7212 0.6085 0.0941  -0.0083 0.0742  267 THR A C   
2008 O O   . THR A 267 ? 0.3204 0.6437 0.5398 0.0827  -0.0158 0.0727  267 THR A O   
2009 C CB  . THR A 267 ? 0.5436 0.8735 0.7531 0.1258  -0.0045 0.0729  267 THR A CB  
2010 O OG1 . THR A 267 ? 0.5703 0.8761 0.7603 0.1406  0.0000  0.0693  267 THR A OG1 
2011 C CG2 . THR A 267 ? 0.2033 0.5392 0.4190 0.1219  -0.0157 0.0741  267 THR A CG2 
2012 N N   . GLU A 268 ? 0.5553 0.9207 0.7952 0.0933  -0.0043 0.0791  268 GLU A N   
2013 C CA  . GLU A 268 ? 0.6753 1.0640 0.9341 0.0780  -0.0091 0.0835  268 GLU A CA  
2014 C C   . GLU A 268 ? 0.5819 0.9537 0.8350 0.0617  -0.0086 0.0820  268 GLU A C   
2015 O O   . GLU A 268 ? 0.6150 0.9886 0.8745 0.0470  -0.0158 0.0830  268 GLU A O   
2016 C CB  . GLU A 268 ? 0.7470 1.1745 1.0263 0.0828  -0.0039 0.0897  268 GLU A CB  
2017 C CG  . GLU A 268 ? 0.9358 1.3843 1.2314 0.0668  -0.0030 0.0946  268 GLU A CG  
2018 C CD  . GLU A 268 ? 1.1485 1.6321 1.4606 0.0740  0.0055  0.1003  268 GLU A CD  
2019 O OE1 . GLU A 268 ? 1.1294 1.6360 1.4576 0.0615  0.0065  0.1057  268 GLU A OE1 
2020 O OE2 . GLU A 268 ? 1.2401 1.7278 1.5484 0.0924  0.0114  0.0996  268 GLU A OE2 
2021 N N   . LEU A 269 ? 0.4443 0.7983 0.6843 0.0648  -0.0003 0.0793  269 LEU A N   
2022 C CA  . LEU A 269 ? 0.4355 0.7713 0.6681 0.0516  0.0006  0.0777  269 LEU A CA  
2023 C C   . LEU A 269 ? 0.4979 0.8045 0.7167 0.0453  -0.0068 0.0729  269 LEU A C   
2024 O O   . LEU A 269 ? 0.5742 0.8730 0.7931 0.0315  -0.0106 0.0727  269 LEU A O   
2025 C CB  . LEU A 269 ? 0.2818 0.6055 0.5025 0.0578  0.0109  0.0759  269 LEU A CB  
2026 C CG  . LEU A 269 ? 0.3735 0.6792 0.5859 0.0457  0.0127  0.0745  269 LEU A CG  
2027 C CD1 . LEU A 269 ? 0.4331 0.7436 0.6429 0.0503  0.0230  0.0757  269 LEU A CD1 
2028 C CD2 . LEU A 269 ? 0.4420 0.7133 0.6352 0.0449  0.0095  0.0685  269 LEU A CD2 
2029 N N   . ILE A 270 ? 0.4194 0.7095 0.6257 0.0557  -0.0085 0.0691  270 ILE A N   
2030 C CA  . ILE A 270 ? 0.3894 0.6526 0.5819 0.0508  -0.0144 0.0647  270 ILE A CA  
2031 C C   . ILE A 270 ? 0.4210 0.6944 0.6232 0.0428  -0.0245 0.0662  270 ILE A C   
2032 O O   . ILE A 270 ? 0.5484 0.8088 0.7466 0.0313  -0.0297 0.0644  270 ILE A O   
2033 C CB  . ILE A 270 ? 0.4487 0.6908 0.6243 0.0636  -0.0130 0.0608  270 ILE A CB  
2034 C CG1 . ILE A 270 ? 0.5082 0.7349 0.6714 0.0684  -0.0040 0.0585  270 ILE A CG1 
2035 C CG2 . ILE A 270 ? 0.4318 0.6504 0.5950 0.0588  -0.0197 0.0571  270 ILE A CG2 
2036 C CD1 . ILE A 270 ? 0.6239 0.8415 0.7759 0.0842  -0.0001 0.0567  270 ILE A CD1 
2037 N N   . ALA A 271 ? 0.3364 0.6331 0.5508 0.0492  -0.0275 0.0694  271 ALA A N   
2038 C CA  . ALA A 271 ? 0.3632 0.6736 0.5885 0.0415  -0.0376 0.0713  271 ALA A CA  
2039 C C   . ALA A 271 ? 0.4265 0.7406 0.6596 0.0238  -0.0406 0.0728  271 ALA A C   
2040 O O   . ALA A 271 ? 0.4538 0.7579 0.6838 0.0139  -0.0488 0.0711  271 ALA A O   
2041 C CB  . ALA A 271 ? 0.2394 0.5823 0.4818 0.0492  -0.0388 0.0761  271 ALA A CB  
2042 N N   . CYS A 272 ? 0.3409 0.6683 0.5830 0.0199  -0.0338 0.0761  272 CYS A N   
2043 C CA  . CYS A 272 ? 0.3366 0.6669 0.5856 0.0030  -0.0366 0.0782  272 CYS A CA  
2044 C C   . CYS A 272 ? 0.4340 0.7304 0.6651 -0.0033 -0.0375 0.0732  272 CYS A C   
2045 O O   . CYS A 272 ? 0.4294 0.7169 0.6590 -0.0146 -0.0452 0.0720  272 CYS A O   
2046 C CB  . CYS A 272 ? 0.2588 0.6105 0.5204 0.0004  -0.0286 0.0834  272 CYS A CB  
2047 S SG  . CYS A 272 ? 0.5757 0.9243 0.8414 -0.0197 -0.0298 0.0861  272 CYS A SG  
2048 N N   . LEU A 273 ? 0.2672 0.5447 0.4844 0.0041  -0.0300 0.0700  273 LEU A N   
2049 C CA  . LEU A 273 ? 0.4619 0.7089 0.6624 -0.0004 -0.0309 0.0653  273 LEU A CA  
2050 C C   . LEU A 273 ? 0.5345 0.7677 0.7278 -0.0029 -0.0401 0.0619  273 LEU A C   
2051 O O   . LEU A 273 ? 0.4304 0.6467 0.6166 -0.0119 -0.0440 0.0595  273 LEU A O   
2052 C CB  . LEU A 273 ? 0.3772 0.6062 0.5631 0.0094  -0.0229 0.0621  273 LEU A CB  
2053 C CG  . LEU A 273 ? 0.4112 0.6432 0.5981 0.0081  -0.0143 0.0640  273 LEU A CG  
2054 C CD1 . LEU A 273 ? 0.2526 0.4650 0.4235 0.0169  -0.0075 0.0603  273 LEU A CD1 
2055 C CD2 . LEU A 273 ? 0.5233 0.7505 0.7121 -0.0062 -0.0163 0.0653  273 LEU A CD2 
2056 N N   . ARG A 274 ? 0.5072 0.7476 0.7019 0.0056  -0.0438 0.0616  274 ARG A N   
2057 C CA  . ARG A 274 ? 0.4662 0.6927 0.6520 0.0044  -0.0521 0.0583  274 ARG A CA  
2058 C C   . ARG A 274 ? 0.4884 0.7231 0.6826 -0.0082 -0.0615 0.0596  274 ARG A C   
2059 O O   . ARG A 274 ? 0.6596 0.8801 0.8448 -0.0114 -0.0685 0.0563  274 ARG A O   
2060 C CB  . ARG A 274 ? 0.3593 0.5886 0.5418 0.0175  -0.0535 0.0578  274 ARG A CB  
2061 C CG  . ARG A 274 ? 0.4308 0.6386 0.5969 0.0279  -0.0470 0.0546  274 ARG A CG  
2062 C CD  . ARG A 274 ? 0.5747 0.7785 0.7337 0.0384  -0.0507 0.0536  274 ARG A CD  
2063 N NE  . ARG A 274 ? 0.7005 0.9320 0.8749 0.0440  -0.0527 0.0578  274 ARG A NE  
2064 C CZ  . ARG A 274 ? 0.6553 0.8962 0.8322 0.0564  -0.0469 0.0596  274 ARG A CZ  
2065 N NH1 . ARG A 274 ? 0.5245 0.7463 0.6877 0.0636  -0.0395 0.0571  274 ARG A NH1 
2066 N NH2 . ARG A 274 ? 0.5363 0.8053 0.7289 0.0617  -0.0488 0.0638  274 ARG A NH2 
2067 N N   . THR A 275 ? 0.3801 0.6370 0.5907 -0.0159 -0.0615 0.0642  275 THR A N   
2068 C CA  . THR A 275 ? 0.4030 0.6671 0.6215 -0.0294 -0.0707 0.0657  275 THR A CA  
2069 C C   . THR A 275 ? 0.4059 0.6539 0.6193 -0.0420 -0.0704 0.0648  275 THR A C   
2070 O O   . THR A 275 ? 0.4862 0.7302 0.7002 -0.0537 -0.0783 0.0645  275 THR A O   
2071 C CB  . THR A 275 ? 0.3925 0.6922 0.6332 -0.0326 -0.0725 0.0720  275 THR A CB  
2072 O OG1 . THR A 275 ? 0.5311 0.8419 0.7806 -0.0363 -0.0645 0.0760  275 THR A OG1 
2073 C CG2 . THR A 275 ? 0.3029 0.6198 0.5491 -0.0182 -0.0714 0.0733  275 THR A CG2 
2074 N N   . ARG A 276 ? 0.4224 0.6601 0.6299 -0.0394 -0.0615 0.0644  276 ARG A N   
2075 C CA  . ARG A 276 ? 0.3953 0.6156 0.5962 -0.0495 -0.0607 0.0635  276 ARG A CA  
2076 C C   . ARG A 276 ? 0.4738 0.6653 0.6576 -0.0509 -0.0656 0.0576  276 ARG A C   
2077 O O   . ARG A 276 ? 0.3967 0.5749 0.5688 -0.0414 -0.0642 0.0537  276 ARG A O   
2078 C CB  . ARG A 276 ? 0.3885 0.6060 0.5870 -0.0450 -0.0501 0.0645  276 ARG A CB  
2079 C CG  . ARG A 276 ? 0.4160 0.6611 0.6308 -0.0458 -0.0451 0.0706  276 ARG A CG  
2080 C CD  . ARG A 276 ? 0.4870 0.7420 0.7126 -0.0612 -0.0502 0.0748  276 ARG A CD  
2081 N NE  . ARG A 276 ? 0.6898 0.9757 0.9336 -0.0633 -0.0465 0.0815  276 ARG A NE  
2082 C CZ  . ARG A 276 ? 0.7136 1.0259 0.9726 -0.0629 -0.0505 0.0847  276 ARG A CZ  
2083 N NH1 . ARG A 276 ? 0.6687 0.9785 0.9255 -0.0602 -0.0587 0.0816  276 ARG A NH1 
2084 N NH2 . ARG A 276 ? 0.5888 0.9307 0.8650 -0.0650 -0.0462 0.0913  276 ARG A NH2 
2085 N N   . PRO A 277 ? 0.4645 0.6459 0.6461 -0.0630 -0.0713 0.0572  277 PRO A N   
2086 C CA  . PRO A 277 ? 0.4521 0.6055 0.6170 -0.0648 -0.0751 0.0518  277 PRO A CA  
2087 C C   . PRO A 277 ? 0.3812 0.5186 0.5350 -0.0572 -0.0666 0.0494  277 PRO A C   
2088 O O   . PRO A 277 ? 0.4133 0.5569 0.5720 -0.0572 -0.0597 0.0524  277 PRO A O   
2089 C CB  . PRO A 277 ? 0.4098 0.5572 0.5762 -0.0789 -0.0794 0.0533  277 PRO A CB  
2090 C CG  . PRO A 277 ? 0.3721 0.5465 0.5570 -0.0860 -0.0804 0.0595  277 PRO A CG  
2091 C CD  . PRO A 277 ? 0.3847 0.5791 0.5787 -0.0754 -0.0726 0.0622  277 PRO A CD  
2092 N N   . ALA A 278 ? 0.3874 0.5055 0.5267 -0.0514 -0.0672 0.0444  278 ALA A N   
2093 C CA  . ALA A 278 ? 0.4236 0.5273 0.5528 -0.0448 -0.0596 0.0423  278 ALA A CA  
2094 C C   . ALA A 278 ? 0.4418 0.5379 0.5701 -0.0511 -0.0561 0.0437  278 ALA A C   
2095 O O   . ALA A 278 ? 0.4209 0.5176 0.5489 -0.0472 -0.0486 0.0449  278 ALA A O   
2096 C CB  . ALA A 278 ? 0.2527 0.3368 0.3667 -0.0399 -0.0615 0.0371  278 ALA A CB  
2097 N N   . GLN A 279 ? 0.4170 0.5050 0.5440 -0.0607 -0.0617 0.0436  279 GLN A N   
2098 C CA  . GLN A 279 ? 0.3574 0.4354 0.4818 -0.0665 -0.0591 0.0450  279 GLN A CA  
2099 C C   . GLN A 279 ? 0.4150 0.5093 0.5509 -0.0694 -0.0535 0.0506  279 GLN A C   
2100 O O   . GLN A 279 ? 0.4828 0.5700 0.6148 -0.0691 -0.0481 0.0516  279 GLN A O   
2101 C CB  . GLN A 279 ? 0.2916 0.3559 0.4112 -0.0762 -0.0667 0.0438  279 GLN A CB  
2102 C CG  . GLN A 279 ? 0.3970 0.4451 0.5098 -0.0800 -0.0643 0.0443  279 GLN A CG  
2103 C CD  . GLN A 279 ? 0.5092 0.5415 0.6096 -0.0709 -0.0596 0.0404  279 GLN A CD  
2104 O OE1 . GLN A 279 ? 0.4276 0.4488 0.5185 -0.0661 -0.0621 0.0357  279 GLN A OE1 
2105 N NE2 . GLN A 279 ? 0.5109 0.5432 0.6115 -0.0688 -0.0528 0.0426  279 GLN A NE2 
2106 N N   . ASP A 280 ? 0.3789 0.4955 0.5286 -0.0721 -0.0545 0.0545  280 ASP A N   
2107 C CA  . ASP A 280 ? 0.4558 0.5898 0.6163 -0.0741 -0.0484 0.0601  280 ASP A CA  
2108 C C   . ASP A 280 ? 0.4396 0.5740 0.5962 -0.0632 -0.0395 0.0593  280 ASP A C   
2109 O O   . ASP A 280 ? 0.4590 0.5956 0.6165 -0.0642 -0.0334 0.0622  280 ASP A O   
2110 C CB  . ASP A 280 ? 0.5773 0.7383 0.7544 -0.0774 -0.0506 0.0645  280 ASP A CB  
2111 C CG  . ASP A 280 ? 0.8223 0.9844 1.0045 -0.0907 -0.0595 0.0663  280 ASP A CG  
2112 O OD1 . ASP A 280 ? 0.9355 1.0767 1.1082 -0.0977 -0.0628 0.0647  280 ASP A OD1 
2113 O OD2 . ASP A 280 ? 0.8454 1.0289 1.0407 -0.0939 -0.0633 0.0692  280 ASP A OD2 
2114 N N   . LEU A 281 ? 0.2720 0.4033 0.4231 -0.0532 -0.0389 0.0555  281 LEU A N   
2115 C CA  . LEU A 281 ? 0.2845 0.4138 0.4303 -0.0433 -0.0312 0.0543  281 LEU A CA  
2116 C C   . LEU A 281 ? 0.4035 0.5121 0.5370 -0.0437 -0.0284 0.0520  281 LEU A C   
2117 O O   . LEU A 281 ? 0.4174 0.5262 0.5491 -0.0414 -0.0220 0.0533  281 LEU A O   
2118 C CB  . LEU A 281 ? 0.1838 0.3138 0.3261 -0.0330 -0.0314 0.0513  281 LEU A CB  
2119 C CG  . LEU A 281 ? 0.3704 0.5195 0.5231 -0.0301 -0.0347 0.0530  281 LEU A CG  
2120 C CD1 . LEU A 281 ? 0.4805 0.6251 0.6262 -0.0189 -0.0341 0.0500  281 LEU A CD1 
2121 C CD2 . LEU A 281 ? 0.3473 0.5212 0.5146 -0.0304 -0.0307 0.0583  281 LEU A CD2 
2122 N N   . VAL A 282 ? 0.3519 0.4433 0.4769 -0.0463 -0.0334 0.0486  282 VAL A N   
2123 C CA  . VAL A 282 ? 0.4452 0.5185 0.5595 -0.0462 -0.0313 0.0466  282 VAL A CA  
2124 C C   . VAL A 282 ? 0.4736 0.5475 0.5909 -0.0533 -0.0293 0.0506  282 VAL A C   
2125 O O   . VAL A 282 ? 0.4750 0.5433 0.5872 -0.0512 -0.0243 0.0509  282 VAL A O   
2126 C CB  . VAL A 282 ? 0.3820 0.4376 0.4866 -0.0472 -0.0369 0.0424  282 VAL A CB  
2127 C CG1 . VAL A 282 ? 0.2992 0.3392 0.3954 -0.0481 -0.0351 0.0414  282 VAL A CG1 
2128 C CG2 . VAL A 282 ? 0.4016 0.4539 0.5004 -0.0392 -0.0372 0.0386  282 VAL A CG2 
2129 N N   . ASP A 283 ? 0.3615 0.4423 0.4866 -0.0622 -0.0334 0.0538  283 ASP A N   
2130 C CA  . ASP A 283 ? 0.3094 0.3897 0.4368 -0.0702 -0.0321 0.0582  283 ASP A CA  
2131 C C   . ASP A 283 ? 0.3548 0.4495 0.4877 -0.0680 -0.0242 0.0623  283 ASP A C   
2132 O O   . ASP A 283 ? 0.4229 0.5170 0.5561 -0.0733 -0.0219 0.0662  283 ASP A O   
2133 C CB  . ASP A 283 ? 0.3879 0.4732 0.5229 -0.0814 -0.0384 0.0613  283 ASP A CB  
2134 C CG  . ASP A 283 ? 0.5212 0.5881 0.6480 -0.0850 -0.0464 0.0574  283 ASP A CG  
2135 O OD1 . ASP A 283 ? 0.6279 0.6767 0.7427 -0.0796 -0.0462 0.0531  283 ASP A OD1 
2136 O OD2 . ASP A 283 ? 0.5254 0.5962 0.6575 -0.0931 -0.0529 0.0585  283 ASP A OD2 
2137 N N   . HIS A 284 ? 0.4325 0.5394 0.5686 -0.0597 -0.0202 0.0615  284 HIS A N   
2138 C CA  . HIS A 284 ? 0.4098 0.5318 0.5511 -0.0572 -0.0128 0.0652  284 HIS A CA  
2139 C C   . HIS A 284 ? 0.3968 0.5150 0.5303 -0.0467 -0.0069 0.0622  284 HIS A C   
2140 O O   . HIS A 284 ? 0.2589 0.3851 0.3931 -0.0442 -0.0005 0.0646  284 HIS A O   
2141 C CB  . HIS A 284 ? 0.3221 0.4680 0.4776 -0.0580 -0.0128 0.0687  284 HIS A CB  
2142 C CG  . HIS A 284 ? 0.4919 0.6466 0.6570 -0.0701 -0.0164 0.0738  284 HIS A CG  
2143 N ND1 . HIS A 284 ? 0.5409 0.6933 0.7093 -0.0771 -0.0248 0.0731  284 HIS A ND1 
2144 C CD2 . HIS A 284 ? 0.6187 0.7833 0.7898 -0.0770 -0.0129 0.0797  284 HIS A CD2 
2145 C CE1 . HIS A 284 ? 0.6684 0.8291 0.8451 -0.0884 -0.0266 0.0785  284 HIS A CE1 
2146 N NE2 . HIS A 284 ? 0.6886 0.8569 0.8672 -0.0886 -0.0193 0.0828  284 HIS A NE2 
2147 N N   . GLU A 285 ? 0.3525 0.4583 0.4780 -0.0410 -0.0091 0.0571  285 GLU A N   
2148 C CA  . GLU A 285 ? 0.3808 0.4824 0.4986 -0.0316 -0.0042 0.0542  285 GLU A CA  
2149 C C   . GLU A 285 ? 0.3402 0.4353 0.4512 -0.0319 0.0008  0.0551  285 GLU A C   
2150 O O   . GLU A 285 ? 0.3308 0.4307 0.4395 -0.0266 0.0065  0.0553  285 GLU A O   
2151 C CB  . GLU A 285 ? 0.4171 0.5049 0.5265 -0.0271 -0.0074 0.0492  285 GLU A CB  
2152 C CG  . GLU A 285 ? 0.5099 0.5804 0.6115 -0.0308 -0.0104 0.0471  285 GLU A CG  
2153 C CD  . GLU A 285 ? 0.6162 0.6753 0.7100 -0.0262 -0.0128 0.0426  285 GLU A CD  
2154 O OE1 . GLU A 285 ? 0.6989 0.7445 0.7854 -0.0273 -0.0141 0.0406  285 GLU A OE1 
2155 O OE2 . GLU A 285 ? 0.6754 0.7396 0.7703 -0.0210 -0.0132 0.0414  285 GLU A OE2 
2156 N N   . TRP A 286 ? 0.3459 0.4304 0.4536 -0.0382 -0.0016 0.0558  286 TRP A N   
2157 C CA  . TRP A 286 ? 0.4512 0.5280 0.5513 -0.0381 0.0021  0.0564  286 TRP A CA  
2158 C C   . TRP A 286 ? 0.4850 0.5736 0.5888 -0.0400 0.0074  0.0612  286 TRP A C   
2159 O O   . TRP A 286 ? 0.5289 0.6132 0.6257 -0.0385 0.0112  0.0616  286 TRP A O   
2160 C CB  . TRP A 286 ? 0.5594 0.6210 0.6544 -0.0429 -0.0022 0.0558  286 TRP A CB  
2161 C CG  . TRP A 286 ? 0.5677 0.6191 0.6536 -0.0412 0.0000  0.0551  286 TRP A CG  
2162 C CD1 . TRP A 286 ? 0.5647 0.6174 0.6454 -0.0364 0.0049  0.0544  286 TRP A CD1 
2163 C CD2 . TRP A 286 ? 0.6880 0.7261 0.7684 -0.0441 -0.0029 0.0551  286 TRP A CD2 
2164 N NE1 . TRP A 286 ? 0.5752 0.6175 0.6483 -0.0369 0.0049  0.0542  286 TRP A NE1 
2165 C CE2 . TRP A 286 ? 0.6597 0.6934 0.7328 -0.0411 0.0003  0.0547  286 TRP A CE2 
2166 C CE3 . TRP A 286 ? 0.7479 0.7769 0.8282 -0.0486 -0.0081 0.0552  286 TRP A CE3 
2167 C CZ2 . TRP A 286 ? 0.6408 0.6633 0.7080 -0.0421 -0.0016 0.0549  286 TRP A CZ2 
2168 C CZ3 . TRP A 286 ? 0.6580 0.6743 0.7314 -0.0489 -0.0096 0.0552  286 TRP A CZ3 
2169 C CH2 . TRP A 286 ? 0.6214 0.6354 0.6890 -0.0455 -0.0063 0.0552  286 TRP A CH2 
2170 N N   . HIS A 287 ? 0.5980 0.7027 0.7126 -0.0432 0.0078  0.0649  287 HIS A N   
2171 C CA  . HIS A 287 ? 0.6426 0.7606 0.7613 -0.0450 0.0134  0.0699  287 HIS A CA  
2172 C C   . HIS A 287 ? 0.6045 0.7324 0.7217 -0.0360 0.0201  0.0690  287 HIS A C   
2173 O O   . HIS A 287 ? 0.6208 0.7567 0.7376 -0.0359 0.0258  0.0723  287 HIS A O   
2174 C CB  . HIS A 287 ? 0.6421 0.7749 0.7738 -0.0531 0.0114  0.0751  287 HIS A CB  
2175 C CG  . HIS A 287 ? 0.8037 0.9247 0.9351 -0.0626 0.0048  0.0761  287 HIS A CG  
2176 N ND1 . HIS A 287 ? 0.8569 0.9848 0.9979 -0.0701 -0.0004 0.0783  287 HIS A ND1 
2177 C CD2 . HIS A 287 ? 0.8450 0.9469 0.9668 -0.0652 0.0024  0.0750  287 HIS A CD2 
2178 C CE1 . HIS A 287 ? 0.8618 0.9735 0.9980 -0.0771 -0.0058 0.0782  287 HIS A CE1 
2179 N NE2 . HIS A 287 ? 0.8812 0.9771 1.0059 -0.0737 -0.0040 0.0763  287 HIS A NE2 
2180 N N   . VAL A 288 ? 0.5158 0.6417 0.6307 -0.0281 0.0197  0.0646  288 VAL A N   
2181 C CA  . VAL A 288 ? 0.5090 0.6428 0.6215 -0.0189 0.0259  0.0636  288 VAL A CA  
2182 C C   . VAL A 288 ? 0.5604 0.6807 0.6585 -0.0141 0.0296  0.0605  288 VAL A C   
2183 O O   . VAL A 288 ? 0.6245 0.7474 0.7178 -0.0059 0.0343  0.0588  288 VAL A O   
2184 C CB  . VAL A 288 ? 0.3514 0.4906 0.4677 -0.0115 0.0244  0.0609  288 VAL A CB  
2185 C CG1 . VAL A 288 ? 0.3078 0.4631 0.4392 -0.0164 0.0203  0.0643  288 VAL A CG1 
2186 C CG2 . VAL A 288 ? 0.2075 0.3278 0.3140 -0.0083 0.0205  0.0554  288 VAL A CG2 
2187 N N   . LEU A 289 ? 0.5805 0.6863 0.6712 -0.0188 0.0274  0.0598  289 LEU A N   
2188 C CA  . LEU A 289 ? 0.5936 0.6880 0.6710 -0.0154 0.0303  0.0573  289 LEU A CA  
2189 C C   . LEU A 289 ? 0.6683 0.7716 0.7437 -0.0150 0.0366  0.0609  289 LEU A C   
2190 O O   . LEU A 289 ? 0.7333 0.8469 0.8163 -0.0209 0.0375  0.0660  289 LEU A O   
2191 C CB  . LEU A 289 ? 0.5171 0.5958 0.5880 -0.0201 0.0261  0.0561  289 LEU A CB  
2192 C CG  . LEU A 289 ? 0.5169 0.5833 0.5843 -0.0186 0.0214  0.0515  289 LEU A CG  
2193 C CD1 . LEU A 289 ? 0.3935 0.4482 0.4562 -0.0230 0.0180  0.0513  289 LEU A CD1 
2194 C CD2 . LEU A 289 ? 0.5712 0.6317 0.6301 -0.0112 0.0235  0.0472  289 LEU A CD2 
2195 N N   . PRO A 290 ? 0.7122 0.8109 0.7767 -0.0083 0.0409  0.0581  290 PRO A N   
2196 C CA  . PRO A 290 ? 0.7096 0.8163 0.7698 -0.0056 0.0477  0.0604  290 PRO A CA  
2197 C C   . PRO A 290 ? 0.6855 0.7877 0.7400 -0.0118 0.0482  0.0635  290 PRO A C   
2198 O O   . PRO A 290 ? 0.5888 0.7022 0.6453 -0.0133 0.0529  0.0680  290 PRO A O   
2199 C CB  . PRO A 290 ? 0.7958 0.8928 0.8427 0.0035  0.0504  0.0549  290 PRO A CB  
2200 C CG  . PRO A 290 ? 0.8178 0.9047 0.8647 0.0053  0.0453  0.0506  290 PRO A CG  
2201 C CD  . PRO A 290 ? 0.7967 0.8805 0.8506 -0.0031 0.0393  0.0522  290 PRO A CD  
2202 N N   . GLN A 291 ? 0.7736 0.8602 0.8209 -0.0149 0.0436  0.0612  291 GLN A N   
2203 C CA  . GLN A 291 ? 0.7092 0.7904 0.7507 -0.0203 0.0430  0.0642  291 GLN A CA  
2204 C C   . GLN A 291 ? 0.7269 0.7999 0.7727 -0.0267 0.0363  0.0651  291 GLN A C   
2205 O O   . GLN A 291 ? 0.7701 0.8397 0.8208 -0.0264 0.0323  0.0623  291 GLN A O   
2206 C CB  . GLN A 291 ? 0.6974 0.7675 0.7232 -0.0166 0.0443  0.0607  291 GLN A CB  
2207 C CG  . GLN A 291 ? 0.7982 0.8712 0.8161 -0.0085 0.0502  0.0579  291 GLN A CG  
2208 C CD  . GLN A 291 ? 1.0109 1.0749 1.0245 -0.0027 0.0485  0.0516  291 GLN A CD  
2209 O OE1 . GLN A 291 ? 1.0027 1.0580 1.0179 -0.0049 0.0431  0.0493  291 GLN A OE1 
2210 N NE2 . GLN A 291 ? 1.0168 1.0826 1.0242 0.0052  0.0534  0.0491  291 GLN A NE2 
2211 N N   . GLU A 292 ? 0.7411 0.8107 0.7845 -0.0322 0.0353  0.0691  292 GLU A N   
2212 C CA  . GLU A 292 ? 0.7597 0.8188 0.8040 -0.0366 0.0291  0.0693  292 GLU A CA  
2213 C C   . GLU A 292 ? 0.7260 0.7739 0.7616 -0.0327 0.0268  0.0640  292 GLU A C   
2214 O O   . GLU A 292 ? 0.7424 0.7875 0.7682 -0.0303 0.0289  0.0630  292 GLU A O   
2215 C CB  . GLU A 292 ? 0.8628 0.9197 0.9044 -0.0421 0.0289  0.0750  292 GLU A CB  
2216 C CG  . GLU A 292 ? 1.0686 1.1153 1.1121 -0.0467 0.0228  0.0764  292 GLU A CG  
2217 C CD  . GLU A 292 ? 1.2728 1.3157 1.3116 -0.0514 0.0228  0.0824  292 GLU A CD  
2218 O OE1 . GLU A 292 ? 1.3130 1.3621 1.3472 -0.0514 0.0276  0.0855  292 GLU A OE1 
2219 O OE2 . GLU A 292 ? 1.3061 1.3391 1.3447 -0.0546 0.0180  0.0840  292 GLU A OE2 
2220 N N   . SER A 293 ? 0.6902 0.7321 0.7289 -0.0322 0.0224  0.0608  293 SER A N   
2221 C CA  . SER A 293 ? 0.6240 0.6571 0.6552 -0.0290 0.0205  0.0561  293 SER A CA  
2222 C C   . SER A 293 ? 0.5473 0.5731 0.5813 -0.0303 0.0153  0.0545  293 SER A C   
2223 O O   . SER A 293 ? 0.5177 0.5442 0.5589 -0.0329 0.0130  0.0560  293 SER A O   
2224 C CB  . SER A 293 ? 0.6257 0.6604 0.6548 -0.0238 0.0232  0.0520  293 SER A CB  
2225 O OG  . SER A 293 ? 0.6435 0.6851 0.6820 -0.0230 0.0233  0.0520  293 SER A OG  
2226 N N   . ILE A 294 ? 0.5354 0.5544 0.5632 -0.0287 0.0135  0.0515  294 ILE A N   
2227 C CA  . ILE A 294 ? 0.5475 0.5611 0.5775 -0.0282 0.0096  0.0489  294 ILE A CA  
2228 C C   . ILE A 294 ? 0.5468 0.5581 0.5729 -0.0251 0.0103  0.0444  294 ILE A C   
2229 O O   . ILE A 294 ? 0.4933 0.5044 0.5127 -0.0235 0.0129  0.0432  294 ILE A O   
2230 C CB  . ILE A 294 ? 0.4991 0.5077 0.5265 -0.0294 0.0064  0.0500  294 ILE A CB  
2231 C CG1 . ILE A 294 ? 0.5079 0.5157 0.5270 -0.0291 0.0072  0.0498  294 ILE A CG1 
2232 C CG2 . ILE A 294 ? 0.4470 0.4548 0.4775 -0.0323 0.0050  0.0544  294 ILE A CG2 
2233 C CD1 . ILE A 294 ? 0.6152 0.6199 0.6325 -0.0295 0.0036  0.0507  294 ILE A CD1 
2234 N N   . PHE A 295 ? 0.4770 0.4857 0.5062 -0.0241 0.0082  0.0420  295 PHE A N   
2235 C CA  . PHE A 295 ? 0.4413 0.4466 0.4666 -0.0217 0.0086  0.0383  295 PHE A CA  
2236 C C   . PHE A 295 ? 0.5548 0.5625 0.5788 -0.0187 0.0119  0.0372  295 PHE A C   
2237 O O   . PHE A 295 ? 0.5600 0.5637 0.5767 -0.0166 0.0135  0.0347  295 PHE A O   
2238 C CB  . PHE A 295 ? 0.4062 0.4072 0.4237 -0.0224 0.0080  0.0369  295 PHE A CB  
2239 C CG  . PHE A 295 ? 0.5658 0.5627 0.5823 -0.0224 0.0061  0.0343  295 PHE A CG  
2240 C CD1 . PHE A 295 ? 0.5669 0.5611 0.5828 -0.0202 0.0070  0.0319  295 PHE A CD1 
2241 C CD2 . PHE A 295 ? 0.5437 0.5401 0.5598 -0.0243 0.0037  0.0347  295 PHE A CD2 
2242 C CE1 . PHE A 295 ? 0.5227 0.5130 0.5369 -0.0206 0.0056  0.0301  295 PHE A CE1 
2243 C CE2 . PHE A 295 ? 0.4824 0.4769 0.4981 -0.0246 0.0024  0.0329  295 PHE A CE2 
2244 C CZ  . PHE A 295 ? 0.5060 0.4969 0.5203 -0.0231 0.0035  0.0306  295 PHE A CZ  
2245 N N   . ARG A 296 ? 0.5950 0.6095 0.6260 -0.0184 0.0129  0.0392  296 ARG A N   
2246 C CA  . ARG A 296 ? 0.5172 0.5366 0.5494 -0.0146 0.0158  0.0385  296 ARG A CA  
2247 C C   . ARG A 296 ? 0.5405 0.5649 0.5822 -0.0151 0.0137  0.0394  296 ARG A C   
2248 O O   . ARG A 296 ? 0.5989 0.6256 0.6464 -0.0191 0.0115  0.0418  296 ARG A O   
2249 C CB  . ARG A 296 ? 0.3862 0.4124 0.4174 -0.0140 0.0200  0.0409  296 ARG A CB  
2250 C CG  . ARG A 296 ? 0.4738 0.4946 0.4937 -0.0130 0.0221  0.0397  296 ARG A CG  
2251 C CD  . ARG A 296 ? 0.5425 0.5566 0.5537 -0.0081 0.0238  0.0356  296 ARG A CD  
2252 N NE  . ARG A 296 ? 0.7100 0.7177 0.7092 -0.0081 0.0251  0.0341  296 ARG A NE  
2253 C CZ  . ARG A 296 ? 0.5741 0.5746 0.5676 -0.0117 0.0221  0.0331  296 ARG A CZ  
2254 N NH1 . ARG A 296 ? 0.4403 0.4394 0.4391 -0.0149 0.0181  0.0333  296 ARG A NH1 
2255 N NH2 . ARG A 296 ? 0.4658 0.4609 0.4480 -0.0119 0.0229  0.0318  296 ARG A NH2 
2256 N N   . PHE A 297 ? 0.5701 0.5952 0.6124 -0.0110 0.0140  0.0374  297 PHE A N   
2257 C CA  . PHE A 297 ? 0.5434 0.5729 0.5938 -0.0113 0.0112  0.0378  297 PHE A CA  
2258 C C   . PHE A 297 ? 0.5829 0.6223 0.6379 -0.0070 0.0135  0.0385  297 PHE A C   
2259 O O   . PHE A 297 ? 0.6619 0.7003 0.7112 -0.0018 0.0169  0.0371  297 PHE A O   
2260 C CB  . PHE A 297 ? 0.5677 0.5881 0.6143 -0.0103 0.0082  0.0348  297 PHE A CB  
2261 C CG  . PHE A 297 ? 0.6093 0.6214 0.6504 -0.0129 0.0072  0.0339  297 PHE A CG  
2262 C CD1 . PHE A 297 ? 0.5924 0.6041 0.6368 -0.0169 0.0048  0.0355  297 PHE A CD1 
2263 C CD2 . PHE A 297 ? 0.5181 0.5232 0.5508 -0.0114 0.0084  0.0317  297 PHE A CD2 
2264 C CE1 . PHE A 297 ? 0.5894 0.5954 0.6295 -0.0184 0.0039  0.0351  297 PHE A CE1 
2265 C CE2 . PHE A 297 ? 0.5308 0.5309 0.5598 -0.0141 0.0072  0.0314  297 PHE A CE2 
2266 C CZ  . PHE A 297 ? 0.5845 0.5859 0.6177 -0.0171 0.0050  0.0331  297 PHE A CZ  
2267 N N   . SER A 298 ? 0.4767 0.5259 0.5417 -0.0092 0.0117  0.0408  298 SER A N   
2268 C CA  . SER A 298 ? 0.4751 0.5380 0.5472 -0.0059 0.0140  0.0427  298 SER A CA  
2269 C C   . SER A 298 ? 0.5800 0.6421 0.6496 0.0016  0.0143  0.0402  298 SER A C   
2270 O O   . SER A 298 ? 0.5562 0.6252 0.6257 0.0075  0.0182  0.0406  298 SER A O   
2271 C CB  . SER A 298 ? 0.4730 0.5460 0.5567 -0.0112 0.0105  0.0457  298 SER A CB  
2272 O OG  . SER A 298 ? 0.6174 0.6940 0.7041 -0.0174 0.0115  0.0492  298 SER A OG  
2273 N N   . PHE A 299 ? 0.5758 0.6293 0.6428 0.0017  0.0102  0.0379  299 PHE A N   
2274 C CA  . PHE A 299 ? 0.5211 0.5735 0.5862 0.0081  0.0094  0.0361  299 PHE A CA  
2275 C C   . PHE A 299 ? 0.5178 0.5540 0.5717 0.0097  0.0084  0.0328  299 PHE A C   
2276 O O   . PHE A 299 ? 0.5888 0.6185 0.6416 0.0061  0.0049  0.0319  299 PHE A O   
2277 C CB  . PHE A 299 ? 0.4031 0.4648 0.4781 0.0066  0.0049  0.0375  299 PHE A CB  
2278 C CG  . PHE A 299 ? 0.3247 0.4047 0.4113 0.0060  0.0062  0.0411  299 PHE A CG  
2279 C CD1 . PHE A 299 ? 0.3021 0.3922 0.3913 0.0136  0.0094  0.0419  299 PHE A CD1 
2280 C CD2 . PHE A 299 ? 0.3041 0.3911 0.3987 -0.0020 0.0047  0.0440  299 PHE A CD2 
2281 C CE1 . PHE A 299 ? 0.3730 0.4826 0.4740 0.0132  0.0112  0.0457  299 PHE A CE1 
2282 C CE2 . PHE A 299 ? 0.4166 0.5217 0.5224 -0.0035 0.0062  0.0479  299 PHE A CE2 
2283 C CZ  . PHE A 299 ? 0.3794 0.4971 0.4892 0.0041  0.0096  0.0488  299 PHE A CZ  
2284 N N   . VAL A 300 ? 0.4003 0.4298 0.4452 0.0151  0.0118  0.0312  300 VAL A N   
2285 C CA  . VAL A 300 ? 0.4226 0.4362 0.4558 0.0155  0.0115  0.0285  300 VAL A CA  
2286 C C   . VAL A 300 ? 0.4481 0.4556 0.4739 0.0234  0.0129  0.0271  300 VAL A C   
2287 O O   . VAL A 300 ? 0.3882 0.4045 0.4181 0.0294  0.0144  0.0281  300 VAL A O   
2288 C CB  . VAL A 300 ? 0.4386 0.4457 0.4653 0.0117  0.0137  0.0278  300 VAL A CB  
2289 C CG1 . VAL A 300 ? 0.1778 0.1911 0.2118 0.0048  0.0123  0.0298  300 VAL A CG1 
2290 C CG2 . VAL A 300 ? 0.3435 0.3518 0.3654 0.0162  0.0183  0.0276  300 VAL A CG2 
2291 N N   . PRO A 301 ? 0.4894 0.4819 0.5042 0.0236  0.0124  0.0250  301 PRO A N   
2292 C CA  . PRO A 301 ? 0.4305 0.4144 0.4362 0.0312  0.0139  0.0237  301 PRO A CA  
2293 C C   . PRO A 301 ? 0.4304 0.4167 0.4330 0.0368  0.0183  0.0234  301 PRO A C   
2294 O O   . PRO A 301 ? 0.4038 0.3879 0.4025 0.0340  0.0207  0.0226  301 PRO A O   
2295 C CB  . PRO A 301 ? 0.4416 0.4080 0.4349 0.0280  0.0131  0.0218  301 PRO A CB  
2296 C CG  . PRO A 301 ? 0.3776 0.3468 0.3767 0.0209  0.0101  0.0226  301 PRO A CG  
2297 C CD  . PRO A 301 ? 0.4263 0.4096 0.4369 0.0176  0.0102  0.0241  301 PRO A CD  
2298 N N   . VAL A 302 ? 0.5273 0.5190 0.5317 0.0453  0.0194  0.0239  302 VAL A N   
2299 C CA  . VAL A 302 ? 0.4999 0.4932 0.4999 0.0529  0.0241  0.0234  302 VAL A CA  
2300 C C   . VAL A 302 ? 0.5613 0.5338 0.5439 0.0589  0.0252  0.0205  302 VAL A C   
2301 O O   . VAL A 302 ? 0.5168 0.4795 0.4946 0.0608  0.0224  0.0202  302 VAL A O   
2302 C CB  . VAL A 302 ? 0.5198 0.5325 0.5322 0.0598  0.0252  0.0259  302 VAL A CB  
2303 C CG1 . VAL A 302 ? 0.5088 0.5217 0.5238 0.0638  0.0211  0.0267  302 VAL A CG1 
2304 C CG2 . VAL A 302 ? 0.6927 0.7065 0.6993 0.0698  0.0305  0.0252  302 VAL A CG2 
2305 N N   . VAL A 303 ? 0.6089 0.5732 0.5809 0.0615  0.0290  0.0184  303 VAL A N   
2306 C CA  . VAL A 303 ? 0.5919 0.5363 0.5465 0.0689  0.0303  0.0155  303 VAL A CA  
2307 C C   . VAL A 303 ? 0.5696 0.5200 0.5258 0.0819  0.0322  0.0163  303 VAL A C   
2308 O O   . VAL A 303 ? 0.6019 0.5605 0.5586 0.0895  0.0367  0.0162  303 VAL A O   
2309 C CB  . VAL A 303 ? 0.5316 0.4656 0.4734 0.0685  0.0337  0.0127  303 VAL A CB  
2310 C CG1 . VAL A 303 ? 0.5317 0.4434 0.4543 0.0763  0.0348  0.0095  303 VAL A CG1 
2311 C CG2 . VAL A 303 ? 0.5899 0.5177 0.5294 0.0564  0.0313  0.0121  303 VAL A CG2 
2312 N N   . ASP A 304 ? 0.5758 0.5229 0.5329 0.0847  0.0288  0.0174  304 ASP A N   
2313 C CA  . ASP A 304 ? 0.6158 0.5728 0.5783 0.0963  0.0292  0.0191  304 ASP A CA  
2314 C C   . ASP A 304 ? 0.6681 0.6059 0.6133 0.1081  0.0310  0.0169  304 ASP A C   
2315 O O   . ASP A 304 ? 0.5947 0.5410 0.5434 0.1196  0.0321  0.0182  304 ASP A O   
2316 C CB  . ASP A 304 ? 0.5517 0.5165 0.5245 0.0939  0.0239  0.0217  304 ASP A CB  
2317 C CG  . ASP A 304 ? 0.6034 0.5474 0.5650 0.0876  0.0201  0.0207  304 ASP A CG  
2318 O OD1 . ASP A 304 ? 0.5866 0.5116 0.5342 0.0837  0.0212  0.0182  304 ASP A OD1 
2319 O OD2 . ASP A 304 ? 0.4961 0.4437 0.4630 0.0862  0.0159  0.0225  304 ASP A OD2 
2320 N N   . GLY A 305 ? 0.6833 0.5956 0.6101 0.1050  0.0311  0.0138  305 GLY A N   
2321 C CA  . GLY A 305 ? 0.6668 0.5554 0.5746 0.1145  0.0316  0.0117  305 GLY A CA  
2322 C C   . GLY A 305 ? 0.7746 0.6567 0.6814 0.1168  0.0273  0.0138  305 GLY A C   
2323 O O   . GLY A 305 ? 0.8141 0.6853 0.7113 0.1284  0.0275  0.0137  305 GLY A O   
2324 N N   . ASP A 306 ? 0.7631 0.6512 0.6789 0.1061  0.0233  0.0157  306 ASP A N   
2325 C CA  . ASP A 306 ? 0.7338 0.6180 0.6496 0.1074  0.0191  0.0180  306 ASP A CA  
2326 C C   . ASP A 306 ? 0.7110 0.5859 0.6242 0.0940  0.0157  0.0184  306 ASP A C   
2327 O O   . ASP A 306 ? 0.7604 0.6117 0.6575 0.0914  0.0148  0.0175  306 ASP A O   
2328 C CB  . ASP A 306 ? 0.7218 0.6331 0.6569 0.1119  0.0176  0.0211  306 ASP A CB  
2329 C CG  . ASP A 306 ? 0.7508 0.6595 0.6855 0.1149  0.0129  0.0235  306 ASP A CG  
2330 O OD1 . ASP A 306 ? 0.6790 0.5640 0.5975 0.1147  0.0115  0.0231  306 ASP A OD1 
2331 O OD2 . ASP A 306 ? 0.7004 0.6308 0.6507 0.1171  0.0105  0.0260  306 ASP A OD2 
2332 N N   . PHE A 307 ? 0.5614 0.4548 0.4904 0.0857  0.0140  0.0198  307 PHE A N   
2333 C CA  . PHE A 307 ? 0.5509 0.4382 0.4786 0.0734  0.0119  0.0199  307 PHE A CA  
2334 C C   . PHE A 307 ? 0.5850 0.4588 0.5023 0.0673  0.0142  0.0173  307 PHE A C   
2335 O O   . PHE A 307 ? 0.6414 0.4986 0.5478 0.0607  0.0131  0.0168  307 PHE A O   
2336 C CB  . PHE A 307 ? 0.5644 0.4734 0.5099 0.0666  0.0103  0.0212  307 PHE A CB  
2337 C CG  . PHE A 307 ? 0.5960 0.5006 0.5410 0.0564  0.0079  0.0217  307 PHE A CG  
2338 C CD1 . PHE A 307 ? 0.5142 0.4126 0.4555 0.0474  0.0090  0.0204  307 PHE A CD1 
2339 C CD2 . PHE A 307 ? 0.5949 0.5019 0.5425 0.0561  0.0045  0.0236  307 PHE A CD2 
2340 C CE1 . PHE A 307 ? 0.4683 0.3645 0.4098 0.0389  0.0073  0.0211  307 PHE A CE1 
2341 C CE2 . PHE A 307 ? 0.5870 0.4904 0.5334 0.0476  0.0030  0.0240  307 PHE A CE2 
2342 C CZ  . PHE A 307 ? 0.5706 0.4692 0.5144 0.0392  0.0046  0.0229  307 PHE A CZ  
2343 N N   . LEU A 308 ? 0.5442 0.4264 0.4653 0.0692  0.0173  0.0159  308 LEU A N   
2344 C CA  . LEU A 308 ? 0.5497 0.4197 0.4600 0.0649  0.0193  0.0132  308 LEU A CA  
2345 C C   . LEU A 308 ? 0.7443 0.6033 0.6422 0.0761  0.0225  0.0109  308 LEU A C   
2346 O O   . LEU A 308 ? 0.8195 0.6929 0.7247 0.0838  0.0255  0.0110  308 LEU A O   
2347 C CB  . LEU A 308 ? 0.4673 0.3548 0.3902 0.0580  0.0204  0.0133  308 LEU A CB  
2348 C CG  . LEU A 308 ? 0.6051 0.5004 0.5377 0.0473  0.0174  0.0149  308 LEU A CG  
2349 C CD1 . LEU A 308 ? 0.4784 0.3907 0.4233 0.0419  0.0183  0.0154  308 LEU A CD1 
2350 C CD2 . LEU A 308 ? 0.6978 0.5750 0.6184 0.0393  0.0157  0.0141  308 LEU A CD2 
2351 N N   . SER A 309 ? 0.7492 0.5824 0.6280 0.0772  0.0219  0.0091  309 SER A N   
2352 C CA  . SER A 309 ? 0.7697 0.5881 0.6336 0.0887  0.0247  0.0066  309 SER A CA  
2353 C C   . SER A 309 ? 0.8088 0.6313 0.6708 0.0896  0.0285  0.0038  309 SER A C   
2354 O O   . SER A 309 ? 0.8580 0.6838 0.7177 0.1014  0.0322  0.0027  309 SER A O   
2355 C CB  . SER A 309 ? 0.8370 0.6237 0.6790 0.0869  0.0227  0.0050  309 SER A CB  
2356 O OG  . SER A 309 ? 0.9391 0.7170 0.7756 0.0733  0.0213  0.0037  309 SER A OG  
2357 N N   . ASP A 310 ? 0.7449 0.5672 0.6071 0.0775  0.0276  0.0028  310 ASP A N   
2358 C CA  . ASP A 310 ? 0.7801 0.6068 0.6404 0.0763  0.0306  0.0005  310 ASP A CA  
2359 C C   . ASP A 310 ? 0.6971 0.5419 0.5729 0.0642  0.0290  0.0024  310 ASP A C   
2360 O O   . ASP A 310 ? 0.6893 0.5441 0.5774 0.0590  0.0264  0.0053  310 ASP A O   
2361 C CB  . ASP A 310 ? 0.9168 0.7155 0.7540 0.0737  0.0300  -0.0036 310 ASP A CB  
2362 C CG  . ASP A 310 ? 1.0083 0.8062 0.8373 0.0785  0.0339  -0.0069 310 ASP A CG  
2363 O OD1 . ASP A 310 ? 0.9404 0.7601 0.7827 0.0770  0.0362  -0.0057 310 ASP A OD1 
2364 O OD2 . ASP A 310 ? 1.0176 0.7917 0.8256 0.0839  0.0347  -0.0107 310 ASP A OD2 
2365 N N   . THR A 311 ? 0.5737 0.4217 0.4478 0.0599  0.0306  0.0009  311 THR A N   
2366 C CA  . THR A 311 ? 0.5993 0.4616 0.4859 0.0486  0.0288  0.0027  311 THR A CA  
2367 C C   . THR A 311 ? 0.6334 0.4834 0.5149 0.0375  0.0244  0.0026  311 THR A C   
2368 O O   . THR A 311 ? 0.7580 0.5861 0.6229 0.0366  0.0231  0.0004  311 THR A O   
2369 C CB  . THR A 311 ? 0.6249 0.4913 0.5085 0.0465  0.0310  0.0013  311 THR A CB  
2370 O OG1 . THR A 311 ? 0.7508 0.5947 0.6147 0.0431  0.0297  -0.0024 311 THR A OG1 
2371 C CG2 . THR A 311 ? 0.5112 0.3889 0.3973 0.0575  0.0362  0.0013  311 THR A CG2 
2372 N N   . PRO A 312 ? 0.6598 0.5238 0.5552 0.0290  0.0222  0.0052  312 PRO A N   
2373 C CA  . PRO A 312 ? 0.6412 0.4976 0.5338 0.0182  0.0186  0.0055  312 PRO A CA  
2374 C C   . PRO A 312 ? 0.6910 0.5328 0.5686 0.0127  0.0176  0.0026  312 PRO A C   
2375 O O   . PRO A 312 ? 0.7267 0.5523 0.5936 0.0070  0.0151  0.0019  312 PRO A O   
2376 C CB  . PRO A 312 ? 0.5735 0.4507 0.4839 0.0124  0.0175  0.0083  312 PRO A CB  
2377 C CG  . PRO A 312 ? 0.5493 0.4408 0.4717 0.0197  0.0193  0.0101  312 PRO A CG  
2378 C CD  . PRO A 312 ? 0.6612 0.5486 0.5760 0.0296  0.0228  0.0082  312 PRO A CD  
2379 N N   . GLU A 313 ? 0.7228 0.5699 0.5992 0.0138  0.0195  0.0013  313 GLU A N   
2380 C CA  A GLU A 313 ? 0.7588 0.5917 0.6196 0.0090  0.0182  -0.0019 313 GLU A CA  
2381 C CA  B GLU A 313 ? 0.7650 0.5981 0.6261 0.0086  0.0181  -0.0018 313 GLU A CA  
2382 C C   . GLU A 313 ? 0.8341 0.6409 0.6744 0.0126  0.0179  -0.0052 313 GLU A C   
2383 O O   . GLU A 313 ? 0.8377 0.6281 0.6660 0.0047  0.0146  -0.0066 313 GLU A O   
2384 C CB  A GLU A 313 ? 0.7269 0.5686 0.5874 0.0125  0.0211  -0.0029 313 GLU A CB  
2385 C CB  B GLU A 313 ? 0.7349 0.5777 0.5967 0.0109  0.0206  -0.0026 313 GLU A CB  
2386 C CG  A GLU A 313 ? 0.7803 0.6079 0.6238 0.0078  0.0195  -0.0064 313 GLU A CG  
2387 C CG  B GLU A 313 ? 0.4914 0.3523 0.3669 0.0028  0.0188  0.0002  313 GLU A CG  
2388 C CD  A GLU A 313 ? 0.7992 0.6359 0.6415 0.0118  0.0228  -0.0071 313 GLU A CD  
2389 C CD  B GLU A 313 ? 0.5182 0.4007 0.4142 0.0051  0.0203  0.0041  313 GLU A CD  
2390 O OE1 A GLU A 313 ? 0.7834 0.6284 0.6298 0.0217  0.0276  -0.0066 313 GLU A OE1 
2391 O OE1 B GLU A 313 ? 0.5046 0.3904 0.4057 0.0125  0.0225  0.0048  313 GLU A OE1 
2392 O OE2 A GLU A 313 ? 0.7791 0.6152 0.6165 0.0047  0.0205  -0.0079 313 GLU A OE2 
2393 O OE2 B GLU A 313 ? 0.5124 0.4081 0.4188 -0.0005 0.0189  0.0064  313 GLU A OE2 
2394 N N   . ALA A 314 ? 0.7732 0.5760 0.6094 0.0247  0.0214  -0.0062 314 ALA A N   
2395 C CA  . ALA A 314 ? 0.7217 0.4987 0.5379 0.0302  0.0214  -0.0093 314 ALA A CA  
2396 C C   . ALA A 314 ? 0.7856 0.5494 0.5982 0.0245  0.0179  -0.0078 314 ALA A C   
2397 O O   . ALA A 314 ? 0.8589 0.5984 0.6531 0.0205  0.0155  -0.0101 314 ALA A O   
2398 C CB  . ALA A 314 ? 0.7359 0.5155 0.5518 0.0458  0.0261  -0.0097 314 ALA A CB  
2399 N N   . LEU A 315 ? 0.7123 0.4912 0.5412 0.0240  0.0175  -0.0039 315 LEU A N   
2400 C CA  . LEU A 315 ? 0.7133 0.4805 0.5386 0.0205  0.0149  -0.0020 315 LEU A CA  
2401 C C   . LEU A 315 ? 0.8238 0.5851 0.6463 0.0058  0.0111  -0.0012 315 LEU A C   
2402 O O   . LEU A 315 ? 0.9440 0.6858 0.7541 0.0015  0.0089  -0.0010 315 LEU A O   
2403 C CB  . LEU A 315 ? 0.6988 0.4837 0.5412 0.0245  0.0155  0.0018  315 LEU A CB  
2404 C CG  . LEU A 315 ? 0.6946 0.4865 0.5412 0.0388  0.0185  0.0019  315 LEU A CG  
2405 C CD1 . LEU A 315 ? 0.5604 0.3701 0.4240 0.0404  0.0178  0.0057  315 LEU A CD1 
2406 C CD2 . LEU A 315 ? 0.6596 0.4265 0.4865 0.0475  0.0191  -0.0002 315 LEU A CD2 
2407 N N   . ILE A 316 ? 0.7786 0.5566 0.6123 -0.0021 0.0102  -0.0005 316 ILE A N   
2408 C CA  . ILE A 316 ? 0.7909 0.5663 0.6233 -0.0158 0.0066  0.0005  316 ILE A CA  
2409 C C   . ILE A 316 ? 0.9683 0.7225 0.7810 -0.0208 0.0044  -0.0032 316 ILE A C   
2410 O O   . ILE A 316 ? 1.0960 0.8392 0.9014 -0.0317 0.0010  -0.0027 316 ILE A O   
2411 C CB  . ILE A 316 ? 0.6910 0.4913 0.5418 -0.0223 0.0059  0.0027  316 ILE